3HFRA

Crystal structure of glutamate racemase from listeria monocytogenes
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
266
structure length
266
Chain Sequence
AMKQAIGFIDSGVGGLTVVREVLKQLPHEQVYYLGDTARCPYGPRDKEEVAKFTWEMTNFLVDRGIKMLVIACNTATAAALYDIREKLDIPVIGVIQPGSRAALKATRNNKIGVLGTLGTVESMAYPTALKGLNRRVEVDSLACPKFVSVVESGEYKSAIAKKVVAESLLPLKSTKIDTVILGCTHYPLLKPIIENFMGDGVAVINSGEETASEVSALLDYHNLLDATDEEIEHRFFTTGSTQIFKDIAKDWLNMPDMTVEHIKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Glutamate racemase
publication title Crystal structure of glutamate racemase from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
total genus 91
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature ec 5.1.1.3: Glutamate racemase.
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hfrA02
3.40.50.1860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hfrA01
2JFOA 1ZUWA 2DWUA 2ZSKA 5ELLA 2W4IA 2OHOA 5IJWA 2GZMA 2JFQA 3ISVA 3OJCA 2DX7A 2JFPA 2VVTA 2OHVA 3UHFA 2JFYA 5HRAA 2JFZA 2JFUA 1B74A 5HRCA 2OHGA 2JFXA 5EVCA 3S7ZA 5HQTA 3UHPA 2DGDA 3OUTA 2JFWA 2JFNA 1B73A 1JFLA 3HFRA 5ELMA 3UHOA 2EQ5A 5HJ7A 3ISTA 3S81A 2JFVA 1IU9A 4B1FA
chains in the Genus database with same CATH superfamily
4QBKA 5EXEA 2BISA 1J33A 5J43A 3GJ0A 4XX0B 2FU5C 3OF5A 4JELA 4DTCA 5ADWA 1GEGA 3PR1A 4L3OA 5TEWA 1H85A 1WV1A 3MYRA 1FS4A 1TCVA 3MRVA 5JH7A 4M2LA 2PXXA 1B0ZA 5TGTA 1L5YA 3HLKA 2WMOB 3NV9A 4TUYF 4CIYA 3QPDA 5M04A 3FTFA 4DANA 1X9GA 4U63A 2JIZA 1CUJA 3KDPA 5TGZA 3U3KA 1J00A 3MCTA 1HGXA 2TRSB 2CZQA 3IPRA 3BWDD 1E60A 2EWWA 4NEHB 1P6QA 1OLSA 3PTZA 3I62A 5K3CA 2EFGA 1EVQA 1D1SA 3RABA 3ROFA 4ZZIA 2P6PA 4MAFA 2HU2A 5JXJA 4P38A 3EGDB 3I42A 4LGCA 3LTEA 3WWYA 5TLSA 2HU7A 1FRZA 3ZIDA 3DCNA 3SLKA 1I4WA 5DLQC 1LQ2A 5BSRA 2CFOA 2W4MA 4DC1A 2DR3A 2JS7A 3LBFA 1O0CA 3AUSA 4TT3D 3U7QB 2JCGA 3DBHA 3E1GA 4LKRA 1HZZA 1G18A 3DB2A 2AI1A 3O2SB 5FBRB 1R15A 1EI9A 2P9FA 5J63A 4KOEC 3UHJA 1FUEA 1DI0A 1UDCA 3GJZA 5LWQA 3IVCA 1SHLA 4LJKA 1YS9A 2EZ4A 3L92A 2EJCA 3PFKA 5E1DA 3JAMA 4PO3X 3P20A 3VC1A 3ONEA 1BDMA 1J2TA 1FOEB 2WM3A 1W73A 3KBBA 4LFBB 2GXSA 4OYYA 4IZHA 1B3BA 1TOAA 3VJRA 3EZFA 3VH2A 1WX1A 3ZVKA 1XPOA 3PNMA 2JJQA 2C57A 5M3BA 2FEOA 2TMYA 4JODA 1EXMA 1N2IA 3KLNA 5F1YA 4E88A 4D56A 4S35A 3H0KA 4IAOA 1E77A 5FP0A 4GSLA 3DMRA 5IM5A 4FMDF 1G98A 4ZQFA 4PGMA 2X0NA 3A7DA 4Y0NA 5IXSA 1BCSB 3V8RA 1LDNA 1JSCA 2V7XA 3T5TA 5ALYA 3ZGVA 1B2LA 3NHSA 5MFPA 2YVAA 3TRIA 4N01A 4ZTBA 1YI8A 1KETA 5JADA 4I5DA 5BVHA 2VAXA 4M49A 2X6QA 2YOHA 3L0PA 1L4LA 1WPQA 1Q1GA 3CNQS 3IEUA 3LX8A 1NY6A 2GF2A 3EUAA 4L9AA 4O4LB 1DRJA 5KVSA 4KU4A 3WNVA 1XLTC 2Q6LA 3BRQA 4XWYA 4CR7A 3HNOA 3D7LA 4MW4A 1K86A 1TUGA 4ZICA 5MN6A 1C1XB 1MU0A 1UC5B 2W2NA 1KBZA 3KJIA 5CCXA 1L1QA 1IPFA 1PJQA 1L3BA 1KDZA 5FOQA 1UK7A 3SP1A 1T0UA 4Z8XA 1H93A 4F4JA 4RTKA 4BJ5A 1ICIA 1VA5A 4R2JA 4RULA 2FP4B 4NHEA 1D6MA 3G2JA 1DXOA 1Z07A 1EE1A 3JYOA 4WNCA 4BKUA 1I7NA 1NU8A 1TCBA 2W6ZA 2WMYA 5DCUA 2Q7OE 3VPCA 3VPGA 2C5FA 4EHJA 3NVKI 1UIMA 3H8WA 4UEQA 5TMEA 5CHEA 1JEQB 1XVVA 3WGUA 4W4TA 1PWZA 3EUEA 4DR6B 3H11B 3OX4A 4KR0A 3WLHA 3EXFB 4Y30A 2IJGX 3GB9A 1K3FA 4D9IA 2W0SA 3EWNA 2WRZA 3AEKB 3GRFA 2DCMA 3MT7A 2XNDA 5JNWA 4KXWA 1GGNA 5J47A 3EOBI 2CNKA 2I2XB 5AP9A 1XTPA 3DOHA 4GVLA 3K8YA 4MQBA 2IEZA 3GLGB 2QUKA 3EVNA 5FOVA 2OYCA 3FETA 1AUXA 3QFHA 5JSQA 3GV0A 2XSZA 3QPAA 4G86A 1A2OA 3S81A 3H4IA 3DDNA 1CSEE 4R2IA 4R69A 1VDZA 3VYTB 3TE6A 5E7JA 1QU3A 1KQ3A 1J2YA 3CRVA 1SXQA 5KYKA 2NSHA 5GZ1A 4DHWA 2IS2A 4YAGA 1XU4A 4HLQB 3RC1A 5AESA 1E2JA 2YY7A 4OQNA 2FETA 2PJDA 4CMBA 4QBIA 2YXNA 3OLYA 4AP6A 2O54A 4WDRA 3U5TA 4CQMB 4CTOA 4EY6A 2VWGA 3W5AA 1M7GA 4WY8A 1JEYA 1A27A 2PN1A 4BZZA 3B2QA 5DNYB 3IP1A 1XU7A 4LRYA 1SUDA 1JV2B 1TPYA 2PIDA 3OLZA 1QZXA 2EVWX 2R8YA 3F47A 3AKCA 4E3WA 2W2XA 3ZS9A 3HFRA 3IQHX 5IMBA 1IJFA 3CWZA 1QVRA 2J41A 4PZZA 5C4GB 5JALA 4KBYA 3R77A 4PG6A 1RPAA 3I39X 4KQXA 4RXTA 3WLSA 1RD4A 2BGJA 2SBTA 3B51X 3KAJA 2Y27A 4O63O 1Z08A 5JHHB 2XMSA 3L1JA 4D8YA 4AMBA 3TAUA 3TKYA 2VRCA 4B6QA 3ZVMA 4TXJA 1WMFA 1J25A 1Y4UA 4PC7A 3CA8A 2C29D 1BH2A 1R0WA 2ZSBA 2YFYA 2FUNB 3N87A 5ARCA 5LZ8A 3TTSA 1DC6A 2OR3A 3B1ZA 3ILSA 3ZIAA 2PUVA 1W36D 2ZUVA 2ZBQA 3GAAA 1GEEA 2GEJA 1OYVA 3OJEA 4QPZA 3CVUA 3HMQA 2XT6A 4FSXA 3C1TA 2CFIA 4OAQA 2I67A 4R6XA 3TXAA 4MUAA 5CLFA 5LQMA 2Y1FA 3RIGA 5ITZA 2XVXA 3EZNA 4OHPA 4ZTUB 1KJ8A 1WABA 3L0CA 2AKYA 3LUBA 1G6OA 1QC5B 3ETCA 1QGUA 3SZLA 5KMGB 1L4FA 5CU7A 3T3IA 3KYBA 5FPPA 1JAYA 3LHIA 5F7JA 3P1JA 4O1MA 2YQ4A 4IIJF 2A5DA 1E1QA 2NU6B 1YZTA 3OUUA 3N8NA 3SXJA 1HC7A 3CCBA 2XNDD 4PLWA 1X80A 2QB5A 4I4CA 2XTAA 3OO1A 4DDVA 1J2EA 4MI9A 1TIKA 3R0ZA 3IR5A 2W90A 1SBIA 3SHWA 4HYTA 4YHHB 1GTSA 2J3IA 1E3EA 3FJ1A 4TWBA 4LE2A 4DG8A 1UBFA 1UINA 1K97A 2OXEA 4UNPA 4H16A 1IN7A 2XSZD 4EPXA 2G5TA 1SEPA 4II2A 4E6EA 4E6PA 2O8BB 1N8SA 3A1SA 5TJ9A 4NH4A 1N8TA 1U2GC 2XKKA 3FPCA 3PLNA 2HLNA 4YI3A 3OVMA 4CLHA 2HBRA 5DBOA 1AKWA 2Q9BA 3BIXA 5GMOA 5H83A 4AJ1A 4EY5A 1CUVA 4AC9A 2CLSA 1F38A 1LZKA 4MV9A 1GA1A 5DOVA 1G3IA 3AEZA 5FTKA 3W90A 2RMKA 3Q8MA 3EPHA 4L0CA 4O0LA 2FA9A 4RC9A 2ZTSA 4ENSA 2Y66A 4IQGA 5JFGA 4V03A 1QANA 2K7FA 1W6UA 2K2WA 5EQJB 2IH5A 2D2FA 4BAZA 4YS6A 3MINA 3ITDA 1D1QA 4ZZ2A 4OG2A 1YIAA 3K0FA 3OZWA 2PD4A 2X5NA 2ZOSA 2FPOA 4A91A 3WYAA 4DUGA 1NF9A 3TINA 3IEVA 1ZM9A 4OU5A 3SYLA 3VPSA 3RYFA 2NPFA 2GAJA 3WGOA 4F46A 3KEMA 3G6KA 4DV2B 1NNEA 2VRCD 1AKTA 2PMFA 4PANA 1RAEA 1AB5A 3RRNA 3T34A 4EZIA 2YZMA 1X7ZB 2WHYA 2ZJ6A 1KS9A 2D4AA 1AKEA 3ZIAD 3A4YA 1JDZA 4JEHA 3QF4B 1M2VA 3ND5A 1I6WA 1L4HA 4JENA 3UJBA 4PYIA 3Q8WA 4Z3KA 1SUEA 2XWPA 3CJQA 4UHHA 1R4NA 5BN5B 5A9TA 3BD6A 3CH6A 1SU8A 2GNAA 4DWWA 4A92A 1E64A 3DKKA 3IDAA 3P2YA 1P5RA 1C7IA 3CZCA 1FL9A 2P65A 4IQ0A 4F2DA 1ZBDA 4JS0A 1NW6A 4MYDA 2J5KA 4YJGB 3MJEA 4QREA 2NPOA 4LNUB 1KFKB 1BGXT 1E1QD 3ANTA 1KBOA 2ZKIA 1RXYA 3NVAA 2C3OA 1XXHA 5BNTA 2NSLA 1GRNA 2BGNA 3K6JA 1FLNA 2H52A 3E5RA 4EO4A 2IY8A 4O4HA 2AQIA 3R76A 3G6WA 4HGPA 4QEDA 4W1QA 1DQZA 3A1CA 3OZIA 5A1TA 1CFJA 1FQWA 2AI2A 3T1OA 4TL8A 1HFKA 3QVGB 3B36A 1C4OA 1I7LA 4B6PA 2FJPA 1VSTA 5ALMA 4KQJA 3GNSA 3QA9A 3MBOA 1JFSA 1NASA 4G0OA 5DBHX 1L4GA 3WOHA 4X7MA 1H6CA 3FNQA 1D4OA 2FEKA 1ESCA 3B7WA 3I3OA 3QVJA 3R5TA 3EGEA 3I04M 1EUYA 3GCDA 4FCVA 3C6YA 3FTDA 3R6DA 4QBTA 3SI7A 2Z5LA 3D7SA 2OC9A 3BHNA 1JXMA 2JLBA 1U4OA 4HAXA 4YQYA 3TMKA 5KTTA 4G0UA 2YR0A 1PQUA 3DQPA 3U81A 1FP4B 1D2CA 1ZQ9A 2AFHE 2VI5A 1BEEA 1T6NA 1AU9A 1G8FA 3QFTA 3IPCA 3ASVA 5AM2A 4RWZA 2QRKA 4D4GA 1X8JA 3IDZA 3TYXA 3PR3A 3VR2A 4F93B 1KVTA 3U4QB 1XCOA 3ZPXA 4EZEA 4IIHA 4CG2A 2JI6A 4DUGD 3NXKA 3ZHBA 4LYFA 2QW8A 4CMIB 2WK1A 1FCJA 3L1UA 3GFQA 2PS3A 2V6FA 1MN6A 2FOIA 4DCVA 1IHDA 4WACA 2RIRA 5LQDA 3GPLA 3NBYC 5K0ZA 2VQSA 4ZDIA 4I9NA 2IVZA 1HDYA 1P2TA 3H1TA 5EXPA 4XASA 5KTOA 1II8B 3HBJA 3Q85A 2HC9A 1KEVA 1W9MA 3UUWA 5D7BA 3U4GA 2GVZC 3OCUA 3ZU6A 2JJMA 1MA3A 3C1AA 3SE7A 3R41A 4B82A 4LWQA 3A27A 5FPKA 3OURA 1LVGA 2ZB2A 4BTEA 2O3SA 3JX9A 2GZAA 3JQFC 3D6MA 3W6OA 4L9SA 4CR8A 1QONA 4PN7A 4R0MA 1RW4A 2J87A 3E9ZA 5IVHA 5THQA 3T9AA 4JBNA 5CVVA 3W05A 3SC2A 1HT0A 2KLHA 3W2EA 3VR5H 4F9GA 2ORVA 1I4LD 5I9LA 1GVNB 4ZO6A 5B6IA 1HORA 2CNWD 1QGED 1TU4A 3NT2A 3ON5A 2JA2A 2O3QA 2B0JA 4L8VA 4U2EA 3WISA 5BVGA 2NO4A 4B79A 3ER6A 3NHLA 1E2NA 1ZN2A 3FCXA 4RD1A 3TQTA 5A4MS 3PC8A 3DE4X 2W2MA 1HTBA 3R0IA 5KAPA 3QEBZ 4MYUA 3HKEA 3MB8A 2Z2KA 3I6YA 3FYDA 2RC6A 2AXNA 2I7VA 5EP3A 5BRJA 1NHGA 4Q82A 1CT9A 1KIMA 3ETEA 3F0TA 4F06A 1OU0A 1ST3A 1XAIA 4H4CA 2GEUA 1RSZA 3E82A 5TQJA 2OECA 3A06A 1JLKA 4G26A 4DV3B 2CUZA 4X6YA 1EFPB 3UTCA 2Z1MA 5D86A 1Z8HA 1NP3A 3VYWA 4E7OA 2IUTA 5IKMA 3PXBA 1P1JA 1ZC4A 2Z4SA 1RHRA 4H1HA 3ZGNA 1DL5A 2IYPA 3AUTA 3QEMB 4XI9A 2D0IA 4U8HA 4ZVRA 4OI4A 3KQNA 4MV5A 2E55A 5EINA 1DXYA 4ND7A 4J3NA 3RB8A 3VR2D 3D1VA 4NBUA 5DM2A 3WBBA 1KJJA 3RVSA 3ZWMA 3E9DA 1CJKC 3H9UA 2ZUSA 2AZDA 4DYVA 1Z6ZA 2X76A 5ILOA 2H1VA 2JZCA 2FF7A 3M6VA 3WMXA 4ZAGA 2P4SA 3PDWA 3Q3JB 2CXPA 3C15C 3HCDA 2HK9A 4I6JA 4JXJA 4V0NA 4BFVA 2AUNA 4FSHA 5LQSA 1YRHA 2ZDGA 3L8FA 4ZMSA 5D3KA 3UGJA 4RTLA 2G6TA 5F21A 1WSAA 2A35A 4L4UA 1THMA 2J9FA 4IWXA 4R9RA 1AD2A 4HVCA 3NM6B 1GPKA 4BNTA 2HMAA 3EDMA 2I2CA 3RC7A 4ZOLF 3UUEA 4DCPA 3A6KA 4DN6A 2JJ8A 1UBKS 4C4ZA 3DO8A 1Y3FE 4EB3A 2WZDA 4F1JA 1C0EA 2IIQA 5KWSA 1BFDA 2BEKA 5IW8A 2V6MA 1JIXA 2VP9A 4GQBA 1W5TA 2J3QA 1U7HA 3ET4A 3JQ8A 2GHQA 3TEMA 1UXGA 2VJMA 4YBZA 1NBAA 1RAHA 3TLCA 1JHQA 2WTXA 3LC2O 1DJOA 1Z0KA 1K8XB 3PRHA 1WKVA 3DKRA 1NBEA 2R8ZA 4BBPA 4Q4HA 2YS7A 4TLMB 2AG6A 3I53A 4QD3A 2IELA 1TO6A 3BE6A 5HVNA 3LHDA 2IS1A 1E4OA 2ZJ2A 3DMFA 4QXMA 1JJ7A 3RCBA 5L53A 1IBLB 4H27A 2CEKA 3VNQA 2GO7A 3EEOA 4HTFA 3BXFA 1YCGA 1FYEA 1TLFA 1H05A 1ZFNA 3D7KA 3EEQA 3WIUA 2HMVA 3T7EA 1RXEA 4GZ6A 1LWNA 3EGWA 1C7RA 2IP4A 3O5AA 2ID8A 2LIPA 1SCAA 3GARA 3PFBA 4GPZA 4PG7A 1C30B 2PX2A 1CU1A 1PWXA 2R6R1 4C29A 4ER7A 2P9EA 2PUAA 2PG3A 4LFAB 5JJKA 1PN3A 1N7IA 4LISA 4XCVA 4N18A 4I46A 5AKXA 3OF3A 4WN9A 2OWEA 3GH3A 3JQ6A 4GWGA 2XUFA 2BFEA 2FOXA 3QVTA 5D8DA 4OQEA 3RV3A 2ODAA 1NULA 5KC9A 1TZKA 4NNPA 4H35A 4AIRA 3HB4X 2OCLA 2BFWA 2QP4A 2YJ3A 4WCFC 1TKAA 3BREA 4KW7A 1VKHA 1F9AA 4IGKA 5K3BA 3SJBA 4ARZB 2YWBA 2V97A 4HDNA 3T3DA 3ER8A 3WRWA 4ZCSA 4UAGA 3OCYA 3HHPA 4YRMA 4F4UA 3JWJA 2GKGA 1RIIA 1XYYA 2X0RA 3HB7A 1O6FA 3ETNA 4FYKA 3RIHA 1AQ6A 3GFPA 2OSBA 3NPMA 3UMRA 3ZWAA 1WSBA 3RVBA 3GFBA 3HEBA 5TF4A 2QTMA 4RZXA 1WG8A 4FNAA 4HEQA 2PUTA 1LDEA 2P9HA 2QQGA 4XLZA 5G0WA 1F3OA 3QLEA 2JZOA 4NCAA 1FDOA 1PVDA 2QTAA 3H9EO 4JV5B 3ZJVA 3E0XA 1U4SA 3RJ5A 3NBXX 2WAYA 2C9ZA 3BF7A 4D42A 3OOJA 3C5CA 2F00A 1N9GB 2PKCA 4PO8A 4ENQA 2MINA 1K7EB 1LW6E 3VKVA 1UADA 2JG3A 1BEZA 1P2GA 1XC7A 1OIWA 1KKUA 2G1UA 3GJRA 3I2HA 2XMGA 3G49A 1VIVA 3HVKA 3KQOA 2FPGA 5AMXA 2Q1XA 5IBRA 4ZA2A 4YXWA 5CDFE 1M1YE 3DOCA 2GSDA 4NCNA 3ND8A 2PYIA 1T4CA 2W6MA 1DTSA 1EWKA 3L6RA 3U4HA 5BUCA 3TR6A 4ZVKA 1H0RA 2QF7A 4DRXB 4Y9SA 3WA6A 4L8GA 1C8BA 1UBJS 2BGTA 1E2MA 4AJHA 4DXHA 1U9CA 4Q7LA 1FSZA 1UAAA 5HSGA 3DWIA 4C2AA 1FDRA 2PBLA 3FVQA 4UHEA 3GH1A 1L5RA 2WW8A 2CXSA 3NTRA 4M6WB 2O57A 1CWUA 5LQNA 2VHXA 4IUYA 4MWEA 2HPZA 5BR7A 2VSOA 1PJLA 2A78A 2I66A 1NYLA 3JZAA 3K96A 3C97A 4FMPA 3N8DA 1AKVA 1NLZA 2XTMA 3C14C 4GOMD 4BNVA 3A26A 1VLZA 3AGPA 4L0QA 1K66A 1XVUA 3GAFA 2WWYA 3BFKA 4K9SA 4WRRA 1E3SA 2ZU0C 1Y1KE 4HS4A 3R7WB 2G1KA 2OB2A 4G0WA 2X8WA 2BZ0A 3UWMA 2D2VA 1ACLA 3D5EA 5LIPA 4J49A 4WZ6A 4YPFA 4F38A 1KIAA 3D3EA 4F1WA 2BSAA 3QBJA 4M0UA 4EP1A 3RG2A 4QM6A 1Q3HA 1UKEA 1A04A 1EAYA 1L9XA 1OFVA 1JXQA 1LBIA 1R0ZA 2GEBA 3K8OE 1VPVA 3LHFA 4QRIA 5CLGA 4BFZA 9ABPA 3AIIA 1AHIA 3ERCA 1K7FB 2QRHA 4CF3A 3HCWA 5JD3A 1U2ZA 4RSRA 3OOEA 4UU0A 1DC5A 2N0SA 3HDHA 3ZJ4A 4ER0A 3K1AB 3FZGA 3R9WA 5U9CA 4L8WB 1SC6A 1R5OA 4M88A 1XB2A 3KQSA 2NW6A 2QX8A 2YDYA 3II6X 2C97A 3BCRA 1NC3A 4IHJB 1L7AA 2ZTLA 2BTQB 3SSOA 1HEYA 4W63A 4AZ0A 5CA0B 2A5LA 3VQTA 5AQEA 4W5JA 1G5IA 3T9CA 3JTMA 2DUMA 4JUFA 4NYIQ 1QFXA 1X39A 2GBGA 3FTPA 1EIZA 3BMQA 3RWOA 4IKEA 1V47A 4IEFB 4V0QA 4E33A 2YRFA 2YS6A 4RIEA 2G5CA 3PJGA 3VU9A 2HF9A 5CFNA 4IDHA 5IX8A 1JPNA 4WJZA 2V54A 3S2EA 3ZV3A 2M6SA 3KKLA 3I8OA 2Q07A 4KH0A 4OIMA 4YXWD 3C3BA 1EDEA 1QM5A 5CPBA 1LPMA 1XNHA 2WKPA 3V8MA 1D0VA 1WAMA 3WNQA 4EMSA 4DV4B 1W581 1CERA 2D1FA 3H84A 2V45A 4LV6A 5TVKA 2HX1A 1FDTA 4IIDA 3RK4A 5CDGA 1ISPA 5LM3A 1HURA 4ZJYA 2VHTA 3GGPA 4MHOA 2AFIA 2FWJA 2AXQA 1FFCA 2I2FA 2LNDA 3DMTC 4XR9A 4MR7B 4COOA 2AKEA 1CTQA 1DRUA 2VBIA 4MUNA 3RE1A 3B1XA 4B09A 2GLXA 5TVGA 4LDJA 5GOTA 4UQLA 5LNK1 3T1TA 4TKUA 4WE3A 2JI8A 2RK6A 3M33A 2VF4X 5CNJA 1L7MA 1RLTA 3AU9A 4WCDA 4X45A 1ZPDA 3G2PA 3MJSA 4ISBA 4V0RA 5FFNA 1KO7A 3I5XA 4YRPA 3RTBA 2P9ZA 1KJ9A 2CHUA 2QWXA 2W9XA 4AZ3B 1E3JA 3IEKA 4EB6B 1G59A 5BW5A 4KVGA 2Y1DA 1BDBA 4ZT7A 1CPYA 4CHTA 1F2UB 4Q3AA 1SG9A 3G85A 5IP5A 4DA9A 4OQYA 2QW0X 2BFDA 4D2IA 5AQ1A 1TAHA 1KI7A 1POWA 2BM9A 3C6XA 1UM9A 3QIVA 3ZCTA 4JLMA 1JYEA 3M81A 2D2XA 5ABPA 1ID1A 4JLSA 3PT9A 2X8AA 4QYWA 5I9MA 3LQQA 1RQGA 5TT1A 2GUGA 1QVAA 2OCGA 1S2MA 3OI7A 2ZTVA 4IX9A 1W19A 1X1QA 2VTKA 3RT1A 2OV2A 3VZPA 1X14A 2DVMA 3HMKA 2G8NA 3DM9B 4B45A 3N58A 5ALNA 3TG8A 5EA2A 3ROGA 1N34B 5IM4F 2BWJA 3Q72A 3W1EA 3MA0A 1MABA 1C1HA 5LXTA 1Q1AA 2EERA 5IKPA 4NOMA 2ISSD 1T5OA 2JLUA 2B4AA 2BFBB 2ZREA 3BIJA 3PRJA 4XD7A 2E4VA 2QT9A 4DNPA 1XDUA 1E4VA 3JATA 3NGMA 4G0MA 4MIEA 4QAQA 2OAP1 1A4RA 2R68A 3DL2A 3U4DA 3DAYA 1HE3A 3PWZA 2HSZA 2PDAA 3WHPA 4ENWA 5BN4A 3P94A 3LOQA 1XZDA 1PFVA 3U1VA 4QKQA 4J4TA 1DE0A 5M29A 3RYTC 1XZMA 3IFSA 3BZWA 1X7YA 5KWJA 1GCUA 1N9ZA 5FV4A 1VXOA 3D8RA 4RENA 3GOHA 2QZSA 4HO1X 1PV4A 2O8CB 1LGYA 3B20A 3LNTA 4IBOA 1EWQA 2R8BA 3JQBC 4JVNA 4KV7A 4BO8A 2OHVA 3F71A 3SWWA 4UREA 3B48A 2VHJA 2X8BA 4MKZA 4PPNA 5HGJA 3SSAA 3T1VA 3DMYA 1M8GA 2WNIA 3I8SA 5E1MA 5EFOA 3RRBA 2H07A 4FD2A 2EZ9A 3D8NA 3DDWA 1O4WA 4B81A 5C8VA 5CITA 1FDVA 2R4UA 1UANA 1V8PA 4L78A 5F33A 3DDZX 2KYRA 3H5VA 3TVTA 1BYIA 1PJTA 2WSIA 1YGYA 3MELA 4Q4CA 1EWYA 5ESRA 4BNNA 4RF4A 4OKIA 2IV7A 3VKFA 3Q88A 3LA6A 3MS7A 4CL0A 4Q19A 1K98A 2X3FA 4H7DA 3HZZA 3T4PA 5K6AC 4KACA 2DP4E 2R5NA 3IMCA 4QQNA 3QWAA 5DJ5A 4P83A 3E22B 4DR2B 2AB0A 1Q7GA 3K71B 5ILQA 4EKDA 2NUAB 3FNIA 3CMCO 3BTVA 3OHPA 3WHIA 1SIBE 4YRLA 3SX0A 4JKYA 4JI2B 2BM0A 2VK4A 3Q1LA 1BZYA 5DE3A 3PXDA 4WZBB 5AHXA 3X1KA 5CK4A 2ZEJA 3FX2A 1ZD9A 4X64B 3CVOA 3VXKA 2KHZA 4CQLA 2B7CA 2I0FA 3RDPA 2BOVA 4ZVUA 3NR2A 1Y3AA 5ICCA 3KZXA 2OE2A 5DISB 3DPUA 3R9IA 5B1EA 2H59A 3GJQA 1ECBA 1HSOA 1NLMA 1YDWA 2VDNB 5AJTA 3IQXA 4WXEA 3FFXA 5FULA 2MSKA 3BJRA 3M1YA 1SN7A 3V8BA 2VXYA 1I2MA 1WB4A 4XD7D 2VHYA 1Z0ZA 1KQPA 3EBOA 1OXMA 3E4DA 5JAPA 2GYWA 4PLVA 1SBHA 3PFHA 4I9GA 4J0GA 4OUKX 3AY3A 1JPVA 3EFOB 3X1ZA 2J0SA 1JQLB 5IBQA 1XDGA 3BZBA 5ALSA 4GMXA 1EP3B 2QRPA 2I4MA 3GZTB 3DXYA 2D6FA 1I9GA 3RODA 2CVPA 2VH2A 3S3TA 2GCNA 4S1VA 1NE7A 5BV8A 2AZXA 2BFAA 2FW8A 5LB4A 3FSEA 4QOGA 3AF4A 3D6FA 1OREA 1P77A 2H1OA 3FR7A 4YC7A 1J21A 1W46A 1XL1A 2Q0HA 4QYTA 4A0FA 1E6CA 1WVMA 2IHBA 3IO3A 5KSZA 2NU7A 1MORA 4JL5A 4BRUA 2BKXA 3EVTA 4I8IA 3WDSA 3ES9A 5E9AA 1W48A 3ICEA 1VB5A 5KAMA 5CEFA 2NSYA 5BR8B 4AUMA 1AV7A 3TK1A 2HZ7A 2C7QA 1NQAO 2B7BA 2AYZA 3OBBA 4JBWA 1DTEA 3C8HA 2IYWA 2UUOA 3AR7A 2A30A 1BQEA 1N2CB 4FS3A 3DT8A 4TTPA 1THTA 3I8XA 1IMJA 2AK3A 3QPWA 4NYIR 1Q6YA 2Z2IA 5ALQA 5ALDA 1AGXA 2ZE7A 1ZGBA 3OPMA 3I9NA 2KBFA 3LOUA 2GR9A 2ZYSA 2WAXA 4NX2A 5AXAA 2XMBA 4MVJI 2IYVA 1EHYA 1KS2A 2NPIA 3K9FC 1SZDA 5K51A 3RARA 3GLKA 3HSYA 4C4AA 2HXSA 4B80A 4PZ0A 4XARA 1TRKA 1NSFA 1NVGA 1C3EA 3L6UA 4PGAA 4JUDX 1OXSC 3WQQA 4UHBA 1QCDA 5EP2A 1E1RA 4QGFA 4O25A 1W2HA 1J1UA 1K0UA 1PBTA 2IHJA 3C98A 1C0PA 1Z38A 4GI3A 5C3UA 3RSGA 4D9CA 5KZMB 1YJCA 1HE8B 4KIGA 5HCUA 1KH2A 3AQIA 1R6AA 2Z6VA 2Q3HA 2FZLA 4Y6LA 5T6BA 2P11A 3T9EA 2OO7A 3RS9A 4R05A 1GAEO 3CR7A 2FZKA 2ZRPA 3C85A 4DL9A 5CH8A 1NJ8A 3JTEA 4F72A 1DQRA 3FZYA 4R2WA 2BL4A 4NDZA 4PLZA 4W8HA 3Q0EA 1Z0FA 4IDDA 2WTAA 3AI1A 5CFMA 1LK7A 3QSYA 3NNNA 4CKEB 1AK9A 5DM0A 2ZIWB 2I2WA 4JKOA 3TZBA 2QGZA 5K3FB 3UJ6A 3OX2A 4WESA 1U2DC 4YCLA 1GZ6A 3IBTA 1R18A 5DGCA 1BMDA 4UUQA 4V0ME 1TD9A 2A5YB 4QXQA 3AM4A 3K9QO 2FI1A 4LOKA 2BMVA 2BW0A 1KTVA 3F8SA 4YH1A 1NRIA 5JMWA 4N5IX 2J67A 2VBFA 4NS4A 4K0RA 1G9SA 3FHCB 3O82A 2BFFB 2EHJA 3T3GA 1K6MA 3E58A 1S2NA 2A14A 2B4TO 4GF5A 5FBVB 4F9TA 5CH3A 3UJ8A 4DLZA 4F12A 4A0QA 5HP4A 3ZWNA 1W93A 1ULUA 4C2TA 1XQ6A 4U2DA 4XUDA 5J5AA 2BMWA 4DLNA 5K20A 2H2DA 1P1BA 3LHKA 3PQDA 4U7DA 3P9CA 3LT1A 1U81A 1GZSA 4GOKA 1FMLA 3JARB 4EAAA 1E92A 2NXJA 3FDZB 5EWJB 3MHTA 3D4IA 1E0AA 3E5NA 4M53A 1EM8A 2ETXA 4WXMA 3RIEA 1GPMA 4HZIA 3ZY2A 1LA2A 4EY8A 3V1KA 1FJHA 4P22A 5JD5A 4FEAA 1EKXA 2QAJA 3LT5A 2XZDA 4URHA 2YFQA 1JLMA 2ON6A 1S1CA 4KI0A 4TUYB 1T3GA 3GEPA 1OFTA 5AI0A 3WLRA 5JROA 2F3SA 1E9VA 2FJ0A 1SUFA 3HKBB 3ILHA 3L7JA 1GV1A 3R6GA 1E1RD 2OAGA 2P2CA 3DCIA 4UDYX 1GV0A 1N36B 2PT5A 3HN7A 1J8MF 1PEKE 1RR6A 1RWMA 2Z2JA 3M3PA 4NR0A 1VG9B 1VLHA 4UM7A 2ZSIA 2FUCA 4RD0A 4RV9A 5FPYA 1Y33E 4WECA 3RUHA 4V0SA 4ZFNA 4YDRA 6LDHA 1NPTO 1G7TA 3FFBA 3BRWA 1ZHHA 2QAGA 4POOA 4RAQA 3DLIA 4JLAA 3HR8A 2IPOA 2PGXA 4K05A 4BNGA 4XX1A 3MAAC 1KQFA 2WA1A 4Z4IA 4DSOA 2YIMA 2QNIA 3AEUB 4MDYA 1MJ5A 3DAOA 3CLUC 2HIMA 3O31A 1NXSA 1YCFA 5IJ0A 3BBPA 1TQHA 1CZLA 4C4PA 4KK4A 2GERA 4I19A 3R7NA 2Q4DA 3LIIA 1R0KA 3MJDA 4TZ0A 1J2UA 3QVMA 4PN3A 2R6FA 1SC3A 3DDCA 4F9EA 5FUQA 2BBTA 1U7UA 1YB1A 1J20A 4M0CA 3WKDA 3AESA 2FF5A 4FYIA 3IP7A 3ZTWA 4IYRA 1F2TB 5K09A 1QP0A 1EVZA 2C5HA 3B1FA 1JDVA 4PTLA 2P35A 4B4VA 2JRLA 3O8LA 2P68A 3KL4A 3RQIA 2PSHA 2QSZA 2ZPTX 3DOJA 3IVMA 2P6RA 1O77A 4M1MA 5JPDA 3Q6NA 4OHMA 1JH9A 3HP7A 3DWFA 3C74A 4BNFA 1JFFB 4PAMA 1BH6A 3FZQA 4DQKA 1PJCA 4X7PA 1E3MA 3I9JA 1LF5A 1Z0SA 4RF3A 3PWSA 4CV3A 4X84A 2Q9UA 5DTRA 4YLEA 3STUA 3UOAB 1HDCA 4Q9NA 2PUCA 1T8UA 3H9JA 2XT9A 4NBKA 1YZFA 1YUNA 1YE8A 2ZATA 3FROA 3G5MA 3PX2A 1KR5A 5MN5A 4RE6A 3HFSA 4H59A 4AP9A 2ZBDA 4MQEA 2FRDA 1J49A 1JWBB 1OBVA 3CIFA 3LRPA 4KLAA 4ZHQA 3HXOA 5FRDA 4C06A 3DBRA 1Z5WA 4MO9A 4MS3A 4S1OA 5T8KC 4GRAA 4HXYA 1DIAA 1R27A 3ZHYA 5TS3A 3KALA 3CLRC 4H08A 2DWOA 3EK2A 3UMVA 2GK3A 1KJZA 3DDSA 5DVZA 3GGGA 1UKAA 1FC0A 3WX0A 3D1LA 3GQBB 2EP5A 2VCHA 3GVIA 1J0XO 2RH8A 3B7GA 3L1IA 1ZGHA 3ICPA 4CETA 1XP8A 2GHIA 4C2BA 2VJQA 3NDIA 4URZR 1G6Q1 4HQ6A 4EKIA 5C37A 3WO0A 2VHZA 2IZ1A 1KORA 1ARZA 3JU3A 4XUCA 2XUAA 3K0AB 4LNAA 2OBNA 2FPSA 1LUAA 2V58A 1TYAE 2XKAA 2H7YA 3SE0A 4D4LA 2C8JA 1LWOA 3BSWA 1KSHA 2BF7A 2BGKA 2BM8A 2BM1A 2GJSA 1JEAA 1ZWKA 3UGTA 5BSUA 2YHIB 4QNMA 4IVQA 3TE7A 1DDGA 3DCYA 3BGSA 3KKPA 3O3MB 4CBVA 3Q10A 1IC6A 3DAPA 3EH2A 4NVRA 4WERA 4R54A 1EDZA 2PKQP 3U7RA 4BB9A 4KMMA 4TM7A 4UFOA 4F5DA 2AZTA 1H2XA 3C3KA 1NQWA 1TTPB 1SIUA 2D0DA 4I50F 3G9QA 1UWLA 3CO5A 5AH0A 1UXKA 3WLNA 4BP8A 1CXZA 2YWFA 2GBFA 1XJ5A 2WIGA 4XZ3A 1Y7TA 2NT3A 2GBIA 2WPNA 4X92A 2BHSA 1JKFA 5JSKA 1RXSA 1KAMA 1SD2A 4HAWA 4CKBA 1F2DA 3PQ3A 1UMKA 4CM7A 2BGWA 3QE9Y 3P9SA 1GNRA 4X8HA 1ZZEA 5I7RA 3W6UA 1AH2A 4F96A 1W8DA 3LF2A 1PJ2A 1VM6A 5GV7A 4DT1B 4Y0AA 2DLCX 2A57A 1ND6A 5CLIA 5KTNA 1JILA 1K6XA 1MGOA 1ULHA 4G5OA 4TXHA 4C1NA 2GI4A 4Q3KA 4Z3DA 3HB9A 2C4NA 2X3UA 3I3SR 3D0RA 1RCUA 4ADSG 5FQNA 5FWXA 4NJEB 4MYCA 3BL8A 3E4CA 5AJWA 1NUUA 3SJ7A 3H8SA 3UYKA 1ONBA 4PSUA 3C87A 3LQYA 4PO9A 4YUWA 2I8AA 3OEHA 1CKEA 3UWDA 3KQPA 3N59A 1XPRA 2OZLA 1XTBA 2BTEA 5EIXA 5AICA 1KL7A 3OKCA 2GKOA 2X1LA 4S0XA 1SULA 3EGXB 4R51A 1L5KA 4AG3A 1XALA 2CNLA 4TRNA 3S0JA 1KZ1A 1H2ZA 5I4CA 1T26A 3SLGA 4DLBA 1JG6A 3QU5A 4Z53A 1B8VA 3IBGA 1YL6A 3SR3A 4DUYB 1Q7BA 3W6NA 3PXCX 4UMFA 3VU8A 3MS2A 4X94A 3WG9A 5H9WA 1H8EA 2Q8QA 4IUCS 4A10A 4G1BA 1VLQA 2G77B 4RX1A 3V4FA 1W49A 3M6IA 4OFBA 2V6GA 2VDLB 3IV6A 1MDBA 1RJ9B 3U7GA 1GCAA 3RSOA 4RGVA 1J1ZA 1SKAA 3IVRA 3DSRA 1E1DA 4REQB 5A2QA 1A5AB 4AX8A 4IIJB 2XB2A 1L4BA 4HNUA 5K8TA 4UMVA 3Q41A 4DUPA 2RGEA 3B1VA 1O5TA 3B6IA 2QTRA 1D4AA 2KJQA 3K6KA 2VEDA 5HFNA 1ZSNA 2B8NA 3FDFA 4PBRA 3URMA 5KQRA 2GDJA 3P71T 3V7WA 1VMEA 3FCEA 1J9ZA 3GFGA 4OEHA 1JDBB 3IODA 3PF9A 2IYTA 2DFKB 4AKEA 3ESCA 1YS4A 3JQ7A 5LQKA 2HT6A 3ISJA 5DZSA 3K70D 2UZ4A 1CQPA 1I4DD 3P32A 2VJNA 4TTIA 3B3AA 3V1LA 3RI3A 1JIUA 2CDBA 3MQ4A 2AOVA 3CKKA 2FQ1A 3FLEA 4IHQA 3D6JA 1R4MA 3E7XA 1N3LA 2WSSA 4AXXA 1HOTA 1V5IA 4E70A 2OESA 4UD2A 5DEIA 3SIXA 4CN8A 1X87A 2GK7A 4KE8A 3X44A 3S1SA 2PAAA 1XMJA 1F5SA 1PFYA 1RP7A 4Z9FA 4H1VA 2W0MA 2XZPA 3LP5A 4GKAA 1RLUA 2WG1A 2VXBA 3DZ8A 9GPBA 2I6SA 1CRQA 721PA 2WHPB 4WAUA 2XDQA 3U6KA 3BSFA 4EGSA 2NVUA 4QL3A 3FLAA 5HQ3A 1BW9A 1TKBA 1FW8A 2HL6A 5CRIA 5H8WA 3N2YA 4OU4A 1GHTA 1KYYA 2P3LA 3OEHD 1EP9A 1QOPB 3OP1A 5ALKA 3D4LA 5BNFA 3ZHOA 1FSGA 4I3HA 1G41A 1STOA 2ZAMA 1Y5MA 3BK7A 3PDIB 4QUEA 4E22A 1KC1A 1VKZA 4G8BA 3AUYA 3I72A 4A6PA 1Y5NA 2GNOA 4RVCA 3ROKA 1FK8A 1YC5A 3HKCA 2PYZA 3VKHA 5KOJA 4PQRA 3WHLA 3F6YA 1QCYA 5FADA 1M1XB 1L5MA 1JMYA 2QHXA 2ECFA 1W5EA 1N5JA 1HYQA 1H8ED 1DAPA 2RGWA 1JAXA 1HDRA 2XBLA 3CNLA 1YFKA 3I5MA 4TTVA 4TV9A 5G0UA 3V42A 3WLJA 1GTG1 5LZ2A 3PL5A 1Q6ZA 1PO7A 2NUPB 4P4UA 4MMYB 4AU1A 2C2ZA 1NRXA 3LJKA 2UVPA 3L8ZA 4QBGB 2IX3A 1C1YA 3H4TA 3Q9UA 5J2TB 3CLHA 1IYZA 3LCJA 2X1MA 4N49A 4RA9A 1AE1A 4RESA 1UT5A 3CMMA 1J0BA 3K7EA 1FS6A 4LTNA 3R24A 4OK3A 4YMUA 10MHA 3HV2A 3ZDBA 4PHGA 4RIFA 4BEJA 2C5AA 2W5UA 3QV2A 4KI7A 3FRHA 3D2LA 4A8JC 2HHCA 1R16A 2JAPA 1JIQA 2ZJOA 3EG5A 5C81A 3J81k 1ECGA 5C4MA 3H75A 1FMTA 1HNZB 3VR1A 1SIOA 2NAFA 4L95C 3HVIA 1LS1A 5FOXA 2ZT7A 5B4TA 1WXWA 3RFUA 1YNOA 1JIKA 1PFGA 4RHCA 5L3VA 2WSSD 3GA5A 1PX0A 2JAHA 3L4EA 1PGPA 1SR8A 1O94C 2C3PA 4RSMA 1GSIA 2YASA 1X8XA 5KSOA 4X95A 3F73A 3ESZA 1F7UA 1UEIA 1H1DA 1L7NA 1CIVA 1VIYA 2O8VA 2YNMC 4JBYA 3E0QA 3KXKA 3L49A 4RBNA 5D5QA 5BSMA 3VAYA 2W93A 1YZ3A 1WU7A 3C1UA 3T1YB 2DPYA 4RF2A 5CXQA 4XTRA 4U0KA 1T3TA 5IJ9A 4BIIA 2YBEA 1T5HX 3BXZA 4GRDA 2P0EA 2GM9A 4NDNE 1GJRA 2HSEA 4ZEXA 3DEJA 3IB6A 4DJFC 1L4KA 2OV8A 3EEFA 3EPPA 4NG5A 3LU1A 1O08A 3RYCA 4YO8A 4Y8VA 4YPOA 1PL6A 1PV2A 3OQMA 3WL7A 1RIFA 2V7UA 4MSUA 1VKJA 1QDUA 4HCJA 4PPQA 4YRCA 3HVUA 4Q7KA 4FX5A 1CETA 5D6NA 5BR4A 1OV6A 5CYGA 4JB3A 1LBTA 3NTUA 4BKQA 3GCWA 2QUHA 1XLTA 2GRAA 2Q49A 3IMEA 4ZQGA 5BMVF 1FFSA 2FEPA 4KYVA 1NN3A 1X86B 3LNCA 5DYNA 3UAXA 1H1TA 1QPBA 3F1KA 3U39A 3W2FA 4AURA 4D9JA 5B4UA 3ZJTA 3ZDFA 5FPSA 3KKZA 3OLXA 2XMQA 4GOJA 4C07A 2A94A 1S9HA 1RM4A 1U65A 2GVNA 2RGUA 3ESBA 1QORA 4IS2A 4PU0A 2PRKA 3E18A 4I9HA 2ZSAA 3SDBA 1GNLA 4DA7A 5I8PA 1KRHA 3SX2A 3HSKA 3L0YA 4LC9A 1U2EA 2AC7A 5BQFA 1JAHA 2FN7A 4JGIA 4P8RA 4W5NA 3MTGA 3D2CA 2B1QA 3T06B 4FIDA 1JKJB 4PFJA 1Q1ZA 4MV0A 4HH4A 3J81A 1PS9A 1UZUA 2ODPA 2ACKA 3OY2A 1T0HB 3FRIA 4FNGA 1WUTA 3DVAA 4V02A 5DHAA 3PX7A 1TQ6A 1FYWA 4ZO4A 2QMQA 4K81B 5SYNA 2YUIA 2XLCA 3CX3A 3ROTA 2O8FA 1DS6A 3FCOA 1Z33A 4KIWA 3ZQJA 3LQRA 4PNHA 5A3QA 5AIBA 1G2PA 4REMA 3THYB 2DRIA 4JSYA 1K4YA 1ZK3A 2K6GA 1QF6A 2HMUA 3D64A 3GFOA 3GRPA 4FQ5A 4QUDA 2WF6A 3MJ4A 4IDQA 4F1KA 3KPYA 3RS4A 3T7CA 1MBZA 5IC4A 4AO6A 1ESEA 1MVNA 1K7SN 2Y1CA 2AVNA 2ZRBA 1Y4AE 3B70A 2A0UA 2CD9A 2ZI9A 4ND4A 1IUOA 3ZIUA 3JCZA 1Z6YA 5BUZA 3KWMA 2Y76A 3Q3VA 1GZ5A 2F43A 1TYDE 5I7OA 1J07A 1RJDA 1UPCA 4JVMA 3PKJA 1SUBA 3A6GA 4RMNA 3TLYA 4ARVA 3N0VA 1IXZA 1JX6A 4GVPA 1EFAA 5J2UB 3BKXA 5LKAA 4Z7QB 1DMRA 3K15A 2NIPA 1YUMA 4YJ2F 5AVUA 3KKQA 4HUQA 4Y1RA 3G7UA 3R0QA 1OC4A 3K9GA 3M5WA 4LCEA 1Z18A 2OZKA 4GZ5A 4KYIB 4UDNA 4XWTA 2RHDA 3AR9A 3SHTA 3DAFA 1KOJA 4ODIA 4O4JF 2Q4BA 4G8JA 1A2KC 2Q3EA 3DFMA 2ZULA 5KNDH 4FX2A 1EB8A 4C08A 3AHIA 4KR6A 4ZOLB 2PZEA 4V1CI 3QFRA 5F2KA 1ANKA 2OXRA 1SVLA 1GADO 3RW9A 3WK7A 2WVGA 5KSYA 5DWVA 1W1WA 4LW8A 1KYXA 3ZZUA 1YC2A 1BWPA 1HQYE 2NTEA 3ECAA 2BEWB 2XI4A 5A9SB 1Z34A 2OMEA 3ABSB 4RS4A 4B5LA 4W6QA 3GRRA 5KPDA 1EHCA 4C6TA 1QDEA 1LX6A 1YI1A 2WUVA 4G41A 1VG8A 2R7AA 1V1JA 3IELA 1GZDA 5B58T 3VOTA 2DERA 5JAUA 3NZEA 4IYJA 5HXAA 4W5QA 3AJ8A 4BFYA 5AKIA 2WP8J 2FE4A 3KTFA 4MV3A 3HCOA 3STVA 4ZDKA 3HA2A 1P1HA 1HG1A 2N42A 5KJ1A 5KYGA 1O5OA 1F06A 1N3YA 2B34A 3H1PA 2HAEA 4EGJA 3K5WA 4J1TC 4F8JA 4KODA 2BKAA 3TVYA 2OPBA 4M87A 2EGGA 2MWMA 3G0HA 4G8CA 1KDPA 4QPCA 3Q7EA 2VNIA 3NWBA 4PXYA 3IESA 4BGEA 1I3MA 3C8DA 3LWDA 3JVIA 2M6RA 3IJRA 2O9JA 1K8ZB 1ZVKA 4ALMA 4XVRA 2IS4A 3RSSA 1XD8A 3D6HA 2YVUA 5AW9A 5BSKA 1NVVQ 4E2ZA 1U0RA 1C4KA 3I05A 1U2GA 1MQ8B 1YB7A 2YRXA 3I1FA 5DEOA 5GAJA 4QPNA 1EUQA 4HMOA 2A5FA 2Q4RA 4Q3OA 4TZTA 4Y6RA 2NU9A 4Y18A 3W2TA 3PEVA 3ZHRA 4EPWA 4KPEC 4MDFA 1ZNXA 3E7DA 2VPTA 2GA9A 3C3EA 1VFPA 3VO2A 3FD8A 1QF7A 2EF0A 2JGDB 1AMNA 2EDAA 4BFSA 3I0ZA 3HR4A 1UFVA 4KLCA 4HMPA 4ZAWA 2BV3A 4A0GA 2FEWB 2JARA 4JN6B 4EMUA 3BG5A 5CGZA 5EKSA 1QGAA 2IEIA 2JLSA 1CYEA 4DCNA 1QK3A 1ZRHA 2HLHA 3F2IA 2ZM6B 4TMXA 3JASB 4ZKEA 4R7ZA 1YSCA 1T9HA 2OCKA 3BUSA 3P27A 4XWGA 1M5RA 4W8OA 5C80A 1HE2A 1GQOA 1LNSA 1ML3A 4V2UA 1BX3A 3DTVA 3SMQA 1ZU4A 5IUJC 2VA9A 3AUUA 5ALIA 5BYJA 1PVVA 6ABPA 5KJ6A 3TO5A 3DE7X 5F2NA 3LECA 2ECPA 4MXDA 2QX7A 3AKYA 5JRZA 2KM1A 2CNNA 5IT5A 4EGCB 3ANYB 1IONA 3ZE6A 3LMKA 3KWFA 3RC9A 1X7WA 4CKWB 2CSXA 1ZN9A 2ZJ3A 5FPQA 3FN4A 5C8YF 4P0TA 1GNPA 1VPEA 5TNXA 1JJAA 4KQ1A 3WGQA 4Q47A 4B6SA 5L7YA 2B36A 2JKVA 5A3SA 5CDSA 3DMPA 3CLTD 1DX4A 1QRDA 3W5VA 5A02A 4BNDA 4EY7A 2DFNA 1P1RA 3PUJA 4U7WA 1KBQA 2W2TA 3AL3A 1CJMA 2Z3ZA 1YB5A 3QBTA 3RIYA 3UXYA 3D0QA 3K5IA 2I9PA 2X2PA 1R0BA 4BGDA 3T9BA 4J1QA 4JUBA 1KTIA 2CJYA 4U7HA 2EX0A 1D0SA 1U1GA 1K4MA 4A7PA 4IW3B 4LE1A 4QXRA 4BO4A 1OH7A 2EFJA 4WY2A 5L4LA 3B2EA 5E9JA 2DBQA 2B4RO 2JGIA 4DNQA 1R8JA 1MTZA 3GCGA 3PNOA 4UBIA 4ALLA 2C98A 1EHIA 2CHEA 3KM0A 3L3BA 3QELA 3LUKA 1DRVA 4JI0B 4HRAA 2V74B 3PJRA 1H5UA 2EGHA 3UWOA 1OROA 5C18A 3OZAA 1XR3A 1ZOLA 1EGQA 4NNJA 2K87A 1L1FA 4KAFA 1Q1BA 2AK2A 5H70A 3FMPB 4KIUA 3WWZA 4R8SA 1TW2A 3NJ8A 6CHYA 1TQDA 1UMCB 4X00A 3C70A 3SNHA 4RTNA 2BFCB 2C00A 4JVSB 4LXXA 3G9TA 4E3ZA 3LH5A 2PNJA 1KI8A 2TMGA 5EIBC 1I51A 1MRNA 1HE1C 3IV7A 4CMCA 1E2GA 1GUBA 2EW8A 4NOLA 5AJUA 2HPHA 2AR9A 2WAMA 3AR6A 4E5YA 4LF5B 2JIBA 3RU3A 2HHHB 1EFKA 1ECCA 2JLRA 2WLTA 2J48A 3K30A 3PNSA 4JIGA 3W7BA 1H1LA 4JLBA 1TK3A 4H7PA 4YAUA 1VGQA 3DTVD 1EFVB 4Y67A 4V1CB 1RZVA 3EISA 4WOPA 1QIIA 3SLRA 1GU7A 5KKAA 3B53X 5AW1A 3PRYA 2JGMA 1LTHR 3HBAA 4RJIA 4ML3A 4Z9AA 1I9CA 2CE2X 4JK3A 1CE8B 4F86A 1JFTA 1QX3A 4EJ6A 1ISHA 3DHNA 2O5VA 3BDIA 3RKSA 4HDRA 4UBKA 1V95A 4MLCA 2NT4A 3EH1A 4TMZA 1S5PA 4YRIA 1NUSA 5BOSB 1JG1A 1TCCA 4S1PA 5LZ5A 3JQFA 5GM2A 3UAZA 5MN4A 3ZHCA 1I30A 4ZOQI 2G28A 4C3OB 2WD7B 4Z4GA 3GL9A 4QJBA 3CVWA 1PHPA 2B8TA 4WK2B 1DIGA 4FGLA 1L2TA 1SFRA 4JP3A 4GU5A 3LLUA 2K4MA 4JDPA 4KN5A 3JZFA 4RK7A 3RG8A 3TLJA 1H5QA 1O96B 3CZ9A 3GLQA 4M0LA 3AWIA 5KWEA 2NM0A 4CYMA 4NJOA 1YH3A 1OXTA 5AKJA 5EGNA 1NMSA 4U9HS 4R84A 2QTBA 4B85A 5HQTA 1ZDMA 2C3MA 5F64A 4J6FA 4O2BF 4LYYA 1NRJB 4MW5A 1ODLA 2ZT6A 3A3YA 4IO1A 4XYEA 1SOWA 3SQMA 1RRPA 4FQ7A 4AWBA 1TA9A 1HOXA 4FS8A 4INOA 3ZZ0A 2X5XA 1I94B 5EZSA 1BHO1 1WNTA 1A8SA 3IDOA 3L8GA 1MW9X 5KWVA 3DAHA 4S04A 1CJUC 3EPRA 1NT4A 3E3OA 1XMSA 3Q4GA 3K6SB 1P4HA 1PEYA 1GNSA 2EL9A 4G9EA 4WXRA 4FDVA 4LPKA 4I4TF 4HZUB 3LSYA 5CVUA 1U0OC 3ZWVA 4YACA 1QHSA 4CIBA 4MRVA 1E3WA 1QQTA 3RO7A 5WRFA 2D7JA 5E4JA 1NJ5A 5E9QA 1FTYA 2ZB8A 4WNYA 5GZ6A 2C94A 2MU1A 3R5KA 1GCIA 4A8TA 1DQPA 2DPMA 2P91A 4FEGA 3WLKX 1RP1A 1ZOIA 2CJXA 4LGVA 4I3FA 3P4UA 4JIMA 2HWKA 1K6JA 2VTDA 4NJMB 3WA7A 3A10A 3Q0IA 1T5SA 4KH1A 1IBMB 4F60A 2QLNA 4YI5A 3FCAA 4EG8A 4TZKA 2JHAA 1KY5A 3JQAA 1GUFA 3IOBA 3IV9A 2DEUA 5HMMA 1NLYA 1I0LA 1QB7A 2GESA 5D84A 1Y9DA 4J4BA 4PHFA 3OICA 2XKJE 4QBHA 1ZQ1A 1PW5A 2IYRA 3RVLA 1WLYA 3QLJA 1Q91A 3BEDA 3WQBA 1KDYA 2VSXA 2QD2A 2XBUA 3RK1A 3DH0A 3NEPX 4F3TA 1ZGAA 2ZRHA 3CVJA 4C4RA 2I4OA 4R41A 4RELA 3KVRA 4OL0A 4BQRA 1JHXA 3HGQA 1N6IA 2ACVA 1VYUA 1VZ2A 2XDAA 2C4TA 1EP2B 2WJ6A 2VWHA 1KHHA 3NOOA 4EO7A 4BX8A 1T0IA 1Q15A 1BFKA 1PQPA 2DAPA 2FSSA 2FUEA 1J39A 1PR4A 4Y2HA 1OZHA 1R9GA 3ZHVA 4TPKA 4BZXA 4UAUA 1HV8A 1GNTA 3OSZA 4RORA 3T38A 5ICSA 3GRVA 3I2FA 1SVNA 3ZK8A 2ILVA 3QV1A 2OYRA 1EGVB 4WDQA 2BHTA 2QTCA 3UAWA 3PRKE 5FR1A 5BSGA 1G5QA 5H3CA 1M6VB 1XPUA 2PVCA 1QQBA 5FBZA 5AHWA 3PQFA 1HE4A 3HYSA 1VIMA 5EMLA 2FEAA 4EA6A 1LDMA 1RRMA 3CRW1 3LPMA 5KKNB 2Y67A 1SBNE 4PICA 3SOPA 2QI9F 5A5DA 4PONA 9LDTA 2WR8A 2E4WA 4J0DA 5FWAA 1NUAA 2CVZA 2F1IA 4CEHA 1RAGA 3GEIA 1YZNA 4QNNA 1YQGA 1DBQA 2CXUA 1N2EA 2O1SA 2YMLA 1XJQA 2C7PA 4YAKA 1C3LA 3AI7A 4MWDA 1U6JA 3E03A 2AWOA 1VQ1A 4D0NA 1V11B 2VUHB 4WCFA 4EPTA 1BGVA 1DBRA 3KKOA 3P52A 2LPMA 3RT9A 3UJ3X 3MW8A 4LY9A 2QENA 4M1WA 3QU4A 3N2GB 4Q4AA 4ZVNA 2NUTA 1N8NA 4DAEA 4JOCA 1CRZA 3VZQA 3FYSA 1XGKA 2ST1A 4LHVA 2O52A 3W5DA 1NNSA 1EEHA 1L4YA 1XUOA 1PQYA 4MKHA 1J06A 1LLCA 2VIIA 1IEWA 2PIAA 3D59A 1U9JA 5AJHA 5EXTA 1A95A 4D6XA 4Y1FA 4NRDA 2F1HA 3JQAD 3G0BA 3UFXA 1HPLA 3AK4A 1RXWA 2AC4A 3NEAA 1JBQA 3BXXA 1J99A 1JDTA 4LNHA 4WFKA 4K9OA 3UCXA 3W5UA 2O7QA 2DQYA 3LYAA 1Q0ZA 4DNFA 2LZ0A 2ZIXB 3FTNA 2NP6A 1AO3A 4EVRA 6GPBA 2IZ5A 3TZHA 2ORWA 3AOEC 3N70A 4BC0A 1ORHA 4BN0A 1A9XB 1D2AA 2XZTA 4JQYA 1P2FA 1N3IA 1U8FO 3CE6A 3FVTA 4NZNA 4JOSA 5JZMA 1YRYE 3RNLA 3UWPA 1V3TA 1KSJA 4GR4A 3DGEC 3MK31 5HUHA 4LOJA 2HY7A 5SZIA 2FWIA 3OLQA 5HUQA 4JL6A 5LMUB 3CLSC 2EKDA 4PC2A 4O3MA 3F3SA 2R44A 2PJRA 4ZYZA 1T6BY 5AW7A 2OGUA 4YCAA 5DX8A 1SD5A 4Q01A 4AFNA 2J3MA 4BS9A 5LL6P 3EDYA 1ACJA 2X8LA 4HBZA 4I9FA 4ILKA 3ZK9A 4JLDA 1WJGA 5JAIA 3ZLTA 4Q18A 2H06A 421PA 2DQKA 5HOEA 1ZK1A 3A3NA 3BSYA 4OXXA 5B30A 3OIWA 3IBSA 2FK7A 2OV1A 2PA3A 4Q37A 3TZ6A 1NVEA 1CUZA 1F0YA 1KFCB 2BBOA 5D5HA 3CRRA 3CE9A 2QBYA 1P9RA 3W4JA 2A8YA 5GPBA 5DNDA 3WB1A 3COWA 1LU9A 2QDKA 4G37A 4BX3A 4C43A 3PDHA 2V5UA 3KHTA 2QK4A 1EXNA 1XRLA 4BDSA 3LFUA 3FLBA 1FFWA 1ZI6A 4K40A 2D4HA 4TMFA 2OLJA 3MWLA 2H5JA 1OAOC 5EKTA 2RSLA 4K8OA 1SCIA 1H2HA 1UC9A 1YJ8A 3AJ9A 3GUUA 3HL4A 3P0RA 4ON9A 4PYLA 3ZCRA 2P4EA 2PLAA 3SSMA 1G1MA 1ONOA 4DUZB 2A5JA 1QB8A 2BMAA 1ZUWA 1DDIA 3M70A 2A9QA 2O7VA 2OKGA 3VVBA 4I7EA 1PT7A 2SKDA 3WL3A 4MLPA 3NKFA 4BNHA 2UYQA 4PTZA 3PXAA 2JGNA 3K9BA 4D9HA 5LD2B 1TO2E 5J3JA 1H69A 1W85B 2XRYA 2RI6A 4YRRA 4CMHA 4EI2A 3THXB 2QOEA 3OT1B 2HW8A 4BECA 2X2FA 5GIOE 2OORC 3WLIA 4KRGA 5TY0A 2QGNA 4BRSA 2EXXA 5G1PA 4EABA 4KYTA 1LTQA 2FW9A 1U3CA 5CMLA 4ZIRB 2J45A 1NBHA 2XD9A 1GXSA 4PAGA 4RHFA 2ZVDA 4YMIA 2AFHB 3ZGXA 2QU8A 1Z75A 2QV7A 2GEFA 3C6BA 5KX5F 3N7TA 4BN5A 1B43A 2IUFA 3RHTA 1AS0A 2FSIA 1JB9A 2GAIA 5F51A 2F1OA 1TU3A 4QTUB 2C2XA 3FNFA 4H6PA 4Q3CA 4WEQA 3SR4A 3TOCA 3A6PC 4X8MA 5JFTA 1F0KA 4AYWA 4BAGA 3A36A 4MUFA 2CVHA 3OF2A 3DMNA 4OATA 1PDOA 4OMCA 4UXJA 4M0MA 4PZUA 4RF5A 3M2PA 3L0SA 4XFJA 1TC1A 3AHHA 2QVCA 8GPBA 3NHRA 4X62B 2HADA 4MTLA 2ZKLA 3DMTA 5FTJA 2XE8A 5AXDA 1QGDA 2CNOA 4HMQA 4CF5A 1GL3A 1MENA 5KOHA 2RD2A 4HXFB 4LDZA 3LX6A 1E0SA 4P3XA 1MX1A 1P33A 1P7VA 2J30A 1YVUA 4J07A 3T99A 3WNBA 4A6DA 2NMVA 4DREA 5AW6A 3ZLUA 5EUBA 4LK2A 3STTA 2WJYA 3C8ZA 1YWGO 3RKUA 1DJQA 1KSFX 4DLYA 2YV3A 1ABBA 2IH2A 2DFLA 2OG2A 1S9DA 4R16A 4EYSA 2QLJA 3GN2A 4TVOA 5D5PA 1Y3BE 3GRAA 3LFTA 1YS1X 4C0JA 2ZVPX 2UYCA 4HWTA 1QIJA 2EC5A 1IQUA 3ISVA 1RHMA 3H19A 2Q29A 3DVRX 1ZD4A 4LYDA 1JR2A 5HBGA 3E70C 2R8RA 2W2QA 2RONA 3MCVA 2NZXA 1XL0A 2CJWB 4TM8A 3P2IA 2WY2D 4KQ6A 4R5MA 2FFJA 2RI1A 4ALKA 4ZU6X 3OC0A 4V2IA 3TVDA 1E98A 4UTOA 1E96A 3F2VA 3UMCA 4UAJA 3ZWXA 3I28A 1RQXA 4IMRA 1QJCA 4QO7A 1FP4A 1SA0A 4N12A 3C7CB 1YR6A 4QDJA 4KR7A 1WF3A 5EUQB 4IX1A 3PQ6A 1NU6A 1LLFA 1W4BA 1U8ZA 3PVZA 4GYWA 3BE4A 2XUIA 3NM4A 4MVXA 4XVHA 1U28A 5TS2A 3DZCA 5B53A 3S2SA 3VZBA 5JBIA 3WS7A 3W9SA 4UJ5A 1O6BA 2IXAA 1SC1A 3VNBA 1G9XA 3IBCA 2N46A 5EOVA 2XDYA 5LVAA 4KG7A 5FOWA 1UPAA 3IVGA 3MGKA 1Y5IA 3PE4A 1OTYA 2V8OA 3O83A 5HRCA 4IJQA 2AW3A 3E48A 4WNAB 3F46A 3SXUB 1OJ7A 2ZSEA 1EFDN 2IQIA 4P82A 3BAFA 3CBQA 4UM5A 4EI8A 1Y1LA 4YRDA 1ISSA 1II8A 2JFHA 2L17A 5AW4A 1QIKA 4HQNA 4MWGA 3PHGA 1GAWA 1JHZA 3FKSA 4Q7MB 4HGQA 2F59A 4BJHB 1UCFA 2QQFA 3KOWA 2ENUA 3JQBA 1N2OA 3UMSA 1O9HA 1VIAA 2EKZA 2Y0EA 5HK9A 2A58A 2PU5A 4M0FA 3VFDA 4D4HA 1KVUA 4ECEA 5LA6B 2C5EA 4BKRA 1MJHA 1VC2A 4X1OA 5FO0A 3TXXA 3X2FA 1Z63A 2H7VA 2A0YA 1V8FA 3IUSA 1BXGA 5KCMA 3CN7A 4HDKB 5JLAA 1XZFA 4GZ3A 3KR2A 2B5OA 2OFFA 1NW4A 3FOEC 1RRGA 1MGPA 1SVWA 3IKJA 1I2CA 4FDTA 4DR3B 3BHMA 4G1CA 3RTAA 5T7BA 2NYUA 4WN3A 4KBGA 2V4ZA 4Q21A 3NFRA 4AMVA 2ONYA 5LQCA 5L3SB 2R1UA 3QHPA 2ZBPA 3R74A 3EIEA 3A04A 2JKYA 1F4PA 3G82C 1E9RA 4CG3A 2GXQA 3DT6A 4W9NC 2MCFA 2I2AA 3JVEA 5K6AA 4DKJA 1EUZA 3TI7A 3AMVA 4JJEA 1E69A 1IHXA 5AUOB 4JR0A 5IU6A 3NBZC 3I1YA 2HV8A 3ZI7A 1AKNA 1N7GA 4BCDA 4HX9A 5K0GA 1YZYA 2C8KA 1GFSA 3K09C 1AKMA 4H7KA 4OLJA 2GT1A 3RTCA 5JZOA 1OB2A 1UBHS 1XXHE 2D2EA 4PR3A 2FVYA 4XE5A 4BN4A 2P5UA 4LDPA 3VGJA 1ORTA 1USVA 3KXIA 4H4EA 1Z4QA 1VHLA 4JEIA 8ABPA 1DFGA 5C46F 4YCJA 2VNHA 2X77A 1AA9A 2C0CA 2IC5A 4G5RA 1BMTA 1EVJA 1LS6A 1W94A 1V8DA 2Q5FA 4IFIA 2W6JA 1WCIB 1EINA 1RMYA 1IAVA 4PZCA 3U2QA 3NATA 4UCXA 3S8EA 1G0OA 2R7LA 4P33A 1G6HA 3G2NA 3I2JA 1M10A 3GLRA 3GPIA 4KYUA 2A6PA 2HHJA 4QU8A 1XEWX 2O4UX 4TRRA 3HZOA 4H7JA 1VG1A 2CHQA 4FDMA 3U61B 2ZANA 3TCXB 2GJAA 5I5GA 1OGJA 4NZYA 5EPOA 4E5KA 4XIGS 3HTXA 4PBTA 1ZMOA 4PSKA 3FKSD 4ZV7A 4ARAA 4KHPB 3G8YA 4Q34A 4E1VA 4BKOA 1DPGA 1MFPA 1ZWLA 3OOWA 4N48A 1SKBA 2XUDA 1A50B 1AF7A 4NQZA 1Z6XA 2HRQA 2QD4A 3L5KA 1Q83A 1SU6A 1C9KA 3W3AA 1YAHA 5DHRA 4X61A 3ECCA 3O47A 1E8MA 3DHEA 5DWQA 1E0KA 4TMKA 2D3WA 7GPBA 3GD5A 3JPYA 3M1LA 3VAZA 3NHUA 3CBGA 3DNPA 5JNUA 1GQYA 3QUCA 2IX9A 2DUJA 4Q7QA 3BCUA 4ZOAA 5C5CA 2A1TR 4HLUC 4E11A 1U63A 3G59A 1V35A 1ZNWA 2IF0A 2OCBA 3NXSA 3P0EA 3TOVA 3CC8A 4DMFA 2PO7A 3LVFO 4JC4A 1FB5A 3QLVC 5FKJA 5BO5A 3S68A 3HLYA 4Z49A 4ZARA 1T5IA 4N3CA 1RPJA 1OX4A 3VPBA 1M1YB 3CNOA 2PGOA 2DQZA 2CHVA 3PKIA 3QHAA 4CL8A 5B6JA 1N3BA 2WIBA 3BE5A 4YLGA 5IKOA 4ZKDA 4IZIA 1V6SA 5J40A 4WBXC 4BB6A 3U1TA 2O2XA 4OHWA 4BNMA 2UZ1A 1ORDA 1MHPA 5T3YA 3UT5A 5BV7A 1EFUA 2FSHA 3JQCA 4DIFA 1FFYA 1QH1B 1P5JA 3T35A 1U1IA 1GRQA 3D6TB 4ZMRA 4QGGA 1QYXA 1R0YA 2XCIA 3MHPA 2FV8A 4CCWA 5EHNA 3QW4B 5E3JA 3GJTA 4FXOA 4P4SB 5BYBA 3TJZA 3WAGA 2QRNA 5KTMA 4Z0NA 2P8JA 3KXDA 1I4TD 4DIMA 1HETA 3DUWA 5FPTA 2W6JD 4J2OA 5EL0A 3U49A 1CS0B 3TZQA 3JQRA 4XDYA 1V1MA 1GFWA 3I30X 9LDBA 1W4LA 1VCOA 1DKUA 3CINA 3DPIA 2BZGA 4KXYA 2VF8A 3SQLA 3WJ1A 4MCHA 3O2QB 1QR6A 3P96A 4B3HA 4QUGA 2IIVA 2YV4A 1UJ5A 1WWKA 5JLJA 1U2DA 4AN1A 1QHFA 1DELA 1NJSA 2JCSA 2CY0A 3C4QA 3TXYA 1T25A 4UM8B 1XAGA 4RV5A 4ACAA 1EJ0A 1ODKA 3STWA 3CXRA 5K2MA 1T2NA 4K88A 4RAOA 3F9IA 3ZVRA 1HA3A 4UUMA 4I1PA 2EFCB 3OX1A 3GUYA 2IA5A 4RZQA 4F92B 1VLVA 3IEPA 1HEUA 4NZMA 5SY6A 1D0IA 4KVAA 4ARSA 4YT4A 1JSLA 3ZQ4A 4FFNA 1EYZA 4BO9A 2ZRFA 2IYNA 2GJ4A 2IYZA 3GIWA 4QDZA 1NVMB 3T41A 4QUBA 3G2HA 4CI0B 4X8OA 4KREA 4C04A 1TT5A 3WAJA 1VECA 2YXEA 1L0BA 1LZLA 1L5HA 1Y0BA 2QU7A 5BWBA 2RAVA 1A77A 1GQQA 1V7PC 1VLMA 4UEKA 2JFUA 3UMFA 4C4YA 3KZNA 5ULLA 2JIOA 2VZLA 4XGIA 1K3TA 5F5NA 1BO6A 3EEBA 4FKZA 3D6AA 3M6MD 4GR5A 3PYLA 4G0YA 3KZCA 4S3MA 5BN3B 1QRSA 1REQB 4TWJA 2H31A 1CB7A 1T1SA 4IF6A 3U3DA 3SIRA 1EMDA 3NVMB 1Q1QA 2RB5A 4K6GA 1H42A 3IE0A 3OH8A 4HDSB 4QUAA 3S2IA 5JAMA 2PSDA 2IEAA 1XMIA 4XUGB 3I09A 1TF7A 4DSNA 4E94A 1U8TA 4UKDA 2VRBA 4XH9B 2A0XA 1K92A 3DTYA 4TT8A 1ZCJA 2O2GA 4C7XA 4JXZA 4BQSA 1HNWB 2B21A 3FFAA 1CQIB 1H5NA 3NC1C 5KTSA 3THWA 1ZIPA 4L7VA 2QMEA 4GUAA 3TMAA 4LDQA 5BYAA 1K5DA 2A9FA 5LNK6 2EOAA 3HA5A 3K1AA 4L2IA 4LQCA 1UT8A 3IUEA 4RH0A 4QJ5A 4E0BA 2PWBA 3FNEA 3C5HA 3SHFA 2JIDA 1D2NA 1E7WA 2CUNA 1GO2A 3RFFA 3X1YA 2CDAA 4MICA 3M2TA 3PYXA 4V0OA 2GPTA 3M6AA 4UBJA 4YJ3F 3IEMA 3AO0B 4AO8A 1IVSA 3A3KA 2PGJA 5EGSA 4CFSA 3IAUA 3SHQA 4XD2A 3IEXA 2B94A 2AOWA 1NW7A 3UOGA 3W9UA 3RS3A 4LX0A 1MQAA 2H4FA 5DCLA 3RD5A 5B1IA 1X38A 5JY6A 2EFDB 2FY8A 4GQIA 4G5SA 4TWZA 3F5SA 5BQ3A 1E9AA 3PUIA 4Y6GB 1OZGA 4YMSA 2ZI5A 5CYOA 3KZVA 3ADDA 1PZFA 2VFAA 4LF6B 3HO8A 1G8GA 4L16A 1NONA 3TFQA 1EX6A 1RBYA 2AQKA 4OJMX 1JIIA 2C83A 2HCFA 1LI7A 4GI2A 4FP9A 4TV8B 1JQKA 1U3DA 5HKOA 5JQGF 1J0DA 4KC0A 2HSJA 4PVCA 1DTWA 3CZAA 4QUKA 3UAOA 2OOSA 4W1PA 2YXPX 4U6NA 1QHIA 5LP6C 1OTHA 1CZHA 3NGXA 1EK6A 1X1CA 2GZHA 2XUJA 3F49S 3VVCA 5ITSA 2CHFA 4EJSC 2WTUA 1YOVB 3LQKA 4NF2A 4YRJA 1I3NA 5DTEA 3VJKA 4AZ3A 5JU6A 3GGSA 5C0OE 4YTEA 4CHGA 2X22A 3G8AA 4ZJUA 4ETIA 2ZBRA 1DIHA 4MP3A 3WGLA 3V1YA 1LBSA 2NVOA 3TBKA 2EX1A 4G3XA 3R6LA 5KYUB 4I50A 4M37A 5ALTA 1QHXA 4DJEC 5JHGB 1IM5A 4N3BA 5T8KA 2I6UA 4PWZA 5BMOA 1BROA 3VHLB 2EBWA 2JLAA 2VAMA 2FMUA 2Y3IA 3D8TA 4C87A 3HGMA 4LBVA 3V2GA 4F6RA 1CG6A 4ZYTA 2C5LA 4CM8A 5JH7F 1BCRA 3DL0A 1PZGA 5AVVA 3QYPA 3ANNA 3IUQA 4JLWA 5EUMA 3NT4A 1LRJA 2IOYA 3WI7A 4HNAB 3HUEA 3DMDA 1LLQA 5AKKA 3R7BA 1GIAA 3OIFA 1BWRA 1TVKB 3JZMA 3KR9A 4NCHA 5DYTA 3S44A 5ADUS 7AT1A 4GWLA 3CLUD 3T7IA 3LK6A 2GTHA 4IKPA 1XD9A 1S6YA 4I8DA 3TCKA 1EZ1A 4B75A 1G5FA 1U5BB 1YAJA 1ZBQA 2C78A 2ZP1A 5LP6F 4BVFA 3QX9A 3AW9A 1ZR2A 2ZIZA 5B5SA 3TOSA 5CCEA 5CBPB 2CB0A 1RAIA 4H3SA 2Q41A 2J3DA 1VCNA 3TIIA 3O0TA 2FMFA 1W2GA 4P7BA 3FWNA 1GT6A 5GZ3A 2QLLA 5SYAA 1Y6QA 4AZSA 2AIRA 4HQKA 4B3GA 4B4OA 4RPIA 2PCLA 4DA0A 4N7JA 1PZNA 1INLA 2QXTA 1I32A 2ASEA 4MVJM 4YDSA 1W30A 3M89A 4Y6PA 4E5NA 2CL7X 3OTWA 5LZ4A 1PNVA 1ZVQA 3NGLA 4B3XA 5DMXA 4JXKA 1TYBE 4BMVA 1ZAYA 4PIMA 1E3IA 1DAHA 1EGAA 1YJBA 1EA7A 1FDUA 2O3JA 1DCKA 3M6LA 1NW9B 1WE2A 4JT9A 2VSNA 1G5RA 3MWGA 1EK5A 1I2BA 2EL7A 3BXPA 3RUAA 2QRUA 5HFAA 4LUCA 4NFYA 1OA0A 1NIPA 1Y9JA 2IV3A 5JT1A 5E95A 4YJ2B 3DFZA 2ZAYA 1MC1A 3IBYA 1KMCA 1WXHA 2WWFA 3V4RA 1KVSA 4LMAA 2ZJZA 2HRBA 3RS0A 4BQNA 5KNDA 2V6JA 2NYVA 2WAAA 3FWYA 1GM5A 2ZRLA 2I87A 2RGAA 4Q6WA 3VNVA 1U0SY 3ESAA 4WQMA 3CLRD 3MOGA 5DHPA 4MS1B 3KUKA 1L5ZA 3LVBA 5LYJB 3OZVA 3SVZA 2QRZA 2CLOB 5GY7A 1BJTA 4INAA 4UU1A 3AR5A 9MHTA 1ZMXA 2C2GA 1P1IA 2E5LB 5ICMA 1C3XA 2AFIE 1FYDA 4L57A 1NX6A 1YJ5A 5I7UA 1XP5A 3EY9A 4LN1A 4IPTA 5GP1A 4R81A 1ZK4A 3KB1A 1ZY2A 2OCPA 4FI3C 3G0OA 3HRIA 1NI5A 4KGVA 9ATCA 3LK7A 4DG5A 4X66B 2RARA 2FSUA 2GPJA 2CMDA 2GGSA 3IKVA 3D3NA 3P5SA 3EQZA 3UQYS 4D80A 1OUMA 5F7XA 3ROQA 4GC9A 2ZIFA 5E1OA 5C31A 2G04A 5EHXA 2DHEA 3PQEA 1DBSA 3AB8A 1WU8A 3KFVA 3UGQA 3Q8KA 2IXEA 1W1UA 3ZV5A 1HLGA 4OKSA 2P6OA 1A72A 3TTUA 5A5EA 3DLPX 4HNRA 4O4IB 1JWLA 4PZAA 1R9JA 2WKRA 1T2CA 4GGMX 3ZI0A 2IKQA 3RPEA 4B3FX 4H7HA 1YDEA 4EY3A 3KU1A 2AJLI 1A2BA 3PPXA 4IGEA 2DCUA 1EZZA 3ZG6A 2B8JA 4CMKA 1UQTA 3WIOA 3EVGA 3QMPA 2RFLA 1QKIA 2PZAA 4MKFA 4MQUA 4YRFA 4B3JA 1ULTA 2CXXA 5KYNA 1PSZA 1HNNA 1HQKA 1U7DA 1MFZA 2J6BA 3NI2A 4L7QA 1X8LA 2HGZA 1GYQA 2Q5HA 4OXQA 2YW2A 4P08A 3OQJA 2ATCA 4KUGA 5CJPA 4PE5B 4PIPA 5AOBA 2ZAOA 3QG1A 4P4GA 4QULA 3LLVA 5FNVB 3SX4A 3KIPA 1P0FA 2VOEA 4L8LA 2PX3A 1GG9A 1M6YA 2WFMA 3QY0A 1RTKA 4LOHA 1GILA 1XKLA 4D6PA 3E2IA 5FXMA 1XTQA 3A4NA 1CUUA 1R2QA 3NJ4A 3WV5A 1WUYA 3AERA 1P4JA 5ESDA 4YPVA 1JEEA 4HGYA 3V80A 1L7PA 2ZI7A 2XYPA 3Q15C 2X1VA 4XWWA 4AG6A 3R6TA 3GBPA 4I1IA 3JWIA 2ZBUA 5DN9A 3G2IA 5I9SA 1CX9B 5LUBA 1FFXA 1P5ZB 1U90A 4WOKA 4BMCA 3RBXA 5KNDD 2PH5A 1TM7E 3LUFA 3RGWS 5JCZA 3W9BA 2RGNC 4HNHA 4WJLA 2G9UA 2W8ZA 3NASA 3LWZA 4PYJA 5BNZA 4Q7JB 4PGHA 1Z28A 1DU4A 5C35A 2PZGA 2DX7A 5EIFA 3BE8A 1G20A 3AVWA 1UMDA 4MGZR 4KHZA 1W5AA 1XK7A 4ACBA 1HT2E 4Y2PA 1ZOPA 1QIGA 5AO9A 1P62B 3A1VA 2FK8A 4MRPA 5C8YB 1MVOA 2EJVA 3CSSA 1X6VA 2JFNA 4PG5A 4YT8A 2RAUA 4BVAA 1YZGA 4IKOA 1DG1G 1RYBA 4B2PA 2HMYB 3GRKA 3PHHA 2OM2A 4MPRA 4FGJA 1KWGA 2POCA 4I0WB 4BLTA 1QCZA 3RQSA 2VCYA 1ZU5A 3LBHA 1QIHA 1A7UA 1U1DA 1O0SA 1RZ3A 1NG1A 1T36B 3LW8A 4AUEA 1KO5A 2F1RA 2QM0A 3QP9A 4CKEA 4HUTA 5KCZA 2XODA 2R7MA 2R00C 4HN2A 2AHOA 4MW6A 2HU5A 1OYYA 2CDCA 3N0XA 3SM9A 6NULA 5C9ZA 5AW2A 4QU9A 1FRFS 3KZKA 4A8JA 3GJ8A 4BVLA 5I5EA 2EDCA 1DJLA 1YRLA 3B38A 1XZPA 5DTMA 3RJTA 4M7PA 1BE1A 1TF2A 1V5EA 4D98A 2HXGA 2P7HA 1OXKB 1Z7BA 2XD4A 3MTQA 2NZWA 3H2HA 4H9GA 4H3KB 4Z1OA 1IQRA 5FL7A 4J7CA 5ED0A 2BFFA 4HB0A 1U8EA 2GYUA 2G1PA 4U00A 3KJNA 4MR9B 2IOFK 2Q4OA 2BSQA 4LK3A 4DLAA 1O94A 1X9HA 4CT0A 5KQGA 1UMBA 1UJ2A 4LOIA 1BXRA 3AHCA 3CH5A 1M2OA 2QRVA 2YNMA 3ZHUA 1B8PA 4Z4QA 3TPFA 1B0AA 1CCWA 2NO0A 1CD5A 2B99A 1EXDA 4QYMA 4KR2A 3IKLA 1QQAA 3EULA 2G83A 2RAPA 1UDRA 1JHUA 2C82A 5C1BA 3AU8A 3GLSA 1KRXA 1MB0A 4BMXA 3KB8A 4QQRA 4B6JA 3UT6A 1AS3A 1WCV1 2PGLA 3KYCB 4ZQHA 3A11A 3ST7A 4BVEA 1UDBA 2IT1A 3LT2A 2E4ZA 2P1ZA 2PXAA 5EJ7A 3TAXA 5KJCA 4L5YA 3TSOA 4QYIB 4CCAA 3FA2A 1WZIA 1YJXA 5CXSA 3GDWA 1GLVA 2C3YA 3KUDA 2BMEA 2NGRA 4HS9A 3LCMA 2VT6A 2P2YA 4WLFA 5DNEA 1WUHS 3A7EA 5K0NA 2RJNA 2WTNA 5A7GA 3NHZA 2BY4A 2EKQA 1MB2A 1E7SA 2JI4A 2D1YA 4U7FA 2NP7A 4MVYA 3N0TA 2ZJ7A 3OJLA 1OVMA 5HIMA 5ALEA 1YK1A 2FPRA 1F12A 2X9GA 4MVJP 4PXAA 4URYR 5F23A 1CBUA 4UTVA 4EL0A 3RVJA 1E2IA 2QROA 3DE5X 3QE3A 2DWQA 3K32A 3WWCA 1LH0A 4C0SA 1EESA 2EQAA 1AS2A 4KIJA 2JD2A 3ZKWB 4QUHA 1HM5A 1UBNA 1NMEA 3BWCA 3RJMA 3U7HB 4WLNA 1VL6A 3H7IA 5AR1A 3S40A 1NXVA 1MPTA 1NLUA 4O2BB 1PKEA 5KTYA 3RBVA 1Z26A 2HF8A 4O4JA 1PT9A 3SCZA 5JCOC 5IAKA 3HXTA 2VYFA 1W29A 4HH1A 4TWIA 1DWPA 1U0FA 1Z36A 3NFYA 2H11A 4GXQA 1SURA 1YO6A 3O84A 3SYRA 2O5CA 5FL7D 2D0OB 3O8NA 1MT0A 1DUSA 2BBSA 5DP1A 3V33A 2YRWA 4O4HF 1TZ2A 4A8HA 1TTTA 5F9MA 2PGIA 3AIMA 1O94D 1OH5A 5TQ2B 3V6LA 1FNCA 1MMFB 4HX5A 4MUYA 2AOTB 5KO2A 4YCSA 1SZCA 2H1RA 3MWDA 1N2XA 1L8LA 2BHRA 4MUIA 3E9EA 2C2WA 1ISRA 2PMBA 1ISIA 2YNMD 1NMYA 2IU6A 2JASA 4HI0E 3DEIA 4O2AF 4JBGA 4PRZA 3O8QA 2HK7A 1BDJA 2JBHA 3OQPA 1WS6A 2PM8A 5LIRA 5F52A 5LUAA 1T1EA 2O05A 4YJHB 4CIXA 3IDSA 3EXHB 2WJGA 3T12A 2NO1A 4AN0A 4I3GA 1NJ6A 1ADBA 3FGZA 4AKIA 3FDJA 4LX8A 1S3GA 4C0WA 4H3HB 3I4LA 4Q00A 4CMAA 2M6KA 4J2TA 3ICQB 2H1FA 2QVYX 3AL2A 2JKZA 1CQJA 1E2FA 3D3WB 3EUFA 2ALJA 3H6HA 4WX2B 4O29A 1PFKA 2ZJAA 2GCIA 3LS2A 5AHOA 5JWOA 3UCEA 3IMGA 1Z4OA 1OZAA 3FYUC 5JI3E 4FD3A 2JD0A 5J4HA 2O50A 1X74A 1PU2A 1T13A 4R2MA 2ZJYA 1YRAA 2YFKA 1YDMA 1N1DA 4GOLD 3A2NA 3L82B 3VH4A 4MUBA 1ZD5A 4MVWA 1HLPA 4M86A 5GONA 2RGXA 1V8OA 3OZEA 4N54A 3E27A 2H3EA 3V2UA 3NBUA 1J70A 1QHHB 1KMHA 5FUVA 4Q1FA 1D07A 2PL3A 4JMLA 4ZVSA 2O2DA 3WYCA 1XFDA 2NU8B 1D04A 1VLJA 1WV0A 2LXNA 3L79A 2AZ4A 1X19A 4P98A 3UUGA 1NXOA 1B3RA 2E87A 3L8EA 3UG6A 1IJKA 2XCOA 1XQXA 1A9YA 3AVOA 4MWCA 5HIKA 2J0QA 5IDXA 3QTBA 4WIAA 5I7WA 3DP7A 1J7KA 3FB4A 3PV0A 4OO3A 4J1TA 2QP9X 1ATZA 3CUUA 4X6XA 1IDOA 4IIUA 4ZAYA 5AWFC 1F4VA 5CNKA 4TTSA 1SCUB 1XA3A 3DVQX 5ERXA 4B1FA 3OE5A 1SGWA 3QYJA 1SRRA 3PTAA 3ETDA 1HK7A 2P69A 2ZCUA 4A1FA 1VPTA 2WMNB 3JWHA 5T4FA 5I3ZA 1PJAA 2Q8PA 5CG1A 2I29A 1PUIA 2O48X 1ZESA 3UH0A 1XN4A 2R1TA 5REQB 1DKLA 2JD1A 1T0BA 3E2PA 4IFBA 3WL6A 1J6UA 3L18A 3I12A 4UBNA 3GDOA 2F3PA 3D8SA 2Q1TA 4L4ZA 5E7QA 5FWYB 3VMMA 2Z3WA 4IZ6A 4D4KA 5LDHA 4YRTA 4D3DA 5IH7A 1B6GA 3MBIA 1ZA2A 3N0RA 3IP6A 5A71A 2W37A 3CZRA 4H18A 4J2HA 3I9LA 1Q0QA 3AI3A 3LPAA 2UXDB 4ALNA 3OIGA 4AY3A 3A6JA 2I54A 2J9GA 3F5QA 2ZB4A 1YVDA 2I22A 3L05A 1ZMBA 2HWXA 4L75A 3T3MB 2VQEB 4QWMA 1IDN1 2ZAIA