2OYSA

Crystal structure of sp1951 protein from streptococcus pneumoniae in complex with fmn, northeast structural genomics target spr27
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
230
structure length
230
Chain Sequence
NKIFIYAGVRNHNSKTLEYTKRLSSIISSRNNVDISFRTPFNSELEISNSDSEELFKKGIDRQSNADDGGVIKKELLESDIIIISSPVYLQNVSVDTKNFIERIGGWSHLFRLAGKFVVTLDVAESNGSDNVSEYLRDIFSYMGGQILHQVSITNSLKDIAEAQLMEATYKIEDVLEGKIKYKTTDYQERAYQTLKLILENYDSEHFEKMYWEKKRLFEANSLEEWYYVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein SP1951
total genus 90
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oysA00
2Z9DA 4YAWA 2FZ5A 3NHYA 2QX4A 5FA6A 4XDGA 2HNAA 1QHEA 1WSWA 2QX8A 2V9CA 2Z98A 2ZKIA 1AG9A 2FZVA 3HLYA 3OWHA 3FW1A 3OX2A 4HEQA 1D04A 1FVXA 4LTNA 4XDHA 4C76A 3N3AC 1NNI1 1OBOA 2GSWA 3GAMA 1TLLA 2XODA 4H6PA 3HA2A 4GQIA 4CETA 4PTZA 3OX1A 3K1YA 3B6JA 4YQEA 3QE2A 3FVWA 2MT9A 3OX3A 3ZHOA 1BVYF 4FX2A 1DXQA 2BMVA 3B6KA 4M0CA 4Y7CA 3GFQA 2ARKA 1AKTA 3K20A 1B1CA 4HS4A 3R6WA 4PU0A 4R81A 2OYSA 4Y9UA 1X77A 3ESXA 1C7FA 3N3BC 3NHKA 4FGJA 4QOIA 3NHSA 4U7HA 5LLDA 1AMOA 2B3DA 1VMEA 1RCFA 4C0XA 4D02A 5LMCA 4N82A 3KAQA 3B6MA 1WSBA 4GI5A 4QOHA 2QWXA 1XYVA 5LBUA 2W5UA 1AZLA 3OVMA 1J9EA 2V5UA 4FGKA 4YALA 1T5BA 1DX9A 3O2NA 1KBQA 3L9XA 2N1MA 3EDOA 3SVLA 3NHJA 4QOFA 1SG0A 2BN4A 4FGLA 4ESEA 3D7NA 1QRDA 3NLLA 2MWMA 5F51A 3W7AA 4DILA 4OXXA 1D03A 3TEMA 2F1OA 3KAPA 2X2OA 5ULLA 3F2VA 3RPEA 1E5DA 2QMYA 2WC1A 3OWXA 1JA1A 3NHPA 3FJOA 1CZOA 1J9GA 4YAUA 1AHNA 3W79A 4DY4A 1FLAA 1I1OA 1YDGA 2FX2A 1JA0A 4ZVKA 1KBOA 1QBGA 2MTBA 2QX9A 1FTGA 4PTYA 1V4BA 2Z9CA 3LCMA 1RLIA 4NLLA 1RTTA 4U7GA 4J8PA 5EAIA 2BF4A 4YAOA 4ZVMA 2V5VA 1T0IA 4QOEA 3KEGA 1XYYA 3P0RA 3NHUA 2A5LA 4C14A 3QFRA 5B3KA 4NULA 1SQSA 1FUEA 1ZWLA 5NLLA 1QR2A 3NHRA 2KLBA 2MOKA 4N9QA 4BMPB 1XT6A 3G5MA 4CF6A 3LT5A 3NHLA 2BZSA 3TE7A 3ESYA 1TIKA 1OBVA 1YCGA 3KLBA 1XI2A 1D4AA 4QODA 3U7IA 5LBTA 5B3LA 2FLVA 5LJLA 4F8YA 5FUQA 3NHWA 1FLDA 1FLVA 1J9ZA 2BPOA 2M6SA 2R97A 4Y9RA 3U7RA 2Z9BA 3ES9A 1YCHA 3NHFA 1AKRA 4LTMA 3ESZA 3OJWA 3UXEA 5LVAA 4GR9A 3NFRA 2FCRA 5F4BA 1ZX1A 1F4PA 2M6RA 3B6IA 3S2YA 3FNIA 1YCFA 4N65A 2OHJA 4S24A 1AKUA 5EA2A 2X2PA 1FLNA 1FX1A 3F6RA 1CZUA 3OJXA 2FAXA 1YRHA 3TZBA 3UXHA 1AKQA 1GG5A 3QFCA 1BU5A 4ICIA 2R96A 4QOJA 5JROA 5LJIA 1C7EA 2D5IA 3FX2A 2OHIA 4LTDA 1CZRA 2Q9UA 3O73A 3F6SA 1J8QA 4U7FA 1ZWKA 3F90A 1RLJA 2KQUA 2QR2A 4ZVNA 5BUCA 1H66A 5EMNA 1CZKA 4ZVLA 2XOEA 3HR4A 4H2DA 2FOXA 1H69A 1CZLA 2HNBA 3EYWA 1CZHA 6NULA 3N39C 1YKGA 4YAFA 3W77A 4LAFA 2FVXA 3GFRA 3GFSA 2QMZA 1OFVA 3JSXA 4C0WA 5A4KA 2HPVA 5F12A 1AKVA 1CZNA 1DXOA 2QX6A 2RG1A 2Q62A 5TGZA 5FX2A 4DIKA 3W78A 2AMJA 5NULA 3L9WA 2OHHA 1AKWA 2FDXA 4LA4A 4BMOB 1YOBA 4QOGA
chains in the Genus database with same CATH superfamily
4UNPA 5JOQA 3KTAA 1P5RA 4HNGA 1C9NA 3BS4A 5D5QA 1ESDA 1G3UA 1QS0A 3EDCA 4LC0A 4ARBA 1W5TA 1D04A 3GYBA 1ZM7A 3M4XA 2C9DA 2GF9A 3L8FA 5DOZA 3IALA 3W2FA 5LB2A 4DE5A 3HADA 3VQTA 1Y8AA 5LQSA 4H0NA 4HN4B 3VHQA 2ZZMA 3HYLA 3HN6A 3TJZA 1YZ3A 4RVNA 1NYRA 3FHLA 2NQTA 3C3BA 4IDPA 2A9VA 3IEVA 1DSSG 3O91A 4JLPA 1II9A 4WQMA 4G0QA 1D8AA 3MCWA 2NMVA 4FSHA 1P4HA 4ZU6X 1OXVA 1BE0A 1I36A 2GLXA 1P3Y1 2WF6A 3DE4X 4XJSA 3W6PA 1X1TA 3OH8A 2HA6A 2H51A 5C4GB 4Z2AA 2CL6X 4FI3C 2NQ2C 1ZH8A 3K4PA 4H3SA 1YOVB 3BSWA 1QVRA 4NP6A 1GRCA 1NOKA 4NOKA 3VU8A 5C35A 1VJGA 4K9LA 3SS7X 3QOXA 1QO9A 3WY9A 4DNOA 4IIJA 2YJTD 3BL6A 4HDKA 2QI9C 1LD3A 1U9YA 3PBKA 4R83A 3SX4A 4DLZA 4G8BA 1DC8A 2JFOA 4QGFA 2Z6AA 2OD9A 3M2PA 1K3FA 4ALMA 1B6TA 1VG9B 4JQCA 2AKEA 1Z13A 3R7NA 2OXCA 5H9WA 1PFGA 3COJA 4W7IA 5JI3E 1RJEA 2XR1A 5EGNA 5AW5A 4AG5A 4Y9TA 1AUPA 1SXJA 1GGNA 1Z74A 2NN3C 3A6KA 3IESA 3HU2A 4LNAA 2NVUB 3WBKA 2GPBA 3DKKA 3MAJA 1SKYB 3USZA 5I7OA 1ZHHA 5IN4A 1D6NA 2D62A 2XYVA 3LFTA 3ZPXA 3T61A 3U3OA 3EWNA 2RC5A 3UHAA 1D5WA 3GT7A 1E7WA 1NXQA 3ZOKA 4UMVA 4URUR 4JYPA 4BQNA 4D92A 4TRJA 3CPHA 1F1BA 1NVGA 1WZCA 2ATEA 4GP7A 3KR2A 3AILA 3A1TA 2UKDA 3VPBA 2OV2A 1E77A 3DLCA 3KSRA 4OU4A 2CFOA 2B98A 3HUFA 4PSKA 1I4TD 2DRIA 2WJ4A 4IIFA 2QPOA 3QW4B 2YFKA 2P2CA 1L4GA 4QRHA 3TEJA 5TRTA 4MW4A 1FUIA 3AO0B 3BYZA 5T67A 1XHEA 1OPRA 4YI3A 5H9VA 4HZUA 3F7NA 1T8RA 1Z9BA 2BBTA 4ZK2A 1MOQA 1VPEA 2UUPA 4P6VF 5JO9A 5C46F 2OWEA 3KB6A 5DTMA 2Y68A 4CQMA 2FSFA 3RASA 4DCMA 2V7GA 3C3EA 3ZYCA 3SC6A 3GBPA 3ZDCA 2IYZA 3TZBA 1XOIA 1BE8A 1RHJA 3WC4A 3BK1A 3AVQA 4MP6A 3UCXA 3NAMA 1SCBA 1JJIA 1VXOA 3D59A 1XO1A 1OI2A 3D4BA 4H4DA 2Q5CA 2HDNB 4CQNA 1COWD 3T7CA 1KSJA 2QVXX 1IVYA 1S8FA 1KI6A 4ZVOA 1ZG3A 1LQTA 2O0LA 4NBUA 4RO0A 2ZAIA 1JIQA 3PHBE 1B8PA 1NI3A 3M33A 4YAFA 4QUJA 1WNFA 5BT8A 3KZCA 1TECE 1W49A 4PC1A 5A4KA 1DWQA 3GLIB 2HQSA 2VHVA 3S44A 3ZHZA 1WMDA 3U48A 4UCWA 3U7QB 5CVDA 2OHHA 1MBZA 2IEDA 3WQSB 1WEKA 2WFAA 3HJNA 3T41A 5BW5A 4BXOB 1KEEA 5THQA 3LI2A 4PBRA 3CG0A 3ENZA 1IBSA 2ZRLA 1NXPA 4J94A 1GGJA 2HSJA 1KFKB 4BECA 4DL9A 3K5HA 4FYPA 2A0KA 1J24A 2GLUA 1OU4A 2IP2A 2BF7A 3P20A 4IO1A 4M53A 3V4OA 1DC4A 4MDYA 3VYTB 4JI3B 1PP4A 1BFUA 4E4YA 4IMJB 3OEWA 4PNEA 1IM8A 2CF5A 1DEHA 4LK2A 4NJMA 1KZGB 4B7AA 1VJCA 5HM6A 2W6JA 2ZRMA 3GLSA 4Q1DA 221PA 4KIJA 3UHOA 4L8YA 4UBJA 1RRCA 5ALJA 3I6MA 1C7IA 3FDZB 3WNZA 4WY2A 1KYQA 2RGNA 3HGQA 2RMKA 1AMOA 3K70D 5CTAA 1WOMA 5JUWA 4E12A 1OKKD 3I3OA 3LRTA 1F6WA 1UT6A 3R20A 3L6CA 4X54A 1E6CA 1U80A 3PCXA 4FINA 3LDAA 2M98A 1AUQA 1N25A 1RRMA 2DPGA 2VFAA 4PFKA 1XZIA 2A4KA 3O2NA 3NCHA 2XECA 5LR6A 5J2TB 2VSOA 2ZEJA 2H7YA 3H11B 3SC2B 1SVNA 4G65A 4HGOA 4Z5XA 1KFJB 1IXSB 2MWMA 1C1YA 3VSEA 5JJ5A 1E0JA 3D2BA 1U8UA 1Y8QA 3HWSA 1TCUA 2VYQA 4MYRA 3G79A 3K9GA 2IHVA 4GRIA 1G2QA 3HN2A 3OTIA 4MZDA 1U9IC 3HDVA 2BEWB 4YAIA 4W1RA 4LSWA 4JENA 4Z86A 3RAJA 5JNVA 4BFTA 2KM1A 4M8KA 4U5XA 4DMKA 3QE3A 4MS4B 3KHUA 4CR8A 2VR1A 3DHYA 4I9NA 4KWHA 1PKXA 5K20A 3PD0A 1UFVA 4GLLA 1G7TA 1QLWA 1SIOA 3UAYA 1MB0A 1PYOA 4DCNA 1DEOA 1E8MA 2WINI 3GRRA 1IBLB 3AY0A 2FEAA 5K4GA 5FHQA 1NZDA 1F8GA 1U3FA 1XAHA 2GAOA 3VPFA 4CCYB 5AM2A 5I8WA 2KMLA 4URVR 4R01A 3KQKA 5U4XA 3WMFA 1G41A 1QUEA 1SIWA 4CLOA 3P0IA 5E9QA 1MOSA 4WTOA 1L5KA 2B82A 2BL4A 3J81A 1ZSNA 5IZ4A 1ZJYA 4M1QA 1XWFA 1ZQ1A 3LX6A 4HKTA 5JAIA 3GWGA 3WLSA 1W6RA 2CXQA 4HNQA 4PS1A 2RHDA 4KVAA 3ZD7A 4PLYA 5D86A 2O0KA 4BYGA 3MCZA 5DIFA 2XZLA 1QG6A 3A1DA 2GKSA 2OO7A 4RAOA 3ZI0A 4JLJA 3I2FA 3ZNPA 3D7RA 4CMEA 3N2IA 2DY1A 3W1VA 4D3XA 4IVQA 1U98A 2YJNA 3JU3A 4KXUA 2PJDA 3GPLA 2IIBA 3PUYA 1RKVA 2NM0A 3UB4A 1J39A 3TUJC 5JDCC 3NC1C 5EIWA 4AIRA 4EHKA 1RW4A 3UB2A 2JIZA 5KTTA 1IIRA 3ZW9A 5DJ5A 1MJFA 3ZDAA 5BYKA 3OM0A 4UHBA 2WOOA 2UYCA 4MEJA 2X9NA 4BNTA 4RCZA 2YY7A 4HK4A 3HTXA 2BGKA 4E32A 1XZBA 5IKEA 1NN5A 3WLFA 2J5QA 2QZJA 4ESHA 1XC7A 4IEEA 3VZBA 2AT1A 1DS6A 4OMDA 3I83A 1BHO1 4B3BA 4CHTA 1W73A 1Q1AA 3RYIB 1A2KC 1B15A 2D06A 1M7HA 2GSWA 2TS1A 1S8AA 2VZ8A 2G0TA 2ID4A 2CFRA 3KV3O 1NKTA 4H1VA 2G5PA 4I8XA 4IVRA 4N18A 5DHRA 2OXIA 3CHYA 3PC8A 1H2RS 4MUXA 2DP4E 3U3RA 2HGZA 3WXMA 5KYUB 4PNZA 2JLUA 1CS0A 2IOHA 2WYOA 3PRKE 4XVHA 4ENQA 3U4QA 4I7EA 3IO3A 2ENWA 1WQ4A 1QONA 3WB0A 5F9FA 1ECPA 2AOTA 2BFCA 5KQRA 5IFKA 3HNRA 3H5VA 4JOCA 1OASA 3T7KA 3SQNA 1ILEA 3V8EA 1QTQA 3RS5A 1YZGA 1IHPA 4WINA 1E1CA 2JKZA 4HRXA 4A4DA 1E3MA 2O8FB 5IEJA 1DTEA 2CDRA 4XFJA 4CIVA 1UH5A 3LO5A 2A7QA 2R60A 3M1AA 2G1JA 5JQGA 3ANXA 1Q1QA 2WJ6A 3N0WA 3ZWDA 2GASA 2QW0X 1KKLA 2FRXA 5FTLA 4XAQA 5JDIC 3KALA 4QPNA 4KR2A 4QATA 1H1LA 3RJ5A 3DQQA 2YFQA 3P4YA 1YUMA 1K6MA 3K0CA 4M8SA 4HTFA 1YE5A 2OLJA 3MJFA 3QVJA 4PSVA 4UE2A 3TI9A 4AO8A 5KTYA 3R3WA 4YY3B 4PNPA 3DNPA 1KYIA 4YRPA 1VSUA 5IAAA 2O8BA 3LDFA 2AFHB 3LQKA 3WHIA 4LHZA 1JQ3A 3IBGA 4CM8A 3A6JA 3ITNA 2ZM5A 1JJBA 3RV4A 5GTDA 1ZH2A 2XUHA 2ADMA 2GM9A 5L51A 1C3EA 3BXXA 4ZALA 1VDZA 2WMYA 3GT3A 2FFRA 2RHTA 1E1DA 1SOAA 3MWFA 3QI2A 2PKWA 2XKBA 4AS2A 4NOJA 1R18A 2SICE 2CYCA 3NS7A 2YCLA 3PXDA 2FQWA 4D0GA 4DT1A 1TIBA 1HDCA 2AI2A 3DVLA 1ZNYA 3RIHA 1NR7A 1UBFA 4RHYA 1PD0A 3WA7A 3SYKA 2GA8A 1QG2A 4C5CA 4B31A 2X42A 4GR9A 3N2KB 1CE8B 4KE8A 3OKPA 1PR6A 2Q1XA 1EVLA 2JIQA 3KT3A 3R3YA 3OTQA 3MOSA 1Y81A 1ZO8A 2ZWMA 1LV7A 3NTOA 2QBYA 2X5KO 1XZFA 3M6AA 4X97A 2F8LA 3G9QA 4J0KA 3REOA 4L4SA 1NI4B 3TR0A 2ZCUA 3MAGA 1BRMA 3GRCA 3IQGX 4LRQA 2DWPA 1J1ZA 1QV6A 2ZUWA 3EEBA 3ZQ4A 2CD9A 1E2LA 4HI0E 2Z6UA 1YQDA 3EYWA 1BEEA 3UY4A 3V1NA 1MJHA 5HZMA 3OKFA 4EVIA 4NR0A 2AMFA 4QULA 3SN6A 5FOUA 2QSUA 1XTRA 5BQOA 1XD2B 3L1JA 5KINB 4TSFD 1RR6A 1G4HA 3KHSA 4FMDB 1XCBA 2PKRA 5HUJA 4JN6B 1F4VA 3M8KA 5DNWA 1V1MB 1CR0A 3H4TA 2X4LA 1DEXA 3EZGA 4MK4A 4MULA 2X0KA 4FGUA 4AP5A 4F72A 4QFCA 3U31A 3BCUA 1CSEE 3OQBA 3MRXA 3U3KA 4TS4A 5CA0B 1R8XA 1P5JA 3E7FA 3SLRA 4D0SA 4BATA 2UZ3A 1W36B 3QVGA 1H05A 1BHJA 4GRDA 1CIVA 1XXHA 2QL5A 2Q3DA 4KQ2A 4FEEA 3RKUA 2NVUA 3SHTA 1ZLYA 3WSWA 2Y0BA 4BVLA 5TQ0B 2PGXA 2QUHA 4N0DA 4RE5A 1NDUA 5CH3A 1ZN8A 5ITSA 3D4NA 2GF2A 1GFWA 5AOVA 5EKXA 1J5EB 1ORVA 1E58A 3TBFA 3DD5A 4R1OA 2AFIA 1KKUA 3F96A 4Y9UA 3PFFA 3TW0A 1ZHOA 2VQ3A 4M1OA 1W2GA 3B6ZA 5ALSA 4D3DA 3NTLA 1HZJA 3WLHA 2BHSA 3VUEA 1DJLA 2R4UA 4YRRA 2OVBA 2XQGA 3LOUA 5TB5A 1E18A 3CISA 4XI9A 1UEXC 2ZP1A 3W3AA 1T36B 1XDGA 3UMGA 1SZCA 1S3FA 3AUKA 4CG3A 4EA8A 5KYXA 1OAKA 1TQ4A 1U4NA 2IYOA 4M38A 2HU5A 5AK4A 1BIFA 3EGCA 2IHKA 3DOHA 4MS3A 4HBZA 3FM9A 1PZFA 2HSEA 4DKJA 2PBZA 2ZB3A 4F7WA 5AW4A 1U0BB 4U8HA 3AB3A 4RVHA 1EIZA 4JKIA 4ON9A 1DTWA 2ZBFA 3K2QA 3S2UA 5DM60 1VJRA 3AHDA 3OQPA 5D5HA 3HJBA 1YRYE 4MMXB 1U1CA 1HEIA 3C97A 3NBZC 3R0QA 4PZDA 4RHEA 4FYVA 1QBGA 1NJ1A 4CN9A 4B3JA 4JA2A 1NNUA 3DZFA 1CDZA 3DHVA 1JLSA 1LBIA 1CTQA 4YP1A 1I01A 1ZJJA 2R8XA 3BRCA 3RQIA 3VBCA 1F3OA 5D51S 1B1AA 1BE6A 3M4ZA 4MWDA 4I9GA 4QFMA 4XWGA 4FT2A 3DBIA 5JMPA 3FOAA 3PJFA 2Q1UA 3TFQA 2P5YA 3WYCA 4U5QA 2W0SA 2W2KA 3CTMA 4MTLA 3P9KA 4HDNB 1E3QA 1YS9A 4LJRA 3AVYA 2CXTA 1D3AA 2AC2A 1U8TA 1ZX1A 1O5OA 4FHZA 5CLFA 2JKVA 1S2MA 4KREA 5KYYA 3I2IA 4M0DA 4XDYA 5JAHA 2I4TA 1R6VA 3DXYA 1MJNA 3H9EO 1JS1X 3BXOA 2UU9B 1W48A 2GUWA 3QNUA 2QE7A 1EGHA 1A5TA 4WHMA 3DFMA 2P67A 1B6GA 5JCXA 1I94B 2GN4A 3ZU2A 2WWGA 1NVFA 2XWSA 3CNLA 3DEFA 4GOLD 4W5OA 5BMVA 4PZYA 2CN1A 3PC7A 3JAWA 1KDPA 2BCEA 2Z95A 3CFYA 3MRTA 3FLMA 3NC4A 5AT1A 3V1KA 3B3QA 4JOQA 4F5EA 1DXOA 2PU7A 2FOIA 2DKOA 1N2XA 3IB3A 2J41A 4Z4HA 3LPNA 2QN3A 4CEIA 3E7XA 3N2KA 4LRSB 4OBEA 4GDFA 1UMBA 3F3MA 1UKYA 5LXTF 1KJ8A 4MGYR 4KXFB 1E2PA 1P1RA 1TF5A 5IMBA 3B2NA 4KE6A 5FFMA 3SQMA 1T3TA 3FW1A 3W7AA 5IRCD 2QN9A 5FBZA 1PBTA 4NFYA 5E2IA 4LVOA 2XNSA 1MQSA 4A91A 1N3LA 4O4HF 4X85A 4ZOBA 4DMCA 4D9JA 5DB4A 3L4SO 2EZ9A 5J2UB 5HRUA 2IVFA 1H2HA 4AC9A 1FUKA 3TVYA 2HC9A 1VA5A 2GM3A 4UVIA 3RBAA 3B6KA 2A0FA 2WNSA 3EIOA 3DCJA 3REGA 2QTMA 5K3AA 4A0FA 5A02A 1C7FA 3NUQA 4E2XA 5HRAA 4KR3A 5BV0A 2VNIA 4GKJB 1O97C 1OIXA 1WX1A 1K27A 1MO4A 1ZCAA 4IWYA 4QG7A 2ZSDA 1ZW1A 1KMQA 2Z2XA 3B9BA 4RH0A 4ERXA 4LF5B 2CLIB 2Z2YA 4U3JB 2MCFA 2FG6C 2B69A 1T5BA 3KJEA 4UJ5A 2L42A 1V8PA 2X23A 1G5PA 2H18A 2V97A 3R0JA 4H4EA 1XEXB 1MVLA 2OFOA 3OE7D 5B53A 1OH8A 3PA8A 2OSVA 5EEHA 4I2NA 4MKIA 3QKRA 2R7AA 3IEPA 3LOPA 3DDSA 3T54A 1CUAA 2J0UA 1V16B 2BUBA 2I6GA 4IJUA 5FOSA 5SZHB 1SKMA 1DBSA 2J9FB 3ZI4A 4FFSA 3EDYA 2QG6A 1WAMA 1ZISA 1N6LA 4RKWA 3T3PB 3SX2A 3UG7A 3CB2A 3ETEA 5FOWA 4CU2A 1RP1A 3H8VA 3CZAA 4WEOA 5I3ZA 1A04A 1NYQA 2X5JO 1Y3HA 2RH4A 1KJJA 1R74A 2X76A 1SH7A 3OCWA 2VPTA 3KYCB 1E61A 1H8HA 5EHNA 4H16A 3ISJA 2Y1EA 2O1WA 4WZAE 2XZTA 5FA5A 2R7NA 1UOOA 2FQ1A 3DZHA 3OFND 5JASA 3A6EA 5ALXA 2PMFA 5K0ZA 4GMXA 1XUOA 4K8RB 4PLHA 4LXIA 5CHEA 3PSAA 4MPPA 4RJJA 2IZ6A 2ZYUX 5DNAA 4HB3A 5FBHA 5DTJA 4RULA 4ZU1X 2FE1A 4K0RA 4TLBA 4QPJC 2DX7A 3L41A 4NBVA 1A50B 4JY7A 2J9GA 2FQXA 4IXWA 1JNXX 2PUBA 2AC7A 5ICGA 4QAQA 4D3YA 3A9UA 4LRUA 2NP6A 2CYAA 3THWB 8LDHA 3V9AA 3MLAA 3MS4A 3C5HA 4N5LA 3SJ7A 2C04A 3VR6A 4QTYA 3B8EA 3NUGA 2B6NA 1NQOA 1NQTA 4YJFB 1LQ2A 5DHUA 4ZCIA 3ZNOA 2J08A 3N8HA 4F1WA 1RI4A 1CS4C 2BE7A 3PENA 4Y2RA 3VI4B 3EUFA 3GX1A 4NONA 1XZMA 4QFBA 5DBOA 2P6OA 4MWEA 3ZWVA 5AIBA 4QEZA 2ERCA 3S1LA 3TW4A 1F1JA 3UPTA 2M1XA 2MIIA 3F3KA 5TJHA 1IN4A 3DA8A 2GB4A 3O8DA 4AJEA 1SXJC 3PPXA 5G4KA 5E6RB 2WV7A 3NOXA 2V6IA 1ENYA 1T8UA 1C9YA 2Y05A 4JLDA 4O4IB 1AQ6A 2Z98A 1TQ6A 1CUHA 4HEQA 4YRFA 5H5JA 3PJGA 4MQ5A 1MGOA 3BSFA 1T91A 4JYBA 1A96A 4PX2A 1Y34E 4LYEA 3EPKA 2Y93A 4RD0A 5KNCH 2MYNA 4MKRA 3OF2A 4U2CA 2WAOA 3PI7A 3VJLA 3AF1A 3G2NA 3SP1A 1WA5A 2JDID 1OBHA 2Q2NA 2XOKA 3QMPA 2UVDA 3QFSA 1F60A 5FNVA 5BSFA 3PF9A 1DX4A 1HDRA 1TVMA 2YJZA 1L9KA 2WWFA 3MTGA 5FBRB 4ZEXA 4NXMB 1F0NA 4MR7B 2EP5A 3V2HA 3B1YA 4B7CA 3SJUA 5BXYA 2LRHA 2ZE8A 3R0ZA 5EXSA 4JJ7A 5JPIA 3GT4A 3AY6A 1L5YA 2GZMA 3F8WA 2JI9A 1QIIA 2GT1A 4K81B 4PZEA 3TQIA 3W6ZA 4EYQA 3L6RA 1TUEA 1N5OX 4BRWA 1ZIOA 4BNMA 2LXNA 3L9XA 2O9JA 5IM5A 3VHRA 3NHJA 1O97D 2PUWA 3KWMA 5ICSA 3MC1A 3FZGA 4TTJA 1ODFA 3GRVA 3K71B 2CB0A 3RKSA 1FEZA 1OH5A 1XAJA 1XMJA 3H5LA 3WKCA 1FNBA 4N7RA 3UW1A 3DQZA 1SAYA 3FWKA 3QEJA 3ROQA 2ATIA 3GEPA 3N28A 5K3EA 2X8AA 4WBNA 4RDCA 1E79D 4UHJA 4EA6A 1ISGA 1EFVA 2NO4A 3ZIUA 1I5RA 3D9QX 1UMBB 1YL5A 1LBHA 1LK0A 1E6UA 2FSUA 1M34E 1NSFA 4QPCA 2C00A 4U7GA 4R8SA 2JAUA 1HDZA 4W7SA 3LGAA 4DNPA 1I6MA 2RH9B 3RUEA 2CNOA 3NFYA 5FLYA 1S0UA 3AIOA 3NAGA 4EPYA 2GAAA 5JRJA 3EUEA 1Y9AA 2IZ1A 2PMCA 5GOTA 3MCAA 4TV8A 1HNZB 1EG7A 2O8NA 1VPLA 2AK2A 3TD2A 3HYCA 1BA3A 4TYPA 3UMMA 2B37A 5A1TA 1EIWA 2O8FA 5CNKA 4FBGA 3W5VA 2DTDA 4RK5A 1JTVA 1ZBQA 2R8ZA 2X7XA 3AG6A 1C0KA 2J7PD 1L7NA 4MKXA 3ICPA 4QQ8A 2FPKA 2CCKA 3UN1A 3BFPA 1MIOB 3AJAA 2C5LA 3TOCA 2HH9A 1KYVA 3RYCB 3WRVA 1PI3A 4YWJA 3JRXA 2CJPA 1WW8A 3SE7A 3WWEA 1LF5A 2CV0A 1YSCA 5EZ6B 4DSZA 4MI1A 3S5JA 3E81A 1ZCFA 4DMHA 2CDCA 2QZ9A 2ZG6A 1JHAA 4ZCTA 1T4MA 4EW6A 2JGLA 3EGIA 3U4CA 2I7TA 5CAEA 3WO1A 3HMKA 4NATA 4DA4A 2UVPB 3IODA 2J5BA 1LTKA 4PE5B 3SEZA 4ZYYA 2XE6A 3Q4GA 3F74A 3P45A 5H70A 1KFCB 1NF3A 3UF0A 3WNBA 2BDUA 5KVSA 1TU4A 1Y7TA 4WN9A 3FDFA 3WI7A 3RIEA 3HL0A 3NV9A 1IYZA 2X41A 4WOKA 1Q5PA 1TQ2A 2C92A 3F46A 1JFFA 1B8VA 3UJPA 1DL5A 2B83A 4FNGA 3VH3A 3B9PA 1PDOA 3PDWA 4HQFA 2B36A 2Z04A 1AMNA 2HNAA 3IKVA 2YMQA 1Q7GA 3PC2A 3ZH2A 3WGMA 4ECEA 3CRVA 1NBMA 1KI3A 1V8DA 1V0JA 1YU6A 2XB6A 4G1UC 1NW5A 3GLHB 2BFMA 4M8IA 5F2OA 3ZOZA 4IILA 1Y9DA 1SM4A 2MSWA 4JB3A 4Z9XA 5LZ9A 3IQEA 1AM4D 2BSAA 4RA9B 3PDIA 2WZQA 3OPYB 2BBWA 2MT9A 4EA7A 5CB6A 2IP1A 4QLBA 3BGOS 1PG0A 1W87A 1CUXA 3KVYA 4FFOA 3ZVKA 3HYRA 2PH7A 4JUFA 4HNTA 1ULSA 4LUCA 2IHBA 4EB3A 1E9CA 1V43A 1WOYA 2PRYA 1QZ3A 3O3OB 4FS3A 1Z4JA 4J0QA 4Q9NA 4BDTA 1VXRA 2AYYA 5IVIA 3IT3A 2B20A 4AN1A 4D9HA 3T5GA 3P7MA 2H0AA 2H8GA 2NT3A 1MMFB 1US8B 4A16A 1BXGB 2Z0MA 5KQMA 4Q19A 1TVKA 1NUAA 3BVPA 3AONB 2PVCA 5T57A 4TLMB 3K6SB 4BNXA 4CFZA 3ZUPA 3I5XA 4CG2A 3B82A 1TZMA 3LD9A 3V4VB 2YOFA 1MA3A 1JT9A 1N5JA 3C6BA 2NU8B 4POOA 4U7JA 4A6PA 4LOLA 1E4EB 2E87A 4LDQA 3DDWA 1NLMA 4ACAA 4IZHA 1B4DA 3CO5A 2OFFA 3RYIA 4RGVA 1TT7A 4BLWA 5HUHA 4DSNA 1Q6YA 2J48A 3OD5A 3KB1A 2HEGA 1GGMA 4M4SA 2PRKA 3B52X 4YJ3A 3H4VA 1X92A 1IE3A 1LY1A 3GGCA 1H4TA 3LK7A 1UJ6A 4JEIA 5CM8B 3WYBA 3BH6A 4MV8A 1SJ9A 1L5OA 3U37A 1LSSA 5IVDA 1X94A 4XYBA 1TTPB 4DDWA 3BORA 1I2DA 5D5PA 1IHUA 3E03A 4XOIA 2O8DB 4PQFA 2AQIA 3LHDA 5H3CA 2MSCB 4EW1A 2NNWB 1F8YA 5KTSA 1OGJA 3T9EA 2BPOA 4CM1A 2Q27A 5LUAA 1XZNA 1LZKA 2H54A 3ZUGA 2JHGA 3U7RA 3ZJ4A 7REQA 2OTCA 3MRSA 3VPSA 4X41A 5ADUS 3KXDA 4M37A 4OFXA 1JTEA 4XCQA 4YT4A 2VDVE 3NI2A 4N5IX 3T12A 4Q1CA 3CX7A 3DO6A 1JHZA 4KE7A 1Z56C 4PWYA 3JARB 3SSNA 3UXHA 5JAUA 5HG0A 3W3ZB 1XJWA 3SS8A 2UUBB 1JP7A 1R8SA 1ZCJA 3NTRA 1AXGA 1CDDA 2IHTA 1YL7A 3QEOA 3FYCA 4MLDA 3MT7A 3IE1A 3PUXA 1YHNA 1RLJA 4MVJF 3WJAA 2GBFA 2VDNB 4OQXA 1QHYA 4I5FA 3F6CA 4MV4A 3RS7A 3VYUB 1WUYA 2JLBA 2WMOB 4GIBA 3JVUA 4P7FA 1DUIA 4RCVA 4CTMA 1E1MA 1A2BA 1VLLA 3KLMX 3ZW8A 4YRGA 4C07A 4LJSA 1U63A 3FIJA 2G8LA 4KAFA 4OLAA 5HKKD 2JHPA 1JHOA 4YXWA 5HJ5A 3VO8A 1YBHA 4QGGA 3ZWCA 4GT1A 1O8BA 4ZT5A 4HLDA 3WYEA 1CVRA 5CVVA 1N4DA 2FZVA 3CZPA 1Y7PA 3TLEA 4I1VA 2PBRA 4J0FA 2BGUA 3U6KA 2JCYA 3N2YA 3GAMA 1N32B 2GBLC 1G21E 2ZTHA 3VR3A 3FMPB 3JS5A 5KX5A 4MKHA 1DHTA 4JHXA 5M7EA 4QNNA 4G67A 1QFYA 2GXSA 2Z5LA 3FRJA 4YQEA 5AESA 1U7XA 5C8YA 5HIMA 4EFKA 2NTNA 3WK7A 3EVBA 1OFUA 3ORHA 1CV2A 3EFEA 3INYA 3PDUA 4MV9A 1XXHB 1YAHA 5ED0A 2IZOA 4LHVA 5AKEA 1ONBA 2DFLA 4PANA 4N7JA 4JUBA 2HHAA 4JV5B 3ACDA 2BKLA 4G2TA 4TRRA 3BFJA 3T7EA 1UPBA 3BUSA 4O4JA 1RXVA 2BWJA 3O1HB 5K05A 3RM3A 1QH9A 1XP8A 3WB2A 3SHOA 5C8YF 1Q22A 1J7JA 2WKQA 2Y67A 2IYLD 3ND5A 4RFSA 3K9FC 3LCVB 4RPLA 5FKJA 5HA5A 4C2TA 4IQ8A 3ICQB 4CE6A 4Y0NA 1GAEO 3KQPA 1U02A 3PGLA 5SZJA 4MSUA 3BMCA 4YHHB 4RLFA 3A0UA 3EHDA 2OZEA 1WMFA 3NHPA 4QPZA 4RA6B 3W8EA 1BMTA 5HQ3B 3DW1X 2ZJAA 2FSHA 3SIRA 1VGVA 3IC5A 3L5KA 5ALMA 5DO9A 5EMHA 3RANA 3MELA 4CZ2A 1ZNWA 1AS2A 5EUBA 1T13A 3L1UA 4ZGBA 3R4VA 4H60A 2DU8A 3QVVA 4WKBA 2FETA 3R0VA 2V8BA 4JJ6A 1UK8A 5I7HA 4HVCA 2ZCJA 3B6EA 2GBLA 3MIIA 5CPBA 2L0XA 3MMZA 3GLIE 3LWDA 4MVWA 3C98A 1LRKA 1MW9X 2PFGA 3F7MA 1G3RA 2H6EA 4OKSA 2HCBA 4R8RA 1X0XA 1Q0SA 3H1AA 3ANTA 2H9AA 3I3SR 4G84A 2H2GA 1E1YA 3F9RA 3MINB 3E18A 4UFOA 3GDHA 1RRFA 2JKYA 4M49A 5KVQA 1VKNA 1P4AA 4F6RB 2ZB2A 5BVGB 1WZ2A 3MOGA 1MQ8B 2QX7A 2R62A 1TE2A 3BJEA 1EGVB 3FSRA 1Z8NA 2PYDA 3M3HA 3RRFA 3AOEC 3SJZA 3UMJA 3X0DA 8OHMA 5JD6A 2FUEA 3BICA 3SZLA 3T38A 2O2YA 3PNMA 1T1JA 1WRBA 1CQPA 1G2IA 2H00A 2AQ8A 3OCUA 4S35A 1SO8A 2IPXA 2WLSA 2YICA 1OAAA 3FFXA 5TMDA 1NPDA 4RMGA 3M7IA 1NVDA 1WHSA 3EGWA 3T35A 3VNQA 2Q3CA 4J6FA 1SN7A 1B42A 3FOFC 1AKYA 3T3OA 3E5RA 5CURA 4E1VA 5BUCA 4EKNB 4YIHA 1WDKA 3LQYA 2FZGA 1Y37A 5HIKA 5LMNB 2ID9A 2YXEA 1I5OA 3EW7A 3F5FA 1YHZA 4FI3F 4HX2A 3U60B 4YJ2A 4HDMB 4HSGA 1ICIA 2J09A 3BWYA 3DOIA 3L1VA 3L84A 4JLVA 2JAOA 4MMZB 4AF7A 5JO0A 4Z1OA 3EC2A 4NH0A 1V6SA 3NDIA 5EUCA 1QQ6A 1NRWA 2QI9F 1AVTA 3AFOA 4PNHA 4UDOA 3FMVA 3OIFA 4BMOB 3U4MA 4X93A 4Z0TA 4U2FA 3CCCA 2F8SA 1S4MA 2EX0A 2HLNA 2RK3A 4JT9A 2W2VA 3UK0A 3QUAA 4HAUA 2FNAA 4BFLA 1FQOA 3RHSA 2PZJA 3I2GA 1SK9A 3IE2A 3R7WA 1JG7A 1P18A 1YS1X 2YY6A 2G04A 4D0LB 1CEYA 3TL3A 1ZNQO 4BO4A 1OWNA 2FPUA 2P6UA 1WD7A 4KV9A 3GEDA 4OQNA 4PQGA 2XMSA 3M6WA 4QXPA 2VRWA 4L4XA 1LLQA 1P2BA 3IEMA 4NXNB 5E38A 1K5DA 5AXAA 1PS0A 1P91A 1DWPA 2D1QA 2C0QA 2HADA 2Z2ZA 1EFDN 4LXTA 1GP2A 3LYAA 4RK4A 4EUNA 3V4RA 1N2JA 1VPVA 1ZK4A 2BJHA 4K9MA 1W1UA 3D8SA 4CR6A 3QLVA 1SMKA 4J3JA 3OF5A 2VL7A 3WIUA 1Z28A 4Y2YA 3JZFA 1DPFA 2RARA 4JL5A 4N54A 2IU0A 2IUTA 3ZZNA 5TDHA 1C5KA 5H16A 2X9QA 3VV2A 3ZHVA 1BQ4A 3TW8B 2GPTA 2YMMA 4MKGA 1V7ZA 4REQB 4V03A 1MQAA 3P2KA 2FFJA 1JQBA 5EERA 4YRDA 4JI7B 2V5AA 4TQGA 4OQPA 1GPYA 2B9EA 3NTXA 4I99A 2RIPA 4DJTA 2VYND 1J97A 4RWEA 5CXSA 2ZULA 2H11A 2PGNA 2C7OA 1NULA 1KBQA 3SFZA 5JDIA 1E3IA 2Y76A 4HLUC 5F1OA 2WDZA 4AJ4A 2I3DA 4CM4A 2WU0A 2C8VA 1E60A 1P62B 3PWSA 5KUTA 2PUAA 3KWLA 3EQZA 4MIYA 5H7XA 1KHHA 1KZ7B 1IEVA 2QMYA 1CJMA 1MAWA 5TXGA 4B3DA 3FHOA 1XEXA 5DLQC 1P31A 3RVKA 4ZI7A 2C7QA 4NCKA 5J2TF 4LS3A 2ZUUA 2XA1A 4I9FA 4J76A 2XVXA 2IW3A 3ELDA 3OZGA 3HBNA 1C81A 5LOVA 3LXUX 3O03A 1QYIA 4E2FA 4J8PA 4BNHA 1PGOA 5AVKA 4WUVA 3NVMB 4W1PA 1N6NA 2NV6A 2YV2A 3AGPA 3N8KA 3OLQA 2BLNA 1NZFA 3ED1A 4PPFA 4PLZA 3IEKA 1KMHB 2ZATA 4MAMA 3NOQA 4EBBA 1ZD3A 1ZSVA 5HFJA 4M1MA 3DOOA 4JLWA 2XVMA 3A70A 3AEUA 1KETA 5B12A 4TLAA 4RSGA 3O8OB 2OMEA 4GX2A 4UE3S 5JSQA 2ZYHA 4DREA 4JLKA 1EZ1A 2AN9A 1E3JA 1T5OA 2BC9A 3ZXUB 1LWNA 2QROA 1IBMB 2PU5A 3AUAA 4YRQA 3THYA 2F9LA 1NDHA 1FFCA 2FLWA 1HSOA 1AKQA 3BXPA 2A94A 4OTZA 5DBIA 1XZJA 2WJPA 3C5CA 1L1FA 3A04A 4J7AA 4M46A 4MRMB 1UJ2A 3DE5X 1OV6A 3THXA 3K8QA 3DT9A 2GJKA 4HNAB 1UWKA 2OK7A 2WY2D 5TJ9A 2EJBA 3OZAA 4YDHB 4OQYA 3RF7A 2PSJA 3N58A 5DT2A 3W2EA 1Z2PX 4OJMX 5FUWA 3WB9A 3QBVA 1Y8QB 3MHPA 4BGVA 4QYWA 3HRKA 4K9RA 4Y0AA 3JV7A 2RG7A 4ZIRB 2HFJA 4BP8A 1Z39A 4K86A 1LS6A 4P33A 1FDSA 1ISPA 2PS3A 3ZZUA 5T3UA 1Z6ZA 5LDHA 1QG4A 2NXCA 3RUAA 2XD4A 3OJEA 3OEHA 1RRGA 1N6PA 1A4RA 3LXXA 3WGVA 5K9ZA 3U09A 4Q02A 5FPKA 1XMQB 1DKNA 2K4MA 2J7KA 3A2MA 4L4YA 2ZKIA 4TKZA 3F4LA 3D3WA 1T43A 2CVQA 3NETA 4A0GA 1V95A 2VJDA 3OCJA 4KGXA 4ZQIA 2Y77A 5BV1A 5JRDS 4BQPA 3QX3A 2O7RA 2YYSA 1HZZC 1SKBA 1NMXA 1VHTA 4Z4QA 2AE1A 4QU0A 3KUCA 4NL4H 4ZU3A 3Q7PA 5BOVA 3ZY5A 1N8SA 4LNUA 1UR5A 3KXLA 1JXAA 1ULAA 3UB3A 1ISRA 1R5JA 3BWBA 3MJDA 5FTJA 4TTTS 4HNRA 2CHEA 2FVYA 3PR2B 1N8TA 3RS0A 2OFPA 4YJ2B 5AIAA 5LQAA 1MDFA 4I50A 1OLSA 1FZTA 1P81A 1W52X 1NURA 3LC2O 4H6XA 3C3KA 4XWYA 2XD9A 3N2NA 4DLTA 4DUPA 3TQSA 3CQ9A 3V1YA 1YS7A 3CRZA 5ERYA 2A0UA 4DPMA 1HTWA 1NFRA 1WUJS 5CDGA 3GA7A 3D7SA 5ES3A 2F4NA 3RSFA 3QX9A 1II0A 3H6HA 1V5WA 2I7XA 3I9LA 4KIGA 2R751 1EWVA 2D6FA 1QHHB 1Y6RA 2H63A 2RI1A 1FFWA 3OU7A 4JQSA 2Q0QA 5CLJA 5K03A 3PNBA 1DV1A 1SQ0A 1TEHA 4IXDA 1XN4A 4UUBA 5DBHX 4FR2A 2ZS7A 1E7QA 1NQWA 2P69A 5KYVA 5KNBA 3T5MA 1P0FA 1LPOA 3ORFA 5LQKA 3M3DA 3X1JA 13PKA 4HO1X 1WPQA 2G4LA 3RFVA 1FXWA 5IUJC 3MTQA 1MKYA 2HQBA 2R6CA 3QF4A 1THZA 4M1ZA 4UBOA 3Q7EA 4CV2A 2BFFB 3COSA 1XWIA 1WXQA 1QYRA 5J5VA 1QDEA 1BX3A 4WKGA 4BAUA 4FLFA 4QSMA 3BAFA 4AMYA 4FZ3A 3S6JA 4CU5A 5BPHA 4I4NA 1D2AA 5HKKA 1HRKA 1HYBA 2EBWA 1JSRA 3IOCA 5ADHA 1QPGA 4HG2A 1GCGA 3WNCA 4O2BA 1TJ4A 4RQAA 3KQSA 3AK4A 2KI5A 4Q1EA 4CN8A 2G5TA 4LXYA 5ALRA 3BTOA 1E20A 4C7JA 5DN6D 2ACEA 5P21A 2OBFA 3DNFA 3D6TB 3DDOA 1BMDA 1G9XA 2QTNA 3KKEA 1TF7A 4FS8A 5DHFA 1R9GA 5MN5A 2X1MA 1WMSA 3KELA 4I66A 5MGNA 1FYXA 1D4ZA 3VH4A 3R8CA 3TN7A 2A9RA 2AJCA 4C4TA 3C7DB 3LBAA 2PUCA 2F59A 1EX9A 1M8FA 3LBYA 4HUQB 4UOQA 4R68A 2W70A 4ZZ1A 3EDMA 1HTTA 4ZO7A 4HDNA 5FPHA 4QBKA 3L02A 2EZUA 3WK5A 3C5EA 1E3TA 1U8CB 2ORYA 1Z0KA 4HH4A 4QVGA 1TM3E 1VGRA 3LY8A 1G21A 1UDBA 2D4AA 3NHAA 4C3VA 4US2R 3IDOA 1CZKA 4IIXA 2B5VA 1E4YA 3S2ZA 1HDGO 4OM7A 1T3SA 1T4DA 4WKOA 4CLRA 1Q0ZA 3DOUA 4Q3EA 4FYKA 4O4LF 2D00A 1GGHA 1DWUA 4R3NA 1GSHA 4BKPA 4DA7A 3H5OA 2OR3A 2DECA 3HY6A 4PG7A 3T99A 1PGPA 4PVDA 3WGYA 3E53A 5JZBA 1BU8A 4YAWA 4H77A 2VHYA 2VHEA 3WGJA 1HE2A 2FUKA 4Q4AB 1UZUA 2I2XB 2QX8A 4ZXPA 5BUQA 2FJUA 4LG1A 1LVHA 2VA9A 4AQDA 3X1ZA 4H7DA 2W2QA 3WG9A 3VNUA 3ORSA 2DCUA 2LCFA 1XRJA 3KYDA 4QU9A 4FE4A 3ZQKA 5JFOA 2L17A 2RE8A 3JQ9A 3I1YA 1W2WB 3BQNB 3Q72A 4R2HA 4ZZ3A 1OYVA 3A4TA 3VU3A 1S96A 4R1QA 2XQVA 4XX0A 3X1DA 4LRYA 4RCYA 2J0EA 3AH8A 4JIMA 4DARA 2J87A 4CRWB 2PZGA 4FSXA 1Z7WA 3A14A 3B1WA 3UMCA 5DLDA 4XD7A 3S99A 3D1LA 3ZY4A 1NF8A 4LJYA 3C3XA 4Y18A 2AG1A 4ASUA 3ILXA 2X1VA 3Q8KA 2BT4A 2FZEA 1I4DD 1X9IA 3DEIA 3FKQA 3MFYA 4X1YA 3GCGA 4IXMA 3GNTA 3T95A 2B4RO 3UMYA 1G3MA 4XWWA 3O8LA 2LD4A 3VH2A 1R6UA 1FVOA 3LF1A 3UWOA 1WVMA 3RHFA 2OWDA 2JL1A 1JSLA 3EOBI 1XA3A 1YASA 4OYYA 5KI6A 2QE7D 3NIWA 4FT4A 1KYXA 2AV6A 3IOYA 3UJNA 1R0WA 2X6QA 2P9YA 3N7UA 4MVJD 4DMUB 5CYGA 4TLLB 5EJ6A 4ZYZA 3AHIA 3V7UA 5J2UF 1FPQA 5LYJB 1PJBA 1NUUA 3F2VA 1EX6A 2PMBA 4LXUA 4OLFA 4TMXA 2VH5R 3ONVA 1QF7A 2Z43A 4PGHA 5EIHA 1HFJA 1TQHA 2FP4B 2SCUA 1PZHA 2VWPA 2JEZA 5BP7A 4BVHA 1VZ2A 2VQEB 4E7PA 4BJ1A 2Z1DA 1KBOA 4JOBA 1E2JA 4BU0A 3WFJA 1LBEA 2PKEA 2H2DA 4KIWA 3T1YB 2QAIA 3A27A 4LMBA 1XV5A 3GRAA 2V6JA 1KF0A 1ZWLA 2VJQA 4MRRA 1ZD4A 3B8HA 1H8ED 1HFEL 2WJJA 2UYOA 3O84A 4RKFA 5CFZA 2DETA 1VI6A 3G5MA 4K2AA 2VLBA 4JMPA 1LRLA 4JELA 4G23A 4ZAVA 3U7IA 1UC8A 2X6TA 4ROSA 4TMWA 3RSZA 2YR0A 1WKVA 3H5RA 2ZAMA 4JC0A 4OGFA 5EY5B 2DBRA 3BMXA 5EYPB 1TTHA 5AKKA 1Q0HA 1RM5A 3KJIA 1OAOA 4I50B 3UAWA 1OLSB 5DCWA 4RK1A 2J6IA 2ZUBA 3H0KA 3HKBB 4WBSA 4EK9A 1XZKA 4MRMA 1KMMA 1M0SA 1WV0A 3P0JA 3Q5DA 2DJIA 2YVAA 3C7TA 2EG9A 1WG8A 1WUTA 1X74A 2GKOA 3GFGA 4H0CA 5LLDA 1B23P 2GEUA 4TL6A 4EUKA 4Q1FA 4BC1A 2EKLA 2PLWA 1B2LA 1KR2A 2K7FA 2Z58A 2HLDA 4RPHA 1B3RA 4D8UA 5IG2A 1X1AA 2PWYA 1A72A 1ZW6A 2YYAA 1BAPA 1SXIA 2F48A 2X8WA 5DGTA 5CBPB 1ZIYA 1FFHA 1JAIA 1CW2B 1QMGA 1RWOA 1E2HA 1OX4A 1PR2A 2FMIA 4GM0A 1N2HA 4Y30A 5G53C 2ZB8A 3BZBA 1T9GR 4LJ8A 3PA6A 3ECAA 4A0RA 2L19A 3HPRA 1J07A 4L7VA 1QE0A 4B6OA 3A1SA 1L5LA 3WNVA 2V54A 2ECOA 4BFSA 5L4NA 1KPIA 4I4TA 1L5MA 1BH6A 1YQXA 4LSMA 5AK6A 2ORWA 1MRSA 2JLYA 1C7QA 1GLVA 4JYZA 5AI5A 4OI4A 4YDRA 2FV8A 4TMKA 3WLPA 3I04A 3ZE8A 1TRKA 1O3YA 3B3AA 2J3EA 4Q16A 4GOND 1HDOA 1HK7A 4F6RA 2Z3WA 2IE0A 1JEJA 4EEZA 4JJZA 5T8KC 1CYEA 4PGMA 5CB4F 1TA4A 1EE9A 3LSTA 1PR0A 4YH1A 2KHZA 3TBKA 3DPSA 2CFIA 3ERCA 3C41J 1TLLA 3R7FA 1T4CA 4BE9A 4DLUA 4BTEA 4FQ5A 5JS7A 2WHQA 3MJRA 2ZUDA 1ZN9A 3OX1A 1EXVA 1H1DA 2DF8A 1A3CA 2OCLA 4XX1A 3TX6A 4C4RA 4UTVA 1ULTA 4CLRB 5JNLA 1LDNA 2LW7A 4ZV9A 2PUEA 2IH5A 421PA 5AVWA 2RJ3A 1KAOA 2OCIA 2YZ7A 5DGIA 4GYWA 5ELMA 3TLCA 3X1YA 1XX6A 1Z35A 3BGVA 2MMGA 4NCJA 4FFBB 4YMHA 3ER9A 1AY0A 1XPJA 2P6MA 3AKCA 3QOYA 1BDHA 1EVJA 1GR0A 1PGJA 3LTEA 3TXYA 3KEOA 3A32A 3RRBA 4M2LA 5FOVA 1I3MA 2HMTA 4NBNA 2W2KB 3THRA 4G26A 5CXQA 4G2NA 1LI7A 4ZCQA 3KYDB 2AMVA 4DTCA 4N8EA 1KDTA 5JS2A 4CL2A 5EXEA 5ITZB 5HUQA 4N49A 2A9QA 5HS6A 3KAPA 3K4QA 1K08A 1Q7TA 2AL7A 2IZZA 1WPGA 2NXEA 4ML3A 4KTTE 1Q1EA 3OWXA 2HWWA 3AEKB 4RJ2A 4TZ0A 3DAHA 2ACWA 1J06A 4BDSA 3NTUA 3L0IB 3P9XA 4OB6A 2GCGA 4II3A 3LUFA 3S68A 1AUOA 4L9SA 3ZXXA 3GK3A 4QM7A 4OG2A 1BD3A 1RQGA 1Y3CE 3N0VA 1SVMA 4MUBA 1I7NA 4ZOQI 4R1PA 5BY2A 4K7JA 1Y6GA 1TYBE 1QH1B 4LMRA 2PRSA 4Q4DA 1XA0A 1QFSA 4MUIA 4D96A 5BSVA 2QTVA 4EHBA 1PW5A 3UEOA 4A8JB 4CF4A 1L1RA 4J9VA 5A9SB 16PKA 5C37A 1LVGA 3TZHA 1NL3A 1R8YA 1R7RA 3Q8WA 3R5TA 3RVMA 1U1FA 3ST7A 8MHTA 4X63A 4CKWA 3QWFA 4NBLA 1MZPA 5EIBD 2SNIE 1HQYE 1VP3A 3IR7A 4HNSA 3EK2A 2IL1A 1TUIA 1U8EA 3OTHA 4OH7A 4IQFA 2B3TA 3STTA 3ONFA 4QG3A 4FFLA 2XGSA 4KQJA 4U2DA 3UA4A 5IBPA 4IAOA 3RRNA 1YD7A 2XCQA 4D4HA 1DXHA 3M1YA 5KWSA 3G2IA 2BHNA 3VV3A 5JWHA 4OPMA 2YINC 2GCOB 1KTIA 2P7HA 2B2NA 3FLEA 4OA8A 4ARSA 4V1CA 3BX1A 3G5TA 4TWBA 1KI9A 3IBSA 1B6RA 2HBRA 4LOHA 2D1TA 3ET5A 3VH1A 3C6XA 4FYJA 4CTKA 3KSZO 1E3WA 2H7XA 4C6SA 4ZA2A 3TGWA 2HJSA 4OHKA 3VNBA 2CK3A 4BP3A 5C4IA 3DWIA 2VJKA 3SBEA 5AR1A 3LRPA 2O59A 2V55B 4RHTA 2GN2A 2Z1MA 2VP3A 1J0XO 2PWPA 2W11A 1DE0A 4F84A 1UIMA 3KIPA 2JARA 1S6YA 2QX4A 4R1SA 4J90A 4UHKA 1CUZA 2ZBPA 4PS0A 1KU0A 3OSZA 5FWXA 3BCHA 2GH1A 1KYYA 1QCCA 2XXJA 4EL0A 4ZYUA 2QG9A 2C1XA 1A7KA 1VC2A 1EB8A 3LVQE 4DUYB 3R3UA 1SUSA 2J9RA 4MQLA 3U62A 2OZVA 3A37A 4AMBA 3ZQJA 5KDLA 1U9CA 3HZZA 3NBUA 5C7OO 1ARZA 1EWRA 3AMVA 4Y2PA 3SVZA 3HHPA 4DQVA 2AMLA 1V37A 3S8EA 3G3EA 2M1ZA 2MSLA 3ILHA 1GV0A 2AYZA 4G1VA 4E5PA 5LN1A 1FYWA 2HPAA 1XDDA 2DPMA 2J30A 2TSYB 3BMNB 1MHTA 3E1GA 4Q4JB 5ALNA 3UJ6A 1J56A 3ZXIA 1M34B 1QX4A 2QTRA 4OOEA 2EFYA 1Q7CA 2J59A 4NJMB 3JQQA 4RGBA 2FSGA 3SLGA 3BWCA 4IIYA 4KUGA 4GOXA 4LJ4A 4DXDA 1T9KA 5FV7A 2OGZA 3IJEB 1EJ6A 2O2JA 4WZBB 4YGXB 2QLNA 6REQA 2O2GA 3L5OA 1X7HA 2KSQA 1RHQA 2WUEA 4BNNA 1W46A 2ZLBA 3PUHA 5EI5A 5I6DA 4QREA 1M2GA 4ZODA 1GQ2A 1RI2A 1QFJA 3DMDA 1YQEA 4A8JC 1H2WA 4TVBA 1DX6A 5ELXA 2WU4A 1U2ZA 2BISA 3I42A 3ZWBA 1UIRA 1VI5A 2GYUA 4US1R 4NU6A 3IEUA 2VBCA 3K2EA 3TLYA 3HB9A 2GFIA 2ECFA 3KSUA 4POAA 4UM5A 4L5JA 3TSAA 1M0EA 1VCIA 1F48A 1R64A 2ZI4A 1R3UA 1U3GA 1Q14A 4ZOCA 1Z3CA 4TXHA 3QELB 5I7EA 2GD1O 4RH3A 2AK3A 1U3DA 3D7MA 2K2QB 3VTKA 1ZN2A 3AL2A 4E22A 1EWQA 2DAPA 2O48X 1N1GA 2VG8A 3H99A 3JX9A 3K72B 3IR5A 3C43A 2R1ZA 2XBLA 4A9AA 3EHEA 2QRVB 4M1TA 3U17A 3DE3X 1T4BA 1J7KA 1V2HE 4WGGA 3RIXA 2YV5A 3JWHA 2WVGA 3SM9A 4D41A 2FXVA 2EX1A 3R3SA 4HXYA 3DTVA 4IDQA 3U5TA 2O8DA 3IDAA 1OFUX 3L40A 3IVAA 1WXHA 3QNWA 3QVMA 3QKRB 3A4VA 4N7MA 2QY6A 1DPGA 1X8JA 3KDAA 1UAGA 4HX9A 1NHWA 3VJKA 4DLPA 4NZOA 4PCVA 4QYIB 1CNMA 2V7QA 3UUFA 5CX1A 1NBEA 1W9HA 3FGZA 5I51A 1NVVR 4HAZA 3CBGA 1E2NA 3A31A 4KXMA 5KSYA 1IK4A 3NALA 4HMPA 1YTLA 3CS3A 3DC2A 5AM5A 4JBLA 2P4EA 2QQEA 2WJZB 4WE3A 1FRZA 2JVKA 2OM2A 3HO6A 3L7AA 5H4GA 3PHGA 5JFTA 1IN6A 3W77A 2IYEA 5KDDA 1QLHA 5SY4A 5C32A 4II2A 1VRCA 4FUTA 1F17A 3H9JA 1JSXA 3SK0A 4BX0A 1LK5A 3V8RA 1E3EA 2PRZA 2XE8A 4AF8A 2X9GA 2NPFA 5B1YA 1OY1A 1EK6A 5DULA 2WQ7A 4V0MA 2YQ5A 1UC5B 1C2TA 3HABA 2HY7A 2VIIA 4WJZA 2IODA 1XHFA 3AEZA 4B8WA 5TPZD 2CXHA 1EWTA 2V6BA 2H7CA 1L4YA 1O8CA 2ZTLA 1U1EA 2YWCA 3E0QA 3NWEA 4I46A 4MS1B 5LB4A 1SBYA 2I87A 4FW8A 4KJXA 3OX2A 4WXHA 1I6KA 2KS6A 2A92A 3WSTA 4KSBA 4E46A 4EHDA 1RPZA 2FPMA 4GG1A 2I33A 4RV4A 1L5SA 3UGJA 2OAGA 5AKHA 4ENUA 1GQFA 1CQIB 3R24A 4HWSA 2DUUA 3GJ8A 1E6WA 1CRLA 1ZGZA 3EAFA 4EUEA 3U56A 3M4NA 3AVOA 3QV2A 1WO8A 1XJ5A 3N7AA 1KQFA 2VNAA 3OZXA 5HILA 5HCIA 3VR2A 1FP2A 4J3NA 1LQUA 4IGFA 1BXGA 4AXBA 3PQDA 4ADSG 3MJSA 2AWOA 4Z9BA 3AWIA 3CRW1 4PBSA 4D8XA 4RZXA 3OD1A 1JDZA 4IDDA 5JYDA 2XKKA 3OU2A 3H11A 5JG7A 2RGWA 3IVXA 5LP6B 5T4BA 4MV1A 4DCUA 4A5OA 4Z51A 1PHRA 4DLWA 1E2DA 4B17A 2V4ZA 2B1IA 1OZFA 3D3EA 2ACVA 4XQCA 3TTXA 1EDOA 1WDMA 3GEIA 3B5EA 3QYPA 4UDXX 1UKAA 3RVDA 2XNCA 3KPWA 4L8WB 3G6WA 3NJ8A 5IC5A 4UCXA 1ML3A 4P53A 1TJPB 1S2OA 1TU0A 5AXCA 3VHXB 4CEHB 3PITA 1WIWA 1TB4A 4EATA 2JS7A 3Q6NA 4UBIA 3H1PA 5IXJA 1NXSA 2IPNA 1RWKA 2O2CA 2X14A 2AXNA 1ZCBA 5FADA 1NJFA 1VE6A 3V8PA 3PUJA 3HJAA 1ULBA 1QVVA 3V34A 2QM7A 3ZHUA 1P8JA 3ZCTA 1SBTA 3HVKA 4RYLA 3KX2A 4PTLA 3GNLA 3P0HA 4FKBA 4RD2A 4RE6A 5CT5A 3PFKA 4FFBA 2HSZA 3D6UA 1C7RA 5A3JA 3S7TA 5TR9A 3HCOA 3IILA 4QO7A 1GKKA 7REQB 1K2VN 5G41A 3JYLA 3WZMA 1VDMA 4ZYLA 5FBQB 4IINA 4EAQA 1G2PA 1GV1A 1MB9A 3F6EX 2GEJA 4J4TA 3QEKA 2CMKA 4EGQA 1GTRA 2ZJ8A 4ZEWA 2OENG 4GC5A 3EISA 2I2BA 4KNVA 2C7BA 1FY2A 1WCXA 1ZM3A 2HMSA 4TMTA 1QPBA 2GO1A 3KHKA 1UKBA 2HQRA 5FI5A 1E99A 1ONPA 3B51X 2Y1OA 4HDSB 3QKIA 2Z2IA 3TRDA 1RQ7A 2XTJA 3PIIA 1AK2A 1SUDA 1O6FA 1QC5B 2PMKA 4DC1A 4DCSA 2COEA 2ICAA 3Q9SA 5JYEA 2FPLA 4MUKA 4QT0A 2LIPA 1BVUA 2QR2A 1RYFA 3CXRA 3LPAA 4L2IA 1EZZA 4XQ0A 1IZ9A 4FDTA 3B1XA 4LOJA 3AETB 1VLZA 2FY8A 4MQEA 5EZYB 3ZWAA 1UINA 5JSUA 3RVSA 3ZGYA 4CV3A 2OCAA 2QRGA 1ZIDA 4C0WA 3F9IA 3L6OO 4BVEA 2OBLA 4FBMA 2CV2A 4ZRNA 1E2BA 1BGXT 4I9UA 4OB8A 1RZRA 2FK8A 1QIFA 4X61A 2I5PO 3II6X 4Q3DA 5CNMA 3ZBUA 1G9TA 1T8TA 2X4GA 3TKLA 4FP9A 5E7JA 4P8RA 3EMDA 4B74A 4JNKA 4BEVA 3OBIA 1P9RA 4RZ3A 3E15A 2F9MA 3V3TA 2WWRA 3JPYA 4K5QA 2GD6A 3I9OA 2VHUA 2CVZA 1KAMA 1REQA 3ZU5A 1FVXA 4YECA 3S8MA 3P9CA 1FCJA 1BA2A 1GTMA 4BZQA 3HKCA 4R5HA 5CVCA 2JIOA 1KEVA 4N6GA 2XV1A 4MPRA 4MV0A 1KE2A 4NKRA 1YZQA 1YMVA 2BP7A 3T5DA 4LBYA 2UZ1A 1N78A 2QT9A 3D2AA 4Q4JA 3K3PA 3NZEA 1C0IA 4LQ4A 3BGIA 3CH7A 4GHWA 5DU2A 3TOZA 2JIPA 5BR1A 4JNCA 3Q98A 1JBEA 1U7ZA 1FFEA 1UBMS 1YL6A 2FB9A 3OQHA 4WADA 2CMDA 1CR1A 2GAFA 2IJGX 1JECA 3QM1A 3K9HA 1BYUA 1V26A 1AUXA 2QLLA 3LVRE 4F96A 1OVMA 3DOCA 3M6FA 4C0XA 4WA8A 2WSSD 3CUTA 1GNSA 1MAVA 3D1VA 3ZCPA 3C8UA 5CGZA 4ZTUB 2GVZC 2QWXA 5CT4A 2ZRKA 4CT0A 3OVMA 4NCNA 1IN1A 2IEIA 1KQGA 4BKRA 2BH2A 4A0HA 4YREA 4AJHA 4DDTA 3IPYA 1KOLA 2QIPA 3I4CA 4CDMA 1IJEA 1PL6A 1RWNA 1TNDA 1M75A 2BFBA 3L18A 1DO0A 3HWRA 4PSUA 3UH1A 2EU8A 3P2IA 5CDUA 4GXNA 2PX2A 2QD2A 4BEJA 4WJLA 4YUWA 2J3QA 1E5DA 4MS3B 1Z7GA 4OBWA 2ZFUA 2BTQB 3C0KA 2ZZKA 3T1TA 4K6GA 5LA6B 3TX2A 3G23A 1E59A 1GGEA 4YCBA 2IYTA 2P8SA 3DUFB 3FROA 2P7IA 3MWLA 4PYNA 3K1ZA 4ZJPA 1WY5A 4JIGA 1D1PA 3B78A 3DMTA 1Q44A 4ONEA 4QGHA 3CZQA 3IBYA 4XGIA 1N0IA 1W4RA 4QEKA 1YBAA 1QGZA 4BY9E 3K9LA 4FFVA 3ZTTA 4CGZA 1J2JA 1GZ3A 1VIMA 1Z6TA 4BB5A 4YV7A 3L2OB 3KLBA 3NM5A 5ALEA 2W00A 2FWRA 3DHNA 4YDQA 3PLRA 1E6MA 1FLVA 4L6AA 1JLLA 4QYXA 3O8BA 4WZBA 2W6NA 1ZH0A 4P4UA 2D2FA 4AWBA 4GRAA 4LZZA 4MYCA 4BUZA 4E5DA 3RLFA 1LPPA 4W5QA 3UAVA 2ZI9A 3BQMB 1SEVA 1E94E 3GLTA 1LUAA 3DVAA 1P9WA 5AYVA 3CG4A 4TL8A 2VUTA 4QSHA 1QK3A 2YWRA 5JXGA 2LDXA 4P4SB 4TKLA 3GVXA 2YVUA 3ABOB 3AEXA 3AC0A 2P79A 1C7EA 2HL6A 4BJ5A 4EECA 3GN2A 3LUAA 3NVKI 1PT6A 1PQYA 1Z73A 3R6GA 4R8LA 3TLKA 4GFDA 2HCTA 3QI7A 1L5GB 2DT5A 3NTQA 3RBVA 4WECA 2OCKA 2P5SA 1AKEA 1FA9A 1XKLA 1RACA 2GEVA 2XYQA 5FHRA 4EG5A 3T5CA 1IQ0A 3GT0A 1A7AA 1NXOA 2LBPA 3E2PA 2IUFA 3A7EA 1U5CA 1XDBA 5AI6A 1RKUA 1YB1A 3AP1A 2IHZA 5DEOA 3EVZA 3HU3A 3R7WB 3LIIA 5EP2A 3UV7A 1GITA 3I01A 3H0EA 4CCAA 4CTOA 4CIWA 2EJWA 5EWMB 3GH1A 1Q12A 2I7CA 2B35A 2FWJA 1EJ2A 3RUCA 4IIEA 4E4RA 2DR0A 1KS2A 1ZITA 5FBVB 5KNBD 2X3UA 1R66A 2JA1A 2H2IA 2KBFA 4U0KA 3IAEA 5DYWA 5BVHB 1NSYA 2A6PA 2Q6IA 2WIGA 3ZDBA 3NEJA 2IUEA 4ZCPA 2N75A 4GSLA 4N4AA 1R0KA 3BD8A 4PZZA 1CY0A 1FP4A 2WBLC 1DKUA 1UT8A 1NXWA 1U0JA 5TMEA 2Z4RA 4ETWA 3G13A 3DLTA 5L40A 2XW6A 5KTRA 1KZ1A 3CLRC 5H02A 1XU9A 2JIZD 5FORA 2FMTA 4EMBA 4IDBA 1POWA 4B2IA 3RSSA 4H7JA 1RDFA 5JCZA 4X1IA 3MGCA 2AFHE 1AU9A 5I4CA 1LC0A 2QXUA 5C8ZA 2EFJA 3KAQA 3O90A 9ATCA 2OORA 1WU7A 3L4EA 2D2XA 4CMJA 5HXAA 4MUAA 1H2YA 4J0CA 1EAMA 2OSBA 3V8MA 4KO4S 4ZI7F 2HBYA 2OY0A 2V3CC 3MJEA 1VB3A 3IXQA 1NTOA 1UWCA 3RABA 5A9SA 4G5OA 1HX7A 1UZNA 5DGDA 3BWEA 1FTYA 3Q2IA 4KE9A 2VSXA 3RVJA 3WGHA 2SKCA 5JT1A 1JKMA 2NZYA 1CJVC 3HCFA 2VZLA 2C82A 4RPGA 4C7VA 4E13A 1K6XA 4W5NA 3QPAA 3DTNA 1SU8A 1KI7A 2QLBA 3I6ZA 1XTJA 2UUOA 3KXPA 4HTAA 4IP0A 4TT8A 4Z4IA 3LIPA 5BWCA 3QHAA 2J0UB 2ZJ1A 1V16A 2ZTSA 1Y9EA 2HSGA 3CC8A 4OYLA 4ZVMA 4DR2B 4R1MA 3R5JA 4RVGA 3UMSA 2VATA 3DH0A 3FB1A 3KCNA 3PGMA 3VPCA 4CLHA 1Z25A 1OH7A 3H8JA 4UM7A 1PX2A 2CJXA 3A6ZA 3DZKA 1IOVA 2NZXA 3OE1A 4LQCA 4NI5A 4YRLA 5JVDF 4FDMA 2W9XA 4MDHA 2G71A 4ALIA 1E92A 2WYVA 5IAGA 2OG2A 5KYWA 1KEKA 4REOA 3GI1A 1RHMA 3AERA 2I1LA 3MJHA 4X62B 3WNQA 4CMIB 3ZJYA 5HIAA 2EHDA 1SC1A 4EB6A 2PVSA 4L8GA 4DIOA 2A0WA 1NWCA 2RAFA 5PGMA 1EVZA 4WKNA 4AJPA 1O9HA 3PEUA 2BFEA 3B3FA 3E4CA 3RRXA 2XVZA 2YWFA 1QE3A 3HJUA 1OTHA 2PKQO 3NOVA 3SG0A 1GZDA 4KN6A 3TZLA 1PWZA 3AW8A 4WPGA 2GHRA 1ICEA 3B3GA 4ND4A 2EC5A 4O02B 1N7HA 2G5CA 3BSSA 1QVAA 2P78A 5C4MA 1WZIA 2ZUSA 1KI4A 1GEEA 1WW2A 3ZK9A 1OREA 2E85A 4MCAA 1ORRA 4YP9A 2IYVA 4HQNA 1BROA 2JH3A 3E5MA 3JWJA 4JFRA 3R6DA 3TRIA 1JWBB 1JWAB 1W29A 3MNFA 1GDHA 1NM5C 2AGVA 1T5DX 4J1TA 5E6SA 5FA8A 2J0SA 2JRLA 2Q2WA 4AMZA 2YUIA 3EE6A 5K2MA 5EHZA 3E35A 3I12A 1PT7A 5SICE 1X2EA 3ELBA 4LVNA 1CEQA 3JAWB 4H7KA 1K5PA 2ETVA 5JCJD 5B6JA 1P44A 1WD5A 3E3OA 3FMFA 2JZOA 3Q9NA 3K1AB 4NH4A 4TPKA 5E9JA 1EUZA 1TYZA 1DCKA 2Q3BA 2VRCA 2VVTA 3NRCA 4AKEA 2AVDA 4Y8VA 2CNDA 2XVAA 4A2CA 5HZKA 4TVSA 1VECA 3OU6A 2XH8A 2QMOA 3X44A 2P9ZA 4L72A 4DV5B 2AFIB 3VGPA 4PPGA 3W05A 3VISA 1FX0B 4ARZB 2HIGA 1N1MA 4CI0B 4OMFG 3SIWA 3W06A 2PT5A 3E23A 2SECE 2A30A 3EWAA 1K98A 1DQYA 3C39A 4FWTA 5JY6A 4G4SP 4DWOA 2IYXA 2X5XA 5IKMA 2VAPA 5JAQA 4IUDS 1QP4A 2W6ZA 2I2DA 3FETA 1ENPA 2AN1A 4ZMSA 4ZARA 2GHIA 1M2KA 3KE8A 4PHGA 1XEWY 2PBFA 2IIQA 4EBFA 3E9DA 1KJNA 3AJ8A 3SYTA 1HYEA 5B2EA 1YZTA 2ISCA 2KW5A 4L74A 2TRSB 5D7NA 4MHSA 4L3WA 1ZYUA 1SUAA 2BFBB 4QJBA 4TTIA 3PXUA 4UPVA 4BGEA 4F9TA 1DIGA 2QD1A 4DTIA 1J1IA 4QGBA 4RXTA 1P2GA 3DLAA 3ZX5A 3P4XA 2J3HA 4MJ7A 1K7EB 3MIZA 3SJBA 4EKEA 1CQXA 1XTZA 4K9KA 4WL0A 3BIOA 3EEFA 5EJEA 1JIXA 3IERA 1USIA 5JMTA 3U0BA 3FDIA 1V1RB 4FYXA 4GS5A 5AICA 1U28C 1SZJG 2CVPA 1TMOA 1QNLA 2H0RA 3DTVB 4NS4A 1L2TA 1P2SA 1U8XX 1NVTA 2BEKA 2A0XA 2QTWB 1BCRB 2VPIA 2WDPA 2XMQA 3ABQB 1VE9A 2PR7A 1MOPA 3CLHA 2ZU0C 3N5KA 3MYRA 1LPNA 3MS7A 4DIMA 1YB6A 5AOBA 1FRFS 4MHTA 4QU5A 1IWBB 1Z83A 4QYSA 4AJKA 4TN5A 1FS4A 2C5FA 1VHJA 3NT2A 4DJJA 2NOAA 4NE2A 4RSHA 4GP9A 4B73A 5HNKA 4F56A 3D4OA 1YWGO 2P1DA 1XYGA 3E4DA 2QW8A 2NUAA 1H4SA 4LE1A 4EPTA 1M1YE 4GBMA 1P17A 3RSQA 2NZJA 2Q0SA 3L0ZA 1PS9A 4IJKA 3OQJA 4IUBS 4MRPA 4XPIA 1HTBA 2Q2OA 2YWJA 4D4MA 4DF3A 3THWA 2ZYIA 4BBJA 1TOAA 3C8HA 3OPNA 3K6SA 2CWDA 2EGGA 3PUWA 1HRDA 4TV8F 5IJ0A 5GM2A 5KNCD 2GX6A 3AKEA 4B3RB 2G9UA 5EMKA 3NRBA 3BF7A 2CDAA 1BJRE 1DZIA 3TDNA 8ABPA 4R9SA 2O1EA 4S24A 3IUNA 4OREX 2X2PA 4BZXA 4FUQA 3PJDA 4Z49A 5B58T 4M0UA 2OXRA 3N0RA 1D7AA 3WIDA 1SU4A 1JR3A 3SGLA 2DBVO 2GA9A 2O8CA 4GECA 4OHOA 1EM8B 1ZRSA 4GR5A 5JFGA 4GDMA 1YBVA 2N42A 4X44A 1RPAA 1NBME 3GAAA 5A0FA 1M6HA 2W6ID 1W30A 3BDVA 3GB9A 4XJXA 5K0SA 1ZD8A 4MAFA 2J3LA 3BXGA 3UK2A 3BIXA 1SKUA 1SVSA 2V6GA 3ZNQA 1NE2A 3ZU3A 4B4UA 1B41A 2CL7X 1AKVA 3HI4A 4E0BA 1Z2CA 4QX6A 1KERA 3VZDA 3FNQA 3LP5A 1Z7EA 1RU3A 4J3FA 1XMSA 2VZEA 1HT2E 2XNDA 1A5AB 3R09A 4IL5A 4ZAGA 3V4FA 2BEVA 5JJBA 2B7LA 3EH1A 3TQCA 4PN7A 2C4NA 2OAQ1 2QF7A 3PPYA 1ABBA 2MDTA 4A26A 1X9HA 3PDJA 4ZT7A 1YBFA 1V8BA 4BFXA 3JARA 2Z6VA 1AB6A 3PZBA 4RTSA 1OKKA 1QIMA 4KN5A 2EIXA 1BWSA 4OSPA 2WM3A 5A05A 3TLJA 4AUKA 2AF3C 3PNOA 2P6RA 1LBTA 1VM6A 3K0FB 5JZMA 4I5IA 5FNZA 1PNTA 4HVTA 1L7QA 1OGIA 3VR5A 3C3YA 3GFQA 4IKOA 4NHEA 5GQSA 3M1IA 4PZLA 1POXA 4M88A 1E5XA 5KC8A 1Z47A 2JLAA 4AS1A 1SULA 3FKSD 3VMFA 5AHWA 1SKYE 4UTPA 3BIFA 4DR4B 5JAPA 2YN2A 5JHHB 3GNQA 1U3VA 3TL2A 1WB9A 2O0JA 4P5DA 1X87A 4D3FA 4XIIA 4M36A 4RL4A 1V5FA 2Q2VA 3R5FA 4B76A 1I4OA 2JFWA 3TZCA 2ZE5A 4HN2A 2ZIAA 4P0QB 1RPNA 1FYVA 3RSCA 5AHOA 1G66A 2PL5A 3E58A 4M9RA 1GA6A 2DGDA 3B2QA 3B7GA 1TCAA 2JCXA 3DF9A 4NU0A 1Q57A 5D1HA 2HU7A 2NYVA 4XD7D 5JHGB 2C5BA 1ZCZA 1Q74A 4E15A 2WIDA 1CZOA 1GEGA 1A71A 2XMDA 2ZBVA 2WUDA 5HF8A 1RXSA 2I2FA 2QUAA 3W79A 4DY4A 5LQRA 2V98A 1I2CA 4HC4A 3O4VA 5EC8A 5IYZB 2VP6A 1QHFA 4QGAA 2Y2VA 1SVWA 3DMPA 2QLJA 3RE1A 1ONSA 5G0UA 4C14A 3QWHA 1FK8A 2PKQP 2WKSA 3VC2A 4C0AC 2DBYA 1U0FA 3W34A 3WRXC 4U9UA 3TE7A 3KD2A 3CSSA 2EX4A 4OXNA 3WAKA 2D13A 2K5UA 2R48A 3AR8A 2EARA 1TUBA 3P5BA 2FLVA 4F6LA 3KU1A 1OWOA 1ADGA 4J0IA 1G5FA 1QBKC 3GJ7A 3TRJA 4GPD1 3FVVA 3WMGA 3TW6A 4HV4A 2G1PA 1ZI9A 4RIHA 3V1MA 2Y6UA 1BRTA 3QBEA 3QVSA 3FGNA 3ZE1B 1VP9A 4MOWA 3KKNA 4EFMA 1ZGJA 1EDEA 5C5CA 1CY1A 2GD2A 3HL4A 2Q0HA 1L7DA 1K4KA 3ESCA 5GOZA 1YZLA 1XZAA 1T8YA 3C6ZA 6CHYA 3MQ2A 4NG5A 3HKCB 3N53A 4MEBA 3YASA 4A10A 3D64A 4BB9A 2WT9A 1IDOA 2G09A 1OLOA 4HXGA 4KQCA 4AKSA 4BNVA 1J4AA 4IOMA 2I2AA 1EBUA 2BJWA 4OXYA 4Z3DA 1A5BB 4JVNA 3Q3IA 3GGDA 4P81A 3FNEA 4X6YA 3SJAA 1HETA 4OSEA 4YMTA 2NZ2A 5LMUB 1HSZA 3DSRA 3M0EA 3MTIA 3PEFA 2GEBA 1VL5A 1C1DA 3LQRA 4AICA 3LWNA 1YOBA 4KQ9A 1P9OA 1VLHA 1D4FA 3WWOA 2B21A 1FQKA 2I8CA 2Q3FA 1W25A 2YXDA 4O6VA 5HVNA 1CR6A 1DTSA 3FFTA 3OFNA 1DBWA 3OZEA 2HTEA 4F7DA 2HO4A 1IOWA 5FQNA 1SIBE 3OPYA 4HLCA 3PP8A 4JLMA 5TT0A 3SR3A 1ZXLA 4BU1A 4C7KA 1SGWA 3ABIA 1AA6A 5GP1A 4EF4A 2PIDA 3ZGNA 2IV7A 3O93A 3QKUA 5B4VA 4DAEA 1TPZA 2A5YB 1E8DA 2RHRA 4WBXC 2NO9A 3VX4A 3ZHCA 2ZVQX 4O2RA 2ONKA 1OXTA 1NUTA 3EGVA 4NS1A 1GG8A 5I7WA 1GTJ1 4DUZB 4P08A 1XCMA 3QPUA 4HZUB 5JXWA 1Y4ZA 4I5GA 1GKIA 2Q9BA 2RKBA 4R2MA 4A36A 3IP3A 5IT9A 4B6SA 5GAJA 2G8NA 5FAXA 4AUEA 2DXIA 2QY9A 4OQQA 1ZQ9A 2W42A 2PCLA 2Q5QA 4Y6QA 1M1NB 3DB1A 2V74B 2REQA 3AM5A 2WA1A 3EG9A 3IAHA 4A03A 3L8MA 3PF8A 2PL9A 3DQPA 3SNKA 2DQKA 5IKPA 5C81A 5EHIA 1VL2A 4ZHQB 5BVHA 3O1JC 2FMUA 3LMKA 3L06A 3EY4A 2I29A 2XKAA 2NXJA 3FPBA 3ZWYA 4Y2JA 3DDZX 4ARAA 4NPCA 3W2GA 2VF8A 1U8YA 3LPCA 1OW3B 3L0CA 5ALWA 1KYZA 1LTHR 3O4JA 1FLAA 4FFWA 3TLXA 2PCJA 1V3UA 2GDJA 1E3DA 1F7VA 2Q4BA 2NP7A 2LGJA 2O7VA 2V65A 2ZJ5A 4QC2A 3E1KA 5EG5A 1W7AA 1ACMA 4AX8A 4AROA 4J1NA 1GT6A 2VLIA 1KVQA 2VC2B 4OJTA 1PJQA 4BRUA 3IUSA 2XMPA 3TQHA 1M6YA 1L0BA 4OGLA 4IOLA 3HACA 4TS1A 1NIJA 1RRPA 5LJIA 2C5EA 1DZ3A 2ZBQA 2WAMA 2YWDA 1UJNA 3ENKA 3PDCA 3KQVA 1VE7A 1BG6A 3R9IA 4IGEA 5EWLB 1CJKC 3WWCA 3JASA 3OQOA 2YJ4A 4G1EB 4JJFA 1N6IA 2HDHA 2C58A 2QRJA 3SJCA 2B7BA 3EOAI 2JCVA 3O3NB 3Q1LA 3QLJA 3EPHA 3ISVA 2CYBA 3V8VA 3SZ3A 5HYVA 1I5EA 3A36A 2JLXA 1SBZA 4WWHA 1XRMA 2W71A 1NG9A 4UUMA 1Z5GA 2C2YA 2H1WA 1TCVA 4UAUA 1DIRA 3D4PA 1RQPA 4D9NA 3COPA 2JI7A 4BQQA 2KQUA 1QQAA 1GTL1 2ES4A 3DAPA 3C1OA 1MEEA 1NUSA 4TQ9A 3QV1A 4D81A 1XXLA 3P94A 2H1FA 2VWGA 2CJWB 2PQ0A 2QDXA 3D02A 5CX4A 4KNYA 1FNNA 2HQ1A 2DHRA 3DBVO 2JFPA 5HZGA 2HO5A 4DBZA 5M29A 1L1EA 2R4TA 3FTFA 3HE3A 4G86A 1VMIA 2I7VA 2OESA 3CNOA 4RJIA 2BGJA 4G09A 3UK1A 2PXXA 2YJ6A 5CT6A 5F52A 1FNMA 3A1UA 1Z4LA 3NAQA 4D6PA 1XJ0A 1YQQA 1F2TA 1J99A 1RXUA 3K31A 1C8KA 1VHWA 4TYMA 3MFQA 4HXFB 4M9CA 3AESA 3OWHA 5CLLA 4E6PA 1V3QE 5DYYA 4JWTA 1YRQA 5DLYA 2GZHA 5BSKA 4WLFA 3G5UA 4U9IS 1BCRA 5DBFA 2ZSUA 3EMKA 4ZYTA 3LYLA 1P2VA 2DFKB 1X39A 2NQ8A 3N87A 4TL9A 1T2EA 5ALGA 3FKJA 3WL8A 4AJOA 1WDTA 2OC9A 2P91A 3E7WA 4RZQA 4D4KA 1XMOB 1GDTA 1TEZA 4DAOA 4B35A 5B4UA 1NJ8A 1UXIA 3OTOB 4DR5B 4RIGA 4CM5A 1LCIA 4YWHA 3HXPA 2HGSA 4OJKA 2EF0A 2A33A 4RXUA 2QB5A 3Q11A 3L7DA 5EE1A 1DRVA 1S8OA 4AL4A 5I48A 3RT9A 4NENB 3ZLJA 1GNLA 5IEBA 1XNQB 5DM2A 5CFNA 5IAKA 4KODA 4YCSA 4HFJA 2FN3A 1ZA2A 3FPHA 3IP9A 2ZCVA 5EIFA 5C34B 3W0LB 3WL5A 4AU1A 1E6KA 1MIHA 3FMOB 3TLGB 3UWMA 1L5WA 4BNGA 2H8KA 3R5KA 4YI5A 5MFZA 1DGQA 2EWMA 4B79A 1PZNA 1E3WB 1SG9A 2G9ZA 3WGIA 3PWKA 3LUCA 4I55F 1KNQA 5ULLA 5FYQA 2HMUA 4OX9Y 3JQ8A 2X5OA 4OHVA 3I61A 2WHRA 3ZZTA 1J00A 2E48A 1Q3HA 2I4LA 5JCPA 4FJ0A 2GLTA 2X8JB 1DQNA 1XU4A 2ACKA 2QRZA 3K05A 4OL9A 3T4UA 4A6EA 4ARCA 1FTGA 4PTYA 5I5EA 2JFHA 5F7ZA 1BDMA 2OGTA 1FZQA 2BF4A 4DCVA 4W5TA 1OHHA 1TO2E 4BNDA 3EZFA 4RIIA 4YJHB 3DFFA 1TUBB 3PC4A 3DB2A 3GHHA 3U4DA 2WW8A 1S2LA 4Y1FA 2WIFA 2YNMA 3H83A 4KTVE 3OLWA 1ZK2A 3DE2X 4P3OA 3S55A 4E94A 2O07A 3VR1A 1JEQA 1NRIA 3NGXA 4R31A 1YJBA 4CM3A 3X2FA 2NUPA 1QZTA 1WQ3A 1YR6A 1D4AA 1L7XA 3VVCA 5ARDA 2D2VA 2NZVG 3EZ2A 5K0LA 3KM0A 4TUYB 1NP3A 2HA0A 5JC8A 1ES9A 4RTLA 4UDNA 1NVKA 1CDEA 3B1FA 5F73A 3K0HA 1L8QA 1E0KA 2DR3A 5CM2Z 4DSUA 3PL5A 2Q45A 4Y7DA 3BQ9A 4TKMA 3IDSA 4OP1A 1MXHA 2IE8A 3KDSE 3J7TA 3OHPA 2YFHA 1DBIA 4PPYA 3FI9A 1PFYA 4PG4A 1JDNA 1B43A 2RBEA 5K3CA 3UGKA 3VMMA 5CA1F 4Q9KA 1GYPA 2Y4NA 1M1XB 4L76A 5ALZA 3ENVA 1G0OA 4J2HA 2YJGA 2RCNA 3LZ6A 4HLQB 3BHNA 4HGRA 4Q4HB 1QYCA 3M9XA 2VK1A 2ZBGA 4G4IA 3ZCQA 4KQFA 3IULA 4DNFA 2I3AA 4C01A 1H9AA 4HH3C 4XKJA 4AURA 3EXFA 4WFKA 1JIIA 3KJQA 4EIWA 3H75A 3VZCA 1QU3A 2VAXA 2VTKA 2ST1A 2WJVA 3RUFA 3BMQB 1G3QA 3F4BA 3I6IA 3H18A 3LPDA 1JMYA 3NHMA 1I4LD 4WOCA 5F5LA 5AVJA 4CL3A 2ABWA 2MR5A 2I3GA 4LYDA 1ECGA 2GN6A 3U4HA 3CWQA 4CG0A 3QQPA 4X3CA 2X0DA 2WF9A 2ILVA 3L82B 1NIPA 4V0RA 2H9YA 2RHCA 2ZSEA 5GIPE 3HCWA 3DR5A 2B4QA 3I9V1 4IIJF 4W8GA 1IN5A