1ZNYA

Crystal structure of mycobacterium tuberculosis guanylate kinase in complex with gdp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
183
structure length
183
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Guanylate kinase
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 57
structure length 183
sequence length 183
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znyA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znyA01
4Q01A 2CL0X 5CYPA 2Y8EA 3BJIC 3KTAB 5TARA 1E3MA 3SHFA 2F1RA 4NZYA 4Q1AA 3C16C 5KNCA 2G6BA 2L0XA 2IYZA 2KB0A 3LQQA 1YKSA 3GPLA 5JZVA 2EYQA 2PT7A 5CK5A 5FBRB 4JYBA 4URYR 1UPTA 1E9RA 2OM2A 4BFVA 2C77A 2VTKA 1JR3E 4BZQA 3WYAA 2GTPA 1E1RA 4RFSA 4RZ3A 4TN1A 1W7AA 3B60A 5A5GA 2GXSA 1HURA 1R0YA 1LVGA 1G3UA 4ACAA 1IXSB 2OLJA 3PQCA 1KY2A 4C0KA 1SXJA 1XJQA 3SQWA 4AYXA 2OCPA 3ECCA 3U3MA 2EFCB 3SZRA 3WP1B 3MWLA 1E0AA 3QF4A 1XEXB 2GCOB 1GRRA 4G5GA 4MYTA 4B34A 1GKYA 1V5WA 4UKDA 4P3YA 2Q3MA 1W4BA 3TNFA 3SR0A 1ZUHA 2VHUA 3AGQA 5KSOA 3VKWA 4M9XA 4UXIA 2YWFA 4ILEA 3OFND 1F2TB 1P72A 1KJYA 2VLIA 4DCTA 4F92B 3KXLA 5FFMA 1G8FA 2FZLA 2O52A 1HT2E 3D8BA 4XD7A 4WZ6A 1NVUQ 2DPXA 2UVQA 3WYGA 3SQXA 3EZ7A 2F9LA 3LWNA 3BH0A 1ZNZA 1HEIA 3TQCA 1CJMA 3HJNA 2BIFA 4YMWA 3WRXC 1Z3IX 5EUQB 2G88A 1JEEA 4E03A 1TAGA 1Q21A 1TQDA 1X8KA 2A30A 2AD1A 2R6GA 2WWYA 1E79D 2DHRA 3C5HA 4AURA 5KOYA 5AJWA 2A5YB 4PHHA 4LV5B 3SJZA 4IFBA 2J0VA 4GMDA 1OFHA 1Z6GA 1TF5A 4TMVA 3ZQ6A 1NVVR 4KYUA 4Q03A 1JNYA 1ZU4A 3EA5A 4WBSA 2BEJA 2N46A 5FUXA 4XWKA 2IYSA 3MSXA 1CJUC 3PUZA 3T5GA 2WSMA 4OQNA 1IJFA 3ZYCA 2HT6A 3K0FA 1Z0DA 1XD9A 2CK3D 4BPBA 4KHZA 3F3YA 4GP7A 1F3OA 3ZVNA 1JXOA 3U6BA 1WQ1R 3R8FA 2XITA 4QM7A 3KX2A 3QI2A 2P0EA 5LD2C 2YINC 2PT5A 4KLZA 5F98A 2CHVA 3KXIA 1KDOA 2ATXA 2WWHA 3A1SA 3HP1A 3PXGA 5BN3A 3A37A 1SKYE 2DYKA 2QAGB 1Z8FA 4LHZA 2F55A 2ZUCA 2JLZA 1RRPA 1ODFA 2GF9A 1LFDB 3UMFA 2QTHA 4CEIB 3R20A 3HU2A 1W47A 2REBA 2XOKA 4TT3A 1NMXA 1VG1A 3JZMA 5GJCA 3KQHA 5CYOA 4Z8XA 1E2GA 4EPVA 1TU4A 2A5JA 2ZJOA 5CB6A 2J7PD 3G5UA 2QN6A 2ERYA 4ESVA 3TSWA 1XRJA 4KBGA 2WM9B 4K46A 1QHNA 4NDZA 3TVDA 4DIEA 4XWOA 1E2NA 1S8FA 5CLQA 5IF9A 3N2IA 1JJVA 3UATA 1NKSA 2JLYA 3N70A 3LBIA 1KHTA 5EP4A 1D6JA 1N6LA 4Q1EA 1G3RA 4B2PA 3MFYA 2GK6A 4NYMR 3ZZTA 4BFSA 1U8AA 3BOSA 3CZQA 4IEEA 2DWOA 5EXTA 4BGDA 1P75A 1IXZA 4MGIR 2BCJQ 2WWWA 3FDIA 4ERNA 1G7CA 5J4LA 3AF1A 3LA6A 3AGPA 2YYZA 2AXNA 3RWOA 1II9A 2RCNA 3EAQA 1S1MA 1SVLA 4DT1A 4M9ZA 3NXSA 2H8KA 1VIYA 4L5BA 3RYTC 5CJ2A 3A4MA 1OW3B 3CPEA 4KFTA 1ZNXA 4UNRA 1OB2A 3LW8A 4PXAA 3SBEA 2O8CB 1F5NA 3IILA 5L3SB 1ZM3A 2UZIR 1KDRA 5EQTA 1ZW6A 1OIXA 2FA9A 3VQTA 5CITA 2F43B 1G9XA 2YZ2A 4GRAA 1L8QA 1PVOA 2O8FB 1GL9B 4G5OA 2DB3A 2CE7A 4ZPXA 3AUXA 3B1WA 2GA8A 221PA 2RAPA 4Q9LA 5E4FA 3RS3A 5FOUA 3I73A 5E3HA 3WBJA 1XP8A 2ZVQX 4O2RA 1DE0A 4Q4HB 3RDPA 2OHFA 1XTJA 3EWAA 4D82A 2QAJA 1HY3A 2YOGA 3LQRA 1RE0A 3ZDQA 1MO5A 1FX0A 2QMUA 1HT1E 3KZ1E 2FFBA 4M1SA 2V7QA 1G8HA 1XEFA 4FD2A 3FTQA 4GBMA 2HLDA 2ZPTX 4B75A 5LDDC 3GP8A 2P6UA 4C0HA 1NG1A 5L8VA 4OK5A 3GLFE 1ZNYA 4FI3C 1BKDR 1YRAA 4RD1A 4WXPA 3EPKA 3T15A 3U3JA 1JJ7A 3MWJA 2FJUA 3EZFA 3I32A 4W7SA 2IYYA 4PPGA 2ONKA 2NO1A 3T1QA 4BZPA 5DI3A 5G41A 3PEWA 4B2IA 5AUQA 4MKIA 2GJKA 1JB1A 4MH0R 2QP3A 3ADKA 3GMTA 3ASZA 1DG1G 1E2PA 1G18A 3DOEA 2ZTSA 4URUR 1CXZA 2FFAA 4L9SA 3I8SA 4LHVA 1J90A 4A15A 2GETA 3VR6A 1DAIA 3WRYC 4NTZA 3PG5A 1MO6A 4BWYA 3VHLB 1CKEA 3LBHA 4RFSB 3QEOA 2A9KA 2PL3A 3Q5DA 4DLYA 5F9FA 1Z0JA 1NMZA 1Q1QA 2H16A 1E69A 3K53A 3B1XA 5HZKA 1FW6A 4KXFB 3F0TA 3FB4A 4H9GA 2WSSA 1SXJB 4Z1MA 3AVXA 4BRWA 3Q7PA 3KKOA 4QHTA 1G8PA 4RSGA 3QF4B 4B32A 4LGMA 1XCGB 1U0LA 2FFHA 4A6XA 2NMVA 1CR0A 1VDZA 3IEUA 5KSYA 1JXMA 1GZSA 1T5LA 2ZANA 4R9UC 1E1QD 1GG2A 2GILA 4CIDA 1E9FA 4LV6A 3PR1A 2CNWA 2BBWA 2FE4A 4A82A 4JSTA 2A5DA 2AK3A 3C8UA 4Q9KA 4DUGA 2VP0A 1RJ9A 5HTKA 1GNPA 4LWZA 2VSOA 5JLJA 3EPJA 2ZS7A 1IXRC 4TL7A 1KO1A 2C9YA 1QG4A 4V02A 4N3NA 1KI3A 3TH5A 3CPJB 3U3KA 2DWPA 3M1IA 5EP2A 4OI0A 1FTSA 1C4OA 2PLFA 4RFVA 5HKKD 5FI0B 4II7A 4G0NA 1UEJA 5CK4A 2HJVA 3J81k 1AK2A 1JAIA 1FQJA 4FXPA 4AKIA 1IJEA 3CRVA 2XGJA 2R62A 3CNOA 421PA 5JCPA 1FUKA 2B21A 2GZAA 3LXXA 5JSZA 4Q00A 1E4YA 1D2EA 2R8RA 3B2EA 1Z6TA 4B3XA 3OIVA 1OF1A 4GZMA 3FYHA 1E32A 3DM5A 3VAAA 3LD9A 1YZKA 4OL0A 4A2WA 1Q3TA 4A0GA 1Z0AA 3W90A 2DR3A 3FFBA 1UADA 1AN0A 3VHXA 4C0LA 3NEJA 3K0FB 4I4LA 4A92A 2J1LA 3G0HA 1D9XA 1UBEA 2HEIA 5BQ5A 2IUSA 3HWSA 4QGGA 2VPPA 4YMUA 1XMVA 1MRNA 2ZSDA 1GRQA 5KHOC 2ZRAA 4F7WA 4AK9A 3ND9A 3SC3A 4E5UA 4MQBA 1RPZA 4ZIRA 3EXAA 1QHIA 3PUVA 5JHGB 4BFWA 4PC1A 121PA 1OXSC 2FGKA 3HU3A 1Q1ZA 1Z28A 1Z2AA 4A1FA 5JBQA 4DEYA 3P4XA 1YRBA 1EXMA 3KB1A 3QPUA 4B71A 4FW9A 1GFIA 1TADA 3DM9B 2OUKA 5GADl 1CJTC 4MYHA 1OXUA 2CCKA 3IEVA 3MLEA 1T4GA 3GQBA 5KSPA 1YZUA 3LH5A 2BMJA 3K9GA 4HLUC 1PLLA 4B35A 4IKEA 1G8GA 2PZFA 4W5HA 4YXWA 1UKYA 3T61A 2OBNA 5FOXA 3UKDA 3U5ZB 2VEDA 1L4YA 1Z0IA 1Z08A 4QHSA 3GJ3A 3IIKA 2LKCA 2XJ9A 3SYKA 3THWA 3VKGA 4URXR 4EPWA 3SFZA 5UKDA 2QRNA 1XMJA 1ZD1A 3HR8A 2QRZA 3IUYA 4I1VA 2IYTA 4DLWA 1VHLA 4JL8A 2O5VA 5FR2A 1IY2A 1XD8A 4IDQA 1KO4A 2B7CA 4QGFA 1RFLA 1SGWA 1I4DD 1ZCBA 1OB5A 4NE2A 1X86B 4I1OA 2G3YA 4DT1B 2Q0HA 1V43A 1CR2A 2PX3A 2FPLA 3JVUA 4Q21A 4TSFA 4JLDA 4TMKA 1YZGA 5DHAA 2IS6A 2VP6A 1H65A 4M1OA 2P65A 4MRVA 4QRHA 3W34A 2J7KA 4L8GA 3NVAA 4PHTA 1WMSA 4PC3A 2P5TB 4IDNA 3NDPA 5EE9A 4QKQA 1IN6A 1FUUA 3IBYA 1GITA 3MJRA 1HV8A 3NHBA 2GEUA 4EPYA 4ZI3A 4MRSA 1IOZA 5B30A 1QZXA 4D26A 2JLRA 3GCGA 4F4IA 1VPLA 3W5IA 1MV5A 2CK3A 1TPZA 1AGRA 4DC9A 3CX6A 821PA 3U44A 1FX0B 2HV8A 2XOKD 4TT3D 3U3RA 2W83A 1AA9A 1GL7A 4G5QA 4OJKA 3C4JA 4DDVA 1A2BA 1G4AE 4LJ7A 5C4GB 2RGAA 2YWGA 1QBKC 2XNDA 4HAZA 1CULC 2VSXA 4OK6A 2ZVPX 2F1JA 1FP7A 4O2LA 1WDTA 4TYQA 1FZQA 4QXAA 5EP3A 1EFTA 2G83A 4LK2A 1N0WA 2GRJA 4UNNA 4D4LA 4Q5IA 3ZD7A 3NG1A 1RIFA 3B6EA 4CRWB 5DI3B 3A1VA 1KKMA 3CRMA 4HAWA 3LLMA 4MITA 4GI7A 2GXAA 2EFDB 2JLSA 3RC8A 3VR5A 2QMOA 2ZRFA 1Z6AA 4IHQA 3QVVA 1EGAA 3DKVA 3GJXC 1OKKA 1MR3F 2GJ8A 4I1SA 4EPTA 2BBOA 4JT4A 2G0TA 3SYNA 4V0LA 1MOZA 2WJJA 1ZD8A 3UWKA 1N6IA 4HEJA 4BLTA 2XZPA 3VMFA 1U81A 2Q6TA 1TX4B 3WBKA 2W2VA 2QTVB 4B73A 2R2AA 4C7OA 4HDCA 1GTVA 4UQOA 1CR4A 2Z43A 1AQYA 1AKYA 2GDJA 2ORVA 3CRW1 3RS4A 3EIQA 4DB4A 2OLKA 3B1YA 3HR7A 1KI7A 5BN4A 1E2DA 2ONJA 4OYHA 4US2R 1EG7A 1JQLB 3PENA 1XJCA 5JI2E 3WXMA 2BBTA 2Z5FA 3TVTA 2H92A 2I4IA 2XZOA 1ONBA 1RYFA 5TXGA 1N6OA 5BN5A 1JI0A 3LY5A 2AR7A 4DKXA 3MG9A 1JALA 5CIWA 3LAWA 3IIJA 5IDVA 2DFTA 3K0SA 2O0JA 4YDHB 3VR1A 2QPTA 3QBTA 5DE3A 1KO8A 5KTYA 1DAHA 2O0HA 4GL2A 2HLDD 2OXCA 1KO7A 3KKNA 1RJ9B 2B8WA 3BGWA 2ZI6A 5FH9A 1G1MA 4KU4A 4Q19A 3AVVA 4KLNA 2BHRA 1S9DA 2XB4A 3CZPA 4DLVA 2XAUA 3IBGA 4YLGA 5FBWB 3RRMA 1R8QA 2CDNA 4PTLA 1W36B 1L2TA 3SDZA 2R9VA 3REFA 4LHWA 2NZJA 5BW8A 2HDNB 1N5KA 5JSZB 1IONA 4TWZA 4O25A 3TGPA 2V8OA 1DVRA 4MGYR 1OFIA 2FU5C 2D2FA 1UBCA 5DNYB 5G3ZA 1N0VC 3IO3A 1W2HA 1NBME 1R5NA 3BB3A 4OQXA 1U0JA 1R2QA 3GJ4A 3SU8A 1P2TA 3KXKA 4DWJA 1US8B 3DO6A 2JASA 1XBTA 1DAFA 3H86A 2R44A 1E2EA 1T91A 3T12A 3CNLA 4OI4A 1DO2A 1U94A 3WMFA 2H7VA 4TYWA 5FBQB 4JVSB 2J46A 3NC1C 5J4YA 3HDTA 3PFIA 2WSSD 2XSZA 4Z1MD 2PH1A 2RGBA 1W0KA 3K70C 4ZIRB 2RHDA 3THXA 1AJEA 1PUJA 1EFRA 4DB2A 1W4AA 4AI6A 1M7HA 1KJWA 3LX8A 4R2IA 3TR5A 3I1FA 2BWJA 5KDLA 1DEKA 2WAYA 4L15A 3MRSA 1NSTA 2NO6A 3SOPA 2ORWA 2JJ1A 3L82B 2HYIC 2GEDA 1MKYA 1G291 2D2EA 2ZSBA 2OILA 2MSCB 1KZ7B 1VMAA 5EE3A 5KUTA 2B8TA 2CNWD 4TLCA 1IN7A 2JJ8A 4WA7A 3RSLA 4LJ9A 5KNBA 3X1WA 1CIPA 4DUGD 4AG5A 1SZPA 4BFTA 3H84A 2ZYWX 4MUBA 2NGRA 4ASUD 1IM2A 3AB3A 4D81A 1E1QA 1Z2CA 3TUIC 3ZGXA 2VQSA 3QNUA 1G17A 1KK0A 2RHMA 4M1YA 2C5LA 3THWB 3TQFA 5JRJA 3GLIA 4NU0A 2IS1A 3AP1A 4UJ3A 1FMLA 3QJYA 2CLDX 4RD6A 3TJZA 2DY1A 3QG1A 3V4RA 4JS0A 4KFRA 4EJSA 4PQFA 4EQ6A 4MGZR 3VR4A 5B2ZA 4H1UA 1SXJE 1XU4A 2JCSA 3FOZA 3EZ9A 3AVQA 1T9HA 1E9SA 5HKKA 1XZQA 3DOFA 4TZ6A 1TUIA 3CB4A 2J0SA 4PO9A 4DXAA 1XPOA 5CDFA 2ZI9A 2ZJ5A 3X1ZA 3GLGE 2G1KA 2X2EA 3JZAA 1GNRA 5B58C 2VA8A 2WOOA 4E09A 3OEED 3FMPB 1HE8B 2YJTD 3H1TA 1TQ6A 3WNBA 4CT4B 5FPYA 5J5CA 1CBUA 4XH9B 2B92A 3MD0A 3VX4A 3B78A 4JKIA 2QGZA 3ICEA 2EQBA 2FSHA 2ZEJA 3EC2A 3K0CC 3QPVA 3T1VA 1SHKA 5FI1B 1G19A 3M6AA 2OAP1 5P21A 4RD4A 5IK2D 4ZI2A 5IHPA 4EPXA 4IOKA 5JCZA 2E9SA 2YC2C 4OHVA 3U44B 2ZRKA 5SZJA 5FTNA 3B8HA 3T35A 3WMGA 3C41J 4BUJA 4RJLA 1QHGA 1Z6XA 2X19A 1KI6A 2IXFA 4LJ4A 4QBFA 4TYPA 2J59A 1E4VA 2GZHA 2IYWA 1LNZA 1LTQA 2XJ4A 3BXZA 4JLJA 4MKHA 1NMYA 2OESA 5AR1A 3PIRA 4PZLA 5LB4A 5JJLA 3TBKA 1OH7A 1H8HA 3C15C 1TEVA 4ZKEA 5D3QA 1NNEA 1II8A 2OCBA 4NP6A 4YXWD 1KAOA 3TMKA 4NCNA 2EW1A 2G1JA 2VYFA 3FHOA 5GVRA 4D4MA 3ADBA 3AKCA 4ZCIA 2ZE8A 4Q4JA 3NH6A 5LD2B 3AUYA 3SYLA 5JJIA 1E2QA 1E9BA 3CPHA 4X8MA 1DAKA 3CKLA 4B6EA 2PJRA 2VF7A 4DLXA 1UEIA 4JBYA 4M21A 4HZIA 3L8ZA 4IVRA 1Z83A 5E7MA 1E98A 4HB0A 4C9BA 3EASA 4A2QA 3U61B 1ZM9A 4TSFD 2ZAOA 4B76A 3UWOA 4C7OB 2JAQA 2IUTA 1ZRHA 2F1HA 4D0NA 2ZRIA 1BH2A 3IHWA 4HLUA 1FQKA 1B23P 1G21E 3NH9A 1D2MA 2AFIE 3KUDA 3OEHA 1P62B 4P4SA 4TZ0A 5GJWC 4DCVA 3Q7QA 5L3QA 4LHXA 4QBGB 1K6MA 3DMDA 3L0OA 4V0ME 1U2RA 4FINA 1YE8A 1U98A 4Z54A 1E0JA 3ZH9B 2O8DA 1M7GA 4ZDIA 4CT5A 2B6HA 1GILA 1ZJ6A 1ZM7A 3A1TA 4KODA 3W8RA 2GJSA 2PLRA 1JEDA 1KNQA 1E9CA 2CBZA 3UMRA 2XXAA 1OV4A 1W46A 2FPMA 4M1MA 5AJXA 3AVTA 2KI5A 2WBLC 5EE1A 3ZQJA 4NHOA 3U60B 1S9HA 2XNDD 1YU9A 2ZJBA 4TL9A 5DN6A 2P6NA 4ZKDA 4GFDA 1W4CA 1XTIA 4HYYA 4BQSA 4L4UA 1AM4D 4XVQA 1Z07A 3IO5A 4U7DA 1VCMA 2BM1A 1A82A 1SVIA 4KCGA 1NSFA 3CWZA 2KBFA 3DMNA 1TMKA 2ZJ8A 1J7KA 3ND8A 4CZ2A 5FL7D 1OKKD 4CW7A 4RD0A 4A0FA 4G1UC 1ZNWA 3AF3A 2BMFA 4WOPA 2JLUA 3ADDA 5FBVB 2GCNA 2ZE5A 3TSOA 3DZ8A 4GOXA 3LDAA 5FR1A 3ZVRA 5CB8A 4B47A 1MT0A 2QZ4A 4MRPA 1KNXA 1BMFA 2LKDA 4PC7A 2IA5A 2OEPA 1UFQA 2ZI5A 3E2IA 3OF5A 3THXB 1EFCA 2OE2A 1VYUA 4XTRA 1DARA 3GLHE 1KSJA 2VBCA 2IX3A 3FMIA 4MYUA 3O8CA 2ZXUA 4UNQA 2HUPA 2QMHA 4BECA 4QGAA 1WA5A 5FPHA 1D8TA 4DRZA 1XCPA 3CBQA 3WMEA 5JHHB 4AY2A 4OQFA 1YR6A 5D3MA 2F3TA 3KJEA 4Q7LA 5E7JA 4M53A 4OHXA 3MMPA 1ANKA 3QIAA 3GD7A 2BJWA 5DO9A 3EX7C 1Q12A 4RZUA 2IS4A 2N1BA 2QMEA 3BRWD 5BYKA 3REGA 4BEBA 3BS4A 2GBLC 2VIIA 1JECA 2ZREA 4JMPA 2GVZC 1E9DA 5LBIA 4Q1FA 1FMJA 1X6VA 4LPKA 4LYHA 3ZZ0A 3TRFA 3GLIB 2Z83A 3EIEA 5M04A 4AD8A 3H4MA 5JJKA 1AQUA 3GJ8A 1BIFA 4JL5A 1NN1A 2NPFA 1JR6A 3ONWA 3T1TA 2IS2A 2CJWA 4D0LB 2ECKA 4Z8YA 5CM8B 2WVJA 4EQ6B 3SNHA 2C8VA 2J0UA 4HI0E 2AKAB 3QKSA 5J4VA 2N42A 1KIMA 1GUAA 5DSZA 5AUPB 3BH6A 4V0NA 3G82C 2HT1A 3B9PA 3E70C 2IYUA 2W6IA 3CLVA 5AWFC 2QEQA 2VP4A 1N2CE 1U8ZA 4OQMA 1II0A 2QU8A 4LBZA 2IT1A 4C3ZA 4LC0A 1LF5A 2PZEA 3PUXA 3LFUA 4ARZA 2FOLA 4LHYA 1TU3A 2XSZD 2RGEA 4JKYA 5GJVC 1W0KD 3SHWA 3CO5A 1EFRD 4D80A 2GJAA 4ESHA 3HYTA 3LVQE 2ZRGA 3K9HA 1WXQA 2ZRNA 2R6FA 4R2HA 2XZLA 2P3SA 1X3SA 3KQKA 1KI6B 1AS3A 1CJKC 4A0HA 2JJ1D 5HPYB 5KSZA 1N5JA 2JLXA 1W4RA 4QFMA 2GAOA 1CR1A 4PQYA 4PFSA 1MH1A 4EJSC 2VF8A 2TMKA 2XTMA 2Z4SA 2CCJA 2F7SA 2ZSEA 1IN4A 1II8B 1HA3A 2BBSA 3AP3A 4PSVA 1LV7A 3NIBA 1TTTA 2C04A 3FPAA 4M2LA 4W5JA 3LX5A 1KY3A 2CVHA 3K9NA 2X1VA 2NO0A 4Q4JB 3Q85A 3FHTA 3ZS9A 4X8OA 1ZUIA 1Q20A 1B0UA 3GLFA 2ZSAA 4JBXA 1T0JB 5FOVA 2AN9A 4DLTA 1WB9A 3RABA 2WMOB 2CEAA 3DDCA 4FCWA 2Z4RA 1CP2A 1J2JA 1EWRA 1KK1A 3QQ5A 5C46F 5ELXA 4UNPA 4JJZA 1PLJA 1R0XA 4JSYA 4MGKR 3VU9A 4ASUA 4B43A 2FG5A 2IL1A 3L0SA 1XFAA 3UANA 5EZ6B 2XX3A 4CEHA 4XSGA 4CGZA 3TKLA 1MABA 5AK0A 2G9NA 4IOJA 1E2JA 1Y63A 1R10A 1XXHE 1TNDA 5CLLA 2YWEA 4P4SB 2ASEA 3AF0A 4HUQA 1NKTA 4F93B 1P6XA 4PO8A 5L3QB 2JDIA 2WZQA 3GFTA 3KJHA 2IW3A 2AXPA 2QROA 3SJAA 1J70A 4M9SA 1G7RA 5HCIA 3CM0A 3IQWA 4GNKA 4LCBA 4AKGA 2O8DB 1CJVC 4URZR 1GNQA 2AD5A 3BORA 4IDHA 4FMDF 4GZLA 2QPAA 3OEEA 4ACBA 5JS7A 3P32A 3W6PA 4FWTA 3BB1A 4RKEA 4US0R 3I4LA 3SI7A 2XXAB 3GJ6A 2JEOA 4LZZA 3PITA 3FMOB 2IUUA 2VHQA 2KWIA 5FOWA 2GKSA 1CF4A 2QP9X 1ELOA 2VSFA 1I4TD 2XB2A 4TTPA 4S35A 4DSUA 2E87A 4HATA 3EWSA 5IK2A 4NCHA 1DAEA 1H8HD 5SZIA 4RVCA 2ODNA 4M9QA 2LWIA 4JLPA 4QBIA 3A8TA 4I1UA 3P26A 1KI9A 3RS7A 1XEWY 3VR3A 1KZGB 1G16A 1G6HA 2QI9C 1GRNA 1KDPA 4TLBA 2YNMA 1KAGA 1M34E 2WIBA 4Q4AA 1X1SA 3K0CA 4A2PA 1KOFA 1N6KA 3QBVA 2V3CC 4PSAA 3MUFA 2P2LA 1E2KA 4P32A 5EE0A 1G5TA 2ZR0A 4XIGS 1JBKA 4F91B 4HAXA 3PVSA 6Q21A 5TMPA 3W9YA 4PAQA 4DCSA 5B64A 2GK7A 5FPSA 3H0KA 1GAJA 2BM0A 4PQRA 5JWRA 2DFKB 4PO1A 4ZCMA 3QOFA 1LY1A 1XB2A 2PEZA 4IOLA 1IAQA 4Q9IA 3A1WA 2CHQA 1KMHA 3OEHD 4H1VA 1KMQA 3RRZA 3NTUA 4FMCF 1JR3D 3IQXA 2ATVA 3QKRA 5EP1A 5EXPA 1VECA 4ZV4A 1U0HC 1EX6A 2QM7A 3GJ7A 3SJBA 3VX3A 5FUYA 4Q9JA 4HAUA 5LB2A 3EPLA 1N5LA 3BB4A 1BO6A 3P27A 2WHXA 4JVMA 4KSCA 1SULA 2WV9A 5G3YA 1CU1A 1L4UA 3CH5A 1SKYB 5D3MB 5DHFA 3ZS8A 1T3LA 5AJVB 5JFGA 1N5IA 1Z0KA 3RSOA 1MO4A 4FCVA 4Y0AA 4ABYA 1AGPA 3A36A 4O0MA 3RS5A 1G20E 3QG5A 1PUIA 1WCV1 2QP4A 2XNSA 4L9WA 3L8YA 4RKFA 4C0AC 5DN6D 1R7RA 1W48A 2CLCX 3CWQA 5K8LA 4WIAA 4E22A 1XDBA 1SVOA 3KTAA 2DFLA 3ZIAA 2R6DA 2GF0A 4MRNA 4A8JC 4PR0A 3U7EB 3LW7A 1OSNA 3CF0A 1YR7A 2W00A 1YVDA 2V6JA 2FEOA 2J0UB 4IJMA 1D5CA 1T8TA 2C96A 4HB4A 5HZHA 3QKSB 4PX9A 1LB1B 3NKVA 3NC0C 4ON9A 1NJFA 3QUSA 1OH6A 2DCUA 2KSQA 3FMFA 4JLNA 5TB5A 1ZU5A 2BCGY 5EUMA 1COWD 5DYIA 3Q5EA 1GIAA 1R6BX 2ZS8A 5ANRB 5DYGA 2YHSA 3OZXA 3BK7A 2IC5A 4TTRA 2WICA 1Y3AA 2MSEB 4MYCA 1FFHA 2RH5A 3AQ4A 1T5IA 2A2ZA 1NY5A 4F4CA 1IN5A 2AWOA 2BDTA 4TMZA 2ZETA 3MAAC 1UJ2A 4W5WA 5EZ5A 5FL7A 5TV2A 4ARZB 1KSFX 2I1VB 1BMFD 1Q57A 1XEXA 4M1WA 2GJ9A 4PPQA 1XPUA 4U02A 3EG5A 4PHFA 1WE2A 4C30A 1RVDA 4XVRA 3UIEA 1LW7A 1DS6A 2AWNA 4B3BA 5DGXA 3CF2A 1UKVY 3CRRA 1W2GA 4EFLA 3P1JA 3EC1A 4GMXA 4OI1A 3B9QA 2F3RA 2HCBA 4HLDA 3W5JA 1Z0FA 1KJZA 2Q3FA 1QDEA 1ZYUA 2XEXA 3K8YA 3LRPA 4HDOB 4MUAA 5FUWA 2IWRA 4HAYA 2RGDA 3H2YA 3K1JA 1GP2A 2GVDC 2ZM5A 1FTNA 1T3HA 1WBBA 2ZE7A 4NL4H 1YHNA 2DFNA 2OAQ1 2QPOA 4PANA 3TLXA 4GDFA 3LLUA 2W58A 2JJ2D 2ZRDA 2ZI3A 1HUQA 2CE2X 3VFDA 4JZKA 4C0SA 1X1RA 3MCAA 5JRZA 1BYIA 1VYTA 2CL7X 2ZYTX 2JIZD 2R65A 3CX8A 1O87A 2WJVA 3EIHA 3IGFA 4PC2A 4TLEA 3GLFB 2FF7A 2PEYA 2QBYA 1SHZA 3I92A 2ZUDA 4XJXA 2GZDA 3CONA 4RCZA 4PSKA 3TK1A 4HB2A 3K70B 1XTQA 5SZHB 4JBWA 5K8UA 3QXXA 4JIMA 1KTVA 5FOTA 4TLDA 3VU9B 4HUTA 3AVUA 4URVR 1E2HA 1EX7A 1KK3A 3DPUA 4PPFA 4IOMA 5C1BA 2QE7A 4UJ5A 2BC9A 4A6PA 3DKPA 4LJAA 1CTQA 4JL6A 2ZJYA 4ZDKA 4HLCA 4CEHB 2EFEB 4PZYA 1D2NA 1MABB 4V03A 3ZVMA 3QF7A 2W6ID 4WZAE 4D2IA 1G6OA 2ODEA 3LNCA 4JYCA 3AV0B 3M0EA 5AJYA 1GM5A 2WJHA 1DPFA 4NYJQ 2Q9CA 3ZZUA 4HUQB 2WTUA 3EA0A 4A4DA 3BC1A 4QG7A 1S96A 4BLQA 2GBLA 2ZRBA 2PCJA 1ZIPA 2WKRA 1ZINA 5G53C 2AHOA 2A5GA 2JA1A 1M2OB 2XTNA 5EXXA 2IBMA 1TQ2A 1GDDA 1AIPA 3Q3JB 2WWGA 2E1RA 5FTKA 4AG6A 2ZRMA 2ZS9A 5HCNA 1SQ5A 1XEWX 4B48A 5AUNB 1R4AA 3PUWA 4KFUA 2IYVA 2RGNC 3ETLA 2Q9BA 3W6OA 1XF9A 4GP6A 4PAOA 1K5GA 4RD3A 1W5TA 4DSTA 1P7CA 4DBLC 1LF0A 4EUNA 4DSNA 3O8RA 2V9PA 2VHJA 3L0IB 4BFXA 2CCGA 4V0KA 3U7GA 2VP5A 3WNCA 1KSHA 5LPNA 3UG6A 1AKEA 3IHLA 2UZ3A 2NZ8A 4AIIA 3QXJA 1NIJA 2FWRA 4Q4AB 3O8DA 5CDFE 4O3MA 1H8EA 3SEAA 1Z63A 5A0FA 2OV2A 5TY0A 2H57A 3OE7A 3K70D 1K8RA 1VHTA 3O47A 1J8YF 2HYDA 4MKGA 1SVSA 4Q4LA 4NONA 2P6RA 3RRYA 5FPTA 4LI0A 1TF2A 4PPNA 2VRWA 1OHHD 4NMMA 1Q44A 2J87A 2IWHA 4ZCLA 3ZD6A 4DJTA 3TUZC 2MMCA 1EFHA 2A5FA 1NJGA 3ICQB 3B5JA 5KYKA 1DADA 1KDTA 1NF3A 3B82A 2BMEA 2VL7A 1NBMA 1KMHB 2P67A 1OIWA 1P4SA 3E1SA 3KQNA 5CJPA 3PV0A 5L3RA 1UAAA 4QBHA 2JDID 1TQ4A 4QNRA 3QKRB 1I2MA 2BKUA 1FL9A 2YV5A 3QEJA 3EZ6A 1W0JA 4AKEA 3V00A 4TYYA 1G7TA 4FMBB 2CL6X 5DH9A 3X2SA 2EYUA 3LBNA 3WHLA 1DG3A 1E9AA 3AKYA 1E6CA 1VCNA 3I8XA 3SE0A 1S4QA 2QT0A 4TQAA 1E0KA 4QC2A 3FHCB 5FTMA 1ZIOA 4JLAA 1HH4A 1IY1A 4QOSA 3TW8B 2D74A 3KFXA 4YONB 2D4HA 4WXRA 2IYLD 2GEVA 1CRPA 2PZGA 3P20A 2NG1A 3PJRA 1S1CA 5GJBA 2BVNA 2X2FA 2PX0A 3DHWC 4HSEA 1P2VA 2ANBA 3D3QA 3T1OA 4PHGA 3IPYA 3F8TA 2JATA 4P4TA 3GEHA 1J99A 2V6IA 1U90A 4M8NE 3R9WA 1G5PA 4YMVA 2PCLA 2WIAA 1P2SA 1VG0B 2FFQA 2OFOA 4B2LA 2NIPA 1VTKA 2V4ZA 2ZI7A 3LO5A 4QHYA 5L3VA 2H17A 1XX6A 4OKSA 1A5TA 4IDPA 1XCMA 4GOJA 4KO8A 3BBPA 4BLOA 721PA 2CMKA 4GPTA 2YC4C 3TE6A 4TTQA 1P9WA 4R98A 5B57C 3OAAD 2FSGA 2GWHA 3U7HB 2ZRPA 1RZ3A 3N2EA 4JVLA 4X8LA 2GXUA 3RLFA 1NN5A 4M22A 4ZDWA 2H18A 2BEKA 2IXEA 1T0HB 4NCJA 3GLGA 1JPNA 2YOFA 5J40A 4JLVA 1RRGA 2REOA 3DZDA 3RANA 2Q3HA 3OIWA 3GEEA 4Q1DA 2OZEA 1M6NA 1I2DA 3K9LA 1YJ5A 3QXSA 4EPRA 3PEYA 2ZRCA 3BFXA 5K8IA 2ZYUX 4BFZA 4XTCS 1N6HA 5EJEA 1NVWQ 2IEYA 1JR3A 4QJ5A 5HR5A 1ZUNB 2JLVA 5FUVA 5CIQA 1QF9A 1L7VC 1JQJC 1TL7C 4JLMA 3GFOA 5E95A 3W3ZB 1T8UA 1ZCAA 2F6RA 5KDDA 5KNDA 2C95A 4OHWA 3IIMA 1VG9B 4D25A 1OXVA 3QKUA 2QQ0A 1PZNA 2WPDD 4OJQA 2QBYB 3K09C 4KYIB 1G4UR 3ZIAD 4LDJA 1WBDA 3UG7A 3D31A 3KB2A 1KI2A 4RZ2A 2H5EA 2NTYC 3KJGA 2J45A 3QVUA 4WVFA 1NP6A 3D6TB 1OFTA 2PJZA 4JLBA 2ZU6A 3UPUA 2W0SA 2BKEA 1SVWA 2YOHA 3CR8A 4A9AA 4L16A 5BWMA 3U2QA 2V54A 2GXQA 4JJKA 2GESA 4CF7A 1HYQA 3CW2A 1RYHA 4P4UA 2EFHB 1FOEB 4KVGA 5F2EA 4B3FX 4PAMA 3PCRB 2QSYA 5EE5B 4DDTA 4RY2A 2ZIAA 2HCJB 1XJ0A 4J0QA 1NVVQ 1KI4A 1COWA 3SFVA 1Z22A 2OXRA 1K5DA 1CRQA 2DBYA 2IK8A 3I61A 1NG9A 521PA 1ZC4A 4AYWA 2WKPA 1U9IA 2FN4A 4GT1A 1AS0A 4A8JA 2ZJAA 4BRUA 3GJ0A 2OCYC 4BLSA 3Q9LA 2ORIA 5F9HA 4DLUA 2K5UA 3NHAA 4HZUA 3K0AA 3U6KA 1N6PA 4V0MA 4F4JA 3RVBA 4LX0A 2KE5A 1OJLA 3P4YA 1CEEA 1U8YA 3IPXA 2RGGA 2VO1A 3R9XA 4RCYA 1N25A 4URWR 2VHTA 2HJGA 2A3RA 1BS1A 1GKIA 1ZP6A 3WHKA 1RKBA 1UF9A 3HPRA 2C98A 3GJ5A 1OXXK 4WW0A 1M8PA 2ZR9A 4HLQB 5SZKB 3R9IA 5JEEA 3ZJYA 4JLOA 2QG6A 5FTLA 3HPQA 3FE2A 1PJRA 2NPIA 2JJ2A 3I62A 4N1AA 2FZ4A 3RC3A 2H1LA 2QAGC 4CEJA 5JI3E 4YQFA 1F48A 4KITB 2WWXA 4OK3A 4B3GA 3R7WA 3A4NA 1OH5A 2NQ2C 2JIZA 1IY0A 2QE7D 3VKHA 3RHFA 2IEZA 1OYYA 2D3WA 5G40A 1Z06A 2IF2A 3SS8A 3AH8A 4M4SA 3VR2A 4DLSA 4NYMQ 3C7KA 1RRCA 1EFUA 2P5SA 2WJYA 4EJSB 3NBZC 2ZR7A 2ZSFA 1OLOA 1NN3A 2ZAMA 2GCPA 4B33A 2ZYVX 3Q72A 1N3BA 3EZ2A 3A58B 2VP2A 3D7MA 3WY9A 4Z51A 1DAGA 2VP9A 3FKQA 1YQTA 4US1R 2GNOA 3THYA 4C4PA 2IXGA 3DEFA 4M0LA 1GL6A 2FH5B 1A7JA 3FFAA 1JPJA 2YVUA 2DWQA 4KI0A 3WNDA 4U00A 2QM8A 1S3GA 2JLWA 3AKEA 1KSGA 4MDEA 4R71A 1FNMA 2FPKA 4BLPA 4LUCA 2OT3B 4EFMA 3GLHA 2EFGA 3CIOA 1OE0A 5HE9A 1X8LA 2J41A 4XOIA 5BYJA 1OH8A 1F2UA 3L43A 5AJZA 3BD9A 1P5ZB 1NRJB 2RKOA 1S3SA 4FCTA 1J8MF 5H1YA 5JEDA 4TL6A 621PA 4EKDA 2CXXA 5J47A 3SBDA 1QRAA 3RRNA 1GWNA 4UXJA 1QHYA 3CF6R 2NO7A 3QXCA 4LJYA 4UNSA 3X1YA 3VNUA 1ZM4A 2W0MA 1W5SA 2R6AA 3TSZA 3KKQA 5FPKA 2O8BA 4G5SA 3KL4A 2ODWA 1H8ED 3X1DA 4FN5A 3I5YA 1XTRA 2BMDA 3OE7D 1Z5ZA 2FX3A 2G0NA 4DCNA 4KJZA 2YWHA 3WP0A 4YMTA 2OCAA 2PBRA 3O8BA 3LV8A 3KQLA 4OHYA 1XNJA 2FGJA 3S1AA 5IRCD 3PEVA 4A36A 2O8EA 3B13B 2QORA 1E94E 3BAFA 2LCFA 4PZZA 1HE1C 1G7SA 2RGNA 1XZPA 1IN8A 1OYWA 1R8SA 2J9RA 2Q21A 1Z29A 3NBFA 4LJ6A 4ZO4A 5H68A 1BYUA 3BWDD 2QGNA 4OQLA 1NBMD 2Q9AA 1LS1A 2J5XA 3MJHA 1P61B 4DZZA 2YKGA 1WF3A 3B1ZA 4WZBE 4IFEA 1AZSC 3A4LA 5JECA 1HQYE 3GLGB 2FMXA 2W2TA 4LJ8A 4IW3B 1OHHA 3L0PA 3QSYA 4G5RA 2SHKA 1ESMA 4UXHA 3I3SR 1W0JD 3IDQA 1KI1A 2ZU0C 2KJQA 1ESNA 1P3JA 3RS2A 2VH5R 1P60A 1G64A 1KKLA 3V9PA 1NN0A 1OFUX 1BOFA 3KFVA 2W6JD 3UK6A 1OIVA 3V4FA 2AX4A 2AKYA 4IXNA 4G3XA 4BE7B 1A2KC 4LBWA 4BEJA 5H8WA 3U4QA 4BLRA 2F1IA 2X77A 4IEIA 2D7DA 1SVKA 2I3BA 4FMDB 1XPRA 2RGCA 2RMKA 5C2JB 1KK2A 4DHEA 3T5DA 3AVWA 2FSFA 4AC9A 5DLQC 3AKDA 4XWAA 4Q48A 5HE8A 1F60A 3FKSA 1SXJC 2BOVA 5TVKA 2FNAA 5E7IA 2A7QA 1JAHA 2XTZA 3OIYA 1HQCA 2ODBA 3RS0A 2BJVA 2OFXA 3QXHA 4DVGA 1N0UA 3KUCA 4X8HA 1VKJA 4LSGA 4B3CA 1NLZA 3QENA 2GHIA 3MWKA 8OHMA 1S0UA 2HF8A 1EESA 1US8A 4LBVA 2ZUBA 3W6NA 1E1RD 4KBFA 4LOAA 4P0TA 3QKTA 2V1XA 2WOJA 1QHHA 3NBXX 4K81B 4EIWA 4XVUA 5TDHA 4F38A 2AK2A 2C78A 2HXYA 2V55B 1A4RA 2ZJ2A 4PC6A 3AEZA 1SXJD 3T34A 1VCIA 4FWIB 4K8OA 1ZMXA 1EK0A 2IYRA 4D4JA 4AWXA 4QJ3A 2X8AA 4Y0VA 1GVNB 2PMKA 5KDOA 1TF7A 5BXQC 1NLFA 3MWYW 1T6NA 2Z6VA 1QHXA 2D62A 4Q7JB 1E2IA 3FWYA 3WYFA 1GOTA 3NBYC 1KGDA 4Q18A 3FGNA 4A8JB 1XXHA 3PEUA 3BERA 4Q7MB 4KSBA 2GAAA 4D0GA 3OAAA 1UDWA 4HZUB 3K0AB 5JWOA 1CLUA 3AVYA 2QL6A 2D7CA 3CX7A 3FVQA 4XD7D 1D9ZA 1I4LD 2C9OA 4U5XA 4CVNA 4FMCB 4V0OA 1VG8A 4NH0A 1E2MA 5DISB 1VYVA 3A6PC 3B1VA 4LYJA 1E2LA 1XTSA 1IHUA 3OFNA 4QJ4A 4D6PA 2W2XA 3NWJA 1FP6A 4IVQA 4B74A 1NL3A 2G77B 2QTFA 2WJIA 5KPDA 2C2HA 4DLRA 5C18A 1SKQA 2CHGA 2WKQA 5H70A 2AL7A 1UBFA 3ASYA 3VTKA 3AVOA 3Q8XB 2JGNA 2F9MA 5FOSA 3VNVA 1XD2A 2EWVA 2RGXA 1T3SA 1QHSA 2PMDA 4DCUA 1O3YA 1E96A 3IKJA 2EVWX 4KAXA 1W49A 2FV8A 1TUEA 2Z0MA 3C14C 4CEJB 1Q0UA 3LVRE 4R7ZA 3TR0A 1DTSA 2C03A 4CYMA 3E5HA 4IXMA 3R7WB 5J4HA 4TL8A 1GSIA 1E79A 1XMSA 1E2FA 2EWWA 2WPDA 4ZDJA 3BH7A 3KDSE 3AF2A 3MGCA 1G3IA 4AKHA 1U9IC 1W1WA 2AFHE 3N5CA 2BV3A 4OBEA 5KPJA 2QA5A 1DOAA 3THOA 2CJWB 3SN6A 4LY6A 4MDFA 2ZJZA 3CH4B 1VCOA 3A1UA 2JLQA 3UMSA 1C1YA 1W44A 1RW4A 3THYB 4TMTA 4HAVA 1N6NA 5DIFA 1ETUA 4YC7A 1R0ZA 2C99A 3OESA 4TQ9A 4GOKA 3K09A 4EFNA 4A0RA 1MO3A 4N0DA 1NY6A 1R0WA 1R5OA 1S2MA 3B7GA 4G01B 2OBMA 2WWFA 1P73A 1R5BA 3B85A 5FTJA 1G5RA 3GLHB 3ZLJA 4HB3A 2GCOA 1PV4A 3TW4A 1F2UB 1CS4C 3KKMA 4Q7KA 2I1QA 4RD2A 5J4KA 2IF0A 3X1XA 1NI3A 2B7BA 2RB4A 3OHMA 1F2TA 2IYXA 3ADCA 4TMXA 1Q22A 4NYIR 2J7PA 4DSOA 2J0QA 5JS8A 1HTWA 1TEXA 4C2UA 4W9MC 3BFVA 1DBSA 1DELA 2O8BB 2ZRJA 1M74A 1N6RA 1ZBDA 1P9RA 1YZLA 4YDSA 1AZTA 1M1YE 3K0EA 2NOAA 2R6CA 3AF4A 4C2TA 4Q9HA 5DI9A 1EWQA 3EW9A 2IHBA 3S1AB 3TAHA 2O8EB 1Q1BA 1ZAKA 2QUZA 5KO2A 2ERXA 1A1VA 3U7FB 4NYJR 1E9EA 1Q3HA 2J3EA 1NVXQ 2HXSA 4HDQB 4LPSA 1DO0A 3RWMB 2OO7A 3CNNA 3BFKA 1Z6YA 4NYIQ 4P33A 4M1TA 4YMSA 3TIFA 2NO9A 4OHZA 4WAUA 3L2OB 4I99A 3GFPA 4JVNA 2WAXA 1UKZA 1Z47A 4POAA 3AVPA 3TAUA 1QG2A 1VIAA 3QY0A 4BFYA 1QVAA 4P31A 2V1UA 1NIPA 3NEYA 5C4MA 4M1KA 1E99A 3C5CA 2V7QD 1G3QA 1RRFA 2IYQA 2VHCA 3CUEF 3NDBB 1FPMA 4LC1A 1LS6A 1ZM2A 2ZROA 3DVLA 4MKFA 4FIDA 4E07A 3SJCA 4EDHA 5AUOB 1P9NA 2QAGA 2QENA 4TQUS 3BIFA 1ZD9A 2WWIA 4QL3A 2FEMA 3KKPA 5IT5A 1YR9A 2KBEA 1U99A 1UM8A 4NKRA 3U4QB 1OXTA 3W3AA 2MMGA 3CRQA 4IRUB 4CEIA 4Q66C 2C9CA 2CLSA 3RAPR 3KQUA 3BE4A 1C9KA 4LYFA 1RC8A 3GEIA 2MSDB 2REXB 3I72A 2OBLA 1XMIA 4AYTA 1DAMA 4Q1CA 4BASA 5JMTA 1G8YA 2O0KA 1X8JA 4TMWA 4IVPA 3AP2A 4KVAA 1UDXA 1E0SA 1YZQA 3ZVLA 4IDOA 3GLIE 3F5FA 4CDGA 2OG2A 4C0BA 4DEXA 1IBRA 4Q47A 4MRRA 1OT3A 2QNRA 1WRBA 3UXMA 1WP9A 2ZE6A 4NPHA 3OIUA 1G3MA 2IHYA 1AS2A 1YZNA 4B6FA 3AM1A 1QVRA 3HU1A 4XSHA 4MA4A 1KI8A 3PUYA 1ZVQA 3RNLA 2OFWA 2ZITA 4DDWA 3EPHA 4KV9A 1KO5A 3W8NA 4C0QC 3CR7A 1QHHB 2FDCA 4RZXA 4TYNA 4LBYA 2QSZA 5JWHA 2QY9A 4NCKA 1F6BA 3M4YA 4JLKA 2WJGA 2CVFA 2OSBA 3HYRA 4LYAA 1ZC3A 5EXSA 1KYIA 4Q1BA 2ZRLA 4BFUA 2FSIA 4DDUA 4B3DA 3TUJC 4LRWA 1NLYA 4QNMA 1W36C 4QM6A 4QGHA 1XXHB 2O8CA 3LXRA 5L3SA 1MRSA 1Q1EA 1YR8A 1M7BA 3JVVA 4GSYA 4I81A 4TLAA 2F43A 3QPWA 4S2EA 2D06A 5CM9C 4C0JA 5KU1A 1P2UA 2A78A 5F3WB 2O8FA 2QQEA 3KJIA 4KFSA 1PLKA 1IQPA 1XWIA 3T06B 4EAQA 3QE0A 2WMNB 3EARA 3U3OA 4Q4HA 1OPXA 1SVMA 2ZI4A 4DLZA 1XTKA 1W36D 4N0EA 2ZQ5A 1UKEA 3I5XA 2HF9A 4B44A 4NBSA 4ITRC 5GVSA 1GKUB 2ZRHA 4LJ5A 3DL0A 2W6JA 5K8TA 4JT2A 5A4JA 4LV8B 1XD2B 5FBLB 2UKDA 1UBGA 2QT1A 1FNNA 3FKSD 1G41A 2ANCA 2EU8A 4D4KA 4DIDA 3R8CA 5FL3A 4Q02A 1YZTA 4OI2A 4BZXA 4NCIA
chains in the Genus database with same CATH superfamily
5JZMA 1IG3A 3QI7A 4MULA 5F5XA 5TS2A 2B20A 5CYPA 1PNTA 2Q41A 1J9EA 2Y8EA 4RIIA 2JFUA 3EBLA 3DNFA 5KNCA 4M86A 3GF4A 2VNHA 2W6ZA 2IYZA 2Y1LA 4ZEOA 1TM4E 2OR3A 5A5FA 2Z9BA 4ZC8A 1JEQB 3V97A 3OCXA 3ONNA 1LBSA 1ZVKA 1SD5A 4U7JA 2XUPA 2BE9A 3EAFA 1PGJA 1U0RA 2XE6A 1XHLA 3NBAA 5C1OA 3N7AA 3UTCA 5ES4B 4KI7A 5IYZB 1N9GB 2GARA 3OFVA 1M2NA 4F1JA 1DDOA 1D6NA 3CLUC 3A9TA 4XIJA 4WOKA 4RFSA 1E1RA 5AOAA 4BIMA 1R3UA 1FZTA 1BJTA 1W7AA 1VP3A 1ML4A 3N6XA 3ICPA 2WD8A 1IXSB 2K2WA 1MIOA 3WK7A 3VJLA 5CURA 4MQ6A 1W29A 3HNPA 1EUZA 3B3JA 4IDDA 4OBXA 4AYXA 4C0KA 2OCPA 3K5IA 5JFTA 2XLBA 5K7SA 3MWLA 3N2LA 1JSCA 4Q3NA 1E0AA 3Q15C 4P93A 3R4CA 2GCOB 4L8WB 1QS0B 1J1ZA 1EVQA 1YBMA 2CXQA 2GOYA 2H0QA 1OFUA 4G5GA 4UKDA 5E9QA 2Q3MA 3S40A 1W4BA 1ZUHA 2VHUA 2VNKA 3QFHA 4BKOA 3CLUD 4B85A 1V6SA 1C1HA 2PXAA 2ALJA 3JX9A 4UXIA 3OFND 2HA3A 3KEMA 5KMGB 2X6RA 1CB7A 4QEKA 2FZLA 1G0OA 2DHQA 4KZKA 3RRJA 2QUBA 4C7JA 1GT91 1EKXA 1KETA 3A9VA 1A8UA 2JBAA 1EDEA 1YNOA 1NBOA 3PJFA 4XD7A 3PK0A 3TZHA 4G6ZA 3UCEA 2Z8ZA 3CT6A 4BNDB 4M8SA 3SQXA 3D8HA 3TXAA 3GEBA 2EIXA 4EL5A 2F9LA 3U09A 3BH0A 2DQKA 3HCBA 4KN6A 1PFYA 1IY9A 1UFKA 5HIMA 1W35A 3ZWPA 4K9OA 2R84A 1HEIA 1VZ3A 1YZ3A 4IHJA 3TQCA 4H7DA 3LDHA 4DLBA 1CIVA 2BRUA 2G88A 1WU7A 1Q21A 2A30A 2R6GA 1RFGE 2WWYA 1Z45A 3NOXA 2YXNA 2XT6A 1ZK1A 2TECE 4O63O 4PHHA 4OEHA 2ZW9A 3FPSA 4Q4DA 5JD3A 2VUTA 4GMDA 1OFHA 1T35A 1WSDA 1XXLA 2F59A 3F3MA 1NMSA 1ICIA 4UDOA 2OCLA 4EG8A 2VAVA 5BNTA 3EA5A 3MCTA 1PJAA 1KEPA 3YASA 2N46A 1Y82A 3OVMA 4CTOA 1TLLA 2JJYA 2XDQB 4UTXA 4KR2A 5EUCA 3KJQA 4ADSG 4UTVA 1CJUC 1KF0A 1O77A 3ZXUB 1MV8A 1YE3A 1KEZA 2C3PA 2WSMA 3ILSA 5KI6A 4MP3A 3TTYA 3H4VA 3V8NA 5AD1A 3K0FA 1CZRA 5EXDA 9LDBA 1HXHA 4F5ZA 2GBGA 2WJZB 1XLUA 5TQJA 4AWAA 1OUMA 2WDPA 2XITA 1ZGAA 3EGVA 3ASUA 1U1DA 1NU8A 2YINC 3OJWA 4KLZA 1IB0A 2CHVA 4R1QA 5C5CA 2WD7A 2WWHA 4UOZA 3KWJA 2HNKA 3BXEA 2QDKA 4BNFA 2QAGB 2JH3A 4LHZA 1ZMOA 2Z3VA 2ZUCA 1KQGA 2Q62A 2H4JA 5K6AA 2JLZA 1RRPA 1GR0A 2GF9A 2RHWA 5FFFA 3WL4A 3LK7A 4I9HA 2PV0A 1EFKA 2Y99A 3WAJA 2REBA 3DZFA 3HO8A 4XR4A 5ICCA 4RULA 1VG1A 4COKA 3E9CA 5ECGC 3QFTA 4Z0PA 4B40A 4Z8XA 1E2GA 4EPVA 1Q7EA 4OJMX 5CB6A 1P1CA 2YHUA 4AKTA 2JD0A 5E6UA 3O8QA 1I7PA 1KU0A 1M2VB 1YB6A 2H4FA 2J7PD 2ERYA 1K0FA 3HLYA 4J29A 4UDNA 4LJRA 1TAUA 3ZD9A 4KBGA 2AOTA 5B6JA 1B6RA 1QHNA 1UL1X 2BR5A 4NDZA 4ER5A 2H1RA 2VDOB 3S8EA 3BQNB 3WTCA 5IF9A 3AO0B 5E4JA 4B9AA 4R9RA 2NZUG 2JLYA 2ZR8A 4K2AA 1KHTA 5EP4A 4Q1EA 2PS3A 3VO1A 5DX8A 3ZZTA 3WGLA 1QZ3A 3D5QA 3ZY3A 5I7RA 5L45A 3BXGA 3GZTB 1AU9A 1F8UA 4IEEA 4BGDA 1QF6A 2BCJQ 5FX2A 1QIKA 5K99A 4MMYB 1T43A 2NUTA 2IQ5A 1GRVA 2W43A 3AF1A 4ID9A 3CC8A 1L8OA 3D7SA 2FETA 4UU1A 1YCFA 5HG0A 4YPOA 1EVIA 2GPYA 1II9A 1QWSA 4GMFA 4XDGA 1L1FA 1EPUA 1E7QA 1KVUA 2BJHA 1ZK4A 3QVKA 4G07A 5ECWA 3RRBA 4UPEA 4DT1A 1UZNA 2V0NA 4DV0B 1GNLA 1B16A 1B6GA 3H8WA 4XB1A 3SZ3A 4YYEA 5M7EA 3B38A 3P97A 4U2DA 3CPEA 3BCRA 1H5NA 3IMCA 3ZV7A 3LLCA 3WL5A 4UNRA 4ARCA 4ZI5A 1O08A 1E18A 3SBEA 4D57A 1F5NA 1GTRA 4MUGA 1KDRA 4JY7A 5EQTA 1PCXA 1ZFNA 1OIXA 2FA9A 1QOZA 2I5PO 2F43B 3D2LA 3IB3A 2GLUA 2YZ2A 4GRAA 4INPA 4PWZA 4X20A 2WB4A 5EHQA 3GLVA 1PVOA 4G5OA 4O2AB 3AUXA 221PA 5E4FA 3RS3A 2ZJ3A 3O3NB 3FSGD 1UXJA 2ZVQX 4BX8A 1DE0A 4Q4HB 3RDPA 1U8FO 1FDOA 1P7PA 3LQRA 2Z04A 1QBGA 3FLBA 3PYMA 4U4AA 2Q4EA 1EZZA 5BR8B 3W3AD 5HUHA 3JY6A 1MO5A 1FX0A 1HT1E 2O50A 2GKGA 1G8HA 1XEFA 1R15A 2QK4A 5DASA 1HO3A 2ZPTX 2AT1A 3HCFA 1XZ8A 2VJCA 2AFVA 1JDUA 4Y2PA 1IXKA 3U3JA 2VWHA 4RM3A 3PNVA 4FFNA 5IBQA 3EW7A 1IULA 4KTTE 4TXLA 4DBLE 3DE3X 4W7SA 4YR7A 8LDHA 3REQA 1KFCB 2IYYA 5CVTA 1H1TA 3T1QA 2OD9A 4N39A 2D8AA 3DBRA 3HYNA 4B2IA 3WO0A 1I33A 5AUQA 1O97D 4BMSA 2JFHA 2C1XA 4G0PA 2DPGA 3D3JA 5KYUA 5I7EA 1UPUA 2P1DA 1CW2B 4MH0R 2Q7XA 3ADKA 2Y4NA 3GMTA 3ZHVA 4CG0A 3DOEA 4MVJM 2E3JA 1LU9A 1X7XB 3VYVA 3FOEC 2F1KA 1POWA 3UUGA 2QD5A 2Z4TA 3GIWA 4UCWA 3KK0A 3WRYC 4B7ZA 4NTZA 3PG5A 4OYRA 1MO6A 2JH8A 2BM9A 3VHLB 4GLOA 5I7SA 1Y7PA 5KHAA 4RL6A 5I8PA 3RIHA 5EIWA 4DLYA 3GBVA 5GM2A 1E69A 4YN3A 3HO6A 3B1XA 2ZIUB 3WV5A 4E15A 1FW6A 1A9ZA 3EXFA 4FZJA 3FB4A 4GGPA 4H9GA 1SXJB 4D3ZA 2GPSA 4BRWA 4YX9A 1WVIA 1PFUA 5B53A 1G8PA 2HMVA 4HCJA 2WP0A 3H2GA 4LGMA 3EF1A 1VDZA 4RQUA 1FU7A 1YDWA 4FNGA 1O96B 1N2CA 1JG3A 4WXYB 5F5NA 3MTQA 2FP4A 2GGSA 1Z36A 4HVCA 1APBA 2VQEB 2NTEA 4C7XA 3EGCA 1L4NA 3UA4A 1Y8CA 4Y2RA 3PR1A 3PX7A 1PO7A 3VYUB 5KX5A 2AK3A 5E6RB 2EG9A 3R40A 5B1HA 2SCUB 3BWXA 2JLBA 2VP0A 2PUDA 4NENA 1NI4A 4P6VF 3D4NA 5AM4A 3SF8A 3CURA 2QLNA 4QTUB 5DP2A 2EF1A 4N3NA 3TH5A 4LW8A 2O3QA 3EGOA 3CUYA 4KN5A 1IEVA 4ZZ3A 4I55B 3HVIA 3SYMA 5HKKD 5IEBA 4JI8B 2JK1A 3CW8X 4F3CA 1IXYA 1U9CA 3GYBA 3A3YA 3HDGA 3ABRB 4EGQA 3OZUA 1NBHA 2QI9F 3F9RA 3LP8A 2P78A 3F73A 1ZY2A 5EZYF 3CNOA 2H7CA 3C3XA 4MVXA 3RRXA 421PA 4QUIA 3RS9A 3U7RA 5JSZA 3K9FC 4Q00A 5LZ8A 2HA0A 3O7WA 3B2EA 1Z6TA 4B3XA 2QN3A 3VU1A 5E6SB 4GZMA 1S02A 2CWDA 3DM5A 3I30X 5BSRA 2VA9A 1RI3A 2Z1DA 3S5UA 3FROA 1Q3TA 3TIXB 4A2WA 3HZHA 1JKIA 1Z74A 4GMGA 2JI6A 3FNIA 1V5IA 4AWBA 4UBKA 3VHXA 3NDJA 1JF8A 3NEJA 4A5SA 3DLHA 1JGTA 1TRKA 4LQLA 2J1LA 7ABPA 2AE2A 3AMVA 1KJQA 1UBEA 5CFOA 3M5DA 1YZHA 3HWSA 1YSCA 2E89A 2BFDA 5BWLA 2FWBA 1ORIA 4NABA 1GRQA 5KHOC 2WUWE 4G8DA 4XFDA 2Y92A 4OFZA 2L69A 1GU0A 1FF9A 4F7WA 2MINA 1D8AA 2YH2A 3MT8A 3NRJA 1QO7A 4KZPA 3PUVA 3R7FA 2D1TA 121PA 1OXSC 3C8DA 3HU3A 3LCVB 5A5VA 1WHTB 2FZKA 5ED4A 2QRUA 4MW0A 4NWIA 2BYTA 1KQPA 3QPUA 3KB1A 4MI3A 3RK0A 2XUGA 4JT8A 1DCKA 3MA0A 1Z2DA 4BCBA 3J7AC 1CJTC 1PR4A 1OXUA 1FFEA 4UE3S 4JP8A 4FDTA 1OX4B 2XB9A 1OGYA 1YZUA 1EVEA 1NVEA 2R6JA 3D6FA 4WCFC 5IX8A 3K9GA 2O7RA 3HB5X 4HLUC 4AM8A 1VQ1A 4IKEA 1G8GA 4KVFA 3JQAB 1TYDE 3D3EA 1AKQA 4UVDA 1L5YA 1JG4A 3K5HA 1A71A 3N75A 5ILQA 3BA6A 3U5ZB 1HDXA 2VEDA 1L4YA 1BDMA 2VI5A 4OH1A 2VUUA 1UBOS 1Z08A 2YWBA 2YICA 3DWIA 4LECA 3ZDCA 3GJ3A 4HDSB 3SYKA 3THWA 1EHIA 3IAHA 4FDAA 4MV4A 2GAFA 4JEMA 1MJNA 3H97A 2QGFA 4HQFA 5UKDA 1XMJA 4PGAA 3AFOA 2X42A 1Q16A 4FGKA 1Z7BA 3AEQB 4NI5A 1LD3A 2JL1A 4U7TB 3WQSB 1RHJA 3E7PA 1DEOA 4RDHA 5FR2A 1M6WA 4JKOA 5DBGA 1VYHA 2IYFA 3W5SA 2BGKA 2D1YA 2H4XA 1RFLA 2K87A 4ZI7B 5FLXA 2F3UA 4C3OB 4GBJA 4JYZA 5KOJA 2ISCA 4NE2A 4GIBA 5CA0B 4M0PA 1ZW1A 3BX1A 3IUEA 1PEYA 5HS6A 1K8YB 2ZDQA 4TSFA 2P8SA 2M6RA 4TMKA 2IS6A 3PVCA 4JUIA 3ZCTA 1DQRA 2B1IA 2D5CA 2YVKA 3I76A 4JXZA 1FYEA 1LLUA 3KAKA 1M34A 3WGVA 3GFSA 4MRVA 4WKPA 3W34A 2IOQA 1CETA 3NHZA 2OD7A 2WKWA 4KIUA 3ZDZB 4DFDA 5HRUA 4DV3B 1WMSA 2NUPB 2P5TB 3KVYA 5CT5A 1DXQA 3QV2A 1NQVA 2PO7A 3O92A 4G9BA 3E03A 1IN6A 2VJBA 3H7IA 5CFQA 3KEQA 4WPGA 5TQ0A 4Y30A 1JLSA 3NHBA 2GEUA 5HTOA 3WLEA 2QSUA 3HN6A 1HPLA 1YRYE 5TT0A 4MRSA 1NOKA 4D9IA 4D26A 1JQEA 1QB8A 1VIMA 1KARA 5I9IA 2AZDA 2CK3A 2OD2A 2P68A 2VC2B 2Y1GA 4IWNA 3KALA 4IYRA 3EIUA 1KDZA 5EGNA 1U7WA 3LVFO 4JUFA 4F85A 4GKKB 3FJYA 1GL7A 4FWBA 2OGSA 2JK0A 2Q0QA 1V1RB 1JTVA 2MSLA 2RAFA 3V8MA 4MUNA 5JZOA 3N28A 5KJFA 2RGAA 3OSUA 1WCYA 3QFCA 2Q4RA 3AFIA 1Y3CE 4EJ6A 1IBKB 2DR2A 5A0TA 4O2LA 2V6MA 2F8MA 1PT5A 3DDSA 1EFTA 2D4AA 3HGQA 3IB6A 1N0WA 4LK2A 4WDRA 1SOVA 2VJAA 4XIYA 3OCJA 2FZVA 2OMKA 3ZD7A 4NXMB 4CRWB 8AT1A 3FGOA 3OQ6A 3A1VA 1KKMA 2B1QA 3AUTA 2G25A 3LLMA 4XIFA 2GXAA 1BXRB 4TV8F 5BN1A 4RGYA 5J2UA 3PIIA 3DULA 5JROA 3RC8A 4C4SA 4OXQA 2ZRFA 4IHQA 4M3NA 5C3MA 2UUAB 3DB2A 3ETDA 3HEAA 5K4AA 1YA8A 2ZWOA 3A10A 2GJ8A 2ZUUA 1T2DA 1Q95A 2J3KA 4A8TA 2OM6A 3T5BA 3QMVA 4FC7A 4UQPA 3SYNA 2G06A 2OPBA 4KQ6A 2B8EA 3UWKA 2CDBA 3G3EA 3PICA 2XZPA 4UUQA 5BNIA 4KIJA 3AR8A 4IBOA 5L7TA 3NWOA 1U81A 2VSQA 2IRWA 5DTMA 1R1DA 2WF9A 3FOBA 4FDLA 2UAGA 2AFHA 2QTVB 2O7VA 3LP5A 1X1TA 3B20A 5IVDA 3TTVA 4F60A 1P7YA 2AF4C 4YNBA 3C8MA 1EE2A 2Z43A 2BKXA 1I4WA 2PUHA 4MRAA 4RK4A 4DG5A 3EIQA 1GYPA 4HRYA 1N34B 2EX1A 4HWTA 3WICA 1KI7A 4B2YA 3OF2A 3FN4A 6GPBA 4OYHA 4US2R 4BNKA 1XI2A 4BNVA 2EZ8A 5LQAA 5JI2E 2BBTA 3CRZA 4BVKA 4QREA 4EYSA 4CLRB 3EF0A 1EP1B 4QOGA 1RU3A 4EKIA 2XZOA 3IUPA 5JASA 1ONBA 1PHPA 3NM4A 1B93A 1GGEA 4BBAA 1CY8A 2ES4A 2C4HA 3V2HA 4DM3A 3BXFA 5BN5A 1F20A 1JALA 1I30A 4HGZA 3SICE 4I6EA 4V0SA 3T7TA 4L4SA 2J9GA 3G85A 4HFJA 2Q28A 3K0SA 2O0JA 1T2CA 3QX7A 3QBTA 3VPCA 4W8GA 5KTYA 2HJHA 1OWOA 1KO7A 3KKNA 1RJ9B 1YFKA 2ZI6A 4KGDA 1X14A 2O5RA 1I3MA 2BGNA 4LZOA 4NATA 4TS1A 3AVVA 2H1CA 3RJZA 1S9DA 3CZPA 4M8KA 1TJPB 3IBGA 4FQ8A 1EDBA 3QVLA 3JQPA 2CDNA 3RRMA 3SXPA 5C5DA 1IHOA 2IHTA 3PI7A 3N8NA 3GJYA 4MCHA 1GTSA 4WFJA 2GHQA 3PQ2A 4WXMA 5IZCC 1UPCA 4LY0A 1HRKA 5DX1A 4A1OA 1N77A 2HDNB 3W1EA 2YWXA 4F9GA 4FGJA 1P2GA 3IALA 4ERXA 3CVWA 1NUTA 2EP5A 2NU6A 5G02A 3NCTA 5CCXA 1W73A 2O7SA 3OQMA 5DNYB 2V58A 1N0VC 4P08A 4QUGA 3UW3A 1JAZA 3BREA 1X7DA 3C1AA 2X4GA 4NFYA 2CEKA 1W1IA 3RSZA 5TQ2A 2OHXA 4Q9NA 3X2FA 2O19A 4IJQA 1NDHA 2X8JA 3ZY2A 4AJKA 4DWJA 4KQJA 2B37A 1PSDA 2JASA 3DO6A 3NFRA 1Y33E 1EMDA 2KMLA 10MHA 2IBSA 1E2EA 2ZATA 3TFWA 3L79A 3FOFC 2BFEA 2VATA 1HDYA 4AN0A 1G42A 2J46A 3NC1C 4CM8B 4Y0NA 5J4YA 3RHSA 1JEYB 5TC4A 2XSZA 2B5VA 4K9SA 1LJ8A 4HF7A 5JXGA 1NLUA 2RHDA 1LK0A 5HMMA 2D0PB 1GGHA 2PGIA 5L51A 2ZYRA 2YXBA 3BRQA 2O2EA 5ERGB 4BO1A 1DRKA 4L22A 3GZNB 3I1FA 4OLHA 4QDKA 1DEKA 3OT5A 3QY9A 4PTYA 5FULA 2PD3A 1L5KA 4F1KA 5HUQA 1J25A 3PWTA 3GQBB 1GU7A 3DE7X 2Y1FA 2H59A 1PG0A 1Y5MA 3H3FA 3JALB 3ML1A 2HF2A 4YJFA 5CG1A 4JHXA 1OASA 1YCHA 1C1DB 3F7MA 4OYLA 3SSOA 1ATZA 5AO9A 5CB4B 3GL9A 1NP3A 3Q5GA 2PPVA 5DT9A 3TEMA 4CL2A 2GPWA 5SY9A 2A67A 1IM2A 3AB3A 2I8CA 1CFJA 1DC4A 1E1QA 1N1EA 3PUIA 3ZGXA 4OD0A 5EWLA 4Z9AA 3CW9A 4K9NA 3Q7EA 4RANA 1NR1A 1U5AA 3GLIA 1C7JA 4N48A 3K9WA 2I1LA 4KOEC 3AP1A 4UJ3A 4YAFA 4YJKA 3ADOA 3EXHB 5FWXA 4J0CA 1W88A 2CLDX 3KELA 3UMMA 1PVDA 1B3BA 2DY1A 3QG1A 3Q9NA 4YRRA 4XX1A 5CXUA 5HMLA 4Y2QA 3L8DA 4DIUA 4EQ6A 1R6VA 4RTKA 3TDNA 2H2WA 4TVOA 1CCWA 4H1UA 2X7XA 2BELA 4YV2A 1SBQA 2G40A 2WC1A 3BCHA 5B58T 4KIGA 4D9BA 3AVQA 3LQKA 2I3DA 3X2EA 1T9HA 1MG5A 4O2BA 4UFNA 4H3VA 4ZOLF 5GGXA 1UBHS 1A9XB 5FV7A 4X3OA 1BVUA 1TUIA 1ILEA 1C3OB 3CB4A 4RIHA 2P7IA 3ETCA 1UZUA 4PO9A 1HG1A 2J3QA 4Q3LA 4A27A 2J0SA 1LBHA 4LTMA 1XPOA 4KO3S 3KPWA 3GLGE 3NLLA 1WKVA 5CVUA 3VO2A 4RJJA 2GERA 1M83A 2YJTD 4UUBA 1EDZA 3COSA 1JQBA 1KIFA 2IGTA 4XH9B 2V7WA 3MD0A 1B8VA 2R79A 4GXQA 4NBRA 2E5LB 3ICEA 2EQBA 1Y8ZA 3K0CC 4JLUA 4KUEA 1DCFA 3DT8A 5F78A 1MC8A 5JAOA 1ZICA 3AERA 3GD5A 4DLKA 4E33A 5IK2D 1T29A 3IBCA 4L7QA 5CYGA 2YQZA 5JCZA 4IOKA 4GI2A 1WPGA 2DLDA 2YC2C 3D4BA 2ZRKA 3NNNA 3PQEA 3VHQA 5LQNA 3ZX4A 3T35A 3DXXA 3M6UA 2C82A 3HFGA 4U9UA 4LJ4A 2MR6A 1FUYB 1PWHA 5AT1A 5JXHA 3CNBA 2B61A 1C80A 5JANA 1GQOA 3BXZA 2FWNA 3ZE8A 4WXHA 4U2KA 1WOYA 1I94B 3JPWA 2ADOA 4TTJA 4PZLA 3X1KA 1XTVA 5JJLA 3TMYA 1U63A 3C15C 2RIPA 3VA7A 2R5WA 3DR3A 3ZK8A 4IUBS 3TMKA 1IWOA 2XRZA 2B3TA 9LDTA 3Q6IA 3OO1A 1UPBA 3G17A 4W5TA 4CGYA 5HW0A 3CV3A 4PAWA 1GA1A 4G1BA 2YY5A 4D46A 1AURA 4Q4JA 4ZCIA 4X7PA 1R5JA 3WIUA 3UGQA 2H2AA 3PEEA 4U39A 2GEJA 5JJIA 1T6ZA 1E9BA 4X8MA 5LYYA 2OHHA 4HTFB 3CKLA 1HK7A 1YQGA 3TBHA 5JO0A 2Q5QA 4ZT7A 3BSFA 3F47A 1UPFA 3D2AA 2C4VA 3EEOA 3RWBA 1IK4A 4HZIA 3CCCA 1Z38A 2V6GA 4IVRA 5E7MA 1JLKA 1E98A 1JIKA 4KXNA 2O0MA 4E2XA 4YRMA 3U61B 3COZA 1ZM9A 3ZHBA 1N0IA 4TSFD 1GV0A 1RJEA 4B76A 1GGNA 3DO8A 5JMPA 3QFFA 1V96A 5SYMA 1KAHA 3RHTA 4D0NA 1ZRHA 1L4KA 2F1HA 3RVJA 3V32A 3OC0A 3LPNA 1D3AA 2I0FA 4FFOA 5DHTA 3Q4GA 1B23P 1G21E 3LUDA 1D2MA 4HPJB 3WADA 2CVOA 4FK8A 2R7NA 3B2QA 4CE6A 4P4SA 5JNWA 2N75A 2B34A 3D59A 1ODLA 2PUVA 4ZJYA 2OHGA 1UCFA 3F4LA 4QBGB 1GAWA 3TEFA 3DMDA 4V0ME 2WHPB 4CU2A 1CRLA 1U2RA 1ZSYA 4RTLA 1MVNA 4Z54A 3Q3GE 4B81A 5IUNC 2O8DA 3BJMA 4C0WA 1T4CB 3PNKA 1SU8A 3A1TA 4FONA 1MEOA 1VBNA 2P9QA 4FNOA 3LBYA 1CHDA 1JEDA 1KNQA 3EB9A 1ADJA 2CBZA 2HMSA 3IQEA 3OBIA 3FDXA 3PF8A 4MV1A 4NS1A 1W46A 4C4OA 4P54A 1RQ7A 5E1BA 2JF0A 5AJXA 2KI5A 4EHFA 3D7NA 4PN7A 2YZKA 1JVNA 3E8MA 4XDYA 2A92A 4I5GA 3U60B 1QV9A 4QYIA 3G9XA 1ZL0A 5KQMA 2NU9A 2VQ6A 1A9QA 1EBBA 2C8KA 5DN6A 3KT0A 2JGFA 4GFDA 1ODCA 4W7IA 1TYBE 4V38A 3JVEA 5LQRA 1MLDA 3HCPA 1DAOA 1W4CA 4F8EA 3HDJA 4PYMA 3WISA 3AR7A 1ZWKA 5FYDA 1I8TA 5LMUB 1Z07A 3LUGA 4WACA 2WIDA 3FPFA 5AW1A 1UWKA 3WV4A 5G0TA 2NTVA 1XYGA 4RF2A 4BGEA 1LPSA 3Q0TA 3MTBA 3BT7A 1NSFA 3CWZA 4FFLA 4KRYA 1TMKA 1KIAA 4IINA 4CNQA 2QN9A 2ZJ8A 3FUXA 3GCXA 2GTIA 4WK6A 3ND8A 2YY6A 3CPSA 3ELYA 4BMDA 3VPSA 1ZHHA 1O7JA 4U7PB 3PDIB 3LM8A 2P2DA 4D4GA 3H6GA 1X7ZA 4BP9A 3AX6A 3WK5A 4WOPA 4AN4A 2ZE5A 4GVXA 4X71A 3PDWA 2Z9DA 3QUBA 3GELA 3G0OA 5LKRA 3LDAA 4YRLA 4BUCA 4YECA 1WXFA 5HIIA 4KWCA 5CB8A 1MT0A 1SOMA 4C6RA 3EIWA 1WTCA 3EEFA 4IV0A 1UOPA 2XMRA 3KG2A 4JASB 1KNXA 1RI1A 2JI8A 3LHFA 1ZONA 3EVFA 4X9XA 4DW8A 4UTPA 2PUTA 1I7SB 4D96A 3OF5A 1EFCA 1Q7BA 5KWSA 2OE2A 3K35A 2GASA 1VYUA 3K8OE 4L3OA 4XTRA 2QXTA 4D8XA 1KSJA 2VBCA 2ZXUA 4YMLA 2PU5A 8GPBA 1L4GA 3P0HA 4BNTA 3ZLVA 4LE0A 4BECA 5G4LA 3W5AA 2PZJA 5JFOA 3E27A 1M73E 1EB9A 3P9ZA 4NMWA 2Q2QA 1D8TA 1ZOSA 1L3IA 3AJRA 2QRJA 2BZSA 3RUIA 1B15A 1VSVA 4P7JA 3CBQA 3M6IA 4EG6A 1UT5A 1LX6A 2KW5A 5JHHB 4AY2A 4OQFA 2QVCA 1U3GA 3RHZA 2RI1A 2BTQA 2QLTA 1CUFA 4M53A 3MMPA 4O5AA 4QUAA 4KR3A 4BNWA 2TRSB 4WBXC 2C5BA 3DAFA 3GD7A 1VJGA 1HI9A 3D0KA 3C74A 2XWBF 1Q12A 4RZUA 1QUFA 3EX7C 5AVTA 1OLUB 2C5GA 3BRWD 1XP5A 3G1UA 3I2GA 1U2QA 2AQ8A 5HRCA 1AH2A 3VDRA 3KZXA 3WSTA 4X85A 3NAGA 3K71B 2QT9A 4AY6A 5CNIA 5JQGF 2W4IA 1L7XA 5NLLA 1X1CA 5BUQA 3SS7X 4AD8A 1KORA 4YLYA 5IM4A 5IJWA 5JJKA 3TJRA 1NW6A 2DBQA 2F3QA 3DE5X 2JFNA 3OKCA 1H2FA 4O4IF 4RV5A 1L4MA 5HSGA 1LQTA 1M75A 5DM0A 5GV7A 3U9LA 3UEOA 3KKLA 2YQ5A 2ZVDA 5AI5A 1SQSA 2CNDA 2HLNA 3NGLA 1G55A 1F8XA 1YQDA 1V8FA 2RG1A 3CFYA 3EISA 2QQFA 4KMMA 4AUNA 4LNUA 4V24A 4EX6A 3WWZA 4YJ3F 5AUPB 2VTVA 5HRAA 1EYZA 4EUKA 1I3CA 3BH6A 3ZXXA 3G82C 2C1EA 1J4AA 1C9YA 4NHEA 2C5AA 2W6IA 5C5IA 2VK8A 1NQXA 1N2CE 4OHBA 1XAHA 3U0BA 3GRVA 4MS3B 4OVKA 2DT8A 3LKZA 2M98A 3KB6A 3A4VA 2OWEA 2PZEA 4F3NA 3D8RA 3K05A 3PUXA 3LFUA 3R3JA 5C51B 1SB9A 4S12A 5AK6A 1PDWA 2XRFA 2XSZD 3M81A 2JCBA 5DW0A 5EJ9A 2H1VA 2QMYA 3CO5A 3CNEA 3W9UA 1I5RA 4MR8B 2GJAA 4UM8B 3RSQA 2APJA 1TIPA 2YBEA 5AKYA 1AF7A 5T8KA 2R6FA 4UE6A 3EEQA 1TW3A 1VBFA 4Q82A 2A9OA 3GRAA 1TKBA 3IMGA 2COEA 1T0PA 2ZSUA 5KSZA 1CUIA 3KZOA 3MS7A 1VSUA 4TPKA 2IIQA 1W4RA 2GK3A 3CVOA 1CR1A 5JSHA 2WTBA 5ALTA 1NBIA 3OZVA 5LUBA 2VF8A 3AV3A 2ZSEA 1LLQA 2P8JA 2RI6A 1HA3A 3AP3A 4GYWA 5DCWA 1KOLA 5G1OA 5HHTA 2XRMA 3L7LA 2ZJFA 1JNXX 2HREA 3K1AA 3D8UA 3LX5A 5A9RA 1D0SA 2XOEA 4U63A 3T0GA 1CR6A 1U5BB 3U3ZA 2X8LA 2X1VA 3KVOA 2NO0A 4KYVA 3Q85A 4Y1FA 3ZS9A 3O6VA 2VKQA 3QLVC 5DHSA 2ZSAA 3SC6A 2ZJ4A 4F11A 1VMEA 4RF4A 4GPEA 2O2ZA 3GAMA 4DLTA 4IDBA 4J9UE 2Z08A 2Z3WA 5C46F 2CV0A 3ANMA 4K7JA 5GQSA 2PR2A 5B7QA 1KMNA 2ZG6A 1PLJA 3NIFB 4EY6A 2ATEA 4HGOA 3O4VA 3M9WA 1X94A 1XFAA 3NIGB 2ASVA 5B4VA 2FWPA 2X4IA 3HJUA 3HSSA 2DSTA 4G4JA 4M8LA 3JWPA 1NAIA 3DAYA 2XX3A 4RPJA 4AZWA 4TT8A 5REQB 3R8XA 4CEHA 4BUZA 4CGZA 5IF3A 1MABA 3A4YA 3K6SB 2HPZA 2G9NA 2G9UA 1O54A 2ZUVA 3F49S 3FUTA 4IOJA 1M1NB 1V4BA 3I2YX 1Y63A 4LXIA 3TLAA 3TX6A 1R10A 3OCVA 1TNDA 1VHDA 4DWOA 1C3VA 1FU4A 4WN3A 2ASEA 4JXKA 3KKZA 1WMAA 3FRHA 1NKTA 3KWLA 4D9EA 3RARA 1P6XA 4DY4A 1OQAA 2YR0A 4WD3A 1ORWA 2WZQA 3KJHA 2IW3A 4YRQA 1J70A 4IIJA 2JD2A 3KYCB 5GV8A 4J4BA 1HDIA 2GLXA 3UF0A 2YUTA 2HU8A 4W9NA 1MB0A 4FEEA 4NZPA 4OM7A 1OD6A 1UKCA 2JVIA 4DQUA 4FWTA 2OV6A 3W6PA 3BB1A 1YFLA 3OD5A 2NXNA 2Q6KA 4X41A 2X23A 2V4MA 2JEOA 2I2DA 4CMBA 5JVDF 3FMOB 5J2TB 4H35A 3EPRA 4UUNA 4BKMA 2BPOA 3DJFA 4WZBA 1ELOA 2VSFA 1TAHA 3P8ZA 1I4TD 4TTPA 4S35A 3ROTA 3M1YA 2CXRA 4IQ8A 3EWSA 3B6MA 4GMHA 1KTIA 4NCHA 1DAEA 2TSYB 2R1UA 1PR6A 4M9QA 4OAOA 2LWIA 4IJ6A 4DA4A 4HQ0A 3UV7A 2B4YA 4AG3A 3RC2A 4H18A 4FILA 3VPAA 1V16B 1XEWY 5LQKA 1ZH8A 2JZCA 3AHFA 1CUEA 1GRNA 1IMOA 3FPCA 1T34A 1RAAA 1M34E 1X9HA 2WIBA 3X0DA 1V47A 1X1SA 4UASA 2XIJA 3ZWMA 4CTJA 3IAUA 3G68A 1P5FA 3RAEC 2XT9A 1N6KA 4CR7A 4D8VA 4EA8A 2V3CC 1R6DA 1QO0A 2VCHA 3ZHYA 1ZSNA 4OXXA 1JDBB 4P32A 1RC0A 5EE0A 4X24A 3HA2A 3RS0A 3K4QA 4B4DA 1N2IA 2F9FA 5BURA 3KYJB 1JBKA 1XKQA 1QMGA 3EUAA 3FFWA 4CM9A 1U1CA 3PRJA 5ARBA 4G81A 1NQAO 1AZWA 2GK7A 3PR2B 4QDZA 4YQZA 3RTBA 4ER7A 1YJ8A 4KXMA 5KVAA 2J5BA 2JAXA 4MCAA 4UHFA 2DFKB 3ZV4A 1O95C 1LY1A 4PYLA 1PR1A 4LYDA 4F4FA 4IOLA 1UMBA 2VYNA 3DL2A 3O2QB 3QYAA 1KMHA 3PRKE 3F5DA 1TUGA 3GB9A 5I3CA 1YA6A 4RY8A 4EG4A 2C4KA 5C1DA 1DZIA 4LFCB 1YKGA 2NSYA 1VECA 3LG2A 4L4ZA 5ETJA 1V2HE 2QM7A 3SJBA 4LF8B 1ZA1A 5LB2A 3SXUA 4EUSA 4INJA 3WB9A 2WHXA 5H16A 3B1KA 3KWMA 1SULA 2WV9A 1CU1A 1L4UA 3D7KA 5AJVB 1QLJA 2Q2WA 1G6KA 1NT2A 1Z0KA 3RC1A 4NOLA 4FLFA 4Y0AA 4ABYA 3GVXA 5BORA 1AGPA 3DBIA 2ZQYA 4L3WA 2HA4A 4O0MA 2UZ4A 2BUCA 2UUBB 4YALA 3OM9A 3LPCA 1PUIA 3MF4A 3CBGA 4L3VA 5JNUA 5EMHA 4L9WA 4NU5A 5AHXA 5DN6D 1W48A 5K8LA 3CNQS 3JARA 3B5EA 5I7VA 1M10A 1JFLA 4X1YB 3QWBA 1NYLA 5CXQA 4XGKA 1H1LA 1VLHA 4WK0B 3ROXA 4LXQA 4MRNA 4A8JC 1SXHA 2J6HA 5HA5A 2PBFA 1Z0SA 4HDKB 3LW7A 3QE2A 1UXOA 4GU5A 1XELA 2BFAA 3GAAA 2PL9A 2V6JA 2VDPB 4GPAA 5FJJA 1T3GA 2GSDA 2VJKA 4IJMA 1T8TA 2E0IA 4MUKA 4UAVA 1JHDA 2HTFA 3QKSB 1DJLA 3T3GA 3NC0C 2PGDA 3O3OB 1V37A 3PC2A 2E4VA 3WDSA 5BWNA 1P74A 1QH1A 4JLNA 2FSSA 1W36D 3QPBA 3CGWA 1N9GA 2CXNA 1CUCA 2BSAA 3ZDAA 5EUMA 5BO5A 2PD4A 2CVPA 3RUPA 1K9VF 5JNLA 1L8LA 5CDUA 3UJ3X 3AR9A 1OR8A 3ANLA 3RKRA 3IUBA 4EB8A 2AWOA 2BDTA 3GPCA 2IIVA 1PRYA 1KSFX 3HCAA 4H6VA 1CQPA 2V7BA 1Q57A 3AJEA 2I80A 4M1WA 4PPYA 3ZYCA 4AZ0A 4U02A 4F96A 2B8NA 2JCGA 2YJZA 2WINI 4C30A 2VJLA 4XVRA 2G5PA 1NPTO 3UIEA 1DS6A 5BSUA 1NW8A 1XZMA 4AO6A 4X7MA 1KBQA 3D6JA 3IOBA 5KTSA 4GDMA 4DG8A 3HJBA 1OREA 3OIDA 4GMXA 3MERA 3JSAA 5BVGA 1U7UA 3BSSA 1DXHA 2HCBA 5ELMA 2E5FA 2RAUA 3L77A 2XEXA 1QDEA 1I4OA 1ZYUA 3LRPA 4MUAA 2OB1A 3RQIA 1YC2A 1QIHA 1T8RA 4Z0HO 4YV1A 1DPGA 4HAYA 2YCBA 1QKKA 1TM7E 2FMTA 3BHIA 1GP2A 2V7TA 2Y68A 5CU7A 4LK3A 3WWYA 1GADO 4NZ9A 1FJ2A 1YHNA 3MAJA 2KM1A 4GDFA 3ZWBA 4MUIA 3DV0B 4MWTA 1WHSB 3NIDB 3SSMA 5JPDA 4OJNA 4J3JA 4LE1A 4MS1B 5DNUA 3OQBA 3L07A 5DM1A 2XUIA 3V7YA 4C0SA 1XFDA 3MCAA 3UBTA 2VF2A 1BYIA 3CX8A 2GBIA 2QTMA 3SQLA 3A9CA 3GLFB 4TLEA 1QP4A 4EMUA 2QBYA 4MW1A 1Z7EA 5ESWA