4OGGA

Crystal structure of arabidopsis thaliana dj-1d with glyoxylate as substrate analog
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
386
structure length
384
Chain Sequence
NSRTVLILCGDYMEDYEVMVPFQALQAFGITVHTVCPGKKAGDSCPTAVHDFCGHQTYFESRGHNFTLNATFDEVDLSKYDGLVIPGGRAPEYLALTASVVELVKEFSRSGKPIASIHGQLILAAADTVNGRKCTAYATVGPSLVAAGAKWVEPITPDVCVVDGSLITAATYEGHPEFIQLFVKALGGKITGANKRILFLCGDYMEDYEVKVPFQSLQALGCQVDAVCPEKKAGDRCPTAIHDFEGDQTYSEKPGHTFALTTNFDDLVSSSYDALVIPGGRAPEYLALNEHVLNIVKEFMNSEKPVASIHGQQILAAAGVLKGRKCTAYPAVKLNVVLGGGTWLEPDPIDRCFTDGNLVTGAAWPGHPEFVSQLMALLGIQVSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein DJ-1 homolog D
publication title Stereospecific mechanism of DJ-1 glyoxalases inferred from their hemithioacetal-containing crystal structures.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 133
structure length 384
sequence length 386
chains with identical sequence B, C
ec nomenclature ec 4.4.1.5: Lactoylglutathione lyase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oggA02
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4oggA01
4Y1RB 2RK6A 3BWEA 4OGFA 3NOQA 4N12A 4I46A 1I7SB 2D7JA 2W7TA 1P7YA 1M6VB 2NV0A 2ZUUA 1KWGA 4Y1EA 4WXYB 1C30B 1SY7A 3PQ5A 4Y1RA 1L9XA 4MGHA 1PE0A 2R1TB 5K4AA 4D1YA 1VHQA 3PQ6A 4ZGGA 4GE0A 1T0BA 3WFZA 2YWJA 1N57A 4UOQA 3TTTA 1GPMA 2GHRA 1GGHA 2YWDA 4Y1GA 1OI4A 4E08A 4S0ZA 1R9GA 4ZDIA 4HCJA 5LIRA 4AULA 2R1TA 1ONSA 4I4NA 3NVAA 1K9VF 4P36A 4P34A 3UJNA 1CE8B 4B40A 4ENRA 4ADSG 3CZAA 2ABWA 1QDLB 4OGGA 3MGKA 3P9RA 4P35A 3B36A 3R74A 1VCMA 3UOWA 4ENTA 3UK7A 1SOAA 4BFLA 3NORA 3MIIA 4UOZA 3CZ9A 4ENVA 3FIJA 1JVNA 2ISSD 2VXOA 1VCNA 1GGJA 5DFAA 4Y0NA 4L8WB 1WL8A 4UCFA 1GG9A 4ZDJA 1GGFA 2ZUWA 3F5DA 1KEEB 1OX5A 3VU3A 3ZR4B 3TQIA 1BXRB 3FSEA 2OR3A 4QYXA 3L7NA 4ENPA 3OT1B 4OQ4A 3ZJ5A 1I7QB 2VRNA 3BHNA 1CS0B 3NONA 1QVWA 2YWBA 3UMMA 3SF8B 3L3BA 1KA9H 2A9VA 3NOVA 3GRAA 3EN0A 2R1UA 1J42A 1P80A 1IZYA 4OJYA 1G2IA 3TTSA 4B5KA 3OT1A 1QF7A 1PDWA 3D54D 3EZGA 4GE3A 4R7GA 5SY4A 3TTYA 4B31A 1PDVA 1Q7RA 1S1MA 2YWCA 3NOOA 3SF8A 3TTUA 2R1VB 3CY6A 1QWSA 2AB0A 3UGJA 4N0MA 1OX4B 2WJZB 4K2HA 2RK4A 3B38A 4AUMA 4AUNA 4E5VA 1OX6A 1P5FA 1UCFA 1VCOA 2IUFA 2ZUSA 3F71A 5JZOA 1KWKA 2R1VA 3P9SA 3EJ6A 3L18A 4BIMA 3CNEA 1JDBC 1OX4A 3B3AA 4ENQA 1FYEA 1QVVA 3N7TA 5IP5A 4OIFA 4ENWA 4WINA 2RK3A 1P81A 2H2WA 1GGEA 4ZDKA 2V4UA 4LRUA 2XF2A 4B2YA 3TTVA 5JZMA 2VPIA 4OFWA 3L4EA 4L95C 4QYTA 4BTEA 4L7QA 1O1YA 2LXNA 1IZZA 2ZUVA 3EFEA 1U9CA 1FY2A 1KXJA 4I2NA 4MTCA 2FEXA 5E9AA 5SY9A 3SOZA 4ENSA 2VKTA 4UNIA 4B7AA 1C3OB 1A9XB 4L8FA 3TTXA 3EWNA 4GUDA 3PQ2A 1GPWB 4L8YA 1I1QB 1OY1A 4L78A 3RHTA 3KKLA 5SY6A 3PQ7A 1CF9A 1PV2A 3P9QA 1Q2UA 4P2GA 4RKWA 3P9PA 2GK3A 2ZUTA 3ZJ4A 1T3TA 1T36B 3PQ3A 4Y1FA 4UZSA 3ER6A 3PQ8A 4PXYA 4ENUA 5SYAA 3PQ4A 3R75A 4AUEA 4XLLA 1IPHA 2VDJA 4JQSA 4P5PA 4LGYA 3R76A 1P7ZA 3M3PA 4RKYA 2AD5A 4AJ9A 3CYFA 4MNTA 1QVZA 2NV2B 3TTWA 5BV2P 1GGKA
chains in the Genus database with same CATH superfamily
1PUIA 1MH9A 3WRVA 3N70A 3D2CA 2WWVD 5CDFE 2VHWA 4JR1A 4I46A 3A4MA 3JWEA 4Y2RA 5ALVA 5BPHA 2ES4A 3QX7A 4DZRA 4WL0A 5BSHA 4AF6A 2PWBA 2HMSA 4MW5A 3VHLB 3DR5A 4GR9A 4L74A 4GQAA 3AVUA 2AEJA 3CX7A 3GGDA 3RFFA 2PD6A 3CMCO 1E79D 4E2FA 5EPOA 4OEHA 4EO7A 2OECA 2PAAA 3RW9A 4HRVA 5CB4B 3ML1A 3NLLA 4LDQA 4NMXB 4YO7A 2DY1A 2PY6A 4FFLA 3GGPA 4FP9A 3EVFA 4AS3A 1B74A 1R0BA 4R05A 1YI8A 5JNRA 2F1JA 3ANTA 1TOAA 4RFLA 1U8CB 2BR5A 3NYIA 4M37A 4Y2UA 4HWKA 3T34A 1ONSA 3ZWKA 1HK7A 4A6PA 3IPLA 5JD3A 1HZZA 1T36A 1GG2A 2CLLB 3KOMA 3U60B 3IXLA 1CUWA 2CHVA 1KMCA 4MW9A 2ABWA 2P90A 4AG5A 3MOIA 4K6CA 4WBNF 4TMWA 4ZEMA 4QRIA 4S3MA 3S5UA 2IPNA 4CRWB 4G4JA 1NQWA 4ZCSA 2NVUB 2V1XA 3O8QA 3EHDA 3H9GA 3I53A 5DHFA 1BYIA 1KH3A 2DETA 1N1MA 4Q00A 3TRKA 3GMIA 1UXIA 1FLNA 4P4LA 4CF4A 1KOJA 4FC6A 4HV4A 2VTKA 3AHHA 4V3BA 1CHDA 5G4KA 3THSA 4YS6A 6ADHA 1Z5NA 1P0IA 1DC3A 4KK4A 1RP1A 1Y4DE 3QE3A 4TLDA 2PZGA 3W2EA 4EY5A 1RYYA 4RL4A 3S29A 2WB4A 4F12A 3T1HB 1QIDA 2GZ3A 1Z37A 2DWPA 2ID4A 3RRBA 3PDCA 4DXDA 1ZK4A 2ONZA 4XARA 3DMRA 3I83A 3NU1A 2VUUA 1WXQA 2MINB 3O94A 4KQGA 3RUHA 4K9QA 1DBWA 2R79A 4FYHA 5G1NA 5IX8A 3EXFB 2P9QA 4KQKA 4D0RA 1YZQA 5J58A 3PC4A 3N0XA 4G4SP 2QN9A 4PFKA 4EYEA 2SBTA 3IIEA 4F60A 3UUGA 4YJ3B 4Q6WA 1QQAA 3FJOA 2JJQA 2XSZD 1L5HB 2VEDA 4QTXA 3IESA 4MVJG 1VLLA 3K9LA 5EP4A 3A1TA 2I7CA 5F3DA 4B8WA 3DPUA 4G1CA 1FNCA 3TQFA 1BU5A 2SHKA 2R60A 2Q6TA 3CN9A 2NVUA 3DZIA 1YDGA 4NV0A 5DI9A 3LLUA 4UW9A 1QYVA 3DLAA 3EMDA 5INTA 2BSQA 1HLDA 4ZVOA 2WAXA 4J1TC 2JFOA 1LNQA 3CRVA 5KNBD 3I4FA 1C4KA 5ESDA 3BQNB 5G0WA 3LX4A 5JD6A 1HT2E 5G1OA 4A8JC 3ZGVA 3CF0A 1DGQA 1A4XA 3CVOA 2XUGA 1KI2A 1GPH1 1NW4A 1A97A 1NR5A 1QVRA 1UKZA 1YRHA 1ZWKA 2CZQA 1AF4A 3FNIA 3PENA 4P5DA 4DMRA 5C3MA 2ERYA 4AKHA 3F7TA 3GAAA 2P4UA 4II7A 4O4LB 3NW9A 4KB5A 3V8VA 3RBVA 2GPNA 4AF7A 2I22A 5C4IA 2MINA 3PKIA 5IC6A 3MILA 3PSAA 4H6VA 2ACVA 1U0LA 4I14A 4R0NA 3E82A 13PKA 2MYUA 4Q4JB 2A8YA 3RSSA 1ZK2A 1VYUA 1X7YA 4WZBA 1C3EA 1DMSA 1KP9A 2QQ5A 3FETA 2NUAB 5M2QA 1TA9A 2PMBA 1F3LA 2FCRA 3TZHA 1P33A 3ZDZB 2R6HA 2RK6A 1RYEA 4K3VA 4MV3A 5BMVB 2PGIA 3IOEA 1Z2PX 1EXWA 3T3OA 1KQFA 3K0FB 1I6LA 3SIXA 2NV0A 3LXUX 3X1ZA 1ZMOA 3QBTA 2C2MA 2WPDD 4UTZA 1FMTA 4EY3A 1TCUA 1UWVA 5CLHA 3ZCQA 5AKJA 5DOVA 1TEHA 2RHDA 3Q72A 2R7LA 3WYNA 2XMBA 2Q5CA 4C4OA 4LZZA 1K6XA 2IZ7A 4JIMA 3F73A 5GIOE 3QP9A 3K31A 3SLKA 4B2IA 4FHDA 5IH3A 1WUKS 1V47A 3EUWA 4B32A 1B16A 1P2GA 4KSCA 2ORIA 5JS2A 3GPIA 1R9GA 2J9XB 2I0FA 2HXGA 3K09C 2QLMA 5K8VA 4IV0A 2HPAA 1RJ9B 3G5AA 1BKYA 4OL9A 2PFSA 4KQ6A 4KR3A 3LQFA 4Q4JA 3R74A 3VTFA 1WDLA 5BYBA 4TVOA 1J97A 4G8CA 3D4PA 5FO0A 3COWA 4IYRA 3TD6A 2C7BA 1PKXA 3PB3A 3H1AA 1MW8X 4O4JB 1DKRA 1PW5A 2J7PA 2C8VA 4MHSA 1E6LA 1Y0BA 1MBZA 2OORA 2R6AA 3DMTC 1D3AA 5B58T 3TSYA 4TL8A 3PHHA 4ZCPA 2IE8A 3VGPA 3QTLA 2Z83A 1HL7A 1UIMA 4O2AA 4I1YA 1GFIA 5ARDA 3SXUB 2EKQA 3BQMB 2CHEA 1UQTA 2OT3B 3PKJA 3ZCTA 4BGVA 4C0SA 3T3NA 4PC6A 3BRWD 3MRTA 4BEJA 5A9RA 1Q91A 1S8AA 5C53B 4KN9S 2C3YA 1XMJA 1S96A 4X1KB 4DIUA 2ID9A 1PT9A 4NS1A 2O5EA 2YN2A 3AF5A 4JA2A 1JFRA 1J1IA 1NZJA 1D04A 1QIJA 4KW7A 3TQTA 5LQRA 2XD9A 1C41A 1PDWA 4Z8XA 4EBBA 1C29B 3FOCA 1AKUA 1N2IA 3HGTA 4H7HA 4KPGA 4QICA 3SHFA 3W3AD 3UA4A 2YWGA 3PNKA 4B48A 1OPXA 4R7ZA 2Y1GA 3K1AA 4BLWA 4ZMBA 2CW5A 4MIEA 3HGMA 4Y2TA 2I3ZA 3H04A 4P7KA 4RMIA 3UH0A 3W3ZB 5BN4B 3EFOB 1VPWA 4RK1A 4WEOA 4YYZA 5KNCH 3V2HA 3V7YA 3OLVA 3HY4A 2FRVA 3IELA 3K35A 3KSDO 2IA5A 1J39A 3LHDA 1P2UA 1XVIA 3V4LA 5JCZA 1IONA 5JC1A 2ET6A 1BVRA 1ISGA 1R18A 2YY7A 4OM7A 5FNVB 3T5PA 1CZNA 3ECCA 3HZOA 4P7FA 3SXUA 5CG1A 2PCJA 3VMFA 3AUSA 4UXIA 3EFEA 3SEZA 2OO3A 3D3KA 3W9SA 1N9GB 1KZYC 2XYPA 1F6BA 3CGGA 2MSDB 3WC4A 1ZM7A 2ZXUA 5IDVA 1DJLA 4QBKA 1FFHA 2OCLA 3OX1A 1P5ZB 1XJCA 3G0OA 3LQRA 4I4TA 4L8YA 5FFMA 4A2PA 4CEHA 1AZSC 2OMEA 2FRDC 3IUMA 2BOVA 5KVVA 5EKUA 2BDEA 4Q37A 4FIZA 2ATEA 1R8YA 1O0CA 1BN6A 2IDJA 2MIIA 1FOEB 1Z6XA 4E4RA 2HQOA 5EHQA 4QJ3A 1NYRA 2QQEA 5LU9A 3JWJA 2HDNB 3FTPA 2RH5A 1WABA 4JQSA 4TZKA 4BNWA 3EEOA 4OHKA 1P1IA 1RPJA 2BEWB 2AMFA 1T2UA 1D09A 3NATA 3OCUA 1HLGA 2Q4RA 3IAEA 1VKZA 3GVIA 4C89A 4LTMA 4E2ZA 1S1CA 2FH5B 2ZBPA 3HXKA 2FG5A 4WZAE 1PLJA 4NCAA 3C5WP 3D3QA 5LBUA 2CNOA 4V0OA 2EZ8A 1SUEA 5CA0A 4CUZA 1Z0DA 5CFOA 2QEQA 3MCVA 1XCOA 5FNVA 1M34A 5ITSA 1X2BA 2GD2A 2X14A 3NM6B 4MTLA 1UPAA 4GOJA 1JBKA 2JJYA 3CKLA 2XD4A 3K6JA 4IOKA 4WFIA 4RTRA 2J9FB 1VJRA 4TUYF 2WB2A 1IQRA 3THXA 3TLZA 1OFHA 1SBIA 3VO2A 3A10A 1OI4A 2IKQA 1CIPA 2P3LA 3E05A 3M6UA 4HUJA 4XSHA 3WMGA 4X91A 3COVA 3ZY2A 3H5NA 4ANFA 2WYHA 1V1MB 4OHWA 4EHFA 3DF9A 3DFKA 1TKRA 1BZYA 1E3WB 1MNQA 1Z5WA 2JIZA 5IF3A 1HLFA 2IHJA 3F4BA 1PJAA 3AKZA 3ORYA 1K8RA 3IJ5A 2VBIA 3MWKA 2I55A 3BREA 2P9HA 1X8JA 4L8LA 3MWDA 2E4AA 2WD7B 5D3QA 2CFIA 2OL4A 5DN9A 3T7EA 2VQ3A 3ZE2B 1L4UA 3WJ2A 1AF7A 4WV3A 1A2BA 1HY3A 2FW1A 1O8BA 3KEMA 3ESQA 4BNZA 1YC2A 3VVCA 4JCOA 5HTKA 3DMFA 1YQQA 4PYQA 3NVDA 2RCNA 1T3LA 1Q16A 2GH1A 1WLYA 3KXKA 2NQ2C 3MWFA 5ELMA 2JNWA 1XF1A 1GZSA 2BI7A 2G70A 4BNNA 1CXZA 3GARA 4CG1A 1KARA 3A70A 4R41A 2VK8A 4J7XA 2C95A 4HNQA 3RS2A 3W34A 2FWNA 4D0LB 5C1BA 4F0JA 1LZLA 3ONWA 5CD1A 2Z9DA 1O57A 1E3SA 1ONOA 3BORA 3CH6A 1IN6A 1HYGA 4P4TA 3JQ7A 4PQYA 4YPFA 1WZNA 2R7AA 1OROA 4KKVA 5HOQA 1GLVA 4EPTA 3AJ9A 1AA6A 3WLPA 2W4QA 3AR6A 1V8ZA 4QPPA 2OXTA 2V7XA 2REXB 5T41A 3T4UA 2AJCA 3D43A 2B25A 2IYOA 2CL6X 5F7ZA 2WD7A 1F48A 1KJWA 1R0RE 4EG7A 3CH5A 4II3A 4CKWA 2WIKA 2VDWA 2GPWA 2RB5A 3LTNC 3QF4B 1ISJA 1DZIA 4PWYA 4XWTA 1E7SA 1FYXA 1DAHA 4CG2A 4ZN6A 5ICGA 2RHWA 1M33A 4FHFA 4OATA 1KJ8A 4OTZA 3ZHOA 5ULLA 3V1KA 3T0IA 4U7FA 3UWDA 1IOWA 1RSZA 5HZHA 1WKBA 1PF7E 1QIKA 1YJQA 5JCJD 2ZYWX 3L8HA 2C29D 2A9OA 2NUBA 3RB8A 4AY6A 4RKWA 1CLEA 4YC7A 621PA 5J2UF 1JLKA 1JQAA 4OQEA 4WBNB 2BR4A 1XRRA 4JX8A 3EXAA 4QBFA 4R9SA 3RVMA 1WX1A 4DBVO 1IXYA 5TJHA 2FUG1 3ISJA 3NAZA 1JT9A 4YR7A 3T41A 3FTDA 4BJHB 2C00A 3B60A 4C0JA 1VIMA 3F5MA 4QFBA 1KO1A 1U5BB 3FBGA 3L02A 2PX4A 4LCEA 1I2DA 4N6OA 1QGDA 2IYPA 3DB2A 3AVQA 1IEWA 2BFMA 2W2LA 2Y4OA 2PKCA 4BFVA 4IX9A 3HA7A 3LCVB 1X7DA 5JBNA 2V8BA 5EJ7A 3HDYA 4KGVA 3KV3O 1G3RA 1L7MA 2NZVG 2RARA 3FIUA 3PJFA 5H4HA 4A8HA 4YCMA 3RBZA 4KR7A 1LDMA 1E5XA 3D4NA 5BSEA 1AKTA 1ILEA 5AQEA 1OU0A 5E1DA 1X1TA 2Q3FA 4LNHA 2ZSJA 4TV8F 1QKJA 5HRUA 5FLEX 5GV7A 1MUUA 2HI0A 3SQWA 2LDBA 1ZVQA 2RKOA 4KTTE 4M1TA 2GHRA 1COZA 1Q95A 1ZM2A 3E84A 1E5LA 4FE4A 4OP2A 3AYZB 4Q4HA 3TNYA 2G06A 3UZUA 4C0LA 3AUUA 4U2DA 1T5DX 1ZVVA 1EFCA 4CLDA 2ECFA 3I62A 4AIIA 4ZEXA 1UBMS 2HTFA 1MO6A 1TMOA 1FW8A 4UMDA 4WKCA 3TKLA 2QUAA 2MSWA 2I87A 3I39X 1QIHA 1FJ2A 3L6CA 4YRCA 3FOZA 3DKVA 3OESA 1XJ0A 3TMAA 1XELA 4OXQA 1WUHS 3ESDA 2C20A 1Z4NA 1R0ZA 3DOHA 3CQ9A 1WTAA 3OWOA 4MPPA 1F1BA 3W4IA 4EKIA 3LYUA 2C5AA 4MLZA 3QU7A 1Z8NA 2I76A 3EMBA 4WD3A 4E14A 1XKQA 5E38A 1BOFA 3VR0A 1IUNA 2OBFA 4HMPA 3N75A 4OXXA 3WYDA 1T9AA 4Z9AA 3TSZA 1RQ7A 2C42A 1EDOA 4OXRA 1F9EA 2HA3A 1F3OA 5JS6A 3OURA 2IUYA 2V8OA 4LRYA 5CU7A 2O7RA 2X0FA 3WNZA 1U1FA 1LDNA 1WEKA 4MGKR 1NQTA 2I34A 4Q15A 1YCHA 4PLCA 3TW8A 4WKBA 2FP3A 4KYIB 1V6AA 4GOND 4RQUA 2OOSA 3DEIA 1WD7A 1ID1A 1NYLA 1EQAA 2WQZA 3OBIA 3NWPA 4TS9A 5LDHA 2VP3A 5BMOA 2OFPA 4CV2A 5EJ8A 3EJ6A 4XDGA 3WWOA 2D7CA 4I1RA 2D54A 1DAGA 3HCBA 1R0KA 4IIBA 4TTPA 3T4PA 5A7GA 2PS1A 2BFOA 4DDUA 4C3UA 5IASA 4FNGA 4JBGA 2H4HA 2J9YB 4DGQA 5I4CA 4B2YA 5LQKA 1HXHA 1K2VN 2HRDA 3ZQKA 1WB4A 3U6KA 4L4YA 4C1BA 1S89A 4QFCA 3OM8A 2Q6KA 2JARA 2HA7A 3M9WA 1U31A 2I7XA 1BDJA 4AJIA 3PR2B 3BK7A 2XCRB 1U8UA 3FVTA 5HIIA 1V8BA 4IUYA 3A6KA 1ML3A 2IYSA 3CUUA 2Y8EA 3ICOA 3RHTA 3SC2B 1KMHB 4B7ZA 3C1OA 2VJCA 3JVDA 4HRXA 1OXTA 2R25B 4I81A 4G63A 1QF9A 4YEDA 3NAGA 4G23A 5SYAA 4QTTB 2NU9B 4LE0A 1M6WA 4DQ0A 1ZBDA 1NDUA 2XJ9A 3NT4A 3EARA 3H2JA 1G2QA 1RRMA 1T6YA 4G2TA 4MRNA 1GEEA 4Z7JA 4CUJA 3ETLA 2FKNA 2FY8A 1ML4A 2ZOSA 4KBFA 1Y98A 4LXYA 3F0TA 3CJQA 2EC5A 3DZDA 3TLYA 4RQAA 4OX9Y 4EH1A 1KO4A 2HK9A 4JP2A 5ALHA 2F62A 1D2CA 1DEOA 2GEBA 2ZYVX 4P98A 1NUUA 2W8BB 3HA2A 5EZ6B 4BKMA 1W85B 1VB3A 4J0FA 1N25A 1GR0A 4V1CA 5K0FA 4J9VA 3M4JA 5E8JA 2VP5A 3LECA 2GCOA 1UBEA 1V0JA 2H1IA 4KEAA 3AB8A 3MF4A 1GLNA 5T67A 3WYFA 1TYZA 3G9XA 3UHFA 5HMMA 3KZ1E 3SC2A 5DGTA 2VCHA 4M21A 4I2VA 3W7AA 4AULA 4B74A 1RAAA 2VN8A 1Y3DE 1EVEA 4URVR 3N05A 4RBNA 3V5NA 2IYUA 4P34A 5EEHA 5L4NA 4CODB 3I73A 1NBWB 3X1KA 4EJSA 2BFFB 5ALWA 2GZMA 2NU9A 2LVBA 3A3NA 1UOPA 4M9CA 4ZAYA 3OPVA 1E92A 4KUEA 1PT8A 1KJ9A 3PL1A 3ZZNA 3QFTA 4XCQA 2A0YA 4Q48A 3TI9A 4QDOA 1OTHA 4FDVA 4B2PA 2PUDA 3A28A 5P8WA 5IM4A 1S2GA 3HM2A 1YHYA 2J3JA 3L8EA 4MYSA 3QBDA 4KXWA 1QPZA 2A1TR 3F9CA 3DKRA 1T4DA 4QUEA 1L7BA 3T6KA 3DTTA 3TRJA 4DBLE 3NTVA 3PI6A 3O90A 1PJCA 4O33A 1VMDA 4Y6LA 3PEYA 5FX2A 5EMNA 2QTAA 3MWYW 5KSOA 2HWKA 3QUCA 4IJ6A 4V0MA 1W85A 2XE8A 1UMDB 4R3NA 5CLGA 3DTVB 1Y7HA 1QBGA 2YHIB 3PHCA 3QYJA 3FDIA 3G6KA 4QEDA 5KYWB 3O4HA 3SVLA 3KKZA 4A0FA 3V8MA 3P4XA 4HYQA 3SPXA 4OMUA 1K3FA 4EELA 2JEYA 3EQ9A 2VJBA 3MJEA 5JZVA 1AURA 3CB4A 4S12A 2A9QA 1CQJB 3PBKA 3MJCA 3KJEA 3ERCA 3BFJA 1CC1S 2I99A 4ZAWA 3TXXA 1WUIS 1LKZA 1OZAA 2EL9A 2QW8A 3LF1A 4HS9A 4X3CA 5H16A 5LP6A 5K3EA 4TTJA 4RL6A 1VA4A 4II2A 3WDLA 4E15A 1Z26A 2DTXA 2C2ZA 4OAPA 1T2CA 4OGWA 2HSDA 1GAQA 4EENA 1Z06A 2ONKA 4GDMA 1G4AE 2IEBA 2NU7B 1XD8A 2YW2A 1IJFA 3HS3A 5EXEA 4AY3A 1IMJA 2XF2A 3V8BA 1I10A 3KTDA 1UPTA 3JASB 2WM2A 3PNYA 4GSYA 1KZHA 4EKNB 4MCIA 1E2GA 4TUYB 4ZO7A 3TTWA 3ZGXA 3Q88A 1XTUA 4XFDA 2JIOA 4INAA 1DBRA 3LG2A 2UZ4A 1PAUA 5DBFA 1PEYA 2QB5A 1YZNA 2I54A 2YOGA 4PZDA 3VYRB 1ZM4A 2BEKA 3L0BA 1P45A 4X7RA 2VYNA 2ZTSA 1G41A 2OGTA 3L5OA 1IJEA 1EJ6A 2O8BA 2IUSA 3ER6A 3OJ0A 4TGLA 5E4YA 3VR5H 3VDXA 1CK4A 3OJEA 4AUEA 1W46A 1FDVA 1CQJA 2QL6A 2WUEA 1J8VA 3CVWA 2HYDA 3EZFA 3PZBA 1GSAA 4WLNA 4MOWA 1Q0QA 1JEDA 1E6EA 1V3UA 2FPGB 2P6PA 3JPYA 2DKFA 4F7WA 1P1RA 4QOJA 4KN8A 2GERA 4EK9A 2YXDA 2XWJI 3HJNA 1P3DA 4OHBA 4JBIA 2Q0QA 5LMNB 1IUPA 3DG9A 5BSMA 2XHZA 1HX7A 3OJFA 4DJ5X 4S35A 3UJAA 4BQIA 1INLA 2J07A 5JARA 1LH0A 5J40A 3V8NA 1N32B 1EFKA 3G0GA 3ELYA 4NBNA 4DJFC 4BVJA 4CEIB 1OXVA 2DPMA 4G41A 2KLHA 3EDRA 3LL4A 4M1OA 2OPBA 1G6OA 3S8EA 3FPJA 4OHUA 2OV2A 3LPCA 5IZ4A 5FBVB 2W6JD 3L0ZA 1IHPA 3PL5A 3TECE 1MB2A 5JCOC 3KD2A 4FFBA 3SSMA 1JFTA 1E9SA 3HUDA 1JLMA 1NW5A 2YQ5A 1G98A 3IQFA 4FOLA 4F3NA 1XXHE 4B46A 3QE4A 2CJYA 5C4MA 1ZJYA 4JWKA 1EGVB 3IEXA 7ADHA 3VH3A 3OEEA 1V5WA 4RTPA 4CKBB 5L8VA 1SUAA 3ZLUA 5J47A 5J43A 1N8TA 1X1DA 2ZT8A 4KWCA 4B4OA 4D9FA 4RF2A 4H6XA 4TMYA 4UZEA 3A2LA 3JYNA 4P3PA 5LC1A 3TUIC 1AKWA 3AVWA 4TL9A 4G0XA 2OYRA 3DMGA 3SFZA 4EYGA 4IDDA 1BROA 4CM1A 3RGGA 2BKVA 2R62A 2ZBFA 3ABSB 4GMFA 4M1ZA 2YXLA 4K9MA 1B73A 3L8ZA 4JBNA 1PR6A 1UBKS 3I1IA 1W96A 5DJ5A 1KEEA 5BNWA 2HBYA 2V3CC 2QRMA 3ZXSA 5J2UB 2O0LA 4NMMA 4NMLA 3V48A 4IS3A 1UXHA 5FO1A 1CS0A 1PI3A 3VNSA 4DUPA 3C7AA 1ONPA 1J2TA 1T8SA 3M1IA 1NULA 1PFUA 4HFRA 1V96A 2ZVQX 3BMCA 4MVJD 4XDYA 3ROPA 3RU2A 3S7ZA 4KHZA 3TMKA 2GX6A 5DULA 4EY4A 1EJ0A 1YZUA 4DABA 3B2QA 3ZVRA 1UMCA 2VNIA 3D8UA 1SUWA 4K6OA 4QC2A 1JIVA 1NU8A 1XL0A 4FW9A 3BB4A 3EY4A 2Q0SA 2FSUA 1FYWA 4ZIRB 1ZWLA 5A3VA 2JLQA 1FYEA 1CUBA 4GZ3A 1F06A 3VR3D 5THKA 4H2DA 1WP4A 4FFSA 1E3TA 2H3EA 2DJ5A 2EW1A 4MI9A 1FDWA 1QGYA 4NY1A 4US1R 5T8KA 1YL6A 1Q1EA 3VC1A 5DLPA 1T8WA 2DPHA 3HLYA 1NJGA 1SG0A 1DWPA 4TV8B 1Y9DA 2XT6A 3OECA 4CEJA 5ALKA 3R20A 3LW7A 4I2NA 4LC9A 4WOPA 1CYEA 1V9LA 3GT7A 1M6YA 1TXGA 5D7NA 2ZRQA 4P38A 3E9MA 5FJJA 5B3LA 1YOBA 4C2UA 3HBFA 3NT2A 3VR6A 1ECCA 5AOAA 3D8RA 3K96A 1WXWA 3PQ3A 4Y7DA 4NOJA 2IEDA 1SBTA 3W5DA 5TF4A 3S44A 3EGIA 2MTBA 3N6VA 4OLFA 2H7YA 4YUWA 2Y1WA 2HC9A 1UEIA 3C14C 2V7EA 2O4UX 5FT9A 1XK6A 1N0WA 2PMCA 3G9UA 3ND6A 1VL5A 4CT5A 4PNHA 1XZEA 4HAYA 3WGMA 4L85A 5A62A 4OI0A 4R40A 2LTAA 1NJ1A 2G28A 1UT8A 2QTCA 2EQ5A 3DHNA 3HL4A 4EAAA 1SPXA 4MPJA 5HKLA 4ICIA 3QXXA 4G4IA 3G7NA 1TJPB 3N0VA 1PGNA 3PIDA 5LLTA 1G8FA 4Y1RA 4CIBA 2WUGA 3MLEA 3TAXA 2D6FA 5HZGA 3SSOA 3SBDA 4GL2A 2JCBA 2AHRA 3BS4A 1L8QA 1WBDA 3CCCA 4XEUA 1MV8A 3HADA 4PR3A 3RU3A 1JLRA 1S8OA 3KL2A 2I4RA 3L8DA 4WGFA 5EC8A 1YO6A 1G1AA 4Q9KA 5LYJF 1NRWA 2CWDA 4IWYA 4I8DA 3QU2A 1N5KA 1BRMA 1C9MA 1G5QA 2Z3ZA 2Z8YM 1OHHD 3CG0A 3EEFA 3G2IA 3I64A 1SGWA 1PV1A 4NRDA 4TTQA 3DP9A 2CJWA 3NBXX 1CLUA 2PWZA 2X6TA 3KPYA 2GZAA 2JCYA 1TCCA 1CE8A 1AK2A 2AZTA 1CR0A 3B82A 2CKMA 3QZUA 4G0ZA 3GGCA 4JB0A 2Y05A 3DONA 1WL8A 3EBOA 1E1YA 3OIVA 1CT9A 3D64A 4MKZA 1OX5A 3LW8A 3B1JA 3LY8A 5DN6A 3T7AA 3VJLA 4CMIB 1F0KA 5FWYA 3K9CA 4L0CA 4MV6A 1L8LA 3R9XB 3JCZA 3ABZA 4WZBB 5SYMA 3I9KA 1NI3A 3R8CA 2A9VA 1R5NA 2ST1A 1TUBB 3BE4A 2JLYA 2EBUA 2ZDHA 4FOSA 3GUUA 2FEWB 2J87A 4URYR 2I3AA 4AMUA 3N5CA 1DFIA 1NWHA 3NRJA 2Q5LA 4R7GA 1SD5A 5DNVA 5KNCD 5GOZA 3R7DA 1U1GA 2A9JA 5K1ZA 1NHWA 2CV1A 4LZAA 1OB5A 4JJGA 3B3QA 3PRYA 4F6RA 3PS9A 3ZZUA 1PZEA 4M7PA 4H1UA 4WN9A 1RAEA 1OXKB 1OFTA 1Z6AA 5G41A 2BN4A 3E9YA 821PA 4EGJA 2C8KA 2GQ0A 2IEYA 4ZALA 1K0UA 3RC7A 5A5GA 1EA7A 4CIWA 3C98A 1PZFA 4ZANA 1NAHA 2P78A 3D2AA 4J49A 3AV0B 5JQWA 1RQPA 1UPBA 4KIUA 5L3QB 1V9SA 2GK6A 1MJFA 2QW1A 3QJYA 4YDRA 4CYMA 3FX2A 1OC2A 3IFSA 5JJBA 5J2TA 4MA5A 4BEVA 3M2PA 1DC4A 4OFWA 2IQ5A 5AKLA 3S81A 4Q16A 3FPLA 1U1CA 5FULA 1Q7BA 3R9XA 3BERA 3TM5A 4XJVA 4OA5A 1WZCA 4GXTA 1JPNA 2QQGA 3H1BA 4QPDA 4H4DA 3TLBA 2NGRA 4JJ6A 1RM4A 3VHRA 3QSGA 3NDBB 3DEHA 1ZJWA 4E5UA 4DLNA 2ASVA 1PV2A 5AD1A 1T4MA 4CQLA 1BS2A 2H1SA 4D9IA 1YDEA 2Q99A 2AVDA 5IAEA 4NDAA 4B3XA 4CNBA 1HEUA 4OOEA 5LB4A 3EA0A 4ZTUB 2V7PA 3TO5A 2Q2WA 4I08A 1GNLA 4BO8A 3CUWA 3OU6A 3H6KA 4D0GA 5IVDA 2WHRA 1PHRA 4FFRA 3LQYA 5TMEA 1PWXA 4HAOA 2XB2A 4MQFB 4NBKA 2EARA 3I09A 2B21A 4FT2A 4ZHSA 5L3QA 1IN1A 1QZZA 4LK2A 5FL7D 1KIFA 2I6QA 3DDWA 3LX5A 4L2IA 5AH0A 4DC1A 3UMSA 2WG1A 2YJNA 4JR0A 1W4RA 1US8A 1KVRA 1R6DA 1TM3E 1Z36A 1DT3A 2Y3IA 4UNSA 2MR6A 3DFUA 4EYOA 5KYXA 4I19A 2ZLBA 3SX0A 4TLCA 1PVDA 1A7KA 2ZKIA 4X20B 3V6MA 1TF7A 4QE3A 1W47A 1SG9A 3OC6A 2XTZA 4OHXA 5FR2A 3DT8A 4IHJF 1B14A 5IXYA 1HNXB 2J46A 4A9AA 5HZKA 1XTZA 1BQ3A 1F51E 2ZIZA 3NJRA 4HEJA 5TVGA 2F2TA 3DPIA 3VAYA 4ENTA 5HJ5A 3GLFE 3U56A 2VNAA 2UUOA 2II6A 3ZW7A 4BP1A 4XWOA 4KPYA 2WWYA 2H4ZA 3F5FA 5ALQA 1Z0ZA 5I7EA 2Q5QA 1B93A 1M2VB 1ZRSA 3RC8A 4MPRA 4W4TA 2RG7A 3IDZA 5HE9A 2IZZA 5TVKA 4JEHA 2WFLA 1B1CA 1DCKA 3A4YA 2F17A 3LE8A 3CVUA 1TCAA 2XTAA 3O8OB 4LXTA 2IH2A 5EVJA 3DXXA 2YJ4A 3KWJA 1T4BA 4HDKA 4TPKA 4Z9XA 3ZCXA 2YKGA 2YNMD 1NE2A 2IEZA 3L6BA 5TY0A 4GGOA 3RABA 2H1OA 3HCFA 3L4SO 4P81A 1JA1A 3ZHZA 2BE7A 4K28A 2H17A 1LSSA 4CM5A 6ABPA 3MT0A 3PD1A 1XN4A 1QRAA 2GARA 2GBCA 4QDXA 5EQFA 4AJKA 5ESRA 2VWHA 1WP9A 4PHTA 5LBTA 4AJ1A 4HQNA 1CUHA 1X6VA 3NH6A 1SCBA 3O2JA 3PUVA 1RRVA 3MTEA 4XIGS 2WOJA 5EKTA 5IN4A 3OZFA 2DSTA 3PD7A 4L3WA 5EJ6A 3OC0A 1N34B 5JECA 3M70A 3UMYA 4PY2A 4A10A 2QVCA 5BNTA 4PWZA 2XCSB 3EXEB 3OZAA 5IVHA 5C1PA 3QA9A 2YZ7A 3DOIA 4NZ9A 4PLZA 4C5CA 4MUYA 5DCUA 3SG0A 1XVLA 2YRWA 1PWEA 3D3WB 1D1TA 3WL7A 3VPXA 1RU3A 3DQZA 1SCNE 1XCGB 1ZCFA 2F3QA 2OXRA 2VPQA 3JQAD 3O8OA 4LZLA 5FBLB 3RF7A 2PKQP 5DLEA 1FU8A 3HA5A 4D9GA 4L8FA 1Y1RA 4HLDA 1O7JA 1R0CA 3FLMA 1GPWB 3NB0A 1EUCA 3WOVA 5FD8A 1L8AA 4L73A 2PBFA 1VG1A 4NCNA 4JI1B 3FPKA 3ZGYA 1T0PA 1IHDA 2NTVA 4DWWA 1BX3A 1J7JA 1JBEA 1YBVA 4U9IS 5D2CA 1ZEJA 2ILVA 3HU5A 9MHTA 3TK1A 2H63A 3CPHA 4C6SA 1CBUA 3OZDA 2HU2A 2Q3JA 1IY2A 1GU1A 4PEVA 4AJ9A 1SKYB 4CL0A 3JQBA 3PIIA 5JI2E 4KX3A 3RR2A 1NHGA 4D8TA 2F43B 3RJTA 4G09A 3B5EA 4UREA 3RWBA 5JZBA 4QO7A 4OU4A 1FQOA 1MAHA 2E4UA 4IDHA 2O8FB 1U04A 3EXEA 1PFQA 2TMKA 3FZYA 5HPYB 1EUDA 4KPFC 1Z16A 1HORA 4YRJA 3T5TA 2RAPA 3C3EA 1VJCA 3HCWA 1M0SA 3BDIA 3D3WA 3SK0A 1MVNA 2W6IA 3S2UA 4GS5A 3W2HA 2IX9A 4EFMA 5KOHB 1JAIA 1YA4A 1F2DA 3VPAA 1I14A 2W2TA 2CNWA 2CCGA 1XZMA 3I52A 4FDAA 3GCGA 5TB5A 4DA7A 4E3ZA 1QU3A 5LIRA 2GM4A 1ARZA 1Z3CA 2QTVB 3ZLJA 1T6BY 2QAIA 2DHQA 2GJSA 3OCVA 1MW9X 4EMSA 4M1QA 4B4KA 4BN0A 3D3EA 4QLBA 1GUBA 2X0IA 3FWYA 3B6EA 3C85A 4MJXA 4QDTA 1LK5A 3Q9SA 4CMHA 1FFYA 2C77A 5JO9A 4X9XA 4AO7A 4DT1A 2OCPA 3PGMA 3TX2A 3UXMA 4LVCA 5F2EA 2HJ9A 5EN4A 5ICEA 2IUUA 1ZIOA 3UN1A 3EIQA 1W88A 1XA0A 4CDNA 1NDHA 2BY4A 3GRPA 1YKGA 2F43A 3OHMA 5A9TA 2DHCA 4DPLA 3RANA 4O63O 4Z5XA 1YDFA 4YHBA 3QJ5A 3I2HA 2FZVA 4N8SA 2ZRLA 3MM4A 1DFHA 1XU4A 2X86A 3MMSA 4OP1A 4UEWA 4ZU6X 2YHSA 3RREA 4LF5B 1HF3A 1XMSA 4DLUA 4EVRA 4DLLA 3NHLA 1XIVA 3KKPA 1C0EA 2XCLA 5C1IA 1DB3A 2H7VA 4CT0A 5F7XA 1MOSA 4OLAA 2NSHA 1WZEA 4KVZA 1C5KA 3WAKA 1JAXA 2IDKA 2GA8A 3G0BA 4N0PA 2YY5A 1G42A 1ODFA 2O2YA 1LRKA 2P11A 5H9VA 4OQQA 1RHJA 2C9DA 2VF2A 1HYEA 3GZTB 1V1JA 1BN7A 5EWLA 4E51A 2R1VB 1S7GA 2LW7A 3ZVKA 1UF9A 4IIJF 3RTDA 4CMBA 2AJTA 1H2HA 4PBTA 3G8AA 4DR7B 5T64A 4EYSA 5BQXA 4ZWNA 4O29A 2HBRA 3ZY3A 3CWZA 3GNLA 4WASA 4CEJB 3NGXA 1JLLB 1QZTA 2FMFA 2JLBA 5DO9A 4G07A 2DEUA 3WRXA 2YVAA 4PFQA 3EXG1 3UC9A 1BWPA 1XRLA 1QG0A 2H5EA 2QE7D 3BBLA 2WJYA 2F00A 2Y6UA 2CFRA 2RK3A 1VKRA 1XYVA 2ZJAA 1Z4JA 2N3ZA 4YB8A 3RDPA 3V55A 1QO7A 4DMFA 2JF0A 1JQ5A 4WXMA 4GZLA 4RETA 1CZKA 2RKWA 4UPVA 3DDUA 4JZKA 4ND1A 2W42A 1W1UA 1SXJB 4PZ9A 1PFYA 5E95A 1U2GC 3EF3A 3KD3A 1YZLA 3QHPA 3RRZA 3WHKA 4D7AA 1K88A 4FMDF 5HXAA 2IP4A 2J85A 2HRBA 3O4VA 1GNVA 4P4GA 4F8JA 3WGYA 5SY6A 5LYJB 1J0CA 2IS2A 1JR2A 3EGEA 1E94E 4WJZA 4FXOA 3LBIA 1OVMA 4ZJPA 1FFCA 4BBZA 1D2HA 1X0XA 3ZVNA 4CG3A 4IV8A 4MS4B 1CX9B 4DCMA 5K0LA 1DT5A 2Z9BA 5E3HA 2WTNA 4FI3C 4P3OA 3NETA 1UBJS 1P7ZA 1W5TA 1W5EA 1T25A 4Y6SA 1KK1A 4WOKA 4IXMA 2OC9A 4WMLA 2RGBA 2GM5A 5JXJA 3TRDA 1JYEA 1N5JA 3OLXA 4FYVA 3KSRA 4PQEA 1ORHA 3GCZA 4BZQA 1YBFA 1JW9B 5GV8A 5BURA 2JZOA 4DTCA 3JVIA 2AOWA 3EB9A 4EX7A 3HO1A 3A7EA 3SR4A 3G68A 1D4AA 2ODBA 2RSLA 4XCXA 3WA7A 5ITWA 1NR7A 2VAVA 3GMSA 5BN5B 3COPA 5HHTA 1K6IA 1JHXA 4NCHA 3TLGB 1YNOA 1H0RA 2O52A 3QHAA 1CP3A 2PUEA 1E1NA 1SG6A 3FUTA 2Q3EA 5E3JA 4KJZA 2NZ8A 1E2UA 4BE7B 4N6NA 1XDSA 3RVRA 5CDGA 4F4HA 2HMWA 1DBSA 4KR6A 4DCPA 4QG7A 4JI0B 3BWBA 4BCDA 5J23A 2JFXA 2FXIA 1WZIA 2NZUG 3AQIA 4DMHA 3QGMA 3MMXA 4QRHA 4QGHA 3TGWA 1YIOA 1GCIA 2CXSA 3WJ1A 1E6WA 3MB5A 3NHWA 5GVSA 4ARSA 3I04M 3KQTA 4PSVA 3LC0A 3DOCA 4J0CA 1QFXA 4D43A 3I3OA 3MIIA 3C74A 1C0IA 1BS9A 3I8OA 3ZHCA 1WCWA 1SO8A 4UHEA 1NC1A 5DIFA 1KFBB 3IPCA 2CKDA 4OJQA 4YJ2F 1W19A 5B2FA 2IF0A 4TXLA 2B7CA 3AV3A 2PA3A 10MHA 2IBTA 1W36D 4FMBB 3W79A 1TZKA 3O75A 1KIMA 5EG5A 1U3UA 4PHFA 3SWWA 1DG3A 1U0OC 3BXZA 1GSHA 4FGWA 4KVGA 4LRQA 4BXOB 1DO2A 3A6ZA 3C48A 1FNDA 4RXMA 1C2YA 1HYBA 5CXUA 4DDHA 1Z8FA 3AHJA 3CF4A 3OOWA 1CRWG 3X1XA 4B6JA 4EQ6B 4HUQA 1QP0A 2EKZA 1Z38A 5AVWA 4EKYA 5IT5A 3HB4X 5BSRA 1TTPB 2DUNA 1UEJA 2VWGA 1R6UA 1Z0KA 3JY6A 4JVOA 4JYBA 1IG3A 1P6QA 5JMWA 3H8JA 1KDOA 4B71A 3G8BA 3H6GA 3JD2A 2WIFA 2ZT6A 1WV1A 4MO2A 2LIVA 2IZ1A 4A2WA 3DE6X 4HRAA 1LWOA 4BRUA 2AFHB 5I7FA 1JSRA 4MKXA 1LEHA 4Y2GA 1VJ0A 2B1GA 5G3ZA 4PYJA 4D3SA 4BO2A 4IDGA 4K8RB 1IY1A 1NRIA 5HTOA 5KTOA 3IIMA 2FSPA 3G2JA 2XEDA 3HVJA 4I1SA 5JHHB 4UE2A 1WB5A 2HX1A 1G55A 1EP3B 3HHEA 2WMOB 2JLWA 3B7PA 3QUBA 1H6AA 2YZGA 3TSWA 3EG9B 1KPGA 2PPLA 2G1AA 3NJ8A 1GTVA 3CUKA 2OD9A 3HEAA 3MJDA 4OSOA 4QREA 3SYRA 4BB5A 4DSUA 2ZTLA 1VZ2A 4Q1EA 5ETJA 2Z2YA 2G83A 2HNAA 2WMDA 3PC8A 4GUDA 3LX8A 3EC2A 4ITUA 1GN8A 1Q0RA 4LGCA 3RUPA 1O97D 1EFVB 1EJBA 2O7SA 3S2IA 3H3JA 3KYCA 1KI7A 1MB4A 3BQ9A 2WUWE 3MCTA 4IHQA 2I2FA 3PDUA 4LE1A 1JHYA 4YJGA 3ZYZA 2BM1A 4B4UA 4GP6A 4WNYA 4CVNA 1Q14A 5CFLA 1YVUA 1QXSA 1TTHA 1NVMB 2O1XA 3HXPA 4H31A 2YW9A 4FFVA 1I9GA 5HKKD 4I3FA 2BTQA 2ZI5A 3KCQA 2D0DA 4G6ZA 1GCOA 1QE5A 3A4TA 1IAVA 3WWCA 2P62A 3J81A 1RWPA 3HY3A 1AHNA 3H2SA 2ZCJA 2Y6VA 1ZQ1A 4XGRA 3KS9A 1KOFA 1NW7A 3WZLA 1ONBA 3CPJB 4O4IA 1QHHB 2D5CA 3IAAA 4XSGA 3VPFA 3G0HA 3F3KA 1WNTA 2PGNA 5A6VA 4GIBA 3OLQA 1RI2A 4DR2B 3K4PA 3U4HA 5K0BA 3B52X 1G19A 3H1EA 3N59A 4KDFA 1K0FA 3KLNA 2V58A 5D1NA 4DIDA 2WINI 5HX7A 4LMRA 1KAMA 5H59A 3H3XA 1QH8A 3QUQA 3U39A 1H5NA 3INYA 3TVYA 1VJGA 3OSZA 4DLBA 2H57A 3LDGA 1ZGGA 2C3UA 1MTZA 3MBOA 3NHFA 4RPKA 4WK2B 3X2EA 5FWXB 5L7WA 2Z3VA 3CCBA 4NU5A 4FOOA 1SWVA 1XZBA 1F12A 4KAAA 5AJWA 4R5HA 3R9IA 4JOBA 3H1GA 4YMVA 2ZS7A 3Q9LA 1DI0A 1IXKA 2X8WA 3NHUA 1RZUA 1M0TA 1RC8A 1OZFA 4KOEC 2XIQA 4PBRA 2VPWA 4RTNA 2R6JA 2HT6A 4DXHA 2OWEA 3WHPA 4YCSA 2WKSA 2N1MA 4I36A 3FNBA 3E9QA 1O0BA 1X9GA 3R77A 3WIUA 4KLRA 3TEFA 2VSQA 4Q3KA 1EWVA 2X8LA 1HDXA 1XNGA 3FUUA 3P26A 3R5TA 4F1JA 1JS1X 4F4UA 1DMRA 4DRXB 1ZJJA 3NONA 7AT1A 4RM3A 4QXPA 3QXCA 4Y6RA 2IK8A 1DIGA 1X15A 1WRBA 2OB1A 1GRRA 4Q9AA 4KFCA 4CLHA 1ZX1A 1FSGA 2F3TA 3D1VA 1F1JA 4G5RA 1G7TA 3AI3A 4QGSA 1SUSA 3Q7TA 1JGTA 1BFUA 2ATVA 2LE0A 2VHXA 4AVYA 2BM8A 3R8FA 2XVMA 1LQ2A 6GPBA 2R97A 3CF2A 3LWNA 1SOMA 4C0WA 1QNLA 5TGZA 3JZAA 1XRJA 1AKRA 5IF9A 1V5IA 1LK0A 1K7XB 4XIFA 1JQBA 1NTOA 2VHZA 4UXHA 1ZH0A 1QCDA 4PSUA 2R47A 1P74A 2Q28A 3H5IA 1W581 1JB1A 4XRRA 1MFPA 3QX3A 1SBNE 2AC2A 4XVRA 1AKQA 3VZBA 3CEHA 1UXOA 2ZIFA 4JQOA 1L5OA 2FSVC 3AUFA 3WNCA 2A94A 1JPVA 4NC9A 1E0AA 2I8CA 3U44B 4KQMA 1RLIA 1PR3A 4GX1A 4QJ5A 2GSDA 1DX9A 4U9UA 4ENSA 4DV5B 1ESDA 3CWCA 3H0KA 2WVJA 3OIFA 1CYDA 1HDZA 5DHPA 4ZOBA 1R6AA 3ID6C 5HF5A 4LOIA 1YT5A 1G5IA 2PZMA 1W4AA 2YWEA 3DA8A 1R6BX 2NU6B 1IEQA 4YMHA 5HQ3B 5I4BA 2IPOA 3QVKA 2EGHA 3ONVA 5I8PA 5LU8A 4EYQA 1NBAA 4OO3A 5B58C 5A3SA 2ASEA 4DHEA 1Y8ZA 4I5GA 1U8TA 1CZUA 1CD5A 2X2FA 1E4EB 1TJ5A 3B51X 1Z13A 3OICA 4L02A 1Q7GA 1KGSA 1W4LA 4KAFA 3H1FA 3UPTA 3DNPA 4LCBA 3O4IA 3VTZA 3R5FA 1SXHA 1TW2A 2MHCA 3TZBA 3HYTA 3FXAA 1NMXA 1K4KA 3A8TA 5DWVA 3V8QA 2WHYA 2VRCD 3C0KA 3FYCA 1CHNA 3WYEA 4CCAA 3QKTA 4BDSA 4TVKA 1LPAB 3NS7A 1CR4A 1M83A 4ME6A 1GLGA 2HV9A 3MD9A 5LQMA 1XVUA 3CRMA 4FBMA 1ZN2A 1R0SA 2B3TA 3KJQA 3WV4A 4ECAA 4ZO4A 4F84A 4KNYA 2VCYA 3I9FA 1VZ3A 2Y99A 1QTRA 3KLOA 1MABA 1QDUA 4HVLA 5C1DA 1U5AA 4UCQA 1I4DD 4QTUB 4LYHA 1GGHA 2ISQA 4UNNA 4ZDIA 2QZ4A 4AG6A 3LKBA 4IIJB 3L06A 2XAAA 1EINA 4W8GA 2RC5A 4MKHA 1FNMA 1A4RA 1MLDA 1QCYA 1XMIA 5ALGA 5DZSA 4D97A 1FTGA 4MV0A 2FEKA 4J0IA 4P36A 1LW6E 1ZUIA 1FLDA 1HT0A 4E5YA 2Z4TA 4ZO9A 2PS9A 5B4UA 3HKBA 4NBWA 5AXAA 3DTNA 4V1CI 1JIKA 1Q0SA 2AR7A 2EP8A 3E5NA 1O96A 4HF7A 1U7OA 4QHSA 5D5QA 2AQ8A 3ZHUA 2BTOA 1XRQA 5TQ0A 4E3WA 3GOQA 5LNK6 1HGXA 1ZGCA 2I33A 4MCAA 1G8KA 1OFIA 2Q0HA 4XB2A 3PT5A 3A9TA 1J9GA 1R0LA 4RKRA 4O2BF 3SC3A 1Y1PA 2C0CA 1UZMA 2OPHA 3TRIA 4C3ZA 5F2KA 3T3EA 4EJSC 4KREA 1RYFA 2EJUA 2H51A 3FPSA 4ZVQA 5TEWA 1YDHA 2C8JA 4FMDB 2PZJA 1YBMA 4JH0A 4RVSA 5E9JA 3TQCA 4RVOA 4B1FA 4QKQA 1PCXA 3EQ2A 3U7GA 3WXMA 3FDZA 1NL3A 1P2BA 2ZBQA 4HD8A 3C1AA 4EB6B 5KWEA 1GIAA 3B7GA 2XQKA 4GE3A 2IWRA 4H59A 2C2HA 1G5TA 2GCPA 2XCIA 2ZE8A 2BFEB 4K2AA 4KHPB 2JGAA 1XYYA 5E7MA 2FHSA 1M1NA 2OC4A 3H5LA 3K2EA 3RH0A 1XCBA 1DEHA 3NMUF 1DJOA 3JQ9A 4J6EA 3PDWA 1X9IA 1UK8A 4Y2HA 3W90A 1X14A 4D4HA 3AR4A 1KAQA 3U09A 1FLAA 2YFKA 2ZSIA 2DM6A 3CB2A 5CNIA 1FE8A 2GKOA 4MGYR 5LMUB 5FEUA 1MIOA 1ZNYA 5AICA 2CB9A 3D31A 2P2YA 5IP5A 4ZFNA 5WRFA 2HCBA 3NIFB 4OBBA 2HUNA 1DEAA 4XGKA 4TQAA 3VZRA 3U5ZB 2YJ3A 3IUJA 3K5WA 4B4DA 1EIWA 1U3VA 2XHEA 3KR0A 5LP6C 3W8FA 4QYTA 1R0YA 3IAS1 3C6XA 4DCTA 4EPYA 1I3OA 4E2XA 2PH1A 2WTEA 2Z98A 2G1JA 3S6JA 4HT3B 5JJLA 4DY4A 5CITA 5K8TA 4MEJA 1FSSA 1NVGA 2Q9UA 4HLQB 4LYDA 1L4MA 1RAIA 2OV4A 2RHTA 3E0XA 3TLXA 4CKXA 4UHJA 5JOQA 2IHUA 3WSVA 1YI0A 1N3BA 4F4FA 5JNSA 5FPKA 4ID9A 2HU5A 4RD2A 4TSFA 3SJUA 5FHRA 1XQWA 2QTGA 3LLCA 2YX1A 4G84A 4GXQA 2EF1A 3I4LA 2I71A 2A3RA 2AD1A 4R9RA 4WLVA 1TMKA 1G8PA 4MA4A 4F8YA 4FWTA 3VUFA 3KKOA 4L5YA 3FYTA 5LZ8A 2FWJA 4ZI7A 4MW0A 1BQEA 1BOOA 5ELXA 4YJ2B 1NP3A 1OH6A 2H9AA 2ATCA 3F6RA 2XX3A 4HXYA 2BI8A 2V7WA 1NW9B 1X77A 2PZLA 2JIMA 1F4LA 5IANA 5K8JB 1IXSB 3GLIE 1RJFA 5KVQA 1KI4A 3JQFA 3SOPA 5MFPA 2QPTA 1C1DB 4H0FA 4Q3CA 1E2PA 1UK9A 2NADA 3GCDA 3NC0C 2G3YA 2MMCA 3OEHA 1NBEA 1Y9AA 2D3TA 1MZPA 2QLFA 4EUHA 1RADA 4LF6B 2WTBA 1D2GA 2I67A 1Q17A 3AUKA 1SK8A 2QRUA 3RVNA 4MS3A 4L6IA 4ZVUA 3TOSA 3F90A 2XUKA 4UJ3A 5CYGA 1RCTE 4ZYLA 4C29A 3WDSA 5LMZA 4BPRA 3GVXA 4Y6OA 3UFXA 3CR7A 1V7ZA 5A4AA 1C9NA 4NCKA 5FPHA 3N7UA 1TQHA 1RRFA 1X39A 4JJFA 4OGGA 2OFWA 2OHOA 4ZVVA 1OZ0A 4MVXA 3RIGA 4ZTBA 1QO0A 3KAPA 3FHOA 1E5DA 3Q3JB 4IIHA 4LJ7A 4LW8A 1UDCA 3O91A 2WM3A 2AWNA 1JEJA 1YUNA 2DH5A 3SQMA 1A9RA 2EJCA 5EIXA 4W9RA 5F2NA 3EULA 3FGOA 1IU9A 4KUHA 3X1WA 3PV0A 4IR7A 5AVJA 2V6IA 3JR3A 1A8PA 3K70D 1FQWA 3VGJA 3OLCX 4Y2VA 2HA5A 3JXEA 3S7TA 4NL4H 3SYNA 3H13A 3ETGA 5A6SB 3KUCA 3OWHA 1SQSA 2DBZA 1PD0A 2OVBA 3RC2A 1AH2A 3EZ7A 3K1TA 2PQ6A 4GLLA 4TKLA 3ZGZA 2YFQA 1F14A 1QGED 3GPDG 3ELWA 4GWKA 4N18A 4Z1OA 4P0QB 1DHRA 1AK9A 4ZKDA 5KTNA 2QV0A 3NQ41 2C4UA 4P22A 5HGXA 3JV7A 3DVQX 3DZCA 2PRZA 3NTQA 3OH8A 5F21A 1Z8HA 4DL9A 4DV1B 3A36A 4HN9A 1FDIA 4R8RA 2I65A 5K0GA 1H69A 2QRLA 1NLFA 2IXDA 2QQFA 3FYUB 1ADBA 5AWFC 3ZD6A 3GEDA 1UCFA 1YK0A 1GNTA 1TJNA 2R48A 5KTTA 1BDIA 3M49A 3QUTA 1OIXA 1KO5A 1YU6A 2G17A 2QYOA 1Z9BA 2VA8A 1PR0A 2A33A 2QS9A 4Q12A 4F92B 5JZ9A 1JSXA 3MUOA 2MCFA 3FKSA 2FMXA 1KFJB 2HWXA 3OTGA 5KC8A 1KIAA 4IOMA 4BC0A 1L7VC 1TA0A 1IWBB 3ICVA 4LZWA 3E5RA 4G0PA 2WSSD 4UU8A 1VHDA 4UBIA 1D2EA 2ZWIA 1S01A 4ZZ3A 4LF8B 4BRWA 3RSGA 3WLTA 4RTMA 3X1JA 2YV3A 2D1YA 2NLOA 3FLEA 3KX2A 2ORWA 4PINA 3OMLA 1GVHA 3SS9X 3VSDA 4F8EA 1J8FA 1XFDA 3NHRA 1NWCA 1KEWA 5IAJA 4UVDA 3SNKA 3W7VA 4BP8A 2W2PA 3ENNA 1XVVA 3G2PA 4MV1A 3ES9A 4ARUA 4ARVA 4FM9A 2EJTA 3BWCA 5FTMA 1L3BA 1A69A 5CDFA 3U1VA 1TMGE 1YMQA 1FX0B 2ACWA 1GAWA 3I12A 1Q1NA 4JIGA 2BMJA 3ZS8A 1H2FA 3I9V1 2B1JA 1WW3A 3JATB 5KJFA 1PP4A 1L3CA 5AIBA 2WP0A 2LP4Y 1E79A 2O2HA 1JFFB 3OE7D 4JI5B 3CBQA 1UBOS 2NO0A 3IYLW 4OYHA 2QGNA 4IXDA 1O87A 3RC3A 1E3IA 3ILXA 1CEEA 5EUQB 2ZETA 3T8YA 3UC5A 4EB8A 2DY0A 1MX3A 3G0CA 4YUVA 3RODA 1M7BA 1OWPA 1PJLA 2XRYA 2ZYIA 1ICIA 2CB0A 3KZXA 2YVKA 1A7UA 2DBVO 3WZMA 4YY3B 5HM6A 121PA 3FYHA 3G9ZA 3THRA 1K9VF 3QWAA 3R3SA 1DQZA 1OREA 3OU7A 3E22A 3WKCA 3QQ5A 1J90A 2QIOA 4P9NA 5F76A 4S24A 4PXSA 5GGYA 4B6EA 4F04A 3MZ0A 2K6GA 2VSFA 3FZQA 3Q8WA 4KKXB 2D1RA 3DC2A 4ZI3A 4E94A 3A1DA 1NBIA 1NONA 3DKIA 3W2TA 3DWIA 2GBGA 2PYZA 3M8KA 4PLVA 1FX0A 3SS7X 2HHCA 3MUFA 4B9EA 2P41A 2RGAA 3PFCA 3CUYA 4PTZA 4PPNA 1H4TA 5IARA 3X1MA 2IH5A 3C3JA 4ZODA 5LZ9A 1XQXA 2NV6A 2C3MA 3U9TA 4B6PA 3GLIB 4AY2A 3LGSA 3ZKWB 2VDQB 1JPUA 1JEEA 2AI3A 5ALUA 1R4MA 1YZTA 2VJKA 3DHWC 2C2BA 4ZOLA 1I7DA 1HA3A 5KYVA 2H16A 2CXTA 2VQFB 3C6YA 2WWTA 4Z8YA 2XWQA 4BKUA 5TEVA 2H2GA 4JU8A 2XSZA 4HKTA 5L4SA 3PTZA 3CY6A 4C3OB 3VO8A 3S8YA 2VXYA 1TYCA 2CN1A 4ALIA 5ICSA 1FMJA 3QVSA 3Q41A 3K0AA 3Q7EA 2Q9BA 2LKCA 1U2PA 3AETB 3WHLA 5IBCA 2DYKA 4H7FA 5HKBA 2OMKA 2F9MA 1BRTA 3E61A 5IU6A 2AN4A 2J3IA 1HFKA 5KNBA 4CUKA 4R9VA 4GPEA 5EIAA 3UAWA 2D0IA 1SVKA 2R84A 1LLDA 1S3SA 3DBLB 3SKYA 4BMXA 4YR9A 2HCFA 3RTAA 1N2ZA 4G5SA 3UMCA 1VMAA 3PXEA 1LLUA 5IWCA 3CZ4A 2PEYA 4TRNA 4BNIA 1QB8A 1TL7C 2X23A 2FZCA 1TUGA 2ZJ3A 3L7DA 4IVQA 4N5DA 5CXXA 3FNRA 1C8BA 4GYYA 1I2CA 3TGPA 1VSQA 2J5QA 1IY0A 2E55A 2GYWA 2DCUA 3MWEB 2G80A 2XH8A 4HQRA 3LM8A 1EZ4A 4HK4A 1GTJ1 4N1AA 4F4IA 4CN8A 5KINB 3HK2A 4O5OA 3H5WA 4YIKA 1YB5A 4TROA 3KKKA 5L95A 1O6FA 3C41J 2P0YA 5K3DA 3VKGA 2G4VA 1XA4A 3GFTA 1QX3A 3BPSA 3FUWA 3NIBA 3A25A 4R8SA 4TL7A 2G9QA 1EVJA 5BOVA 3ZU3A 3VNUA 4LYYA 4F3CA 2J1LA 1R66A 1R50A 4C4YA 2FP4A 2W48A 2YJGA 2GVZC 2QRHA 3LX6A 3AETA 1MT0A 2H5LA 3OZXA 2HF2A 1DCMA 4WW0A 2PMDA 1G7CA 1BEEA 1U6KA 1BE6A 2J0UA 2WPDA 4H3VA 4O2BB 5KWSA 1G3QA 1UBNA 4P53A 4U8HA 5ISMA 2BGJA 1JDNA 1U63A 3MTQA 1BD4A 4M6WA 2NVBA 4X1YB 5TPWB 2RGYA 1JJIA 3UF0A 5E8RA 3WGZA 3KOXA 5BRJA 3UUEA 3IUBA 1PL8A 3QV2A 1HZJA 3PE3A 4REQA 3G2OA 4C7JA 1MT3A 2D00A 2YWRA 4FHGA 4DAOA 4W9MC 1S2IA 3MCAA 4XXHA 3O31A 1EE1A 4ZRMA 4RIHA 2JLSA 3KU4A 2WQ7A 4MVCA 4L22A 1KRWA 2W2OA 3DMDA 3H86A 3WP0A 3IQDB 2IYYA 1SD1A 4PC7A 2C2YA 2ZTHA 3B53X 4Z1MD 1H05A 5L53A 4D8WA 4EL0A 1C7IA 221PA 2BONA 1AIPA 3DUFB 3WMRA 3ZQJA 4D9HA 3W6ZA 1TEVA 3GLVA 4XQCA 3K5HA 1CR6A 3ORSA 5E2AA 5GZ6A 3SHOA 3TVTA 4Q82A 3NORA 3KQWA 4JOSA 4DLAA 5F12A 2AMVA 4AO8A 2C4WA 3E5HA 1QUEA 1XNJA 1J06A 3IKLA 4M1EA 1VE3A 2WF7A 3BRWA 4C0XA 1YL7A 5LWHA 3T1YB 3BSWA 2WU8A 3LCRA 4ZEOA 5L3VA 4WOJA 4CCWA 3IHLA 4JLNA 1R8JA 2WPNA 1A0OA 1IWOA 4TQUS 4WEQA 3GMTA 4YRKA 2G0AA 5LZ7A 5KKNB 3W3AA 4MQBA 4HEA1 4H15A 2PL1A 4Q4LA 3I2GA 4PW0A 1YZFA 1CEQA 1UIRA 2GF9A 5EJ2A 1YI1A 3HUTA 4MP6A 4XUEA 3TXAA 1NG9A 1VJ5A 2QD4A 2GJAA 4R16A 4B31A 2H4FA 1M8PA 3AW8A 3C3AA 2VDPB 1WMSA 4PSCA 4G5OA 1Q3TA 1XT6A 4D81A 4EJ0A 5FH9A 1GTSA 3ANSA 1NRXA 3G8DA 4RVNA 2Y1CA 3TBFA 2X0NA 3FVWA 1LF0A 2WD8A 3V1NA 3DUFA 4WZAB 2QMUA 2R7MA 3K72B 2FMKA 3AJRA 3JALB 3ZCRA 1COWD 2GHIA 4DA4A 2PGXA 5EWJA 2CY0A 1W52X 1N2BA 2ZIXA 1T1GA 1XWWA 3BHIA 3G7UA 2CLOB 5EPEA 1KI6B 3NIDB 2FV8A 4NQZA 5FOUA 2W83A 4BLUA 1VBKA 3C87A 3DZFA 3BXHA 5C8DA 2DLDA 2EDCA 5EWMA 2QL5A 3TIIA 1ZJ5A 3QEJA 2Y1XA 2ZRPA 3H2ZA 4C06A 1P0FA 2YZKA 1HE2A 1C1YA 1TZCA 4LFCB 2VG8A 5H1YA 1J33A 4YV0A 1TE2A 3DDSA 1IYZA 3DE7X 3UJ9A 2Y9MB 2QUJA 3RVLA 4PG7A 4BO1A 2QPOA 3LDUA 4Z51A 4KQWA 5HK9A 3BCUA 4OU5A 1N9KA 4M8LA 4RXTA 2M6SA 5BV1A 2UUCB 3P9QA 3Q98A 4U7JA 3SSAA 3V1YA 1GG8A 4D3YA 4QOEA 4I3HA 4L4ZA 5A2QA 2E1RA 1Q92A 2BKXA 3E9ZA 1KDTA 1U02A 5AJTA 1OH8A 1WM1A 5CM9C 4UTPA 4DV3B 5CVEA 1OYVA 5JDCA 1P0QA 5DP1A 4WZAA 1PNVA 1X7WA 4D9MA 1NX6A 4MR7A 3VJRA 4QBIA 3Q6IA 5DF1A 4D82A 5LM3A 2FJUA 3L6EA 3KHTA 2FSFA 3BTOA 2FGJA 3AVTA 1LBSA 4Y6QA 4XM2A 3ZWPA 4WNAA 1P5JA 3EOBI 2G76A 1R3UA 2JRLA 3D3JA 4Y1EA 4YUYA 3U7HB 2WLTA 1RZ3A 3E0QA 5DM4A 5BN1A 5FV4A 1T0UA 1YS7A 4J0GA 1DLJA 1XR3A 2CVFA 3D8NA 3LFUA 4HAIA 1ENOA 2J7PD 1E2FA 3EK2A 4FFOA 1RPAA 1XALA 2XITA 5TPZD 2CHQA 2DKNA 2DWOA 4O4HF 4KO2S 1XX6A 4Y98A 3U48A 4CHTA 4S0ZA 1ZRHA 4MWBA 4DG9A 3H42B 1RBQA 5TIIA 2P1DA 2ICAA 2PJZA 4YGXB 3IDOA 1GQYA 1EEXB 4KL8S 4KWIA 1RJWA 4NI5A 3GRYA 1NSFA 4YRDA 1ACLA 3M5WA 5JYCA 1U11A 5EIBC 1WOYA 2V59A 2W93A 2B2CA 5MN4A 2GPAA 3GJ5A 1CUUA 4LXIA 4MRRA 2WNSA 5JMPA 1UBFA 2ZS9A 5A4JA 2JFHA 2Q21A 4L4SA 4HGNA 3VJMA 5A3JA 4JYPA 5IKEA 1ZR2A 1AB5A 5F1OA 3VSCA 2V0GA 1JKMA 4OGKA 5B1IA 4DHWA 2ONCA 4S0XA 4QM6A 3M1LA 1I2MA 2B82A 2PFGA 3QY0A 5BT8A 3I3SR 5E7QA 3E9NA 4FSXA 2FLKA 3DCYA 1G8GA 2H0RA 1A04A 5TMDA 5AVKA 1I2BA 4RJIA 3T1VA 3TZ6A 2XMCA 5C9ZA 5IWAB 5LQSA 3H5AA 4YLEA 1P80A 4BUZA 5HJ2A 2LCQA 3DW1X 3O38A 4DQUA 2CNLA 2ZTMA 3TTYA 2EZ4A 1XTTA 3OE4A 4D9JA 2AQHA 3NRCA 2G25A 1LF5A 1SFRA 2OXIA 3W8EA 4DY6A 1Q6YA 3SIRA 2V6JA 4IIYA 3F1LA 4JJ4A 1JMYA 5GY7A 4WWHA 4Q4CA 4MUMA 5AVQA 1QZ3A 4O1IA 3ROZA 5K6TA 1G0OA 3ASUA 2V4ZA 2H4JA 1YFKA 1B6GA 2WZQA 1KRHA 1YBAA 3PLNA 3R24A 3RLFA 2DUUA 2V6FA 3RTBA 1QVAA 3BKXA 4DCNA 2EHJA 4HB4A 1QTNA 4KQXA 1PFKA 1WXGA 4HDNA 4R6XA 4TT8A 5C7YA 4J4TA 4FONA 1P72A 2Q9CA 2IRWA 3NPAA 4L9SA 4F46A 5MGNA 3RI3A 3NDJA 4YMSA 3KELA 2VK1A 3U3XA 1KS9A 1X1SA 2EKBA 5LKAA 5K8LA 3D59A 3CW9A 2G1KA 1I94B 2IS1A 1PYOA 1RIIA 2ZPAA 1GQQA 1F7UA 4M0DA 1X1CA 2BGLA 2GESA 1IEXA 1Q1AA 2NZWA 2AW5A 2D0PB 2O3RA 3H2BA 2VDKB 2SKEA 4D3ZA 2X41A 4FYWA 3R7LA 5LPNA 1H2ZA 2DTDA 1I13A 5T3YA 1XZCA 2VPYA 3C1TA 1R9MA 1J21A 4HN4B 2XXAA 1THTA 1GCUA 1Z6ZA 3B6KA 1OAKA 4DN6A 1QFSA 2NUPA 2BFDB 4M55A 3A6LA 4N3BA 4L5IA 1SHTX 2FWBA 1LX7A 1NQOA 4C7VA 3ZKAA 2BHNA 4R0VA 1USKA 2Q29A 4AB1A 4Z7QB 5KU7A 1YCDA 3UWMA 3K8OE 4N9WA 1FP4B 4EKGA 1T2FA 2CBGA 1XCPA 1JDTA 2O2JA 2HRZA 3F8SA 1UBHS 1I0ZA 2DECA 3LFHA 4H08A 4ZD6A 4RLHA 3WK8A 3ZJUA 2WK1A 3PITA 2IUEA 3KHSA 1J99A 2ZGVA 1NQUA 4ISCA 4LWOA 2IOYA 1L7QA 4C87A 4BQFA 3D4LA 2WKQA 3EPJA 5CVCA 1M6EX 2PX2A 4WRRA 3HACA 3WGHA 1D03A 2D62A 5EIOA 1HDOA 2H5IA 2OUKA 3KRTA 3LK6A 3T3GA 3B8EA 2ZREA 3N86A 5MGBA 1N6LA 4FJ2A 4L76A 3TLKA 3VBCA 2ENWA 3MJTA 3AL3A 3II6X 3MN1A 4MQMA 3BRQA 2EHDA 3RS0A 3DWEX 3VU0A 1VYVA 2CLDX 1Y3AA 2PLNA 4COKA 1JILA 2R6R1 2IP2A 4UD6A 2IHZA 3B36A 4ON9A 2XXJA 1AC5A 3OO1A 4KXXA 2H31A 3CLRC 3FBWA 4UXJA 1KU0A 3W8RA 3R1IA 5IDYA 4FC7A 1SU6A 4EO9A 2C5HA 3N39C 2QLNA 3BIXA 4YRPA 1Z3IX 3HHPA 2FPKA 3ICPA 4TKVA 1EDZA 4L8WB 1FP4A 4OI4A 5G1PA 4RULA 3R5KA 3U4IA 1A9PA 3ZWXA 3ENZA 4Q1CA 1P75A 2C57A 2AN9A 3A6EA 3C7KA 4LI0A 2L69A 2OLJA 3PU6A 4FTWA 4PS1A 3SQLA 1SOUA 1DV1A 2QJOA 3HDHA 3LHSA 2HHLA 3GCWA 4MRMB 4PYRA 3LVQE 1HQKA 2Q27A 3B2EA 2Q5IA 1QSGA 3EE6A 5IEJA 3NUGA 4UHBA 3ND8A 4HPJB 1X92A 1MRZA 2ZFUA 3KK0A 2R7KA 2YYZA 1Z6YA 6LDHA 1O77A 1PL6A 4MYRA 4J91A 3UCEA 2GTHA 2NACA 2Q2QA 3DYVA 3MBIA 4LV8B 1ZJ6A 2HA2A 1NLYA 4LQ4A 3IP8A 4Q34A 3TE6A 1WETA 3GPBA 2FQQA 3IUYA 4RIGA 5FI3A 4GO1A 5DGDA 4N47A 2A7QA 3ZCPA 4F2GA 1JH9A 3OMWA 3HUEA 3L4KA 1U2TA 2A9PA 2YDYA 3OZRA 2FFBA 3RCBA 2R4QA 2CDNA 3PHJA 4N7BA 3R0XA 4CFZA 2CL7X 2FK8A 3V46A 3V8EA 1L9KA 3IBTA 2CBXA 3OIWA 1FUKA 1KDZA 1FRZA 3SKVA 2OYCA 1NBHA 1XLVA 4MARA 5CBPA 3GP8A 2JASA 1OTXA 3DO5A 5EKDA 4MQLA 3OAAD 1WDWB 1ADCA 3CLTC 4G8BA 3ZE1B 2PEZA 3IKTA 1WMDA 3EY9A 2HHHB 3TUZC 2RJNA 3ULKA 1R5BA 4V0KA 1ESMA 1I3LA 4OK6A 3ZDRA 1L7DA 1KU6A 1WCV1 5C18A 4WQMA 2VYQA 3W9BA 1X9HA 2UVQA 3DDNA 4JJEA 3TIGA 4Q24A 1WBBA 4K5QA 4Y2XA 2PUWA 3SFTA 4YQEA 1FMCA 4WY5A 4GP7A 3HABA 4PF1A 4M9XA 2QZSA 5LYYA 1B0PA 4Y2QA 5CEFA 1ZU4A 2WWXA 3OY7A 1GRVA 2LCFA 2NYAA 2V5UA 3PC8C 2QMEA 3S5JA 5L4LA 4YMWA 3OTQA 1NDQA 4ZZIA 2R6DA 2H9IA 4J8PA 1TF5A 4C5BA 1QK4A 1GVNB 3EDQA 4XWKA 2ODPA 4K87A 1H85A 4P54A 1N5RA 2VPXA 2D7JA 3RHSA 3B3GA 4K03A 1G4UR 3FNHA 4FK8A 1LQUA 1OFUA 1FFDA 2XIJA 3W4KA 3ZV5A 3ILSA 4ATNA 2BZGA 2WUVA 4DV6B 1XQ1A 4RFSB 3CPEA 1RKBA 4BVBA 3EA4A 4L16A 3HJBA 4XWWA 3GMDA 2XGSA 3Q87B 4PC2A 2Q8PA 4IRUB 3AI7A 4LYFA 1U8FO 5FF9A 3U9LA 2R87A 4V02A 4U5QA 2IOFA 3U17A 3PCTA 1NA5A 3FCXA 3OD5A 2XOEA 3IP6A 3KP1A 2OV1A 3C5VA 1WCIB 5JVDF 3P2OA 3ZYCA 3O92A 2P5UA 1Z4LA 5DTQA 2QP3A 1TK3A 2WAYA 3D1JA 4YAFA 3L40A 2ZE5A 5FOTA 3OM1A 1NX9A 4B84A 5G0SA 2EFHB 4QIHA 1AJEA 1YC5A 2XVXA 3PRHA 3WLNA 3A4NA 4WUTA 4AKTA 3P2KA 4ETIA 2E4YA 3AESB 4GQBA 4U2EA 2XBLA 4MP8A 5DBGA 4RWZA 1T4CB 2HIAA 3BEDA 4HDQB 3RSOA 5BSGA 1FZTA 5IK2A 1FTNA 1U2SA 2ZYDA 2JVKA 4YA6A 2ZM5A 5DHRA 4DRYA 1W5AA 4L9AA 1JJBA 5DSTA 2R65A 3LPNA 5E6RB 5AHOA 2R4TA 4NZMA 4N4AA 2PFKA 2ZE6A 5J5CA 1QVWA 3KAKA 4J94A 4XIIA 1GL3A 1FMFA 3Q5GA 1H8ED 1KMMA 4MR9B 2B4RO 2X2EA 2BUAA 4OKNA 3UWPA 6CHYA 1QQBA 5EIFA 1IZYA 4M1YA 1E2JA 1NATA 2QY6A 1V5EA 2NXJA 1GD1O 3OTOB 2J3EA 1Q57A 1LA2A 1FXWA 3D8TA 3SCZA 2F4VB 1TKBA 1G20B 3K94A 1FB5A 1Q3KA 2Q4DA 4H1WA 2FNAA 2XE4A 3FYSA 4C7XA 4RZUA 1OWLA 3L46A 1VIAA 1RT9A 2X58A 3DOUA 4WK0B 1EHYA 4OMFG 2Q5JA 4XFJA 2AN5A 4PX3A 1ZH2A 3VPCA 1IWPB 3AY6A 5CAEB 2NAFA 1H2WA 2GN1A 3EGXA 4DADA 2GNPA 4AZ0A 3VPSA 1L5WA 3AESA 4PIVA 1V4VA 2C7VA 2NN3C 1E1RD 4KACA 4LZNA 1Z0UA 2J6HA 3HU2A 3ND7A 4R3UC 4V0LA 4Z4GA 2Z08A 4N3GA 5H3CA 4QU5A 3FHTA 3IJEB 4HATA 2PN1A 1A4IA 3I9OA 5FPYA 1EK5A 3OD1A 4LISA 3QG1A 4ZO8A 3WBBA 3KZCA 5A06A 2FPSA 1Y80A 2J45A 3AT1A 4RD3A 5I9MA 4O4HB 1Z0SA 1N75A 2WT9A 2XMRA 2TECE 2Y9PB 1DVRA 1R15A 2FPRA 3BGIA 3H87A 1YB2A 4FYJA 1A9OA 4IZHA 3DCJA 4L78A 5JNLA 5LOVA 3F47A 3AZPA 2XZPA 1R2QA 4B8ZA 4K1XA 3SJBA 2UZAA 1TT5A 1XXHB 3DZHA 3OQMA 4U2KA 3IS3A 4YCDA 3SC4A 3W2GA 1I3CA 4KP7A 4KXNA 1E2EA 3N6RA 3TAUA 4BFWA 4KFRA 3CLSC 2V45A 3TUJC 4P7BA 5CDUA 2YWHA 3IP5A 4RKYA 5AQ1A 3RRJA 1VPDA 2JGEA 1E64A 4YN3A 3SZOA 3U49A 3UAVA 4AN4A 4ER3A 5BQFA 1CVLA 4M0UA 3EPKA 2WMNB 4BE9A 1WMEA 3GT0A 2OESA 2P2GA 4UC0A 1N5DA 1E9DA 3GA0A 2ETXA 4KZPA 2B98A 2WTUA 4N12A 1RMQA 3EVAA 5JW6A 3HJGA 3ZWAA 4B3RB 1P6UA 1QH9A 1L5VA 1T5SA 2EZTA 3EG5A 1YZHA 5K3OA 2Z8YA 4JLOA 1U2DA 1BXGB 3KTFA 3OZUA 1JR3E 3FCYA 4LTNA 4WDQA 1JR3D 2W6JA 1IZ8A 1H2AS 4PG4A 2VLIA 2CZCA 1J70A 2DPLA 3FLBA 3TQHA 3O8LA 1BMFD 1NUHA 4ZOAA 3CA8A 5HOEA 4FD3A 5JSZA 4NYMR 5CVDA 4LYGA 5BWCA 4I4CA 2QLBA 1MN6A 1N2XA 4I4NA 4TV9A 1MOPA 5EZQA 3K1ZA 1GT91 3CG4A 5HKOA 2PVPA 1XXHA 1T9CA 2CVZA 2JGJA 2YJ5A 4I4LA 4EF4A 4ZYYA 1RM0A 1BVYF 3BMNA 3BJMA 5HKAA 1QDLB 3HVHA 1H4QA 3DNMA 1P7PA 4INOA 5LCXA 1VCMA 3CNLA 3RYCA 3CBGA 1SOAA 4EGFA 4S1OA 3L4JA 4RY9A 5CDHA 3CF4G 1GPYA 1ZA1A 4EMBA 3BXXA 3KETA 2Z2ZA 4DJDC 1HKUA 1XVAA 2VT7A 4WOCA 2PUBA 4H7JA 2R8BA 4YAEA 1RMYA 2Y0DA 3CKYA 4NK5A 4QU8A 2QR3A 3LHFA 3Q0TA 2C4MA 4KNWA 1HRKA 1UOQA 1E8DA 3FPBA 3I0ZA 1VI6A 4HBZA 1T0IA 5CB6A 4DMKA 5DYWA 1UAAA 3NVMB 5J59A 5D3ZA 2J4DA 2JFZA 3HN7A 2CC2A 1EB8A 3ZVMA 2GAJA 1N0VC 3HBJA 3KTOA 5L3SB 3CEJA 2D5LA 2KYRA 5DI3B 3TX6A 2P2CA 1SC1A 5TARA 1HTTA 2O5RA 3QQPA 4FZ5A 2FZGA 4KE9A 3HDTA 4EMUA 5IM5A 2Q5EA 3ZNPA 2WW8A 3WLHA 2Z04A 3GG9A 2CXUA 5FPQA 1X1AA 1ZG3A 2OV3A 3MT8A 2UZ1B 4OHCA 4PRLA 1NASA 2K2QB 2YL2A 3DL2A 3ELDA 4GOMD 4UZFA 2C04A 3SVZA 4D8XA 1NF3A 1EM8B 2WSIA 3HRIA 2QBYA 3GLUA 3ROEA 3VOTA 3DTVD 4HX9A 5H83A 4EG8A 1YBHA 4D26A 3SSNA 3O9MA 4W7SA 2VYND 4ACAA 2APJA 1E58A 3P71T 1JWLA 3IIIA 3MFYA 4AS1A 4CF6A 1M8KA 1CUSA 2WIGA 2M98A 1RI5A 1K4MA 2G5GX 2H2WA 2OK8A 1N2HA 1R8QA 3KEOA 3N8NA 3JQ9C 5HCIA 4UBLA 3RYFB 4A0HA 4QNNA 2Z56A 1X80B 1G9TA 1T34A 1RLUA 2IL1A 5E9QA 5EHXA 2WM8A 3TIFA 5C7OO 7REQB 3ZD7A 4FLMA 3KU1A 1FY2A 4QQFA 3P9ZA 3VFDA 3X2SA 4B82A 4LX8A 1O3YA 2A5DA 4INJA 1Y63A 2QAGB 5BWOA 3RK1A 2Q6LA 1JB9A 4OH7A 3N58A 2L19A 3ZHQA 5HZMA 3AFIA 5JRDS 1P1CA 3MWJA 3DE2X 2SECE 2R8PA 2CSUA 2CUTA 1CR1A 2ZROA 3SYMA 2Y1LA 2QNRA 3ZGLA 3R2JA 4Q93A 5DHAA 4GPIB 1AB6A 1OT5A 1X7XB 3ROFA 3RVPA 4JI2B 1T8UA 3V34A 1XTSA 4IXWA 1G21E 2FDCA 1XCMA 3CLKA 1NMEA 5K3AA 4P80A 4NICA 2I6TA 1V9CA 1VB5A 2P0EA 2ZEJA 3MQ4A 2ZUFA 1GZ5A 4L9RA 5EE3A 2HXSA 5ENVA 1SWWA 2RCYA 1LWNA 1BH6A 1HNNA 1WY7A 2QX8A 3GFOA 4UDXX 5KIAA 4I50A 1QHNA 2HBZA 3GUHA 4YT5A 3UAOA 4LBVA 3WLOA 1G8AA 2A58A 2PZFA 3V4VB 2K5UA 4RTKA 3VAAA 3KB2A 2PUHA 1RXWA 3USZA 3HYNA 1C80A 4C7MA 3REQA 2HSGA 4LAFA 4LF4B 1GTG1 4KFTA 1EGQA 3BTSA 2FEPA 2QAGA 1F6WA 2W2KA 4Y1GA 1QRDA 4MYHA 4WZ6A 5T4EA 3NBYC 1YZYA 1EKXA 2E4WA 3D2LA 1GN9A 3K71B 1XDZA 1CQZA 3OKPA 1K8QA 1MKYA 3HBLA 4ZDWA 4UCXA 4CKZA 2DG2A 4HB0A 4L50A 3RSHA 2YY6A 1PLLA 5AI4A 2I29A 4MKIA 1T10A 1RPZA 1Y8RA 4D80A 2X42A 3KOZA 4GXRA 1WOMA 2QG4A 4BNTA 2ECPA 1DADA 3C2QA 3FWKA 4U4AA 1WKVA 1UZLA 3H84A 2RGNA 4Y3UA 5B37A 3IAUA 4I3GA 1MZVA 3EXHB 1E20A 4LWQA 5KYUB 1BXRB 1N7HA 3C7TA 2JLAA 2WU0A 2Q5OA 2WSMA 4PLYA 1GQSA 1JDBB 2JPDA 3GLGE 1Z12A 4HMOA 3UTDA 5KNCA 1GXSB 3RSZA 3HY6A 1KSGA 3VV3A 5AJZA 1RTKA 3FPCA 1WSAA 2N42A 4D4GA 5AXCA 4OKSA 2I4MA 2YCLA 1PYGA 2C7GA 3MS2A 3KEQA 4A26A 1UP4A 2B7LA 4LVUA 1A3CA 4RX1A 3IMEA 3AUAA 1IDN1 2YXPX 2ZJ7A 3JZFA 5ECWA 2E4ZA 2ODTX 1M2OA 2REQA 3P2EA 1MOZA 3U1BA 5BWMA 2UKDA 4IM7A 3IUSA 1MO2A 5JMOA 2DLCX 1BGWA 2OXFA 4OMCA 1YKSA 4JXKA 3UATA 1LNSA 2FMHA 2XBUA 1WQ1R 4JP5A 3RWOA 4ZCIA 4KQ1A 1DPFA 1ZD3A 4NG5A 4RFVA 4DM4A 3TWOA 5A5EA 1XTQA 1RHRA 5AKIA 5AI6A 1I5OA 2HU7A 4JKOA 3DLBA 5KSPA 4JLUA 2CLEB 1XV5A 4GM0A 1ZD8A 1BXRA 1M2WA 2ZBGA 3IXQA 3Q40A 3OFVA 2CZGA 5TV2A 2C58A 5G40A 3V00A 3PUKA 2WZDA 4PV7A 3WZ2A 1BTOA 2QN7A 1GRQA 4GX5A 2IYTA 4GOXA 3OQJA 1CY6A 2FW0A 1RJGA 3E18A 2FWRA 1W35A 3OZSA 4UBJA 5JVDB 3Q4GA 4WKPA 3T1TA 4JU9A 5K3FB 1UFVA 4TKZA 2FI1A 3A9CA 2YFHA 1L3IA 1O9HA 1U0FA 2X3UA 3T15A 3Q10A 3ZJ4A 2IH4A 1JU9A 1K5DA 4BE4A 2IS4A 1L4EA 2YINC 3RV4A 5DNUA 2WJPA 3FPEA 4D0SA 1EWKA 2P3QA 4Q1DA 3FG9A 3H9BA 4NYIQ 1G291 3C3BA 4XX0B 2ZWVA 2PNJA 1IIRA 1LRJA 1K63A 1ZKMA 2AFRA 2CYAA 2FK7A 2P4SA 2N9UA 4I1VA 4S1NA 1YCGA 3DEZA 1JH8A 4J9UE 2VK2A 5IJ0B