3HFRA

Crystal structure of glutamate racemase from listeria monocytogenes
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
266
structure length
266
Chain Sequence
b'AMKQAIGFIDSGVGGLTVVREVLKQLPHEQVYYLGDTARCPYGPRDKEEVAKFTWEMTNFLVDRGIKMLVIACNTATAAALYDIREKLDIPVIGVIQPGSRAALKATRNNKIGVLGTLGTVESMAYPTALKGLNRRVEVDSLACPKFVSVVESGEYKSAIAKKVVAESLLPLKSTKIDTVILGCTHYPLLKPIIENFMGDGVAVINSGEETASEVSALLDYHNLLDATDEEIEHRFFTTGSTQIFKDIAKDWLNMPDMTVEHIKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate racemase
molecule tags Isomerase
source organism Listeria monocytogenes
publication title Crystal structure of glutamate racemase from Listeria monocytogenes
rcsb
total genus 91
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hfrA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hfrA01
5ELLA 2DWUA 5EVCA 2EQ5A 2JFQA 1B74A 2W4IA 2JFXA 3UHOA 3OUTA 4B1FA 5HRCA 1IU9A 2JFOA 2JFVA 2VVTA 5ELMA 5HRAA 2JFPA 1ZUWA 2JFNA 2OHGA 5HJ7A 3S7ZA 2DX7A 2JFYA 3HFRA 3OJCA 2JFZA 3UHPA 1JFLA 3UHFA 1B73A 2ZSKA 2GZMA 3S81A 2DGDA 2OHVA 2JFWA 3ISTA 2JFUA 5IJWA 5HQTA 3ISVA 2OHOA
chains in the Genus database with same CATH superfamily
3P9CA 4OCZA 4J2HA 3KV1A 2BKUA 2Q2WA 1LVHA 1YVEI 2I29A 3DAOA 3DKIA 3T94A 5BUSA 4PRLA 3A0RB 2A0YA 1X15A 2GI4A 1C9NA 1SQ6A 4BTLA 4J0DA 3DMHA 5M29A 5P21A 1KO8A 1I9CA 2OR3A 3LUKA 2W8BA 3NYRA 3A70A 4MEBA 4P5DA 2ZRIA 3NHUA 1V96A 5GJWC 4BNJA 5A5DA 3D8TA 2P7IA 2OENG 1SUAA 2A9VA 2P9GA 1XK6A 1MZVA 1V8DA 5CHYA 4IDFA 5DULA 3KHTA 4A03A 4IIJF 1KP3A 1CP3A 2FWRA 1GA6A 3GCZA 4RK5A 5IH7A 3KXIA 3HUTA 5J5CA 4PWZA 2J3KA 4EHAA 4JOQA 1Y82A 3AOEC 5BORA 1CY6A 2V4UA 3UKJA 5CAEB 5CA0F 3MFQA 3STVA 1L5NA 5BWNA 4E6PA 2JFQA 3JTMA 4XGIA 4UULA 1N75A 3GUUA 1OLSB 1GZVA 3N0XA 4HDMB 3EXIA 3A8TA 2JF0A 5HUHA 4UNIA 3NW9A 3EAGA 4TKLA 3ZDXB 5BMOA 3TUIC 3OTQA 1RJEA 4KVZA 2R96A 1FOEB 2ZAOA 5IJ9B 1FYVA 2ODEA 2PL9A 4UQOA 4YUVA 1W2HA 4KBGA 4ND3A 4YK7A 3PX7A 4CQNA 5CX4A 2G77B 3FNIA 4RTMA 1K8RA 4JLUA 3VPXA 2C2KA 3LW8A 5KHOC 2VK4A 3UJ7A 3P0EA 1KQ3A 2C3UA 3FVWA 2ZWOA 1ULAA 3C98A 2W7TA 3WG9A 4RPIA 2VHTA 3KFXA 4RFVA 2RB4A 4FI3C 3EIQA 1UQUA 4MTCA 1PZXA 4KCGA 4CMIB 4CM3A 3N2GB 1T24A 3B6EA 1T9ZA 1Y8RB 2OZPA 4LECA 5BSUA 1CF2O 3ZNPA 3GLIE 2JHGA 3GLSA 1PD1A 1ZJZA 4AF6A 4YMVA 3K53A 1JEYB 2SNIE 2XA2A 4IHAA 4CU2A 2OCGA 1UP4A 2C9CA 4WZBA 5L3ZA 2EJVA 3Q5EA 5AK3A 3UJCA 1XWFA 4YVFA 2A5YB 4Y2YA 5D1HA 1NMEA 2OORC 3QNUA 1RPJA 1H1LB 2VG8A 3R23A 4KH0A 3S70A 3OZXA 121PA 1ESNA 5BWBA 5CT4A 2AMYA 2QIOA 3K2BA 1UBLS 3PGKA 5BN3A 3L8CA 1II8B 1EINA 5F4ZA 4LOLA 4AY3A 1OVGA 3W9YA 2ZIZA 3PLRA 3WQSB 3AJAA 4XQ0A 2K5UA 3MGAA 4KIUA 4BO4A 2B1JA 1LBQA 2DOKA 3FPEA 4QBIA 9LDTA 4CQLB 3TQOA 3LC0A 2VDNB 1DEOA 4Y30A 4ZP1A 5KCZA 4L0MA 2C2MA 2PVPA 1NZFA 3H3FA 4U00A 3WNBA 1E3LA 1Z8HA 4OQXA 1TIKA 4TKVB 2YWGA 3ZQJA 4D0LB 3QSYA 2H4JA 3UT6A 2J59A 3WIUA 5TVKA 2HUNA 1KAMA 2GESA 4N0PA 4MV7A 5K3EA 5G02A 5A6SA 3R40A 2ETXA 1XQ9A 4PS0A 4RW0A 4Q1VA 4M99A 3SM3A 4Z7OB 4RPKA 3FCOA 1F4LA 1QAOA 4KO2S 3LDAA 2B37A 1P77A 3NHYA 1G20A 2H2FA 4TXHA 4HDNB 1TNDA 2DKNA 4W5RA 2QRQA 4ZVLA 4LXGA 2I7VA 2ZJFA 3N5CA 4KR0A 3TZEA 2QROA 2CVPA 3IAHA 2VDMB 1P1FA 2GCOB 4PTZA 4R83A 5DWVA 4J9VA 1BKSB 3TXXA 4J0HA 4WN9B 1ZSYA 3V7UA 3NBAA 4B4VA 3TQFA 2V4MA 2NZWA 2OCXA 4L08A 4RUKA 5DNEA 2VBCA 4U63A 2HU5A 3EXHB 4WWHA 3T4PA 1KVRA 2C7RA 2QPOA 5KJCA 3T4EA 3CISA 2ODWA 4W9NA 2CGEA 4ATNA 2G5TA 4BX3A 3ML1A 4KV9A 1LBEA 2ODTX 5JUWA 1FSFA 2PZBA 5H81A 3AESA 1VP3A 2CUNA 2XF2A 3E2MA 1PJ3A 3KUKA 3PE3A 4DIDA 3STYA 1WIWA 2VPWA 4FYVA 2VATA 3LIIA 1Z3CA 1DXOA 4ZAZA 4QTUB 3X2EA 1GSHA 5A5GA 3ZX4A 3AUJB 4M22A 1ISPA 2OD2A 5KVSA 1XCMA 3CX6A 1KR2A 3F7TA 4G5XA 4RTOA 2VPZA 4B3FX 2FW7A 3E1GA 5ALUA 4RK7A 3ZCQA 2ATIA 2EFYA 4TTAA 5TPZA 3NI2A 1IN1A 4Z7NB 1FU4A 2PO7A 3COYA 4F0JA 1BG6A 2I67A 4BMOB 1NI4A 1O94C 1VE1A 2ISCA 3RKSA 1ODKA 3HQ4O 1E63A 1KF0A 1TO1E 2X5JO 4AF7A 4GU5A 1N8NA 2QZ9A 5F52A 2ZT6A 5TQVA 1SVKA 2AYXA 2CCKA 3BH6A 1NA5A 3GZNA 2RH9B 5KREA 4IIGA 4MJ3A 5HILA 2ZYUX 5CJJA 2ZBVA 1M2GA 1IUOA 5E9QA 4LJLA 4WXHA 1KARA 4U6NA 3ZBPA 4NF2A 1R27A 1KYQA 5JC1A 3DEAA 4M86A 1POXA 1TYAE 3Q8LA 2Z1MA 4HEJA 4XM1A 2Q5FA 4WY2A 2XB2A 4S1WA 5SY9A 1XCJA 3CNNA 1Y98A 3DZKA 4YXWD 1VG9B 1ZM3A 2XWPA 4V3CA 1YDWA 5IEJA 4IH1A 3RAJA 3HSKA 4G36A 1E3QA 1LDGA 2BMVA 3KJFA 4BKUA 4XVUA 2O7NA 2DEUA 4YBZA 4YT4A 4Y2GA 3EEYA 3NV7A 4MRVA 4ZTUB 5BSKA 1Q0ZA 1XTUA 1Z18A 2GQ0A 1LCIA 3OCJA 3OP1A 4F9EA 1NUPA 3T7KA 4CG2A 3DEFA 4C7OB 2O7QA 1XZMA 4HGNA 4MHTA 1W2WB 4Y0AA 1OT5A 1T2DA 3C70A 3LC1O 1Q74A 2JGFA 4OFXA 5DZSA 2GHQA 4IJ5A 3FFTA 3U48A 2EEZA 3F8TA 5IHXA 4LQ4A 1C30A 1S2GA 3KALA 2NO7A 4OAPA 2Z4TA 4FS8A 1OE0A 4C08A 4EDFA 2GFIA 5COQA 2Y71A 2DU8A 4B6FA 1THZA 2ZB4A 5TIIA 4BPBA 2Y4NA 3H16A 3AP2A 2SECE 3WBKA 1FB5A 4Z54A 3QPUA 4CXMA 1HR0B 4U5XA 4LZPA 3H3JA 4LNUA 4P08A 4Q9KA 5NLLA 3IMGA 4MVXA 3S55A 4F2HA 3MXOA 3DTVD 1M2OB 3NHKA 2ZYGA 6ADHA 5EHGA 1GPWB 3I4LA 2O3UA 1HYBA 2I6QA 1RS0A 2PHZA 3K9LA 3EIHA 3OAAD 5A7FA 1T4CA 1B7GO 4IDAA 5EN4A 1Z8NA 3HR4A 1HFJA 4L3VA 4LHWA 4D0SA 5EG5A 3PNVA 5TQ2A 5LJLA 3T3NA 4GSYA 1RFGE 2QZJA 5BRNA 2WIAA 4MCAA 1S1CA 5LBIA 4B4WA 3LBFA 3KT3A 4ETMA 4B9EA 2ZXUA 3F3MA 4J16A 3PC2A 5KKAA 1BMFA 4EAAA 4TRMA 1H2YA 4FWBA 3UAZA 3HJAA 4A0HA 1CE8B 2JJ2A 3LECA 3BXEA 5IJWA 3T5AA 4DRZA 2BH9A 2C78A 1XJQA 2GOYA 2TYSB 2WJHA 2K2WA 3CJTA 3I2GA 4HRYA 5HJ2A 5TDHA 1I24A 1XDUA 3P2EA 1IHPA 1RWWA 3DE0X 4UUMA 1A27A 1LNSA 4HTAA 2VDWB 4G97A 3QU7A 4CKBA 4H9GA 2JEYA 4BNLA 4YRGA 1S6YA 4KVFA 5I4IA 1YI1A 1FYEA 1DELA 2QKYA 3O7WA 4WKBA 2WI8A 3HDGA 4WZBB 5JQWA 5BYBA 1XVIA 4ZI7B 4R1PA 4BTVA 2J48A 3MMPA 4MYCA 1L3CA 1MBZA 5B4UA 1BGWA 2H2GA 2XB9A 5FFFA 2ZCVA 3LJKA 1V8PA 2Q8NA 4RF5A 2TS1A 1XKQA 1ZEMA 3C1UA 4MKZA 4RTKA 2R60A 3DMRA 4QPJC 4C30A 3TF5A 1PNRA 3Q10A 4LHSA 5AVKA 3BL8A 4EWLA 1A4IA 3UW3A 1NR5A 3R76A 5KYYB 3K3PA 4K9OA 3O8BA 1DOAA 1S7GA 1FFXA 3AV3A 3EGWA 2R00A 1E99A 3E27A 4G9GA 4NJOA 2I3GA 1CNMA 3DOCA 3ZKWB 1H0SA 4LQCA 1JLMA 4EPRA 5AQEA 4YV2A 5LD2B 1G38A 3KB1A 1IVNA 2CEKA 3DLCA 3I23A 3AJ8A 3COWA 2FCAA 2ZR0A 3M1AA 2YINC 3N7TA 1HYHA 1EDBA 1PG0A 3QPBA 3ZKWA 3ZJTA 2XADA 2HRRA 3B7PA 3C3DA 1RLJA 3F4KA 3PENA 3V8VA 3WHPA 3FAKA 1BEUB 1CUCA 4O8CA 4ZV4A 5KTNA 3UUWA 4DY4A 1GUFA 1Y9EA 1CUYA 3OM9A 2FZEA 4Y6PA 3N8GA 1KAOA 2W4IA 3MWDA 4GFDA 2Y27A 3LQFA 1JQDA 2EFJA 1DUVG 4CFSA 1BC5A 5KOJA 1VLZA 2AWNA 3C6KA 1PZGA 3GVCA 1BMFD 2VNAA 3NTVA 2EIHA 2XDQB 1UDAA 5IWCA 2ZSBA 4AKGA 5SYMA 1QC5B 1RU3A 4GPZA 2XCIA 2WWRA 2PUEA 4HFMA 2WMNB 3IB6A 3KP1A 1VJTA 4FGWA 4HDKB 5ETJA 3D54D 1NN0A 1P33A 3PUHA 3RUHA 4F5EA 4L6AA 2RK4A 4F1WA 3INYA 1QSGA 3DE7X 1F0PA 5E6RB 4OOFA 1BKYA 3H0KA 1YQGA 3VR2D 2Z3WA 5BSGA 1RWPA 3LWDA 2ET6A 3F7NA 4URHA 1E1RA 1TYZA 4BNTA 5CJPA 4HN9A 2UXBB 3PNLA 1L0BA 2PFSA 5DHFA 1GSOA 1LC0A 1C9MA 3CLRC 3M34A 2DE0X 5FIUA 1FQOA 4BVJA 3PE6A 4F3TA 1Q0TA 1D0VA 3C48A 3PUZA 4G63A 5DGXA 1GG8A 1HUQA 1ILEA 5L8VA 5AXCA 5LZ8A 1A5ZA 2G6TA 2V7QD 1Y9DA 4Q19A 4Q93A 1XDDA 2FZWA 2VSOA 3P4YA 4MW0A 4I1OA 3BFVA 2ST1A 3AUXA 3GH3A 4QHYA 1LBIA 1KPGA 2ZW9A 3EFEA 4ZT5A 2ZANA 4MP6A 1J23A 5J2TF 2XUQA 3N86A 5AR1A 5F5XA 4OH1A 4ZYTA 3OT1A 4W5NA 4QBFA 2C7QA 4R68A 1EUCB 2JIQA 3ECAA 2ZPUA 5TEVA 1SXPA 1SMKA 2IHVA 3NNNA 1O1YA 3AKYA 1JLSA 2OLJA 3E18A 4PZCA 1JMYA 4JBYA 5J4KA 1XF1A 1RC1A 5DX8A 2B4TO 2UYHA 4KXLA 3PEVA 1MIOB 1ENZA 5JYBA 1N9ZA 4IO1A 4Q1EA 4P0PB 5HF5A 2Q9UA 5BWOA 2V9PA 4HNRA 1ZGBA 4QXMA 1J8QA 3I6IA 3KT6A 3R7WA 4K46A 4ZAFA 3A3PA 5ER6A 2ZWMA 2FZCA 3Q0IA 3A1SA 4K0RA 4NSNA 4L73A 1P4GA 2CNLA 3W8RA 4UW9A 3NDJA 4IGIA 3UXYA 3VH4A 3RAPR 1PHRA 4TWRA 4ZC8A 4AO6A 2XCRB 1T0IA 3H4TA 3OLQA 4NH0A 2ZITA 4AKEA 2DLDA 2M1ZA 1W0KD 3ONNA 3R7NA 1TTQB 4OHCA 4G0OA 2AQ8A 1N7HA 1SXJD 1KQNA 5IZ4A 3LQ2A 3CNEA 2VC2B 1FJ2A 2QY6A 3F3SA 4MNTA 1MVLA 3T5BA 2VHQA 2HNAA 1JKJA 1U1EA 4KQJA 2PA0A 2CNNA 3L1UA 2EIXA 1CUEA 1AOXA 4NH4A 1JU4A 5A2QA 4LOJA 2IZOA 4TS1A 4YHHB 2WAYA 2YHIA 4MW4A 4U5QA 3LUFA 5DTQA 1Y1LA 3WO0A 2PEZA 2CJWB 1L5QA 1XZLA 3FWHA 3P9QA 4MICA 4PFQA 2A5LA 1GPDG 1QDLB 2BMJA 2QA5A 4OK6A 1VYTA 4PFJA 1H42A 2PRSA 3NVDA 4UJ5A 3V1MA 1YA6A 4ZA2A 3RSHA 2R48A 3GAMA 2O8EB 1Y5LA 4L7QA 1UBOS 2D5LA 1V9LA 3LP5A 1D8TA 1LRKA 2IVZA 3MJFA 4D8XA 4QYIB 4S1OA 5DHAA 1GKKA 4JHXA 3EXG1 1WXDA 1Y3DE 3RTCA 3ZCRA 4KMSA 3ZU5A 2Z2JA 5IANA 1MAVA 3EVCA 3HBLA 3RYIB 5JNWA 1Q50A 1H6DA 1K6EA 5JDIA 1I4EB 1YE5A 4TTVA 1C2TA 2EBUA 4C4TA 1HA3A 4NAVA 1KERA 1V25A 2EG9A 3E3LA 2NU7B 2NO5A 4O59O 2W6PA 1MC4A 3GRYA 1L5OA 2ZQYA 2JFFA 3WOHA 1KK0A 1LY1A 2DWPA 2GF9A 3M4NA 1K7FB 1PJRA 2H06A 2ICAA 4OL0A 3V5NA 3V7NA 1A9ZA 1V7PC 2EGGA 1WUTA 2JL1A 2RBKA 2UVQA 4P80A 3W2FA 2PGAA 3TK1A 3G68A 1V7CA 4PM4A 1EWQA 4BLTA 2IU4A 2VZ0A 1QE3A 2ZI4A 4FLEA 4UAUA 3ND9A 4BVBA 2PJZA 3II6X 3F5MA 1CRWG 1DU4A 1JAXA 4J4TA 1T5LA 1X7YB 3ITNA 3MGGA 4WAUA 3VR5H 2H9IA 2BDTA 1IXKA 1UOEA 1O95A 3ZE6A 5CVVA 1IJFA 5K8UA 3MPOA 3AB3A 4FGZA 4RA6B 1JAIA 5G4LA 3QKTA 4ZV9A 4DIFA 1AF4A 1MOZA 4N7JA 1LWOA 2O2CA 3P2YA 3EIUA 3I28A 4JXKA 2YY7A 1SKYE 1WD7A 2P4EA 4LXIA 1L5VA 3QJYA 1T8SA 2PPVA 3HRIA 1LWNA 3BD9A 5A9SA 4ZMRA 4HZUB 2VK2A 4RMIA 3EISA 5F21A 1Z28A 5TMDA 3RTAA 5C37A 1K6MA 4OJTA 4XRRA 5LQSA 4PGMA 4KYTA 3PXBA 4R69A 2QZPA 1NXSA 2XBMA 5H9WA 4J0CA 5JVDB 4YO8A 2FMTA 5GGXA 3TH5A 4DSUA 2O2YA 3I3OA 4L4ZA 4F71A 2OYRA 3X1YA 3CLUD 2QL9A 3B52X 4GPEA 1UADA 3B5JA 2XCSB 3GHYA 2V6GA 2BFEA 4ENRA 4WEOA 1ZM7A 2ZRDA 5EMJA 1AA6A 3IEMA 1YASA 5DCUA 2BY4A 1NJ8A 2ZBDA 3B8HA 3DD1A 5JI3E 2XXAB 1W5EA 5CPBA 1G7SA 3PSHA 3QXHA 1CLUA 3QOWA 1JQKA 4I4TB 1BCRA 3QOYA 2Q46A 2RC6A 5CA0A 4TLAA 1LPOA 4L2IB 4QHSA 1NBME 2PH7A 3UJNA 1UR5A 2HDOA 3QOFA 4HXFB 3TW0A 1Z4KA 3PTLA 2B7BA 2OAEA 4GL4A 1NXQA 3WHLA 4R1QA 2C4MA 1VDZA 3DOFA 3M7IA 4TVKA 1L5MA 1OBOA 4DZZA 5BQPA 4Q4LA 1WEKA 2I4NA 4GMXA 1VKRA 2R3SA 1VL5A 4X84A 2BD0A 2IJGX 1QWSA 4KN8A 4M2LA 4MDHA 4XUCA 2QAJA 1YK0A 3CT6A 3NFRA 4OGWA 3ZHQA 3N2ZB 3G2QA 3GNLA 3M1YA 3ND6A 4DV5B 3L0CA 3VNVA 3W6UA 1OHHA 1NI4B 1V7ZA 2WJ6A 2XYGA 2ZDQA 1NLUA 4ALKA 1NBOA 5FXMA 1ZJ6A 2JBHA 2FLVA 1E3WA 2ID9A 2IIPA 4KZKA 5REQA 4D2IA 3ZEIA 1IWOA 1O0CA 2D54A 3C16C 1JXQA 3DLPX 2O20A 2UZAA 3A1WA 3KEMA 1R8SA 3PXDA 5TGDA 4CM9A 2IWRA 1UANA 5AW5A 4JQCA 1UXOA 4FYIA 3HC7A 3G59A 2ZVDA 3WLHA 1WO8A 2ZR7A 3AL0C 1YR6A 2J4CA 1GFZA 2PANA 5F1YA 4BO0A 3T1HB 5ICFA 1F1JA 1H66A 1WHTA 4PQEA 4ETWA 1H23A 3LVRE 2JJQA 1BS9A 3GN1A 3OPYI 1CUIA 1KJJA 1THTA 4HUQA 4KQ6A 3JAWA 5I5GA 4E70A 1BQEA 2AQHA 3EARA 4N0DA 4TTJA 1CJBA 4XDGA 4LZLA 3H7IA 4PY2A 1SC3A 4AP9A 5IKPA 3WNZA 3E5RA 4LRSB 2X7XA 3PQ3A 4NE7A 1NVBA 3GLTA 2CHEA 5L6MB 2G5CA 5KVAA 1CR4A 4RGVA 2V45A 3GP3A 3G6WA 1BDIA 4BNNA 3HA2A 3I52A 4IF4A 2PYDA 2JAUA 2E5LB 1A9YA 5TQ0A 4LC9A 1C3OB 1NFFA 3H5OA 5GOZA 3KPYA 3R7AA 3ZU3A 2C9BA 1S2OA 4BRUA 5IC6A 3U4HA 1Z17A 4D9GA 4UAJA 2XOKA 2C59A 1YOVA 3UJHA 4DLXA 1NT4A 2GETA 3DXYA 3MNFA 3SBOA 4YHBA 2EDCA 2Q0HA 2Y93A 3LT5A 4IQ0A 4NICA 4TV9B 3Q4GA 4Y2UA 1Z6XA 1K75A 2JATA 3JASB 2HA2A 1XN4A 1ZR4A 1DDGA 1UIMA 1E77A 4MQEA 2Z98A 1NVMB 3C1TA 4EG8A 2QN2A 5B64A 1IEQA 2J9XB 2H08A 4V02A 3R7WB 5JRDS 2I2WA 5BV1A 1G3QA 3EQ9A 4FKZA 5KOIA 2O8FA 2OCAA 1Z0SA 2AEJA 2ZREA 1GTRA 1EB9A 3QLUA 2JGKA 4NENA 3WHIA 3AI7A 2R25B 3LZ6A 4IXNA 5E2AA 5A5EA 3IESA 2JD1A 5LA6A 3DQZA 3D2AA 4EB8A 3GMSA 5EE5B 3TKYA 1GVNB 2PD6A 2ZROA 3BIJA 1DCKA 3N8DA 4M1OA 1G3IA 2FR0A 2ZIXA 3WYBA 1IOZA 1KEVA 1R4MA 1P4AA 1VL8A 3CW8X 1HEUA 3H18A 4O1HA 1JG3A 4DS3A 4B4OA 4RKFA 3GO4A 3UENA 3NBMA 4YV7A 2RARA 4J3JA 1FUEA 2GN2A 3OJEA 1Z4MA 1EDEA 1NFQA 4ZKEA 3E35A 3CZQA 3EA4A 3WQBA 4OGKA 1G0OA 2RSLA 3D9QX 3IQEA 3LGXA 4G26A 5EINA 3OIYA 2G7MC 5KC9A 3BREA 3VHQA 4P5PA 2QS9A 3ILYA 4FEGA 2XGSA 3K70B 4AMVA 2YCBA 3UGQA 4DFDA 5I9SA 5CB4F 1YZYA 4DCVA 4HAIA 4ZDKA 2VP5A 1TM4E 3PLNA 1YHNA 5H16A 3AF6A 1KZGB 5JARA 4HMOA 4IY1A 3P9PA 4PCLA 3TIXB 4Z9YA 3ROZA 3SI7A 4O4HB 4EI9A 4F1JA 1YJBA 1QV9A 1SCBA 2QMQA 1F5SA 3OOEA 2WU8A 4N7RA 4KO1S 4Y1GA 2BCJQ 1LLUA 5KYWB 3BX1A 4WKNA 5K2MA 3O2JA 1G8MA 4OBBA 4X20A 4J1TC 4YRBA 1JU9A 1KZYC 1Q16A 1ZUWA 5C18A 1IHXA 3H2YA 3SEQA 2ANCA 3O4GA 2JFYA 3OURA 4UUQA 5B1DA 3ZZNA 3O73A 3ZWQA 3NCTA 4FT2A 1YTLA 5COBA 4B79A 2H59A 4BPRA 3OQHA 3QTTA 4ZT6A 4EMUA 3EW7A 4YRMA 4WEQA 3B5IA 3OSZA 4OB7A 1UINA 1Q14A 2WB4A 3OP4A 4YUWA 3VBCA 1UDWA 2Y1WA 2VF8A 3AI3A 3Q3JB 4QUDA 1DUIA 1P91A 3LWZA 2QE6A 1WQ3A 2KHZA 721PA 4F92B 1P0CA 1PZNA 5K0BA 3UQYS 2ADMA 2C98A 1JF8A 2D59A 3DCJA 1W36B 5SZJA 1KQGA 5FUWA 1O97C 3G6KA 3O90A 5ELMA 2QMZA 1UPXA 1SFRA 3AVQA 4UBIA 5CT8A 3DVRX 1OBVA 4RZUA 2PD3A 1QR2A 1N4DA 2AN3A 3U0BA 2EKLA 2GT1A 3EDYA 1EXNA 4IQ8A 1UXKA 4EGSA 4POOA 1XDSA 1A71A 2NVBA 1TKAA 1L5KA 2C3MA 2HXGA 2PUDA 3JQBC 3KUDA 1HGXA 1U0NA 4DRYA 1SU8A 1QFSA 4MHSA 1YFJA 1UEIA 4L8YA 1LLDA 2UUCB 5ALQA 3KZMA 5AVUA 4LJSA 3LPLA 4URFA 3N8KA 5ECWA 3KJXA 4LPSA 4AD8A 3F98A 2RHBA 3O38A 1PJAA 1XBTA 3BWYA 5AIAA 1QGYA 4KQ1A 5AQ1A 1DKMA 3QXGA 2DAPA 2PKEA 3V46A 2CDCA 1Y8ZA 5DIZA 4QTYA 2FAXA 3D5QA 1UT5A 3GQVA 3HZRA 5DBIA 3B2NA 1PEYA 5K0ZA 2PMDA 2RG7A 1EE1A 4I46A 5BXYA 5E6SB 3H65A 1SPBS 1LJ8A 2OFOA 5TVGA 4EP1A 1N2JA 1EFVA 5J63A 1QCDA 2DF8A 1UMBB 4TSKA 4B8ZA 4CLDA 2VPTA 4XI9A 2WVHA 5JNVA 4DJJA 3GEHA 3KSZO 3OLZA 1WV1A 4DYVA 2ACEA 1L9KA 2CYAA 4QDUA 4Y2RA 3MTJA 1BTOA 4P8RA 2V6FA 3TLEA 2ZK7A 1E6EA 2OV2A 4RZ3A 2OOKA 1U0EA 3OZSA 3CEPB 4LOAA 2Q3HA 3TOSA 5KNBD 2IPXA 2DP4E 2ORED 3GGJA 3IC5A 3S1AB 2AG0A 3SBXA 1L7OA 1YDGA 3I64A 3C45A 4MWBA 4ND8B 4RQUA 3TFQA 3EOAI 4JZYA 4L5IA 3AIOA 4F4CA 1VA4A 1YA4A 5DHQA 3RGGA 4BUCA 3N0VA 2O54A 2IOQA 1AN9A 1VL2A 3A25A 4DJDC 3AL2A 3DFFA 4PAQA 4CDRA 4DJ5X 3H0EA 3T5DA 4UVIA 2QM7A 1QQ7A 3KD2A 4NC9A 5KU1A 1RYFA 3L77A 4QUBA 3M3DA 5E38A 6LDHA 2FEXA 2PFGA 4V3BA 1U2TA 1ZMOA 2DZDA 4OIMA 2XVXA 2QX6A 4UQPA 1KVQA 1B1CA 1R6BX 3LPDA 1AURA 3C5EA 3PHJA 3VRHA 4IVNA 4BNUA 3AOGA 3HYRA 2ZEJA 1F9AA 1S89A 1XNGA 1O54A 3AIKA 3K0CC 1C3LA 4ZO9A 4KDEA 3RIHA 1C0KA 1A0OA 5DWDA 1A9RA 3AI2A 2FF5A 2J9YB 2XE7A 1ABBA 4XGRA 3UV6A 2QPLA 3VR4A 4CLXA 3DMDA 5BN4A 5DO9A 1X14A 5AESA 4DLNA 1EUDA 1GN8A 3S5JA 3NKVA 1VYVA 2X22A 3O74A 3TUZC 4F12A 3OAAA 5EOVA 3NC4A 4KNVA 2I7CA 3IUNA 3R5JA 3FOCA 2FFJA 3DTVA 3NBXX 4KGZA 8GPBA 1RPTA 4L5YA 2OWEA 2KYRA 1C4WA 1FU7A 4N40A 2K7ZA 2XLCA 4YS6A 3WLJA 1NC1A 4ENVA 1YULA 3KQTA 2XB6A 3U26A 2HI0A 1EX1A 1KNXA 3D7SA 4PX2A 3ZGLA 1MW9X 1Y0BA 2JGDA 4I1YA 4MV4A 1NNLA 2B4YA 3MWKA 4GI2A 2FPSA 5BNZA 5JCPA 3R6WA 5BT9A 1K2VN 1OHHD 3THRA 1JHOA 2QD1A 3DBRB 1OKKD 3DMNA 3DPUA 2FNAA 4QEZA 1JIIA 4QOEA 2P2NA 5CNMA 2DFVA 2Z9CA 3HZZA 2BELA 3IKTA 4ZEOA 2G9NA 1TT5B 4UM9B 5TGTA 2AFIE 5AVOA 4HB4A 5EESA 4B2LA 5DRYA 1M1YB 3IUSA 5C0OE 4EENA 3WIOA 2CJYA 3IB3A 5JSQA 1BN6A 1ZQ1A 4RVUA 3ANNA 1YCHA 5JYDA 1O6FA 1XCLA 4IV8A 3X1JA 3CVJA 1WKBA 1FXUA 3VX3A 1T35A 2B4RO 1TFRA 1NAHA 3A1CA 2FFAA 4KQHA 4OPMA 3SZ3A 1CC1S 3DT9A 3TLBA 4L57A 1OZAA 2Z6VA 1GCGA 1YRAA 3GZTB 3U6BA 1AGYA 4IOLA 2Q3CA 3EPHA 1QNLA 1OASA 3SZUA 4LNUB 4UBKA 1TYEB 3MGBA 4QQ8A 1A3CA 4MV9A 4BB6A 1PVVA 4AI6A 5JAPA 4PLGA 5GQSA 3RKRA 3HP7A 2N46A 3CCCA 3OZGA 3P9IA 7YASA 3FUCA 2QR3A 3UV7A 4JU8A 2GZDA 4CPDA 4KWTA 4RSHA 3IT2A 3LL7A 1GXSA 3OZFA 1JSCA 3WZLA 4FTWA 4KIJA 1SWWA 4KN6A 1HM5A 5L7WA 1NV8A 5JS8A 2E1RA 3DV0A 1RIFA 4KKVA 2OV3A 4PYRA 3ZJ4A 4N54A 3W6ZA 5A4AA 7ABPA 5FWXB 1FFAA 1F6DA 4UNPA 1OX5A 5L3QB 1W4AA 1E2JA 2A7QA 3HM9A 1U0JA 2NTVA 3EC7A 3NHLA 3E7FA 3TECE 2JGJA 1PT8A 1Y9JA 2C1XA 2HJHA 1CRPA 3EQ7A 4NCBA 2CLIB 2O2EA 1MB2A 2YHUA 4L28A 1QF9A 1WCV1 1FLAA 1QQ5A 3UJBA 1OXXK 5C1PA 4H7HA 4WD3A 2OD7A 2CLHB 2R6R1 4UVGA 4D7AA 1YAJA 4F9TA 5KHLB 5FA6A 2CHUA 4TRNA 2C7PA 2CHFA 1N3YA 2F8SA 1U81A 2V0CA 2O2XA 1NBMA 2FSSA 4LIPD 5B3KA 2SBTA 3PC4A 2XY4A 3E84A 4CF3A 3SDBA 1J9ZA 3KE8A 3FSJX 2JJ2D 1VZ2A 2AD1A 4GIBA 5GZ3A 3TQRA 5KI6A 5HKBA 2P40A 3UMGA 4GPD1 3PXGA 3GJZA 1Z7BA 4R5HA 4EZEA 4EARA 3Q87B 1CUXA 1JIJA 1XZNA 4XWAA 2GPYA 2Z1NA 3H5NA 3I6BA 1CU1A 3O2QB 4C7VA 3EZFA 3VOAA 3FF4A 4BL5A 4LFAB 4BKMA 5JRZA 4NQZA 3LYHA 1OW3B 3B1YA 2GHTA 1L8AA 3RRNA 4OB8A 1W5AA 5DBOA 1XTJA 1PR6A 3UAWA 3H6GA 2PUGA 4G07A 2R7NA 5CBKA 5CDHA 3PHLA 3Q8MA 3CJQA 3EG9B 1E7MA 1JALA 4QYSA 1PT7A 5HJ5A 1AVTA 1W94A 3LDFA 3EA5A 3PDUA 2XIQA 4POAA 4XUDA 5TF4A 3MWYW 5A04A 5JIBA 4LF9B 4WLEA 3ROPA 1JB9A 1QJCA 1Y37A 3KKPA 3ZY6A 1XWIA 1PQPA 2OKGA 1Z82A 2GH1A 4TGLA 5L7YA 4DM3A 3W5AA 5HOEA 5BSTA 1RJFA 3CEMA 1CQIA 1NSYA 1XZDA 5FULA 1SG0A 2PD4A 1JFFB 2P2ZA 4RYDA 5AICA 3O6VA 1IPHA 4LN1A 4X9XA 1W581 1AZWA 5DK6A 5T6MA 2X8LA 3TZLA 2ZPAA 3WBBA 2YMMA 4GS5A 3E9DA 1IN8A 1L5FA 4U39A 3T3MB 4BU1A 1K9SA 4MYTA 4LHXA 4J75A 4LGMA 2YASA 4P33A 4IDHA 1OA0A 3HBFA 4G8DA 2WSYB 5EUCA 4DVGA 5L4NA 3W78A 5KYNA 3A27A 1L5HB 3H5IA 4AY6A 2CNDA 4F5ZA 1YH3A 5CLFA 2ZULA 1AGXA 4XZ3A 1BN7A 1GG2A 3H5WA 3IT1A 4FWTA 3OUUA 4DDUA 2QNBA 3JU3A 1UKCA 1E1RD 1DG9A 4HJRA 1YVDA 3ADCA 3O8CA 2FSVC 1ZNWA 4HDCA 3GELA 2NPFA 4BNDB 4LJ5A 3MS2A 1SIOA 2V5AA 3QNMA 1GQQA 3I2YX 4FUTA 4GX5A 2D5AA 4JLPA 4TN1A 3AJ9A 3CF6R 3UUGA 5L3QA 3TD6A 5THXA 2WWXA 4BGDA 1H8ED 1QB7A 3C5VA 5JO0A 1R4ZA 1Z0FA 1E62A 3VKFA 1E92A 5CVCA 4AROA 4G9EA 4HI0E 3RSLA 1QVRA 1T4MA 3EUAA 1NUSA 1FNNA 2A9PA 3QPWA 3I62A 2XECA 2WSMA 3HO6A 3VR6A 1ZM9A 1KMNA 2VDLB 1HFWA 1ZUHA 4REQA 4NARA 3S8YA 1ZY2A 2VFAA 3ER8A 4K8RB 4JODA 4EO7A 5K0TA 2QDXA 2Y1EA 2AG5A 1ORVA 1U65A 5K8VA 5IM4A 1ZITA 3GRFA 1P72A 2QT0A 4WY5A 2KE5A 4EVRA 1UPAA 4EYSA 3IQXA 2OO3A 2OE2A 2NADA 1ZI8A 4J0JA 4ENWA 3E23A 3L4BA 3M6MD 3PWTA 1BWRA 1DAMA 3I04M 4CV3A 5E0OA 1RKUA 4BCDA 3E1SA 2P90A 3AR8A 4GVXA 1WL8A 2F55A 1Q3HA 1YIOA 3EGDA 1P1JA 4S1NA 2G0TA 1ODCA 1EWKA 2HGZA 2E5FA 2WDPA 3FPHA 4RACA 1ATZA 2OWDA 2CN1A 4KO4S 3BWCA 1T13A 2AC2A 3D4LA 3IE2A 3NDBB 2PH1A 2D13A 1UT8A 4HZIA 4HQKA 2EKPA 4RD6A 2DERA 2PCLA 1IOWA 4CFYA 4U02A 4LF7B 3NUQA 3LBAA 4R9NA 4YJ2F 1QFYA 2PTHA 4PEVA 4IXMA 2XKJE 3U3KA 3E8SA 4BVHA 3FCEA 1D04A 1SBNE 3F1KA 2FSGA 1G6OA 1W49A 3UVEA 1SK9A 4F7WA 2XPCA 2W48A 5CT6A 5AHXA 2OV6A 4DTCA 5HJEA 3WLTA 2W6CX 3KYDA 4F3YA 3I76A 3I8XA 1V2GA 9ABPA 5IXSA 2BTQA 3GBPA 3FPLA 2VSXA 1N9GB 3GUYA 5DXJA 2P35A 2BKAA 4AN1A 3IMKA 4BNGA 3I9V1 4Y9UA 1Y7TA 3ONFA 2JNWA 4EATA 3HMQA 2CWDA 1H9AA 3M83A 3KVRA 1CDZA 5DMXA 3PNBA 3RVRA 4MV6A 1M6NA 1QIGA 2VRCD 1SQ0A 1V5IA 1H4QA 1HY3A 4ZVQA 3K71B 1DRVA 3UMBA 2ECFA 1EQAA 1FRZA 1YS6A 1M2EA 3ABIA 4K6KA 3TIIA 4H15A 5SZHB 2IY8A 4AZ0B 2C1ZA 1Z7EA 1E6WA 3GY0A 3O3CA 1TJNA 3IQHX 5F7JA 3PFGA 4C5BA 1JI3A 1Q1AA 3ER6A 3CW2A 5AW4A 4IQ4A 5LN1A 5GJCA 5LQCA 4QFCA 5FL7D 5CD1A 3FVVA 5L4SA 1KA9H 2XKBA 4ENUA 3ZZ1A 2DM6A 3PFCA 1YL5A 3NOVA 1O87A 4TTRA 4KQXA 3W2IA 4JFRA 4MVJH 4TLMB 4UE6A 4GOLD 1UP6A 2VP2A 1EVZA 3A3KA 3T9BA 4DVJA 2I2CA 3QZUA 4LK2A 3FMVA 5TPWB 3SEZA 3VZQA 1SXGA 1J2UA 2YVUA 1O4VA 2DG2A 3RFUA 2ZKIA 3PUXA 1Z3IX 1P17A 1PUIA 5AWFC 2CLMB 4E6EA 3A7EA 3RFTA 1J2YA 1M6VA 5CYOA 4XYLA 3D8NA 1AUXA 2Q29A 4DYDA 1Z2CA 3HY6A 5JHHB 3K72B 2BRUA 4PBSA 1VE6A 5ICGA 5IT4A 3KR2A 3EBPA 3U49A 3BQNB 2FPGB 3FKJA 2PSDA 3LOPA 5J47A 2GSDA 1Y3HA 2J3DA 3G2LA 2OILA 3AZOA 3PQ5A 1E4YA 2A9RA 2HCJB 4HS9A 1BS2A 1J8YF 2ERXA 1P80A 2OGZA 4MV8A 4BQOA 3R20A 1P6XA 2CEAA 2R8XA 3IAAA 4ZT3A 2A5JA 1Q7TA 3FSRA 3GRKA 1MJHA 3H42B 3F8WA 2R5WA 4IHKA 4YEDA 1C7QA 2J0EA 1XZKA 4NCJA 4CMEA 5DNWA 3DMGA 4COKA 3WK9A 3VR1A 2PVSA 3DBRA 3MQ2A 1JXAA 1XLUA 1AUQA 1JB1A 2NUTB 4EI2A 1IJKA 2ONKA 1ZCAA 3QE9Y 5T8KC 1A9QA 1O57A 2QYHA 2QJOA 2VKTA 2E87A 2LW7A 1LVUA 3QVMA 4GMDA 4ROTA 2AI3A 3KQLA 3LXUX 4D3FA 5DOZA 1TLTA 2X1HA 2AFRA 4KLZA 3F6YA 1YUMA 4B3TB 1OF1A 1SUBA 2G63A 1T9HA 4E31A 3LKZA 1DCMA 4GWGA 3UOAB 4OQ4A 4QFBA 2VS1A 4EHDA 4H6VA 5DF1A 3SJAA 3MUNA 2C9YA 3B9RA 1SCNE 1BQ3A 4ZI2A 4GUAA 3T1QA 2P3QA 3G88A 2HT6A 2VDRB 3NG1A 3GLFE 5TNXA 2K6GA 3DBHA 2WJGA 3EF1A 4XCVA 2HA4A 2IHYA 2WJ3A 4MPTA 3SICE 4L72A 4AJEA 2QVXX 3CLVA 1V71A 5LDDC 2HR1A 2ZG6A 3RVSA 2C5GA 5KOHB 5F5NA 3OZDA 2B61A 3L79A 3PIRA 1PT9A 3SC3A 1I6WA 4YMIA 5SY6A 4H60A 4F4UA 3L43A 3HP4A 4PCUA 3UA4A 3ZLUA 4YP6A 3QBEA 3ZNNA 1QOQB 3COVA 3UAVA 4DM7A 1KWKA 1KDZA 3I6YA 3G7UA 3TJMA 4MMZB 1U7XA 3RT1A 3H5LA 1J09A 3EG5A 1UDRA 3FGNA 2Z2XA 5TPZD 4BB9A 2JDIA 3JATB 3KTAB 4BDSA 4ZGWA 3J80A 1CVIA 4QNRA 4F6RB 3N0TA 2PWAA 1SCIA 4CMHA 4LGYA 1LPAB 4LMBA 1N6RA 3K0EA 1SZDA 4FN4A 5FBHA 2V9ZA 1FPQA 5D5PA 4PAOA 2ORVA 3DBLB 1KVTA 1Q0LA 1PRYA 3DDHA 3L5OA 4JCCA 4KR9A 1KKUA 2GZ2A 3PQ7A 3AVOA 5ITSA 2VEDA 4M1MA 4PLCA 4C87A 4WERA 1Y1PA 4TLCA 2AFVA 3BIOA 4EPYA 5IKEA 3DE5X 2YFKA 2IV3A 3REOA 3RS9A 5JDCC 3AUSA 3T3PB 1NU8A 5IAOA 2DETA 4KIWA 3ZWYA 4U1RA 4LG1A 4WLFA 8AT1A 1ZM2A 2QRPA 1NMYA 3IIMA 2E9SA 3VVBA 2I66A 3OOSA 3WQQA 2OBNA 4NBVA 4URVR 2JZNA 4UZSA 3ABRB 1P1BA 1UBUS 1Y3CE 4KDRA 1KBQA 4I2NA 3SLGA 2Q4RA 3OH8A 2AF3C 2Q07A 3VC1A 1WZIA 4IDNA 4CNBA 4COOA 1GPNA 4Z1MD 4EKNB 2PH3A 1DLIA 1MF7A 1SWVA 1PQWA 5B37A 5EQJB 3MAJA 4ALLA 3ZWMA 1PVDA 4TXNA 1Z2AA 4W5QA 4D96A 4MR8A 3W3AD 3MJEA 4QJBA 2A58A 2JI8A 2XDWA 3FTPA 3GDWA 1HKHA 4FC7A 4URWR 2HBRA 2ZYTX 4XB2A 1KIFA 2GWHA 2YY5A 2VYVA 4GX0A 2CV2A 2G1AA 2VJDA 3EE6A 4OIFA 3VYSB 4TTIA 5AW6A 2XEDA 1AMOA 2GN1A 4EO4A 1WHSA 1AQLA 1LSOA 2NUAA 3L18A 1KOJA 1YB7A 2DKOA 1CR2A 2P11A 1XP5A 2Q2OA 1L7PA 5G0VA 1GGFA 3SYTA 2WT9A 4DQVA 3WA7A 3ADDA 1GQ2A 1E1CB 2YJTD 3LA6A 4HDRB 3N87A 3HBJA 1IZYA 3TL6A 3CF4G 2MYNA 1E9AA 2C95A 2HBYA 3EHEA 3E48A 1ZH4A 4FDTA 4R8MA 3TTWA 4HDSB 2ZVJA 5BQFA 4OHVA 5FBRB 4H1HA 3P4UA 3WLMA 3K0FB 4LZAA 2YXBA 1VIDA 5ENZA 3FLAA 4N5NA 1Q1GA 3MBOA 1U1DA 1UKEA 2OFPA 3DCYA 3TCKA 3G82C 4MDYA 1SEVA 2YMLA 4ZOEA 1N57A 1ZOSA 1KS9A 3FTDA 1H2RS 2I80A 3TKAA 3ADOA 1N2SA 3UMFA 1RXIA 2HHJA 1G8GA 5BR1A 5JATA 4K0KB 3G2HA 1X8JA 4RABA 4Q1AA 1J0XO 3JWPA 4B76A 1LX6A 1ZHOA 3JAKA 3SSAA 4EY4A 2D1FA 2M6SA 3C7CB 3HUEA 3HKEA 5FFNA 2Q1SA 2ZT8A 5KKCA 1TTTA 1E2KA 4M53A 1V5WA 4CKWB 1FMTA 1MRNA 3CW9A 2WTUA 2DC1A 4HEHA 4NENB 1W36D 2BE9A 4K28A 1FMLA 4JV5B 2AHRA 3LP8A 2I4IA 1R6VA 1BRTA 1M8KA 3CO0S 4EH1A 4YP7A 3BICA 1TVCA 1OH6A 2VQDA 2CL7X 5G0SA 3V32A 5KQSA 3IHKA 5JEDA 1GKIA 1OI7A 3ICCA 3TEJA 4OXNA 4Q3NA 5ES3A 4WOKA 1AKTA 1Z6YA 3E9CA 1X1BA 3KJHA 3V97A 2WC1A 1DX4A 3KOMA 1R8YA 4IM7A 2I7DA 1JLRA 4PS1A 4B83A 1V16A 1BDHA 2QV0A 4ARZA 2E4UA 3UJPA 4OHKA 4N3GA 1S3FA 3PPIA 3ESDA 3BCHA 4FONA 4MUKA 5JYEA 1VJDA 3D0RA 4UM5A 3EPJA 2G7ZA 2GGSA 1VGVA 2HPHA 4RFSB 5HF8A 4G5HA 1WW8A 4DBVO 5MHTA 3EY9A 4H6XA 1PK7A 1ZBQA 1KVSA 4C05A 1R6AA 2I7TA 3ZR4B 3UPTA 3IL2A 2FDCA 1HT3A 1RQRA 1CIJA 4UE2A 2NMVA 1SPXA 4C7JA 4DUYB 2WUWE 4GR4A 2DBYA 3SF0A 3EWAA 3LIPA 2NTNA 2HCRA 1BEEA 1KI4A 4G24A 4P7KA 4RBNA 1ZQ9A 3ZHBA 4J1TA 3GR6A 1QV7A 5DI9A 1YZLA 3N75A 1Z5ZA 1E0DA 2R4QA 4ALMA 2O3QA 4DLLA 3DPSA 1SBYA 4M1ZA 1HT0A 2QLMA 4Y6LA 4LY9A 1VE7A 3OQ1A 1XPUA 1W52X 3CLTD 4CM1A 3KJQA 4XQGA 2G80A 3TBKA 2G3YA 3IO5A 2YV3A 3SGLA 4Z3KA 4YRCA 3Q3VA 1DQNA 3UH0A 5EJEA 2X6RA 3ONDA 2RH8A 4DC9A 5M34A 2I1QA 5HE9A 1XZIA 2JAWA 4PVDA 1CQPA 3K16A 3INRA 2Q3EA 3ZGVA 2H7CA 2IH2A 1XRPA 1K8QA 4XYEA 4B6GA 1G19A 3RTEA 2PLFA 2VF2A 4JLNA 3MTIA 1U8YA 3VJMA 1J7KA 5BN5A 2A2ZA 2PJUA 1LJUA 1FDWA 2WTMA 4K2HA 4NDZA 3C6XA 3LBNA 4OTZA 3RU9A 1VHLA 2X5NA 4JENA 1RWOA 5FWYA 3CWCA 2C20A 1H2EA 2WU0A 4N3CA 5CTAA 4F2PA 1ZONA 4DSZA 4WN3A 4ASUA 5DLPA 1MDBA 2FZGA 2HWWA 4I81A 1A8PA 4TMFA 4EEKA 4DE5A 4CEHA 4FHFA 4B73A 2CFTA 3RLFA 4G4IA 3GLIA 4PHGA 5JPDA 2ZI3A 1HZZA 2ORIA 3IH5A 3SX2A 4XEHA 1DAFA 1P39A 4QJIA 3WK4A 4ANFA 1UOPA 3QUSA 1NPDA 3GOHA 1PLKA 1RZUA 1XRRA 2RHOA 2ZYVX 3HJBA 4PLVA 5KWVA 1E89A 3BFJA 1EFRD 2BEUA 1KO4A 1L4FA 1V4VA 1G2IA 2Q27A 3RYIA 5F1PA 4U4AA 1AB5A 2BFEB 3AX6A 3DAPA 4LAFA 3R8FA 1TU4A 4IWXA 4DR4B 1F38A 1ZH6A 2YJGA 4XCQA 3WWOA 5KNBA 4MPDA 2C9OA 2FMIA 3FDZB 3SPXA 4CNQA 5A3JA 1YHZA 2VVTA 1F1BA 5HF9A 9LDBA 3ASUA 3PQCA 4F6RA 1HFKA 1CZLA 3NC1C 3INNA 1MQAA 2RGUA 3KTOA 4D0NA 2QJFA 2W5UA 3QPDA 4OUDB 1F3LA 1PO7A 1H2HA 5DW0A 5IC4A 1SQGA 2NO4A 3D64A 4LJ4A 5AK0A 1ZIPA 4ZI5A 4GC5A 3A6KA 3RC7A 4EABA 3LUDA 5JBQA 3BYZA 3BD8A 1VG0B 1XMQB 3SXUA 1K97A 4MPJA 4GMGA 5A9SB 4X3PA 2WSSD 1AS2A 3HH8A 3KKZA 1DBWA 3TCNA 3IR6A 1T1SA 1PS9A 3LBYA 5EC8A 1IEWA 1KBOA 3N2KB 4P92A 2NTYC 3NYQA 5ICEA 2W8ZA 4JSRA 5BW4A 1YNOA 1OBFO 4XGNA 4Y98A 1D07A 2L17A 4UHHA 1TOAA 3QBDA 1YSCA 1N2OA 3PNKA 3FKQA 4IAOA 2HIAA 1G8JA 3JQPA 5AUOB 1EHCA 4FEAA 4MHOA 2ABWA 3DV0B 1TKCA 1C7FA 4EGFA 4AQ7A 4CEIB 4RVDA 3LNCA 1ZGAA 2H9YA 4UOQA 3WMFA 4ZCMA 2RGCA 4HQOA 4FYYA 1YUNA 1R0YA 2VXCA 2CSUA 3OO1A 4GPBA 1S01A 1NY6A 3BRWD 4JBNA 3DS8A 4HLQB 5AH0A 2IU0A 3WL5A 4CQMB 4PN3A 3TLZA 5CFPA 2IH5A 2YJ6A 2BI4A 4V0LA 4R2IA 3SC4A 4ALIA 1OLSA 2FKNA 4NPAA 2ZB7A 1R0CA 3ITEA 3P9KA 2DHEA 5DV9A 2WJZB 3RHZA 3WJ7A 5BURA 2O8BB 4MR9B 4BAGA 1RWVA 1N6NA 2GR9A 4HUTA 1YVUA 1RQLA 1JRLA 4MR7A 3X3HA 2RKBA 3WGUA 1T3TA 1IM8A 1YR9A 3QVGA 4KXVA 1A4RA 2IOYA 4MPPA 4MCHA 4E46A 2QXUA 1H2XA 1JNYA 2B1IA 2O7SA 1WLYA 4KLNA 5HBGA 4QO8A 1HKUA 1URPA 2G07A 2QP4A 2JFPA 2W6JD 5DCYA 1NAIA 3HXLA 1TD9A 2WD9A 1RYZA 4MW7A 5TQJA 1IRIA 3PNQA 1G3UA 2PWYA 1JXOA 5SZKB 2HHLA 2WF5A 3DVSX 4CMAA 2D3WA 3RC3A 4JYZA 2WYHA 2BF7A 1PEDA 5C8YF 2DGDA 5ADHA 5TJ9A 2ZTLA 4G85A 3LFTA 3CUYA 3V9PA 2AN9A 4N7MA 4W1PA 2HA5A 3JYPA 3MMXA 1XZGA 3AB8A 3WWEA 1QTNA 1OZFA 3RM3A 5DN6D 5BN4B 1MXFA 3BULA 1N2GA 2IZ5A 4O1MA 4IJQA 4UJ3A 3UBMA 3AHDA 2WF9A 3UB4A 2WHXA 1W35A 4QGHA 4AUEA 4P84A 2O5CA 3A6LA 2NQ2C 3HGMA 2ANBA 2HJVA 4YN3A 2BSXA 2G8LA 5CLQA 3KAQA 1SR8A 2REBA 1UFVA 1XZJA 5H59A 4CIAA 2VR1A 5FUBA 2YHIB 3ZW8A 5F23A 1DPFA 4F06A 1DAIA 2G1KA 4J7UA 4JFAA 5AVTA 1KGDA 2I6XA 2A59A 1PJSA 1DP4A 4LGVA 3DB1A 3OESA 1P9WA 3B7GA 2JIMA 3FZQA 2BFMA 2WMDA 3Q2IA 2D1SA 3ED1A 2QMUA 3QX7A 4I1SA 3MCWA 1PFWA 1DG1G 2AOTA 2FH5B 2Q5LA 2X58A 1D8AA 4IDQA 4DGQA 3T6KA 1IUKA 4HNTA 4DV6B 3OU2A 3QVUA 1DWQA 3QF7A 3HNPA 5LWQA 1SULA 4DLTA 3H5RA 2CLLB 4PWYA 3HDQA 4QWMA 2ODBA 3ZHOA 4EX6A 4R1NA 5BV7A 4GL2A 5EZQA 1Y8CA 3F49S 2FOIA 4LV8B 4FB5A 3G5MA 2IYSA 4X95A 4XTCS 7REQA 5JANA 3AF5A 3H1EA 4XVHA 3LXRA 3N28A 3FYCA 4A0RA 2IEBA 4AYXA 4TQGA 2XMCA 3OHPA 1WB5A 3VZDA 1J90A 4R9RA 4FJ2A 1MRZA 5ALLA 1ZN2A 4E33A 1UZLA 3AEQA 4P35A 5IBCA 4KE9A 1KU0A 4UHJA 3RK1A 2Q6IA 5DVZA 3WYEA 3DZHA 4Z49A 3ZDEA 3U09A 3L1KA 5JECA 1G98A 3I9LA 3REQA 4JP3A 2V8BA 4BUJA 1K5HA 3DWGA 3L7DA 2OKCA 4EF6A 2RE8A 5L3RA 3W5BA 4Q00A 3H4IA 3I5XA 3WNVA 1OH5A 2BOVA 3FPAA 4E2XA 4D44A 3W4KA 3KQUA 4S04A 2ZB3A 1I6LA 1Q1BA 1GTMA 2W6NA 3HYLA 1KPHA 2PR7A 5TRTA 4QBKA 5A03A 4HH3C 1QMPA 2FPPB 1FX0A 4YMLA 4Z9BA 5CT9A 3ZD7A 1DIBA 1DL5A 3PFHA 4V38A 1Z13A 3NHPA 2BMFA 4LE0A 2IH4A 3IUEA 4PG8A 4BXOB 2QGZA 3DT6A 1EVYA 3WNCA 1JEJA 2Q7OE 3LX8A 4RORA 4Y6RA 2WEKA 5KYVA 1QDUA 1OFIA 3LY7A 3KXKA 4M0CA 1RLIA 3B51X 1NQXA 4MUEA 2YOGA 3CSSA 4PX5A 3SG0A 3ON5A 5EHXA 1NONA 3T1YB 1WW3A 4I6GA 1W4ZA 4IZOA 1X86B 1L8LA 1J21A 3I53A 1YR1A 3HN6A 3PEWA 1TZKA 1G7TA 3R9XB 5GM2A 2EYUA 4HRXA 3T7DA 4NBWA 2YFYA 3RRBA 4AICA 2WG2A 3QUBA 1B2RA 3ZYCA 2ZXFA 1V11B 5K1ZA 1I3CA 4P32A 2OQVA 3ENKA 4JI3B 2BR4A 4RKWA 4XAQA 3JRWA 1MB3A 3PPWA 2YWJA 1BS1A 4QXAA 3LCJA 4A6PA 2FFQA 3ILVA 3WYAA 1I94B 2XZPA 4P7BA 3WNDA 1MB4A 2B0CA 4XFJA 3NIFB 4PBRA 3AV0B 2QTVB 3GCDA 1SD2A 5F9MA 5UKDA 2EATA 5EP3A 3ZPXA 1R0KA 2OXIA 2FQXA 3OOWA 3T5TA 5HXAA 4TOIA 4A92A 1XTVA 2EKQA 2RFLA 1K4MA 3B1XA 4PLZA 3FVQA 1TCAA 4Q3BA 4XLLA 2D2FA 1QZXA 3OM1A 2R6DA 5AVWA 4RJIA 1V45E 3EDOA 5P8WA 1M76A 4UOZA 4CLOA 4XDYA 4QBTA 1AE1A 1FLNA 2PRYA 3LKDA 1SHJA 5JNUA 1RPZA 2C9ZA 2FWIA 1WQ1R 2ECKA 4LBZA 3RVLA 1JFFA 2EL9A 2XSZA 4N8DA 4R3NA 4EYKA 5FAKA 3CVYA 3WKAA 2IUSA 2Z58A 1J24A 2FPIA 3G9XA 4PQRA 1Q77A 3FNHA 5IP5A 3ZGNA 4D8YA 2QN7A 3IT0A 1YB4A 2Z6UA 2IZ6A 2DPHA 5JPIA 1F8XA 3PHIA 2AW3A 5HCNA 3I6MA 1P45A 1GAJA 4HEQA 4IHJB 2OHJA 5SY4A 4BYMA 5EAIA 4YAWA 3KZOA 1Q11A 1EDDA 1W87A 2PJDA 4K9SA 1DBQA 5FR1A 4R71A 3K1TA 2ZAIA 1U7DA 1CXZA 1FU8A 3NCHA 4J90A 1ECFA 2PSFA 4NBKA 1KY3A 2XR1A 1U7UA 1OT3A 3DEYX 3OLYA 4P98A 4UUNA 4X6YA 3WAKA 1JHPA 4C2AA 2FPOA 1RMTA 5KO2A 1TB4A 3JWIA 3B3QA 5D86A 1Y8QA 1YZGA 4BLPA 2OC9A 5TQ2B 1OAAA 2ZJ2A 3DC7A 4YJKA 2MYPA 3ZWCA 4GQBA 4D8WA 3WB0A 1PFKA 1GL7A 3B13B 4GWLA 1Q3TA 1GLNA 2XYHA 2PLWA 3TB6A 1G5HA 1GDDA 3QQ5A 1JEQB 1M1XB 1U4NA 1JN0A 3AHCA 2HY7A 2PTGA 3PPXA 2QJRA 1U6KA 1JJBA 2OO5A 1ZL0A 1XA0A 2FEPA 3DHVA 3JTEA 3ORYA 2YWRA 3PWSA 4OY3A 4YAOA 3UJ6A 1XYYA 1OU4A 1XVTA 2NXWA 4B4UA 2O8NA 1EM8B 4F3KA 4W63A 1MX3A 3PJEA 3QI2A 1IEVA 3FCYA 5CFZA 2OPHA 4NYIQ 3LKVA 5F76A 3HU2A 2VWHA 1L5WA 2LZ0A 4YXWA 3WMRA 1KEEB 1VGQA 2QOEA 4KK4A 4NBNA 3R7DA 2FHSA 2LV8A 2C7OA 3MQ4A 3LT2A 4X1YB 5JZMA 2VJBA 4ZHQB 1Z2PX 4BVLA 1YZFA 1MQ8B 4QIHA 1N8SA 1W8IA 3W77A 3UA3A 1U5AA 3P96A 4C3OB 2J5QA 3EMDA 3W3AH 5CCDA 4V0KA 1L5ZA 3CJRA 2I2DA 2D8AA 3NHAA 1ZKDA 3R0IA 4IICA 4WLUA 2P3SA 3AUUA 2PNFA 3KCNA 2QSJA 3EGVA 2N0SA 3QX8A 5GONB 5T3UA 3DZFA 1YRLA 1C50A 1GYQA 1GWNA 1KYZA 4JI6B 2P9YA 1XTRA 4WACA 1QH0A 1Z26A 1XZAA 4QEDA 3IEIA 4JX9A 3L1JA 1E3WB 5REQB 3U3OA 2Z43A 2I5PO 1E59A 3D6VA 4I5IA 4QZVA 5DXFA 4FFNA 4JR1A 1SJ9A 3TNLA 5DN9A 3GPLA 2REOA 4OQEA 2EZUA 3GWGA 1USIA 3OIVA 3N5KA 5HKAA 4FDLA 3F0TA 4XQEA 3IDSA 1Z6QA 1JXMA 4Q48A 2JBAA 1KHHA 2OCKA 4BB5A 1MAWA 3KB8A 5KYXA 4FMPA 3WGIA 4L02A 4PYQA 1YOBA 4RK6A 3V6LA 3JD0A 4HJXA 2IGTA 3M6AA 2O59A 3ROFA 2OG1A 1JAZA 4PHHA 3SR0A 3VAZA 4MYDA 1AF7A 4JGGA 1CQWA 1FBNA 3CRMA 3L1VA 4O25A 3S1LA 2GJSA 1GNSA 1NRIA 4EI7A 1R0LA 4YX9A 4QRHA 5IKXA 4PR0A 2VQFB 1G5FA 3NHJA 2I71A 4GNKA 4LBWA 2QRVA 2GN8A 4HVLA 3L4BC 5KQMA 2HNBA 1OB2A 5FWYB 3ZN2A 4OAOA 2QRZA 4HL6A 3BJEA 4FC6A 1HLDA 3EVBA 1GO2A 2X4LA 5GP1A 3CHYA 3DQPA 1GRCA 4LJKA 5AI4A 5EERA 1VPWA 1P6UA 3EBLA 4B7XA 1GHTA 2YFQA 4LA4A 1NQAO 4LYDA 1TT5A 1XEWY 2FW1A 4FN5A 3R5KA 1E2IA 2JFZA 3BB1A 4JVSB 2F4VB 4FW8A 2X0KA 2YOFA 2ZSUA 2JAQA 2GD6A 3EZLA 3REQB 4P58A 4R3WA 2ZOSA 2O2JA 2JA2A 3TRIA 3I72A 2C7BA 2A84A 1EBUA 1DIGA 2YHAA 1FTQA 2GBPA 4TMKA 3OJ0A 5DM60 5BY2A 2WW8A 5DYIA 1IXSB 2UUOA 3GUCA 3RFCA 1P2TA 4PZ0A 5CBPB 1CQZA 4A8PA 2JI6A 2I54A 5H9VA 1PAUA 4LXQA 4XSHA 4DSNA 2A57A 1KMMA 3CUVA 3LL4A 1UBCA 2FZLA 5GIPE 3OCVA 1EZ1A 3F78A 1T36A 4X1YA 3RG8A 5EUMA 1LU9A 3AUYA 2FK8A 2IHZA 5IU6A 1AJEA 4AS1A 3QBTA 2DVMA 1YKFA 2XVMA 3UV3A 2PX2A 4CTOA 4ZYUA 3KE9A 1O3YA 4M36A 2H7XA 2D1RA 4P4SB 4RH1A 4LYAA 3VSAA 3D0KA 1ST3A 3E9NA 3ZDZB 3AXTA 1SHTX 5AVQA 1IY0A 1U04A 4BVAA 1MIOA 3CZCA 2FGJA 1MDFA 4OJKA 2NU7A 4C06A 1L5RA 1B0UA 3SX4A 4R2XA 1MTZA 4KPGA 1J1UA 2VYFA 5K8LA 3E1KA 3SEAA 2PKCA 1X1CA 1GAXA 1PE0A 3RASA 2I2AA 2F3QA 1MX1A 1XEXA 1D7AA 3COZA 4IVQA 1DMSA 3WK6A 1MLDA 3WQHA 1DTWB 1QJ4A 2QJTA 3P2JA 2H92A 4HX5A 5F7ZA 1DJNA 4DLVA 1WU7A 1F2TB 3C3AA 1CEQA 3CX3A 3D6HA 1PU2A 5KWEA 3JYNA 2X5OA 3EQ8A 3RUFA 4ZYZA 3Q0TA 2CJXA 3QMWA 4ZVUA 4FOTA 2WM3A 2GKOA 2R6AA 1UDBA 2E4XA 3GP5A 4B2IA 5EVJA 3OM0A 1YMQA 3HZOA 2GFHA 2QG6A 3T0IA 2PYIA 4BC0A 3EFOB 1N2HA 5EFZA 1C29B 4KG7A 1D1SA 3ZH2A 5AW2A 2AI1A 5D3MB 2Q5JA 5FPKA 5CR9A 5I7EA 4H2DA 1XHEA 1P74A 1G5PA 3BUSA 1TE2A 2FUKA 1J49A 4RIIA 1SXQA 3T3OA 3VTZA 2YYZA 3U80A 4WADA 1QTRA 1SCKA 3TVTA 3AHHA 2IGBA 2JFVA 1KS2A 2O8EA 1HG1A 4YT8A 3ADPA 3KTAA 3PFFA 1P9OA 1COWD 3GEEA 4RF2A 4TRRA 4PCAA 4V1CB 4IYRA 3I0MA 3G89A 3IXMA 5JBIA 2DTXA 3N05A 2UU9B 1X80B 1U9IC 3H2HA 1B8PA 2OBBA 2X4IA 3H9BA 2YS7A 2ACWA 3CRVA 4MQBA 4XYMA 1KH2A 4AQDA 4B71A 1N2CB 5LSAA 1C9KA 1GNLA 1IHDA 2ZVPX 4LWZA 5B3JA 4AXXA 2OB2A 2VJQA 1WMDA 4ZQIA 2FMHA 3ZHTA 2PUAA 1CUWA 1BXZA 2B6NA 2H3EA 1BD4A 2HA0A 2P9JA 5TPWA 3NM5A 4JI1B 3I61A 1LLQA 2O5VA 1JZQA 1AKWA 1I7LA 1TQ8A 2BFAA 3HUUA 3NONA 4Q01A 4C29A 2QE7A 2Y1GA 2PQ2A 4FKMA 4MGKR 4NOMA 5AKKA 4NESA 1X7HA 3WGNA 3GUHA 1SIUA 1WSDA 1IY1A 3GRVA 1O8BA 3BB3A 4LYFA 5BOVA 4ZIRA 1JE0A 4KLAA 4TL9A 3Q3GE 2X5KO 1J1ZA 4LC1A 2GBFA 1GEEA 4DJTA 2ZIGA 4BMZA 5BN1A 4ER3A 2CDBA 1DO2A 3GVIA 1PKEA 4FOLA 3DVLA 4X20B 3KB6A 2IV7A 3THSA 2R1VB 3NEJA 4ZOLA 3YASA 1YRHA 3WI7A 2VQ6A 2PZ8A 1Y6ZA 1COZA 2R6GA 4TS3A 2GZHA 4AURA 2FMUA 2O7VA 4KPYA 1G42A 3NIBA 1W6UA 1DAHA 4Q7KA 3K09C 4BKPA 5ABPA 4RIFA 4J0IA 4DDMA 3ZXUB 2F90A 2GAJA 5DU2A 4W1RA 4H3VA 3GBSA 1L7BA 1XI2A 4PYLA 2RGNA 2JCSA 1WULS 2IV2X 5SV2A 2HSWA 1W93A 3PRYA 3EAQA 4OUDA 4TWZA 3TNJA 4XCXA 3D3NA 3DZJA 3PHGA 1G7RA 2IKSA 2M9MA 4AO7A 3U4MA 2O5EA 5KNCA 4F5DA 3G2KA 2FDRA 1ESZA 1ENYA 1H85A 3QW2A 1DE0A 4YLEA 1ORRA 5SZIA 4F6LA 2ZSKA 4M87A 2XAAA 3FPSA 4XWGA 4BBZA 1VRVA 2II6A 3KVVA 5JAIA 1DWPA 2HJ9A 1ZI6A 3CZMA 1U0GA 1PIWA 1DINA 1NG1A 2I1LA 1PX0A 2OHOA 4G1EB 3ZTTA 4J07A 3WIDA 5JNSA 5J3JA 1IQPA 1JPVA 1E3EA 2VJOA 3CRRA 3L6UA 3P2OA 4KXUA 5GV8A 5BNIA 5CB8A 1OD6A 5AVVA 3ZTYA 3HTXA 4C03A 2W98A 4YB8A 2WP0A 4UVHA 4KQEA 4U7TB 3V7FA 4K6HA 4MMXB 1YB5A 4AJ1A 1JIVA 5HIIA 2I8CA 1GAQA 1K4KA 2Y9PB 3LZCA 4Y0VA 3BJIC 3R0XA 4C2BA 1SN7A 4NU8X 4AKHA 4W1QA 2CZCA 4R84A 1PDOA 5T6BA 1VSTA 4L4YA 5F4BA 4PLHA 4NPHA 1FVHA 3V4SA 3ZCSA 3LHSA 1T2AA 4HO1X 4V0OA 2IU6A 5KINB 1KMCA 1JHZA 1RPNA 2D1TA 1ZMBA 1D2HA 1WE2A 2BFBA 2HWYA 3WRXA 4X54A 5LMZA 4BBPA 5DI3A 2B4AA 2P6RA 1UK6A 4B3JA 2XSZD 2VZ8A 4JMLA 3HYNA 4MRPA 1VG1A 2NLOA 3KKQA 4MW2A 5E9JA 2V58A 2O8FB 1P9LA 4MW5A 4XARA 4ZAGA 2H1FA 4WLNA 3FCCA 3UK7A 1TIPA 2D0PB 1G5QA 2FG5A 2LKDA 1FYXA 4I9NA 5DEIA 4NLLA 5F9FA 2AMVA 2DHRA 2NWQA 4H0CA 4UCQA 3TTUA 1ZC4A 2FWBA 1P5FA 3EAFA 5T64A 2GN0A 4MB6A 1FPMA 2ZYIA 3K73O 4GE3A 4DMRA 4YONB 5BOSA 4W9MC 1OH8A 1U0LA 3PP8A 4YYZA 4ZIRB 2XQJA 3TQHA 1YGPA 1Q2XA 3KLBA 4R2JA 5C7LO 1IOLA 1E6UA 4R9UC 3KLOA 3VHLB 1TQDA 4TQ9A 1IUPA 2W2KA 3PRKE 5D00A 2B0JA 2CYBA 2WTEA 2XA9A 3D2BA 3L4EA 1ES9A 2V59A 4OK5A 4IIHA 3ZWOA 1B23P 3IQDB 2A0UA 4HB3A 2OSBA 3EUWA 4AUNA 4C04A 4CIWA 1CUBA 1EM6A 3WLPA 1C7JA 4YCNA 4EHJA 3R77A 4EVQA 3FHTA 3QEMA 1HQYE 3UMCA 4F4HA 2NV2B 2P7HA 4M9ZA 3TQTA 1ZDMA 2YZKA 2VCHA 4YJ2A 4ZTZB 3ZIDA 5JH7F 1YT5A 4ZANA 3THXA 1P2FA 3FKSA 3A04A 4BGEA 2EZ9A 1C9YA 3UG6A 3QW4B 3L6EA 4G8JA 4RZHA 2W11A 4BO2A 4ISCA 5A7GA 1N2IA 2DFLA 3CR8A 3QWBA 4KX3A 5E8JA 2P68A 3KQSA 3S2SA 4L5BA 3MYRA 1RRVA 4LSMA 4YQYA 5CFLA 2GHRA 2O1WA 1PWZA 5K0EA 2YJ5A 3GLQA 1KZHA 2ZAMA 2GO1A 3B78A 3FPFA 3P0FA 2NO6A 4FOPA 5CM8B 2YWFA 3ZHCA 1M5RA 4EG4A 1JJAA 1JDSA 1KC1A 4EA8A 1YO6A 1NQUA 3LCUA 1EB8A 1Q0HA 4RCYA 5DIFA 3SS9X 3TR0A 2O2ZA 4YRSA 2CXPA 1T9GR 3AR3A 3MGKA 3PL1A 2R87A 1CULC 4H08A 4NKRA 1NUAA 3EH1A 2RGXA 4A2PA 1ARZA 1NW6A 5A5VA 2QEQA 2FHPA 1EP1B 1SIBE 5EI5A 5FTJA 5TMPA 2Z0MA 3WICA 2VRBA 3JD3A 3O8QB 1K06A 4K6MA 3PPYA 4ODIA 4B9AA 4B84A 4IIBA 4B6QA 4DG8A 4LHVA 1AKMA 4BMSA 6PFKA 3VO2A 2IIBA 1U11A 5SYAA 3ZVRA 4ZRNA 1P1KA 4S1TA 3WR5A 4JQZA 3GVPA 1T4CB 4E7PA 4BVGA 4E2ZA 4EG5A 3BTOA 3KPUA 2E2WA 3WGKA 5FOQA 3W2EA 5AKJA 2I6GA 4RK4A 2FN7A 1C7ZA 1HI9A 3PQ2A 4JA0A 4N6NA 3ZU2A 4ZJUA 4F91B 5TQ0B 1ORWA 2IUFA 4PIVA 3V55A 4EJFA 1QF7A 4ZGGA 4JT9A 4JITA 2J0UB 4V2UA 3VH1A 4ESOA 5K0GA 5ALPA 3H9JA 1QYXA 4OI2A 4NRDA 2F43A 3BGSA 1VDMA 1ZX1A 3BMCB 4OU4A 3QWHA 1L5GB 1YVRA 1ZESA 2FSFA 1RLUA 2A88A 4CR6A 3TLJA 5FCDA 5CXSA 4MQLA 1BMDA 1P0MA 1GP2A 3E61A 4HUQB 2QXYA 3Q98A 4ZU6X 4N01A 3G8DA 2FRDA 1FLDA 1NJSA 3GFBA 3UAOA 2AOUA 3FDZA 1WHSB 3LM8A 2Q4EA 3UAYA 1XVAA 3L49A 1BMTA 1VRCA 1GTG1 2AG8A 3DMFA 1JTVA 1NJGA 4D4KA 2G1PA 2H0QA 4RD2A 4CIDA 1EK2A 4EPVA 2WZCA 3OBIA 1EP2B 3S68A 2GLXA 4CU5A 4FYJA 4NPCA 3U7JA 5J58A 4NJMA 1HORA 1BSVA 4JXJA 4CIVA 4UQLA 3UCEA 5T5QA 5U4QA 3DF7A 3QNWA 4GXTA 5FRDA 2BSQA 1LDBA 1PFYA 1HEIA 1ODSA 5DYNA 1R10A 2DWUA 2FYTA 4PFKA 1GR1A 1GPAA 3N07A 4ZT2A 4KFRA 2IUYA 3RSSA 3WSVA 5I4BA 4OQQA 4LI3X 2ZSFA 1IB6A 1VMIA 2NN3C 2PU5A 4NWIA 2VA9A 3RFXA 2CXNA 5CNIA 5J5AA 2OQRA 2VHZA 3HFJA 4K86A 3TL2A 3UICA 5LZ4A 1I7SB 3HXMA 4I55F 2X6TA 2OLEA 1TVKA 5ALZA 4M60A 4PBTA 1J25A 1TXGA 5FWNA 4UHEA 3PE4A 4ZT7A 1FLVA 4DUGD 2QP3A 1IJEA 2G1UA 3E7DA 5BMVF 1NQWA 1SZPA 3PFWO 1A9OA 4X8OA 1P2VA 3AMVA 5HRUA 2BPOA 1RXVA 1JHMA 3UWKA 4M0EA 1Y7LA 2CK3D 3TVDA 1KE2A 3ENWA 1BX0A 1OAKA 3UIEA 3GFFA 3OKPA 2O3SA 3JAKB 2UZ4A 3KS9A 2O0HA 1EJBA 2PLAA 1ECCA 4IIUA 3TW8B 4EVIA 2SKEA 5DE3A 2YJ4A 1ADFA 3ASVA 3D02A 3QFSA 4TX1A 5NULA 3ELBA 3ACDA 3BCRA 3DTVB 3UUFA 1UCFA 1ZIDA 2AFHE 4ER5A 5JROA 5HS4A 1R6UA 4PHFA 4XFDA 4JP5A 5KTKA 3IEVA 3LY8A 4YV1A 3ZDAA 3O8NA 4UCFA 3WKEA 2VNIA 3KVNA 2X9GA 4Q21A 1L3IA 4IIJB 5AMXA 1RBQA 3QUCA 1MV8A 1PJLA 1GXSB 4Z0TA 2AXNA 4XX0B 1NI3A 3K0FA 1U6IA 1U9CA 4UTVA 4XPIB 2PPLA 4FCCA 4H7DA 3FOWA 3WX0A 2OXTA 1LPSA 2O2HA 3F73A 2GCNA 4JC8A 1OR8A 4BE9A 1Y33E 4A2WA 3EZXA 1QTQA 3PF9A 3WGOA 3N74A 1V16B 1EGVB 4K1XA 3AO0B 4M38A 1M83A 1J9EA 1DEAA 4RNCA 2GJAA 2G88A 2Q62A 3LYAA 3G1WA 3OM8A 1R74A 2JIOA 4ZAYA 5FB3A 1NVGA 3EGOA 3EYWA 2QTWB 4C6SA 2R6FA 3P9YA 4Z4HA 3CUTA 1H5UA 1A9PA 3PKIA 2JLZA 3IIKA 3I9JA 4MWOA 1L4HA 2FRVA 2ZBPA 3IPRA 3KEGA 3WYCA 4BO6A 5CDSA 1LI7A 3T5PA 3PVCA 3SQOA 2X1MA 1IAVA 1ZHFA 2KBFA 3K2QA 2HWUA 4RY8A 4D56A 2QL7A 4XWKA 4FFVA 1DJMA 3U3ZA 2PK3A 2VJAA 1YWGO 4PQFA 3RGWS 3IUMA 2BLLA 2NXNA 1MXHA 3GH1A 4B7ZA 5G3ZA 2GD2A 3ROMA 2XOXA 4CDNA 2R6HA 1B6TA 2FPIB 3W1VA 2R4UA 4FFDA 2C2XA 3OMWA 3KYBA 3SVLA 4FDVA 4F86A 5KTRA 1QPGA 4K9LA 4P9NA 1WTAA 4WMLA 1JKFA 3SHVA 1RYEA 4A5SA 5JQGF 5E2IA 4MWEA 3M6WA 3OZAA 3WXMA 2HUPA 1H1TA 1HXHA 4OX9Y 1DKLA 2DQ4A 2GYYA 2HQ1A 4KACA 4TMXA 4GF5A 4ZO8A 3F8SA 5AUPB 3Q11A 1VCOA 5CEJA 5K6RA 1DVRA 2AN1A 2RJ3A 2WAXA 3UUEA 1L1QA 1JKJB 2PKQO 3GDHA 1C3XA 1BYIA 1QLHA 4RDXA 1USWA 4QFDA 3HM2A 4OMCA 1D6NA 3E0QA 2WA1A 1UQTA 3F9CA 2EX4A 4Y9TA 5FADA 2DUUA 3BWBA 4E22A 2CFRA 1ZIXA 3CBQA 4NYJR 4GKJB 3O9MA 3PD7A 3DKRA 1XFDA 2KJQA 1ZZGA 5M3BA 5JY1A 2HLHA 2CLFB 3P52A 4ZT4A 2B2XA 1TUEA 3M9XA 4ZQCB 3MB5A 1T6ZA 3KLMX 3K0AA 1DJOA 5BQXA 3CTMA 4AZTA 1ECGA 1U28A 2Y99A 3EUEA 5FOXA 3HDVA 4IKOA 4JASB 5LUAA 3T35A 3L7MA 2Q1TA 1H9BA 3D2CA 4KFUA 1MU0A 5TF0A 2QBYA 4BP3A 4TL7A 3GZJA 4ZCLA 3FY4A 4QDJA 3D3KA 4IG9A 1SC4A 4BEWA 3PDIA 1WXXA 2CV0A 2EHJA 1HF3A 3QX9A 4NG5A 1U8CB 1F6BA 4RQAA 4CG3A 3OF5A 3RQSA 1N7IA 3ANMA 4L1KA 4L0QA 4QC2A 4ZYWA 4QDKA 1X19A 3VPCA 4EEZA 5G0WA 3CCFA 1HLFA 2EZ4A 1KC3A 2ZWIA 3IKJA 1RAAA 1OLXA 4MX8A 2ZM6B 3RODA 3C24A 5DTMA 3UN1A 3VKVA 3QEAZ 2CLOB 3OCWA 3SKYA 1G66A 3NETA 1ORHA 1DLJA 2P2YA 3MFYA 3QXSA 1M34B 2GD0A 2RKOA 4MKXA 4CV0A 3KXPA 1UK8A 4Q82A 5TMEA 3L4KA 5D85A 1SKBA 1D2NA 4DCMA 1WY5A 4C3VA 5DNAA 2IYVA 2XA1A 2RHDA 2ATEA 2H4WA 2ZDHA 1H22A 2QUHA 2BEWA 2BFDB 2RHTA 2WHYA 3HLKA 3UMJA 1EG2A 3GUVA 4TZ0A 2XYRA 3OQVA 5TXGA 4MRNA 2VUIB 5L3SB 1XU4A 3UZUA 1EHIA 4UBOA 4MWZA 1R16A 3QFHA 4NHEA 2Y9MB 3CLSC 4H7FA 2C83A 5A71A 2JGDB 3E9ZA 4PSDA 4ZDIA 3DKPA 3A1VA 2Y2UA 4LRWA 4OF4A 3K2IA 4G5OA 2QW1A 4RE6A 4PYNA 1L7NA 2WQ6A 1PDVA 3Q6NA 5LIRA 1F0NA 4ZYYA 3Q9NA 5B7NA 2H7VA 3IV9A 5B7GA 1FE8A 3RYHA 5BNWA 1BHO1 4YPFA 2ZE5A 3TLKA 3JYLA 2A14A 2IITA 3IHTA 1FS6A 1WB6A 2OAQ1 4G8BA 4J0EA 1SELA 2FSIA 3KOXA 3T4XA 5C5DA 2P2SA 4RGBA 1M8JA 2PWBA 2J7KA 3LQRA 1PCXA 5K3AA 4ZZIA 4KC0A 1M6VB 1QH1A 2H4ZA 3RO7A 5IAJA 3LCCA 3GJ8A 3LRXA 4MYRA 3T9CA 3ZI4A 4MO2A 4B17A 5B6IA 2VJMA 2IHJA 3MS7A 1SHLA 5I8WA 1P2BA 1M75A 4JOSA 4UHFA 3ICWA 3V1KA 2Q6KA 1TI7A 1T5DX 1Z38A 1QIFA 1GRVA 3LQYA 3NWPA 2XNDA 3X1WA 1QHIA 4LBYA 2P6OA 4L07A 1N5OX 2Q3FA 3AEUB 1NYRA 3DTYA 4LYJA 5FAXA 1CJMA 1RADA 1W88B 1YIAA 3NHBA 1N0HA 4GG1A 4E03A 1XCOA 3L7IA 4CUKA 1UC5B 4BX0A 4HH4A 2B8JA 5J23A 3ZK8A 1J5EB 1SNYA 4LHYA 5F2EA 4ME6A 2PSHA 1HG0A 4WFJA 1J06A 4Y18A 4D9KA 3URKA 3K6SB 1S3GA 1IUNA 1DDOA 3VOTA 1ZCBA 3AFHA 2Q5CA 5E3JA 5HKLA 3RWMB 4DV0B 3VSBA 2IVFA 1Z12A 1DHRA 3OZBA 3VOSA 1JHQA 2KBEA 2VP6A 3QXXA 5BT8A 2P67A 1MFPA 2MTBA 4ETNA 1JSZA 2PY6A 3ANTA 3I4FA 4IGKA 2Q3LA 4X1IA 5E0KB 1D0IA 4LOIA 3V8QA 4D6YA 1X80A 2CDRA 1XE3A 2B5OA 5IYZF 5LP6F 4LVNA 4OI4A 4HWPA 1Z7YA 2ZRNA 4OK3A 3Q7SA 5I7RA 2JJMA 3BHJA 1I51A 1NJFA 3N53A 1P3DA 3EN0A 1DXYA 3U60B 1RD4A 1AUPA 2KS6A 1M73E 3TW8A 3VYUB 1UH5A 3T1TA 2GEVA 5LDHA 4QM6A 2P4UA 3NVKI 1I33A 4E88A 1W1WA 2IPNA 2P8JA 3PGMA 4KYUA 4TSFD 5CK5A 5IMSA 1FTWA 2WABA 3IVRA 1PUXA 4N18A 1KXJA 2IF0A 2NPIA 3OWXA 3VVLA 1J7JA 4QECA 1IRXA 3PI6A 4IMIB 3GLFA 1IY8A 4OFWA 3V42A 2PGXA 4WKOA 1XMJA 4MVJM 4P4NA 3WRVA 1ML4A 2IEDA 3Q0EA 2BGTA 4DCNA 3FWKA 3S7ZA 1D03A 2QD4A 4B5LA 2NV6A 1UOOA 3MLBA 1E3IA 3R3WA 4NBSA 4OA5A 1Z5OA 3VYRB 1RZ3A 3ONWA 4KGXA 3AXSA 1ISJA 5GVSA 4JA2A 3DL4A 1ZGJA 4KI7A 4GM0A 3BK7A 2X3YA 1XTIA 3P19A 2D2VA 2X19A 1UC8A 2PX8A 3EEBA 3NVAA 3TSOA 3ZOKA 5AVSA 3UHAA 5HX7A 1D6MA 4BLOA 4K9DA 2WIJA 3ZJYA 5DHTA 2EVWX 4B6RA 2F3TA 3NR2A 3VTKA 4C0HA 1M0WA 1PP4A 1XLTA 1ZSVA 1N5DA 2BJWA 2QQGA 5HA5A 3GEMA 1T0UA 1RABA 2IZ1A 4LTDA 4HOYA 5BUQA 3U61B 3AEZA 3ZJVA 2A30A 1DBSA 3ITDA 1BNCA 4IIDA 4RIEA 4FNGA 3EMBA 4UMEA 1E9FA 2VDOB 3BXGA 2NV0A 3TOXA 3QI7A 3TGWA 3M49A 3S6JA 3G13A 5IPFA 1EUQA 1CK4A 2W22A 2ZSAA 3K6RA 3Q85A 1O96A 4B2PA 3AUTA 3DTTA 5LQMA 3KETA 4LY3A 4BX8A 4YUXA 4QGSA 2ZTVA 1ZMRA 3OPQA 2ZZKA 2C5LA 5HZKA 3K5HA 3H8JA 1P31A 1K3FA 1CVRA 3KOOA 4C5CA 1APBA 2D3TA 3U1BA 4TL6A 1YAHA 3VR3A 3IODA 3DOHA 3NWJA 1XZ8A 3FGPA 3PA8A 4PG5A 4DA9A 4FS3A 4MS3B 1KO7A 3KSDO 4P2BA 1EFHA 5IDVA 2COUA 1UMDA 5DP1A 5BYJA 3KSUA 2YVKA 3X1ZA 1WPXA 1B16A 2VAVA 4ZU1X 4DNQA 2GUGA 3MJDA 3AG5A 3F3KA 4EGAA 3FOAA 4YCMA 1L7DA 2PS3A 3N59A 4E08A 1TVKB 2W0SA 3WL4A 2QG4A 1I0LA 4RD1A 1MABB 5EXDA 3W4IA 1W48A 4QLAA 1O95C 1Q0QA 4GLOA 4PU0A 4REOA 3M33A 3OJWA 5IWAB 3HEMA 4DIBA 5K4AA 3MLAA 1WCYA 3JQGA 1RRMA 5JSYA 2W70A 2GAFA 3KJEA 3WYDA 4B44A 5KX5A 3TOCA 4PO9A 1ZR2A 4I1RA 1SD1A 5D5QA 1QG2A 1II8A 5JQGA 2QRUA 3FE2A 4GKAA 3I8SA 3EDRA 4IS3A 3TI9A 3TLGB 3KQNA 3CQ9A 3VU9B 3E0XA 2GBCA 5IKOA 1HC7A 2HEIA 4Y2SA 4YC7A 1WZ2A 1Y6QA 2IDZA 2AYYA 2O1XA 3H75A 1TO6A 1ODTC 2RK6A 3OQIB 4NMLA 4DLYA 2GK7A 2RHWA 4QUHA 5AI9A 4I4TA 4IP0A 1PLLA 3PL5A 1TKRA 4EVSA 1Q7CA 2RHMA 2PUHA 2QT9A 3MTBA 1XMVA 2LNDA 2W2NA 4B8YA 5KWIA 5JJ5A 4AQYB 3AVWA 5A3VA 1V39A 4JDPA 1HE4A 3WRXC 1CYEA 3H1AA 1Z29A 2ZUFA 4RTJA 4K8OA 2IYAA 3H19A 3A3OA 2WKPA 4BZPA 4PZZA 3S99A 3UXHA 2XUFA 1YB1A 2XUGA 3LLMA 2RGWA 3NH6A 1ULSA 3ELYA 1MJ5A 3GOQA 3JQ8B 5H80A 2CLSA 1RHUA 4DHEA 3BGVA 5G4KB 1X1RA 1IHOA 1OC4A 3RWBA 5ITWA 2XVAA 2Z83A 3TM4A 4CN9A 4BY9E 2FZ4A 3PD0A 3UC9A 3JV7A