2OYSA

Crystal structure of sp1951 protein from streptococcus pneumoniae in complex with fmn, northeast structural genomics target spr27
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
230
structure length
230
Chain Sequence
NKIFIYAGVRNHNSKTLEYTKRLSSIISSRNNVDISFRTPFNSELEISNSDSEELFKKGIDRQSNADDGGVIKKELLESDIIIISSPVYLQNVSVDTKNFIERIGGWSHLFRLAGKFVVTLDVAESNGSDNVSEYLRDIFSYMGGQILHQVSITNSLKDIAEAQLMEATYKIEDVLEGKIKYKTTDYQERAYQTLKLILENYDSEHFEKMYWEKKRLFEANSLEEWYYVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein SP1951
total genus 90
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oysA00
2M6RA 4DILA 3FJOA 3JSXA 2FDXA 3D7NA 5LLDA 4FGJA 3EYWA 3LCMA 4LTMA 2ZKIA 1XYYA 1YCHA 1JA0A 1T0IA 2BZSA 3QFRA 2A5LA 3OJWA 4H2DA 5EA2A 1DXQA 4YAUA 5LMCA 1BVYF 3TE7A 2M6SA 1D04A 2FCRA 2OHJA 3ESZA 5BUCA 2OHHA 2W5UA 3KAPA 3O73A 4N65A 6NULA 2FOXA 2HNBA 3ESXA 4QODA 1YRHA 2AMJA 4FGKA 1D03A 3NHLA 3K20A 4XDGA 4BMPB 4CF6A 1CZNA 1CZUA 3HR4A 2BF4A 3OWXA 4ZVLA 1H66A 1RLIA 4D02A 2QX4A 3GAMA 4FGLA 4QOJA 4YAWA 1FLDA 3UXEA 4YQEA 1XT6A 3OJXA 1OBVA 2Z9DA 1V4BA 3NHWA 3P0RA 4C0XA 1AHNA 3KAQA 3N3BC 1C7EA 2F1OA 2KLBA 4PTZA 1FVXA 1FLVA 1ZWLA 1SG0A 2X2PA 4H6PA 1WSWA 4QOIA 1AKRA 1FLAA 2FLVA 4LTDA 2OHIA 5NLLA 5FX2A 2R97A 4NULA 3ZHOA 2BPOA 1J8QA 3FNIA 3K1YA 3NHUA 4M0CA 1FLNA 1VMEA 3NFRA 4QOFA 2Z9CA 5LVAA 3NHJA 3S2YA 3W7AA 3NHRA 2MOKA 3B6MA 2X2OA 3TZBA 1ZX1A 2N1MA 1QRDA 3ES9A 4YAOA 3W77A 4DY4A 5F4BA 1KBQA 4N9QA 4U7GA 2B3DA 2KQUA 3OVMA 3KLBA 1CZRA 1ZWKA 3NHPA 1C7FA 4PTYA 4XDHA 2XODA 3W78A 5FUQA 3F2VA 1QR2A 1TIKA 2XOEA 4DIKA 1DX9A 5B3KA 3KEGA 2FZVA 5JROA 2V5VA 3OX1A 3OWHA 5EAIA 2MWMA 1QHEA 4ZVNA 4F8YA 1YCFA 4GR9A 3F90A 3G5MA 5LBTA 1KBOA 1YDGA 2D5IA 4GQIA 1AKVA 2RG1A 4FX2A 3F6RA 1X77A 2FX2A 3OX3A 4Y9UA 1YKGA 2R96A 3GFRA 2FVXA 3U7RA 5FA6A 4C0WA 3B6IA 3QE2A 3HLYA 4BMOB 3N3AC 4ESEA 5F12A 3HA2A 4QOEA 2Q62A 4CETA 3LT5A 2ARKA 1JA1A 1AMOA 1CZLA 2GSWA 1AG9A 1E5DA 1OFVA 4LA4A 3TEMA 3SVLA 4OXXA 2QMZA 3NHFA 5NULA 1YCGA 4ZVKA 2Z98A 2QMYA 1NNI1 2QWXA 4PU0A 3OX2A 3QFCA 1FUEA 4Y9RA 3RPEA 1CZKA 5TGZA 1J9ZA 3L9XA 3ESYA 3F6SA 4YALA 4J8PA 4HEQA 4QOHA 1D4AA 1RLJA 3GFSA 2Z9BA 4C14A 4NLLA 4YAFA 1TLLA 1H69A 1DXOA 2QX6A 4QOGA 3EDOA 2V5UA 2HNAA 4GI5A 2BN4A 4U7HA 2HPVA 3B6KA 3NHSA 5LJLA 3FVWA 1B1CA 5LJIA 1WSBA 2BMVA 3NHYA 3R6WA 1J9GA 1BU5A 2MTBA 1QBGA 3L9WA 3B6JA 3NLLA 1OBOA 3O2NA 5A4KA 4S24A 3GFQA 5F51A 1AKTA 1AZLA 2QX8A 1CZOA 4HS4A 4N82A 1AKQA 1F4PA 1GG5A 3FW1A 4U7FA 1T5BA 3W79A 5B3LA 1YOBA 1AKWA 3U7IA 1AKUA 4R81A 1FTGA 4LTNA 1XYVA 3NHKA 4ZVMA 4C76A 1SQSA 1XI2A 1J9EA 1RTTA 2QR2A 3UXHA 1RCFA 3N39C 5LBUA 3FX2A 1FX1A 2Q9UA 1I1OA 4ICIA 4Y7CA 5EMNA 2FZ5A 5ULLA 2MT9A 2V9CA 2QX9A 1CZHA 4LAFA 2OYSA 2WC1A 2FAXA
chains in the Genus database with same CATH superfamily
4HY3A 3MWGA 5K0ZA 3BWXA 4YBZA 3P0FA 1Q57A 4OHVA 3BA6A 3KD2A 1MQSA 3O94A 4RZHA 4ARIA 2IOHA 1A5SB 3BPSA 3HKDB 3A4VA 2DBQA 2IS1A 4JYMA 3P19A 2G88A 2W0SA 3C3CA 2EHJA 2OHJA 4NCHA 4WLUA 4GF5A 1JT2A 3ZWOA 3L05A 1J0BA 4ZEOA 1DKUA 4LC0A 3RYCB 1LVHA 3U19A 3BFJA 1UOEA 2GVNA 3FFBA 4L3WA 1MX1A 5KNDH 2JRCA 3CEAA 4G5GA 2R1VA 1VI6A 1WRBA 4RLFA 1VCHA 2I6FA 2XZDA 3WJ2A 2GEBA 4CM9A 4ITRC 3TLEA 4BBAA 1INLA 4TL8A 3IP1A 4HVLA 1WQ3A 1P4HA 3NCHA 1ENZA 1LPBB 2BCEA 5E1MA 3SIPA 4CMAA 4TXHA 4D3YA 2YTZA 2C96A 3E9EA 2PR7A 4ND7A 4Q7KA 2SECE 2FWBA 1X1QA 3DH0A 2HB6A 2OK7A 4X5OA 3S8MA 2H57A 2H5LA 3QVGB 3ZHXA 1RJDA 2V59A 1X7HA 1Z33A 1EX6A 2VSQA 4KBFA 4M7WA 3VR6D 4EKNB 1VCIA 3EDMA 4GLBA 2QAGB 3RIGA 4CODB 3V97A 1DO0A 1ULTA 1QFJA 2H1VA 3H5RA 3KKPA 1VBNA 2V6GA 2V5AA 1YZYA 3ND9A 3HLTA 5T64A 3LTNC 1WMEA 1SA0B 4WZBB 4UM7A 1Y1PA 3ZV4A 1HT3A 2B35A 2VRBA 2BV3A 5KQMA 4RVCA 3RUCA 4RF3A 5I7FA 3HADA 3H2JA 2J0VA 4CR8A 5JPIA 1ZRHA 1T5TA 3AHGA 1XELA 1V6AA 4WCFA 4XLZA 3UH1A 4L07A 1D4OA 1LJLA 2QTTA 3GARA 5AO9A 2F3SA 4H1VA 5LXTF 2GZRA 3DV9A 2CCJA 4MKHA 5LQAA 4ZI7F 2QXTA 1A4IA 1YJ8A 5KYYA 3OSZA 4C0WA 3LFTA 4A92A 4M0DA 4LGMA 3IBSA 3MWYW 3TNDA 1H9AA 3LT5A 4ENWA 4I4TF 2QW8A 3BA1A 3HB4X 3FLMA 4JVSB 2ZYAA 5EZ5A 3U4HA 1ZR2A 2EOAA 1UC8A 5BOVA 3TBFA 5JARA 4DLKA 1H0SA 1Y4AE 1WB9A 1C1XA 1OJ7A 4KQGA 3WJAA 1J8DA 1P4SA 5F3RA 3MMNA 1GSAA 1RVDA 2WPDD 4MGEA 4P0TA 1YB6A 3CRMA 3MTJA 2F1HA 2NZWA 4FYPA 4KBGA 4DCPA 2XXAB 1DX4A 4BRUA 1VIAA 2IHNA 3UWDA 5JD5A 1XMOB 2DAPA 3WGHA 3DT6A 1IY9A 2AC2A 3MRSA 3NIGB 3NV7A 3BOSA 3F9IA 3L0SA 3P52A 4J94A 3TKAA 1JHDA 1XZKA 2X2FA 4GMDA 2BEVB 1U8YA 3ROPA 2C3PA 5TSDA 1PP4A 3USCS 3I61A 4DNOA 3B6EA 2OORC 2WUDA 1KO1A 4UVIA 2ACWA 4ZWNA 1VJ5A 3OAAA 1SB8A 3L46A 3PPXA 2E1RA 4NCIA 4QUKA 4XTCS 2C4MA 4AM8A 4CGYA 2ZE6A 3EUWA 4G4GA 3EZ2A 3FNQA 3CURA 3TTSA 4NYJR 5BORA 5B3JA 2AYZA 5HS4A 2AA3A 2ODEA 3O3NB 3L0OA 4PFKA 4ASUA 2B61A 3TW8A 1E2BA 2Q9UA 2JW5A 2C07A 2H0QA 5BRAA 3VBEA 1D09A 1O6ZA 5TGDA 4K3VA 4KX3A 2HMTA 3O6VA 4TT8A 1NATA 5D3KA 4ZT4A 5CB0A 2X9GA 1EE2A 1NAIA 2IW3A 2XHZA 1SKMA 3LF2A 3T5PA 4TMYA 5DX8A 3ZPXA 4PN7A 1R16A 4RD0A 3SZOA 5CDFA 1SG6A 1UXIA 3GIWA 4M6WA 5BSEA 1IFXA 2V1UA 2QTZA 2IEIA 3RU7A 3W1WA 2RGRA 3S27A 2ISCA 3RC7A 3P2YA 4UUMA 1Y6QA 5T4FA 1PJQA 2I62A 1LK5A 3I09A 3PNOA 5AMXA 1UMBA 5COQA 1RZ3A 1SQ5A 1X7DA 4JUDX 3TUZC 1P5ZB 1KKUA 2Z83A 4FWBA 4FYXA 1E9CA 5K6RA 4RK7A 4WGFA 5ITSA 1T4CA 2F1KA 4H1TA 2C1ZA 3EARA 4K1XA 4NBTA 2IIBA 4ZAFA 5IMBA 2C3MA 1JQEA 4QG7A 3T3OA 1LC0A 2QXYA 5JEDA 2F8LA 4RZXA 3X1MA 4R3WA 5EJ8A 1T4GA 2EATA 4F9EA 1II9A 1ODIA 3QVUA 4W9NA 4D4GA 3CY6A 4OFXA 1I80A 2ORYA 4AJ9A 4LTDA 5AI8A 1IVYA 3UV3A 2O3TA 2Z1DA 4YC7A 4A8TA 3GLFA 1BVUA 2I5PO 3U26A 4V0RA 4LEIA 3W7AA 1EYZA 1E1MA 2PWYA 3ZY6A 2XUHA 4DDMA 1CQWA 4PPGA 2OBXA 3MINA 3ZWMA 1V16B 1W5BA 4QKQA 1MC8A 5A0TA 4KQKA 4OCZA 1P4RA 1EJ0A 4Q3AA 4YAKA 2ZBGA 3ETDA 1QFXA 2Y77A 3F4KA 3HB5X 4P58A 1AY0A 3ZLVA 4F86A 4IFIA 4DG9A 1TF5A 1YR7A 1NW8A 3R75A 3PNVA 3QJYA 3Q2KA 4S1NA 3SF8A 2D00A 4EJMA 2DLNA 3AX6A 2E4XA 1C29B 1UP7A 1SVSA 1XJ5A 1P6QA 2FP3A 2PS0A 2OO5A 4IMIB 1CB0A 1JA1A 4L4YA 5ALIA 4RF2A 4ZV4A 2EG5A 521PA 4BWYA 2D74A 5BOSB 5EN4A 2JI7A 3MNFA 4TLDA 3UPUA 5IKOA 1LI5A 3OLCX 4Q4CA 4REMA 4L0QA 3P2EA 4NQZA 2VSNA 1X0XA 3AG5A 3PCXA 3DKKA 4TMVA 5I9NA 4RF5A 1JAYA 1DDOA 2J3HA 4RJTA 5I5EA 1J7JA 2XNJA 1REQA 2KM1A 3CXRA 3MTDA 5D6NA 1TJYA 3LA8A 4ZALA 4AU1A 3AOGA 4IWNA 3TSAA 1T4DA 2FP4A 2E55A 4I4IA 4B8ZA 1G9TA 4HDSB 4CL8A 2Z4RA 4UXIA 4ZVQA 4DA9A 5C8ZA 4HUQA 4G86A 4EUFA 4PXYA 1GILA 1MB4A 1U8AA 3O2NA 4LISA 3JRXA 4C0HA 3L2OB 1Q1BA 1KGSA 4HGPA 2COEA 3NV9A 4P81A 3I2GA 1RXCA 2FRXA 2RSLA 2AD1A 1Z29A 2WHEA 1QGED 3C6QA 3DXFA 3FW1A 3HFRA 4JCOA 1OBCA 2UYCA 4HLQB 1RWMA 1Z36A 2QRQA 2H0AA 5EJ7A 5LL6P 3E6AA 5CB4F 2E4AA 2JAWA 1X80B 3GNLA 5PGMA 4V3CA 4MEBA 4EHIA 2YXEA 1YGPA 4BLWA 4JAVC 4MJLA 4OHYA 2FZ5A 3TAHA 2BAGA 3BGOS 2QX9A 2YVQA 3LIPA 3N7TA 3OWOA 1X1TA 1GUYA 4AUNA 3N2KA 3NCTA 3L84A 4QG3A 2A0KA 1NF3A 1Y5MA 2V74B 1FE8A 1VL0A 2PZMA 3L93A 3FPGA 4JK3A 3WRXC 5AM3A 5FBQB 1F17A 3SYMA 2ECPA 3EPJA 3K9FC 4BYMA 4QLBA 2PSFA 1PWZA 3AVXA 4KQCA 4QYSA 3KKQA 4IVNA 4EIWA 1TPYA 1MAHA 3K1TA 7REQA 4MS1A 4JOQA 3ZTWA 2X0RA 2X5XA 3FPBA 4B48A 1W0KD 1JWAB 1LRJA 3GRZA 1G5RA 3PC8C 4M1QA 2K7FA 4IVQA 1PLLA 1KYVA 2YVUA 3R0ZA 4MQBA 4NICA 1OF1A 1TVKB 1NMXA 2HRDA 2PX5A 3JAKA 3V55A 1WAMA 5DEOA 5F5LA 2FA9A 3SDSA 3G8DA 5LPNA 5FOSA 2JVKA 4HN4B 1IQRA 1P2FA 1I6WA 3AHEA 4FWTA 2Y0CA 1XZNA 2PQMA 3LXUX 3UMGA 4EG8A 3G88A 3IVGA 4MQEA 4F72A 1DWQA 5IK2D 5CLJA 4U8GA 1IIRA 2AJ8A 2C42A 3BMQA 4IHJB 2REOA 4XIYA 3HDGA 4IJUA 4U8HA 4X8LA 2C59A 2QM3A 4LQ4A 5H70A 3DEYX 2A8YA 3QVJA 1HOTA 2CKMA 3QPUA 3S2YA 1OFIA 1BXKA 4N0DA 4RIFA 4YCAA 4GT1A 1XCGB 4HJXA 4ZXFA 4TZ0A 1GFSA 5HHTA 1RWVA 3EG9B 5FI1B 4UXJA 4HDNA 2WUVA 5ALMA 1AUQA 1RR6A 3H75A 2CLHB 3PUHA 3E81A 1OYVA 1M75A 1N1MA 1X2BA 4K9SA 4UDNA 1M2KA 1E64A 2W2LA 1GGFA 4BNFA 4INZA 2OO3A 5DH9A 4KIWA 1A9ZA 2ECKA 1N7IA 2L2QA 1CQIA 1JG4A 2MWMA 1XCJA 2W2NA 1Q1QA 2YX1A 3M9WA 3AUSA 4DCTA 4F8YA 1LS6A 2YS6A 5KWIA 2H4JA 1AB5A 3GGGA 3TIIA 3NWPA 3T1QA 1G8GA 4YDRA 3TSOA 2RHHA 3SJUA 4D46A 5KWVA 3O3OB 1NVFA 2Q9CA 1UK8A 3L4JA 4TLMB 3MS4A 1QAMA 1Y4UA 4DE5A 1W2HA 4R6WA 1RT9A 2HRBA 3MJDA 3K2EA 4L3OA 3KWMA 5F52A 1II8B 1PEDA 2J08A 4LA4A 3ZWYA 1YL6A 1LA2A 1CHNA 1C3XA 4OY3A 1OPXA 1TQHA 4YY3B 3VPSA 4MGZR 1F8FA 1XWFA 1R9NA 1X8KA 2WF8A 4LDRA 4RNCA 3IH5A 1KH3A 5FUMA 3HCEA 4JR0A 3VNQA 4JC8A 3Q6NA 4JYZA 4JLWA 3C97A 3D4BA 2PO5A 3W5SA 2G04A 5JHHB 1J20A 5EHIA 2J30A 1P9NA 1SK8A 2ZJAA 3FVQA 4A16A 1J2YA 1XF1A 3QKIA 3QITA 4J4BA 4R69A 3AKYA 4RMHA 3BXOA 1KPHA 2C9YA 3JQCA 5C32A 3RS8A 2RB4A 3H42B 4TN1A 4BRZA 3E3AA 1YVDA 5E2BA 1YGYA 1CLUA 4QFDA 5AYVA 1OC4A 2Z2XA 1HL3A 1BS1A 2X0EA 3Q0EA 3DLBA 2VF4X 4V38A 1O6FA 1UFQA 3WX0A 1P9WA 4BLRA 2V7UA 3G8AA 2RGXA 1RHUA 3K1AB 2YZ2A 4I5EA 4AP6A 1IOVA 4LTNA 5MN6A 2XECA 3KJXA 4II3A 1DTWA 3HA3A 4RHEA 5ICCA 1OGIA 3MTBA 2WVJA 3Q40A 1X7ZB 4OFZA 4I4TA 3C3AA 4P3NA 1UMKA 3NAZA 3I23A 5HRCA 2NUAA 2CDAA 3CJTA 3UUWA 3S1AA 3K8ZA 1CNEA 1NQAO 1ZNYA 2QU8A 5ESXA 4N40A 3TUIC 3P9IA 1GQQA 5SV2A 3S99A 4GICA 1KEPA 5H82A 2ZWAA 2GETA 2MR5A 3WGTA 5JD6A 1XTUA 4TYWA 4CLXA 1NJ2A 3CUTA 1XTKA 2Y71A 2EGUA 4V2IA 3WO1A 4ZGWA 3R7LA 1V47A 4DCJA 1Z62A 4GQAA 1VSTA 1SKBA 3CPJB 4HWGA 1DG1G 4XCVA 2WA1A 1JEJA 2WU8A 3F4LA 3IXQA 4HYEA 3PXDA 2Z2ZA 4TTTS 3THXB 3QWFA 1YNOA 1GPWB 4D41A 3JQGB 2FSIA 2Q0SA 2R79A 2HIGA 3HQ4O 3TMAA 4TTRA 1YI1A 2O7QA 3PDUA 4JDUA 2FN4A 1M5TA 1O94D 1XBTA 3OKFA 5FO1A 5EE1A 1SC9A 1JFFA 2FPIB 1RPTA 3RIMA 4DSNA 3JQAD 5IEBA 3FAZA 2F00A 4R40A 4WLNA 3RHZA 1NQTA 3ZGNA 4QUHA 2RGNA 4DMUB 2G76A 3KZVA 3LPDA 1UJ6A 1NMQA 2I4LA 3OIWA 4BGDA 2G83A 3D31A 3FROA 1AZWA 3JVEA 4WNCA 4AZWA 5KVAA 5C53B 4DXHA 1P8AA 1UBEA 3C3KA 3K30A 1QQAA 4FCCA 2D59A 4KYVA 2WTXA 2IV7A 3NH9A 5L3SA 3GPCA 2WLSA 3CWZA 2YNMD 2Q46A 1ESEA 1W59A 3QA3E 1JEAA 4FDLA 1IPEA 3ADBA 2VQFB 2X0DA 2P3OA 4IIVA 3G49A 1XQXA 3WLRA 1K63A 1G3QA 1M34B 3FZEA 2OK8A 2R62A 2X19A 2ZTHA 5AJZA 5FA6A 3CCBA 4CG1A 2HUNA 1HNZB 1PQYA 4KVAA 5IAGA 1Q7RA 1DT3A 4LRWA 4IDCA 2NVWA 2CVHA 1UODA 4AJOA 3EZGA 5EXDA 4RDCA 4CEHB 3K32A 3GCDA 4M4SA 1Q2XA 3WZ2A 3X1KA 5J2UF 4DLBA 1PWHA 1IQPA 1QANA 4JYBA 4PVCA 4G26A 1KC3A 2IXDA 3GWZA 4J43A 2A88A 2V97A 4YALA 3ULKA 3FOZA 1BHO1 3WFZA 2XCSB 1CUFA 2RAUA 1ZRMA 3PRYA 4R1LA 3A4LA 3QIAA 2Y1LA 3BJEA 3AINA 3LC7O 1EZ1A 1GTZA 2QX6A 4E51A 4S1WA 5LQRA 1MUUA 3VR4A 4NYJQ 4GMKA 3AEXA 4E33A 2VH2A 1KEEA 1QDEA 4ESOA 1JL3A 3K9NA 2OFWA 1ZYUA 1UPBA 2BMDA 121PA 4MZXA 3IV9A 3ZVNA 3MW8A 1G8JA 4BLOA 4FHCA 3KR9A 3EGIA 3FDIA 3GEEA 4GX2A 4GSKA 4RVOA 3L6UA 3BMNB 1X7YB 3PLRA 1JYFA 2A94A 3ESQA 1I01A 5K0TA 2MYUA 2QYOA 4BNMA 5B6JA 1C2YA 3TMKA 1J2JA 3H5LA 3F7MA 8GPBA 2G9QA 1JU3A 2FPRA 3OTIA 3ZE0B 4KR2A 5EJIA 1KETA 3ILHA 1CJUC 1I9CA 3QYPA 1IN5A 5TMBA 4XDZA 1PIWA 2QK4A 2BKXA 1H22A 4A6DA 2IQ5A 1AK9A 3D7NA 4L28A 4ENPA 2VS1A 3DZDA 4X85A 3MJVA 1B0ZA 2M98A 1US8A 1BVYF 1ZOSA 2OKCA 3BD6A 5C7OO 2AFHA 5JCOC 2WHQA 3DEFA 4WZBE 4NDZA 5CNMA 4W5RA 1UDWA 2P78A 3DE1X 1B23P 1QRUA 2VVTA 4BN4A 1P4JA 3QV1A 5KHOC 5EWMB 4KYUA 3R1IA 3LHIA 1W1WA 4AZ0A 4BU1A 1T6YA 3IFSA 3RS4A 4JUIA 2O5VA 2VTDA 4V0ME 1E9EA 2JJQA 1L5GB 3TRDA 4QL3A 4YRSA 1XGKA 2GASA 2XB8A 3H6HA 3OO1A 2C8JA 1PLKA 2EGHA 3ON5A 4GZMA 2K2QB 2WNSA 3KAQA 4V0OA 5LDHA 4I6GA 4X9XA 1EHIA 3R4VA 3WSWA 3GJQA 1KKLA 1H8ED 3GW8A 2BM8A 5D3MB 4D25A 4BL5A 2OP1A 3PQ2A 3A10A 2M6KA 4R3UC 1Y1RA 2I65A 2KWIA 5CDHA 1Z2CA 4E94A 1PFUA 5K5EA 5J2TB 1E1NA 4B44A 3ZV7A 5DP2A 5ALKA 1W93A 1YK1A 2FN8A 4R0NA 2P1DA 4OJMX 3IUEA 4DG5A 1ZBDA 1C9MA 2OYCA 4BQRA 1CR1A 3WP1B 4ZHQA 4UE6A 1CYDA 5GTDA 3DEAA 3N0TA 5JAHA 1CUHA 5G40A 4AS1A 2JGFA 5I7OA 2D0DA 2X86A 1ZCZA 4CQMA 3DEZA 3M6FA 5H83A 3X1ZA 1AC5A 1JKMA 1W0JD 1Y4DE 5COBA 2HMWA 2NO5A 4J4TA 2WZQA 2IHKA 4YS6A 4O02B 5B7NA 1R8QA 2YJTD 5JQWA 4DPMA 2DFNA 4U9IS 4BN0A 2RHLA 4AWBA 3BRCA 3CCCA 3NOOA 2ECOA 4UM9D 1MFZA 2NWQA 2PRYA 2W2KB 3SQNA 2QRNA 3IUQA 2QP4A 1FA9A 2C31A 4YRRA 3LLSA 4DCUA 1A27A 1ZQ1A 2C82A 1UJ5A 3AT1A 3CEJA 4RYLA 5I4IA 1GM5A 1AZTA 2O0HA 5ERYA 3SZ3A 3D7MA 3B6ZA 1SD2A 1OQAA 2VK1A 3TLXA 4LZNA 3KHKA 1P0PA 3ESDA 4XGIA 4D26A 4D1YA 1YVUA 4GOND 2ZUEA 2UYQA 4NZPA 3C3MA 1OXUA 3JCZA 5BUQA 5HJEA 1A5AB 4JBLA 9ATCA 1QH0A 4CGZA 1UC5B 3K53A 1KAOA 4JB2A 4M1WA 4MR8A 4DHEA 1QONA 1YIAA 5D00A 2I33A 1TLTA 2VHEA 2WNIA 4PAQA 1G5TA 1JR2A 1P7VA 2F90A 3PCTA 3AV3A 1VCNA 5JFTA 5IWAB 5DFAA 4PSUA 3Q15C 3WMGA 1ZAKA 1VJGA 2QDXA 3CQ9A 1K7FB 4IDGA 1WR8A 1GA4A 3HO1A 1S89A 4MMZB 4E5SA 5D8DA 4NK4A 2ILVA 5E3IA 3ELYA 3N8HA 4OHOA 4ILEA 4KWTA 3F5SA 4I7EA 4YMGA 3LZ6A 3UN1A 4BDTA 3WI7A 5B3LA 1LNQA 1U9IA 2GJ4A 4L9SA 4R84A 4CI9A 1AKUA 5TIIA 5KC8A 2QG4A 1NUSA 5DNDA 1KMCA 3HGMA 1ONBA 3EE6A 1MAVA 3NTVA 2YWFA 3M5PA 3CLVA 1U80A 1TUGA 1BQEA 1UXKA 2DFTA 3AV0B 3QVOA 2PMBA 3DOFA 3TOZA 4WASA 1W34A 2IP1A 2HHHB 3EQ6A 1XAHA 4TM7A 1KFBB 2IKSA 1LVGA 4NP6A 4ND8A 2GCEA 2Q1XA 2Q29A 4MW4A 3ROKA 2I3GA 1L7QA 1A4XA 2CVOA 2D2XA 2EW8A 2XNDD 3ISVA 3PI6A 4OB6A 4UAJA 2ZP1A 4WZAE 5KKNB 1DLIA 3N59A 1HUQA 4CMJA 2VDVE 3LPNA 1QWOA 2TMKA 2J6BA 2QX7A 5TQJA 4ZP1A 3PX2A 2Q5IA 3CZQA 3BCHA 2C9OA 4N6GA 3V7FA 1G21B 2NTNA 4C4YA 4DR6B 3N87A 5T6MA 2ZQYA 2EIXA 4US0R 2X7XA 2AI3A 5ECDA 1HTBA 1XPRA 5ER9A 3URMA 2DWOA 4OHMA 1RAFA 4Q4AA 4W7SA 4MA4A 1U7DA 4Z51A 1P1JA 1K7CA 3MBKA 3L7IA 1UEJA 2E7ZA 2FZ4A 1IY2A 5REQB 1YU9A 5B30A 3GHYA 3UOGA 1BEEA 1WQ4A 3WQHA 3NTRA 2Y68A 3P20A 4PZ9A 1JXMA 1N6IA 2F3PA 4NI5A 2I7XA 2Y66A 4OK3A 4UJ3A 1EAYA 2X2OA 4RVGA 4KEAA 5JVDB 3ZK7A 1ZJYA 1CNFA 4OKSA 4Q3CA 4DMFA 1WKVA 2BFOA 4U6SA 1P0IA 2PLFA 2XE6A 2GRAA 2JB9A 4CMKA 1KVRA 3G68A 1WP4A 2OCAA 4HL6A 2O19A 3VMMA 4E5DA 1KWKA 5EQFA 2IE0A 3FPKA 1Y0BA 4LECA 1QRTA 3ZNOA 5JZBA 4F5WA 1YFLA 2EXXA 1XRJA 1K92A 2FSSA 2JZNA 2AOVA 2I71A 2O54A 5EMHA 3KU1A 1UIRA 2NTJA 3ZCPA 1FNDA 2R96A 2GYUA 2C94A 3UQYS 4LBZA 3D0OA 1PFGA 1BXGA 2RH4A 2XE4A 2C00A 3ZLUA 1PNOA 3RTEA 3I2JA 4GPTA 2P9HA 2NOAA 3HU5A 1AK2A 3U44B 2ZT8A 1L0BA 4DVGA 4WBNF 3T1YB 3ZV3A 1KARA 2A9PA 3IP5A 2ZSEA 4PV7A 4L6CA 4AECA 3ZZ1A 3ELUA 1WZIA 2WYWA 1MJHA 2FN9A 4CIVA 1H0RA 3N0XA 3FSEA 1Z4NA 3LX5A 3IJ5A 3PA8A 4HDKB 4HQ0A 4RWEA 1Q0TA 2PVCA 5SZHB 4WN9B 4GOMD 2EBFX 3RG2A 1M2HA 2PV7A 1HKHA 1V39A 1SXQA 4P3XA 3LFHA 3QWBA 4HV4A 1BU8A 1WTAA 4A73A 3A37A 4LXGA 4YO8A 3RBXA 3ZI0A 5AOCA 4XRGA 5IT9A 1RU3A 1Z13A 3QEMB 4JNCA 1CJCA 3RSQA 1VP9A 3V32A 4B2LA 3PWTA 3E9RA 2NM0A 3MM4A 3A0RB 3G02A 2VAXA 3QYJA 3Q7IA 1UJCA 4CF3A 4GNKA 4TYPA 2OSVA 3A4YA 2BTEA 3SD7A 5HP4A 4C4ZA 4GG1A 3OMXA 4OQNA 4GYKA 1PFQA 4RAQA 4Q4LA 3GRCA 1SBNE 2VF8A 2YW2A 3PUIA 5TF4A 2EERA 3C3YA 4DY6A 2G9RA 1U2TA 2J9FB 4U02A 5IBPA 4ENUA 4D9IA 3GA5A 1WD7A 3A0UA 2QA5A 3JWEA 5IAJA 2BFDA 2O8EA 1SIBE 4UD6A 3F47A 3PGJA 3VR5D 4QEKA 3RNOA 5K3FB 1T10A 4J1TA 3RT7A 4JB0A 2K4MA 4OA8A 4DANA 4EUHA 1G55A 1K0FA 1NRXA 2BL4A 2ZAOA 4XUCA 1RMTA 5JY6A 4RTOA 3RF7A 3R7SA 4BO6A 5LQUA 2XWPA 1TU0A 4KPFC 5H4HA 1A9XA 1G4AE 2PXAA 4PRKA 4YJ2B 3IR7A 4PN3A 2FW6A 2QN1A 4EB6B 4JROA 4FEGA 2AJCA 4B3SB 3I9NA 3UICA 1OX4B 3OM1A 3UFBA 1BSVA 3P0HA 4YRNA 1YUNA 3HN7A 5HFAA 2QM7A 1H1LA 4J03A 5CK5A 1V37A 2WDPA 1I3NA 1LPSA 4LXXA 3O8OA 4WLVA 5I7RA 2YXLA 4P92A 1S8OA 3QX9A 4LKOA 5FR1A 4D4LA 4X7RA 1K6JA 2XUZA 3HDQA 2BI4A 2XVAA 2P7IA 3UVEA 3MRXA 4DR2B 4NDNE 5BUSA 1PTJC 1FZTA 3E9DA 5I9SA 4UEWA 5D7NA 5JCJA 3RVQA 3MJTA 3SR4A 4PZYA 4RSGA 3KX2A 4JBNA 1LX7A 1TCUA 4M53A 4RFLA 4AFNA 3OLXA 3DMTA 2G4CA 4PYIA 5IM5A 2YKGA 1JMYA 4RQAA 4MQ4A 4POAA 3LCVB 2FK7A 4M9XA 4N6OA 1XFDA 3O0DA 4NNOA 2JNWA 1IXKA 4OP2A 1QGUB 4WOKA 4NATA 1V5WA 3FPJA 4BHTA 4DRXA 4DV2B 2XCOA 5EFOA 3WS7A 5GGYA 3CZ4A 1A9YA 4D0RA 3EXG2 3GY0A 3COSA 1J5PA 2H9AA 3DE5X 4IX1A 5FB3A 4FNAA 3L7KA 3C5VA 5HKKD 4PAMA 1W96A 1KO4A 3TTXA 2B2CA 4IHQA 1Z47A 3QGMA 4JLOA 3TIGA 3RD5A 4Z53A 3F9RA 5JECA 4D8TA 5A03A 2G08A 2X7HA 3INGA 1SCDA 1TUBB 1YFKA 3TIXB 2FWAA 4KP7A 2PXXA 4IO0A 3ZIUA 4CVNA 2QSJA 2WVGA 4AROA 2B1QA 1ZGZA 2PZGA 1HSOA 4LBVA 4I6EA 2C7OA 1A9SA 3NONA 3P9SA 3C16C 2OLKA 5PNTA 4RTJA 5F64A 2DJ5A 1P6XA 4YPFA 4KPYA 3D2LA 4QOGA 5DHTA 4EEKA 2ZKLA 4F3YA 1QV6A 3R77A 4ND2A 3D02A 5DHQA 1PKXA 3WGNA 4EBFA 2NSYA 1E61A 2B7CA 4WZAB 2PFKA 2UZ4A 4DMHA 1M9NA 2DH6A 1E6CA 1IHXA 3PENA 2JH8A 2XBMA 1RE1A 3IXLA 3RSLA 1WJGA 2XITA 1FMJA 1KOLA 3RSGA 4M3NA 1SXJD 1ZITA 3ZQUA 3T7TA 4GNRA 1R3UA 4G4JA 2PO7A 1L4HA 1QG6A 2IOYA 1ODTC 2D4HA 2FSUA 3KPWA 5HE9A 2R3SA 2O5CA 1HPLA 2YHSA 2NIPA 4PG7A 4WINA 1EUDB 2BFEB 4HUJA 1S02A 3GX1A 3GYGA 4TXJA 5DE3A 4LWQA 4NK5A 4O4LF 5EWJA 4JI8B 3PUJA 3T7KA 1T0JB 3FCSB 1BA2A 1D2MA 5LN1A 3FGOA 1YCHA 4WA7A 7YASA 3EH2A 1DXQA 5EUCA 3EZNA 5T4EA 1YQTA 2HXSA 4ON9A 1KZHA 4DPKA 3WQQA 2B20A 4MHSA 4AY4A 2DHCA 1Q91A 2PJRA 1OWPA 4D8UA 3G0OA 4LXHA 4PEVA 1GLVA 3BM5A 2NU9B 1L5KA 3GLGB 1A8UA 2EKZA 4GYYA 3MHTA 4HQRA 4ZVTA 1Z0JA 3DWIA 1A3CA 3L7DA 1LLDA 4OQ4A 3L82B 4AYXA 3ZHUA 1PEYA 2RIPA 1D0VA 3AETB 3V1MA 2XWQA 2ZGVA 4Y18A 3UWOA 3UJBA 2AMFA 4PXAA 1U28C 3DD5A 4LJ8A 4DLXA 4HKTA 1KQGA 2PXCA 4KE6A 1CUZA 4MRMA 1S96A 1YB7A 1FLAA 1OIXA 3DC7A 1O96A 5GQSA 1RAHA 2QROA 3K4HA 3CVUA 2PY6A 3AQ4A 1NBWB 5KYUA 2N75A 4D0LB 1M8FA 3R0IA 1N6HA 1FRQA 1USVA 3HP4A 1O9GA 4O3FA 1CR0A 2O50A 3NWEA 2QN2A 2XQGA 4DMRA 5KKAA 1QH9A 5EIBD 4PINA 1ABEA 1EFRD 3HCWA 3NTLA 3X44A 3OF3A 3TFOA 4P83A 4RZSA 4FQ7A 4HRYA 3F5QA 1DL5A 4JQZA 5JSUA 4GIBA 4AJJA 3RFXA 5HFJA 3T06B 2FG6C 1DEHA 3BL8A 1MG5A 5EKTA 4WQMA 3PB3A 5GGXA 1XQVA 3DM9B 3UW1A 4P22A 3KPYA 3NKVA 1QQTA 4B3DA 5B6IA 2P2GA 2I3BA 1UDCA 1D1QA 1EINA 2GH1A 3HV2A 3TZLA 5AOVA 3HLYA 3JD2A 1YQEA 3DMHA 1GTJ1 3ILSA 5K3BA 2JKZA 2XB4A 5IJ0A 3AVUA 1EFPA 2EJVA 3AR3A 2QPOA 1NLMA 1MMFB 4BECA 2A6PA 1Z8DA 2XOKD 4Q15A 2CV1A 1O58A 2AXEA 4B3GA 4F97A 4NMXB 3AR4A 5DISB 1QFYA 4US2R 2ZYHA 3BDIA 3QMMA 2PTHA 4LF8B 3CLUC 1PNRA 3F6SA 2QQFA 3WK7A 4URXR 1W7AA 4A6XA 3GMDA 3TFWA 3OT4A 2GRJA 3KKZA 3V8QA 2P69A 3ACBA 4C04A 5IVKA 2HJ9A 1SBHA 1SG9A 2BH2A 4EJSB 3GEPA 2V5UA 4G0UA 2B1JA 1BCSA 2QVBA 1GUFA 1Z2AA 5A6VA 4D8XA 1EDDA 4GPIB 1DX6A 1FU7A 1V0JA 1MRZA 2PVPA 3TKLA 4A3SA 1ZG3A 3R6DA 5G0UA 4AN1A 4EB0A 3KBBA 4W9NC 3NORA 2IS2A 2XOXA 5DN9A 1ISRA 3VC7A 1IUPA 1R6DA 3HKBA 2CL5A 4FD3A 5J40A 2QTRA 1ZD2P 3SX4A 1IDN1 4XD7A 4CKEB 3CNBA 3LBNA 4YLGA 5DGIA 3LC2O 4XYMA 1TGVA 4YBRA 4LK3A 3RVSA 4EMBA 1TVMA 3SCZA 2QD2A 1PI3A 3OEHD 4OMCA 3UOAB 4W82A 3K9GA 4UUOA 1JJ7A 4FLMA 2CEAA 4TKMA 4YCNA 1YSCA 2ETVA 3OKAA 1XQ6A 5D87A 4E22A 2BZ1A 1QQ5A 3JSXA 2XB9A 4L16A 3EYWA 3QHPA 1OH7A 3AM5A 4HAYA 1I8TA 3BL5A 3NWJA 5IBCA 1IXRC 4OXYA 4BFWA 1SZCA 2MYNA 2OBYA 4CEIB 4EHHA 1HFKA 3N2LA 3SY8A 1U2DA 1NXXA 3I8OA 2EWWA 1BMFA 1DKLA 1QV9A 3EQ8A 2F2TA 4Q34A 1EGAA 5BYJA 2ZI6A 1T35A 2P9EA 1N0VC 3B1ZA 3V3KA 4AMBA 1QRSA 2HCFA 3OT1B 1E1DA 2Y76A 3HGQA 4EELA 2XYRA 4M98A 4TZKA 4HNSA 3T3EA 1OIWA 1E2EA 3N1UA 3GJ7A 2HAEA 2EBWA 1GPLA 3FUVA 3ID6C 4F4UA 4G5OA 2BBWA 4X7BA 2PT7A 2NP6A 1Q20A 4MLDA 1YZLA 1O2DA 3TRKA 5CRIA 2OYRA 3MT7A 2X2EA 2X2PA 3ETEA 4J7AA 3N0WA 4NRDA 3UHAA 1NVXQ 4EY4A 3CN9A 3U56A 4ERXA 3MG9A 4QNMA 2OOKA 2CMDA 3EGWA 3L6CA 3R3XA 4B2YA 4EYSA 4F60A 3QEAZ 1OH5A 1JIIA 3COYA 3EXHA 4JSYA 3I9V6 3H2HA 3D7RA 3JQEA 4BNKA 3QMPA 1ZKDA 3NEJA 4M0UA 1ZK0A 3ADPA 4MV6A 4XIGS 1GZSA 1HT2E 2IYEA 3D6NB 3DOEA 3WQSB 1MABB 4OLBA 4NBUA 3L49A 4QAJA 5FTWA 3KYJB 3RRBA 3VX3A 4R1MA 4X6YA 2YZ7A 3BGDA 3RRNA 3WL6A 4RIIA 4F1KA 3PNQA 1L3CA 5EHGA 2IZ1A 4YROA 5C4MA 2FXVA 3JQAA 1Q77A 2JRLA 1ISHA 1CE8B 3A58B 3NJRA 1E0KA 2WU3A 4ZYXA 2AE2A 4KRFA 2C3UA 1TAGA 1TDJA 1UJMA 2WV7A 1NX6A 2P5SA 1X1CA 1WMSA 2WFZA 2GNOA 5LZ2A 1BRMA 2IYZA 5CXUA 4IJ5A 2P5YA 4KREA 9ABPA 1FFYA 4XLTA 5E9AA 2UZ3A 1FYDA 4HDQB 4UEJA 4EGQA 3OF2A 3KRTA 1E6MA 2BFFB 4OHPA 4Q1FA 1C3OB 4JDPA 4QXOA 3W90A 1E5DA 1JWBB 1KI1A 2A0YA 3D0KA 2AEMA 5AKZA 5ETJA 2JFVA 5GV8A 4GZ3A 5HZGA 1H5NA 4BMSA 2Z1NA 1U9ZA 3AFIA 3BERA 3INYA 1FMCA 1Z75A 2HX1A 2WWWA 4PGMA 4YJKA 3E1KA 3TXYA 3UAOA 1JW9B 3VKVA 3EGOA 1AU9A 4G81A 4BNVA 4D4KA 1G2IA 5ERXA 3CB4A 3MYYA 1IN1A 2ZBUA 3N8IA 5CUQA 1PN3A 3VH3A 2RBEA 1OLUA 1T9ZA 1I4TD 1K08A 3R3HA 4BNZA 2H2FA 3KVYA 4PONA 1G4UR 4JBIA 1EJ2A 4QGGA 4MUXA 1P77A 4LSZA 3HJUA 5E0KB 5CBPB 1FS4A 2RBGA 1Q17A 3EF1A 4EJ2A 3O2SB 3P2IA 1QIGA 1TYAE 4RKRA 4XQ9A 3IEMA 3DE3X 1VYHA 1OAOC 2ODQA 5K3AA 1C2TA 4A27A 1DIGA 1ECCA 1LI7A 4BVJA 2FKAA 2E5LB 4B3JA 4G0WA 1P81A 1XI2A 3HPQA 4IXDA 2C2ZA 5L53A 3SXUB 2X5OA 1I1OA 1EFUA 4JEHA 3NT4A 2CXOA 1G5PA 2AXPA 3ANTA 4HAOA 1RHKA 4ZI2A 4MUBA 3L1VA 3RTCA 3M34A 2H3EA 1JPUA 2WIKA 3FHLA 3U40A 1HMPA 3M1AA 2JARA 2NT3A 3X1DA 1CNMA 3AUXA 1TKRA 4ZO8A 2A7XA 1ZO8A 3RREA 1JHUA 1OWNA 3CTPA 2Y1EA 1CKEA 3K9LA 1E4EA 4ZOQI 2EQAA 4B71A 1YCDA 3U4CA 4CIDA 3VYUB 1V8ZA 1Z8HA 1N2CB 1T34A 2ECQA 2GYYA 3HEMA 3UJCA 4DAOA 2D7DA 1HZZA 1U63A 3OETA 3AR9A 2RH5A 1XZPA 1SCAA 1G6KA 2RI6A 1A0OA 1Y82A 3GQVA 3O95A 2VZEA 2HMYB 3THRA 3BQMB 2FJUA 5ELXA 1K68A 4FGLA 3A3NA 2GZAA 1FLDA 1TK3A 1OWLA 2WM2A 3PIIA 4PGHA 3SDBA 2B4KA 2FU5C 2GM3A 2B2NA 4I1RA 5IKMA 4J16A 4FFNA 4EKGA 2AN9A 4TWRA 4ZYTA 1WHSB 2JGEA 4Q4HA 1ZU5A 4HNAB 1FFXB 4LFAB 2GPBA 5H0IA 2DX7A 1XEXB 1E1YA 1QRAA 4ZCRA 2VBFA 2XGSA 5E6UA 4J0FA 4MW9A 3SFVA 4GXRA 1JJFA 2JGNA 2Z5LA 3T7DA 3IT3A 4RESA 1GZVA 4QVIA 3K2QA 3ZCRA 3HKCB 3L8YA 4WBXC 3WYCA 4B33A 2BEWB 2VNIA 2AFVA 2Z30A 5DP1A 2GAIA 2BYTA 2EYQA 1W6UA 2EFHB 2VJCA 2WD9A 1X7XB 1CS0A 1GSHA 5GM2A 4LG1A 4AX4A 4PNEA 2VJKA 2MMCA 3G7SA 3OC6A 5EJFA 1VRWA 4ML3A 3QELA 3QH4A 3D0QA 2PCJA 1QXSA 3HN2A 4I8IA 4JODA 4X1YB 1I7QB 2MJLA 3S28A 2BMWA 5JAUA 2ONKA 5J4HA 1WCXA 1SVNA 2G06A 2YC2C 4LNUA 2HDNB 2ZQ5A 5IJ9A 2V8BA 1FRZA 4TSFD 4EECA 1N9KA 3JVIA 1NVGA 3IURA 3UIEA 3T7EA 4YT4A 2PZBA 4WOJA 2FJPA 4YRBA 2I9KA 1M1YE 1YACA 1RRCA 4JENA 2JAPA 2CVQA 3N9IA 2IEZA 3P0EA 1G291 4MVJE 1Z12A 4O2BF 1NYRA 2RGAA 3MERA 4C7VA 2F6RA 2X41A 2EQBA 2ZB2A 3DMNA 3PZBA 3O4IA 3HVUA 4QECA 4MVCA 1AG9A 1ZNXA 2YUIA 2CNDA 2C04A 4E2FA 2DECA 1GQFA 1S8NA 5NULA 3RROA 4MOWA 3FTFA 3L8CA 3GPIA 3D8HA 2FUG6 5I51A 2P2DA 4MUGA 4LE1A 1W4RA 1WDKA 4IOMA 4XRRA 1WCIA 4KLRA 2VZLA 2WAXA 3DV0A 4D0GA 3CEHA 2B4RO 2D0PB 3DZHA 3SR0A 2O8FA 5FA5A 3GF4A 1R5BA 1D8AA 1GU1A 4PC6A 3OZFA 1U9YA 2VTVA 3BSFA 4QULA 5CP8A 2JFFA 4HN9A 4HPWA 4N8SA 2P6MA 1YQDA 1UBMS 1T15A 2NUPB 3BMCA 4LI0A 1ZM9A 3MTAA 3WZMA 4ANFA 3CH4B 1V5GA 3BD7A 1X1EA 1VZ2A 5HM6A 1E7RA 1XHLA 3VC1A 3AIMA 4CQNA 3VHRA 2JFXA 4ZOLA 1SKUA 1XHEA 3EBPA 1Z0IA 4X94A 4UMEA 2NU6A 4MH0R 4NFHA 4YAIA 4QE3A 3KAJA 5HMMA 1RTTA 2XUIA 2ZBDA 3VU9B 4QDUA 4DR7B 2OL4A 3SYKA 4C89A 1JDNA 1D9XA 1EMDA 4BNDA 1SEVA 1ZH4A 1DADA 1JEYB 3AB8A 4ALJA 4ETMA 1RKBA 1A95A 3C1AA 1RTKA 1KQNA 2VTKA 4Y2QA 3MJHA 4K2HA 1D2NA 1OBHA 3IPRA 3S2ZA 3GZNA 3AMVA 8AT1A 4XWTA 2OB2A 3T1OA 1WKBA 3HI6A 1YRQA 3IUMA 3EVZA 4XB1A 1IY1A 4BBJA 3VZSA 4PLYA 6NULA 3GFBA 3WBFA 1N57A 2VXYA 5ITWA 3ESRA 3KYCB 3QWIA 4OAOA 5CNIA 3FRHA 4OFWA 3LXRA 3SEQA 3Q7SA 1TJ3A 3OPQA 4RJLA 2GBFA 5CLHA 5CX1B 1LB1B 5FI5A 3HVRA 4GBED 1H2XA 3NU1A 5IJXA 3ZNNA 3RVOA 3ZCVA 1NVKA 3VKFA 5FTLA 2QVYX 4E6PA 4JP2A 1WY5A 2O9JA 4UBNA 3V4ZA 1KH1A 2I78A 3T7SA 3BB4A 1MEOA 1IU9A 2R7MA 2AQ8A 3N2NA 3OA0A 4NCBA 2H2AA 3SOPA 3JAWB 3SLKA 5LB2A 3KWLA 4XB2A 3BF8A 4HO1X 5LD2B 4R68A 1CUCA 3ETHA 2A3RA 5FTKA 4C7OA 5GPBA 4FFPA 2JFPA 1V2HE 1FRNA 2QMHA 3L0YA 4JIMA 2O23A 1IHPA 3BAZA 3LUAA 4IJQA 4L8LA 5DV9A 3VZDA 5C8XA 1RABA 3L0IB 3DLPX 4PPNA 1ZVQA 2C7BA 3T12A 4D9GA 5G1PA 3WE7A 3MT0A 3NM5A 1TQ6A 3ORYA 1R9JA 4M0EA 4MVXA 4HDCA 3ET5A 4G1BA 1Z2NX 5EY5B 2RI1A 4C6HA 2H17A 3GDHA 3U7QB 4RBNA 3R74A 3CT6A 1JFVA 4W6QA 5EIBC 1CF4A 4YRMA 4JT4A 4DYVA 1NG9A 2GRUA 3CRRA 4JFRA 2WIFA 4BO2A 1NOIA 4KE9A 3NYIA 4NFLA 1K7EB 1QHIA 3PU6A 1N2OA 1YOVB 3SVLA 2VHYA 5CFLA 3EVDA 2VYVD 4JB8A 4FIDA 4WFJA 2IPLA 4DNPA 4EY5A 3RS5A 3M9LA 2PX0A 1EM8B 1JGTA 2VUTA 1T1EA 2OWEA 4R8SA 3ACCA 2V7VA 3DTNA 1TQ8A 3DLAA 5FBWB 4DR1B 1LSUA 4TS1A 2ZZNA 1KY2A 2D3TA 5DTEA 2HA2A 3TEJA 4YJ3B 5A3JA 1B8PA 1UAYA 3KP1A 5IBRA 2GLTA 5CX4A 2G3YA 2Y8EA 3LPLA 5DM0A 1ZJWA 2O8BA 1P9LA 3HCPA 1V1JA 3L9WA 2YWBA 4NABA 4F93B 5DNCA 1H2BA 4NE9A 1QU2A 4Q9AA 4RA6B 2ZUDA 3PXCX 2P2CA 4DUYB 2JEOA 4DZRA 3UJNA 1LDBA 1KPIA 1WW2A 1RSZA 2WIGA 2EFYA 2I2AA 3U4IA 1ESMA 3ZDAA 4CDGA 2XRYA 5L7WA 4F46A 2WTUA 1JJVA 4U0JA 1XKXA 5F7JA 4PTLA 4MUAA 4E30A 1TMYA 2NV2B 4IDDA 1TM7E 2BHNA 1C7ZA 4H1HA 3CZPA 3VZPA 3ICWA 2G25A 2WC1A 1ULSA 5HQ3B 3NATA 1U28A 1Y9ZA 2WNHA 3A3YA 3ZCQA 5JUWA 2Q5HA 1GWNA 4ZOBA 1UK7A 3C7KA 4OLFA 1KEZA 4TS3A 3CE9A 2GR9A 4C14A 1H2WA 1V35A 2I2CA 1JHRA 2CE7A 1B0PA 3FG9A 3QBJA 3VC3A 5JDIC 2G80A 2VHXA 3VYWA 3WSVA 1ZK4A 2BM9A 4EB8A 1I9GA 1FS6A 2PLRA 3CZ9A 5AIBA 5MN4A 4GL4A 5TMEA 2I87A 2QAJA 1RCTE 1OC2A 2OBNA 2P8SA 4UHHA 4UDXX 2NSHA 4ZQHA 3TGLA 4IILA 2X23A 3ESCA 1ELOA 1TAQA 1Y42X 3FTNA 3KFLA 1PR2A 2LRHA 2OZVA 3NOVA 3O3MB 3QHAA 4YWJA 3RB8A 4F9GA 5JPCA 3OQMA 5ICMA 4Q4JB 5J9FA 2ANCA 1EB9A 1EBUA 4KOEC 3WKBA 2CJWB 1W46A 1MC4A 1PR9A 5B58C 1P19A 5FX2A 3KXKA 4ZOAA 2VJPA 4CFYA 5LKAA 2UXDB 1HYEA 4ND6A 3L43A 1WUKS 4IAOA 1C4WA 3PJDA 3FWPA 1CDOA 2IY9A 1Z7YA 1DJNA 1MB0A 3LY5A 3AB7A 4MDHA 4RWZA 3WSTA 2DHDA 4B82A 4P32A 2I1VB 2WICA 1IRIA 1EVLA 1H6DA 3HXOA 3FTEA 1UF9A 4MB2A 1OROA 3OJ0A 4OXNA 2PYIA 4RVFA 2ET6A 2A5YB 2LBPA 2YHIB 4ND1A 1HOXA 1W73A 4Z8YA 3W5HA 5B57C 5GZ3A 1FDRA 2JLUA 2JHAA 4UBMA 3ROMA 5JZSA 2B1IA 3S29A 1CULC 3UV6A 1H2AS 2F62A 2HDHA 3DHYA 3IUYA 4G0NA 1CY4A 5HS6A 1DKNA 3NM6B 2GJAA 4MYUA 4DQXA 5B2ZA 3RQIA 1DAPA 1K5DA 1MXHA 3PHLA 5K05A 3NC1C 5DSZA 1BMTA 5E4TA 4YTEA 4LF7B 1A88A 4HFNA 5D1HA 2RKOA 3CBQA 2LNDA 3G9XA 1DAIA 3G2NA 3KYBA 3DLHA 1L1EA 3HP7A 3JZFA 2ZI4A 2WZDA 4ME6A 5FA8A 1S8FA 4TV8F 5F2EA 4CMBA 5K03A 2PGOA 1APBA 4JBHA 3NTXA 1QLHA 3RYHB 3BWBA 1SXJA 4NLLA 3OCJA 3CWCA 4G6ZA 1U0JA 1RHQA 3A28A 5E7MA 1J99A 1YV9A 5EVCA 3RABA 1AXEA 2QZ9A 3C70A 2RAPA 1HKUA 2DR0A 4P80A 4CL3A 3IL2A 3H0EA 4C7BA 4EX7A 3PHIA 1ZXLA 2KSQA 4AKEA 4DIBA 4CIWA 3TECE 1Z5GA 1NAHA 2IIQA 4TSKA 3ABQB 2OY0A 4BQPA 1QORA 2HIHA 3H5AA 3L7JA 3O8QB 4BQQA 1U2GA 2IJGX 3LDGA 3ZHZA 4XLLA 3ZKAA 2LZ0A 4CM1A 4EI7A 4ZO6A 3PRJA 1VPLA 1V4VA 3WOHA 5IFLA 1R0KA 1X8XA 2CXHA 4KDRA 1KO8A 2QAGC 2TMGA 4HB0A 5HKOA 3UMBA 4UVDA 1CUYA 4YQFA 1N3BA 3IUNA 4Q39A 1WUYA 3O7MA 4PZCA 4J3NA 3L7OA 5AVJA 4AP9A 4BO0A 2I4OA 4LVOA 1W29A 5INTA 5KCZA 3OQPA 2ZM6B 5AR1A 3FJOA 4BV8A 2QB5A 3SYRA 5A4IS 4Z4EA 5DLYA 3I9JA 3DZCA 2PX4A 2ZS9A 3K0FA 3HFSA 3MOIA 4MNTA 4RELA 1OLXA 2OD9A 5FLKA 2C2YA 3LT2A 4JLMA 3BZWA 4C4OA 1K6EA 3KXPA 2Q8NA 3I9KA 1E6EA 2YY7A 5AW4A 4NCXA 3GUUA 3ABZA 1IZZA 1S2IA 5KX5F 3OM8A 2J7PA 2V0NA 5AM5A 1W5TA 3ITEA 2P9BA 3C5CA 1UXHA 2R1TB 2REBA 4UCFA 1O03A 3BICA 1QIHA 3JZIA 4P4LA 5B53A 1YR2A 2PE5A 3J7AC 1Z68A 4AJ4A 4PFQA 1B8NA 5C2JB 2H9YA 4FBMA 2FEAA 4IQ0A 1DHRA 2NXJA 4GE3A 5GJVC 3WWDA 1E32A 2D7JA 4Q1EA 3VNSA 4GU5A 3ICOA 4RPLA 4ZOLF 5JO0A 5BV8A 4C0SA 4IIYA 4Q5IA 2X22A 2BR5A 2AFIB 4DT1B 4Q7EA 4P98A 1KK2A 4ZU1X 1GG2A 3MCUA 1BRTA 4RTKA 2HQBA 3QP9A 1PTKA 3AI3A 3ORHA 1USIA 2GDZA 1QPGA 2GK7A 2OHXA 2X4LA 3EWNA 3VNUA 2YV4A 1QRDA 3DMYA 3KU4A 2GO7A 4CKZA 1KBQA 3DTYA 3IUBA 1SCUB 1EXVA 4C4RA 4D6XA 4AT1A 3QBEA 4QRIA 1ODJA 1BKYA 1I2MA 2XOEA 3C4VA 2FZVA 1Y1QA 2CCKA 3SM9A 1VECA 4YUYA 4GR9A 4IM7A 2NZJA 3WLHA 1M1ZA 5HQTA 4FC7A 5DVZA 1W19A 2FX2A 3OX3A 1W88B 2DY1A 4YDSA 3UK1A 1IZ7A 3X43A 1CR6A 3NBUA 1L4BA 1RYBA 4K1LA 5HXAA 3NFYA 1BVHA 1MJNA 4XJTA 3UJ7A 3TOVA 1PR1A 1TD1A 3TQOA 4IV8A 5LWQA 1HF3A 1SBIA 2GM5A 2VP6A 3WA6A 4DWJA 4HVCA 3ZHSA 1V8OA 16PKA 4G9GA 4JKYA 1F0PA 2OVBA 3PDIB 4XWWA 4H7HA 5TJ9A 4BFCA 3H5IA 1Z3IX 3QPAA 1SUBA 4MYSA 4QUEA 4ZVSA 1E1RA 7ADHA 4JSRA 1F6DA 2Y3IA 1VRCA 4HFJA 2AEFA 4L3VA 5G4KB 3TNJA 1T4MA 1KJYA 4D9CA 1DINA 3KJQA 4XD7D 5C5CA 1YDMA 3AHJA 3EEBA 3DOIA 5JD4A 1NGSA 4MDYA 4XE5A 4G41A 1Q0UA 1HE2A 1CUEA 2CE2X 3K1JA 2H4ZA 2I6QA 3CNQS 4DGQA 2ZE5A 6YASA 3UKDA 4KR3A 3RTGA 2EGGA 1L7XA 4U7PB 1JSCA 3GPBA 3AUAA 3QXCA 4HH0A 2AWNA 3LWBA 4MQLA 5IDXA 1RJWA 1GCIA 3OCUA 1U2QA 3GNSA 3I42A 3P4XA 4C88A 1CY1A 2QI9F 2VT7A 3IVAA 5C7IO 1HNNA 1NLZA 1RI3A 2GN9A 4MLZA 3TN7A 1SGWA 2JIRA 2C92A 3DZBA 3FPCA 1PJRA 3G2IA 4FK8A 4JKOA 4LWOA 3PVSA 2I7CA 3CXUA 5AVZA 4I1UA 1BX1A 2CXQA 2Q6LA 4FB5A 8LDHA 4K9QA 2QRMA 2I2XB 3HHPA 3RR2A 4LQCA 3CVXA 3CB2A 3PD7A 4HNUA 3W2FA 4EITA 3DMDA 3QUQA 3BFPA 2BSQA 2VJBA 1RFGE 1LQ2A 2VQ6A 4QDZA 1JA0A 4R0VA 4HYTA 4WY8A 4ZAWA 1FSZA 1SUFA 1SQ6A 2J3JA 3NQ41 1QJ4A 3GLHE 5JWHA 3SS9X 5HW0A 4EVIA 4EHLA 2WI8A 2FPSA 3TRIA 3EPHA 1BX3A 3COPA 3FHOA 1I3CA 3LA6A 1V11B 5TEWA 8ABPA 5CPBA 3HI4A 3PPIA 1K9SA 3RJ9A 3DCNA 4A26A 4NENB 1ZNWA 2MIIA 2VT3A 1JEQA 2VWGA 4QNNA 5TX7A 5JJBA 2J0QA 1AMNA 1U0OC 2YMQA 1R4NA 1PYOA 3GAMA 4O4JA 4LXYA 4H7DA 3L0PA 2DFPA 3LGSA 4YUVA 1RP1A 3EXAA 1T5SA 3IAFA 4PTZA 4YIKA 3OQ6A 3UNXA 1RRGA 1Z6PA 1PZXA 1LI4A 2W6JA 1XXHB 4QOIA 2XDYA 4RPIA 3W5VA 1KAGA 1EHYA 1T1IA 5F5NA 4C1BA 1MBZA 4CT5A 3QOYA 4Z6KA 5ES3A 4OM8A 4YMSA 4IF4A 3NHUA 1XUOA 5F77A 1BGWA 2GN4A 4LJKA 4RS3A 4EW6A 4F3KA 1LLUA 1E9SA 2W98A 5AUOB 1N5RA 4QYWA 5JS8A 3G59A 3FCCA 4LXTA 4KITB 4M37A 5EMMA 5ALSA 3V8BA 1VLLA 2D7CA 1VCMA 3ROTA 2W4MA 1AZSC 1T8TA 3QRWA 5MF6A 2ZJZA 1U31A 2W8BA 1N2HA 2BH9A 5DWVA 2Q2QA 4TMXA 4XQGA 1A82A 3HDYA 2GQ0A 1C3VA 1MNAA 2VO1A 3LVQE 1X9IA 5AKYA 2H06A 3IILA 2QIPA 2ZAMA 8MHTA 2NZUG 3G2JA 1B73A 1M7GA 1AF7A 1LX6A 2UXBB 4KPUB 1ESDA 2QTCA 3JQ8A 4RH1A 4CV1A 4BVLA 4AULA 1MXFA 4DV4B 3PFKA 2Q3LA 3WYDA 3UATA 4HDRB 3L8HA 4F7WA 3OJLA 1KFJB 3H83A 4UTPA 3C74A 2C84A 3JWHA 1MA0A 5DBOA 3D6MA 2CXUA 2VEOA 2Z1MA 3KOMA 3OD5A 4FUTA 4UBOA 3M49A 3WBBA 4JI0B 4GR4A 1Y9JA 2VYND 1KK3A 4BAZA 4IGFA 2RG7A 1CPYA 2P2SA 4NEQA 2Z3WA 3DR5A 2JFZA 1XX6A 1EG7A 2OV1A 2PSSA 2YL2A 1W5SA 5AKKA 3S4YA 3TM4A 3TVTA 5A04A 3M4JA 4KSYA 5CTJA 4YCLA 2N42A 4L6AA 4OM7A 1F2VA 3BH6A 4YHBA 4IIUA 5KWJA 4G0OA 3E2MA 1ML4A 5G0VA 1MAUA 3SHTA 1FQOA 3KCNA 4Z7NB 1PVOA 1G0NA 2R8EA 3PNLA 3ZCXA 2DLCX 1AKTA 5FWXB 4JGGA 5D5HA 3KSAC 2Q6OA 4LJ9A 4Q03A 4F4JA 1GHTA 5JDCC 2AYYA 2QMQA 1N2CE 4PRLA 2I54A 2O4CA 3LRTA 4JC0A 4A36A 4TL9A 1KS9A 1FX1A 1XD9A 1QIFA 5ALPA 5BSWA 2H5JA 4BFYA 4F2HA 1NP6A 3C87A 3OZRA 1MKYA 1XZBA 1YZKA 2VJMB 3QG5A 4P33A 3RSHA 4B40A 4AMYA 3IXMA 1YBHA 1M33A 1ZH8A 3GDOA 3RSSA 3R9XB 2ZRJA 1VJCA 4XYEA 3REQA 1HDXA 3H84A 4KH1A 4D4MA 2WJJA 4INJA 2BWJA 1H5UA 1WXHA 4DEXA 1EP9A 1NV9A 1W35A 2B8JA 2MHCA 2BRUC 1AUOA 1XAJA 2C0QA 1ACMA 1ACJA 2HK7A 2Q3EA 2VRCD 3FOAA 4PO3X 5DBEX 4N3BA 1RJGA 4JOBA 2VDWA 4U5XA 1AX9A 1U1IA 4YI5A 1RQ2A 1R6UA 2WKPA 4E32A 1DOZA 2I29A 3II6X 5B1IA 1GVHA 2Y1DA 4MW0A 1PS9A 4Q19A 4WCVA 4JCCA 4BEWA 5KYTA 3WV4A 1X70A 1F60A 1KJQA 2XCUA 3GLUA 1NVDA 1N92A 3L77A 1T6XA 1T9GS 4XQCA 1M5RA 5BN5B 1VIVA 3OU2A 2X8JA 4KAXA 2QN9A 2YJ3A 4HTFB 5LYJA 5BN4A 2P0EA 1UR5A 1E8DA 2N9UA 3LKVA 4GI3A 4PLHA 5CFRA 1OR8A 421PA 2HH9A 3OPYB 2ZSIA 4WXHA 2WUGA 1WSDA 4K6GA 3VR2A 3ZNPA 1Z8FA 4KQ6A 1Z4MA 4NBLA 4RULA 2VRCA 1RJFA 2C95A 2PX3A 2ZE8A 3LP8A 4BV3A 1NY5A 2O8DA 2P2ZA 1AURA 5KU7A 2DBVO 4O4HB 5KX5A 1O95A 2PUGA 4PLFA 2G09A 4JXJA 4K6OA 1W0CA 4E7PA 1ENYA 1XN1A 3V7YA 1SU7A 3F4BA 1BJTA 1J0EA 1RI1A 2X5NA 4KHZA 2EHDA 4KIGA 3KVOA 4DCOA 4DDTA 5ALWA 1RJ9B 1VHWA 3RYFB 3TLCA 1RE0A 4FMPA 1SKAA 3BWVA 2CUKA 2BCGY 1QYVA 2PMCA 4JJ8A 1T3TA 2O8NA 2YWEA 4U5QA 5EIOA 2JIBA 3FXAA 5KYWA 2O7VA 3V9PA 1Y6GA 1A9PA 3LY8A 1C30B 1W30A 1NUHA 5ENVA 3ZWBA 1QCDA 3B1JA 3H5NA 1ZD9A 3HYCA 3QMWA 1XB2A 3RJMA 5KWSA 1EFTA 5A3QA 2CUNA 3BSSA 3HJNA 5ITZB 2FG5A 1G1AA 5CVUA 3C7CB 4XFKA 1HE3A 4N9WA 3QKTA 5K51A 4GHWA 2IS6A 1H93A 3FOEC 3X2EA 3LQ4A 821PA 2AC4A 3LIIA 4JLNA 3BWYA 3DGEC 3NEAA 4KAJA 1TCCA 4DQUA 3V1LA 4QARA 4MRRA 4PS0A 5CVDA 4OUKX 4OX9Y 2JLRA 3BHIA 4COKA 2X58A 4IH9A 4KIFA 3THWA 4KMSA 1JDZA 1QVAA 2FMUA 3E7WA 1FPQA 2QSZA 1LRLA 5DW0A 1JJIA 3EXIB 3JQ6A 1CY0A 2ZYWX 3S2IA 4OJTA 5BVHB 2IEAA 3Q10A 4UBLA 3RAGA 4S0XA 3PQFA 4U2BA 4XWYA 4EGFA 5JCPA 5K8TA 5GIOE 5LIPA 1EFAA 2C2HA 2O4UX 2IZOA 3O38A 2ATIA 3DDZX 4WX2B 3SDZA 3HJTA 2P5TB 1EK6A 4DYDA 5EMNA 4I4LA 1GPDG 2W00A 4TVOA 2Z5FA 1QOPB 2XT6A 3KUDA 3GLQA 3UA3A 2EZ4A 3L7BA 4H31A 3WHLA 4I50A 4J2OA 5HUHA 3KTOA 4F2WA 3E61A 3WA7A 4X1IA 4B4VA 4MKRA 1U3GA 3OP1A 1JB9A 4RLQA 5IFKA 1GNRA 2VBIA 3WYBA 3AEQA 1EDZA 3TGPA 4EX6A 4MVJM 2QNIA 3AR6A 4P31A 4DAEA 4ENTA 5AKIA 1H5QA 2F43A 3GZTB 3WOVA 4ENQA 4MQFB 4JLPA 4HDAA 4OYRA 3HXKA 4REQB 1SVKA 3TTVA 5CD9A 1NI3A 1W5AA 2A4MA 2FV8A 3GJ0A 5JH7A 2OAGA 2XGJA 3QKRA 4K6CA 1P5JA 3I4LA 1K5GA 3ZJYA 4JR2A 4BUCA 3M5WA 2NU8B 2CWDA 2AK2A 3VU3A 1DOAA 1BE1A 1Q74A 4RXMA 5JW6A 4ZVPA 2IT1A 1EIWA 2JDID 4MUJA 1R7RA 4GW3A 2F1RA 4GZ5A 4DBVO 1P72A 4NV3A 4URYR 5ALJA 5C3UA 5AW8A 2XZOA 4DV7B 4BMYA 3EB9A 3RYCA 4RHXA 3C3BA 1Y5IA 4JUCA 3SC6A 1MAAA 2A1TR 1VTKA 2ZJ8A 3IALA 4CKBA 5MGNA 2ENWA 4NULA 2R1VB 1F38A 1XHFA 2P4QA 3O82A 3MTGA 2R65A 1XNQB 1NJGA 2A4KA 3AY3A 3A6PC 2QE6A 3GAAA 2YV1A 1ODLA 1T1JA 2WA2A 1DC3A 1CUVA 3GEIA 5GM1A 3UBTA 4OQZA 2MSLA 2RC6A 3BSYA 5AJVB 2DPGA 2NO0A 3DP9A 1VE9A 1U2SA 3OOYA 2QD4A 1EJBA 1YH3A 1QH8B 3MSCA 4DIKA 2W6ID 3IP3A 2QD3A 1Q21A 2PUJA 3JTMA 1R8SA 1QHHA 4FS3A 3KLOA 4NMLA 5FQNA 4FBGA 3PEVA 1MFPA 1S2DA 4FXOA 5EQTA 4LZOA 3V4FA 2AOTA 2OBMA 1YTLA 3DZ8A 3SHWA 3T99A 3RASA 4EW3A 1VG9B 5TT0A 2IV3A 2C4UA 3OQ1A 2OXRA 4UW9A 1S4MA 1R50A 2E1PA 3P9XA 3PSAA 4BJ5A 3JQ9C 2B4AA 4D7AA 2QVLA 1JLMA 1FBTA 3WWYA 5JXWA 4M89A 5HYVA 4UNQA 2YXDA 3N53A 5D3QA 1TM1E 2AGVA 4HZUB 3EN0A 1ZPDA 3EHEA 5LDGA 4UMVA 3AXSA 1P31A 3WNDA 3E48A 1DDGA 2NTVA 3QE3A 5KJFA 3G2LA 4M9QA 3P2KA 3UGQA 1PWYE 2B37A 3IAXA 2OUIA 2ZETA 4KO2S 3KQMA 4QUBA 1TXGA 4YIHA 4OA5A 3KEQA 5A6SA 2ZREA 3VAZA 1XLTC 4J6FA 2XW6A 3GGCA 2X8AA 3R6WA 3WNQA 1JFTA 1QF7A 1UXJA 1YR3A 2FRDA 2UZ1B 4I4CA 1RNLA 4TMFA 3ROFA 3K9CA 3OQIA 1IY8A 2AMVA 2AR0A 1L5MA 3CSDA 5DM1A 1JG1A 2CL7X 1U8EA 2Q7OE 4U2FA 2XXAA 1GTRA 1DJLA 2Q41A 1YC2A 4I55F 3W4JA 1K27A 1DTEA 3PF8A 3JD1A 2YNMC 1M76A 5K0CA 2J0SA 4LYHA 5A1TA 3KD3A 3DULA 2Q0QA 4MZDA 4OQMA 2CMKA 2YWHA 3Q5EA 1X15A 1F6BA 3AZPA 1KXZA 1TIPA 1M67A 4G23A 3D8UA 5I45A 2X6RA 2H31A 1Z5PA 5IDVA 3GQBB 1J00A 5KYUB 2AS0A 4ECEA 2TMDA 3MAGA 3R0XA 4RHYA 2Q5QA 4MS4A 3MWFA 4Q9KA 4A0FA 4EYKA 3Q8WA 1A71A 2PZFA 1U1EA 4ZCSA 1ZHHA 3ZU5A 3LC1O 3HZZA 1L5QA 3EF3A 1JT9A 2HF8A 5L8VA 2NNWB 3A2KA 2BONA 2GEKA 4RY9A 1RM0A 2F17A 1R0ZA 4BFSA 2GZ1A 4DQVA 1K9VF 2CZQA 2I2BA 1G3MA 3C7DB 2ZATA 1MNQA 5AM1A 1I6KA 5JJCA 4DR5B 3CW9A 1GGHA 1UPTA 1A2OA 4I6JA 1Q3TA 3UHJA 1GIAA 3WIEA 3K4PA 1FVXA 1UT6A 3DLTA 4ZO7A 4ZIRA 4JV5B 4RY0A 4L78A 4H6PA 4DQ0A 4M8SA 1WUTA 4M7OA 1WIWA 5DWQA 1GTVA 3IJPA 3BORA 5P8WA 3ZQJA 3DE6X 1VJTA 2E4ZA 2VDUE 3CG0A 5DB4A 3T5TA 4WHMA 2QIOA 2G7ZA 1PYDA 4S2EA 1M2OA 3SBDA 4NZ9A 1OLSB 2EKBA 1LGYA 1PEAA 1TW2A 2ZCVA 3PEEA 3BBPA 4UTOA 4EL5A 5JI2E 5KQLA 5LP6B 3KQOA 3CN7A 1A50B 4HZIA 3EZ9A 1TM2A 3PIRA 3UMCA 3AP3A 1T8WA 3BKWA 3CNLA 3PE6A 1NVBA 2GEJA 3Q8MA 1OTYA 4UBIA 1C0KA 1JE0A 5H16A 3AUTA 3A2NA 1X3LA 1QX3A 3H8JA 1J0AA 4XARA 1F1JA 4IKPA 1RVV1 5MN5A 4FS8A 4GQIA 2I2DA 4CHTA 2ZUUA 4Z9FA 4LDAA 3OTHA 4EKYA 4UATA 4C3OB 4HDOB 5JRDS 1GDHA 1SXJE 3UF0A 3A70A 3BCSA 1Q0ZA 1K3TA 3KJHA 1NR7A 3OIGA 3VDXA 4DSOA 2XXBA 4D5EA 3JATB 4N4AA 3AH8A 3HA2A 1IBSA 3DNFA 1IVSA 3SMQA 4B34A 1Q50A 1KDPA 2NUBA 1S2OA 3FSGA 5JU6A 1RBQA 1DC4A 2JCYA 2YRFA 2R4UA 1ZK1A 2X77A 4JLAA 4L50A 4MCHA 1N6KA 1NNI1 3D6TB 1QOZA 3FMIA 4N7RA 3V42A 4OOFA 2IP2A 1CUSA 2QRVA 4TVKA 4DREA 1JZQA 4RA9B 1ESZA 3OZGA 5TGTA 4K9RA 3INTA 4WRRA 1KY3A 5EYPB 4R7TA 1DRKA 1E3WA 4TLBA 2Z8YM 1AS0A 1UDRA 1FP1D 1PFYA 3DZKA 4JC4A 2HBZA 2VJQA 1DWUA 2PNJA 4A8HA 4CTKA 5L4NA 1A8PA 3TZHA 7MDHA 1QP0A 3FI9A 4FFSA 3IOMA 3K31A 1FVFA 4IIBA 4C05A 4D79A 1OT5A 3WGZA 1RMYA 3NLLA 2Z8XA 4R1UA 1YWGO 1PZGA 1P8JA 3BXFA 2B36A 4UQOA 4EZEA 1ZOOA 1DT5A 3ZE8A 2I8LA 2D4AA 1FNSA 1F2UA 2Y2UA 3NIBA 1MCZA 3ZDBA 2EP5A 3EULA 5G53C 1ZH0A 4RIGA 5AKEA 5TS2A 4IKEA 4BE4A 5JEEA 4OLHA 4ZRNA 1FOEB 1K0UA 4BWGA 3OIDA 2YXNA 2E89A 3WDMA 4RSRA 5K4GA 3PVZA 2G6TA 3U1VA 3VZBA 4BTLA 4BX8A 4PZUA 3B60A 4J2TA 2FPXA 3PBKA 1UXGA 3WGVA 2XYPA 4IOLA 1U8TA 3VKUA 2Z95A 3FNGA 2XA1A 1W36D 3OY2A 3HG7A 4HPJB 2OEPA 3TGWA 5I7VA 4NZZA 4G0VA 2C5AA 3SXPA 3BRWD 2AQHA 4HEA6 1MA3A 1UP6A 2IYVA 3UB4A 4F06A 3AY7A 3CH5A 3OH8A 3ZWAA 1UINA 2H1CA 2IYUA 2Q1TA 3DBVO 4AF6A 4JH0A 4YXWA 3G2HA 1JLSA 1D2RA 3VO1A 1GPAA 5L95A 1QQBA 5JAZA 1ECJA 4JFAA 3ML1A 1ATZA 3GG2A 5K3OA 5I3CA 4M0PA 4F38A 3EY9A 1XDSA 2YFYA 2WJPA 3B12A 3E5MA 3M8KA 2QYHA 1X9HA 1T8RA 2J3LA 4GPEA 5AUNB 1G2OA 4RGBA 3D8RA 4B31A 3C3XA 3WK9A 4OF4A 2RB5A 3SYLA 3TCKA 1R0XA 4EDHA 1TEHA 3BRSA 4P7FA 4Z7JA 2I91A 3X1WA 1FBNA 1QH1B 4BKPA 5CW1A 1FTWA 2XGOA 4GMGA 4INAA 3FFWA 3LWDA 1J39A 2DY0A 1E4VA 1BKSB 3E58A 2R85A 2XIJA 4KQ9A 2X0NA 5LOVF 4EATA 1Z25A 4N3AA 5LNK1 3K5PA 2DUWA 4E5MA 1V8PA 3BTOA 3F0TA 3QLEA 3OTQA 3T9EA 2F55A 2Y05A 2D2IA 4CCAA 5CDGA 4IHJA 2WKWA 1JSRA 3AONB 4OXQA 1I7DA 2Q07A 1TX4B 4C29A 1U3UA 5DXJA 1ECLA 1VKJA 3MCTA 2R4TA 2HY7A 2O1WA 4RTLA 1OYYA 2I34A 5C81A 1BO6A 2HGZA 2KI5A 2XI4A 3EIXA 3KKMA 4DPLA 2XUQA 2PKYX 1I3KA 4HEHA 5HDQA 2GJKA 4S05A 5DNUA 3WL4A 4BWFB 1XLVA 3DLIA 4GVXA 2F1JA 4Z0HO 4FFMA 5JSQA 3M83A 3K6JA 3RS7A 1ISMA 2GPWA 4V1CI 1Y5RA 1OAAA 4EEXA 4YCMA 2CLOB 3T5CA 2CSUA 1QDLB 4JWKA 3HCFA 3H87A 5KYXA 1G8HA 2XMRA 3GUHA 1GQRA 3IBCA 3R0JA 1FXWF 3D3WA 4N49A 4CEJA 3STTA 1U1GA 1WNFA 2NAFA 1PT5A 3B20A 1RP7A 2QGNA 3MAJA 2ATCA 1MH1A 1YS4A 4BNYA 1A9RA 2DT5A 2QSYA 3A6GA 4S3MA 1VA5A 4JZYA 1ZCAA 3AP1A 3KC2A 1G8MA 3TLAA 1Y8CA 4NPAA 4ZDJA 2FF7A 1TO2E 1CR2A 2JGJA 5E6RA 1NW4A 2QYSA 1D5CA 5T8KA 2VTBB 5HKBA 1XTQA 4NARA 3RIEA 4C22A 5ALZA 3L1IA 5HWSA 2H1FA 3G17A 4MJ3A 3W79A 1Q0LA 4XSHA 1DCTA 2I4RA 4L76A 3A31A 2ODAA 2Y1GA 4RAOA 4C76A 1N4AA 1N5DA 3PHJA 3R7WA 3UHFA 3RYTC 1OXMA 1VB5A 1HRKA 2JFYA 3QI2A 4FU0A 4WJKB 3QY0A 1BJRE 4M1YA 3H4IA 4QPCA 4TV8A 2CNWA 1F8UA 1V5IA 2N46A 4UUPA 5EESA 1I36A 2FVXA 5FAXA 1F0KA 3KALA 4HAWA 5AKLA 3TAUA 5L4LA 1U3TA 4JGBA 1ZI6A 3R24A 2BKEA 4JNKA 4OSEA 1PX2A 5BQPA 3TRHA 4C7KA 4DUPA 3WKEA 1B6GA 5BYAA 3K1AA 1CDZA 1TKAA 4ZGGA 2NTEA 1PSZA 2HU5A 1ZM4A 1EEXB 2IEBA 3B3GA 4Z7OB 2RCNA 2OFPA 5ARDA 4QODA 5B7PA 5KKCA 3KT6A 4KRXA 4BLSA 2F8SA 1M6EX 4MJ7A 2UVPA 2DKNA 4UAUA 2DUUA 2GD1O 2HIMA 3EEIA 1JHVA 2HLDD 1ZNQO 2IYYA 2OPBA 2WSMA 3M0EA 4L95C 4O5AA 5BT9A 3UXEA 1BTOA 3QUBA 1FFCA 3JRWA 1YZUA 1BN6A 1IZYA 1QAOA 4AG6A 4LFCB 1A2BA 3HWRA 5CXSA 3NUQA 1Z7GA 3TK1A 4HBZA 3W04A 3OU6A 3ZZNA 3GJZA 3CHYA 3HCNA 3R0QA 4GE0A 4DV6B 3JS5A 7ABPA 2G7MC 1Z16A 2R97A 3V4PB 2BPOA 1M1UA 3HNRA 1O97C 4MUMA 4AL4A 4BQSA 3UA4A 1XA4A 4KQ2A 2GVZC 1TTPB 3JQGA 2QL6A 3VSCA 3PHHA 1GZ7A 1PR6A 1S9DA 4N9QA 4WUVA 4BJHB 2QUKA 4EYQA 4MPTA 1U2GC 3ZXSA 2YDYA 5C1DA 3K6SB 1M1NB 3MN1A 3SJAA 1MGOA 2NZ2A 3CNEA 3LBFA 3KEMA 4TKZA 2VPPA 1JFFB 4WSOA 4XH9B 3VI3B 2N0SA 5TPZD 4J0JA 3I28A 1RWWA 4HEJA 1XVIA 3DYBA 4Q05A 1Q0QA 3A9RA 5EHNA 2GPYA 1CT9A 1U5CA 4FX2A 4OJQA 3WMFA 1UMCA 3REGA 2CLMB 3E9QA 3LT4A 2YYSA 2VYNA 4Y2RA 1KS2A 4QTZA 4XPIB 1G2QA 2IYFA 5AJTA 1O89A 1XRMA 4HCJA 5GONB 1Q6YA 1KYXA 3IT0A 3AUYA 4FDAA 3NXKA 1J21A 3B5EA 3B1WA 3Q12A 4NBWA 3X1YA 4PG5A 3N6VA 3FY4A 3IR6A 2AZDA 2PGNA 3NYRA 4NJEB 5T6BA 3ZJ5A 1KVUA 2G40A 5C37A 1ZESA 1G66A 2IXTA 1M83A 3IODA 3LVBA 3A9TA 3COVA 5TGZA 1TFUA 1DLJA 2XTJA 3KFXA 3H2BA 4BGIA 2HV9A 4BVGA 4GPZA 1TEXA 4F3RA 5KMGA 4IMJB 2A30A 5EJ9A 1UPFA 4GOLD 2GYWA 1VFPA 1HXHA 5HTOA 4P36A 5CCDA 4L8WB 2BGRA 1E2NA 3ONWA 4BJ6A 4QQFA 4F6RA 3OLZA 4K9NA 4RPGA 5L6LB 4YK7A 3SLGA 2P68A 3Q11A 2C61A 3TR0A 2FTKE 3KYDB 3A3KA 1F9AA 1TRKA 3EVTA 1VKRA 2WUEA 3JARA 4H18A 4QPNA 5AJWA 4EHFA 4J0EA 1R8YA 2NNLD 3IX7A 2QMUA 2CY0A 4UFPA 5C5EA 2Q0HA 4BTVA 4PIPA 4MKFA 1F3LA 4F45A 5BW4A 3HUTA 3A4IA 2R8RA 1JU9A 3NHKA 2IYSA 3EPLA 4BO7A 3B1FA 3GRFA 3PFWO 1K06A 4FOTA 3STVA 4AXXA 3EPKA 5FL7A 1SVWA 5ULLA 4X90A 5WRFA 2H3HA 3K0AB 1TI7A 1TA0A 1JDBB 1GZUA 1Q16A 1WUIS 3ONFA 1V7PC 3ICVA 2FUNB 4FFWA 4PWZA 3W8DA 3ZGVA 3RH0A 4DILA 4WPGA 4LVCA 2PWPA 3TTUA 3EZYA 3HU1A 4BZWA 4FW9A 1RYYA 1YA4A 3LCJA 1X7YA 3WB2A 2X76A 1VLJA 4Z5XA 3CEMA 2KJQA 5B64A 2QJWA 3A6FA 3EGXA 1Y9EA 2C9DA 4LXIA 2GZMA 5FI0B 1DXYA 5IUKC 3RHFA 5JSZA 3PC8A 3AERA 3ZGLA 1KFEB 1FP7A 1W75A 2FHSA 2RGYA 4I9NA 4D3XA 3ZBUA 1FMTA 1RPAA 5GP1A 3EHDA 1QK5A 4HATA 4AW9A 2GCOB 2YY5A 3NVKI 5LR6A 4MCJA 2CK3A 2FK8A 2A3NA 5JNWA 4WE3A 1XCOA 4Q4DA 2V7TA 2YZNA 1A8HA 1F1BA 3GJTA 1U94A 1ULAA 3KT3A 4FOSA 2B83A 3UAVA 1NBAA 2ZBEA 3EGDA 4NL4H 5CYOA 2YVAA 4JOCA 5THKA 5GJBA 3KEOA 3RVPA 1YZTA 4JLJA 4EG1A 2OESA 2BHLA 4G5FA 4RKQA 3BE6A 2POQX 3PKIA 3K73O 4I8DA 2WJ3A 3ZE7A 1IHOA 1S9HA 3LU1A 2FH5B 2A9KA 2O1XA 2AOUB 2H11A 4Z7QB 3LCCA 6CHYA 2AD5A 1AE1A 4GGOA 3V9AA 3B6MA 4E1AA 1YT5A 1N7JA 4Y2SA 1TZMA 5CJPA 4G37A 1CY6A 3RUFA 2PGXA 2GM9A 2Q5OA 2NO9A 2PGIA 2I6GA 1J42A 3WP0A 2A92A 1NF2A 1C7FA 3EEFA 1YRYE 1D1TA 2I8AA 1EWTA 1XRQA 4DIEA 1F0NA 1RLTA 3M6AA 4H59A 2HDWA 4OGWA 4IGAA 5FHQA 4LKRA 2H0RA 3TIFA 3IUPA 3K92A 3CRW1 3A3PA 4LRSB 2HWKA 3ZI4A 4EAAA 3DBIA 2PLAA 4WBSA 3SE0A 4W63A 1KI6A 2J9YB 4CIYA 2ZYUX 4AJIA 3A8TA 1Y33E 3FMPB 4AKHA 5IULC 1FYWA 4J3JA 5DYYA 5DXFA 3GBVA 3TW6A 4QFCA 4KR9A 3Q1KA 5TE9A 2FR8C 1P5RA 1F4VA 1BWRA 1NF9A 1JFRA 1G9XA 1ZSVA 1MHPA 1VSQA 1OA0A 1LFAA 1E2DA 2XEXA 2Q1WA 1B41A 1V1RA 3MSXA 4QM6A 1XDWA 4CKWB 1E0AA 1U7OA 1UL1X 2ZT5A 2O2JA 1Q7BA 5I8ZA 1C4XA 3GH1A 2JCVA 4DNFA 2PZEA 4BP9A 1G17A 2NYRA 5THXA 3DBRB 3H19A 3ZQ6A 3FVWA 3UT5A 5CA1B 2GVDC 1WSBA 4LJ6A 5LQSA 4BPRA 3AHFA 4F4DA 1CQJA 1G7CA 5KEIA 4P4UA 2JBAA 3MGGA 1OBOA 5BSHA 2H7XA 2XB6A 3E3OA 4FYJA 3IR5A 3LQ1A 3TPFA 3IMFA 3ZW9A 4NZOA 2WWXA 2EDCA 3O7WA 4DA7A 2WHPB 1AB6A 2G9NA 2A9JA 2BBSA 3PR2B 3HDVA 3THOA 3I4CA 4BLQA 4CV0A 4CLOA 3D2CA 3KJNA 1XYVA 4OL0A 1TJPB 1YIDA 1YR8A 3GDWA 2JLBA 1Q7TA 2G6BA 2WWFA 1FXWA 2WSYB 4C9BA 4HXEB 2YXPX 2BHTA 4L27A 3B89A 4M1OA 1CZHA 5TS3A 3MJSA 1E8MA 2XYHA 1L4GA 2FFJA 2IKQA 4O1IA 3V4OA