2OYSA

Crystal structure of sp1951 protein from streptococcus pneumoniae in complex with fmn, northeast structural genomics target spr27
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
230
structure length
230
Chain Sequence
NKIFIYAGVRNHNSKTLEYTKRLSSIISSRNNVDISFRTPFNSELEISNSDSEELFKKGIDRQSNADDGGVIKKELLESDIIIISSPVYLQNVSVDTKNFIERIGGWSHLFRLAGKFVVTLDVAESNGSDNVSEYLRDIFSYMGGQILHQVSITNSLKDIAEAQLMEATYKIEDVLEGKIKYKTTDYQERAYQTLKLILENYDSEHFEKMYWEKKRLFEANSLEEWYYVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein SP1951
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 90
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oysA00
3FVWA 3NHLA 3P0RA 4DILA 1F4PA 4Y9UA 3D7NA 2BMVA 3KEGA 1AKVA 3B6MA 3F90A 3U7IA 1X77A 2AMJA 3K20A 2MWMA 3B6KA 1FVXA 3KLBA 3OJXA 1J9EA 2R97A 4ESEA 4M0CA 2Z9BA 3UXEA 3ESZA 1E5DA 3JSXA 3OWHA 2FLVA 2Z98A 4Y9RA 3HLYA 2XODA 3R6WA 4HS4A 2X2PA 4U7FA 3ESXA 4LTNA 1NNI1 1D4AA 2MTBA 1FX1A 3QFCA 5B3LA 1YRHA 3GFSA 1FLDA 3N3AC 2KLBA 2MT9A 3TE7A 2HPVA 1AHNA 1SG0A 5B3KA 1FUEA 1AZLA 4QOIA 2M6RA 2QMYA 2FOXA 1SQSA 5F12A 1J9GA 5JROA 4CETA 3OX3A 2KQUA 4FGJA 1CZRA 3NHPA 4N82A 5EAIA 3FX2A 4DIKA 4J8PA 2FVXA 5EMNA 1C7FA 4OXXA 1BVYF 4NLLA 2FZ5A 2OHJA 3NHRA 3UXHA 2D5IA 1ZWLA 2Z9CA 1AKTA 5EA2A 1XT6A 3F6SA 5F4BA 1AG9A 1TIKA 1QR2A 1DX9A 5FA6A 2FZVA 2BZSA 3FJOA 4YAFA 1ZWKA 1T5BA 2QMZA 4PU0A 2FDXA 3O73A 3NHSA 2A5LA 4QOEA 2N1MA 3SVLA 1FLNA 4GR9A 2V9CA 4LTMA 1CZKA 1YCGA 2M6SA 4N9QA 3L9XA 4XDHA 1TLLA 4QOHA 1OBOA 2BF4A 2Z9DA 4XDGA 3B6IA 1XYYA 4DY4A 1QHEA 1KBOA 4U7GA 5LLDA 1XYVA 4H6PA 1YCHA 4ZVKA 1RLJA 5LBTA 1GG5A 3S2YA 5LJLA 5F51A 2FCRA 2QX6A 3ESYA 2F1OA 1JA1A 1I1OA 1QBGA 1YCFA 2Q62A 1OFVA 1D03A 3RPEA 2RG1A 1FTGA 4N65A 1CZNA 3GFRA 4ICIA 3NHUA 3B6JA 4YAUA 4GI5A 3NLLA 3K1YA 5TGZA 1AKRA 3W78A 2V5UA 2BN4A 3W79A 2GSWA 4LA4A 5BUCA 2X2OA 4FGLA 4U7HA 1KBQA 3ES9A 1VMEA 5FUQA 3TEMA 1J8QA 4FX2A 3L9WA 3OX2A 4GQIA 2OHHA 1YKGA 1XI2A 1AMOA 2ZKIA 3U7RA 1DXOA 2QR2A 2OYSA 3OWXA 4NULA 4BMOB 4S24A 3O2NA 4QOFA 2HNAA 2B3DA 3ZHOA 3QE2A 5A4KA 4CF6A 1H66A 2OHIA 4QODA 4ZVLA 3KAPA 4PTYA 4Y7CA 2MOKA 1WSWA 3LCMA 4YALA 1C7EA 1ZX1A 1YOBA 1CZOA 1AKQA 1DXQA 1BU5A 3FW1A 3EDOA 5NLLA 3OVMA 5LMCA 1JA0A 4YAWA 1YDGA 4PTZA 2V5VA 1QRDA 3FNIA 3N3BC 3NFRA 3QFRA 4QOGA 5NULA 4QOJA 1H69A 2HNBA 2QWXA 1B1CA 1CZUA 1D04A 1CZLA 3OJWA 4C0WA 1OBVA 3NHYA 2QX9A 5ULLA 4FGKA 3HR4A 4F8YA 4HEQA 3KAQA 4H2DA 4BMPB 3G5MA 2FAXA 4C76A 1CZHA 1AKUA 4R81A 1WSBA 3N39C 3OX1A 2QX4A 2Q9UA 1J9ZA 2FX2A 3W7AA 1AKWA 2XOEA 4LTDA 4YAOA 3W77A 3F6RA 1V4BA 5FX2A 3NHWA 1RLIA 4C0XA 1RCFA 2BPOA 3TZBA 5LBUA 3HA2A 5LVAA 2WC1A 3EYWA 3NHFA 3LT5A 4ZVNA 4C14A 3GAMA 3GFQA 2QX8A 1T0IA 4LAFA 1FLVA 4ZVMA 6NULA 3NHJA 4D02A 3NHKA 5LJIA 1FLAA 2ARKA 1RTTA 3F2VA 4YQEA 2R96A 2W5UA
chains in the Genus database with same CATH superfamily
3FVQA 2I80A 3V8EA 4POOA 2NYVA 4TT3D 3H5VA 4TKVB 4HT3B 4RIGA 4EELA 1FY2A 1T3SA 5AKYA 3MINB 4HMPA 1FIUA 4I4LA 1QF9A 1PFGA 1RLUA 1OAOC 4MRPA 1L7MA 1EVJA 5HIMA 2C7GA 4NZOA 4IWXA 3TF5A 2OMEA 4NCKA 3DWGA 4UDXX 3VU9A 2XITA 1GTZA 2EFCB 3QYAA 4HDCA 2W70A 4DAOA 5LA6A 1J39A 1YSCA 1XPJA 3HS3A 1ULAA 4UOEA 1UAGA 2IZZA 3CPSA 1UWKA 3H2SA 1RHQA 3QHAA 4J4BA 4J90A 4NJEA 3ZLBA 3ZDQA 4CMIA 1XZAA 2JFVA 2QRMA 5FQNA 4D9FA 1XX6A 3UT0A 3AGPA 4C5BA 2UYQA 4JP2A 3IP8A 5IM4F 3O94A 1G9XA 1N2XA 2VATA 3CWZA 1X8JA 2P4SA 4WLOA 1DPGA 3LFTA 4XDYA 1M2VB 4FYWA 3FLAA 1Y5MA 3ZHSA 5J9FA 4LF5B 1FXWF 3FCEA 4DMLA 1HORA 3KLPX 5IAOA 4I4TF 1RRPA 3EBOA 3M3HA 3MELA 2ZTUA 4FEAA 5K1ZA 3G1WA 3VO9A 3L7JA 5EFZA 2QUBA 1BS1A 1PN3A 2V7BA 2E49A 1G5RA 3AKCA 4L8YA 5D3MA 5AOCA 2VJOA 2VWPA 3KQNA 1OA0A 3USCS 4GKVA 4MXDA 3A6JA 3N87A 3WRYC 4KE7A 5KTMA 2FEOA 1OC2A 3IQDB 1YZGA 1SBTA 4RTMA 4WXRA 4JUFA 3B6ZA 2GN1A 3CJQA 3QVSA 3CB4A 4C0BA 1QVWA 3GVHA 1L4HA 1Q57A 4CMJA 4F4FA 4GX5A 1IUPA 1FBNA 1W0JA 2BFDA 2W2KB 1OI7A 2C4MA 3HR7A 3AP2A 1QIIA 1X8LA 3A2NA 4WKNA 1VZ2A 2EC5A 1I3LA 3WWDA 1AKNA 4FIDA 3MOGA 3JAMA 1C3JA 2HCJB 1BDJA 1S1MA 2ZB4A 3PNLA 3PQ4A 1UKEA 1EX9A 1VE5A 2OM6A 4Q01A 4A03A 4BP3A 2IUEA 4DT1A 1SRQA 1Z12A 3L77A 4IIJF 4OJNA 2OBXA 4QQ8A 3I1FA 4AL4A 4QJ3A 1PSWA 4II3A 5J1TB 1DG9A 4B7CA 1KAHA 2BKLA 2H6EA 1K5GA 4G1MB 1T24A 4JBYA 4RPHA 5BMOA 2JA1A 1VHLA 6REQA 1ZCFA 3I30X 2HFJA 4W4TA 3F6CA 4MYTA 2XQIA 4ZGWA 4CETA 2W93A 1SBHA 1XIVA 1P7ZA 1B42A 4NZYA 1I2MA 4I55B 5BSHA 821PA 4ZU1X 4CCYA 1B76A 2LP4Y 3JYOA 5JNRA 1OLSA 2HUPA 2OV2A 3DUFA 5EESA 3K9CA 3FCUB 3FVVA 2FK8A 4RPJA 3QFHA 3MCTA 2P9JA 3RHTA 1NBEA 5H0IA 1MTZA 2HKIA 4ARVA 4K9NA 3DZKA 4OAPA 2V98A 3I42A 4G0MA 4R71A 3LC2O 1KYTA 4LGVA 1W0KA 4ARZB 3EXHB 1QQ7A 1BWRA 4D0RA 1QVZA 3RSFA 2V7XA 3MRSA 1SGWA 4W1PA 4ENVA 1KY4A 4KVZA 1QHHB 1GCUA 3DYBA 4N7BA 4QEKA 5FOXA 1Q50A 1A7JA 1T4GA 1E2UA 2D5IA 2J87A 3QWAA 4R3WA 1F8UA 2EFHB 2BSQA 5TR9A 1H0HA 2IKSA 4HADA 5EE9A 1XDDA 3P4XA 3WGOA 4GEKA 3OTHA 4EI2A 2JGLA 5C32A 2VCHA 1V11B 4QPDA 2B9EA 2JAHA 3PGMA 2PWZA 5DYIA 5DXAA 5ALTA 1T1GA 3AJDA 1TIKA 3WK8A 2AG5A 4RDIA 3TW8B 1H6CA 2F3UA 2PANA 2VP9A 3IEUA 3IP5A 2JFQA 2XMSA 1NLMA 3CSDA 1VE1A 3NT2A 5ANRB 5HR5A 3ZQUA 2FWAA 3CONA 3RC3A 2VT3A 3SIXA 3LW8A 1VFNA 3A4MA 4BX0A 3DMYA 1N7HA 1XE3A 2QMZA 5KYGA 3C85A 3OMLA 4BNFA 2ZB2A 4ZAWA 3T4UA 1ZOSA 1ZFNA 4UU7A 4G4JA 3IRVA 1L9XA 3L8FA 2BFMA 4TOIA 3OZVA 3OEHD 1U2PA 3L7YA 4HWTA 1KZHA 1PR5A 1VE3A 4BO7A 1PUJA 3UUFA 4DQXA 5FB3A 1SIBE 1FLNA 2VK4A 3EXG1 3RIGA 4E88A 5JEEA 1TUBB 4MLDA 3HJRA 4MWGA 4NXMB 2OUKA 3R6LA 1IY2A 5AUOB 5KNDA 1Z0JA 5K0TA 2EW8A 5DK6A 1KJQA 4R2WA 2BKUA 1N1GA 5FBQB 4C2TA 3DE2X 4F45A 1E2EA 3UHJA 4QPZA 4XFDA 3JZAA 5AKLA 1FVFA 3N70A 1NSFA 3AC0A 1MC8A 1M2GA 2G17A 3ZDDA 3LCUA 3DPSA 5SV2A 4PVDA 1SD5A 1T26A 1WBBA 1HG0A 1EVZA 5K0FA 2CLHB 1F17A 1KP3A 1IXRC 1ZINA 1ULBA 3EMVA 4JFAA 4U0KA 3AB3A 3TAHA 4ZAFA 1BKYA 1TC2A 1ZVQA 5IUKC 4NJMB 3UFBA 1T3HA 2HSGA 3EMKA 4JQZA 5AOBA 3I3SR 3LC7O 5HNKA 4XJVA 1XQWA 3FXAA 3WKCA 1HNZB 1ULZA 3U3MA 4FHFA 4OH1A 4RPKA 5LFAA 5G1OA 1GG5A 3MYRA 4R16A 3WWPA 4EI7A 4YHHB 1NBWB 2D1RA 1EBFA 2BISA 3IAAA 2VUIB 5I9IA 1G41A 1RKVA 5PGMA 3RVBA 4DA0A 1V1RA 2A0YA 4H1TA 5K6AC 1JT2A 2I71A 3AYZB 3Q2OA 3RT1A 5DTQA 1QBGA 2Y92A 4RMGA 3VKGA 3HZOA 3I09A 2XB6A 4OGGA 3KVOA 3LGAA 3W3AA 4UC0A 5C34B 5LZ4A 3IPLA 1ZJWA 3IMEA 3TYXA 3VHLB 3GG2A 3TMKA 1XV5A 2WF7A 1CB7A 3DC2A 5DGCA 2IOFA 4RA6B 3CPJB 2BFNA 2B5OA 2XYRA 1C2TA 1FBTA 3O5AA 3Q8WA 2ZSFA 2XA1A 1ZCBA 1L3CA 3H83A 3JQFA 4RQTA 1SZPA 3NBKA 3NBUA 4MH0R 3C1AA 3GFRA 1DJQA 3AJAA 3HCDA 1CUZA 3WKAA 2P4HX 3EDRA 4C04A 4MR9A 3OT4A 4AJNA 3W2FA 1U0EA 4XDZA 3GEPA 2X0JA 4IYJA 3RVOA 1TIBA 3ZBTA 4J3JA 3K1YA 1P60A 1AKRA 2AN1A 1ZQ9A 2J3HA 3PGJA 2J9RA 2E4VA 3BAFA 1SKUA 4HDOB 1MQSA 2ZBUA 1VIAA 3H0CA 1C80A 2RIPA 1H0RA 1VBKA 3KKQA 4XR9A 3MUOA 1EFPA 1KOGA 1XQ9A 2A5DA 4YP6A 5A4IS 2QRQA 1ORIA 3HWX1 1XXHA 2XRMA 1V16B 1B43A 3F5DA 1J4AA 1FRVA 1KPGA 1EH5A 4M1TA 3RVPA 5JJBA 2K7FA 1EX6A 3OZIA 1P1BA 1OZHA 1M0TA 2YW9A 4FGLA 4G41A 2O3QA 4H7EA 2JLUA 2PUAA 4TYYA 2R8BA 4FWTA 4DZZA 2CFRA 4PO3X 3PJDA 4URUR 3GD5A 1TAUA 4YQFA 1M8FA 4TYWA 1GGFA 1F2VA 3R5JA 4ND4A 3B3GA 1XALA 1XJWA 2VRCD 1XKQA 2QLLA 2I99A 1TJ4A 3WHIA 3OI7A 2GJAA 2FDRA 3PKJA 1GRRA 4CQMB 2JK1A 5JIBA 1UEIA 4NZMA 3JWJA 3GUYA 4C4TA 1L7EA 1HDOA 1OX5A 1Z7EA 2QRNA 2VPPA 4V0SA 2PUCA 1G8KA 5B1DA 2QRUA 2LIPA 4J16A 1XEWY 5M04A 3T3OA 1JB1A 4NULA 2PRSA 1Z0DA 3JD1A 2QTVA 1UK9A 2V3VA 1T0BA 3HYCA 1UBNA 4MQLA 4REMA 4BMOB 3ELYA 4LGCA 1E3DA 1PWHA 1R0KA 4EEXA 2CDAA 4CM5A 1JILA 3C2QA 2Q3HA 3BS4A 2WHPB 1J1IA 2HN9A 1RBZA 2O8EB 1O5OA 1H66A 4HDNA 3ASVA 1YL6A 2GBLA 3W5BA 4URFA 4HO1X 2BY4A 4YRCA 1G3IA 621PA 3CX3A 3ILXA 3KAPA 3S81A 4RTRA 4DNXA 1JSRA 4B4UA 4HEHA 4MVJA 2GK6A 1XHEA 1RE0A 2FPOA 4RYLA 5EHNA 4BDSA 1FS5A 2OEPA 3LCMA 2C95A 4G6ZA 5K3FB 2UUPA 1FYFA 5SZHB 2HZBA 3CFYA 3FPAA 4KIWA 1NBOA 2PX6A 4QSMA 4JLAA 1F7VA 3H13A 4I66A 4EG8A 1RCUA 3GFOA 4KDFA 5C4IA 2VK1A 2MR5A 2XI4A 4PY2A 5EIHA 2VXOA 5EJIA 5F1YA 5TY0A 2OQVA 4EPRA 4EYGA 3ZLUA 1VYVA 1JG3A 2X76A 3PUKA 2QT9A 5CT5A 2HV8A 1NJ8A 3SYLA 3HJUA 4D4MA 5A3QA 3ETNA 2CFCA 1RYDA 1ODSA 3HDTA 1O0SA 1UKVY 1Y8QB 1QYRA 2V6IA 3K3PA 1FC0A 2JFWA 2Q50A 5HUJA 1GQOA 3OE4A 2PH5A 4C4ZA 2A1IA 2DSNA 2LW7A 4L6AA 3N76A 3LZDA 4UMVA 2JIZD 1VFPA 3E1KA 3BRCA 4KYIB 3CX6A 3OICA 4LHXA 1WDMA 4KJZA 3UFXA 2O0LA 3UXYA 3ZIAD 1BXZA 3USZA 1QAMA 5AVWA 5L45A 1IEQA 1WEKA 1K98A 2PRYA 4R68A 5NULA 4X20B 4DQDA 2CLSA 3KPUA 3SS7X 4E1VA 2HNBA 2AI3A 3VR4D 4MKGA 3PEVA 4OFBA 1LVGA 2AFIE 2FZWA 3A1FA 1IYZA 1JEAA 1KQPA 1PJLA 1TYCA 2C07A 2C2YA 2OCYC 3EARA 3EYAA 1QGYA 1Y5IA 3OTWA 4Z8XA 3T1YB 2BZGA 5A02A 5B4VA 4YV1A 1G291 2DG2A 3H8JA 3GAFA 3ML1A 3L41A 5K3AA 3NU1A 4GPAA 4XASA 2I7DA 3UAXA 2A9FA 2WHEA 1I3CA 2P11A 2NTEA 4UU0A 3W1EA 4BNNA 1ZKMA 2VJNA 1ZBDA 2QX9A 3H4TA 4A0SA 4I1VA 5FNVA 2DSTA 4YLYA 4F8JA 5JS1A 3DQQA 3SCZA 1GNQA 3FVTA 3V1KA 3D59A 3L4BC 4GR4A 2WSSA 1SUFA 1EDOA 1QE3A 3JAKB 1T4DA 4P31A 2HLHA 5ALEA 4X1KA 2B61A 3E7DA 1QTQA 3W90A 7ABPA 4WZAA 3FTPA 4B3JA 4LF4B 1HX7A 3ROFA 4L02A 3TBHA 2CW5A 4MHOA 1KDPA 2X8BA 2FRXA 5I45A 3B3AA 1YF3A 3C4VA 2BCGY 1I0ZA 3PV0A 1E62A 5KHLB 5DM70 3T4XA 2IPLA 2WJ6A 1XFDA 1SY7A 3M6XA 1L7BA 4NCAA 3QJGA 4PLHA 5C4MA 2GILA 3IMGA 1VHQA 1Z15A 2ATEA 2A7XA 2CXTA 2I3BA 1YB4A 2BI4A 3D8BA 3ND6A 4POAA 4RD6A 4Y6PA 2X5JO 5EIFA 2ZRPA 1Z34A 1SBYA 3WFJA 1YR3A 2PD6A 1IQUA 1Q0LA 1ZM4A 2EJBA 4QICA 4ASUA 4B75A 1EEHA 3FB1A 4N5IX 2D8AA 2Z4RA 3B51X 3H9JA 4N0QA 4YRMA 1SXHA 3NNDA 4H3HB 2IPAB 1IBKB 3GJQA 4BLUA 3R09A 3RC1A 3AEXA 2F3PA 3FSGA 4N3GA 4PAQA 5E6RB 1K7YA 1KJ8A 1WP9A 3CR7A 4CWAA 3N2IA 2P3LA 2BDUA 4AJLA 1TCAA 2CXRA 4GPD1 3FPSA 2ATCA 3PF9A 5G1NA 3FR7A 5FPSA 3WL6A 3ZY5A 4FEGA 4ENQA 2PPLA 1SIWA 3DO8A 2ZWIA 4DJJA 3OLVA 4RJTA 2ZG6A 2Q1WA 3CY6A 3HBMA 3LK6A 2WF6A 3R77A 1IFXA 3KYCB 5CA1F 2WHYA 1RYFA 3UAGA 4UM9D 2NZJA 4GOXA 3ZE0B 5KKNB 2BUBA 2G9UA 4IHJA 3CZ9A 2PG3A 1Q16A 4Y18A 2C7PA 4AMZA 3G2NA 4HNSA 1DWPA 1X7YA 1Y9EA 2G88A 3EXEA 3HFGA 3NQ41 1FU8A 4K9LA 3WLOA 5F2NA 2NUPB 4FW8A 3WP0A 4ZVMA 1RPNA 3EE6A 3SG0A 4B79A 4EJ2A 4EQZA 3G5AA 4CF5A 2EHJA 3THXB 1JWAB 3VC3A 2ID9A 1RI2A 2O7RA 1DIGA 2Z5FA 3EGDA 4GW3A 4L3VA 4X60A 5H81A 2CYCA 4I3HA 3NDRA 4F7DA 3L05A 5JNTA 3VDNB 2M1ZA 3H11A 4ITVA 3F2VA 4JLDA 3ASYA 5IJWA 3M9WA 1OTYA 3PSAA 5DX1A 4KN5A 3SZMA 2XKAA 1GTVA 2IVZA 3C16C 3U19A 3NRJA 3DOUA 1A82A 3IH5A 2RHTA 4WK2B 1YMVA 3PWTA 5DYGA 1Q5PA 1W2HA 1SQFA 5DCLA 3ENQA 1WMSA 3W8RA 2EP8A 2QN1A 4YY3B 4G0UA 2A7QA 5CIQA 1EWKA 4EI9A 4S1PA 4L6IA 5KVVA 3PR1A 4K6MA 3R3XA 4ZD6A 4N47A 1EK6A 1N5OX 2PUTA 4A6XA 3IBSA 1WXQA 2EG5A 2QU7A 1RS0A 1A8IA 3B8HA 1ZD4A 3HU3A 1NKTA 3NRBA 1MX1A 2B2CA 3KVNA 2MU1A 3SZRA 4BMVA 4P84A 4D9NA 2QROA 2WFAA 2QQGA 3QY0A 3JVEA 4ZCRA 3ADCA 3MHTA 3O9MA 4M8LA 4JYBA 2EX1A 1XWIA 4ESVA 2G76A 4H7HA 1B3RA 2ZBRA 4QUHA 3TLKA 4MPRA 1F5NA 2MWMA 1R6DA 4FR2A 2Q3DA 4XQ0A 3FBWA 1RQRA 2D6FA 3JQGA 1SK8A 4UUNA 2EKLA 4UHCA 5KSOA 4KDEA 3G8DA 1KI9A 4OB7A 3LKBA 3OUTA 1PDOA 4YV7A 1N6OA 3MAJA 4OX9B 4N41A 2GUWA 2BGIA 2I7CA 1OASA 1PBTA 4AKHA 2R7AA 4HEA6 4GZMA 4KFRA 1ESZA 5JSUA 4JMLA 3U56A 1FS4A 3O0TA 2FSVC 2FHPA 5I4IA 4CCSA 2CYBA 1JU3A 1U5BA 3M83A 3OECA 4M0EA 3PKIA 4GI2A 1FJXA 1UBGA 3KL4A 3O92A 4AKTA 5EUQB 2UXBB 1BW9A 1W5FA 2IU4A 2J46A 2YXLA 5EJ8A 1ORHA 1EP1B 1WM1A 1PGNA 1I4EB 3QVLA 5FFMA 1U0TA 3KV3O 5T41A 4BFLA 5JDIC 1M34A 3LO8A 2CGEA 2B8TA 2PLAA 4C5CA 4Y2VA 1I9GA 4BAGA 2BHNA 1MZPA 3GT7A 2DTXA 3JW8A 4W8GA 3BL5A 3GP3A 2GWRA 1W5EA 1IULA 3AF6A 4CR6A 1UBTS 5AW8A 1GLVA 2VWGA 1AUQA 3AR3A 3BRWA 3TQHA 2I9KA 3ZH9B 4EMBA 3HM9A 3CUWA 3WKBA 2WQZA 3CWCA 2A30A 4PYLA 4KGZA 3ZK7A 4DJEC 2I78A 5CDFE 1C9EA 4OK6A 1QTNA 3HDHA 4RCZA 2WFMA 2IYQA 1Q1QA 1FDTA 3BFKA 4HFNA 4JXJA 4P4GA 3QWHA 3Q7EA 1YR9A 2ZULA 3BMQB 4M2LA 3FOFC 4M9UA 1U8XX 4QOIA 1VL6A 1YQUA 4TLLB 3D43A 4AJEA 2IYFA 2J5XA 3BYZA 2I8LA 4MA5A 3V80A 4F21A 4CKBA 2A0UA 1Y9DA 5EERA 1SQSA 4EJ6A 2FDCA 5J2TF 1JJAA 1NBMA 2OHXA 3VVLA 4CKYA 4Q4DA 1P80A 5A9SB 4PBTA 4GE0A 3IP3A 4ZRDA 5LZ9A 1CU1A 3OEEA 2DCMA 1ZVMA 1LBHA 4J0HA 2QYTA 1J9GA 1GL6A 3VKHA 1JLSA 5EXTA 3PHBE 4KJXA 2VPTA 4UAGA 4RVHA 3AERA 3I5MA 1ADYA 2YJGA 1J21A 1NT4A 2Y2UA 3C6YA 4ZEXA 3W05A 4ZO4A 2X4DA 3ABZA 3LX6A 4D44A 5B55A 4L4ZA 2XCTB 2JFXA 3K4PA 3KP1A 1M74A 4FGJA 3T5BA 2V3CC 2OCXA 3TD6A 3WLTA 3WB2A 4B8WA 3RNLA 5BPHA 3OFKA 2XB8A 4BLQA 1DMSA 4IZ6A 3VJKA 1A9ZA 1QB7A 1ML3A 4PYOA 1RWBA 2CT8A 2R00C 4DGSA 3T3EA 1UK7A 2YOFA 3RFFA 3UT5B 1GWNA 2FVXA 3DD1A 1R6AA 2C3OA 4GMHA 1D4FA 3O03A 1KMHA 1Q7RA 4OV6B 4RMJA 3DDWA 3BIFA 3JQAB 4GFDA 1RI3A 4OXXA 3TOXA 1XNJA 4OM8A 2MYNA 5ALFA 4RHYA 1Y82A 2BVNA 3FR8A 3IMFA 3G17A 4C7BA 5FBZA 1HE8B 4I99A 1OVGA 1ZG3A 2FZ5A 4HI0E 3RANA 2IS1A 1W9MA 3D1LA 3GRCA 2YXPX 1UJ4A 1X1TA 3B60A 2VEOA 3TLGA 2V7VA 3KX2A 3ZV7A 3IEMA 2W6ZA 3NH9A 3LQKA 4O4JF 3WGZA 5B2FA 2D1FA 3QBEA 4V1CB 5JBNA 1YRYE 4PYMA 1T1EA 2JW5A 1GXSB 3QOXA 4DNOA 2P3SA 5ICFA 4LHZA 2YHSA 3EEFA 4LK2A 2KPOA 4V24A 1DPFA 4ZEWA 2GTPA 2CXSA 5EKXA 1E1YA 3MMPA 1NUQA 4JLKA 2XXJA 1VGVA 4EFLA 4B6JA 1S2DA 5DHTA 4J0EA 3T4EA 5ITZB 2QNRA 4WFQA 3K9NA 1VKNA 4MJLA 3OESA 3RSHA 3CEHA 4G5FA 4Z9BA 2ALJA 1W88A 2DQZA 2OO5C 3SBEA 4ERNA 2FWPA 4LOKA 3QG1A 1KF0A 4KXUA 4NOMA 3W1VA 3TLJA 1IPHA 4HUTA 3NHSA 2BP7B 2BGNA 4TTAA 4FQ8A 1RC0A 2FMTA 2VXYA 3BBLA 3DONA 2BAGA 4WPGA 1GGEA 4Q9LA 2XT9A 2FPRA 3INRA 3OOSA 5TX7A 4G9EA 2PZEA 1RU3A 3WGIA 2NV2B 1TFRA 3F1LA 3UM9A 5FD8A 1LTQA 1M1YA 1TXGA 1YCGA 3ZBUA 5CVVA 4NL4H 4AJ4A 4RSRA 3KHUA 3TH5A 2JH8A 4CCAA 2OFXA 1WL8A 3KWJA 4OHVA 4P32A 4Q21A 5FWYB 3TB6A 4YRBA 5B4UA 1EHCA 1OX6A 4WNIA 3FPFA 4DN6A 2JF0A 1OH6A 3RYTC 4U7GA 4KRFA 3THRA 3VMFA 4C3UA 3PEWA 3RYHA 1RE1A 2IX9A 3BX1A 2VFAA 4Q02A 1X80B 4X1OA 5JADA 1XO1A 1XFAA 2ZB7A 3KKMA 3IKLA 3V55A 5LB2A 2MINA 4BQRA 3CWQA 3F98A 2GPAA 4YXWD 3LM8A 1CV2A 1ONOA 1TECE 2C5SA 1TT7A 5IHXA 1SXPA 3LMKA 1FQOA 3ZDZB 3G8CA 1E3JA 1K6EA 4MP6A 4XQ9A 3EVDA 1WKCA 5E4JA 3VC1A 2Q3CA 2HTFA 3DAHA 1SG9A 2VYND 1T5TA 1YE8A 3DTNA 4XIGS 4Y8VA 5AXDA 5CYFA 1E6LA 1K4KA 1LB1B 5SYNA 1KQGA 1NJ1A 3EUWA 3EVZA 2P9FA 4UCWA 2MIIA 3IB6A 5MN5A 3KZ1E 1BQ4A 1JG1A 1LLQA 3TZ6A 3TUIC 3EIWA 1I1OA 1DEHA 1IN5A 2FSHA 1S8NA 3LNTA 4DRXA 3W2GA 1JR2A 2YMQA 1E7QA 5CIWA 2PZKA 3IAS1 4QOSA 4C7MA 1QTIA 2QY9A 1RKQA 2AS0A 2PRZA 2QQ5A 3PPWA 4WVFA 5AW7A 1QP7A 2Y68A 4EF5A 1YQGA 4M7RA 3HV2A 4XGNA 5KPJA 4KXLA 4N65A 3QY9A 4TMYA 2FZCA 1MB2A 1UR5A 4ICIA 3KQYA 3L6OO 3UC9A 2CV1A 1HYEA 1UJNA 4I5DA 4P0QB 2X0IA 2GZ2A 1DGQA 2BDEA 1U9ZA 2WU1A 3K8ZA 3EXAA 3PG5A 4UBMA 2OP1A 4JZYA 4BO0A 1HDZA 4LGYA 5KJCA 2H1LA 1IJBA 2G06A 2PRJA 3CX4A 1N2EA 4FN4A 1JDPA 1WR8A 4TV8F 5T8KA 2UZAA 4ON9A 2ORYA 5BN4A 2O20A 1WDTA 4HOYA 4P7BA 5K0NA 4DA7A 8ABPA 4OSOA 3JASA 4IS2A 4RE5A 1V37A 3IIKA 1D7OA 4WNYA 1Q7CA 4FCCA 4XUGB 2ZSHA 3EEQA 4HS9A 5E7QA 5CH5A 2X2OA 4HRXA 3PENA 1LY1A 1V7PC 2VAWA 1FJGB 1KI1A 2QP9X 3FUVA 3G5LA 3KDSE 3UMGA 4F3NA 3K70D 3IVXA 1J5PA 3KPWA 4JUCA 5E6UB 3PDUA 5ELMA 5JAHA 1D1PA 1B26A 2WU8A 2YHUA 3JYPA 4H3VA 3K2EA 4HBZA 4CF3A 4LVOA 1Z22A 4B3GA 4YDHB 2VHZA 5M2QA 1DCTA 4IQFA 5KWSA 4OLJA 4R84A 1CJSA 4IIFA 4MO9A 3KYDA 5BVHA 1WG8A 1EPUA 2HAEA 3TLYA 2H3HA 3ENZA 3N0VA 1CR2A 5JXHA 2ONZA 4JBHA 4D3FA 1A4IA 1X7XA 1E1DA 3MJDA 4WESA 4US0R 3C3EA 1TM2A 1K63A 3CRRA 4IM7A 4YMLA 3HJFA 2Q1TA 2X1VA 4HB0A 3E3NA 3VPCA 5JO0A 2NO5A 4OG2A 1CRQA 5B3JA 3TN7A 3IT1A 4TSRA 1MEJA 1VKJA 2ZSEA 1MQ9A 4DRYA 1OH5A 3DWIA 4KQXA 4H0FA 4R98A 4NEHB 4NTZA 3H17A 5GQSA 1QAOA 1S02A 1YUNA 2CKMA 4P3OA 5FOWA 1JHVA 5K9ZA 2HBQA 5D2CA 5TLSA 2ACWA 1XCOA 3FZYA 3HWSA 2DQKA 4UATA 3NDPA 5B4TA 3QU2A 3ZVNA 3GVXA 4XPIB 1KVQA 3COYA 2C58A 3U3OA 3M5CA 4LSZA 4CIVA 1FFWA 2JEZA 1JUDA 2CV2A 2XBUA 1HL7A 2FP4A 3G0HA 2CJYA 4WZ6A 1A71A 3CZ4A 5JTUA 3DVAA 2PPVA 4ME6A 4M0KA 2AV6A 1O94D 3IQZA 1OV6A 4FYVA 3M4ZA 2R7LA 1TW2A 1WHTB 2F1HA 4Y9DA 5AM1A 3GWZA 4RU1A 4DGQA 4XWOA 4X63A 5ECGC 1DC8A 3SDBA 2I4LA 4C0LA 5KYTA 3QPVA 5TMDA 2XMCA 4PLVA 4I9HA 1J5EB 4PSVA 1EVYA 4MQ6A 1KK1A 4F1KA 4RCVA 4Z51A 3Q1KA 1Q2UA 2HBRA 4OHOA 4PZEA 1A8UA 1G8PA 3BUSA 4E5DA 1FYEA 3SFVA 5JJLA 2NYRA 1MMFB 3CLSC 2X41A 4REQB 4I4IA 4M8SA 4RSMA 5EYPA 5A7FA 1QOZA 5IZCA 2NT4A 3GZTB 1F51E 5LYYA 4H17A 2QX7A 3OC6A 4U9HS 5E1MA 1T35A 3JATA 1SA0B 4N5LA 2WSYB 1AS3A 4QL3A 5JCJA 1VLQA 3G2MA 1E3QA 4XWYA 3RAGA 4ZCTA 1JFSA 2AMLA 3BWVA 3KQSA 4CEHA 1YDGA 4UQPA 3ZGYA 1AE1A 2VZEA 3NHAA 1G38A 1ZNQO 1L7RA 1Z18A 2FG6C 2ZYSA 4KDRA 3SEQA 5KTPA 1W36B 4NXNB 4Q4AA 5F7OA 3N3BC 1SNYA 1WCXA 4DLPA 2ZRAA 3C4QA 3KKPA 1TEVA 4JFRA 1UDBA 4YONB 2IZ7A 1MZVA 1GAXA 3PE3A 3B85A 4CN9A 2WF9A 5CVTA 3RIYA 4BIMA 2CF5A 2JGMA 3EQ9A 2QVXX 3HZHA 3II6X 4K9SA 1Q0UA 4LDPA 3EQ6A 5TMBA 3UTDA 4PFSA 5CFQA 2IV2X 3BB3A 1F1BA 4MV3A 5DSTA 2RMKA 3NAQA 4MKXA 2WPDA 5LWHA 4EUKA 1M2KA 1W4LA 3UXMA 5LC1A 1E7SA 1KC3A 5H83A 2ZT6A 2WU0A 3OSZA 3JAWB 3N2NA 5KO2A 1IG0A 5ALVA 1Z2NX 3AUJB 4M46A 1RXWA 5H5JA 3FJYA 3QTLA 3I76A 1N57A 2J48A 1WUJS 2I2BA 3AEZA 4K9RA 2R47A 4MVJI 4CNBA 1Z16A 4R1OA 3IDAA 3SR0A 1L4LA 2GD2A 1OWMA 4TTTS 4GU5A 1A9OA 1IN7A 1XG5A 2JI6A 3FLBA 3NWOA 5J2TB 2J0UA 3ZJTA 2NG1A 4E1AA 4X8OA 2NSLA 1B0UA 3M1LA 4GQAA 4REOA 5IMSA 2EV9A 4YRJA 1OT3A 4BMPB 5F3RA 3U49A 2O8BB 2YWCA 1A5BB 1KPIA 2BBOA 4YJKA 3GCGA 4WNAB 2P77A 3N2KB 4AECA 4CV1A 4DNPA 1IM5A 2C04A 1HETA 2AWNA 5EY5B 3TDMA 2CVOA 2HUNA 3J80A 3QUAA 3LV8A 4UDNA 1UC5B 3F2IA 3N39C 4RLQA 4DAEA 3ZXSA 1DAHA 2GCOB 1QFMA 2HNKA 1Q84A 2GM5A 3ZNOA 5B58C 5LYJB 2FEXA 4TWZA 5DTEA 1W7AA 1WUKS 2VK2A 5TMPA 2BFCA 3ER6A 3DLTA 5AVKA 4JWKA 2HWWA 5GVSA 1Z3CA 2JDID 3ZR4B 3BERA 1PLJA 2C9ZA 4LTDA 1V3VA 3HCNA 3PUXA 1BN7A 1N5JA 5KU7A 2VP2A 3ADKA 3R5HA 1KKMA 1PQUA 4QC2A 3SQMA 4ENUA 1N2HA 3U2QA 1E5TA 1I51A 2D1QA 3OJEA 5JAQA 4A92A 4CIDA 4CMCA 3B1KA 4CLEA 1S3FA 4D74A 2IYPA 2Q0QA 1S0UA 4YCLA 1RRKA 5IT4A 1MAUA 5LIPA 3G85A 4CM9D 2OZEA 4GXQA 3ADBA 1WXXA 2BLLA 1ULHA 1VYUA 2H08A 2J9FB 3ZWDA 1ZUWA 4FFDA 2Z6VA 2HB6A 1PR0A 2AG6A 3FROA 3NHZA 4O4JB 4M49A 1LU9A 4BV3A 5A4AA 3ZIDA 1XAJA 2AQKA 2A5JA 3G2KA 4NATA 3K8OE 4IUDS 1DZ3A 1WW3A 5IAAA 3A10A 4W82A 1SOAA 1HDRA 3TCKA 1P2GA 2BMFA 3C3MA 4L5CA 1GU0A 4XIFA 1QC5B 1OTHA 2EZTA 1C1XB 1UIRA 4B3TB 1UPTA 1K8XB 4XVRA 3SSOA 5BQ3A 1U98A 1ZUNA 4E94A 4R8SA 2WJGA 1X39A 3NHKA 3RU3A 1NN3A 4P2BA 3WJ1A 3OHPA 4MLZA 2WV9A 5AVTA 1FS6A 4QYIB 2ZVPX 4MR7B 3KS9A 1PJ2A 3O7MA 3QI2A 4HR7A 3S2EA 4AP9A 4YQEA 5A5EA 3F6PA 4G24A 1YZTA 1QX3A 2BFWA 4BN5A 3CBGA 1W36C 1NU6A 2DLCX 1PZEA 2AXEA 5LB4A 1XTZA 1M5TA 3I2FA 3DO5A 5DO9A 1YONA 1RPTA 3PEYA 1B93A 2J9XB 4RA9B 4FFSA 3VYRB 2NXJA 1HEUA 3PGXA 1XRQA 2JCGA 2N75A 3DBHB 3KQMA 3FWKA 3P0RA 4R1PA 5KTKA 5HRUA 1BA2A 3N53A 3B53X 1WCIA 3M6AA 5CB8A 4XLZA 1L6RA 2HSWA 4C01A 5JCOA 1J8FA 3SC2B 5CLFA 1HE3A 4KLNA 1PFQA 2B92A 4CTKA 2FN3A 4CL2A 1WXWA 1HQKA 1R6VA 1GA1A 1E9BA 3H9BA 1RWOA 3O38A 1N4AA 5DVZA 1TT5B 3L01A 1XNQB 3DZHA 3TXAA 4J49A 5KHAA 5KSPA 4MWCA 3R3JA 1L4UA 4JBWA 1TNDA 4MP3A 5CMLA 1E1CB 5J58A 2V0CA 2RHMA 1CQWA 1Q77A 3E05A 4JQOA 3UYLA 4CODB 2O8CB 3DOOA 4WK4B 1YMQA 4ATNA 3LW7A 5AI5A 4J2OA 3Q6IA 2F1JA 1VJCA 3LK7A 1L5RA 3N7AA 1ABFA 4UXIA 5ALUA 4JR0A 3CF4G 3RRMA 3R6TA 4D57A 4I1RA 1UEXC 5GM2A 3P9ZA 5J3JA 1XD2A 3WO1A 4QJBA 1WXFA 1QSGA 3HBNA 3ICOA 2N0SA 2YYZA 1A97A 3B5IA 3CJRA 1GUDA 3PC6A 1OA1A 3O3NB 4PZZA 3ILHA 1UODA 1WLYA 3L0DA 1CUEA 1DTSA 3ZHBA 3MAGA 4MUGA 5D00A 3FCXA 6LDHA 2W8BA 3MLBA 3PLRA 5C8YA 1W35A 2CSUA 5EE0A 3RVQA 5C9ZA 2FKAA 4GKJB 1EFTA 4MKRA 2QR3A 1YHNA 2OVFA 1UK6A 4ISCA 4IIBA 1G3QA 4RK7A 3BZWA 1KE2A 5AVQA 4L73A 3KT6A 4Z0PA 3EG5A 5KX5F 3MNFA 2AG8A 2PBFA 3EBPA 4KXQA 4O1IA 3UW3A 2NO1A 3I0NA 4MIEA 3EEIA 1OZGA 4EA7A 1E9AA 3R3VA 3HJTA 4LZOA 1HE2A 1UMBA 1XHLA 1YFZA 2PKRA 4UCXA 1Z56C 4YT5A 3BGIA 1M72A 2G8LA 4XFKA 4DMCA 4G25A 4R1UA 2RHLA 5HQJA 4PX2A 3WJ2A 2PXAA 2QJOA 1R3UA 3WYNA 3FD8A 4IF6A 5DBGA 2CB0A 4S0XA 2RGEA 5EEHA 5HM6A 3P2MA 4QGGA 5JYDA 3FPLA 2W6CX 3O91A 3LWBA 4EYQA 2CXUA 2JBHA 4U7WA 5H4HA 2ZZMA 5I7EA 5HGXA 1JDSA 1VIDA 3ZG6A 5DM60 4Q4LA 4Q3NA 4ENTA 1IXYA 3U3RA 3VSAA 1YRAA 3BWYA 2BYTA 1PJQA 1F2TA 5DW3A 1GZ5A 1TZ2A 3VBEA 3O4RA 3RWMB 3FFAA 3PHGA 3PP8A 4LXGA 2H1OA 4UMEA 4JD5A 2VXCA 2YWEA 3EXFB 3LY7A 3ZU6A 4QELA 5F21A 2FSFA 4RH3A 2AHRA 4BQQA 3BWCA 3D8SA 3OX3A 3WOVA 1NUSA 2VTEA 4YP7A 2IHZA 5D86A 4UBIA 1XB2A 1G8SA 4L7VA 2FQWA 1CW2B 1ZIYA 3MMZA 3V8VA 4UMDA 3P0JA 5E7IA 4GPIB 3DUWA 1XEAA 3FHOA 1JHAA 2LWIA 1M1XB 3K1AA 2EBFX 3K8YA 4IL5A 3U13A 2ID7A 5EMNA 2B8NA 1B1AA 2XDQB 3MQ4A 5K8CA 4H08A 4JOSA 1ZXXA 3QVGB 4HQOA 1Q83A 1QO0A 2JAUA 1OKKD 1D0SA 1MA3A 1ZMRA 3GVCA 4HAZA 3SJBA 3WL3A 4A1FA 2W71A 5LDHA 5ELXA 2NVWA 1TFUA 2JLBA 2PFGA 2Q9AA 4FFPA 3ICWA 5LM3A 4IMIB 3LKZA 2ZI7A 3AFIA 1V6SA 1X8XA 1U8YA 3BK2A 1S6YA 2G6BA 2WM9B 3RYIA 2EEPA 4C6TA 1PNOA 4CG3A 2ZAMA 3MCWA 5IK2A 4JR2A 4MVJP 4A8JA 5F1PA 3ZZTA 4ECAA 5THQA 4EJ0A 2VHUA 5DGIA 4NJOA 3ZI0A 4IQ4A 3OAAD 4BVAA 2VTBB 4OIFA 1S1CA 2V1UA 2UYHA 1Q7BA 2V03A 1WBJB 2PEYA 3O26A 1VRCA 5J5CA 3ZZ0A 4JUAA 5DF1A 3R0JA 2OY0A 5FA6A 1MO5A 4A6EA 1NVFA 2EOAA 2FZVA 3HNPA 3IQEA 4GG1A 4NZZA 1T8YA 3CSUA 3KR1A 4TWBA 2R4QA 3FJOA 4MRRA 5EZYB 4YUYA 3AHHA 2PX8A 3X44A 1CEQA 3JD4A 1E99A 2AFRA 3RO7A 4XJXA 4PU0A 3ITNA 4FR5A 2JI9A 5JARA 2ECPA 1E5XA 1GYQA 1LCIA 2J9ZB 2AMFA 4IILA 4JLNA 4LE1A 4Q12A 2GEKA 2HYDA 3WKDA 3BA1A 4B1FA 2OHGA 2PGDA 3VDXA 1KYZA 5DM1A 4F6LA 3ZK8A 5B6IA 1M76A 2QAGA 3LP5A 2NQ2C 3QU5A 1M1NB 4Q1DA 2NZYA 2ORED 3CZPA 3DWEX 4QRDA 2JJ1D 4EIWA 1SC1A 3QHQA 4Q00A 1H1LA 1JIUA 4YAEA 5AW6A 3I5UA 1FP6A 4FW9A 3ZLVA 1X7ZB 1PR9A 4IOJA 4PAOA 4DCUA 4L5IA 1Z5GA 4BMCA 1GSOA 3NB0A 1ISRA 1AM4D 1B6RA 2HJSA 2FPIA 4ZOLA 5EJGA 1IHYA 2HXYA 1WCV1 3STHA 3TO5A 2P35A 3WMEA 2LCFA 5I9NA 2IYNA 3CZ5A 2AVDA 4PHHA 3U26A 1QIGA 4JQCA 4A6DA 1ZQ1A 1P2SA 3BF7A 2YNMD 5GY7A 2JKZA 1X3SA 6REQB 1ISJA 1FFHA 5DNEA 1LXCA 2HU7A 3TJRA 1WOMA 2XVAA 1LNQA 3D6UA 1YC2A 3MBKA 3QUQA 1MH1A 3MTGA 3PPYA 4JHXA 1ZCZA 3PUHA 4R1SA 4V2IA 3TLBA 4WECA 3NM6B 4OQYA 3UH1A 3AV0B 4ZV4A 2RI0A 3QIVA 2VTKA 2CD7A 1DQNA 1DLIA 4TL6A 3SF8A 1Z0IA 4JT2A 3NALA 5DBOA 2WQ7A 4I8DA 3BTUA 1VPVA 3IR6A 3VXKA 3RF6A 3CVYA 4TYMA 4KR3A 2EBUA 4CMEC 2FCRA 1C81A 3GLKA 3M33A 3NP7A 3PYMA 5EEGA 3QF4B 4OBEA 2JGNA 1D6NA 3P9RA 5IBQA 3T5DA 2QM7A 1C7JA 3CC8A 3EIQA 4DLTA 4EY3A 2BGWA 1W4AA 1EFLA 2PY6A 2I7XA 1GAWA 1N9GA 4KN8A 1IQRA 1D03A 3DCIA 1YA4A 1Z36A 3HB0A 1Q0TA 1LZKA 4AY2A 1YS4A 2A4MA 2NO0A 2RG1A 4TM8A 5BN3B 4R9UC 2JHCA 2QDXA 3MTDA 4MVJM 4NNPA 5DX8A 4CT5A 3BN3A 3F6YA 3DNFA 3P9QA 4L75A 5AK5A 1OQAA 1Q44A 4QE3A 3E7WA 1DKQA 4MB6A 5K51A 4AU1A 4B32A 1M2OB 1EDBA 3OA2A 3OP4A 1VM6A 2VAXA 3DLCA 1MA0A 4BLSA 2P9EA 4E51A 5LLTA 1JR6A 4K03A 4MCAA 1Y9JA 3WRVA 1PSZA 4OHBA 1MB0A 8ATCA 3KSBC 3KL2A 4LJAA 4OREX 1LK7A 4O8CA 1ZSVA 3U60B 2ZP1A 2Z43A 2GXSA 3GZNA 4KQCA 2OD7A 1Q17A 3R40A 3RLIA 2EGUA 5K4HA 1J07A 1U2DC 4MUEA 2JKYA 4W63A 4CYMA 5F76A 3VZDA 1VRWA 2EIXA 3I9MA 4OEHA 1B74A 1PR1A 1SURA 1ISMA 2HK8A 3BMNA 4DC9A 3VFDA 1OHHA 3IAXA 3H2IA 4EQ6B 1D3AA 2IOQA 1KBQA 2FMKA 3O9VA 3O74A 1E2BA 4CMHA 3T3PB 2GT1A 5KNBA 3MJRA 4DL9A 1DJPA 4KQWA 4OFZA 4ZJYA 5BWBA 4AUNA 1UOEA 3L1HA 2Q8NA 1RRVA 4OHPA 3R0VA 5FLYA 1SBZA 3DEZA 4QXAA 1XYGA 3ROPA 2OGWA 5H82A 3JV7A 4CU5A 2P6RA 1YIDA 1BCSA 4Q1VA 1VJGA 4I50A 3GEMA 5JC1A 4A10A 1A72A 3PGVA 4QLOA 5F1OA 2O4UX 5B7PA 1RFLA 1QWOA 4FBMA 1ODTC 3KOWA 2QRKA 5FL7A 1A2OA 3DLAA 3WY9A 3F47A 4M0DA 3U40A 2XF8A 3HC7A 1TQ4A 3CB2A 3JQEA 2PRIA 2FTKE 4MRSA 4B48A 3DLBA 3G7NA 5B5SA 1TK2A 4TXHA 4MUJA 4UVIA 3TQQA 5EJ9A 2FSSA 4CW7A 4QREA 4C05A 4KPUA 1ND6A 4RCYA 2WMYA 3RS8A 3TUJC 4JT8A 1V39A 1N7JA 2GI4A 5LUBA 3D6JA 3A6LA 3HRHA 1TF2A 1TM7E 2I1LA 4CM8B 3ZXXA 3HADA 4E12A 3IT2A 2WG2A 4TRNA 1FDUA 4X3CA 1SXJC 2UYYA 3T5TA 3FIJA 1OXTA 3F5SA 1NE2A 3GHYA 4AJIA 1ZN9A 4YP5A 4F97A 5C46F 4OU5A 4R8LA 5ETJA 5F35A 1V5WA 3DAYA 4JJ7A 2I62A 4MROA 2X8WA 3WL8A 3UA4A 2B6NA 1KEPA 5HQTA 1KI6A 1O4VA 2FW8A 3AWIA 4G9GA 4H0CA 3G82C 5J47A 5MGBA 3U7FB 3AM5A 2I4TA 1DIAA 4EGJA 1AN9A 1JAHA 1XBTA 2DLDA 3C3DA 4QJIA 2CWWA 3FW1A 1DMRA 1LDGA 3ZVKA 2RB5A 1U8ZA 4TV9F 2R86A 3FNQA 3ZC3A 4X1YA 3PLAE 2FV8A 2EZ9A 5JPDA 4E5UA 4PX3A 1P6UA 5CGQB 3OVMA 1MV8A 2BEKA 2QRPA 2O5RA 1L7OA 1N2IA 4BQPA 3I01A 4YAWA 3JS5A 3ZV5A 2IWRA 1GIAA 1K8RA 1O5TA 2FI1A 4EB6B 4HPWA 4Z7NB 4JJKA 4ZU3A 4KE8A 1DOHA 1OFIA 1OLUB 2CHVA 3GLHA 5JS2A 4AXXA 3AZQA 1B14A 4S1WA 3HKEB 3UUEA 2GPYA 3C7AA 4EPYA 2W2LA 2GBPA 3JVUA 2IZ0A 4RQUA 1YKSA 1OI3A 4O2AF 3IAHA 3SQNA 1APBA 5AI0A 1FRNA 1IEVA 3UB3A 1FYXA 4F93B 5A5DA 5EMJA 2C4NA 4JZKA 2OZVA 3IDSA 4BX2A 2GDJA 1YZYA 3QKSB 4GXRA 3NNNA 3WHLA 1YS9A 3A9CA 4FYKA 1B8PA 5CAEA 1GL7A 1QK3A 3ZXYA 1AGXA 3KSAC 2NSDA 3GDFA 2JL1A 3BE6A 3K32A 5CVJA 5SICE 3TLAA 2FPKA 2Q2QA 4GI3A 5DI9A 4PRZA 4ZCQA 4ESHA 5J2UF 1CEEA 2X4IA 4M99A 1N78A 2GN6A 3PTLA 4ZYUA 2R6HA 3C43A 3UWPA 3OE5A 3HN2A 4UTVA 1ECLA 3EX7C 3OEYA 4YBZA 2HQBA 3FWZA 2ZUDA 1NHWA 5AICA 2HQ1A 4Q66C 2KSQA 3DH0A 1XRPA 4DYVA 3OZBA 4H2DA 4CDMA 3M7IA 3FTEA 3ODPA 1I0IA 4MVJG 2P7HA 3C14C 5D6NA 3MWLA 2WAYA 1PW5A 3D0KA 3OM9A 2F67A 4L4RA 2PCJA 4Q7MB 4ZZ2A 5TEVA 5IUNC 2ODAA 1QH1B 1UXHA 3ANYB 3IDZA 1KGSA 3BIWA 3R1IA 5LA6F 3GUVA 1TAHA 1V7ZA 3ZQ6A 1G7RA 2BKEA 2A35A 4YJ3A 3UUGA 4C6SA 2EX0A 2Q9UA 4D9CA 1PFKA 4OYRA 2GEJA 3M89A 1EDZA 1LSJA 1NLZA 3G02A 4R2HA 3NXKA 2FSIA 3AR5A 3LQ4A 4HPJB 3Q9LA 2B21A 1NRIA 1JLLB 2WEKA 3C8HA 3N28A 4MYCA 3UWOA 3DXZA 4OJYA 5IJ0A 1X1CA 5KIAA 3IOEA 3PIIA 3BOSA 3H1PA 5JRDS 1YS2X 2PAFA 2JIRA 4YCNA 4MKHA 2H85A 4GO1A 3O83A 1GKIA 1XOIA 4B6RA 4CR8A 2GSDA 2GZ3A 4N9WA 5ARBA 3GLGA 5G0VA 2R11A 5M29A 2XTJA 2QJTA 1P9OA 1SO8A 4PS1A 4U6SA 1Y7IA 2DCUA 2BPOA 3PKZA 4MRAA 5JSZA 3NWPA 3RQSA 4Q37A 3TWOA 4UMFA 5E4FA 4KOEC 2ZKLA 4ZAVA 4DOMA 1AX9A 1W1WA 4MLCA 1FDRA 1RXVA 1BXGA 1RWMA 2ADMA 4EKEA 4ZQFA 2RHDA 3P9IA 4C2AA 4ZI7B 2QOEA 4PO9A 5ER9A 1IY1A 2H7YA 4D5EA 1ORDA 3P9PA 4M0PA 4ZAZA 3GU3A 4UD6A 1EFDN 3ZVMA 4NP6A 1FMTA 1OGIA 1Y6QA 2REQB 1SU4A 5JAUA 1QFSA 3K0CA 3ESCA 3GMSA 4S0ZA 5TQ2A 3IAUA 4PSKA 5A6SA 4CQMD 4N0MA 4IQGA 2ZRFA 4EL5A 4JY7A 4M8NE 4YV0A 2XOXA 4D9GA 5GOZA 4HNUA 5F98A 1U7TA 2R8RA 5KYVA 4JEMA 3UMMA 2NT3A 3KVVA 3HXTA 3FNHA 3SU8A 2ZGVA 4LVNA 1RTKA 2K2QB 3CBQA 1UDCA 4AJKA 1JEYA 1A7AA 1OZ0A 3CKKA 3R0XA 4NYIR 1Y1KE 3O8OA 1HYGA 4C4SA 4DRXB 2HDOA 1D2MA 2FMUA 3AR8A 3HKBA 3UAOA 5B7GA 1DBRA 1U6IA 4JVMA 2ZRDA 4LC9A 1YR1A 4R6XA 4DIEA 1Q1AA 4XPZA 4Z4HA 5INTA 2OOKA 3NYQA 5ILGA 4O2LA 4F85A 5K05A 1M1UA 2QSYA 3D6MA 2DR2A 4Z53A 2VOEA 3VHXA 3VUFA 1TGYA 3GJSA 3T3NA 2ZU0C 2QMOA 3FPJA 1NNEA 1Q0HA 3WZ2A 1C41A 1C30A 3T1TA 4BB6A 1MAVA 1XZIA 3P9SA 4HDSB 4J0DA 1M2EA 3TTVA 4CFYA 1I01A 2C00A 4WI1A 2H9AA 4YDSA 1QV7A 2QG6A 1WW8A 2WMOB 4GGOA 4WZBA 5BNWA 4NBTA 1ZMOA 4D8WA 5L3SB 1KJZA 1J2YA 2A9RA 4H27A 4BRUA 3KLBA 4C7OB 3WRXA 121PA 1J9EA 2O6HA 1JE0A 2ZPUA 4NVRA 4C03A 3LX8A 1I3NA 3VR3A 1I0LA 2C59A 4V0RA 4EUFA 4UTOA 3I2JA 1SZJG 4K0RA 1RM3A 2Z9BA 3H5NA 1G17A 2A1UA 2GEBA 1JSCA 1JG6A 1KFEB 1WLSA 4RTNA 4JJFA 1GPWB 1TO6A 4PC1A 4EHFA 4CEJA 2HA4A 2RH8A 4NYJR 3EG9B 3RVSA 2JJQA 3LO5A 1FF9A 2C7RA 1NOJA 2I1QA 1I7SB 1ZNZA 4MAFA 1A04A 4B2LA 4LYGA 1CUIA 5FI5A 4P0TA 4HYTA 1W5SA 2XODA 4DCMA 2WUGA 4LC0A 1V3QE 3AB8A 3KE9A 2XOKA 1CR1A 4PQYA 1U7WA 5KCMA 5EKUA 3WS7A 1KK0A 4LFAB 4FYPA 3K1ZA 2QN7A 1LDMA 4D9EA 2NGRA 2VHXA 1J70A 2RJOA 1PZNA 3ZE2B 1ADJA 1TIPA 5HZGA 5DI3A 1ID1A 4G1CA 2PLWA 2XX3A 4DIDA 2FFQA 2FUEA 4MGZR 1TA4A 7GPBA 1SVKA 4FFRA 4CMAA 3R3HA 3UANA 2JGFA 4W5NA 5MN6A 1A2QA 1FUUA 2ZIWB 4JDPA 1YL5A 1UKAA 2QMYA 4HDMA 4WEQA 5LDDC 3KQKA 3FKSA 4YPOA 4UEJA 2Z2ZA 5KYUA 3R8CA 4NHEA 4E4TA 2OC9A 1ZM3A 1K92A 3AL2A 1G5IA 1O9GA 3FH0A 3PNMA 3AUYA 2WSLA 2RCYA 2UDPA 2JGRA 1RLMA 3U6KA 2B30A 4IFTA 1WZUA 3PCTA 3GLFA 1XTBA 1E5QA 1QHYA 3PUZA 4JWTA 5CHEA 3HWWA 5HIIA 2Q5CA 4M3NA 2UZ1B 2JJ2D 2X23A 5L3QB 2YVLA 4ZYWA 3F74A 1X7WA 1BROA 3DFFA 1OMOA 5AIBA 1Y7TA 2QQ0A 1K68A 3G13A 4RX1A 2BE9A 2NTVA 1WUTA 3O6VA 3O8QB 4NMHA 5KCZA 3K9LA 3Q12A 2WVGA 1CUBA 3VV3A 3G7UA 1PD1A 4K8OA 2ATIA 3RSOA 1DV2A 1S8FA 2AW5A 2ZEJA 4TRJA 2FUG6 2Q8PA 3GGJA 2FQ1A 1VGQA 3CNOA 4Q3BA 3D3KA 3NOXA 5DBEX 4YN3A 3H42B 4G1BA 5CTJA 1JLRA 1WMFA 3VZCA 3FOZA 5B58T 3UJ7A 4GUAA 2H07A 1AD2A 2DUWA 2WJJA 3O1IC 1MDBA 1NXPA 3G9QA 1L1QA 3BB1A 1SIOA 2PVPA 4S3MA 1JHQA 1Z0UA 2XXAA 2Q1YA 2OHJA 3IAM6 4WN9A 4FFLA 4LYHA 1PU2A 4R2JA 3LUGA 1KFCB 2EYUA 3DHWC 2F3QA 3HGTA 4QXOA 4B2YA 4BNZA 4ZT7A 1YGPA 3DP9A 4E0BA 5IW8A 2YL2A 4QATA 3RBXA 4A9AA 5LBIA 4TRMA 3ZGLA 4P35A 1CFZA 2GPWA 2IZOA 3CM0A 4AIRA 5CM9C 2QTMA 3ICVA 1MNQA 1RJ9A 1EG7A 1MX5A 3F8WA 3TTSA 3Q0EA 3VSDA 2OXTA 10MHA 1PWZA 2ZB3A 3MJHA 3UPTA 2BGUA 2VZ8A 3BFXA 1DX9A 3OFND 1GR1A 4FHZA 3V48A 5DN6A 3DBLB 2GTHA 1AUPA 2PQ0A 4ZCSA 3DKRA 4CN8A 3UUWA 1C9DB 5IBCA 1RAEA 2FN9A 4EPTA 4EO4A 4LV5B 6PFKA 5KOHB 2VQ6A 2WYVA 2B9VA 2R85A 3OZDA 5AJYA 4DR7B 1ZD1A 3E23A 1KQNA 2CXXA 5J1SB 3V1NA 4JLSA 3B89A 1OPXA 1QVVA 1IZ9A 2YJNA 2ZCVA 2Y0DA 1N2GA 1CY4A 4FTWA 1QP0A 1Q0ZA 1RI5A 3FCYA 2LUOA 3IE2A 4CKEA 3OOHA 4BFSA 1KPHA 5FUMA 7YASA 1NMZA 2CLFB 4YBRA 1CZKA 2AOTA 1KDVA 3D7LA 2C84A 2NU6A 1Z33A 3MMNA 2QQFA 4RVGA 4M1OA 2GERA 3PGKA 2V9ZA 3ND8A 2C54A 4PO1A 4XDHA 2GJKA 1ZOOA 3G0OA 1V1MB 4AJ1A 4ANFA 1H0SA 2Z9DA 5BSMA 2G71A 1E18A 1CJBA 1JR3E 2GZDA 3ETDA 1JEQB 3HVHA 4KK3A 4PIPA 4U6QA 1DDIA 3E9QA 3KQOA 3I2HA 5GZ6A 4DY4A 5C31A 1JI0A 4G9BA 1PTJC 1G20B 3W5SA 2CY0A 3HDQA 3L82B 2DRIA 2NQTA 4G97A 8OHMA 4ZI2A 1GQQA 2R3SA 2WW8A 2ZRMA 4O2AB 1P19A 1QH0A 4PQRA 4AZ3A 4W5RA 5C7IO 1DAEA 1G21B 3WVNA 1P2VA 3DVLA 4P86A 4PIVA 2O0JA 3IO5A 1LQ2A 3C41J 2NAPA 1RLJA 3IBFA 1BOOA 4GOMD 4UVEA 3CX7A 4AYWA 1CJMA 1T2VA 3ND9A 1Q1ZA 2PGLA 3FLMA 4W6QA 4MUYA 5DBIA 1V8OA 2QPLA 4UVDA 2PX4A 2XUOA 5AVYA 3COPA 3L8CA 5DNDA 5J2UB 5CW1A 4FT4A 3CURA 3ZD8A 1UK8A 3BZBA 1PJTA 1YVRA 2ZIAA 3WXMA 5K45A 3QSGA 4I4NA 3V7NA 4MVJF 4XTRA 3MMSA 2HGSA 1R4AA 5JRJA 3E84A 2IXTA 1G6OA 4LMAA 5JFTA 2ZUUA 2UZ3A 3K9WA 4JX8A 4TT3A 2Z08A 1QG4A 2WM2A 5DNAA 3LPCA 4E21A 4CF4A 3DMTA 4YJHA 3MWFA 3RVMA 1N5KA 4HLUC 5AH0A 3VU9B 2ZR7A 4BZZA 3URKA 4E11A 1L4MA 3NC0C 1M6HA 3CSSA 5ALOA 1XRJA 4O2BA 1W76A 2XE6A 2BW0A 1S2LA 4XOUA 4DV5B 4LDJA 2JFYA 3DE0X 3GGPA 5FHQA 3TQTA 3VPDA 3FNFA 1FRQA 3PGA1 3DBRB 1E2QA 2P3QA 4NENA 1NOIA 3M9XA 1EVQA 3A6KA 4ZDIA 1WS6A 1M73E 3LT4A 2UV8A 2C2GA 2ZUBA 3I9NA 1HSZA 4YCJA 2DE0X 2GKOA 5ADVA 1JPNA 1LFDB 5IVHA 3RFUA 2ZI6A 1O6FA 4PZPA 4UTZA 5HF9A 2IEDA 3QLVC 3W79A 3WP1B 4JB8A 3U81A 1HNWB 1P45A 3JQ7B 2SKCA 3DFMA 5B12A 1LPMA 2EQAA 3D0RA 1QFJA 2YWRA 4M22A 4AUEA 4BEVA 3JXEA 4N5MA 4L85A 1GCGA 3MJ4A 2D06A 2BM0A 2GJ9A 2YBEA 2OCDA 2R1TA 1IUNA 1CIVA 2IYVA 4OI4A 5AUNB 3FTFA 1BJKA 1NBAA 1P0QA 3RASA 3ZWWA 3VZSA 4OHWA 4G0VA 1N2JA 1Y8RA 4F71A 5IFKA 1GTRA 4K2HA 2YWGA 1GZUA 1VKHA 1VI5A 2AA3A 2C4WA 2NSYA 3K92A 4KO2S 4AZ0B 4B3MB 4KQ9A 2R5NA 1VIYA 2PS3A 1UC8A 3GUUA 2HSDA 4H1HA 1DXOA 4BZWA 4EG1A 5AKEA 2HCTA 4IXTA 2OUIA 2BEWA 2QR5A 1G7CA 5DCYA 3WXBA 1QIEA 2KB0A 5JH7A 3W5AA 2Z5GA 3JQAD 3J7TA 2NU9A 5IDXA 3ZJUA 4P82A 1XZGA 2RH5A 3LHIA 3IV6A 3FYDA 2HF7A 4D9BA 4PSDA 3RAEC 1BMTA 5FNVF 3O2NA 3AHGA 1L7XA 3R5TA 2O23A 3K7EA 1AQYA 3KKKA 3G2LA 3KTOA 1IUOA 5LMZA 4P98A 3UJ8A 4RIIA 3QE2A 2JGEA 4KREA 1TMYA 1ELOA 2HI0A 7REQA 3E4DA 1SCQA 2OCIA 3B70A 3BHJA 2R8YA 2XUKA 1MORA 3H5IA 4DLBA 1YDWA 1COWD 3CISA 3AQIA 3LKDA 1L4NA 4GGMX 1YR2A 3B48A 1LWOA 1WNFA 3HJHA 4TM7A 1WSWA 4NK5A 5CGZA 4DJAA 3DTVB 3K0FA 3MTJA 5A3VA 3E9ZA 1N3LA 1NVAA 1MU0A 1S8OA 2LNDA 3L4JA 1D8TA 4EI8A 1LLDA 3PDWA 4L4SA 5GTDA 1QIKA 2RB4A 4JP8A 3UKDA 5FXMA 1JI3A 1E9SA 1C7EA 1W6RA 3AP3A 3DUFB 4OQLA 4IRMA 2ZITA 3MS4A 4R9SA 3FZEA 3WMGA 3OZCA 1E69A 1G5QA 4D4HA 5TDHA 3NT4A 2WKQA 1AZTA 1NC3A 2IIBA 3A1UA 3DDUA 4AULA 3N9IA 1IB0A 1LDYA 1ZIDA 4ITUA 5KVQA 5GZ1A 1Y37A 4HGZA 4NNJA 1WPXA 1BU5A 1FUKA 4UTXA 1QRUA 3ZCVA 3FYHA 4P83A 1XU7A 2Y3IA 4L3WA 5DYYA 4IPTA 3GJYA 5JSFA 3OHMA 2AB0A 2DR3A 1J06A 2JCXA 1KY3A 3Q5DA 3MMXA 4R5MA 4EABA 1YJCA 3QKRA 1JEEA 4MLPA 4Z9FA 1X1RA 1DJMA 3ZKWA 3OQIB 2GJ4A 3KUXA 1ZGAA 2ZBPA 4HAVA 1C9YA 1JFLA 3SJ7A 3VAZA 1IU9A 4MGEA 3VNRA 1J2RA 3REOA 2WTMA 3M70A 1J90A 1PJRA 4HWKA 4RTPA 5LQNA 3ANNA 4ILKA 1GPH1 5AUQA 2EJCA 5EP1A 4K9MA 4IHJF 2XY4A 3W2TA 1QFZA 3QYPA 5K09A 3EZYA 4FM9A 5FFFA 4COOA 3REFA 3BIXA 3F7TA 4ND2A 1X1QA 3TOVA 3E7PA 1NUUA 2VDQB 1CZLA 3PFCA 3WNZA 1BEZA 4AF6A 2YKGA 1XWWA 4INPA 3BG5A 1Z6GA 3H3XA 4ETMA 2GD6A 3GJ8A 3PNVA 5EPEA 3VNVA 1QRAA 3WNCA 4F72A 1J0DA 3CIOA 1EVEA 1G2PA 3D6VA 3J81k 5LKRA 1WEHA 4BO3A 5FR1A 1ILWA 1RKBA 2HHLA 1H22A 1DO8A 4TUYB 1QTRA 4N54A 3LBYA 3IIIA 3AY6A 2AD5A 3CA8A 3TGWA 3P27A 4PLCA 3C3YA 3F6EX 3TTXA 2RH9B 3C98A 3T9CA 1CP3A 4BJ1A 1JKFA 4F12A 3LBFA 4EYKA 1KI2A 1M3SA 2WAOA 3H75A 5DBHX 5L3VA 1NI5A 3LL7A 2BBWA 2R84A 3DT6A 3OEHA 3QXCA 4JH0A 1N3IA 5DPMA 2VLIA 2RGBA 5JNVA 3VNUA 4YP1A 1PR2A 5DCUA 1U2TA 1YQ9A 5HK9A 1QKKA 1DC4A 2G08A 3B6EA 3D1JA 3R23A 4MWTA 1PZXA 3A1WA 5C1DA 3X1XA 1THMA 1RZ3A 4ENPA 4LJ5A 3I37X 4YMIA 1PAUA 1SD2A 4ZIRA 1WF6A 2D1TA 2ISQA 4CLDA 3OM0A 3B12A 1IONA 3FPGA 4G09A 2YJTD 3U4GA 2MYTA 1BYUA 1XRRA 2YWBA 4NICA 4YA6A 1G20E 3C4JA 3TSYA 3PFGA 4RM2A 4B44A 5AFSA 2W0MA 5BMVA 1Y7HA 1NV9A 4U5XA 5DTJA 2G80A 3MS2A 2PYZA 4KOAA 1IVYA 2VOJA 4NCHA 1GD1O 5JPCA 3IL2A 1G21E 3RRNA 1XTIA 4INOA 4YECA 4DNQA 3SHQA 1O97D 3BXFA 3CVOA 1XA3A 5D3ZA 3ZGOA 4A8TA 5T3UA 1OXMA 3B78A 5TQ0A 2R65A 2ZJOA 4C7VA 1YO6A 9ATCA 3O21A 5SY6A 2D4HA 4INJA 3LXUX 2RHJA 3LECA 2FGJA 4G86A 5BUSA 2ZPAA 1EBBA 5EGNA 2IS2A 1MG5A 4GP7A 3RVNA 1V1RB 2R9VA 4BO2A 4KUHA 4D25A 3K5HA 1AGPA 5A71A 1DAGA 3IXMA 5JT1A 1UP7A 1SB8A 4MUIA 5FAXA 1XK7A 4JBGA 4HAYA 2ET6A 4CDGA 3GNSA 2WTUA 3U31A 1OWNA 4L8WB 1E1KA 1Q91A 4RETA 2JI7A 4OXQA 5FTLA 2VQSA 3EULA 1KVUA 2XH8A 3VISA 5TGDA 3RVKA 3DZIA 2B4TO 1MUUA 3L0YA 1ZD3A 3DOJA 4WLEA 1L5NA 4K86A 5JJKA 3NHJA 1DNPA 4UZEA 4FCWA 1E2LA 5FUXA 4F1JA 2PVSA 1NM5A 4ACBA 2ZIVB 4EFMA 2G9VA 2JARA 1H9CA 4YJGB 3EAFA 3C3WA 4TLEA 3X1YA 3HCWA 5JD3A 2OG1A 1FNMA 1PIWA 4ONEA 3TL6A 3NWBA 2DHCA 1I4OA 2SCUA 3QA9A 4ER6A 5IFLA 2W6MA 3GEGA 1BDHA 4BMSA 3TKLA 1NVVR 4JLOA 5LOVA 2EL7A 5AJTA 2GPNA 1H6DA 7AT1A 3HACA 1XRMA 1IIBA 1EFPB 3JD3A 5AD1A 2O3RA 4ZQHA 2VJQA 5FCDA 3TKYA 4BP8A 1R10A 4BZPA 1PGQA 4MV7A 3D7NA 1AKYA 1XXHB 1USKA 1SOUA 3KEGA 3U9LA 4JEIA 4WBNA 3EODA 3UHPA 2OZPA 4HLNA 1EIZA 3CLRD 1U7HA 5AVOA 3E7XA 2YWJA 5C18A 3Q9SA 3CZAA 2PWYA 3HI6A 3IDFA 1H4TA 4TYPA 4X91A 1DO0A 1WUYA 2H31A 1ST3A 4FS8A 4ID3A 4ZN6A 1IPFA 1P72A 4KO3S 1GCOA 1QV9A 4L8LA 3R24A 4M1YA 3WA7A 3LUHA 1W1IA 4PYRA 1O58A 1ODIA 1A9XA 5A05A 4K7JA 2NMVA 1EZZA 2VYFA 5ADUS 4PV7A 2QUKA 4E1BA 3O4HA 5DX0A 4KGVA 5E0OA 5KDLA 1T2DA 2VRCA 1KBZA 4B84A 4EGSA 4LDQA 2QTVB 2QGNA 5B1HA 2P2SA 2XW6A 1KO8A 1T5HX 4M7WA 2YICA 4G07A 3C8DA 4EPXA 5JAOA 1G66A 5CLGA 2EGHA 3EW7A 4JBNA 1DDGA 2J32A 5E9QA 3SSAA 3N7TA 1JA9A 1N6PA 4RMIA 1CX9B 3PIDA 1Z0ZA 4NKRA 2X1LA 1NUAA 5A0TA 4L15A 3V3KA 2CLEB 2H11A 1PV2A 1EE1A 1L4KA 2K6GA 2B35A 1GR0A 1XJ5A 4MGIR 4YMHA 2NPIA 2O5VA 2OHOA 4G4SP 3C97A 3AX6A 1ZVVA 5FUVA 5EZQA 1KK3A 2EEZA 3GEBA 3GHHA 1Z5VA 4ZQCB 4EG7A 4EYEA 1U99A 3FFXA 4KWCA 4DUPA 4K9DA 5C5DA 2C2OA 2PL1A 5A2QA 2WINI 4JB0A 3HCFA 3UAYA 1EK2A 3VPSA 3K9HA 4CUKA 1H2RS 1E96A 1MJHA 3DF7A 1EVIA 3QQPA 3TX6A 3K31A 2VYVD 3D6FA 4I5EA 1U2RA 4BFWA 5FOQA 1JG4A 3CW2A 4A91A 3O90A 1UZLA 3OZGA 3GGCA 4M1KA 4ND7A 2B6HA 1EK1A 1GNVA 1RWPA 2AE1A 1XMOB 4QDZA 4RANA 3SE0A 3X3HA 5JASA 4V0ME 1VG8A 1WE2A 2HMYB 1E58A 5F9HA 3LG2A 1B4DA 2WKSA 4RVNA 3ZDCA 3IR7A 1SHLA 3T3MB 2HRZA 2VH2A 1LPNA 3S4YA 5K8UA 1Q7GA 3JQFC 2VPXA 1O95C 4PIMA 5C8XA 3UFXB 1SOMA 1NJFA 3RC2A 3QVKA 4EYOA 1PNTA 1YDEA 3PXUA 3NHPA 5CLHA 3WLAA 4BRWA 4C78A 2ZWAA 4D41A 2ZRLA 2BFPA 1VI2A 4LEIA 3MZ0A 3KG2A 1QF6A 2JIZA 1XVVA 2ZE8A 4Q1AA 1WCWA 3EHDA 4XGIA 1VC2A 4CG2A 3EQ2A 5FAKA 5D6OA 2CL0X 1N5DA 1ECFA 1ZH2A 5G02A 3FCSB 2C8KA 3HE3A 3ZIAA 1XZPA 3D5EA 3W5IA 2WUFA 1AS0A 1M8JA 2B34A 2CBXA 2DH6A 3RBZA 3UWSA 1IVSA 1PJSA 3V32A 1OOEA 2XUQA 4GWGA 2ENWA 3D6NB 3VR4A 1T6NA 1IEWA 1F48A 1SD1A 1GDHA 5KOYA 1QS0A 4Q82A 2Y1LA 3HL0A 2FFAA 1FNNA 3IDOA 3O2JA 4GLFA 4Z4IA 3DMHA 4LC1A 2X0KA 3C3AA 4O4HB 4LMRA 2WWXA 1AKTA 1RI4A 2DPYA 4G5HA 4BKPA 4BATA 2I3AA 2VEDA 2J5KA 3LU1A 3OWOA 2PUJA 4CXMA 4TTIA 2WLSA 3QQ5A 4IQ0A 3VDQA 2BEUA 1GNLA 1A9SA 5AM2A 5HP4A 1P5FA 3W9UA 3VKVA 1V5FA 3NYWA 1LNSA 5F4BA 1DQPA 4LX8A 3T54A 2B37A 1BWSA 2VUTA 1JHMA 4S12A 4ND3A 1U7OA 1V9LA 4MQFA 1H2ZA 2AJLI 3UK6A 1RHKA 3LPLA 1J5XA 4OLHA 5AM4A 9LDTA 1SHUX 5KWIA 1UADA 3S44A 5BV2P 1ZNYA 1I1QB 2PV7A 1JR4A 2OV4A 3BEOA 3UAWA 4BUZA 1G8GA 1Z8HA 4KQ1A 4NV0A 5F4ZA 2GNOA 2YJ3A 1ZGCA 2JLWA 4NABA 2E2WA 1K8QA 1HH4A 2VJBA 2YY6A 1F2UB 1Z5OA 4FJ2A 2IU0A 3E9EA 4LNAA 1JV2B 5ECYA 2ZJ3A 1KYWA 4QOEA 3NIFB 1DBQA 4RJJA 2F43A 1ISPA 1SVSA 3AY3A 3WHPA 4C4AA 4OATA 3I3OA 2GBLC 3KT0A 5CM8B 2O2GA 5F64A 4LTMA 1UDXA 4DJFC 1JGTA 3VYVA 5J4YA 1YD7A 1D0VA 4RKFA 1S2NA 2B69A 3DMNA 4MRMA 5CA0A 3R7SA 1ATIA 2HGZA 4UAJA 1L0BA 1SVWA 1Z37A 2A5YB 1XZ8A 2HBZA 3KOUA 3KTAB 2Q07A 3O7WA 3PBKA 4HQNA 3VPGA 3OLXA 3ET4A 1G9SA 1P5HA 2EKDA 4N0DA 1GFSA 2HO5A 1QP4A 1EFVB 5FJIA 1M0WA 5CCXA 4MUBA 3HN6A 1BN6A 4CLRA 4LDAA 3L04A 4O25A 5EXXA 3PXBA 4JQSA 4TSFA 4OXKA 5A3RA 4MARA 4Y0NA 3R7WA 1U8CB 4IHJB 3COVA 1VSVA 1KYYA 4C0AC 3EXEB 1UMKA 1UZUA 4MMZB 5F33A 2F9MA 2C0PA 3EIFA 4NAUA 2XE7A 5L51A 1IZ8A 5ADHA 1CY2A 3TLXA 3ECCA 1PZMA 3ZGNA 1CP2A 4HQ6A 1VOTA 3BSWA 4HFRA 3U3ZA 5EZ5A 3EGDB 3UGQA 3ZVRA 5KINB 4EY8A 4BWVA 5EWLA 2AEEA 5LBTA 2TS1A 3H11B 4JGBA 2RGRA 2YXEA 4RESA 3REGA 3TE6A 4Y2QA 3R9KA 5BYJA 2XTNA 4RV5A 3S2YA 421PA 5KTNA 5K3SA 2NXNA 4D7AA 3KRTA 4DSUA 1TD1A 1KS2A 1T8SA 1JJBA 3L02A 4NK4A 4QNRA 4D1YA 1EQ2A 1ULTA 1JA1A 1VLMA 3FDIA 4IDNA 5HWSA 1PUXA 5DIFA 4RMHA 2IUYA 1O03A 4RZSA 5BW5A 1JTVA 4RWEA 3NKLA 1MC5A 4G65A 4LS3A 3ZWKA 3WNQA 3OJCA 4MA4A 2JAXA 4QU9A 1XXHE 4B7ZA 1FNSA 3EEBA 3K0EA 5IAKA 4UAUA 2GBCA 2CUZA 1GZSA 1N6RA 1CNEA 4LDRA 4XRGA 1W4ZA 4XWTA 2B5WA 1UC9A 4JC0A 2HJWA 3GRFA 4Q0MA 4FKBA 2EU8A 3VZQA 2Q4TA 1A5ZA 3BDVA 3P52A 4JA0A 3BXPA 4IAOA 4YMSA 5CD1A 3LA8A 5EUMA 5JO9A 3THYA 3VR5H 1O1YA 2XCIA 1NATA 5LQKA 4DCCA 4E2FA 1IN8A 3ASUA 1NMSA 4OSEA 4P3PA 1N2CB 3EOAI 4I08A 1GTJ1 2YIJA 4RWZA 5BYKA 4JB3A 4ZC1A 3INTA 1XAGA 5ICEA 1C4OA 2OXFA 4MPPA 1UPXA 1EMDA 2XNJA 5LZ5A 3D7KA 5T4HA 1JIQA 4UUMA 3LWDA 3HLKA 2QIOA 2GWHA 1I5EA 1D6SA 3SP1A 5CLQA 4DSTA 2IF2A 1XTJA 2OZKA 2A9KA 3GI1A 3NTVA 1RJEA 4OMUA 4BFUA 1R5NA 1VG9B 3BCRA 5E1OA 5GZ3A 3U3KA 1N32B 1J8QA 3MS7A 4FX2A 4A15A 3LHKA 4ZAYA 1PFYA 2GN0A 3PQ3A 5C5EA 4WA7A 2Y4OA 2RONA 5GWXA 3OO1A 1PGOA 4Q7KA 4DSOA 1OWOA 5BSKA 5A5GA 1F06A 2CHUA 1ULSA 2QM8A 4B35A 2QMQA 1M2NA 3DO6A 4FLEA 4H1UA 2XMZA 1OY1A 3WR5A 2P6PA 2XUPA 2HDWA 3D4NA 4XLLA 3NP9A 3M9LA 5BRJA 1OGYA 5K0ZA 3P9NA 1M6VA 4H6XA 4ETIA 4ZFNA 1IBMB 1QJCA 2B1GA 3FKJA 4PCLA 3OT1A 1CVLA 1Z39A 4RXUA 3W5JA 1OAAA 1GT91 1R0ZA 3BL6A 3PYXA 1TZJA 2FWIA 3FGOA 1KFJB 3QMMA 1URPA 4HH4A 4HTFB 4I1UA 4P4SB 3VH4A 1AZWA 3VOBA 1E6KA 4CKBB 2II6A 3BDIA 4DC0A 4MIOA 1G1AA 2WYWA 5A4KA 3NBFA 1M5UA 3TXXA 4CGZA 2HPAA 2ORVA 5CEFA 2DBZA 1I3KA 3KQHA 1NWCA 1U1FA 2FR0A 1CUAA 2MSNA 4JC5A 4F9FA 5BQXA 1O8CA 1KZYC 1ANKA 3WX0A 2VSOA 1UMCA 5CEEA 3RWOA 1DADA 1KK2A 1FSSA 1ZA1A 2O2YA 3CF6R 3KHTA 3N0WA 5BW8A 2YVQA 1BO6A 1Y3DE 3E3OA 2ODBA 1N2ZA 3IEIA 4G2TA 4IDHA 3V9PA 4R1MA 4AZTA 5D3KA 4BTEA 1HR0B 1VIMA 1VECA 4JASB 2R7NA 3UBTA 1GT6A 4Y1EA 4ZVQA 3HCCA 3N7UA 4F2HA 2ZJZA 1VKZA 1RQXA 3LYUA 1VPWA 5HUQA 4Y6LA 3QEOA 1XF9A 2AXNA 1AV7A 3Q0IA 3ZN2A 1E32A 4DBZA 4EX6A 1T1RA 3O0DA 3FFBA 1SZCA 2NNLD 4TWAA 2AJBA 4PAGA 2RAUA 3SQLA 2BCEA 4GMGA 1NY5A 4XWGA 3K2IA 5GV8A 3PU6A 1DAOA 2HSEA 2ZIXA 3Q98A 3CVWA 3ABQB 3X1JA 4YUZA 2ZU6A 2JNWA 3P96A 2Q4BA 3OUZA 1EAMA 3TLGB 3RUDA 2J4FA 1W47A 3WBJA 1E61A 5KC9A 1KYXA 3LQ2A 3ZHTA 1QLWA 2IPOA 5TPWB 5KQMA 3I52A 5JOQA 1RKUA 2BR4A 2E6KA 1R8QA 5HE8A 2WJIA 1II8A 1T4BA 2G70A 2X9VA 2ZBQA 4EB0A 2PKXA 3EIXA 4PC6A 4MDHA 1GGKA 3E48A 4FOPA 1N0WA 3R76A 5B64A 5TB5A 1EUCA 2OR3A 1RC1A 1D04A 4GBJA 4RC9A 5HXAA 4DLWA 2NU7A 4UUBA 4GI1A 1COZA 2UVPB 3KR9A 2CNNA 5A0VA 5DK4A 3A7EA 3OLCX 4H9GA 3PNBA 5BYBA 3RJ5A 3SLRA 1GSIA 4DJ5X 2IHYA 4ZVTA 5EIAA 1U28A 3NHYA 1OH8A 4KKXB 4WJLA 5ULLA 1N6IA 1A9RA 1ZIOA 4D6PA 1YWGO 2H1WA 4OUDB 2J6CA 1ZCAA 1UOOA 2BMEA 2QXTA 4ABTA 4L5BA 1GKUB 1QZXA 1E5VA 5ALQA 2NZ8A 2DPHA 2C7OA 3HZZA 5T5QA 2JFZA 2WWHA 2YFHA 3JQCA 3L1JA 5CX1A 2YRWA 3ZY2A 1M1YB 1MN6A 1PGJA 1LQUA 3N6XA 4C76A 3WLPA 1EVLA 5THXA 3H18A 3I9KA 4XUEA 3OZXA 4ZRMA 4EHJA 1LH0A 1DUVG 1EQAA 2HLNA 1SVLA 1ULUA 2Y6UA 3L8GA 5EWJA 2Z95A 3ZPXA 2UUOA 4MB2A 1PWEA 2ZRJA 2V6JA 5BR8B 1P74A 3CRW1 2VJCA 4GSKA 3ZDEA 4MQBA 3RYHB 2J4DA 3EOBI 1RYEA 1YJ5A 1C1YA 2QRHA 3R3UA 5MHTA 2WRZA 2YY7A 3HBFA 5IAEA 4ZYTA 1AO0A 5CJJA 2E85A 1MG0A 1DWQA 1F1JA 1W6UA 4MS3A 5CVUA 1QYWA 2PLRA 3QWBA 3OIUA 1K97A 2Q4OA 4PNPA 1SAYA 2GEVA 2I6TA 4YAJA 4BBZA 1US8A 5KQGA 4YLGA 2I91A 1DSSG 1RCFA 2YYSA 3EDYA 4FDUA 4FILA 3TZBA 4PZ9A 4YXWA 3LP6A 4OQ4A 4AZVA 1B41A 1CDOA 4OI1A 1J25A 2BHLA 3HB5X 3GIDA 4LZJA 4E14A 5C8YF 1K5DA 4BC0A 2QT0A 2NTNA 2KE5A 3PS9A 2HHJA 1V8PA 1ZW1A 3NCTA 4RZQA 4TS1A 3GT3A 3UGKA 3VHRA 3N86A 5TVGA 1ZD9A 4KN9S 3A4TA 1KYQA 1C2YA 2VYNA 1B7GO 3LCCA 2Y9MB 3U4CA 1CY1A 4BY9E 2Y66A 4JYAB 2RHHA 2VT2A 1JXOA 5JNWA 1NUPA 1CDEA 3B82A 1LKZA 3ONDA 2QX8A 5GJVC 2O3TA 1EUQA 1TJ3A 3ONNA 4MPJA 1NVGA 2WTNA 3TIIA 3UWDA 2OFWA 3ANLA 4IKPA 4WW0A 3ZEIA 2F55A 4RGQA 1H4QA 1EM8A 2ATXA 1NSTA 2I2WA 1UFRA 4HWSA 4LOAA 4TZ6A 3I6MA 1HE5A 4E5PA 3ICEA 4NG4A 2GETA 1W49A 3D9QX 3RVRA 1XZBA 1VSBA 2CHGA 3KZVA 4MGHA 2ZSKA 3E3AA 5EIWA 5DNUA 3R0QA 4B4OA 4Q6BA 3F9IA 4Y2GA 2FOIA 5B30A 1MDFA 3FPHA 2B8EA 2QBYB 3F4KA 3UHFA 2IBMA 3CGWA 5I7AA 1ZICA 4C6RA 3GCDA 1UIMA 3OF5A 4RGBA 4W7IA 1UL1X 1YQWA 4RO0A 2ZCJA 1N2CE 4WLFA 1T8RA 4J91A 1SUEA 1Z2CA 4AF8A