2OYSA

Crystal structure of sp1951 protein from streptococcus pneumoniae in complex with fmn, northeast structural genomics target spr27
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
230
structure length
230
Chain Sequence
NKIFIYAGVRNHNSKTLEYTKRLSSIISSRNNVDISFRTPFNSELEISNSDSEELFKKGIDRQSNADDGGVIKKELLESDIIIISSPVYLQNVSVDTKNFIERIGGWSHLFRLAGKFVVTLDVAESNGSDNVSEYLRDIFSYMGGQILHQVSITNSLKDIAEAQLMEATYKIEDVLEGKIKYKTTDYQERAYQTLKLILENYDSEHFEKMYWEKKRLFEANSLEEWYYVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein SP1951
publication title Functional insights from structural genomics.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 90
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03358 FMN_red NADPH-dependent FMN reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2oysA00
1AKQA 5JROA 3F6SA 1RTTA 3R6WA 1AKRA 1CZNA 1OFVA 2Q9UA 4Y9RA 3NHSA 2FZVA 5B3KA 2BF4A 1SQSA 3NHYA 5LBTA 2BMVA 2X2OA 1CZLA 2MTBA 4N82A 2OHHA 4YAOA 1FX1A 1FLVA 1AG9A 3L9XA 2Z9BA 3NFRA 4CETA 3NHJA 2Z9DA 1QHEA 1FLDA 5FA6A 2V5VA 1XYVA 1C7EA 2X2PA 5TGZA 2QR2A 2MWMA 3FW1A 2R97A 5F12A 1SG0A 2MOKA 4N9QA 4YALA 1JA0A 4YAWA 1E5DA 2QX8A 1YCFA 4Y9UA 3UXEA 2BZSA 5ULLA 3NHUA 1AZLA 1AMOA 1AKVA 3F2VA 3GFSA 1J9GA 5LJLA 3GFRA 4BMPB 5A4KA 1JA1A 1YKGA 2FZ5A 3HLYA 2B3DA 3FX2A 3NHRA 2XOEA 1RCFA 4U7FA 2QMZA 2QX4A 2R96A 4LTDA 4H2DA 2HNAA 3OX3A 3B6JA 3O73A 1FVXA 4ICIA 3OWXA 3N3BC 3QFCA 4J8PA 3TZBA 1AHNA 4N65A 3FVWA 1CZKA 2XODA 2ZKIA 1H66A 4PTYA 4U7HA 1GG5A 1QBGA 2WC1A 4PTZA 2D5IA 4QOGA 4C0XA 3U7RA 4CF6A 3EDOA 3OX2A 2Z9CA 2RG1A 3O2NA 5EMNA 3LCMA 3JSXA 3OWHA 2OHJA 3RPEA 2FCRA 4DILA 1CZUA 3W78A 4M0CA 3ESYA 4OXXA 4YAUA 2OHIA 4QOHA 1RLIA 1FLAA 2N1MA 2KLBA 2QX9A 2FX2A 1AKUA 4FGLA 4ZVLA 1TLLA 3SVLA 5NLLA 2FAXA 2F1OA 3ES9A 5F4BA 1YRHA 2MT9A 3W7AA 4ZVKA 6NULA 3F90A 3P0RA 4C0WA 4R81A 5BUCA 5EA2A 3OX1A 4YAFA 1KBQA 4DIKA 3OVMA 1D4AA 1OBOA 1X77A 4QOFA 3GFQA 1F4PA 1H69A 1XYYA 3HR4A 1DXQA 1NNI1 5LVAA 5NULA 4QOEA 2QMYA 1QR2A 4GQIA 2M6RA 1D04A 3UXHA 3QFRA 3EYWA 4GR9A 1D03A 4PU0A 4F8YA 1CZRA 1TIKA 5B3LA 1ZWKA 4S24A 1YOBA 1B1CA 3D7NA 1FTGA 3KAPA 3U7IA 4LAFA 2Q62A 3HA2A 4ESEA 3B6KA 1CZHA 3NHPA 1QRDA 3GAMA 5FX2A 4FX2A 3B6MA 4GI5A 2FOXA 2HNBA 1FLNA 2V9CA 1WSWA 4DY4A 4D02A 5LMCA 3OJXA 2OYSA 1YDGA 1J8QA 1YCGA 2FLVA 4ZVNA 5EAIA 4BMOB 3ESXA 4NULA 1I1OA 1T0IA 1CZOA 4U7GA 1J9EA 1AKTA 3W79A 2W5UA 1RLJA 4XDGA 4H6PA 3B6IA 3OJWA 3NHLA 1C7FA 4QOJA 1BVYF 2A5LA 4FGJA 4Y7CA 3KEGA 4HEQA 1DX9A 5LLDA 2M6SA 3FJOA 1T5BA 1BU5A 3LT5A 3N39C 1KBOA 3F6RA 3N3AC 4HS4A 4XDHA 3KLBA 3TEMA 3FNIA 1DXOA 3L9WA 4ZVMA 3NHKA 2FVXA 2GSWA 4LTMA 3K1YA 2BPOA 1ZWLA 3S2YA 3W77A 5FUQA 4LTNA 1OBVA 4C76A 2BN4A 3KAQA 1ZX1A 3G5MA 2KQUA 3TE7A 5LBUA 4LA4A 2HPVA 1WSBA 2ARKA 2QWXA 1XI2A 2QX6A 4C14A 3ESZA 1J9ZA 5LJIA 1VMEA 2Z98A 3QE2A 3ZHOA 2AMJA 4YQEA 3K20A 1XT6A 1YCHA 5F51A 4QOIA 3NHWA 3NLLA 4FGKA 1AKWA 2V5UA 3NHFA 2FDXA 4NLLA 4QODA 1FUEA 1V4BA
chains in the Genus database with same CATH superfamily
2GLXA 4M0DA 1WZNA 2PRJA 3WMWA 2JIDA 3B36A 1IY0A 2VBCA 4H7HA 3QPVA 1Y6JA 4WN9B 4FR5A 2HEIA 4X45A 1TK3A 1TKBA 2QUIA 2RGNA 4KHZA 1UFOA 3TE6A 4O2BB 5AW5A 3PDHA 5HKAA 5L3QA 4P81A 1IEXA 2BEVA 2VHZA 4IIJF 3OIVA 3N2KB 1SGWA 3WNVA 4JYPA 5D8DA 3VM6A 3I4CA 1SQSA 1IOLA 2EBWA 2Y68A 1H42A 2RFLA 4Q3NA 1B8OA 4AMVA 2QTFA 3FTEA 3O94A 2IZ5A 1GAEO 4AWBA 1GTMA 4FYVA 2YNMC 4WGGA 3K1JA 3L8YA 5AIAA 1GTSA 1IHPA 4HXFB 5CIYA 4N82A 3UTCA 1SXGA 4KWIA 3TTVA 3MYYA 2CJWA 4J0CA 1ZR2A 1NY5A 1KETA 2ZTSA 2MYPA 2H2HA 3H8VA 2JLZA 4H77A 1RE0A 4PINA 2D4HA 1L3CA 3TOVA 2P91A 4Z1OA 2WFMA 2IYLD 3LLMA 5IU6A 3QQ5A 2HU7A 4EFLA 1NR5A 3B6EA 1D1PA 1ESZA 2C04A 4RETA 2FP4B 1QFSA 4UZSA 4YP9A 2HIMA 1RRKA 2R66A 4NBSA 4PC6A 2GKGA 4MV4A 1ENOA 2W93A 3HYNA 4HFNA 4MKXA 5F1KA 3USES 4AZTA 1Q0UA 3AQIA 3T4UA 3VTFA 3I9JA 3R5TA 1IIBA 1C7EA 3D4LA 1IBSA 3OLZA 3SKXA 2X6TA 4BV8A 1BXRB 1DQZA 1VSUA 1Y89A 3ADKA 4Q19A 1GNRA 3REQA 5M29A 4YCNA 3HK2A 4B3RB 2G36A 4I08A 4YRBA 2XAUA 1NOIA 1RKXA 2GK3A 2BM9A 2PGLA 3PXXA 5EFZA 2OV6A 4DV3B 1RRVA 4BE4A 1JVSA 3HY3A 1FVFA 4RTPA 3NS7A 4ND7A 5AKKA 4TLEA 2I3BA 5C7IO 4V0SA 4X44A 4B3XA 5FOXA 4X5OA 1XZ8A 1M8KA 2C7VA 4P9NA 2IZ7A 3OIFA 5EGNA 3WP0A 5B1SA 1ZH8A 3P9YA 1OH8A 3SF0A 1ZIPA 2H0AA 3NOOA 2X13A 2EIHA 1ULBA 4BP8A 1SHLA 1WAMA 3KDPA 4UREA 3UGKA 1NDUA 3UJ3X 3ZWXA 3DDWA 4J3FA 1MT0A 2HH9A 1C29B 2XCOA 3H5NA 4PCVA 1AB5A 4BO7A 4EENA 5CNJA 2PZMA 1NBEA 3PQEA 3ZDBA 2BGJA 4P4NA 3Q8KA 4HVCA 5A4KA 1BROA 4JOBA 4B34A 3KKEA 1QIKA 3VBCA 4I19A 1I94B 2HQOA 4I1PA 1G20B 3WYDA 1ZJWA 4CI9A 4I6JA 3V7WA 1GGVA 1J5XA 1WSDA 4DRYA 1NAHA 2UXBB 2IF2A 1YS9A 5EJAA 1VG0B 3HN6A 4NR0A 3A2NA 4BJHB 2HWWA 5FOUA 4BGDA 5HIAA 1JR3D 1W59A 1FDOA 5BMVF 2FEOA 5IKXA 4ZO7A 2EZTA 3S7ZA 3HYTA 5HUJA 1UH5A 3WIVA 1V6AA 1MPXA 2QMZA 4YCSA 1RI2A 2ODEA 5CP8A 2D00A 5IUJC 3WLKX 2Z08A 4RXMA 5J2TA 2GAFA 5GQSA 2P6PA 2TRSB 4TV8F 1OLXA 1E3TA 2CWWA 2QTHA 3WNBA 2I6TA 3JQFA 3TW8B 1N6HA 3BHNA 4FCWA 1IJKA 1MDFA 1UM9A 2QK4A 2P2NA 3CMCO 4HN2A 1WOYA 4L2IB 1L8OA 3ENVA 3KB1A 3PTAA 2QQEA 4DAOA 2JRCA 3E5NA 4E30A 2C97A 3RNLA 4BLUA 2UZIR 1FDRA 1MPTA 2HTEA 1O7JA 4Q1AA 2ZUDA 3TIFA 2Y6VA 1GD1O 3CVJA 1N2EA 4CDMA 3GLFB 3VR3A 1U1CA 4CG2A 1F6BA 4ZI7A 4J7AA 4QELA 4E03A 3Q85A 2RG7A 3TDNA 1A95A 4M9UA 1BQEA 2B2NA 4RVHA 3INTA 4PTYA 1EINA 3B3JA 4DJTA 3CINA 2H7XA 1OGIA 3MRSA 1IXKA 5DHRA 4LDPA 1ZBQA 3MT8A 1JLMA 1Y4AE 3OCXA 4N18A 4N3GA 2BP7A 4LZWA 2B1RA 2BGIA 4LVUA 2RAPA 4F11A 2JEOA 4EJ2A 2FTKE 3C43A 1QK5A 3F74A 2P79A 2QRNA 4ABTA 2CDRA 2V55B 4ZJUA 2O2CA 1Z7YA 4IQ0A 3KR2A 4E11A 1ZJ5A 3WR5A 2R4TA 3DHYA 4FMCF 1ISPA 4RA9A 4W82A 1J97A 2HA5A 2AJDA 3QBEA 2CBZA 5ITWA 3LCMA 3GMSA 4U3JB 2AR0A 3I3OA 4JXJA 3NBMA 4Q6BA 3O8NA 5EMMA 5ITZB 1QGZA 2GD6A 3PDWA 4EB6A 2H17A 4EO9A 2FCRA 1V8BA 2J7KA 4E1VA 3K53A 3QVVA 1TOAA 2A2ZA 3JQBC 3QG5A 3DZCA 5H83A 4C0JA 1MJFA 1SEPA 1MDBA 1NQWA 5C5DA 2ZE7A 4LJKA 4AUEA 2W2PA 4R2HA 4JL6A 1DMRA 5IZCA 3M3HA 1UUFA 3UMMA 4DR7B 2C1XA 2E5WA 3A1FA 3DF7A 4BB9A 3BRWA 5L4SA 1XFAA 1P4SA 2A4MA 3FYUC 3H5VA 3ZV3A 4MPPA 1LBEA 1TD1A 2PWPA 2H48A 3E18A 3IIEA 4J1TA 4ON9A 4Y6SA 3AJ8A 4DANA 3E2IA 1U02A 2XDQB 1WCXA 3EMBA 5FPHA 4EUSA 2NZXA 3NH9A 3Q8LA 3BJIC 4Y2VA 2X6RA 4ZT6A 1LWOA 1SOVA 4F9FA 1Y6GA 3O3MB 1T1EA 2BONA 5EIBD 4ZCQA 2XMSA 4IJ6A 2YCBA 3RUPA 3GJSA 5IUKC 4F5YA 4N76A 3CCFA 5A1TA 3T3PB 2YW2A 3TIIA 1NONA 3LPDA 4M9QA 1FW6A 2QQ0A 1XNJA 3OM1A 5B2FA 1UK6A 5DBIA 5JNUA 4B3MB 2NP7A 3QBJA 5J40A 4F38A 2IYQA 2BRUC 2NO7A 2ZYSA 2ZJOA 1BDJA 1KAHA 3LWDA 1IPFA 5DX1A 4KR9A 5I7VA 2RGRA 1ISGA 5H0IA 2ATCA 1UKAA 3OQ1A 2QS9A 5FDFA 5L3SA 3QLVC 4NYJR 2AEMA 1VB5A 2RAVA 2ORYA 4KBYA 2QTGA 2ZAIA 5C31A 2I4TA 3ORSA 4EQZA 4UTVA 3KWJA 4RDXA 1MUUA 3G9ZA 1TF7A 3LXUX 4PSUA 2VZ8A 4AULA 3LUBA 1DXHA 1L7XA 3ZJ4A 5LQMA 4HUQA 2HBQA 3MJ4A 2V7BA 3PHIA 5CFMA 1DWQA 1NW8A 4MMXB 1KJYA 1WZIA 3KKZA 5CDFA 3S3TA 1U8TA 3OX1A 5LQKA 1KQFA 5SYAA 2X0EA 1E63A 1L4HA 2ZB8A 3D2AA 3H9UA 4IDQA 4N03A 5A5DA 3UHOA 1EVIA 1XTVA 4RKRA 4E7PA 4KPUB 1AGXA 2D2FA 3HRKA 4K6OA 4IVPA 1CTQA 4BNFA 3N8KA 1P18A 3FDZB 2NO6A 3FYSA 2IS1A 1ABEA 4TT3A 1WABA 3L1KA 2XVMA 3H0CA 1DINA 4PNHA 1NJ6A 2OR3A 3H5WA 5IAGA 3FWNA 4K05A 3EWAA 3KQPA 3F7NA 3PK0A 5E7IA 1A82A 4ZOAA 5KQMA 3CW9A 1P61B 4JJ6A 4L16A 4L72A 4TWBA 3W3AA 2I2DA 4W9RA 2GPTA 5I9BA 4EY8A 5JNTA 3I23A 2Q2QA 4L22A 4DM4A 1WTCA 4MCIA 3L7JA 1D5CA 5E1DA 3CXUA 1P74A 5BNIA 2B4AA 2D1FA 3EYWA 4J03A 4RJTA 5KYUB 4UDOA 2Z56A 4GWKA 4X94A 1H2AS 3WYGA 1HNWB 4AKTA 1ZH6A 3BCSA 3HO8A 3WGHA 3A1TA 4PYQA 3VTAA 4LV8B 2IXTA 4HDCA 2ZU6A 2CLIB 3L92A 1N2HA 1TVEA 3WK6A 4D74A 5CFQA 1W7AA 2AKAB 2PZEA 3AUSA 3VNSA 3V2HA 4UHDA 3ZE0B 2Y2VA 2D2IA 3I61A 2BOVA 2PZBA 3FM9A 1DP4A 4Z3DA 4PX2A 1XDWA 1EAYA 3RAPR 3L7YA 2AOTA 4RNCA 3VVMA 2E5LB 2ZJ6A 5T6BA 1TTQB 3MJRA 2NMVA 1FFGA 3REGA 3KL4A 3LP5A 3A7DA 2BKAA 2DY1A 2TMDA 2QENA 3KAPA 4RWEA 1LRLA 2J09A 1A9XB 1J0EA 1FSGA 1ZD9A 3RHSA 4BQRA 3AVTA 3TZKA 3ER8A 2AG5A 3CH5A 2FJUA 1EGMB 3KKLA 1EM8B 3LBNA 4IS2A 4JLWA 4BJ5A 2DCMA 2ROQA 3BFVA 1CR0A 2ODQA 2RONA 3EDRA 2J5KA 3IBSA 5D3ZA 5J5CA 5G41A 4TZ6A 2OCPA 3A36A 1RAHA 3CPEA 4FZRA 2F64A 2BI8A 3GNLA 1E7MA 1N36B 2DULA 4PE5B 2I3GA 4Q21A 2QRVA 4FCTA 1EQUA 3JS5A 1ZIDA 4NEGA 1OASA 1PNVA 3CX6A 3QHPA 1CDEA 2YFQA 2ZDGA 4O1HA 1FQOA 4IEFB 1SC3A 4KO1S 5HF9A 5M7EA 3ZX4A 5CLHA 5C5CA 1E1RD 3F9CA 3R5JA 3PHLA 1E3WA 2W43A 1E69A 3H17A 1JFTA 1W2HA 2ZWOA 3E9NA 3ND9A 3G9XA 4MVCA 3E3OA 4QRHA 1UXOA 4DLSA 3ZYZA 1IQPA 1FLNA 1NXWA 2DTXA 4EA6A 4DR2B 2PRIA 5KC8A 2OVBA 3ETGA 3FMIA 4IH1A 2YQ4A 4IUBS 4HAIA 4ZEXA 4RD3A 1W8IA 2CSUA 2R00C 3CS3A 3PC7A 2ZUCA 3RVNA 1BN6A 2AX3A 2G77B 3LSYA 2FZGA 4EW2A 7ABPA 1UR5A 3H18A 2YWBA 3I1IA 5KAPA 1HDZA 4BNDA 2ZJ2A 1JPVA 1TQ6A 2JLRA 3KIPA 1JDSA 1YL7A 4AJOA 1WB5A 3SXJA 1TCAA 4BRSA 4HXYA 2WKRA 4NATA 5CAEA 3JYQA 1ECBA 5LA6B 3L6RA 1GU7A 1JT9A 1KZYC 2P4SA 2WTMA 3LFTA 1THGA 4NTZA 4CEIA 1DOAA 2J9FB 5GAJA 2P68A 2VNSA 3BF8A 4DWWA 4EG3A 4M8NE 1IZ9A 1XZAA 1VL2A 3N07A 4EB0A 4IDCA 3W79A 1M1XB 5EJ2A 3W5SA 1P3DA 5K09A 4AKGA 2G28A 2RHBA 5T41A 3UMGA 4QJ4A 3A6HA 3EVBA 1QG0A 3T3EA 4RTLA 1JHPA 2OBLA 3PPXA 4ASUD 4XWOA 4BN4A 4FFSA 4MKGA 3UG6A 1KSFX 1Z0AA 3LX5A 1LX7A 3X2EA 2IKSA 4DCVA 2LZ0A 3GLHE 4A27A 1L9KA 2DWCA 1P73A 3PQ5A 2PD4A 2WT4A 3L1HA 2B7LA 3MOSA 4OFZA 5T4FA 1XRNA 3L8CA 5ER6A 3SOPA 3TD2A 1P7ZA 1T6YA 4IDDA 1YOVA 4KLRA 4YDHB 1J24A 3WRVA 2NYAA 3DCIA 3WGGA 3KTDA 3LKBA 5KCZA 3U9SA 3GBVA 1EE9A 3N2YA 3WTCA 3OJ0A 2EFDB 1RKQA 4HGZA 3Q7RA 1TYAE 2SICE 2GEUA 2QG4A 5FOQA 2QZ9A 5DIFA 3MTDA 3FOCA 3VZSA 4CMHA 3I9V1 1E64A 5ITSA 1K9SA 4FP9A 2ID4A 2WIJA 2MSEB 4ZCLA 2NVUB 5JCOC 4IGEA 4Y3UA 3DZGA 4PHGA 3FNGA 4L28A 5CH8A 1N75A 4NHEA 5LP6B 2FX3A 1X0VA 5JDCA 4EA7A 1X1TA 1CUZA 2Z2XA 2Z2ZA 1TJ5A 3FDJA 4WW0A 2P4QA 3WNDA 2OO7A 4N9WA 2DC1A 4UHEA 1Z18A 4XJTA 3G13A 3LQ1A 4JUBA 4FYMA 1XTKA 3AP3A 3ETCA 2OMKA 4W6ZA 5LMUB 4ZVMA 5HMLA 4EM6A 3I01M 2IH5A 1SBCA 3MILA 4UMFA 5IKEA 4MVYA 4PHFA 3RSSA 3BK1A 3DE6X 2GSWA 4M89A 2I6UA 2RIPA 5DHQA 4UM8B 2CNWD 4IUCS 1K7XB 2BPOA 2QAIA 3F0TA 4EI2A 4A6XA 4OHKA 3PNYA 1H5NA 5E9QA 5EXEA 2W0MA 1XBTA 3RSQA 4AX8A 2GYVA 3T34A 4NMMA 4BX8A 3THYB 2JLQA 4XWKA 3B20A 2NVOA 3PHJA 2OXTA 2JB9A 1J33A 2C2BA 2GDJA 4KQHA 3MTEA 3C5HA 4DYVA 5AVRA 1PLKA 2WWHA 5JUWA 3NHAA 5KSOA 2DF8A 4LOJA 3JYOA 1IUKA 3ESBA 3U3ZA 2VRWA 2WAYA 4ZVQA 1IL0A 1NNLA 2ETVA 1EH5A 3KQQA 3P5BA 5FO1A 1F1JA 3SSOA 3LQFA 3U62A 3KO8A 5K8VA 4RVNA 2IZOA 1J9ZA 1MQSA 3F5MA 5F3WB 1KJWA 4REQB 1W6RA 1RYFA 4XYLA 1ADBA 4IUDS 1DKMA 2V7PA 1XKQA 1TZMA 2XNKA 1P2DA 2Q2NA 2XMDA 1KC3A 1SHKA 4MAAA 4Q9IA 2RH9B 1NWCA 3QBVA 2H1IA 2R6ZA 4CQMB 5AVUA 3C14C 4YJ2F 2O52A 2ZSUA 1JWBB 3ZZMA 1IMJA 1G8PA 1CBUA 1D2HA 2VJPA 4TSKA 1HX7A 4JJ8A 3OJCA 2O7SA 2GO7A 4MQFA 5BWOA 2WKPA 1DQRA 4M8IA 1Q0LA 3CO0S 3KM0A 3BWYA 4R69A 1NJFA 1G8FA 3A10A 1R16A 3KTAA 1KPIA 2ADMA 4TTIA 2HW8A 3O8BA 2Y9PB 2ETXA 1ENZA 4GOXA 1AKQA 3VAAA 4ENPA 4BRUA 4KXMA 3IBGA 2FEAA 4M99A 4ZO6A 5JVDF 2W11A 3FBGA 2P4UA 5BO5A 1NUHA 1RJ9A 4PZEA 5SY6A 1KMHB 1NXTA 3ROMA 4YK7A 2BMAA 5JTTA 3DT6A 2P9ZA 2JJ8A 3ESDA 2ZRKA 3NBYC 2RHRA 1F7VA 2DFTA 2FZVA 3LTEA 4WNAB 4ZOLB 4J0FA 2PMFA 2FSIA 2VNHA 1Z56C 1KOFA 3GG9A 4OMFG 2J9YB 1N2CB 2BZ0A 4C05A 1N8KA 1FE8A 1Y3FE 4QUEA 2O8VA 3IHLA 4JP1A 1W5EA 4GGMX 4QUJA 4CDNA 2VTDA 2DSNA 3CTPA 4II3A 2A1UB 4MVJA 1IAVA 4YAOA 3P1JA 2GN9A 3P20A 1L5WA 4PYNA 1PX0A 3OBBA 2DKFA 2XSZD 4RVSA 1IHOA 1Y42X 3A9RA 1KXZA 5CEJA 3B2QA 1UT8A 4ZKEA 3FPHA 5G1NA 2I6GA 5KJCA 2NXCA 5I9NA 4OU5A 4MVWA 3EQ8A 2QUBA 4CETA 3IUSA 3L77A 1YZVA 1FNMA 3L7OA 1M7BA 1K88A 4KV7A 3K9QO 1LQTA 3M1AA 3HSYA 4RH3A 4OHYA 3RF7A 2H51A 2RGDA 1CT9A 1AO3A 1FNDA 1N2ZA 2JFNA 1IHDA 2NTNA 2NTJA 1NTOA 2CVPA 2Q5EA 4FTWA 4PG6A 4GPTA 2HJWA 1F2DA 2OZEA 1DKNA 3H42B 3OMWA 4MLPA 3ITNA 5CT5A 4OQDA 1NUSA 2NSHA 3WGOA 4CNBA 1MLDA 3EEIA 2VP0A 1PD1A 1T0UA 3EFBA 4QATA 3D1VA 5JBQA 1PR3A 1SG0A 4BNXA 3ZQUA 3TDKA 4YALA 4L4UA 4XSHA 4E51A 5KDOA 4BLQA 4I4TB 3HWSA 2WHXA 3VKUA 1ZRMA 2WD7B 1CRWG 3AJDA 2QP4A 4J94A 1ADCA 2ADOA 4XR4A 1SOWA 5DBOA 5AK6A 1R6VA 1X7WA 1Q20A 2XCRB 1H3NA 3S28A 1G59A 4FEGA 5CYOA 3ASUA 2OWEA 1IJFA 3G8CA 2QBYB 3GNTA 2GLUA 4HLQB 5U4XA 1RS0A 2YHSA 1WF3A 4R1SA 3T9BA 4R9SA 3ZI0A 2PX4A 1H8ED 2DWQA 2QDKA 3L0BA 4ZAGA 5IYZF 3WIDA 3UPDA 2D13A 3RHZA 3KT8A 3QEBZ 3PV0A 3KZCA 3GELA 1MH9A 2LCFA 1ZMRA 3QPAA 2VA8A 2X86A 4XLZA 2VL7A 4BNLA 2RHCA 4ARUA 5KO2A 3D0RA 1QBKC 2OCGA 1KDPA 3PUJA 4XWGA 1TF2A 5CX1A 1QH8A 3NHRA 3V6MA 2REXB 3OQIB 4NECA 4XUGB 3WB0A 3JD1A 2AUTA 4ND8B 1W4CA 1KEEB 5JMOA 4P84A 3VDXA 4B2YA 3ND8A 3NYIA 3FCUB 1IEWA 3HMKA 4JSRA 3AEKA 1QWOA 4IG4A 3GA7A 2I55A 3DOIA 3WLFA 5CITA 1K98A 4NBVA 1PEKE 3PHHA 4NEQA 4MEAA 1B0ZA 3K9HA 2P9CA 1ZXLA 4Q4JA 3KYBA 4RL6A 3AB8A 3KOYA 3PFBA 5D3MA 2JW5A 3GXOA 2VF2A 3CWZA 4JU8A 4Q0MA 1U9ZA 1V1MB 1DNPA 3Q3VA 4WERA 1SCDA 4MS4A 1M74A 1EVJA 4ROTA 3VSDA 3T3OA 2XD9A 3WOHA 4YXWA 3CN7A 3C7TA 3K96A 4PQFA 3DDUA 1CIPA 4LC0A 1NUUA 2R7LA 1H66A 4F04A 5EI5A 1RTKA 3AQ4A 2WC1A 4KFSA 4D26A 1NSTA 5LWHA 1KR2A 4FDTA 4YRZA 2I78A 2WZBA 3QU4A 2RHLA 2WSYB 4LY0A 1H4QA 1SBNE 3AHFA 2CLSA 2IA5A 3D64A 3SZRA 1WA5A 4FNOA 5ALIA 3WSWA 1AIPA 4BNVA 3QVWA 1YD7A 4ARVA 1U11A 4R1UA 4G0OA 5EXSA 3K4QA 3IOMA 3KNZA 1SKAA 4HRVA 5JZ9A 4GW3A 3VYSB 3KZMA 3WI7A 2OP1A 1JHMA 4C06A 2OHJA 3ZOKA 5JS7A 3RKSA 2VDOB 2GK6A 2YJZA 2GAAA 3OQPA 3TLGA 1ZZEA 5J2UF 1GPLA 2CLHB 1EX6A 3B1YA 3HKEB 3WLLA 2QTZA 5AYVA 6REQB 5LQUA 1WCWA 1G41A 1OH6A 1V9LA 2WYVA 2J9GA 5AI5A 3VX3A 2WKSA 2ECFA 2ON6A 5SZJA 1BVUA 3FROA 3ZK9A 4WKPA 3UYLA 3SLGA 2GH1A 3K5IA 1DDIA 1U2GA 3I6QA 4YAUA 2IYYA 2JFZA 1GCAA 3D8TA 3JQGB 4ID9A 2VVTA 3JY6A 4U2FA 3HDHA 2VDJA 4BRWA 2BKLA 3WSTA 4RJJA 1GUDA 2JDID 1SUIA 1NM5C 1ZOOA 3UC5A 1CEEA 4MX8A 4EFKA 4YRAA 3OZCA 2NQTA 1MAWA 5HE9A 3PNMA 4H0NA 1D5WA 4JBNA 2BE7A 1CUGA 1SU4A 1AUQA 4PAGA 2XNDA 2V7UA 1CY4A 3B1WA 2HOQA 3FXAA 3N8HA 5CLQA 2R8OA 2AIRA 5EP3A 2EKDA 4TXJA 3OZDA 3ETDA 5ARBA 9LDTA 2I5PO 1FDTA 1V4NA 1C3EA 4YIKA 4FNMA 4W99A 4JBHA 5BW6B 1N8SA 2ERXA 1W581 3K9LA 1W1IA 2O3TA 3I92A 2WAXA 4MRSA 3RC7A 4AJNA 5IK2D 1XNQB 5IAKA 2LP4Y 3GP3A 1H94A 3P2IA 4ZVRA 4BP1A 1V8ZA 2J30A 2ZP1A 3QPCA 3LO5A 3ROEA 3EQ9A 5F4BA 4A9AA 3CF4G 1C7IA 1O08A 4Q16A 2V97A 4KXLA 2FSVC 4EUEA 1Z2OX 1ZOIA 4Q5IA 2JGMA 4AECA 4C4AA 3TI7A 3C6ZA 1Z0ZA 1RYHA 4IIBA 4V3BA 4ZVKA 5KWSA 5ETJA 5BMVA 6NULA 1UQRA 2J3DA 2WJZB 4N39A 4JUFA 3WLSA 3HJCA 5JCJD 1ORDA 4EG8A 5KOYA 4EKDA 5FBQB 1Y7TA 3AEXA 3K32A 1IJEA 3RH0A 4XB2A 2W8BB 3R7NA 4TUYF 1E60A 3QA9A 4GZLA 2ECPA 3A1DA 4EUNA 3LM8A 2F55A 5LUBA 4RK1A 4B3GA 4I4CA 4PYOA 3HKDA 4TSFD 1Z7EA 4DLLA 4ZYVA 4AY2A 3L02A 2HWXA 4OHCA 1E8DA 3VDNB 3OVMA 1U6KA 2QUAA 2PS9A 5IKMA 2C4TA 1Q15A 1WXHA 2Q9CA 1VB3A 2DG2A 3C3DA 3UF0A 4X95A 5BXYA 1LSJA 3JQCA 5AJHA 5B58T 2OFWA 3IS3A 5HTOA 4P0QB 1AGNA 1P39A 1PGJA 2V58A 3AXSA 3NO4A 3WIUA 4LHSA 4FOPA 4LMPA 3NUGA 1CUHA 1NSYA 4MRNA 1TM4E 1VL6A 1NBME 3EX7C 5JIBA 1THMA 2E48A 3IIMA 2MCFA 3PEUA 1IWPB 2B6HA 4FZ5A 3VO9A 5IAEA 1R7RA 5AUOB 1XZPA 2EQAA 2HRRA 2J9ZB 2K5UA 3A37A 3D8HA 2QR5A 4O8ZA 3BH6A 3E61A 2IHTA 2JHFA 2X42A 4KREA 1G5TA 3QK7A 4KQJA 5HYVA 2JJQA 1G0NA 1NU8A 4GM4A 2FEMA 3BWEA 3MJDA 4WCFB 2QQ5A 1MO6A 1H4VB 4RCYA 1CQJB 1HQDA 3NFYA 2DHDA 3EE6A 4UU1A 5BQXA 4PLVA 4C7XA 3WGLA 4PNEA 4CKCA 2HJ9A 1K8XB 2J4FA 1N0IA 5CD9A 4IDHA 4JZKA 1LI7A 2O5EA 4KE9A 4HDMA 1BWQA 1LH0A 3C16C 2OBMA 1X0XA 1L7EA 4MV0A 2C88A 1BTOA 2GZSA 5LYYA 1R88A 2I29A 3LXXA 2DR3A 1UOEA 1S4QA 3DOJA 3DDSA 1M9NA 5EY5B 1O54A 2LR0A 3U39A 2Y0CA 4FNAA 3ISTA 2IRWA 4ZQBA 3BXOA 3KWLA 3ZCTA 3DDNA 3ECAA 4CIWA 1BHSA 2I99A 2PTHA 2Y71A 1COZA 4HAWA 3EXG1 1GZHB 2Q2VA 4II2A 4QU0A 4A6DA 3K1TA 5IJZA 2RMKA 2CD7A 4B6JA 5G2OA 2H1WA 2R6JA 4FC6A 5K99A 3M5WA 2PH1A 4G0XA 3CLUD 3DONA 2CHUA 2Z3WA 5CDHA 2LRHA 2Y1LA 4HAOA 1POWA 3WBBA 4ZQCB 2ANBA 3GGGA 3T9EA 4QZVA 1T1IA 4BV9A 3I04M 4YUXA 3W3AH 5CDGA 3RAFC 1CZHA 1EFDN 3OHPA 3R9IA 1N92A 1ZK1A 1F38A 1T3GA 3R8XA 1U1DA 3AZOA 4LKOA 2BHNA 3G9QA 1TK9A 3DULA 1NE2A 2HSEA 2R5NA 4IWXA 3BL8A 4F71A 2CKDA 4Q9JA 1OH7A 4QQFA 2AE1A 1DQYA 1GCUA 2XHZA 3NWEA 5I45A 5HGJA 1G8YA 3OURA 4R9UC 1OYWA 2HYDA 1I6WA 3GGSA 8GPBA 5I8PA 4AG3A 1TKCA 3S81A 4WFIA 2HPZA 3UV3A 1AMUA 1XTRA 2C0CA 2C99A 1DKUA 2RGGA 5LC1A 3WGIA 1PZFA 1YQTA 5H1YA 2ZBGA 4QU9A 2NU9B 4HN9A 5CA0B 3PTLA 5CHYA 1WO8A 3D1JA 4TMKA 1FMCA 4Z9BA 2FLWA 4FLEA 1QS0A 2HO4A 5ERGB 3RODA 1R4MB 2IOYA 3SQNA 4F2PA 5J23A 2AS0A 3S1AA 4ETIA 1Q17A 3C3BA 1PW7A 3DOOA 3RJ9A 3GEHA 4PZCA 2XE6A 4G36A 2OCBA 1DUSA 1D0VA 1O0BA 5FWXB 1H3FA 4QSHA 4MXDA 1R50A 4OI2A 5EYPA 2QD2A 3BAFA 3PXAA 1U8ZA 3TJMA 2D3TA 5A3VA 3KYIB 3OTGA 3WE7A 1UJ2A 5KPJA 1NGSA 1XU4A 3O5AA 3L79A 5GGYA 5FP0A 2Z1DA 1TYDE 4LYYA 4C0QC 4IF6A 4N54A 4UHBA 1Z4MA 5TRTA 3OUUA 1OVMA 2R48A 2N75A 4XIGS 2OCYC 4LQCA 5F23A 4F06A 2P2DA 3AB7A 5FTJA 2RHDA 1T2NA 3MTIA 1X7XA 2BCEA 2ODWA 4HGPA 3DL4A 1DX4A 1TMKA 4DIDA 2PYDA 3R0XA 1NW7A 1UK7A 4KDEA 4GX2A 1UBMS 2AKEA 4G4JA 2O8FB 4WXYB 4JI1B 2YICA 2YWCA 1V41E 3R5HA 3T8YA 2IBSA 2ZI7A 2WUWE 3AW8A 5ENZA 1HA3A 1TZBA 2RC6A 4LBWA 4UBMA 1OLUB 4W7IA 1L1FA 3R0ZA 4ODIA 4BIMA 4DIUA 4Q1CA 1CUJA 4YH1A 2GVDC 3EVEA 3ZX5A 3PHBE 4QO8A 2X8LA 1GTRA 2GFQA 4LXIA 1OMOA 1NQAO 2C03A 2YXEA 4KGDA 4P6VF 2CNOA 5K0NA 4M83A 5EWJA 3FJOA 1U4OA 1OZGA 5CB6A 3QYPA 4WK4B 1IUOA 3C41J 3RRZA 3MUFA 3S70A 4C4ZA 4C7MA 4C5BA 3MGAA 1PFUA 5A71A 2YZGA 3OTQA 3PDJA 1IH8A 1NPTO 2GEDA 2H5EA 1MJGM 1OAOA 4MI9A 4RHYA 3USZA 2HXYA 3P9PA 3S4YA 3QEKA 2W6OA 2O8EB 5DP1A 4E32A 4LF7B 1KDVA 4YY3B 3QXHA 4KNWA 2C42A 3NH6A 1RACA 1JHQA 1SN7A 3IEKA 1QQ7A 2GJ9A 3IB3A 2NUPB 2MINB 4R8MA 2BBTA 2J3HA 1GR0A 3QFFA 4Q6WA 5AI0A 4ALNA 2GM4A 2AMYA 1K66A 4GHWA 2X23A 1SO8A 3HV0A 5LMNB 1GNSA 3RUIA 3ZWVA 4AJHA 4UNSA 5KX5B 4J2HA 5MN6A 2HHLA 4YBZA 3RW9A 1YQDA 1MN6A 4F2WA 1BFDA 3WDKA 5FTMA 4GRAA 4RMHA 2CNDA 2XEDA 5CFPA 5B7NA 1M75A 2BN4A 2X76A 1KRWA 1PQPA 3NTLA 3JQAA 1EJ2A 1Y8RB 2KQUA 3ECSA 3JQ7B 2IU4A 1L2TA 2PGNA 3PFHA 2ZSBA 3LRPA 1C80A 3PR1A 4FYYA 4EVSA 2WEKA 2GPNA 1X1RA 5JWRA 3WLEA 1N0HA 1D1SA 5FPQA 5AKEA 5EQJB 3WKDA 2DBZA 2VZEA 3LC0A 4DT1B 5FBVB 5I7HA 2Q3HA 3B7PA 1ESCA 1NT2A 3FOZA 2G04A 1TA4A 3DL7A 2CLKB 1ESMA 1CSEE 2C3PA 4FJ0A 1CUYA 1CNFA 1U3TA 1JTVA 3QYFA 3P5SA 1N6RA 2AMJA 5TIIA 1XE3A 4TVBA 3AY7A 5AK4A 3DE7X 2N42A 3F3MA 1TM5E 3DD5A 3CH6A 2ENWA 4HNRA 3E1KA 4CV0A 2FX5A 2H57A 3S8EA 4FW8A 1U2QA 4ZOCA 2YCLA 1KJJA 2V8OA 5EKXA 1NFRA 3RR2A 3S99A 3KK0A 2B1JA 3IPCA 1W46A 2WHEA 3QENA 3E05A 4LZPA 4YAKA 3PF8A 5E4JA 2XUPA 1FUEA 4OJQA 4I99A 4D56A 3OOWA 1M5TA 2HLDD 1CX9B 3GFTA 1B41A 3HMQA 3O82A 2GRUA 2RIRA 3FI9A 4IXMA 2IUSA 2WFAA 4G4SO 1JEOA 3RWBA 1NIJA 1Q74A 2FZ4A 3KD2A 4PANA 5JROA 1JXMA 1GO2A 1EFVB 1SRRA 4RLFA 5HA5A 5CFZA 1DHRA 1KDOA 4L5JA 1RQPA 1PZEA 5I7EA 3ONWA 3CPHA 2XUZA 2RGEA 5EUBA 1H65A 1QHNA 1QC5A 3WNQA 4L0MA 2RB5A 2A86A 3B9QA 1WXGA 2ZPAA 5DYNA 2EP8A 3NRJA 1E1KA 5E8JA 5HEKA 4E2XA 1FF9A 1ONBA 1U0NA 4C4TA 5JMWA 4PBTA 2IXDA 3UWOA 2WG0A 2BMWA 4V03A 1LFAA 5FNVF 4Y2TA 3IPXA 4N0PA 2EF0A 1H2RS 1M2WA 4Q9HA 2PUAA 1UBUS 1QB8A 2ZI4A 3TQHA 3WB2A 1F3LA 4CKBA 2WIKA 1GYRA 3QEMB 4CF3A 1QHSA 2WHRA 3OU7A 1YHYA 1JBEA 1JBQA 1MB0A 2BTQA 1UKCA 3AOGA 3DLPX 3N2ZB 4P4GA 4YMTA 2VYVD 1BOOA 4ZT3A 4X65B 3D1LA 4RD6A 2IYAA 4GMKA 4A82A 3K70C 1EFAA 1QVZA 1I3LA 2FMKA 3F8TA 1O97D 2WWWA 3GI1A 4FKMA 1C8BA 1SQFA 1UPBA 2DP4E 2RI6A 2Y99A 1J7JA 3CVXA 4FQ8A 1VC2A 3ITKA 4YJKA 1HKHA 4LI0A 4BEJA 2QRLA 1CETA 2PUHA 3N0XA 1N2OA 2XEXA 3TLXA 1XK6A 2VC2B 4JNCA 1SIOA 2IIBA 4PZPA 3NDJA 1T26A 2FUKA 4Q4LA 4LKRA 1KQNA 5K8IA 3VYUB 4MRMB 5AHOA 4BVHA 1QHYA 1OYOA 5T8KC 5IVPA 2FMHA 4YUYA 1S6YA 2H11A 4MYSA 4EEZA 1G60A 3OE7D 3PNLA 5ICSA 2IHUA 3GAZA 4L85A 4RE6A 4UNPA 3ZE1B 2GASA 4A7PA 1O2DA 3PNPA 4K3VA 1T91A 1W36C 3SPXA 3BUSA 2OK8A 3F6BX 1HT0A 1R8SA 1ZVVA 1JA0A 1ZCBA 2CFCA 2WF5A 3MLAA 4YAWA 5TQ2B 2BFBB 2ZBRA 3F5FA 3MT7A 3D7LA 2O0HA 1BKYA 2DU8A 3CNEA 3I42A 3GWZA 3G59A 3OFJA 4WLFA 5PGMA 1EP1B 5IBRA 1GWNA 3K8QA 1KQGA 2H31A 4W5RA 1N7JA 3GR6A 3IE1A 3FPEA 3JAKB 4WASA 2QE6A 5BYJA 3T94A 4DG8A 2ZM6B 4J75A 1USGA 4LXXA 1V96A 4UQPA 3RKRA 5BY2A 5AI9A 1A5AB 2B21A 3OZBA 4HFMA 1M1YA 3CKKA 2C00A 3IPAA 1JA1A 3JYHA 1EB8A 3MGKA 2YN2A 4QYTA 3OQNA 7MHTA 3PXUA 3OPYA 1RRPA 4Q1BA 4W1SA 5DX0A 3RUEA 4JJ4A 3WMXA 3M6WA 4FBMA 5I9LA 2Q1UA 2ZTHA 3VVCA 4Q3AA 3UMJA 2DMRA 1QLHA 1KTVA 3AP2A 4EITA 3IAXA 3DTNA 1KZ9A 1X14A 1U8AA 2HGZA 1XTBA 1ZOSA 3MWGA 5IJXA 4YCCA 4BY9E 2P41A 4B1FA 1FZTA 1GNVA 4P54A 1Y0BA 4GEKA 3BTUA 3PQ6A 4FHEA 4CUZA 3UGJA 3DO6A 1F48A 1W9HA 1JHRA 4TLDA 1TF5A 4M1KA 2AG1A 3WZMA 5AI4A 4DY6A 3EAQA 3ORHA 3W2FA 3N1UA 2E4ZA 3CKMA 3EQ6A 3VSEA 2FP3A 5L51A 1QGUB 3GJXC 4LPSA 1EA7A 1GPUA 2V0NA 2B1IA 2OB1A 3KZKA 4XCXA 1XZIA 1CRZA 4QBFA 1II8A 3NDIA 3GUZA 2AQKA 1QFYA 3LPLA 3E4DA 3V46A 1DC5A 4LISA 1ETHA 4ILEA 4WL0A 5E6SA 3J81k 2QEQA 4AFNA 2VJDA 1WQ1R 2H63A 9ATCA 5GJCA 4I8IA 1HWYA 2PZGA 4LWQA 5GPBA 1LK7A 2QN2A 3F4BA 2IGTA 1Z4PX 2HPAA 3K09C 3N8DA 2YWFA 1UXHA 2I8LA 3W5UA 4C3UA 1UK8A 1SK8A 4KOEC 5JH7A 1E79D 2PVCA 2ZSKA 4ZDKA 3WC4A 1AA6A 1ZI8A 3QUSA 1L3IA 2ZR8A 4L5IA 1W35A 4D0LB 4N0DA 4HLCA 3RC3A 3A4NA 1IB0A 3HUFA 4KAXA 1HE3A 3GUVA 2HJGA 4OYYA 3FPCA 3FUCA 4B87A 3HN7A 1LLFA 4K28A 1P7WA 4MUKA 4D46A 2IUUA 3UJAA 3OU2A 4EJFA 2V3VA 2J45A 2J3QA 3DEJA 2RG1A 3NT4A 3UB4A 2VCEA 1KORA 3IIIA 3W1WA 4BNIA 1F2TA 2EJUA 4P5EA 4EG7A 2OUIA 5F7JA 2ZUVA 4BC0A 1UADA 5I9TA 1R6TA 4QFMA 2PZAA 4IDEA 5LZ2A 1JEQB 1PR5A 3P9CA 2Q3JA 3C3JA 3EXAA 2Q4EA 1N25A 2BISA 3JCZA 4LHYA 3VR1A 3EGDA 3DFMA 4ZCMA 4S1OA 3CZ9A 3EZFA 4LC1A 3RSFA 5I4KA 1KVRA 1AK2A 4ZK2A 1QQAA 2RAFA 3HRHA 3S2FA 4EO7A 4QXMA 4BJ6A 1FNSA 1ZC3A 4CKEB 1YA4A 1KJZA 3PWZA 1QDEA 4HL6A 4R7ZA 3SDBA 5FL7D 4AT1A 2B4KA 3WLAA 2A94A 1G42A 3UIEA 1LI4A 3AR3A 2HZ7A 4ZYLA 1TTTA 1NRIA 2Q3FA 1U65A 3TLYA 1R6UA 5MGNA 1I3KA 2JEZA 3CXRA 2CVQA 4ND1A 4NESA 4Q03A 2GUGA 1FTNA 3I12A 1UEXC 4BO2A 2PLNA 3L0PA 5HP4A 2QLLA 4G8DA 1DCTA 2VJCA 3GLHB 1KVTA 2CGEA 1AKUA 2LPMA 1ZNQO 1LJUA 3QLEA 4NONA 3MWLA 4RVGA 4Y9TA 4PCAA 1QR6A 1EG7A 2FB9A 4Q18A 4XARA 4BMVA 4GPBA 5KIAA 5ALYA 1PF7E 1M2JA 1GV1A 4QFDA 4ZGGA 3TD9A 2M1ZA 2G06A 1RCTE 1DKPA 3S2IA 3UH0A 2GCEA 3AY3A 4LF8B 1L5YA 5CH3A 5TSDA 3TFOA 3DMTC 1I9CA 2EKPA 2ZJ1A 4I50B 1PT7A 3NHMA 5GV8A 1KRXA 4I5GA 3W6UA 1WOMA 2IE8A 3GZNA 4KQ6A 1NVKA 1ISIA 2QVYX 1YI1A 1L8AA 1QCCA 2WSSD 5ALTA 5CK5A 5IMSA 5T7BA 2KX7A 4RCVA 3ML1A 1T9CA 1Z6TA 2OQRA 3DVAB 4I1OA 4ZVTA 3VOSA 1QOZA 2FUG1 3PSAA 4KYTA 2FPGA 3GRKA 4M4SA 3QYJA 4BMSA 1JJFA 2FZEA 1SD1A 4HB2A 4NRDA 1E6WA 2H06A 4XWWA 1DPFA 1FNBA 1X92A 5K3FB 1ODJA 3RVJA 2HHCA 3X1JA 3RS8A 1JBKA 4ZAZA 1BE1A 1ZW1A 1XO1A 2XMPA 3HN2A 3QUAA 1MB9A 1LFDB 3BQNB 3WL7A 3EN0A 1PAUA 1X77A 4LNAA 2C4VA 2V98A 4C4PA 4ALIA 1Z16A 3KQUA 5C8VA 5G0TA 1YC5A 1RXCA 2P6RA 3L1UA 4EMBA 4JT8A 1ORTA 1HETA 2C8VA 3JQ8B 4CMIB 3OM8A 3ZY6A 2DBYA 2GEKA 1JR2A 3LUPA 3Q7TA 4P8RA 4QA9A 5SY9A 5EHXA 3RG8A 3K92A 4X6XA 4RTKA 3FMPB 2EX1A 3I01A 3OF2A 2OORC 4WLOA 4AP5A 5A62A 4BVKA 1VCIA 1Z4OA 4ARBA 1PT9A 5H9WA 1XEWY 4KI7A 4WZBA 2OSBA 3I2FA 3EFOA 3RAGA 4A15A 4ZPXA 2O2GA 3TTTA 4M22A 4IGKA 2ZU0C 4DM3A 1DO2A 5B53A 1VI6A 1CLEA 2BMEA 4NU8X 3ENWA 4DR4B 1KC1A 1XPOA 2FVYA 1JZQA 1T5SA 3DQPA 4H35A 5G0VA 5B3LA 4FR2A 5K0ZA 4JUDX 4JNKA 4NCAA 5ERYA 3X44A 3ZR4B 5F7XA 3KZVA 3IVMA 2XMCA 4OHVA 4B82A 3GYGA 4HQKA 1N6NA 2DLDA 4D0GA 4D4HA 2C7QA 4B83A 3DCJA 1UJ4A 3CMMA 4I9UA 1ESNA 2QAGB 4FGZA 3ZKWA 1KP2A 1Q7TA 2NZ2A 2CUZA 1OXMA 3SGLA 3WA6A 3C8UA 4F3CA 3M34A 5E7QA 1D2CA 1R8XA 2VNIA 3AEZA 3F49S 1YL6A 2VUIB 3WLRA 3EXEA 1K63A 4FFPA 3H4IA 4MGHA 3L2OB 4CUJA 4LCBA 1J8MF 4EKIA 3RWOA 3QFTA 4IYRA 3ISVA 4AXBA 4DA0A 2ID7A 4QPZA 4GYYA 1N57A 1QIHA 4BPRA 4R0MA 3HB7A 1U7ZA 3I2YX 3L8MA 4UVIA 1R0RE 2Z2IA 5CVCA 2ZYVX 3BORA 3BMNB 2SKDA 1RQ7A 3KJXA 2OFXA 4P31A 2AYXA 3CNNA 4OQZA 1EEHA 3ANMA 2FUCA 1JLRA 4ZEVA 4IDOA 4XAQA 3OMXA 3BVPA 1JDBB 4S1TA 1ISFA 4OP3A 1AY0A 1JIKA 4KWEA 1ZK0A 4LY3A 4XD2A 1Q0QA 5GADl 2F1JA 2AZXA 1GZ5A 2DERA 1NJGA 2PWZA 3MQ2A 3PQFA 4H08A 5IEJA 1ZK4A 3OOHA 2PSJA 4UQOA 1QPGA 1XDSA 2AXNA 2YHAA 3FWZA 3NIFB 4HDAA 4BKPA 1LLDA 4G63A 1M0TA 2GN6A 4UPDA 5T6MA 1D1QA 4H7IA 2HYIC 1BNCA 2NIPA 3FKJA 2V6FA 4M3NA 1YU9A 4LRQA 4PW0A 3SBEA 4A4DA 3U9LA 4EFMA 5K0SA 4X64B 4A0HA 5A0VA 1JQJC 5J3JA 1EUQA 4TUYA 1R4AA 1YDGA 5ALHA 3AUKA 4G25A 5AI8A 1TZCA 2QM3A 2X8WA 4MCHA 3PT5A 4F7WA 3ADBA 2W6ID 1E1CA 1X1SA 4AYWA 4D5EA 1OOEA 2I9PA 1P0QA 2IP4A 3HCNA 5DLQC 1MQ8B 2Z2KA 2ZRDA 2F4NA 2R79A 3ZZ0A 2MDTA 1QO9A 1ZCFA 2YIDA 3FMGA 4FE4A 4M1YA 3BD8A 2VSFA 3RRYA 4DXAA 3L4KA 1U3CA 1H2YA 5KTPA 1ICEA 4GG1A 4V02A 3VJKA 4MULA 2J32A 3QXJA 4JI6B 3SXUA 1EK2A 3UUWA 4KGZA 1CS0A 4CG0A 4DYHA 1QANA 5C7LO 3OOEA 2IYOA 3EOZA 3KLPX 1G9SA 2E6KA 3QZUA 4KN5A 4JFAA 3BK7A 2WDPA 4QTYA 1LQUA 4YJ3A 3AV3A 3PGVA 5E6RB 2Q5QA 5DZSA 2EKZA 3RTDA 5EJ9A 2ZDHA 4FU0A 1WCYA 4RIHA 4FWBA 4U1RA 4ZEMA 5LQSA 3JX9A 1JLHA 3HFJA 4W9NA 5AM4A 3C1UA 1BFKA 1E2BA 1QFJA 4ZEOA 3UBTA 3ZNPA 5AMXA 1G17A 1M8FA 3RS7A 4DKXA 2B4QA 1YSCA 2EDCA 1PJQA 4OQNA 4AO7A 1G2PA 1DJLA 1G38A 1MRSA 1Z0FA 3EXFA 4UHFA 1B2LA 1J2UA 2GK7A 2NT4A 3C5WP 1ULHA 2FR1A 4WDQA 3WTBA 4FHZA 1RRCA 1FP2A 1CERA 1XA3A 4FZVA 1VYUA 4JMLA 3EULA 3AJRA 2M6LA 5HOQA 1FPQA 4US2R 2YJ4A 3UG7A 1R6XA 4NXMB 3P97A 4GSYA 4ZVUA 1TJ3A 3GVHA 1QV9A 3IJPA 3NJRA 4OAQA 2NPFA 1ZUWA 3WHPA 5FLYA 3ZV5A 4R84A 4E2FA 1USVA 2BAGA 2IDJA 3QVKA 1TCVA 5FTNA 4XDYA 1IM8A 1K5PA 2I62A 1NX6A 4XSGA 1SXJD 1TYBE 3CTMA 5DM70 1P5FA 4EHDA 3V34A 4DR6B 2PBFA 1UKEA 3Q3GE 2ZIWB 2R5FA 4UVGA 3SXPA 1EFPB 2HFJA 3BC1A 3CGGA 3VR5A 1W0JD 1RHKA 5BVGB 3QTLA 4LJAA 4QDUA 1WLSA 4LXUA 3PC3A 2IZ1A 4LJRA 1JHZA 1GFSA 1XTZA 3QW2A 4Q82A 2RGWA 2AR9A 4MVJP 3U4AA 2C3MA 2YWRA 4DV2B 4HNVA 4RKFA 3LZ6A 1K27A 3K1YA 4D4MA 2PS3A 4EHNA 3TAHA 2UVDA 1K75A 4PN3A 5JPCA 2XNJA 1LNZA 4O3FA 2HSGA 1ND5A 3KXDA 2SECE 3PXBA 1KAQA 5ALSA 1X7YA 4XPZA 1X8JA 3LUAA 1C41A 1F2VA 3QITA 4MNTA 5F3RA 3R3WA 5BYBA 4D4IA 3M6VA 4GXNA 4MO9A 4KVGA 3RRNA 3UICA 4JELA 4HF7A 1CY7A 3ZWKA 3NBKA 3T4PA 5I3ZA 1GFWA 1BKSB 1WSBA 3RU7A 2WU8A 1I13A 2NACA 2Z1NA 1NRXA 4RWZA 2ARKA 3ZIAA 3VO8A 4X84A 3HDJA 1BS1A 2R3SA 4L76A 4YP7A 3H2SA 3Q7QA 2QYSA 3DV0B 4YJDA 4AD8A 3W5DA 2GZ3A 3FWYA 4EL0A 4G26A 4TVOA 2DUNA 1BA2A 2DHQA 5TMPA 4XWTA 1E2HA 1NVFA 1TPYA 1ZJJA 2IHKA 2XUQA 5IDWA 2XUJA 1XK7A 4BO3A 2VQSA 2FK8A 2WZCA 1JEEA 3P9NA 3UHFA 3JATB 5DI9A 4QJIA 2BUBA 3FI0A 5AD1A 5IJAA 2ZRQA 3HCFA 3M4YA 5H81A 4DCTA 4HNUA 3NXKA 2J0UB 2ABWA 4IDBA 4HGYA 3FSGA 3WVNA 1U2DC 2FEWB 3DBRA 1RXSA 5GZ1A 4FFRA 1GT91 1BO6A 2JLBA 1A69A 2EJWA 3FHCB 2JFYA 2ZVQX 1A72A 3I2IA 3QEOA 4G81A 2R751 3AFNA 4PAMA 4BKQA 1VG1A 1Z34A 3MWEA 1R5OA 4Q00A 1E96A 2HMVA 2C8LA 5LN1A 1F4VA 5HKKA 1RADA 1AKRA 4WN9A 5BUSA 4JI0B 1CEYA 4KFCA 2Q50A 1GAWA 4U7TB 4DRXB 5CFNA 3AYXB 3NTRA 1U1IA 3BA6A 3QIVA 4NBWA 4O2BA 5KWEA 1E3LA 5TJHA 4DREA 1E2FA 3QU9A 2Z6VA 4L74A 4IICA 4CM7A 2F3PA 4F4FA 2I6SA 3W5VA 3N2KA 3GVPA 3PZBA 4EMUA 3K5WA 1H05A 1E8MA 4HPJB 3FH0A 2H4ZA 2GFHA 3GFBA 3AY0A 2Q6TA 4PV7A 4TKMA 1XZEA 3UK2A 3PL1A 3R5FA 2I2FA 2I8AA 1FLVA 3ZCPA 3RSLA 1RJFA 4LWOA 2VK8A 3QH4A 4QQNA 5E6UB 1D8AA 1D6MA 4RD1A 3ZXXA 1TZJA 4F12A 5GOZA 3GF4A 3GB9A 1BE6A 4J6EA 1AMNA 4R2XA 3UY4A 2RGYA 2H5IA 3F6CA 4D5GA 1XEWX 1K97A 4BFCA 4JDUA 2YWXA 1KDTA 1A77A 4BYGA 4EQ6A 3K30A 4LUCA 2FP4A 1J1ZA 4GM1A 3AH8A 1XYVA 3NYWA 2ZVDA 5K4GA 2QYHA 5H70A 4EB3A 2V45A 4LHWA 4UXIA 3T7DA 4B3CA 3BMXA 1CYDA 1LV7A 4X20B 3W5HA 2Q1WA 3U3XA 4DF3A 1RT9A 1G3MA 1UPXA 2YVKA 2NM0A 4G5RA 5KPDA 3ND7A 4FOLA 4M7RA 2YIJA 4PXSA 3VTZA 4EJSC 4KHPB 1GL9B 3BCHA 2LIPA 1M34E 2PR2A 5JAHA 2QX8A 1MVOA 4RSHA 4FGUA 2YJNA 3ABIA 1KHTA 4UBIA 3RRMA 4EPVA 1L3BA 2VLIA 2H0QA 3SHVA 3G89A 3VDRA 1G66A 2QYTA 3H7AA 3F97A 3IPYA 1P1FA 4QE3A 2IZ6A 5ANRB 5F7ZA 5H02A 4DA4A 1XROA 3KXIA 1E7RA 1DEAA 4ZQIA 2X0RA 2FW7A 4KDRA 1ZUNB 5F5LA 4BE7B 4EIWA 5CVTA 5C9ZA 1RXYA 3TZEA 3ICWA 4WXEA 2PU7A 5FOVA 3KUKA 4WOJA 5EZ5A 4NYMR 3RIMA 4LYEA 5G3YA 3CRQA 3HFGA 1UZAA 4OJTA 1LPBB 3IEMA 3IOYA 4EB8A 5LYJB 1G20A 2QGFA 3WFJA 2B3DA 3BSYA 1PT8A 4OXIA 1SUAA 2HSZA 3BWCA 1NVVQ 2FV8A 5FJJA 1KFBB 3WK8A 4DMUB 3T5PA 3T1TA 4MVXA 4M49A 1RCFA 3V9AA 1UJCA 3U0BA 3GGDA 5KTKA 1ECFA 1MO5A 3NOQA 4KO8A 4TLAA 3VKFA 2PV0A 5IX8A 1VRVA 5K3AA 1RPNA 2DAPA 2QMEA 2VFAA 1U7WA 5FOSA 4UARA 3LYUA 1QYDA 1DJPA 1I3MA 3A6LA 3EBOA 2GAOA 4M0EA 3P19A 2AVDA 4AZ0B 1LB1B 3BB1A 4D98A 3ET4A 3SFTA 3I6MA 4DVGA 1W88B 4CL8A 4TGLA 3A2KA 2X0KA 4YT4A 4L2IA 2W2LA 4U2DA 3N3BC 1TUEA 4ZHSA 3HCRA 1S8NA 5HDQA 4L9AA 1E9EA 2F6RA 2ZIGA 1L1EA 3UAGA 4WBNB 1EDDA 3JWIA 4PYMA 5DPMA 3C3WA 3MCVA 4RVOA 2B6NA 3GLFA 2BTOA 4GLBA 1X38A 1J09A 2XQFA 3UT5B 1QZXA 2HMUA 1PD0A 4Y2PA 2JVKA 1BG6A 1SVSA 5L95A 2YFKA 4GBGA 3I04A 2Z3ZA 1NNUA 3C6KA 4KLCA 2JFXA 5A7HA 1O95D 1VSTA 3ZBUA 1GJRA 3A4LA 2CJFA 3LZCA 4OV6B 1OFTA 1E77A 2BHLA 2H2DA 1USUA 4RZUA 5F52A 2OLKA 2IDZA 3WK9A 4M7WA 1RABA 1XQ1A 2E3JA 1DAFA 5F2NA 3EGVA 1NPYA 3BN3A 3SJAA 4FDUA 1HE8B 3GLVA 3NB0A 4HRAA 4QICA 2BJWA 4OLAA 1QF6A 1BS9A 2OMEA 3HEBA 3ZV7A 5BW5A 2FDCA 1DBQA 1L5HB 1DEXA 1KFEB 1N9KA 4UNQA 2EW1A 3T1VA 3Q1KA 4PX3A 1P2FA 5A9SB 4CR7A 1IY1A 2PSSA 4U3JA 3LC7O 3ZK8A 3RS3A 2ILTA 3MCZA 3OUZA 5BSFA 1A5TA 5ITZA 1M2FA 1X3LA 2D59A 4TXNA 3A7EA 3R24A 3AEYA 1ZH0A 3GQBB 5LMZA 1NJ2A 4D4GA 2W98A 5AVQA 1JXOA 5HQJA 2G7MC 2OCLA 5JC8A 1Z7WA 2QPTA 3CG0A 3EDYA 4DIMA 3CRMA 5AFSA 1LC0A 1XP8A 5AVTA 1QIDA 1DADA 3H5LA 1ECLA 4XFJA 4ZYZA 4P2BA 3DDCA 1QO0A 1PQWA 1BX0A 4Q4AB 2BH9A 5LPNA 1KYYA 1U3FA 4RL4A 2QLMA 4QTUB 5D1HA 1L5MA 1OV4A 1RXUA 1NQXA 4V39A 4IY1A 5JD3A 2GT1A 2XDQA 5T4HA 4NE2A 2C4UA 3OKCA 1L5KA 4C3ZA 1G7CA 1E3SA 1YS4A 1QDLB 7YASA 2AC7A 3V00A 1XMIA 5FXMA 5KJ1A 4KIGA 3K0CA 4KOAA 1UWKA 1JTEA 2B78A 2PT9A 3NASA 4MA0A 4LYHA 3ZU6A 1HSZA 1QDUA 3G9TA 3MJCA 5CT6A 2C1EA 3BFXA 4HXGA 4JX9A 1BXZA 4ENSA 1JG1A 3F7OA 4RU1A 4ZC8A 5CXUA 1B6TA 1TVCA 2V0GA 1X7ZB 4X63A 5DM0A 4EVIA 5DSXA 5KBYA 3L0SA 3WDMA 1S3FA 1W47A 2WW8A 3KJEA 4UCXA 1QYVA 1VKJA 1SQ0A 3V4VB 1B0PA 1G1AA 1XKTA 1RI1A 3RLFA 1SXIA 2CHGA 4IKPA 2VJNA 4IXTA 5HGXA 3UMSA 5EEGA 6GPBA 2B8WA 3ROTA 5KYWB 1U4SA 2UUOA 4E15A 1CVRA 3BD6A 4HATA 4RF2A 3U7GA 221PA 3G0DA 3ADOA 1ZXXA 4HX2A 1E59A 2HBZA 5FO0A 3ZU4A 4LOHA 4BDSA 5L9AA 1PQUA 5DHTA 3Q3EA 4YRDA 4PLHA 4HQLA 4F72A 2C84A 1TLTA 4TS4A 3V55A 2AQ8A 4FS3A 1O3YA 4Q66C 2IBTA 3QHQA 1MJGA 1WLYA 1LVHA 3UAVA 4ZYUA 3WGVA 4KPUA 1SAYA 1E9VA 2FU5C 5DTJA 3GFQA 4INAA 5IW8A 1E92A 4F3RA 5KTTA 4MGEA 1IRXA 1XAIA 3BEOA 1Z2DA 4HH1A 5LOVB 3PQ3A 1OX6A 2VYND 2NSJA 2P2YA 2HSWA 3FDZA 3HR4A 2XT6A 4LX8A 2Z2JA 1R4NB 1FBNA 1X70A 3PYLA 1U2RA 2VPIA 1KGSA 2R8PA 3GNSA 1Z2NX 5EIOA 4ZZIA 3SIXA 1MGOA 5CG2A 3QJGA 3SJUA 1Y6ZA 5D3KA 1SBIA 2R8YA 4RGBA 1QR2A 1ODCA 1P0FA 4BB5A 5CPFA 2ACKA 5EGSA 4B3TB 1I4DD 1A9QA 2PG3A 2WJPA 4QYSA 4TQAA 2PSDA 4YRGA 3ZBPA 5JAPA 1EBUA 5H3LA 3LVBA 3V8PA 4JR2A 4NV3A 5C32A 3OZRA 3SY8A 5H5JA 5KYUA 4C1BA 3F8SA 1FP1D 3PXDA 3IT0A 4CMBA 4PG4A 4HG2A 4E33A 1P0MA 3FFBA 4ZJPA 2H54A 3RFCA 1ZWKA 1T1GA 1A9OA 2I67A 2Q3CA 1VFNA 2PKYX 2IZ0A 4MDYA 4AY4A 4KQEA 3T7IA 1NMQA 1HLFA 1P0CA 5LLTA 1O94D 1C4KA 2CDNA 4L3WA 3UN1A 1C0IA 2GTIA 1MB4A 2O50A 3WB9A 5ISMA 1FNNA 3URKA 1FFSA 3Q41A 4JEMA 4XM0A 3UCXA 4YNBA 3HJNA 1PSWA 4Z4EA 3QU2A 5CTAA 1ELOA 3HO6A 1M8PA 1W0KD 2AFHE 4XOUA 5K9ZA 3ZZ1A 5J4HA 4QU8A 4UM7A 2P9YA 1XJ0A 3BILA 1Z5PA 3HUUA 1UDCA 2J3EA 3H9EO 2I4MA 3FPBA 4QM6A 1EP3B 4KPFC 1A9XA 2DT5A 1C8KA 2CVFA 5EE3A 2OOSA 3HA2A 2ZAGA 1JZTA 4E5KA 1JP7A 1L7BA 4LYJA 4WFJA 4F4CA 1PFGA 2PUBA 5B3JA 3D2LA 3HM2A 4WX2B 1EM8A 2DPLA 2YFHA 8OHMA 2V7GA 5MGBA 1FTYA 1CYEA 2ZWPA 3N7AA 2VWPA 2FUNB 4L7VA 5I01A 6LDHA 5D5PA 4L4SA 2A1TR 4J0EA 3SN6A 3TVDA 1DO0A 3EW9A 4R1LA 5WRFA 1YZKA 5IVKA 1G3RA 1MNQA 1PTJC 2VPQA 3MGCA 2VYCA 4BQEA 1ZD1A 1L6RA 3GRVA 3LQKA 2IHNA 4YLYA 1CE8B 4HBZA 3EZNA 4CLRB 3CUSA 1VYVA 3B60A 5BW8A 5C4IA 3PFIA 1SHZA 1XA0A 2E89A 3K0AB 5EL0A 1YTUA 1FQJA 3JQ9A 3QWFA 1FJXA 2V9CA 3RK4A 1MXFA 1HOXA 1OX5A 1UBFA 3QE4A 2PM8A 3O83A 4TQGA 5F5NA 1JH9A 5LCXA 4E94A 3RO7A 2XZDA 4KRYA 3A9VA 1PR0A 4XYGA 3OJLA 1BSVA 2FFBA 3BGSA 3E23A 4O4LF 1YCGA 1DBWA 1RLMA 2CXPA 2JD1A 2PAAA 2PUVA 5EZYF 3FBTA 1IWBB 5JZBA 4N8SA 4RELA 3HJBA 3QX7A 3OQOA 2NU8B 2EJCA 3N2EA 3L93A 4EHAA 3U4QB 3O92A 4ZYTA 2YL2A 1PVDA 2XT9A 3TDMA 4HO1X 1JALA 1C1HA 1GGHA 3LKDA 5I5EA 3OE1A 4AWAA 2MYNA 3CNLA 2R44A 5LYJA 1VL8A 4RTOA 5LA6A 5LUAA 4D7AA 3WMEA 3OKPA 2OENG 2ZEJA 3PXGA 1SQ6A 1E1DA 1JZSA 1MIOB 1WF6A 2JH3A 3G1WA 4KUHA 5K0BA 1POXA 2J9FA 1YZNA 2D5AA 4FFBB 4GZ3A 1DQPA 5KQSA 1MV5A 1RLJA 2O07A 4RTJA 1N1GA 3AG6A 2DEUA 4IS3A 4E31A 1HFKA 3D02A 4D42A 4FYIA 2ZYRA 1VA5A 2I22A 1KSGA 4B6FA 4BCDA 1E5QA 4UQLA 3BMCB 2QN6A 3Q6NA 5CLFA 3ZH9B 4S35A 3IVXA 1RWPA 3R3XA 2OGZA 1LDMA 2WT9A 3A11A 4RC9A 2XRZA 2PMCA 2AUMA 4O5OA 4BFWA 4KO4S 3E9YA 2HFKA 4J49A 2C4MA 2P9JA 3DXFA 5BSRA 1FC0A 1Y3IA 2XPCA 1D0IA 2WIBA 1C0EA 1QZUA 3HC7A 3F73A 5ADWA 1HT1E 3JQRA 2Q8NA 4HX9A 1LU9A 4O4HB 4AX4A 3R0IA 2H1RA 3W2IA 3CU5A 1ZR4A 4PYLA 3FWPA 1R0XA 4QQKA 3GGPA 1WVIA 1H0HA 1KE1A 3O1JC 5INTA 1G2OA 1PKXA 4TMTA 3F6RA 2E1RA 4Y9DA 1BGVA 5HIKA 4OUDB 2NVUA 4RZ2A 3EA0A 2OBNA 1S96A 1QH1B 1ABBA 4XDHA 2AEJA 2CZQA 2FPIB 2YJ6A 1UJ6A 4QGBA 3DOCA 3LLVA 2JG3A 2CMDA 2G70A 3EFHA 3O75A 5LP6A 1ISMA 2Y6UA 4G0WA 1K7SN 3KFLA 5DRYA 4GX1A 4MUNA 1GV0A 1Z82A 2G0NA 2KS6A 2V3CC 3FF4A 3QOYA 3NHBA 2HRBA 3NWOA 3R20A 2ET6A 5ERXA 1VHQA 1YZQA 2OGSA 1V16B 3RI3A 3WADA 2FYTA 3WO1A 2HD4A 3SZLA 3FB4A 3IP6A 3Q0EA 1SCUB 1VBNA 2BKVA 3HKBB 2QMQA 1U8XX 3ASZA 2R8RA 2E2WA 3JZFA 1QUEA 3EODA 3KUDA 2VTKA 3FYUB 3PYXA 3U1VA 2JIRA 5F76A 2O1WA 1T0JB 1NE7A 1NC3A 4FM9A 2PL5A 3OJEA 3HFSA 4URWR 1OBVA 2VPZA 5EXPA 1O8CA 1J0AA 2G88A 5A9SA 3I8XA 3KZNA 1AO0A 4YMVA 1AHHA 1T5OA 3UPTA 4P7BA 3EMDA 3THYA 2A9FA 1XMOB 1KMCA 1L7VC 4PTLA 2QRPA 4LE1A 4CIAA 3THWA 4OX9B 1ECGA 2HI0A 1HDEA 1KFJB 5A3JA 1IK6A 2ODPA 5DISB 2FDRA 5DOZA 1QTQA 3HVHA 1YNSA 2QZPA 3F7TA 5EPOA 3ZGXA 1VMEA 1ZRNA 3OESA 1VGQA 4NDNE 3TRDA 4UD2A 3U4HA 1RIFA 1KYIA 4WVLA 1HR0B 3C74A 2BL4A 1FMJA 4B6SA 4REQA 1YDFA 1U0RA 2JNWA 2VXCA 2QSZA 2YXBA 4Y6LA 5K0EA 1G2QA 1TO1E 1F12A 2YV4A 1QH0A 2HLHA 3VR5H 1ONNA 3T5DA 3IQEA 4FGKA 5CDYA 1B0UA 2AWNA 5F21A 3C7DB 4JA0A 1SBZA 2O1XA 3FOAA 4JAVC 1LBHA 5BWBA 1DWOA 4TTQA 2HCBA 2WPNA 4D1YA 3OEED 3M8KA 3B9BA 1ARZA 3DM9B 5E95A 3UEOA 2FRDC 3KD3A 5SV2A 2BF7A 1G1MA 4XB1A 3D3EA 3ICQB 3EDQA 1L4GA 3JQ6A 4OQQA 2OE2A 1JEYB 3NNNA 4B32A 2XOXA 1HFWA 3GFGA 2UXDB 1T6BY 3E1SA 3ED1A 3G5LA 1JHOA 5L4LA 4NYJQ 1FS5A 1YDWA 3WBFA 4DA7A 5CCEA 3PDIB 3BZWA 1QAOA 4G37A 1YBFA 1CNEA 2B35A 3BMQA 1U9IC 1KMHA 3HUDA 1RZUA 1Y9ZA 2ZVJA 4FHDA 2H1FA 3IURA 4XLTA 2ZOSA 1NF3A 2GPBA 4WNAA 4ZOLA 2ZXUA 2JJ2A 2JGFA 3PJRA 4RSMA 4BBAA 3CCBA 3K16A 3I9LA 4MMZB 4MWDA 4QUDA 2MTBA 4RV4A 4B5LA 2QNRA 2K87A 3VJLA 2ZVPX 4RYDA 5ALXA 1GFZA 3LDUA 1N2CA 2EAUA 5IJ9B 4BZPA 1AG9A 2NO1A 3RF6A 1W87A 3KQWA 2A1UA 1ODTC 1NN3A 3KVVA 3L4SO 4N5LA 4G9EA 2PZJA 1N5MA 4C03A 2ZRNA 1RXWA 4B8YA 3QLUA 2VSQA 3ZXUB 2CLOB 2BGTA 1KMMA 1JB9A 4GDMA 4HC4A 4RQBA 4PC2A 4TTSA 1VLZA 5DXFA 4PX9A 3HCDA 5JAQA 4KO3S 4PIMA 3VNUA 1OCEA 1E7YA 3FIJA 1C0PA 1PKEA 1ZN9A 4GLJA 3DDOA 2V5VA 3N6VA 2Q45A 2YTZA 3C5VA 5K0FA 1F4LA 5G4KB 2QVGA 2RHMA 4Z99A 1ZM7A 2F17A 1A2BA 2DKOA 2J3IA 3PIIA 3PC8A 4ZA2A 3O03A 5JATA 1WPQA 3MCUA 1UWCA 1FRZA 2H0RA 1U2GC 3IDAA 2Q0SA 4NPAA 1E5DA 5LSAA 4WZZA 3WO0A 3VPAA 4P86A 2VHVA 4YR7A 2P35A 2IYEA 2ACEA 2WIFA 3HZRA 4I4TA 1UMCB 4O4JB 3WL4A 5GIPE 3AF6A 4G89A 4F6LA 3EVAA 2WD7A 3IO3A 3KPVA 3W8FA 4H6VA 4UBNA 1NF9A 3MVEA 3F5SA 4G5FA 4UUQA 3TQTA 3U1BA 1BMFD 1DC7A 4CE6A 4W7SA 1NY6A 5B5SA 5LWQA 1K6IA 3IOEA 2XCLA 1JTFA 2QBYA 1Q14A 3G8BA 1OYVA 4NOKA 5LJLA 3DEHA 3R0QA 4W5OA 2W2NA 1XTSA 1KZHA 2JGJA 3L0ZA 3FSJX 1KERA 4GOMD 1C1DB 1V8FA 2AUNA 4WUVA 1NXXA 4JYAB 4AZSA 2CN1A 4G0YA 5AUPB 1I2AA 4QLBA 4GOJA 3FCSB 1IE3A 3EISA 4DQXA 1E2KA 3HJAA 3M5PA 1EK6A 1HE2A 1PN3A 2FXVA 2I2CA 2VQ6A 2WT8A 3FZEA 4TVKA 2QGNA 1EM6A 4I50F 4IVRA 4DPLA 2VDPB 2HK9A 2PJDA 2PH7A 3SX0A 1VBMA 4S12A 2OILA 3O9ZA 3OQIA 1LBQA 1BH6A 1P7CA 2G0AA 3AC0A 3DHVA 4ND8A 4W4TA 1V7PC 5HJ7A 2WFLB 1KEEA 4LF9B 1R0BA 1J5PA 1P2TA 2WKWA 4JJIA 3Q8MA 3GAAA 3P9XA 4I9FA 1VA4A 4Z53A 1ZN8A 4PLPA 3WRYC 3RS9A 5FH9A 3ZUGA 1IM5A 6CHYA 1V8DA 2ZS7A 1OIVA 4QLAA 1L7MA 2WV7A 2NPOA 4P53A 5FYDA 4CCAA 2F3UA 2XI4A 2ES4A 5BR1A 3G85A 1Z83A 5MF6A 1OI2A 2G5TA 1RBQA 2XR1A 1SCQA 4YYZA 2BMJA 1V1MA 2C96A 2JAOA 3L46A 3OLWA 1ORHA 3QMWA 4AJPA 4K9KA 1XZMA 2JARA 2WM8A 2VTBB 2DUJA 1XRMA 2NWQA 3IHKA 2QM8A 1DT3A 1RC0A 2G5GX 2NG1A 2PT6A 4J2OA 5TEWA 1Z15A 5GJWC 3G2KA 3ONNA 1PQYA 4P3OA 3UCEA 4HWGA 4RV5A 4LC9A 4PO9A 5E4TA 5SICE 3EW7A 5BRJA 2ZATA 4MEBA 1HFEL 1PL8A 1P5RA 1DO8A 1KEUA 2QU7A 2NUTB 2GZRA 3DXZA 1L4EA 5DCLA 1IBCA 3VZPA 1N7HA 1A98A 1SQGA 3NRCA 5U1PA 4TQ9A 4MW2A 4GXTA 3AKEA 5K3DA 5K51A 4XTCS 1M76A 2GA9A 5LZ5A 3AI7A 3IGFA 1LA2A 1B6SA 1NVMB 1XLVA 2IYSA 4I4IA 3HXOA 2BD0A 1L1RA 1JMVA 1B23P 1U99A 3PDCA 2Q8PA 3B5JA 2ZYUX 3DKKA 3G2LA 3I6IA 3WIOA 4HUTA 1MHTA 3BXGA 1UK9A 3L4BA 3CEJA 3VKHA 2TMKA 3RBXA 2ONJA 3VPBA 4TLCA 4G5XA 1TXGA 2AN4A 4ZAXA 4Y2UA 1DMSA 13PKA 3HKEA 5E2AA 3K15A 3ESYA 2JI6A 6REQA 1QQBA 2Z5VA 4AZ3B 4Q37A 4RMJA 1VLJA 4QOHA 1GKUB 5SZIA 2JFPA 4NU5A 3TLEA 1E2UA 4QJBA 1AZTA 3JQGA 1NF2A 2JKZA 2BR5A 1ULAA 3OF3A 1RFLA 1N4DA 4Q1VA 5GZ3A 3ZWAA 1CUAA 2PIAA 1U28A 3O4IA 1VPLA 2O57A 4DMFA 1BKDR 1Y4DE 2D5CA 2BVNA 1XD2B 2FR8C 2VTEA 2DBRA 3L7LA 2WD8A 3LH5A 3WWZA 3U6KA 2EP7A 3PEFA 2DJIA 3LQ4A 1OXUA 1MRZA 3BQMB 4QGHA 2IJGX 3ODGA 2GCNA 3KCQA 4IRMA 4NDZA 4OTZA 5HBGA 1Q2XA 3U80A 3WZLA 4C7BA 4D3SA 4DV5B 3RKUA 4DABA 1W73A 3TK1A 4KH0A 4BECA 1Q16A 4PYJA 2UYGA 1GAJA 2H8GA 4GQBA 5KC9A 4MUXA 2ZS8A 5KKAA 4KN6A 2Y1WA 3HHEA 1YRHA 1J0CA 1Y80A 2JIQA 2OAQ1 3H99A 3LUDA 1AXEA 4PWZA 2MU1A 3IULA 4JI3B 2JA2A 5FEUA 1HL3A 1FVHA 1VIDA 4MV1A 1R0KA 1UIMA 2V6JA 1Y8QB 3PX7A 3N8NA 1SVOA 3H5RA 3MMPA 4BBPA 1V7ZA 5BP7A 5HIIA 4G0ZA 2O1SA 2PTGA 1FS4A 1U8EA 4H1UA 3TS1A 5A4IS 4MDFA 1JUDA 2QG9A 1G8KA 1KAEA 4LFAB 2W8BA 1TGVA 2X5OA 4HP8A 4PBRA 2A3NA 2FSHA 4G23A 4HQFA 4QQRA 4W63A 4BX9A 4R9RA 1D4AA 1XV5A 3G23A 3CR3C 4QOFA 4ZU1X 1KZ1A 2PO5A 1ZJ4A 3ZCXA 3ESQA 6ADHA 1IUPA 1FJ2A 1PV1A 2F3SA 2R65A 1XZKA 3I3SR 1NXOA 1J90A 4OFWA 2FMUA 2ZRLA 3L7NA 3NVMB 2PX2A 3SC4A 4RS4A 1EHYA 1BDMA 2Q7XA 1MG0A 3X43A 4G4IA 4JJAA 4BEVA 3IOBA 2C5FA 5IABA 4AQYB 1Y5LA 1OTYA 1UDWA 4Z0TA 2I3ZA 1ECCA 3MJVA 2BFMA 3ZE7A 4DSOA 2VP4A 3EG5A 4LZZA 4LI3X 2OOKA 3NRBA 5LP1A 1VIMA 2HGSA 4TWRA 1MT3A 5H4GA 4R51A 4QYIB 3VR3D 3GLUA 5DWQA 2RHGB 4LGCA 1BVRA 2GBLC 3WV4A 1FSSA 2JANA 2X1VA 2H59A 3H0EA 4A23A 5GJBA 3IB6A 1O6ZA 1V7CA 1L7AA 3NYQA 1HQCA 3IV6A 4WCFA 2GYWA 1CQJA 2BHRA 1BDHA 4GEGA 4TRRA 4YV2A 2O8BA 1E6LA 3WQSB 1Z4KA 2XY4A 2CEKA 4GX5A 4X1KB 2W48A 2JS7A 3KDSE 3LL7A 4A2PA 4ZYYA 4AIRA 1NQTA 2E4UA 4RIIA 4COKA 2NSDA 1DCKA 1P75A 3GUUA 2Q29A 4AMYA 5JFGA 1EUCB 3E7DA 4IDFA 1N3LA 5DP2A 4C3OB 4M9RA 3GDGA 3BEDA 2P8JA 2QN1A 2P30A 4QHTA 1HF3A 1W4BA 2HA7A 1RI4A 3UWDA 4FXOA 2EWVA 2QLTA 1EX1A 3AVXA 4ZRNA 3R6LA 3PDUA 3KZXA 1I10A 2JIZA 2KLHA 3GP5A 1TAUA 1TFUA 3NR2A 1EFUA 3T0IA 3UWSA 5A5FA 2OFOA 1F8XA 1RHQA 4DBVO 2NLOA 3U3RA 4ED9A 3BOSA 3ZQJA 1JSLA 4FOSA 1F20A 3L6UA 1P4JA 1NXSA 2VP5A 1C1YA 9ABPA 1A3CA 1NATA 1U7DA 3RFTA 5K6RA 2YJ5A 3ILHA 4NMHA 3JVIA 3TL3A 1MC8A 2GJ4A 3SE0A 4UCFA 1OPRA 4Q34A 3ZV4A 1WZCA 3L7IA 4ZDWA 3NUZA 4HH3C 3BRWD 1WQ3A 3EQZA 3VQTA 4OFBA 3KOZA 5HIJA 1AXRA 1GKYA 4FFDA 2FG7C 5BN4B 1Y3DE 1KI6B 1MAHA 1UBKS 1UKZA 2BLLA 2C7RA 3KDAA 3U4GA 1DEKA 5LKRA 1JAHA 4W5JA 1YQXA 1TEHA 1X3SA 1QMPA 2XAAA 5DW3A 2D06A 3LXMA 2Q6OA 1MEJA 4KBFA 2DX7A 4ARIA 2EC5A 3OLVA 4Q02A 3KX2A 3R9XB 5FLEX 2NU9A 1C4WA 2RKOA 4RO0A 2RK4A 1M2VB 5CA0A 1JDTA 2CXOA 4HB0A 2EBHX 1V1RB 3H2ZA 1QO7A 3K6RA 4GWLA 2TMYA 3N05A 1Z7BA 4YP1A 1R4MA 1PV4A 4DNOA 1I2BA 3GJQA 2JFFA 3ELBA 3ZPXA 3PWTA 4TYYA 1XWIA 3D0KA 3L7CA 5FBRB 3COJA 3I0MA 3R4CA 4LDNA 4QBIA 3L0IB 5A2GA 2OECA 4OGLA 4OG2A 5FWXA 1B00A 3E82A 3KVOA 2X15A 4N7RA 3LT1A 3AVPA 1M34B 1P1RA 4JLNA 4LF4B 1J99A 1TPZA 1YWGO 1EB9A 1HBJA 4PG8A 3IAEA 5KB3A 1LVGA 1WXWA 1O6FA 2HMYB 2PSHA 3UKJA 5FNVB 1MU0A 2L18A 2AN1A 2JFQA 4U2CA 3CZ5A 4CLDA 2C0QA 5ADVA 3K71B 4KAJA 3P4YA 3K2QA 2XOKA 4XZ3A 3NJ8A 3ZY4A 1OI4A 1GCOA 4UAJA 2VT6A 3H1FA 4QDTA 1Q0HA 2QXUA 2X5NA 4G5SA 1L5OA 1NIPA 1J49A 4OJYA 2I03A 4NZOA 2WJWA 3E5MA 3G5UA 4R6XA 1E2IA 3PFCA 1XQVA 4TT3D 3RT7A 3UW3A 1NFQA 4CM4B 5EP4A 1EUDB 1BXKA 1DAKA 2C2YA 3LMKA 3O26A 4WD3A 5CIWA 2BGUA 2WTUA 1RVV1 3EMKA 5DXAA 5FTKA 4NHOA 4Y7CA 5DHSA 3LUHA 4XYEA 4IRUB 4LRWA 1XZBA 3Q7SA 4I6EA 3W3AD 3WRXA 2FCAA 4YVFA 4B8WA 5B36A 1JG7A 1JV2B 4JD5A 1RZVA 3N2NA 3WBKA 2WMYA 3EIQA 4II7A 4O02B 5AXDA 1QONA 3SSAA 2OB2A 3TNFA 4CEJB 3AVVA 5CEEA 1HH4A 4DC0A 1XOIA 4TN1A 1QLJA 4MK4A 3SAJA 1FMFA 4KRGA 4LXQA 2HJSA 2A8YA 2J07A 1WXDA 4XH9B 3VC2A 3VBEA 2C0PA 5BV1A 4D45A 3INNA 2FUEA 2BUCA 2O2DA 3LRTA 3DLIA 1SUBA 4WT7A 2I4RA 2WG2A 1CB0A 1J0BA 4IO1A 1NI4B 4BJ1A 4TS3A 2FE1A 2PKXA 4FPXA 2O8EA 4FZJA 4M1TA 2IXGA 3OICA 2W0SA 5FPTA 2CLFB 4US0R 4PHHA 4PVDA 5B6IA 1HZJA 1GUZA 1UBCA 2QGZA 3WNCA 1MOQA 2NUPA 2WTEA 2MINA 3QWBA 2J4CA 5AOCA 4DJDC 3UK6A 4HDSB 1S4MA 4YWJA 3ZDXB 1IJBA 1JIVA 1P1IA 2QV0A 3C7CB 4JEIA 4MYRA 3EJWA 3WGZA 1L9XA 4EGQA 3EHDA 3M6XA 5KX5A 3A2MA 1CUBA 4YRJA 1D2MA 5EHZA 4I0WB 4CQNA 2PGXA 4UAVA 4PYIA 1YE8A 6AT1A 3ADDA 3UMFA 3P0JA 1HORA 1QLWA 4E5VA 1Y8RA 4LCEA 1XF9A 4R1PA 3WYBA 3DMFA 1NU6A 2C07A 4D4JA 4C7OB 1TMOA 2OO5C 1HZZC 5LJIA 2A0KA 3P2OA 4J0GA 4JT4A 4DT1A 4RLQA 2CXRA 1JG4A 5HHTA 3ZQ4A 4KNYA 2ZSDA 1K8RA 2I6FA 4JOQA 3PGA1 2JAPA 2WTAA 1L7RA 1PL0A 1E4EB 4MEJA 3RC2A 5AVSA 4F2DA 2CCGA 1B4DA 1FB5A 1WULS 2VAPA 3Q88A 4XQ9A 5CCDA 3T7SA 4FHGA 2GM5A 4DBLC 5ALUA 5HJEA 1QTNA 3NHFA 2FQXA 4GOKA 1HNZB 2A57A 4IGIA 1NL3A 5JT1A 1WETA 4QD3A 3JASB 5CVJA 3KVNA 4M54A 4TOIA 4D3DA 2NAPA