2OYSA

Crystal structure of sp1951 protein from streptococcus pneumoniae in complex with fmn, northeast structural genomics target spr27
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
230
structure length
230
Chain Sequence
NKIFIYAGVRNHNSKTLEYTKRLSSIISSRNNVDISFRTPFNSELEISNSDSEELFKKGIDRQSNADDGGVIKKELLESDIIIISSPVYLQNVSVDTKNFIERIGGWSHLFRLAGKFVVTLDVAESNGSDNVSEYLRDIFSYMGGQILHQVSITNSLKDIAEAQLMEATYKIEDVLEGKIKYKTTDYQERAYQTLKLILENYDSEHFEKMYWEKKRLFEANSLEEWYYVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein SP1951
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Structural genomics, unknown function
total genus 90
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oysA00
1RLJA 4CETA 1RLIA 4Y9RA 1DX9A 2HNBA 4XDHA 5LLDA 4ESEA 4C76A 1CZLA 1H66A 1FLDA 4ZVNA 2MT9A 2FCRA 1AKRA 2BZSA 1AKQA 5LVAA 1KBOA 2Z9BA 1T5BA 4H6PA 4YAWA 4ZVMA 1AHNA 3N3BC 1XYYA 3FNIA 4F8YA 2M6SA 4S24A 4N65A 3EDOA 5LJLA 3OX2A 5FA6A 5NLLA 4PTYA 3F90A 4NULA 3OWHA 1NNI1 3GAMA 3K1YA 4YAUA 2HNAA 2Q62A 4HS4A 2KQUA 3W78A 3B6IA 4XDGA 3ZHOA 2MOKA 2OHJA 4M0CA 3SVLA 5F51A 2FAXA 4QOIA 3GFRA 1H69A 2ARKA 1FUEA 5EMNA 1CZRA 1X77A 4Y9UA 1JA1A 3HR4A 4N9QA 4PU0A 2QX9A 4QOEA 2FVXA 1XT6A 1CZUA 1VMEA 3NHLA 3OX1A 5TGZA 1WSWA 1XYVA 3OJWA 1YCFA 3NHRA 3OVMA 4DIKA 1AKTA 5FX2A 1C7FA 2QMYA 4LA4A 1CZHA 2QWXA 2QX6A 3QFRA 4J8PA 1J9GA 5EAIA 4LTMA 4FGKA 3O73A 3HLYA 4U7FA 1TIKA 3P0RA 2OHIA 2X2PA 4FGJA 2FLVA 1FTGA 2M6RA 2QR2A 5NULA 2F1OA 2QMZA 5ULLA 1AMOA 2XODA 3KAPA 4BMPB 5JROA 3QFCA 5EA2A 2R96A 4R81A 2BMVA 3ESZA 4YAOA 1ZWKA 3LCMA 2W5UA 5B3LA 2OYSA 1YCHA 3N3AC 2V9CA 3W77A 3HA2A 4DY4A 3F2VA 3NLLA 3EYWA 2V5UA 3N39C 4LTDA 1SG0A 1BVYF 1J9ZA 1OBVA 1AKVA 3NHJA 1FVXA 1I1OA 4PTZA 5A4KA 1BU5A 4BMOB 4HEQA 4U7HA 4YALA 2Z9DA 4ZVLA 2B3DA 2MTBA 3ESXA 2Z9CA 1DXQA 2FDXA 1YCGA 1YDGA 1YOBA 1FX1A 1DXOA 4QOGA 1E5DA 2BPOA 2QX4A 2XOEA 2MWMA 3TE7A 3LT5A 2Q9UA 5LMCA 5FUQA 1QHEA 1V4BA 4LTNA 1YRHA 3D7NA 6NULA 4QOJA 1ZWLA 3NHUA 1RTTA 4YQEA 1CZOA 2ZKIA 1AG9A 3L9XA 5BUCA 3ESYA 1F4PA 1D04A 4YAFA 1QBGA 5LBUA 5F12A 3G5MA 3ES9A 2OHHA 3FVWA 3FW1A 4C0XA 1J9EA 1JA0A 3B6KA 1OFVA 4U7GA 3O2NA 5LBTA 1WSBA 3JSXA 1AKWA 1GG5A 3U7IA 2RG1A 3NHPA 1C7EA 3KLBA 5LJIA 2FX2A 4H2DA 5F4BA 4CF6A 3TZBA 1FLVA 3NHSA 4GI5A 2GSWA 4Y7CA 5B3KA 3FJOA 2AMJA 3R6WA 1QR2A 1YKGA 4FGLA 3W79A 3OX3A 3KEGA 4GR9A 1XI2A 3NFRA 3W7AA 3NHWA 3B6JA 4LAFA 4QODA 1D4AA 2V5VA 3OWXA 1AZLA 1TLLA 3GFSA 2BF4A 1KBQA 2HPVA 3UXEA 3F6SA 3FX2A 1ZX1A 1FLNA 3B6MA 3F6RA 1B1CA 4ICIA 3K20A 3TEMA 1FLAA 1AKUA 2QX8A 2BN4A 3NHFA 4QOHA 4ZVKA 3GFQA 1RCFA 1SQSA 4DILA 2Z98A 3L9WA 4GQIA 4NLLA 4FX2A 1QRDA 4C0WA 2FZ5A 2X2OA 3NHYA 1D03A 3QE2A 3S2YA 3OJXA 4D02A 4C14A 3KAQA 2N1MA 3UXHA 4QOFA 4OXXA 1CZKA 1OBOA 4N82A 3RPEA 2D5IA 2WC1A 2KLBA 1CZNA 2FZVA 3NHKA 2FOXA 3U7RA 1J8QA 2R97A 2A5LA 1T0IA
chains in the Genus database with same CATH superfamily
2XA9A 4M1ZA 3TG8A 1W9MA 3I6QA 3KZOA 2RGGA 1NXTA 1G7TA 2FPOA 1VRVA 2FWAA 4WZAB 5T3YA 4EW2A 3OD5A 3LFTA 3UAWA 2XEXA 3B1VA 1JN0A 2YVLA 3KLMX 1DJPA 4V03A 3UYLA 1OPRA 3AU8A 3MRXA 1GL9B 1NF2A 2QI9C 2P11A 4KLRA 1M5RA 2BEWB 3N28A 4PR3A 3K5PA 3D7MA 1M54A 2I34A 3WGJA 2EKPA 5EXEA 3VAYA 2P6UA 3DT8A 5K0BA 4EHLA 1N77A 3ZGOA 5TEWA 3K16A 2C7BA 2P2DA 2WNIA 1CXZA 3WDMA 1JBEA 2AN1A 1W35A 3OLWA 4IKEA 3VISA 5K6RA 3VI3B 1KBOA 4M0LA 4RTOA 5BWCA 1OSNA 1IN8A 4CF7A 3TLGB 3OY7A 4IDGA 2JZNA 5BYAA 3DEFA 1N2CB 4LECA 4DV4B 1Z62A 4GLBA 2YHBA 2ECOA 3BICA 3MLEA 3PDJA 2ZIFA 4IGEA 5KU1A 3SQOA 3FTPA 3PQDA 3CS3A 5TDHA 2OB2A 4J94A 3T9CA 4B4WA 1WU7A 3Q7RA 3ZIAD 1W36B 1JKIA 1YGPA 4BX8A 4ILEA 1I3MA 1LDEA 2OC4A 1XDSA 5CA1B 3P0JA 3OFNA 3A05A 4CMEA 2BGKA 1NC3A 5DN9A 2QY6A 5NLLA 2I2FA 1J8YF 4K9PA 1HZZA 2M98A 1H23A 3ADKA 5FUMA 3NANA 3FTFA 1CUWA 3FCAA 5A6VA 3GAMA 4M3NA 3WMGA 3IUJA 3G6KA 4XFDA 4L85A 4YR9A 3TIVA 4CCYB 3WL6A 1JH9A 1HKHA 1FTSA 4TYPA 2VEOA 3AIOA 1TEHA 4HJXA 2HJ9A 1DP4A 5ANRB 3TWOA 2QYHA 2UVPB 4EKGA 2IHTA 1LX7A 3DOEA 4FMBB 3KTOA 1GZ4A 1VI6A 1AUPA 2CXHA 4R3UC 4JLJA 4OK5A 4P0QB 2C98A 2SKCA 5LP6B 2YIVX 1YC5A 3OLXA 3S3TA 3P2YA 4YDHB 1ZN8A 2WG2A 4R2LA 2VTBA 1EFPA 1FUIA 2TMKA 3D9QX 4PLTA 2ZAIA 1MFZA 2Z1NA 1NXPA 3ZBTA 2QYOA 5F78A 1K6EA 2WICA 3H1GA 1LZKA 2PFKA 3HV0A 5KWEA 1PI3A 3OZTA 1JJFA 3SYKA 1IXSB 4MRVA 3WKBA 5EXPA 4CKEA 1ICIA 2PKWA 4N9QA 3I6MA 4DMLA 1XUOA 3PNYA 3FTCA 3KSRA 4IHJA 4N0EA 4PSAA 1CTQA 4XA8A 1V41E 2FVXA 4MH0R 2I29A 4QBHA 1XRLA 1SCAA 4YJHA 3IBSA 4B0OA 3NS7A 4ITVA 1K6JA 4MUAA 2XY4A 4TTPA 1Q91A 3H6KA 4Y18A 3WLMA 2GXQA 5LQAA 1G5QA 1QAOA 1WCV1 4UTVA 1YH3A 2XLBA 1GTG1 4F72A 4R1PA 5LFAA 1PNOA 5FEMA 4MITA 1XEWX 4KMMA 4F97A 2ID4A 1G64A 1REQA 3G79A 2PSSA 3KR9A 1NM5A 3E35A 4R51A 2V54A 2MCFA 3V6LA 2W2VA 3KUXA 5KYTA 1W7AA 3HCAA 8GPBA 1O77A 4BYGA 2IY9A 2IS1A 3V8VA 3PL1A 4D6XA 3CR3C 1T9BA 1S89A 2B5OA 1PZGA 1YVUA 2QP4A 3NWBA 4TUYB 5L3ZA 3S29A 1CR2A 3W5AA 1IU9A 5GVRA 4BIIA 2GK7A 3H97A 1IMJA 2WZDA 2VSXA 3ZHSA 2DQYA 3R2JA 2QBYB 3PD7A 1OA0A 1H22A 4YT2A 2ODBA 4URYR 4EQ6B 3FUVA 2JK1A 3RVJA 2CLSA 1V3UA 5EFOA 1FFGA 3C4VA 5AW9A 4BNLA 4JJKA 3RUEA 4EYGA 1T15A 5BQXA 4G24A 4P0TA 2DFKB 1BTOA 1USUA 4KGXA 4Q4DA 3RJMA 1P61B 3C24A 1EM8B 1U02A 1DLIA 4OHFA 4E08A 5JQWA 2ZI4A 1CLUA 4BNDB 1GOTA 4OK6A 3D4LA 1OLXB 2YS6A 4LJSA 3TLYA 1GQ2A 3CE9A 2JA2A 1R0SA 3ZGYA 2HDOA 1T0BA 3RKUA 3AHJA 5BOVA 1UKZA 5GJBA 4E21A 3L05A 2O8FB 4MV9A 1KMIY 2ODQA 2RGCA 3C5EA 5DLEA 1YTLA 2B99A 2ERXA 1KAQA 3P4XA 4M7RA 3DW1X 1R0YA 3DEYX 4GU5A 4W6QA 4WN3A 5IANA 2HW8A 4G4IA 1SNYA 1WZCA 3G49A 1KDTA 4TYMA 1OXUA 3R5JA 3HV2A 5H82A 3ZW9A 3OQNA 2XUKA 3I2JA 1GTMA 1HMPA 1U6JA 1KYIA 1DQZA 1XALA 2V6JA 1I4OA 3H1PA 2CNBA 1KJ9A 3LCVB 3AI2A 3M3PA 2QZPA 1JQJC 1SIOA 2L82A 3W4KA 1TQ6A 1ZQ9A 1SG9A 1F8UA 1KFEB 1P7VA 1FDWA 2QQEA 5J63A 5A1JA 5BURA 2AVDA 3D8UA 3ER6A 3SIRA 4EYEA 2FKAA 4LGVA 3TZQA 2N9UA 3ZD7A 4AUKA 1JKFA 3KDPA 4F21A 3FPKA 3H3XA 4QPPA 2R8EA 5K7SA 2Z08A 1KR2A 7MDHA 1H8HD 4CMIB 5ER6A 1LPBB 3G82C 1JQKA 4RO0A 2BCGY 3JQQA 1AU9A 3U56A 2DFNA 2J46A 421PA 2BISA 2YXBA 2YWCA 4TYYA 1TKRA 2XKJE 3IA2A 3ABOB 5ALQA 1BHJA 1EH5A 4O2BA 1DIGA 1GPYA 1K8ZB 2DHCA 4BO2A 5DLPA 1ITZA 1VKNA 5B6PA 5A7GA 2CE2X 4ZDIA 3TECE 3ROPA 3F8WA 2TECE 1IWBB 2M2IA 3LQ2A 4RD1A 3RI3A 4MYCA 1N7HA 1CUYA 1O58A 4XE5A 3UQYS 1FFCA 1F8GA 4G0PA 1ODTC 3W04A 4ZEWA 1NUSA 2FW1A 2I03A 2NZUG 1Z3IX 2FN4A 5B1DA 3GGDA 1G2PA 3LXXA 5CLJA 5THXA 1GTVA 1R2QA 1MO3A 1C3EA 1R6AA 3NHJA 4ZO7A 5FTKA 2ACVA 4IIJF 4HJRA 3UFXA 1OX5A 4HFMA 1PEDA 2BFEB 1IY0A 1GA6A 3VX4A 1RXEA 5CM8B 5A2QA 1PNQA 1L7XA 5AHRA 5BNFA 1FUKA 1KKLA 4P7BA 4EMBA 3DHNA 3LPAA 2IWRA 1Q0TA 4CIDA 4DCSA 3VR6A 3GQBA 2ZSDA 3HFRA 4GICA 1NMXA 4JKOA 2IEDA 4TLCA 4C0LA 1QKKA 2Q99A 5I9LA 3HKBB 3MXTA 2QIOA 4CMAA 3HXKA 1CR4A 2QVBA 3PT9A 4G41A 4P58A 4BLPA 4C2TA 3GLFE 4OM8A 2NTEA 5BWMA 3T1HB 2QAGA 2FN8A 1HEUA 3B36A 3IIMA 4TMTA 3ZY6A 1OBCA 3E84A 2Y0EA 1PFQA 1S5PA 3TOSA 4K1XA 4MROA 4XVUA 5FEUA 2JD0A 4ODIA 2WR8A 1HE8B 3DHYA 3LC2O 2G9VA 5FOSA 1CR1A 2PS0A 4MS4A 3WMWA 2X0FA 4OXKA 5HKAA 2VHUA 1OAOC 2VDKB 1DRJA 3DOIA 3NRCA 4BX0A 1UZAA 1LBEA 2CMKA 1YL5A 3D2LA 4YRPA 3AVXA 1BE6A 5HRCA 3OOSA 3TW6A 3IVAA 2R1VB 3CINA 3F8SA 1H3FA 3DAYA 2VO1A 3MRTA 3OOWA 3NHUA 1R8XA 3QTTA 4KXFB 3UVEA 3IXQA 3E9YA 5JDCC 1QANA 1QE0A 4DSOA 2V9PA 2AZMA 4OBEA 1JG7A 2AKAB 1NHGA 1X13A 1II8B 1JEJA 1PLKA 1PR4A 3AZPA 3FNQA 4YQEA 3NYIA 4ESVA 1CZOA 3OLVA 5ERGB 3E1GA 3F5MA 3IKJA 4J0EA 1VI5A 1YC2A 2GAIA 1U1CA 2J9FB 1O8CA 2VYQA 3BREA 3GG2A 2O05A 1ECGA 3KZXA 2VHVA 2FSUA 1ZUHA 3BMCB 4ZGWA 1ZM9A 4MQEA 1FP1D 3TCNA 1SHTX 2ZR9A 1D04A 4LRXA 3RSFA 2NPFA 3R8XA 4P84A 1JHDA 5E6RA 4ZAFA 4I8IA 3DBRA 3ES9A 3SIPA 2GYYA 3AVQA 3BT7A 5E9JA 2Q6KA 3FW1A 3GK3A 1LRKA 2NSDA 2VRBA 1M2VA 3LPNA 4FEGA 2QY9A 1J9EA 5GAJA 2XTMA 4LKOA 1D8TA 1K5HA 1OFVA 5EWJB 3WBFA 4UVIA 2C00A 2VF7A 4QX6A 2AOUA 3KT8A 2BKXA 2R1UA 3R3SA 4JN6B 4TLEA 5AVWA 4HLDA 1SWVA 4QQ8A 1I80A 1P9OA 2AOTA 2Q49A 3KQTA 4KUEA 2J9RA 5EQJB 5FBLB 5M3BA 1W94A 1P2UA 3CLTD 1ML3A 4X90A 1UBHS 2R86A 4XGQA 3PGMA 3DSRA 4Y6OA 5DNWA 2VWHA 3ZIDA 1NSYA 2V0GA 3H2KA 1U0JA 1OFIA 2XVYA 3HSYA 3V1MA 3MAAC 1CUUA 1Z08A 4CKWA 2H9IA 3NASA 4OPMA 3FOBA 2VXOA 4OBBA 4H2DA 3KK0A 1EUQA 2IV2X 3RSGA 1AGNA 1JEAA 4DNOA 3T5PA 2WJ6A 1QDEA 2ZJ4A 4KSYA 1G5RA 2O3JA 2V7GA 2WTXA 1ZIDA 3OEHA 4YJ2F 3SC6A 2GSWA 4ZPJA 4EF5A 4CWAA 3F6EX 1N6PA 3FSRA 3IRUA 4F2GA 4HTFA 2A67A 1S4MA 1EXWA 4QGFA 3T3NA 4NCBA 1BEEA 4NMXB 1XCMA 3FUWA 4RD6A 1JE1A 1XDBA 1D6NA 3TPZA 3KUCA 2QAJA 4HRYA 5ECYA 4BFSA 4C7MA 1WXXA 2AJTA 1PGQA 3ZV3A 4QKQA 3AEUB 1LXCA 1JQBA 3DUFB 3I04M 1T10A 4L74A 3USZA 4OHVA 4BJHB 1WETA 2H63A 1C1YA 4ZDKA 1D4ZA 2D1QA 2G4CA 3ZHZA 1CS0B 2H2IA 1KIFA 3D6VA 3HNRA 3F4BA 3K3PA 1V1JA 3E7DA 4RVOA 2ZXUA 3CVVA 4WEQA 1B41A 2NTNA 2C58A 4C29A 5CFPA 3GMIA 1IBCA 4UM8B 4ZCQA 3ZX4A 4PHTA 3EW9A 1LEHA 1Y8AA 3W9BA 5K8IA 2OPHA 4GL2A 1GDDA 2O9JA 5CFQA 1Z26A 1DE0A 1RU3A 3V6MA 1F1JA 1T5IA 1D6JA 2F3QA 2YYYA 3O8CA 2DQ4A 2X0KA 3B52X 2GAJA 5IF3A 3HU1A 2YV2A 3L7JA 3UXEA 3H5LA 4FDLA 4H15A 5IAOA 3U1BA 2O50A 2EZ8A 3CUEF 3DT6A 4BO9A 5B2FA 2AZDA 4JGBA 3JQAB 2O8CB 1QO9A 3HJHA 5CB4A 5I3CA 4RH0A 4QNMA 4UASA 4Q1CA 1G19A 1NJSA 1JHQA 1QKJA 1UFKA 3WYEA 4DW8A 3F6RA 4Y2QA 3JXEA 5J43A 5M34A 5GINE 5K8JB 3F1KA 2A14A 2VNHA 1FFBA 2PKQP 2XT6A 2H9YA 1NRWA 4G1MB 4RPLA 3K70B 3I8OA 2CNWD 3LO8A 3KQOA 3ZWNA 4F12A 3GLFB 1F2UB 5HKLA 3TB6A 2YJZA 1TUBA 4GECA 3TI9A 1GFZA 2XNCA 4IVPA 1XCBA 1YDHA 1DOHA 4GS5A 2NPOA 3CNLA 4Q12A 4DRYA 4QOHA 3V55A 2YRXA 5JD4A 4P22A 4F6CA 3RKSA 4DXHA 1PEYA 4BTEA 2OB1A 3G88A 2DT5A 1PBTA 2VUHB 1SPBS 2AI2A 4MS3A 4B73A 4YV0A 3ANXA 3DMHA 1FTYA 5CCXA 1IN4A 1V16A 4YGXB 1EDOA 1CRZA 3HLKA 3THXB 5DYTA 3DP7A 4JP5A 5T41A 1MENA 2O8EB 4QBFA 1ZR2A 3QPAA 4RHCA 2WIBA 2YY5A 3O9ZA 1E2LA 3IEMA 2C9OA 5DW0A 2FJUA 2PQMA 4OLHA 1J09A 3BGWA 3UJ8A 4NH0A 2CFOA 1ORTA 4Q3KA 5ED0A 1GZVA 2IW1A 1Q92A 3M1AA 3QOXA 2JFFA 1C30A 1UIMA 2LRHA 1ECFA 2DR3A 3UPTA 5A06A 2CLOB 5HPYB 1R66A 1A0OA 4L5AA 3AERB 2PX2A 4MWOA 1P2SA 2O8BB 2WD7A 1PQWA 1QZUA 1GITA 4UEJA 1C9NA 1E77A 2ODWA 1L0BA 2J31A 5EE9A 3TXYA 4E6PA 1SUAA 3KT6A 4H6WA 4BNXA 3MCAA 4W1QA 4OX9Y 1XZNA 3NP9A 3DZFA 3W90A 1W88B 2WUFA 1SCNE 1WMSA 2ANBA 3IJPA 3UICA 1SRRA 2WC1A 5HMMA 3FPEA 3ZYCA 3P2IA 1YZGA 2WSBA 5DNUA 3ZLJA 1KO1A 1NXVA 2GJ4A 2IYVA 3MRSA 2C2YA 1MB4A 3WGGA 3IHTA 3QWHA 3VC2A 2XVMA 4NEHB 4FQ5A 2SCUA 3I1YA 4U4AA 2ASVA 4WASA 4YRFA 4F2PA 1LPSA 1X39A 4DV0B 5EERA 4OXNA 2ZE5A 3BTOA 1JNXX 1TOAA 1EAMA 1UPUA 1ZG3A 4LW8A 4RJJA 1A27A 1L7VC 1MV5A 1JEDA 2AE1A 2G7ZA 3DR5A 3ETJA 4BASA 4CQMA 1PKEA 1DINA 1P5RA 1N9KA 1SCIA 2D1TA 1SD1A 3HACA 3LF2A 1MT0A 2Q7DA 4Q6WA 4MPRA 4KDEA 1ZIYA 3CNQS 2WUGA 2GZDA 3WB1A 4XUDA 1XPOA 2GTHA 3HFJA 4MW5A 1U8FO 3BS4A 1MQSA 3UHAA 2UVQA 2IF0A 1Z34A 3RIXA 3B6ZA 5A7FA 1RWKA 2QP3A 1KHHA 2ZJ0A 1CQPA 2G40A 3M81A 1N32B 2DPMA 3BDIA 4AX4A 1F38A 3EUEA 4EI8A 3NAGA 4PHHA 5I7FA 1H94A 5JQGA 5M7EA 2RHCA 4KXWA 1EP1B 4O4LA 2FFQA 4RKFA 1KY3A 2PX5A 4P2GA 2A86A 3HZRA 2NT3A 2C96A 3IUPA 2UZ1A 3EY9A 4JH0A 3F7NA 2ZAYA 3SZMA 4M0FA 3M82A 4Y1EA 5AW7A 1G6KA 3EZ6A 5FD8A 3N1UA 5DBIA 3UA4A 3S81A 2UUCB 3ZK7A 4D45A 4HQKA 3R75A 5FLXA 1QMPA 1H0SA 1VLVA 4X3OA 1GA4A 2C7QA 2P4SA 4HDMA 3UHPA 1JAZA 1GAQA 4DBVO 3H5TA 4KAXA 2BOVA 3VQTA 2PZMA 3L43A 1UP6A 2QUZA 1E0KA 1YL7A 3ZG6A 3ZS9A 4UU7A 4P83A 1FFAA 3OY2A 5JH7B 1N36B 1CQIA 3ZR4B 3HJTA 5BV8A 3OIDA 4FLEA 3PXEA 3OX2A 4HEHA 1LJ8A 5JWRA 4P7KA 3H4MA 3IHWA 5CG1A 3D3EA 1Q3TA 3PFBA 5EFZA 3S2GA 5HP4A 4B9AA 3M0EA 2XD9A 3FYTA 4YP9A 2WFAA 3S2SA 2E85A 4OSEA 1GZHB 1KYZA 4V1CA 2OCGA 3QSGA 1NTRA 4H7KA 4I2NA 1QWOA 4CIYA 4B7CA 3FGZA 4PX5A 1JG6A 1H2XA 5TE9A 2PNJA 3USES 1OTXA 2XMBA 2ZYSA 1FXSA 4Z9FA 1W75A 2V0CA 2E4VA 1X7XB 5JYDA 2DBRA 3IB3A 5EPOA 2VJYA 3ANLA 3W5IA 3ILYA 4LQ4A 4KOEC 4R01A 2H5EA 1QXSA 2CFIA 2VRNA 1QCDA 3EXHB 2FMKA 2QROA 2YN4A 3PUVA 3LT1A 3OQPA 3WYGA 4CR8A 4F91B 1NG1A 3PZBA 4BO4A 3BKXA 4N3GA 1PSZA 3RFVA 3AUYA 4D5GA 2W42A 1ZEJA 5KJ6A 4MV4A 1PJBA 1JU9A 2PT7A 5L45A 4JI7B 1G8YA 3TXAA 2JKYA 2ZZKA 4LY9A 1AHPA 1YR8A 1CZRA 3F5QA 4DR2B 1U90A 2Q9BA 4BFXA 3NMUF 3A1UA 3UIEA 1IOWA 1TTPB 1A96A 2A0YA 1XMIA 4P3OA 3DBHB 4Q0MA 4QQFA 4YJ3B 4ENQA 1W34A 1N9GA 4YP1A 3V4FA 2BMJA 1GNQA 3KVVA 3NNNA 3OD1A 3D2AA 3F98A 4Q3LA 1GLGA 2JFXA 1PJSA 2OAQ1 3GMDA 4N0QA 2PRSA 2RIRA 2G5PA 4BOYA 3LWBA 3O8QB 2ZKLA 2ZPUA 4WN9A 4D96A 3TUZC 2C03A 3WY9A 2DJ5A 3HCEA 4QQNA 1PR6A 1Z2EA 2AGVA 4IO1A 5L3SA 4OHCA 2I6FA 2HWKA 4EBBA 3A3NA 4N7BA 1ZGHA 1GVHA 2ZUDA 1VDZA 1PHPA 1U2ZA 1IM5A 1N5JA 1L6RA 2G8LA 2GUGA 3DTTA 1UJCA 2W2KA 1Z5NA 2C0QA 1FPMA 1K5PA 2ZWIA 2QX6A 3LDGA 4J0DA 5JW6A 2CLDX 2E6UX 4CKXA 4E31A 1RDFA 1IUNA 1TT5B 2Z5GA 2HUNA 3HP7A 4MQLA 1R0XA 2HSJA 2GEDA 3EGDB 4LZAA 2X0DA 4NU8X 5BUSA 1CUCA 1F2DA 4I5FA 1IZ8A 4LDNA 3K0BA 5J23A 1SK9A 3CBGA 1MRZA 1KQNA 1GPUA 4GKVA 3WHKA 3LY9A 4OD0A 4RPCA 2BUBA 4DJJA 4TZTA 4MWCA 4V0KA 3HDGA 1O97C 2GKSA 1J2RA 4R8MA 1UJBA 3H65A 4YCDA 1B7GO 2GJAA 2ZIEA 5E7MA 1NUUA 1SU6A 3EDQA 5K4AA 3MXOA 1HLDA 1HYGA 1L5QA 3PXUA 2BHRA 1XROA 1ZI8A 2AN3A 4J49A 1CYDA 1TFRA 2WZCA 3F96A 4K6GA 4PG5A 1KDVA 1QP7A 1J5XA 4ONEA 1VLHA 1OFHA 1JPNA 1ZS9A 2P77A 3DTVB 4X8OA 3IVMA 4Y7DA 9LDBA 1LJUA 4BY9E 3WK8A 2V7PA 3MVEA 2P4EA 1ARZA 1ENOA 4G0NA 3I5XA 1J07A 3W8EA 1YI1A 1YZYA 5JZSA 1MH1A 5HCIA 1JHPA 1ZISA 4YJFB 3RT9A 4KR3A 1MZVA 2R9VA 1NQUA 2C95A 3BAZA 5JCOC 4DABA 4B87A 2W93A 3KXPA 3L04A 3R0VA 3RKRA 2G9NA 1SQ6A 4OTZA 5B7NA 2PH3A 1TU3A 2E49A 4QWMA 4B81A 2QW8A 3RFTA 2PRIA 1XLTC 3T99A 1VP3A 5COBA 6Q21A 4ER6A 3WISA 3N87A 5FBWB 1QE5A 2HJSA 4OM7A 4QTXA 4B40A 1HQDA 4M6WB 5I5EA 1JSRA 1RXIA 3BN3A 4EGFA 4LRWA 5EHXA 5IDVA 1F14A 1AVTA 3G0CA 2W5UA 1MQ9A 3BTVA 4MI9A 2YHSA 5D84A 1KO8A 5K8LA 4G86A 3JATA 2XUHA 2NTVA 3W7VA 1BJRE 4KRFA 5AJZA 4UMEA 1XQYA 4IVQA 3RIYA 1IY2A 3A9UA 3HJNA 3NTOA 1JFSA 2OEPA 2Q0QA 3DG9A 3LO5A 4UC0A 4AMVA 3ELDA 5LWQA 3QX3A 1H8HA 4XM0A 3HA2A 4UHHA 2ZT6A 4AN4A 1I7QB 2GEFA 1AXRA 3KEQA 4ZWNA 4MV7A 4REQA 2ICAA 3R5FA 4XIJA 4LOLA 1X80A 4N01A 1C3XA 1EE2A 1FNCA 1T5OA 1V9CA 4W7SA 2J5RA 2JLVA 5C35A 1I51A 2VP4A 2VK8A 3KM0A 5JXHA 2HFKA 5T4HA 2C57A 1E9EA 3SVZA 3W1WA 3LRTA 4EG4A 3LWDA 4JJ8A 5JXJA 4BRZA 2WIDA 1UQTA 4GRIA 5EUMA 1RM5A 4TYQA 2I3ZA 4YECA 4ZVOA 1FDRA 5BR4A 1R00A 2IUTA 3G0IA 4IEEA 2F8LA 1WDMA 3SP1A 3MWEB 3WFJA 2AKEA 2ENWA 2C59A 3D3KA 4X6LA 4UQPA 3CKMA 2B8WA 3VC7A 3FTEA 4C88A 2B4YA 3EODA 3LP5A 3MCUA 4JEHA 3RW9A 1QIEA 4JI5B 2HDNB 2OENG 2PUFA 4UVDA 3DDHA 1CETA 3ZHXA 1KARA 2H2FA 3I2IA 1M0TA 2LWIA 3DCNA 4RLQA 4UULA 3VJLA 4B47A 4ZMBA 3OQOA 3M1YA 3IPAA 4WJZA 1J20A 4QASA 1P80A 2RHMA 3ML1A 4HBGA 5EL0A 1OI2A 4HDRA 3OQVA 3I61A 3MAGA 1S2DA 4FN4A 3ZE1B 3I4LA 4EA6A 4IJVA 3D8BA 4BMXA 1C5KA 4CKCA 2GKOA 1PFYA 2YX1A 2CE7A 4IDBA 1NVKA 4J0IA 4EG5A 4C07A 4ZIRA 5M2QA 3H0CA 3L5KA 4ENPA 1KKUA 2AX4A 4BP9A 1A4UA 4PAGA 1US8B 1GVNB 5BN5B 4QOGA 5ALEA 3W5JA 2FMTA 2VPQA 3GRAA 5KKNB 5CW1A 1ZM4A 1Y5IA 1U0SY 2QW1A 3ZNQA 3ZI0A 1W0JD 1VC2A 2IUSA 2C5AA 1E9AA 3DNMA 4G5XA 3EAQA 1SCDA 1UPAA 4HN2A 2EW8A 4N9WA 4XQGA 1R4MA 1JQ5A 1Z0SA 4C4ZA 1TO2E 4LWZA 3HXLA 1HWYA 5FQNA 3E5NA 2CVOA 4R05A 4DQDA 4UNSA 3DB2A 2X0IA 4JJGA 1LQUA 3ABRB 1QYCA 1ACJA 2VYVD 1Q5PA 4CDGA 3UWOA 2IQ5A 2H9AA 4JB2A 1NT4A 1L1FA 2Z3ZA 1C3JA 3HB7A 4H0CA 3L06A 4NX2A 2BR4A 5AT1A 3HY4A 4ZU1X 3PC7A 3X1KA 2HYIC 3OUUA 4YREA 5D5QA 3ESYA 3O3CA 1BXZA 4X1YA 2K7FA 2AUMA 1O8BA 3RNLA 4XQCA 1QV9A 1EWTA 5CW2A 3AP2A 3EWSA 3IPYA 1JIJA 3L7AA 1SU4A 1WDWB 1H2RS 4FKMA 4OI4A 1K98A 5ALIA 5DYIA 1ZH4A 5EPUA 4E46A 1JIXA 2PGLA 3VH3A 3KR2A 4BVEA 9LDTA 3WLRA 4JOSA 4B79A 5K3AA 1R50A 1JZQA 1NDUA 2HA4A 4CKBA 2QLMA 4X6UA 2GFQA 2X3UA 3R7BA 1IWPB 3MCZA 2GETA 2PPLA 1A2QA 1EXNA 3U2QA 5KQMA 2F43A 3LUBA 2WJPA 3HJCA 1EQUA 1D07A 4DN6A 1U9YA 2HPZA 1R4ZA 2PH1A 4D9NA 1QG6A 3RFCA 1CEEA 3U4DA 2JJQA 1WU8A 4LI0A 5JCJA 1T5SA 3GX1A 3G85A 2XOXA 2ET6A 4LF8B 3EZ2A 2O2HA 2D6FA 3M70A 4HB3A 5K45A 2V5AA 4AJ9A 2APJA 2ACEA 2WZBA 1GEEA 1X1SA 2BRUA 2KWIA 3QPCA 3LNCA 1J5PA 1Z18A 1HYEA 4ECAA 3VHXA 1FQOA 3HYTA 4JR2A 4QE3A 3O7WA 2P5SA 5KTKA 1ZK4A 1L5ZA 2UAGA 3FSJX 1W52X 3CV3A 1IOZA 1CJBA 2OXFA 2MMGA 5COAA 2ZIXA 4QUGA 1RC8A 2JIBA 3KUKA 3ND6A 1CUSA 4HMPA 6LDHA 5IKMA 3ICQB 2WAAA 2CT8A 3PKZA 3PUZA 5AHWA 4JBWA 1B16A 2KMLA 4TV9F 4IHKA 2Q3DA 2W43A 3FJOA 2YXDA 3HEBA 1GKKA 4N18A 3ZY3A 3LA6A 2X8WA 3VKWA 2Y4OA 1H6BA 1WHTA 1P7PA 1KOJA 2G80A 2LR0A 4JLNA 1U3DA 3W9YA 1GTZA 3FI9A 5LLSA 2DR0A 1KZHA 3GZTB 3G7NA 4PC1A 2XB9A 1GGVA 4AJPA 4QGAA 5CIQA 5CA0B 2I4IA 2MDTA 4Q7JB 3DLPX 721PA 3S7ZA 1XVLA 1OHHD 1S3SA 3DDOA 2GCOB 3E2MA 4MPDA 5CH3A 4ZARA 5HZHA 2NO0A 5KNBD 1Z74A 3FKSA 1Y3HA 4EX6A 2IHYA 2IYRA 4JX8A 1W4ZA 4L5YA 1ZMXA 4HAYA 1EE1A 1QFJA 4AS2A 1SK8A 5JG7A 3X1YA 1NOJA 2OLKA 4BO5A 1T6YA 4BN0A 3D59A 3VHLB 1O6ZA 2G8NA 3D0KA 3VJMA 4FKZA 2DH6A 4PZUA 2ZTSA 2A9OA 4WINA 3SZLA 4HX2A 4L1KA 4DCCA 1UP7A 3BERA 4TGLA 3RYHB 2R2GA 3T7JA 1FQKA 1JKJA 2IU3A 2VAPA 4ZDWA 1PEKE 1PL8A 5B3JA 2ZREA 4UM5A 4ALKA 4INJA 3ZIUA 1AKUA 1HX7A 5JMPA 1R88A 3CPSA 3NTXA 3PJEA 3NNSA 3RS4A 2VJBA 1Z6AA 2CXOA 1TQDA 4I55F 3ADDA 3GDFA 4EY4A 2A94A 3LUGA 2WYIA 5CEFA 3PNSA 3RJZA 1A1VA 2GPTA 5AJYA 4NDNE 2VC2B 3MTJA 1FL9A 4D4IA 1MZPA 1NR5A 2I3GA 5J3JA 5AKEA 4ZVQA 4FNMA 2HA3A 4N7JA 4EJ0A 3HWRA 5ITZA 4PWZA 3HGMA 4RDCA 3R9XB 4I1IA 4YH1A 2Z83A 1Z13A 3CT6A 1IY9A 4X7PA 4X5OA 2BIFA 5ARBA 1NFQA 3F5DA 1RYHA 4H7JA 4FX2A 3PT5A 4BDSA 4CPDA 2GN8A 4C0WA 5J2UA 1JG1A 2EJCA 1PWXA 2D8AA 3QXGA 1G8AA 3RS7A 1TQ2A 5KOJA 1X2BA 1DL5A 2FGJA 1NASA 3B9RA 2ZTMA 2DWQA 3CB2A 3N2GB 4IMIB 3LLSA 3KYCB 2HIHA 1GUFA 4MMZB 2VAMA 4OJYA 1O87A 3P8ZA 4XJVA 5L7YA 4G2TA 3TX2A 3ZE8A 4EG7A 1DEXA 3DWEX 3OCYA 4ZTZB 1WBBA 1FX0A 4KMOA 4MQFA 4Y30A 1PK9A 4OA8A 3C8HA 4ZCLA 2BGMA 2HD4A 3IEUA 2YWGA 2ATCA 4FDTA 2QN8A 1A9TA 1OX4B 1HH4A 3VKFA 4EX7A 5BOSB 1P3JA 3DGFC 3NATA 3ID6C 5EP4A 3WGYA 3QVTA 3PG5A 4INOA 5CMLA 3R7SA 2G04A 2UXBB 3DV0A 1I5RA 1SBQA 3FPSA 3PE6A 3I42A 3NIGB 3RK0A 4R9UC 4W9RA 2PK3A 3X44A 1IEQA 5GONA 4US2R 2EIXA 4RA9A 1Z7EA 2PGOA 4G1CA 4AM8A 1TM2A 4OU5A 4Z8YA 1M1YE 3DMTC 3NHKA 4G89A 1W48A 2IQIA 1Y7TA 5CVDA 4X41A 4CU5A 1YRYE 5ITWA 4A6EA 2OMEA 4D9MA 2J87A 4GD3Q 2Y67A 1RJGA 1ZCAA 4JDPA 3WTBA 1XU7A 1F5NA 1IMOA 3L7LA 1E9CA 4UTRA 1Y4ZA 8LDHA 4KJXA 5DTIA 1D6MA 5CGQB 4G1UC 4M99A 2E6KA 1MJGM 1EDEA 2BH9A 4NS1A 4D0NA 3C6XA 1NOIA 1Q0QA 4C0BA 4G8JA 3RU7A 2FSVA 4XX0A 3TNYA 4L9SA 1ADCA 2YN2A 4TTRA 4CMJA 2IYQA 3A9CA 1JHUA 2JARA 3AI7A 4DRXB 2G7MC 2VT3A 2DFPA 1ZVJA 2PQ6A 4UHJA 2Z9BA 5ALUA 3IBTA 2PLWA 3UK0A 1YB7A 1Y34E 3IPLA 4JUFA 3S2FA 5LQDA 1Y3AA 2IHNA 1N8SA 1XL0A 4ZCRA 1H6DA 4EKYA 1BH2A 1E5TA 1ZC3A 2RHHA 3G2QA 4LVUA 4MP6A 3K8QA 4DNFA 3QF4A 4DMUB 5L40A 1Y4UA 3R0QA 3RFFA 2F9FA 3PUWA 3DAFA 4M8KA 1XLUA 5KYKA 3PVSA 2XVAA 5FTWA 1YSCA 3DS8A 3TRKA 1AMNA 3ZWDA 2WAXA 5T8KA 1SA0A 4QUDA 5G0VA 3SI7A 1Y9DA 4BNZA 4EZEA 2H1WA 4N0MA 2AEJA 3DD1A 3A70A 5FL3A 4BZXA 3CPEA 1D1PA 3F90A 1BH6A 4MV6A 4GQAA 1P9WA 1WIWA 2HEGA 1Q0RA 2P5TB 2QTAA 1WZ2A 2MR5A 4WLVA 1E9BA 5IFKA 3GCZA 2X1LA 4Q4HB 3JPYA 4JBYA 2BCEA 2IUUA 4BIMA 1DVRA 1C81A 3MBOA 1FDVA 4EHDA 4JU8A 2Q5JA 4AK9A 1YR3A 2EFDB 1BW9B 1UMBA 1XCJA 2WM2A 3CCBA 4TKVB 5I9BA 5TT0A 3TVTA 3V4ZA 4XB6B 2GZAA 2ZRPA 2BSXA 4JQOA 4TTTS 3HA5A 4MKZA 5BMVF 5E1OA 1ADBA 1DC4A 3LPDA 1W1IA 3WP0A 4ZJPA 5AKZA 3OJCA 3U6BA 1K4MA 4MAFA 3WB0A 4EPXA 2CVPA 2WHQA 2QL7A 5LSAA 1ABBA 1X92A 1VE9A 1DUIA 1PX2A 2ZB4A 1ZOLA 4H08A 4XYGA 3VR4D 5IVHA 1XD8A 3KHTA 4IXTA 5AH0A 2Q4EA 2VAXA 2YWFA 4HWPA 2OYRA 3A6KA 3SFTA 3FPLA 2C5EA 4I4TB 3HB4X 1K4KA 2NXWA 2D4HA 1JJAA 2WHEA 3K4QA 1KGDA 3K0HA 2NNWB 4QOEA 5FV7A 5B6IA 1OMOA 3X2FA 2HH9A 4E2ZA 2Z6UA 3AM1A 2FMIA 4JMPA 2RGNA 2VLBA 3OX1A 3DZ8A 4UMDA 1UT8A 2WSYB 2ZTLA 1KP2A 2G71A 2BTQA 2XEDA 1D7OA 4GLFA 4OMDA 3WKEA 4ZVPA 2GA9A 3BQMB 2B92A 3Q40A 2XYHA 1UPBA 2R1TB 3EGXB 1NMZA 4BZZA 2FJPA 2NO6A 4FXPA 1VG0B 1T2NA 4K6OA 4PPGA 1EP2B 5C32A 3IV6A 1SXJE 5AI4A 1GPMA 4AN1A 3E9RA 3F4LA 2OV3A 4Q34A 4RJ2A 2O8VA 4YI5A 2VDJA 2XGOA 4ACAA 4ENRA 1T8SA 5TGTA 3TZCA 4C7OB 5TMPA 2WIGA 1ISJA 1C8VB 1FUUA 2HSEA 2ID7A 4KRGA 4WLFA 5FFFA 4BFTA 4J8PA 5BNZA 5LZ9A 1ZK0A 2PX3A 1M6YA 3PEYA 4K6FA 1M2JA 3HVKA 2QAIA 2P9TA 1I1HA 3DE3X 3NYQA 2QG9A 2W70A 2J6HA 4OBXA 2PJRA 4R54A 3GIWA 1T2UA 4M46A 5EEHA 1CHNA 2I2DA 1EDBA 4D8UA 1EDDA 3NUQA 3QI7A 2VYCA 3UAGA 2GI4A 2BGTA 2HMAA 5IT5A 5HRUA 1M1YB 3HY6A 4MWSA 3HADA 4YX9A 4P6VF 1U8ZA 2A2ZA 2FSHA 1XSEA 2O3SA 1QLHA 2VTDA 1BXRB 2ZRGA 3LW8A 2CHVA 1GRVA 1IAVA 1J99A 1GGNA 4MYTA 4Q3BA 4R8KA 1ISRA 3ZE7A 5HKKD 1J0BA 2XCQA 2XAAA 1FMJA 1E5XA 1JFTA 5E3JA 1AF4A 5J2TB 1XMOB 2GARA 3PLRA 2DBZA 3RRFA 2NUPB 4OJMX 4Z9YA 1N33B 2VFAA 1ESMA 3KPUA 4HZIA 1V96A 3CGGA 1PYGA 2SICE 5J4YA 5BSFA 1S2IA 3IKLA 2E4UA 1XV5A 3V80A 3ANNA 3W5BA 3KAPA 4D3YA 4EVIA 4Q03A 5CU7A 5T4FA 3U7QB 5CB8A 1RYDA 2W37A 1FW6A 3BXOA 2HF2A 2D1YA 1YT5A 1ZONA 2I6TA 3KXDA 3P19A 1PDWA 2FP4B 4QBIA 4HGRA 1UWLA 3ABSB 5C8VA 2ANCA 1QZZA 4KIFA 1ZUNA 2BHLA 5JSKA 1Y5RA 1YQTA 4RDIA 3AM4A 1GKLA 4V0RA 1FFEA 3BUSA 3X1DA 4NU0A 1PJZA 1GYQA 1F1BA 2C2HA 2WJHA 3D6JA 3PTZA 2QUAA 3MS2A 4LJ6A 4E5MA 5IAAA 3C87A 1W5EA 3OTHA 4FW8A 3CUTA 3M3DA 2I9KA 4QA9A 4C89A 1N4AA 1MQAA 5ALZA 3SXUB 1M6EX 1P5HA 3EC2A 5INTA 4OHBA 4O4JF 4TKUB 1L7NA 1SOUA 4IOJA 4KE7A 4LRSB 4GRDA 1VJGA 3ICWA 5FBRB 4F71A 3HP4A 4CIWA 3DPUA 1AO0A 4EYQA 1E66A 3AVVA 3H4VA 2VH1A 1IZZA 5TXGA 1ZN9A 1AZTA 2GBIA 4D9IA 4EHJA 1LPMA 1CUGA 2VF8A 3ZQJA 1P17A 4D57A 3DW3X 3PNLA 5CDUA 1NJ5A 4XEUA 3QK7A 3FXAA 3NT4A 4GDFA 1KJYA 5D3MB 2IDZA 2QOEA 1KI9A 1MAUA 1YACA 2Y4NA 3FTQA 4M9CA 4Y6QA 3VZSA 1JB9A 3U16A 2Y3IA 2F00A 3AB8A 4B3CA 1E96A 1YHNA 4LYFA 4DIBA 1VHWA 1K7FB 2IU0A 2VWPA 1OXXK 4JJZA 2H5JA 3KE9A 3NR2A 4RUKA 5CYPA 2EX4A 2EQBA 2OBNA 1YAHA 2QRQA 3PEEA 3I0ZA 1SEVA 1UBKS 5EHZA 3OIYA 5ITVA 1U63A 2O2IA 2P62A 5H8WA 1DG3A 2NU6B 3K6JA 2C3OA 4J1TC 3K70C 3PHCA 2XVZA 5IDWA 2PGJA 4N5IX 5F1OA 3AESB 3RVNA 4WRRA 3ON5A 2G0NA 4CM7A 3Q3IA 4FCCA 4YUYA 1TJNA 1I2AA 3PR2B 3NIFB 3RNOA 1EHCA 3BL8A 3U31A 4PNEA 3LUPA 1F0NA 1MH9A 7ABPA 3MGKA 1XVTA 2IKSA 3AV3A 3M9LA 3I2HA 4LXXA 1N8NA 1TJYA 1ZGCA 2WLTA 3S70A 1USVA 1FS5A 1TIBA 4LSWA 3GZNB 3H75A 1VXRA 1I2MA 1SXJB 4P86A 2CEKA 3QFTA 2DH5A 3IUMA 3T3IA 4DC0A 4KFCA 1CQJB 3SXPA 2XOEA 4OP3A 5JZVA 1H2FA 3D1LA 3REFA 3MMNA 1WOMA 1B26A 4N12A 1QPGA 2Q9UA 3DULA 2B9VA 3H11B 5EN4A 3B20A 4EHKA 1R6DA 4RQBA 5FUYA 4YRLA 4DLWA 5D1NA 1NSTA 1DAMA 2FN7A 1QRSA 1MHPA 4IIBA 2XCSB 4LHEA 5IEJA 1UKVY 4MYUA 4D44A 2C5GA 2N46A 2NSJA 5FUVA 2C3YA 1QK4A 1LK7A 4JT4A 1WV0A 1JHRA 2WDPA 3H8VA 3GD5A 2G76A 4KAAA 1E1MA 2H1FA 1H4TA 4D9EA 2V6GA 2I71A 4K88A 3TR6A 1M73E 3D8TA 3HL0A 3QUAA 1U7UA 4JA2A 3RC9A 1J2JA 3WSWA 1TYDE 5EJFA 4D9GA 4L8FA 2VYVA 4U39A 2RBEA 3E2PA 3TTUA 5E3HA 4PX9A 4F1JA 4A8JB 2WM9B 3PRHA 3KTAA 5H80A 3C7AA 3GFTA 3RUIA 3KO8A 1LVGA 2YS7A 3B9QA 3SSNA 1F6DA 1TJ4A 5HNKA 1TMYA 1M2OA 2WF6A 3MSXA 2E4YA 5BVHB 4BKRA 1VCNA 1QZXA 1UOPA 4G0ZA 4O63O 3K6SB 1YAJA 1AM4D 3NCTA 2GNPA 3BMOA 3W0LB 2QLJA 2V6IA 2RAFA 1I9GA 1X3SA 1YWGO 1FTQA 1TRHA 2JHPA 4RD3A 3AVWA 2QZ4A 4JLMA 3K9FC 2XTNA 1YA8A 3MSCA 4U7GA 2GSDA 2H2DA 3QV1A 5FPYA 2Y2VA 4EHNA 5JCXA 1JLRA 1LQTA 2ZIGA 4EGCB 3OKCA 1K0FA 3FZNA 4UZFA 1MORA 1UDRA 2VXYA 3LFUA 2VN8A 5LA6B 1QPBA 3UG7A 3T5AA 3IAM6 3KLBA 4NSNA 4W63A 3U3ZA 3TAXA 1I14A 1Q0SA 2UYGA 4YQZA 2AW5A 3EC1A 3ZXUB 3NIWA 4FYJA 5C0OE 3K0CC 3N07A 4NG4A 3H17A 3T38A 4JROA 2ZAMA 3CRNA 4QBKA 2X5JO 1CUFA 4RFSB 4TRRA 4CMKA 2MSCB 4NTZA 3IR6A 5JALA 3DMDA 2YQ5A 3K9GA 3LE8A 4MCHA 3ZK8A 4DDHA 5ILOA 1NNSA 2C2OA 2F64A 2H1HA 1KETA 2QVLA 3JD3A 1V37A 4KU4A 1A82A 1STOA 2W6CX 3RS8A 3SDZA 4D7AA 1PV4A 1TCBA 1FJ2A 5JO9A 4JI1B 1JYEA 3HN2A 4XASA 4N76A 3NB0A 1HDZA 2CL6X 3V4VB 3PSAA 4K9QA 1XPRA 4MA5A 3NBAA 3LP8A 4DSUA 1QR2A 4IDFA 4ZQFA 4M49A 3FHOA 4B4DA 5DM4A 4CMBA 4CM4B 4W9MC 2HLNA 3W79A 2FUCA 5IMSA 5A5EA 2H7YA 1LC3A 4FM9A 4HQ0A 1S8OA 4LSGA 2ZOSA 3TQHA 1NVFA 3G9XA 2VZ9A 5HIMA 1R64A 3VV3A 1EU1A 3X43A 1JXAA 1ULHA 1TZBA 4CUKA 4C7XA 5KMGB 1HDEA 2QTCA 1NJGA 1EDZA 3EZGA 5DTEA 5MGBA 4EZBA 1IG0A 3PX2A 1I5OA 4QODA 2BEVB 3ZBPA 3ZUGA 2BP7B 5FPTA 3A9TA 1W5FA 3PE4A 2C1XA 2A8YA 4JQSA 1E9VA 4D9KA 2LVBA 1M5UA 1OHHA 4JZYA 5B6JA 1JLLB 5CYOA 3GMTA 5CXUA 5KNBA 2ZANA 2BF4A 5B5SA 2ECQA 5D51S 4LJAA 4TXMA 5E6SA 5LMUB 3WZLA 3N0TA 3IJRA 4A0GA 4RABA 1T6BY 1QC5A 4EUEA 2MSKA 3Q7EA 3U3MA 1CT9A 3FX2A 2B1QA 1YRWA 1VHQA 2ZBDA 1G0NA 3B6MA 3DBVO 3N0VA 3VA7A 3EXHC 3GB9A 3M9XA 3BE4A 4E12A 2ZJZA 4FNAA 2VTKA 2CXNA 5DCUA 5H83A 1BS9A 3A2KA 1RQGA 4ZODA 2BJHA 4LI3X 3WRYC 1RWNA 3E5HA 4XTCS 3QBTA 4YJ2B 1T9DA 2V65A 1PW7A 3NVDA 4TRMA 3TOVA 3U40A 3S8YA 4W8HA 1NI4A 2HIMA 2PBFA 3VSBA 1LLCA 5IJZA 4EPVA 4E30A 5JANA 3MWGA 3ZGXA 1FJHA 3L6BA 4R1QA 3QVXA 1Z22A 1G38A 1W2HA 4W5OA 2C9BA 3H9QA 4LXYA 1X7WB 2Q5OA 2OO5C 3FLMA 2PYIA 3WGOA 1ZK1A 4BAGA 1MR3F 3KXKA 3MJHA 4D8WA 3LUFA 1H5NA 2DULA 3GVHA 3UH1A 3UMJA 4L2IB 4C5BA 5DNCA 1TTQB 2JFUA 3CH4B 3K0AB 3OZVA 4UMFA 2FB9A 2FPSA 5L6LB 1A2KC 3SKVA 2ZLBA 4N7MA 2ZUSA 1NNUA 1ZNQO 2ONCA 3CX3A 4E32A 4PS0A 1L3BA 4ZVVA 4BHTA 1Z16A 3OPYA 1WUKS 4AQ7A 5DLQC 1QMGA 1F9EA 4R7ZA 4G5HA 2CMGA 2DWCA 1V1MA 4JJ4A 1IPHA 4WCDA 2REBA 3PDWA 5E0KB 1MW8X 2POCA 3PNBA 5J4HA 5KYWB 4KHZA 2HHLA 5BRNA 3GO4A 3BD9A 2ZCJA 5IBQA 3ZHBA 4DMGA 5BNIA 3ZWMA 4FGUA 4B6FA 1OBOA 4GX0A 5FLEX 5CLIA 2YJ3A 1W44A 3O1IC 3UWDA 3X1MA 3GJZA 1NURA 3WBJA 1FNBA 3DHEA 1SKQA 3RT1A 1QQ5A 3WKAA 2A57A 3ZVKA 2EFGA 1NVEA 2NSLA 2VT7A 3E22A 1NYTA 2YFKA 3CRQA 4M0PA 1KEWA 2ZU0C 2YHIA 3KLPX 4ZALA 3AJ8A 2HV9A 4HAWA 1Z4MA 4HGNA 5GP1A 4YAGA 1IATA 3MUOA 2NWQA 3Q12A 1PYOA 4BMCA 3SMVA 2AXEA 4FONA 1P0QA 2EATA 2RBGA 4E2YA 4ZYXA 3DE5X 5EMKA 4CM3A 4YMUA 3HVHA 1EFVB 4RANA 4G63A 1RPZA 1D6SA 2R79A 2PMDA 5LZ7A 2RSLA 3LI2A 1B6GA 1AURA 3HYNA 5T5QA 2IWHA 4BTLA 2B8NA 4Y9RA 5IJ9B 1NW8A 1QIMA 1VA5A 3NNDA 1LK0A 2RHGB 2IYYA 1MU0A 1VECA 1HFWA 4HDAA 3EH2A 3WXMA 2IUYA 1DWQA 3ED1A 2FF7A 4IUYA 3T5GA 3OF2A 3SN6A 3V7YA 3QM1A 1NJFA 5D1HA 2GKGA 2BVNA 1L1QA 5DHUA 3BWYA 1XIVA 2ZUVA 4X62B 3FCUB 3OQBA 2JGRA 2EJUA 4JFAA 4H1HA 5KJ1A 3AF3A 4DV6B 2QYTA 4KVAA 4KEAA 1MOQA 5GJWC 5IEBA 5F23A 1N6IA 2QN1A 4CODB 2GBLC 3SHTA 4B17A 4DV7B 4MVJE 1E5LA 3DMFA 1IBKB 1ZJYA 5FI3A 4NL4H 4NMLA 4OB7A 2P1DA 4L3OA 1QX3A 2PX0A 3LKZA 5C52B 1VYHA 3HEMA 4V38A 4JXXA 3SE7A 1ORWA 4C7VA 1GUYA 3HKDB 3EEOA 4F3TA 3IAS6 4KAFA 3SQLA 3D02A 1TYZA 4BO7A 4Q3OA 3GELA 4F6RA 5BN4A 3FBGA 1PWEA 2JFGA 1R5BA 2VPTA 3LQYA 5LDGA 3U1VA 1Z2PX 5C5EA 1JHYA 3KKKA 3AEKB 4CQLA 4MQ5A 3TS1A 5I3ZA 5KREA 3ONVA 3KVYA 1Q7GA 2JFVA 4PQGA 5E6UB 3RVLA 2RC6A 5TB5A 1ENPA 1V2GA 3L84A 4H1WA 1NBIA 2ZYIA 4M1KA 3ZLVA 3Q3CA 4E5VA 5KOIA 2QTWB 2DOKA 1EIWA 2I7DA 3O1JC 2J3HA 5ALKA 3ROQA 4JVLA 1YFKA 2QRHA 4ZOLF 4LDRA 1OI4A 4GWKA 5AKGA 4DSTA 1GZ7A 2EZUA 4MB6A 5K0GA 2WNHA 3ANSA 2XUGA 2ZUEA 3CUWA 5A2GA 5KS2A 3NEYA 3GDWA 1NVVR 5FWDA 3AJRA 2RD2A 4HS4A 1J4AA 3JASB 3NUGA 4KPUB 5FNVF 5CCDA 3U17A 5TX7A 4PVDA 1PL6A 3NORA 4HDQB 1Z6ZA 2ZRAA 3IAUA 4WA8A 4WOKA 3HS3A 3RK4A 4CTJA 3FUUA 1BRMA 5D5HA 1SXGA 3OJ0A 4NYMR 5GGXA 3ROGA 3GDGA 4OSPA 1FYWA 3ED5A 2OA0A 1JVBA 4YXFA 2RIPA 3COYA 5AVQA 3HJUA 1DKNA 4KAJA 3R09A 3IXMA 2PFSA 2OQ2A 3EW7A 5M04A 2XB4A 6YASA 1TD1A 3ILVA 3LHIA 4L4YA 4HY3A 2HDHA 5FYQA 3GFRA 2Q8NA 3WB2A 3ZXIA 5KYUB 4GPBA 1XRRA 2H29A 3C41J 3QTLA 4ZA2A 3FPBA 1GPJA 2ZRJA 4AIRA 1LRLA 2OPBA 1S2GA 2JFNA 1XEXB 2QK4A 4KKXB 5ELMA 1E7QA 1X70A 3P9PA 1YONA 1ULSA 3K05A 4RIIA 1JAXA 1QGUB 4PU0A 3OBIA 4Q1AA 4UKDA 1C29B 1JS1X 3DGEC 3RUPA 4YRCA 1M6WA 1ZESA 1JU4A 2BF7A 1I1NA 4KFRA 4PZ0A 5AJHA 4MR8A 4JT8A 4BVHA 2IU4A 1DAKA 3COSA 4DFDA 3C6BA 4MDYA 3ZXXA 2P9YA 1XRNA 4U8GA 1O95C 5KJFA 3SJ7A 4IJUA 1QGZA 4TV8A 3SJZA 3BPSA 1RKQA 3CU5A 4ZC1A 1AX9A 5L7TA 1ILEA 1L8QA 1YQGA 4RX1A 2PTGA 4CG0A 4DRZA 4W7HA 1EI9A 1QHXA 4YO8A 1NYLA 3I3OA 4RMNA 1DIAA 5FTNA 2ZI3A 4Z3OA 2AF4C 3C5CA 5DX1A 3TQTA 2GF2A 1Y3CE 3ULKA 1Z5UA 2YV4A 3EG9B 2CF6A 4UDXX 2ZTHA 3M7IA 4FWBA 3LL7A 2XT9A 1ZXXA 4I1RA 1R0WA 1WB4A 2A1UB 4PYJA 1C0EA 4MQMA 4EDFA 2WU1A 1HNZB 3R8FA 4YRAA 5JJCA 3JQCA 3KEOA 5ALLA 4ZTBA 3B89A 4KYIB 4FGKA 3CWCA 2CFCA 4MZDA 4G5OA 1ST2A 1C2TA 4WK4B 1Q1ZA 1RLOA 4H6VA 2A9RA 3O8RA 3IE0A 3HP1A 2C4KA 1BGXT 2C99A 5FJIA 5KAPA 3TLKA 3PQCA 5JD5A 5TPWA 3QLUC 1XP5A 3BF7A 2V1UA 3V2HA 3ZKWA 4XIFA 3A3YA 4KK3A 4D42A 1PFUA 3A36A 3PB3A 1Q0ZA 2QRGA 4MVJM 4DUGD 2OG2A 4LPSA 2HXSA 4X91A 4GLOA 4Z2AA 1RW4A 2MMCA 2Q3FA 3HMQA 1R4NB 1JEQA 3WLKX 5AVUA 1P19A 2AYYA 3AFOA 1C7QA 3UA3A 4P92A 4B4KA 4UARA 2YW9A 4C4XA 1KAMA 3ZOZA 4N3AA 1Z0KA 2PT6A 2C1ZA 3MIZA 1HG0A 4FHCA 5FO0A 4D3ZA 5ES4B 2B6HA 2JZOA 2PXHA 3NTRA 4CLRA 4DV1B 4Z1OA 2I62A 2HPHA 2R84A 2QMZA 3P0EA 1W36D 1TM1E 2W48A 1MC1A 1X14A 4K46A 1X7HA 5EGNA 3RJ9A 1NX6A 1Z8HA 4ND2A 1CY2A 5F7JA 2VJPA 1WOYA 1AQNA 4YJGA 1K6IA 1RKBA 4O2BF 4DKXA 3NJ4A 2ZJBA 1GKYA 2DQSA 3PIIA 5BRJA 1G8JA 3WZMA 1KTVA 1MOSA 2AX3A 3I9FA 2PYZA 4IGAA 4AZ3A 1KBZA 3VYUB 4QG7A 4B6QA 1P6UA 2WYUA 3B51X 1QQAA 3KVRA 1F2VA 4LZJA 4RVUA 3NJRA 3ZWXA 1DKMA 2CC2A 2EJVA 3HDHA 2VPZA 4B44A 3ESZA 4DLXA 4IQ4A 4FCVA 3RV4A 1SD5A 1IN5A 1Z68A 1I0IA 1W0CA 3OM9A 1L4HA 3HRHA 4R69A 4W1SA 1A9RA 2PM8A 2XUPA 4FT4A 3R7AA 2MIIA 1FBTA 2QD5A 3MBKA 4QLBA 1IQUA 3WLLA 4EYOA 3WB9A 3ZS8A 1SUBA 2EP8A 1BROA 1P81A 2FZLA 3QW2A 2O2XA 3L01A 5AJUA 5IP5A 3DDWA 1SVSA 2HJVA 3E3NA 3GNLA 2DECA 3AF1A 1EK5A 1SY7A 3WNQA 3E58A 4QUJA 3QPDA 1EMDA 3V7FA 3AVYA 1WPQA 3CSUA 4BLVA 4JCOA 3TZHA 3RC1A 4IUDS 1F0KA 4QUHA 1E8DA 3SDSA 1NN5A 3COVA 4Y67A 4ZGGA 3T4UA 2PYDA 5FQOA 1CX9B 4G07A 4M7WA 1SURA 5C1OA 1V4NA 2P75A 2J3LA 2EBFX 3G2IA 4XVQA 2IV3A 3RYFB 3UMYA 1X0VA 5HOEA 4DCVA 3WNVA 3EIQA 1X1CA 2A9JA 4HLQB 2A1TS 4GPTA 4L22A 2IH2A 2H85A 4WBXC 8ADHA 5DI9A 2Q4BA 2H7CA 3K9LA 4GXNA 4MIOA 4HXYA 1F9AA 1M5TA 2I4TA 2ZETA 4S1NA 4ZT3A 1XVVA 3T5CA 1IB0A 1QYDA 4M1EA 1KNXA 1KZYC 5DMHA 1CIJA 4OQDA 4MS1B 4WDQA 2FSFA 1WTAA 5JEDA 3T3DA 4EMSA 1I1OA 3DZCA 3WJAA 3LK7A 2RGDA 3ZCQA 3JQGB 2J41A 2WHRA 1XDUA 2DPXA 3QU5A 4FBGA 4CBVA 3B1ZA 1T26A 3PEUA 1VE1A 3WQSB 3X0DA 4RVFA 1OFGA 3FZQA 3PR1A 3DM5A 4MR9A 5ILGA 4DR7B 1WUIS 2B98A 1P0FA 1QRRA 2DHEA 2C5BA 2B1RA 3IP5A 1EUDA 1A50B 1CFZA 1IJBA 4FD3A 4NVRA 3QKRB 1K63A 4C4RA 4OLBA 2V1XA 3M34A 1AGXA 4JHXA 2GCEA 1I4EB 1P2FA 3S28A 3MQFA 3NYRA 1DXQA 4ZAVA 3ADPA 3TTYA 3VUEA 2B0CA 1GCAA 3DV2A 3IEKA 4D81A 1VLZA 3L4EA 1H4SA 4OAQA 2WJAA 1WEHA 3H9JA 4RPHA 4C6TA 1BDBA 3FNRA 2YV5A 2I8AA 1SC9A 3BRQA 3CY6A 3TRJA 5IN4A 4AXBA 4RE6A 2C7OA 2IS2A 2WJYA 3TG2A 1E1CB 2BFBA 5DN6D 3SS9X 1RBYA 1GU0A 3MLAA 3IAM1 4GOKA 1MTOA 1HOTA 3G2OA 3ESCA 3PA6A 4GC9A 5B7QA 1I3OA 1JDBC 2EP5A 1ZJ5A 2IPOA 4YLGA 2BZGA 1KI8A 3OFJA 5BNWA 2PQ0A 4AJEA 2J67A 3KQSA 5CB0A 4F5ZA 1CB7A 1BD3A 4EL5A 2PKQO 3MLBA 1JYFA 1FVFA 1UXOA 3KJZA 5EG5A 4FILA 2J3DA 2WWRA 2L0XA 2O7QA 2QRVA 2O3RA 2OXTA 2ZT8A 4X7BA 4F6LA 3LIIA 4ENWA 3LX8A 5CVCA 2QUKA 5HKBA 4DPLA 1JDVA 1MN6A 4KLZA 3QFFA 2AJBA 5ALPA 3KE8A 4GMKA 4J90A 1E98A 4TZ0A 1DJLA 5BSKA 3CFYA 4IP0A 3BFVA 1V8FA 3N6XA 1NSFA 4TMFA 5AJVB 3CLUD 2IOHA 2Y6VA 3LBHA 3W6NA 1D7AA 3ZDBA 1J56A 3TW4A 1TVKB 4TN5A 2I99A 3HCNA 1GNRA 1SB8A 3DDUA 4HZUB 2OHHA 2PLNA 3CSDA 2O06A 4HNQA 1L7EA 4JJEA 3RODA 2O2SA 1CDEA 4I9UA 3KYBA 5JT1A 4V1CI 1SIBE 1JA0A 1G3UA 1VKJA 1KO5A 2QNBA 1CC1S 3G5TA 2WT8A 4G8DA 3O26A 2O2DA 3R3XA 1HTTA 3CSSA 3OOEA 2VDLB 4B8WA 4BX9A 4P4SB 3VX3A 1U9CA 4R2IA 5IJ0A 4XCXA 4YVFA 1TZCA 2O23A 1Y8RB 2ENUA 5LBTA 5A3QA 3GRZA 1DJOA 4ZYTA 3ORHA 1WSBA 3C8MA 1G9XA 2JRLA 1C8KA 3ZE6A 3P9NA 1ECJA 2D0IA 3AEQA 3EC7A 3EGCA 3DVRX 1E79A 1WABA 5YASA 4B0PA 1MIHA 3LIPA 4GPZA 1E2IA 1OGIA 5E38A 1XKQA 4HYYA 1E9SA 5TQ2B 4XFKA 1NKTA 2FPPA 2YJ6A 2LTAA 1UINA 2QXYA 2R47A 2O8DA 4V0OA 1OJ7A 3MMZA 2BH2A 1EFDN 2IYFA 3OCWA 2GXAA 2NVWA 4EUHA 1NW5A 2Y1FA 1M34A 2FK7A 5GIPE 4HKTA 4EJFA 1LBTA 4R8SA 2W6NA 3AR2A 1DS6A 1P4SA 5EE5B 1RRPA 2Q4DA 1RHQA 2EEZA 3EIWA 5H02A 4HMOA 4HRVA 3KQKA 1WZNA 4U0KA 2NGRA 4WBNB 1RHUA 4JU9A 2J59A 3ZLTA 1A71A 2NSHA 5CB4F 1ZUD1 5DXFA 2Y68A 4EY5A 4QTZA 4D6PA 1EP9A 3U4QB 3OX3A 4IXWA 1T8WA 4A82A 3D8HA 2ZR0A 4AKTA 1UZMA 4HFJA 1QS0A 3HSKA 5JY6A 2D5LA 3LOUA 5KJCA 5HF5A 5K3SA 4FYIA 4NNOA 3ENZA 2ZRQA 3TNLA 2YBDA 4DPKA 3W7AA 2DKOA 1XTZA 2B83A 4NCJA 2F1HA 3AEYA 4DLUA 4LAFA 1AA9A 4DOMA 1CJCA 3PNPA 3L4KA 4CXMA 5F5NA 2KX7A 3CUUA 5GY7A 3EGWA 1ANKA 3F1LA 2J7KA 2NU9A 2VTVA 3LBFA 3DBLA 3QQ5A 3WJ7A 3NXSA 1K8XB 1BEUB 5JD3A 4MKGA 3GFSA 4S12A 1S2LA 1VPDA 2W0MA 4UUBA 2XE6A 3ETGA 2WUWE 2J9YB 2HPVA 5HK9A 1W4BA 4PZZA 4EHHA 4TYNA 1HYBA 3O74A 5C1DA 3FCXA 3LGAA 2H8KA 3ZW8A 3OI7A 2ZDQA 2Y1LA 3AR5A 1E99A 1T43A 1I8TA 1W8IA 4MJ3A 5EZYA 4CIAA 3BRWD 3RAGA 3TPCA 1FRFS 2DETA 3LVFO 1PQYA 1HF3A 3DH0A 2PKEA 1Y9JA 5EWLA 5L3RA 3M6MD 1LDGA 2HQRA 2XXAA 5LQSA 3GJRA 1U9IC 1NUTA 5JPCA 1RZ3A 1YZTA 3C6YA 3JQRA 4PZEA 3SEQA 4L5JA 4TV9B 4Y2UA 3P0IA 1YASA 3C5HA 3R5TA 1K27A 2GK6A 2PWPA 3GYGA 1OOEA 1X7ZA 2NUBA 4LJ4A 3AUSA 5DDIP 3OCXA 3TVYA 3VYVA 4ALMA 4B6SA 5KWVA 3E7FA 4DG9A 2UYCA 1RE1A 2JLBA 3P2MA 2DERA 1RWPA 2ZYRA 2GPWA 1G63A 4MDFA 1T9GR 2CHUA 1VB3A 4O02B 1K8QA 1OT3A 3OIWA 5C4IA 3UV6A 3KKNA 3REQA 2W2LD 4HH0A 4P2BA 4GLJA 3ZHUA 1QYWA 5I4KA 2EFHB 1XF1A 2HRQA 4N3BA 4DJ5X 3CZAA 3EOAI 3TR0A 3TSZA 3VZBA 4J76A 4E5DA 2HBZA 1EXDA 1LWNA 1JDNA 4LXQA 1EVLA 3PSHA 4K9DA 2FZGA 5K20A 4RKQA 1RJEA 2GVNA 4AG3A 2ZYAA 3NT5A 2HX1A 1ZIPA 7YASA 3VDRA 1I2CA 4YRDA 4PIMA 4UXIA 2JIRA 2GZHA 1R0LA 2YIMA 5BSEA 4Y2SA 1U5BB 3DVAB 1KEEB 1M7GA 1Y48E 2IKQA 2QTNA 4HX9A 4QOFA 4CLDA 4MJXA 2IP1A 1TAUA 3D4OA 4XARA 4AB1A 4F92B 2VK4A 5AKKA 3O4HA 3Q6MA 3TM4A 3KZ1E 3ZUPA 2CLLB 1ZDMA 5REQA 2QD2A 1E9DA 1KYVA 1UDXA 3IAS1 4HVTA 4J0KA 3GJ8A 2I2CA 3AHDA 4BN5A 5JCOA 3HU3A 2BGJA 2X9QA 4FB5A 5KVCA 3C3DA 3MELA 3RS9A 4J4HA 1J2YA 3DJYA 4ER3A 4L73A 1XNHA 2PZ8A 4YDQA 5HHTA 5JQGF 1GPAA 4NARA 1WCIB 4O4LF 4Z53A 1FP7A 1YS9A 4JI8B 3WJ2A 1VYTA 2QS9A 1JF8A 2X2EA 2H00A 1TL7C 2A7QA 3FPGA 3S2ZA 5DM0A 3Q1KA 2XT0A 2XUOA 1RQLA 1ZMTA 1E32A 5LQMA 4ZOLA 4JC4A 1ZOOA 4KQGA 3VH4A 3RGGA 3QYPA 1XLVA 2WIAA 1DEHA 4CR6A 2COKA 3Q8XB 4MA4A 4YMTA 1CQZA 1HQKA 1BHQ1 2ODNA 5KHAA 5MDHA 4KVGA 5BV7A 1CE8B 1L4LA 1NIPA 1TADA 4KO4S 4MUIA 1N5LA 4N5NA 1SBHA 1GA1A 4R2KA 3O0TA 3ZY2A 2ON6A 2PXAA 1XBTA 3BBLA 4KK4A 5EIBC 2A9VA 3IKVA 4BGIA 2QB5A 3GLUA 2JFZA 1RHJA 4AUNA 1TC1A 4GZMA 4BBJA 1IXYA 2QSYA 3CEAA 1A8HA 5KDLA 5H7XA 3F47A 4HUQB 4WTOA 2UKDA 3TF5A 4UUQA 2C29D 5KTPA 4WMLA 1B00A 2IZZA 4XPIB 3Q72A 4NXNB 2D2IA 3GWZA 1XMQB 1OZAA 3DV9A 3CWQA 1P1RA 1TQ4A 3PC4A 3RO7A 3KG2A 5D7NA 2WRZA 3BK1A 3JU3A 4NZ9A 5EMHA 4B3FX 2JFWA 3PGKA 1PZEA 4FEEA 2ECFA 4N5HX 4F5YA 4AS1A 2HA2A 3AUKA 2ONZA 2JIMA 1TZKA 3LPLA 8ATCA 3K70D 1DHTA 1ZOPA 3DYBA 5EP3A 3PZRA 4HEA6 3U3DA 5JY1A 4XZ3A 3CUVA 3K35A 5FA6A 4BGUA 4RHFA 3ZCXA 2CV2A 2VWQA 5I9NA 3G1WA 3RVDA 4CEHB 4FGSA 4C4OA 3KPJA 4NULA 4A27A 3U4HA 1NNI1 2VNIA 2ZJ8A 1DBWA 2VSOA 3AL3A 3KXLA 4IF6A 1NPTO 4YAUA 1CY7A 1U7TA 1VLMA 2Y9PB 1XKXA 3PDIB 2VQFB 4MPTA 1EM6A 3GJ4A 3P9IA 4Z7QB 4YRQA 1H05A 1C9DB 3A3KA 4QICA 1IN7A 1X1DA 5DM1A 3M6XA 3FROA 3WDLA 4GKBA 1ODLA 4KG7A 4GAEA 4PQEA 4LGMA 3ZNPA 2Z09A 1LU9A 2B5WA 3KUUA 2OWDA 4JJFA 1WAMA 2X6RA 3ISVA 2FZEA 3OT4A 3JVUA 1N8TA 3C1UA 4GPAA 3BFXA 4KP7A 5H1YA 4MQ6A 3E8XA 4XJTA 4DNQA 2Z8XA 3W5DA 3QXHA 1ONPA 4G85A 4MP8A 4OIFA 3FR8A 5BW4A 4CMEC 4CRWB 1QYRA 2QTMA 3UZUA 3GVCA 2OAP1 3L7OA 4BKQA 4D9JA 4LVOA 1RXUA 1U1IA 2X86A 3R5HA 2R5NA 2WSIA 2XUFA 2ZWVA 1FYXA 1GLNA 2BMDA 3L6EA 3MJEA 2OO7A 3OZEA 1ULTA 2H7XA 5AP9A 4LJLA 3RU3A 4AJLA 3BDAA 4FXOA 1YDMA 4QNNA 1G18A 1E20A 1PUJA 2WSMA 4G5RA 1PSWA 2ZB7A 3C3JA 4M9SA 4PLZA 1VHLA 3AX6A 1XYGA 4AAYA 3LC7O 4GKJB 1SXJC 1UFRA 5HM8A 3RBXA 2X0RA 4INAA 4IWXA 3HB9A 4PGAA 1XXHA 4UHCA 2H31A 2PT5A 4BP8A 3NXKA 1GSHA 1TGYA 4UD2A 3AGPA 3WMFA 1WX1A 1MABB 1LTQA 2JBWA 1WS6A 1L7AA 1E7WA 5LMNB 3HBMA 1PWYE 2FPLA 4K9SA 1W8DA 4C3VA 5KJEA 3OE7D 3GH3A 1HUQA 1QAQA 1MUUA 4LJ7A 4UEWA 2L42A 4NABA 5G0WA 2OGWA 4ALJA 4IAOA 5C5IA 3BC1A 4NJOA 4XM1A 1QVAA 3WV4A 4FHGA 4IX9A 2OE2A 2I1QA 2UV8A 4WZAA 2BFMA 1NZDA 4Y2PA 2WWXA 2WE8A 1GAXA 3IP3A 3TLEA 3T1TA 1PVVA 5GV8A 3D0OA 1FDTA 1D2GA 4F86A 3JR7A 3ICOA 2BEWA 4JLDA 5J4VA 1ONOA 2GFIA 4A8JC 3JD1A 3FYCA 3T1NA 4B71A 3WS7A 1S1MA 4C1NA 3MC1A 2L2QA 5C1BA 4M1WA 1OTHA 2GAFA 4XOUA 3KV3O 3RFXA 3IEIA 2X42A 2ZZNA 1GDTA 2JCYA 3PU6A 3SLKA 4RTKA 4BE4A 4RGBA 1TF2A 5C37A 4NONA 1IEWA 2N42A 3TLGA 4WV3A 2I7XA 4DUGA 2C1EA 1GZUA 2DRIA 2E5WA 2Y0BA 3NAQA 1P6QA 2IOYA 2JJYA 2GMWA 5ADVA 1N2CA 4FDUA 3ZK9A 2OZLB 2NO9A 2RMKA 4S1WA 1AUQA 5L4LA 3T3PB 3ZWKA 5EUCA 3HZHA 1Y7HA 2VG8A 3GLGE 1YQQA 3Q85A 4BAZA 5TF0A 2WU8A 5IT4A 4UOQA 3QYAA 2YYAA 2XUQA 4M7OA 2OD9A 4DZRA 4CMGA 4NAHA 1G3MA 3QWIA 3UXYA 1RVV1 3D5TA 4TL9A 4DSZA 4G36A 1ZVMA 1G291 5CA1A 4H1VA 3BQNB 1ZBDA 5JNSA 2QZSA 1SCBA 3W3AH 3R9KA 1MJ5A 3C1TA 2AN9A 2B6NA 3GPBA 3C3MA 4ZAXA 3JQ8B 2VP6A 5FO1A 3ZOKA 4U9IS 4JP3A 4L50A 1VZ3A 4N0DA 4NJEB 5CVJA 2OXIA 4B6GA 4R1UA 2H65A 3A1WA 3T3HA 2JGLA 4PZCA 3DZDA 5GOZA 4P4TA 2WFMA 2C7VA 1HQCA 2NXJA 1J0AA 1EEXB 2YYZA 3DKRA 4Y6RA 3SEAA 3PC2A 1PD1A 3W3AD 1LTKA 1XQ1A 4CCYA 4YLYA 3E7PA 2GN4A 5ESXA 3JZMA 4IKOA 1GNPA 3IERA 4XPZA 4N39A 4IWNA 1ZOIA 2UVPA 5EJ5A 1TVCA 2CXTA 3G5UA 1RWXA 3WLTA 1U98A 5E7IA 1DJMA 5EI5A 3RARA 4DKJA 4DWJA 1IZ7A 5LP6A 1DO2A 1AT1A 2X3YA 2C9MA 3DONA 3L7KA 1VPWA 5E2IA 5PNTA 1X9IA 2QYSA 2Q21A 1B3BA 4YB8A 5TV2A 3PITA 1NLZA 3PCRB 1O4WA 3VNRA 2P7HA 3BRSA 5AM2A 4G0WA 3JQ6A 4AF8A 1OXBB 2XKKA 3UAZA 1U3WA 3QP9A 4Y1FA 1JQLB 5I9TA 4B3GA 1MF7A 1S7CA 3JW8A 4WXEA 2HO5A 2OTCA 3C0KA 3I9KA 3N5CA 5TMBA 5JNWA 1PS0A 1Z29A 1ZNXA 5J9FA 4U2BA 3P9ZA 4QIHA 1U0GA 1VSVA 2CXSA 2X9GA 2P4UA 1N2IA 3FDZB 2H8GA 4U2CA 3TW8B 1J21A 3PEWA 1B6SA 5KDOA 3NYWA 3OESA 2B36A 1QYVA 3DYVA 4BMOB 4B45A 4GVXA 4FFDA 2QMOA 1RHRA 2ZT5A 4E11A 1TGVA 4IJWA 1PJTA 4M9ZA 1OYYA 4KN9S 2DFTA 1UJ6A 2JZCA 5IUKC 3VDMA 3NDRA 4H60A 5BPHA 3EFEA 5H59A 2KI5A 2P4HX 2MTBA 1Z83A 4G5QA 1MX1A 5EC8A 4IG4A 3ZTWA 4JD5A 3ZZMA 1OVGA 2H1LA 4DQVA 2G1KA 2NYVA 1CWUA 2HQOA 2JDID 1XCGB 3DMRA 1SOWA 3F9RA 4BPRA 4BWFB 3S5JA 3QVUA 4CU2A 4XJXA 1PL0A 5B7GA 3LDUA 4TUYA 2G9RA 4NPCA 1E9RA 3S5UA 4YPOA 3BZBA 3OKFA 4V2IA 1DDGA 4WADA 4GC5A 5HFAA 5IT0A 4UUNA 3NPMA 2QBYA 3GN1A 3U80A 4O3MA 4JLOA 2XHZA 4FMDF 1P18A 3NRJA 5BT9A 4EQ6A 5HJ2A 3DHVA 4JJ7A 3CEMA 1UK9A 2Q1UA 1GG9A 3TTXA 1MB2A 1EZZA 2MWMA 3T0GA 4DCUA 5KTSA 1Y7PA 4M89A 1INLA 2IGTA 3NJ8A 2EFCB 3DTVD 2RGUA 1EM8A 3A58B 4NDAA 4HYQA 3V1UA 3UAVA 3VOTA 3WMEA 4BNDA 4PY2A 1GQQA 1OLXA 2C5FA 2PSDA 3DMTA 1WMAA 2CBGA 3GL9A 3HJBA 1XZKA 1Z47A 2QGFA 5BW6B 6NULA 1ZHFA 1V26A 3EQ6A 2FDRA 2JLAA 3UWMA 3WXBA 2XUJA 1L5MA 1MGPA 3FB4A 1Y3DE 3LBIA 2PV0A 2VH5R 2BEKA 2ZK7A 3W5UA 2O8FA 1M6VB 3EA0A 1TK2A 1XJ0A 2VKQA 3GUZA 3HKEB 3MT9A 3A4TA 4N8SA 4A5SA 1V4VA 2D06A 3QU7A 2H7VA 2IOFK 2CUZA 4JWKA 1B74A 3P97A 4L4ZA 3TR5A 4C3OB 1NHWA 4P82A 3PGXA 2P67A 1E1KA 3OE1A 1E2GA 3KPYA 3UMRA 1EWVA 4R5HA 3BB1A 1QFMA 2OCAA 2BJWA 2M1XA 2V8BA 3EIHA 2YR0A 3Q87B 3AJDA 2NU8B 4DJTA 3KQLA 1ULUA 1LSJA 3WYFA 1PNRA 3E70C 3GCDA 3MWKA 3W4IA 5BQOA 5DHPA 5BR8B 5E2BA 1TAHA 1OXSC 4F06A 1GGHA 1V48A 3Q2KA 1YMVA 2VCYA 2NP6A 5FR1A 1TTTA 3KJHA 2EOAA 2J6CA 3K1ZA 1SHUX 2GVDC 1UMKA 2ZIZA 4BFVA 4PBTA 3GLGB 4HH4A 1DEAA 2VSQA 4ZKDA 3O82A 521PA 1XXLA 4CMIA 3VH1A 3CVWA 1Q6YA 1IPFA 3CJTA 2ABWA 3CRW1 3WLIA 1BFDA 4RVHA 3OQHA 4BLRA 1AKWA 3GFPA 4J0FA 3NRBA 5K51A 3NHAA 4JUBA 1I01A 1W1UA 2HUPA 2GPJA 2I2BA 4UQLA 1NXOA 2HY7A 1GWNA 1NVDA 4GIBA 3U19A 3L4BC 1PGPA 1RPJA 2QN2A 2I4MA 2TRSB 1ZMBA 2JFQA 3AHEA 5THQA 4TTIA 4CCSA 3GBPA 1ZCBA 2YZKA 2AHRA 4Q21A 3F5SA 4B2IA 4IIDA 1YIAA 3TZBA 4W1PA 3EXAA 1Z5GA 5C31A 3EN0A 3LYUA 2CW5A 1FY2A 2YC2C 5SYMA 4EA7A 2OILA 2KS6A 1XN4A 4PGFA 5JZMA 3WGUA 1UP4A 5HKKA 3KXIA 3H3FA 1YKGA 4IY1A 4GE3A 1RAFA 1QK3A 3F49S 1OA1A 2J1LA 2BFEA 1VZ2A 3A14A 3G9ZA 2HCRA 4FPXA 5DBEX 3C14C 2XADA 4LC1A 4PSVA 2XRZA 1EUZA 1SC6A 1MA0A 1V25A 5FYDA 3WR5A 5EE0A 3Q2IA 2QM0A 2G17A 2O2EA 4DL9A 3EDCA 3MJFA 3ZH2A 3HNOA 4Q3EA 3SC4A 3HKBA 1FSFA 2J7PD 2JH3A 4JOBA 2V5VA 2DHQA 1CDOA 3LAWA 3GVXA 3PDHA 1Y6FA 1Y82A 4L08A 4KNWA 4WCFB 3WK4A 1IJFA 1GN9A 1NUHA 2VJCA 1SIWA 5DCLA 2YICA 3N9IA 6REQB 1KY4A 3L7MA 2JI6A 3HGTA 2BWJA 2R5WA 1Y6JA 4DCOA 3K2EA 4KQXA 2F59A 4BEWA 5LNK1 2R7MA 1NNEA 4D6YA 2AZ4A 1U2GA 3H4TA 1Y4SA 3FHJA 3QPWA 1ZHHA 2WJWA 1P4GA 5DOVA 3L79A 4HQNA 5J2UF 1FLNA 4PPFA 4LZWA 3TFWA 1PR9A 4DBLE 3HDYA 3V1NA 1HDXA 3M49A 1YR1A 3WBKA 3NPAA 2O19A 4KBYA 3NKVA 3U0BA 4R5MA 4LMPA 4M88A 2QQ0A 5ICMA 3DEJA 1OH7A 1AO3A 2P2NA 1KI6B 3NTUA 5HMLA 2Y6UA 3TYXA 1GHTA 2R4UA 4L6CA 2R1VA 3SS7X 4IOLA 5B3AA 2YQ4A 5HGXA 4LDPA 1N1EA 1VJTA 3OCJA 5I7HA 1HE5A 3SGLA 3V46A 4XWKA 5A9SB 1JQ3A 3WAKA 5AWFC 1II8A 3I23A 1UBMS 3O2QB 1Z7YA 2NZVG 3S2EA 1H2EA 1S4QA 2P8SA 4TM8A 3L9WA 2CVZA 3W2FA 5DNDA 1D0VA 4WECA 3ZU2A 2BONA 3N8HA 1QRDA 2J9FA 4KX5A 4QREA 4B32A 2GD1O 3OP1A 1LLQA 3BMCA 4LDJA 3ZN2A 3I05A 3A1NA 2BJVA 1D03A 2Z4SA 2ZRNA 3OOJA 4XQ9A 5GJCA 4KL8S 5FLKA 4OQQA 3V32A 2QHXA 2UU9B 3ELYA 4C14A 2W2LA 3KAQA 3L1JA 4UDYX 3FLAA 3UXMA 1THGA 3QXSA 4KYTA 2KW5A 1SKAA 2WP0A 3TL3A 3L4SO 2XPCA 2YWBA 4YRMA 3AUJB 1GZDA 1DDOA 3H2GA 1T3GA 3B78A 3BRCA 3DMNA 1E3WB 4UNPA 5EWJA 1SVOA 3IH5A 5BW8A 5LD2C 4A73A 1BCRB 1X7YB 2HA0A 1O94C 3H13A 4C0AC 2D5IA 1LBSA 2IHBA 3IP9A 3KKMA 1SUSA 4KYVA 4A92A 1JW9B 4YWJA 4HEA1 3FDXA 4HWRA 1KC3A 3AEXA 4NK5A 1OW3B 5A3VA 3T7KA 5A4FS 4PZDA 3D6MA 4F4HA 3BHNA 1QRUA 4YPFA 2FHPA 4ZQGA 3V3KA 4MPPA 4CGZA 1UC8A 4XVRA 1G7RA 1RACA 1OB5A 3QVGB 4RADA 3WL5A 5DTQA 3TCKA 2J9GA 2FY8A 4OQNA 4MUJA 1L3CA 2OSVA 5D5PA 1J1IA 4HYTA 1SZPA 3PHIA 4HTAA 5TMDA 1Y63A 2HF9A 3CBQA 3WGKA 5K99A 1E4VA 1Y89A 2GN9A 3D3WB 3Q0TA 4QYSA 1GGKA 2JKVA 1SD2A 5FWNA 3HCBA 3PPXA 3OLYA 4C76A 4EJSB 1CZLA 1QV7A 2AG0A 3D6UA 5FPHA 1R18A 3NGLA 2A4KA