1ZNYA

Crystal structure of mycobacterium tuberculosis guanylate kinase in complex with gdp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
183
structure length
183
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 57
structure length 183
sequence length 183
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znyA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znyA01
2IYZA 1SXJB 4LPKA 3GLHB 4UNQA 1CXZA 1UKZA 2NTYC 4P32A 2WWHA 1PUJA 4DRZA 1AKYA 1SVWA 5DE3A 4HB3A 1UDWA 1ZU4A 5KNCA 2IYRA 3FPAA 1DAMA 2D7DA 5FBRB 5HKKD 3Q8XB 1HA3A 1BOFA 4URZR 1VKJA 4KLZA 1KSHA 3AUXA 1GRNA 5FOVA 4BFZA 1J90A 1AZTA 1Z28A 1JJVA 4DHEA 3K8YA 1KZGB 4NCIA 2XNSA 4NP6A 1G20E 4B3FX 4DB2A 3LBNA 1E98A 4Q9LA 3TE6A 4HAVA 1U81A 2PX3A 1ZC4A 2YV5A 4HDCA 4POAA 1HUQA 1KMHA 4IDNA 2XEXA 3RS2A 1CR4A 1IAQA 4ZDJA 2XX3A 1EX7A 1M7HA 2PCLA 3SQXA 1E9BA 2AD5A 1OH8A 2ZSEA 2BOVA 4M0LA 5LPNA 1VHTA 2QROA 3V4RA 3V9PA 3PVSA 1XMVA 5L3SA 4QM6A 2DYKA 1OFTA 1FPMA 1UKVY 4IEEA 2EFEB 4WZAE 1CJUC 1SKYB 4HLCA 4BE7B 2VP4A 4KSCA 4L5BA 3DZ8A 2YOHA 1GKYA 4NBSA 5KSZA 3U7FB 1Z22A 2YWEA 3ICQB 2R44A 2A9KA 4JLMA 1FX0B 2RHDA 1PZNA 4C0SA 2R6FA 5BYJA 4QGFA 4BPBA 4E22A 1WP9A 3B78A 4R7ZA 3BFKA 1KO8A 2FEMA 2RGDA 4RVCA 3QKRA 2CHGA 2GZAA 1PV4A 3PUVA 4NH0A 2P5SA 3NEYA 4XTRA 4Z8XA 1SZPA 5GADl 3K70D 4Q1FA 2ZRBA 5JJKA 4NL4H 2KSQA 4TTRA 3GJ6A 4QKQA 4WZ6A 1A4RA 4OHWA 5TY0A 4DSNA 2XTZA 4I1UA 4B2IA 4URUR 3MMPA 3DPUA 3TUZC 3EPHA 1DAIA 2G1KA 1YKSA 4QM7A 4U5XA 3NH9A 4JIMA 2WM9B 1A2BA 1XWIA 5KTYA 2WICA 3SFVA 5HZHA 2AX4A 4C2UA 1ZNXA 3PV0A 1G17A 4WXPA 1E4YA 3RWOA 2AWNA 3EASA 3U4QB 2GRJA 4PC6A 2ZREA 1A5TA 3SFZA 4C4PA 2MSDB 1E94E 2B21A 1Z6GA 2L0XA 1NIPA 3C5HA 1MV5A 3D31A 1GVNB 4NCJA 1KTVA 4ARZA 2ZAMA 3QF7A 1M74A 1NN5A 4Q1AA 3K1JA 2HDNB 2VO1A 2GVZC 2QPTA 3U3JA 1SHKA 2ZS9A 2BBOA 5H1YA 3RC8A 1KI7A 1GL7A 1GTVA 1XPRA 4BZXA 2RGCA 3P27A 1D6JA 3A36A 1MO4A 1P6XA 2GF9A 3ADBA 2JGNA 2VRWA 3G0HA 1OKKD 2BMFA 3C41J 1W0JA 4MGYR 1US8A 3AP3A 3PXGA 3QI2A 1VMAA 2VP5A 3W3AA 4XWKA 2NGRA 1DAFA 3DO6A 2XTNA 4LBYA 2BMEA 2ZRJA 4AKEA 1OYWA 1EFUA 3W3ZB 3U3MA 3BE4A 2XITA 1FP6A 4NYIR 2QAJA 3GLHE 1LF0A 3M1IA 1XMJA 4C30A 3ZD7A 2RGXA 3AKYA 2JIZA 4WA7A 1WA5A 1B0UA 1VG8A 3OESA 3VR3A 2J3EA 3WBJA 2NPIA 2JLYA 5IDVA 1G3IA 3D8BA 4DEYA 1MO5A 1XX6A 2ZRNA 4PZZA 4ILEA 3SOPA 1IQPA 3OHMA 2A5FA 2DFNA 2WWXA 1QRAA 2YOFA 4DSUA 4UXJA 1Q22A 4RCZA 4XWAA 1P61B 4KBGA 4UXIA 3WNDA 2XXAB 4L16A 5EXSA 3CX7A 4Q4AB 2J46A 1H8HA 3P1JA 1E69A 1RPZA 2P67A 1Q0UA 4MUAA 1M6NA 3X2SA 3R7WA 2PT5A 5J4KA 2AL7A 2ATVA 2H18A 3IIMA 4GRAA 4CIDA 3U3KA 3LVRE 2V7QA 2ZE5A 3VAAA 3U5ZB 4Q5IA 1E2NA 3AF2A 2CL6X 1NVXQ 4AI6A 1FMLA 4ABYA 1SKQA 1G8GA 4TWZA 4Q19A 2C95A 2GK7A 5EP2A 2XJ4A 1E0SA 3OFND 2ANCA 3TAUA 3FE2A 5C2JB 1XCPA 2CHVA 4GOKA 1S3SA 4QGGA 1R0WA 3DKVA 4OHZA 4DLYA 4US1R 1HEIA 3CWQA 5HCIA 1M2OB 5CJ2A 621PA 4LHYA 4IDHA 2QAGB 1M7GA 2PZFA 3DOFA 1TU3A 4IHQA 3EARA 3UWOA 5DYGA 4YQFA 1ZNWA 4D4MA 2ATXA 2CHQA 4HSEA 3MWYW 2A5DA 3S1AB 4FMBB 5HPYB 4D25A 3RRYA 1S1MA 4O3MA 1XXHA 5EP3A 4L4UA 1OSNA 1XB2A 2JJ8A 4MRVA 4LK2A 5EZ5A 4EFMA 4UKDA 2WWYA 1NY6A 3CZQA 3IIJA 4E03A 5KSYA 1XPOA 2I4IA 1CEEA 2Q21A 4PAMA 2YJTD 2HCJB 3TIFA 2GDJA 5G41A 2BEKA 3VR1A 2NO9A 4A8JB 2WSMA 2JLZA 5FL7A 2F43B 2EYQA 3VX3A 1S96A 1G19A 1W5SA 4EIWA 2BWJA 1E2HA 4ASUA 2C9OA 1RKBA 2V1XA 2QBYA 1VIAA 3PIRA 1RRPA 4CRWB 3GJ5A 1Q3TA 4LYHA 1P4SA 4Q21A 1NMXA 2IHYA 1T0HB 1OPXA 4TT3A 3SBEA 4V02A 5FTJA 1G7CA 3I5YA 2Q9BA 4R2IA 3JZMA 1CIPA 1IN8A 4TQAA 3BK7A 1W36D 1SHZA 4ON9A 2ZRGA 2HYIC 1SXJA 3PJRA 1G291 3Q5EA 1BMFA 2QU8A 1LY1A 2IYVA 1AA9A 2F1JA 1G8HA 3KXKA 1DAKA 4KI0A 5DLQC 2MSCB 2E1RA 4RZUA 3IQXA 1T8UA 1Z2AA 1E2KA 2ZRCA 5AUPB 2PCJA 5CITA 2NPFA 2BDTA 4OJQA 4PPGA 3BH6A 3DEFA 5L3VA 3U61B 4FMCF 3SI7A 4KVAA 5IF9A 3GLFE 4JLJA 1U8AA 2W0SA 4LOAA 3L82B 4HAUA 1TU4A 1UKYA 3KB2A 1D8TA 1LV7A 3Q7QA 4C7OB 4TMXA 2GCOB 3NIBA 4R2HA 1YZLA 1G3UA 1JQLB 3AP1A 5FI0B 2F9LA 1Z6AA 3RRZA 2QSZA 2V6IA 4RD6A 3ADDA 3CF2A 1ESMA 3VKHA 1I2DA 2R6GA 5AWFC 1R2QA 3IO5A 1GNPA 1W0JD 1TAGA 1T8TA 4BLPA 1PVOA 1X1SA 1G3QA 4BFTA 1IXZA 2ZIAA 1OHHA 2ZRIA 5AJZA 1HH4A 3B6EA 4DLSA 1T91A 4HLUA 2FPKA 5JECA 2W6JD 3X1WA 4PANA 3QVUA 1U99A 2QA5A 3AF0A 3B1ZA 5EE1A 4LBZA 1FX0A 3WYFA 4Q1DA 5C46F 2OO7A 1QHNA 5IT5A 3SHFA 4PZLA 4RZ2A 2JIZD 1KY3A 2C96A 4ZI3A 3KJHA 5FBWB 4BEJA 2X2EA 1M34E 3FDIA 1W4BA 1GDDA 2MMGA 5JHHB 4LJ5A 4OL0A 3I72A 5DIFA 4M1SA 1KI1A 1NF3A 1OIVA 5G40A 1F2UB 4FCWA 2IA5A 2OILA 5AJYA 1D2EA 3X1XA 4CW7A 5FR2A 2QPAA 1OW3B 3FHTA 2AD1A 4C0LA 4V0ME 5LDDC 3RS3A 3UPUA 2O8FB 2OAP1 1P62B 3CX6A 1H8HD 3K9HA 1DOAA 4A0HA 1UM8A 2R62A 5KDOA 1Z8FA 3ZLJA 5FOXA 1R6BX 3VHXA 1U0HC 2P0EA 2VTKA 5EUQB 1XCGB 4DLWA 2WTUA 1QHHB 5B57C 3ZZTA 3T5GA 5HTKA 1QVAA 3U4QA 2DY1A 4FIDA 1KO4A 2E87A 1E9FA 2AFHE 1ZCAA 2CJWB 1GL6A 2FSFA 2ZS8A 2QMHA 3KQLA 4MRRA 3C16C 1UBGA 4DLVA 5JS8A 3PUZA 3ZVMA 3DDCA 3DKPA 4OHYA 5D3MB 1OB2A 4LJAA 3UMFA 2J87A 1OE0A 1NVVR 4KYIB 1HE8B 4PXAA 2ZI6A 3LFUA 1NBMA 5JEEA 2Q9AA 1VG9B 4DCNA 5JSZB 4FXPA 5GVRA 2J0SA 4NZYA 3BH7A 4EPYA 2ZVPX 2HV8A 3QENA 2YKGA 2GBLA 1DPFA 4PHFA 1PLJA 4A2QA 4TMVA 2C8VA 2IS2A 4MUBA 2IHBA 1OH7A 3AKCA 3EXAA 3CH5A 4BFYA 1RE0A 1SXJC 5GJBA 4M9SA 1XCMA 3EA5A 4LYFA 1XPUA 1OFIA 3VMFA 5FL7D 2W2XA 2J7KA 4MA4A 3ETLA 4XVUA 1E9DA 1T4GA 4ASUD 3SJBA 5CLLA 3SJAA 2D3WA 4TL9A 1P9WA 3TSOA 3AF1A 4NDZA 4ZCIA 3CNOA 4B71A 4DCUA 3BWDD 4TT3D 1BYUA 4LJ8A 3ADKA 5LB4A 1T6NA 2FSIA 1SVSA 2ZRHA 2V3CC 2UZIR 3LQRA 2J9RA 1ZNYA 1HQCA 2W0MA 1ZVQA 3UMSA 3Q7PA 3LVQE 1YRBA 2ZRFA 1SXJD 3PUYA 1ZW6A 4PTLA 4FW9A 2JJ1D 4OBEA 3MGCA 1BS1A 3BRWD 2QSYA 4HEJA 3LW7A 1E2IA 2FGKA 4LJYA 4LSGA 1IJEA 3CRVA 3N2IA 1TF7A 1QHIA 2IWHA 3V00A 4JBXA 3H0KA 5KNBA 2VP0A 4F38A 4PHTA 2OHFA 1KJWA 2GZHA 5BN5A 3ONWA 4IDOA 4WBSA 1JPNA 4F4CA 3RLFA 3QBVA 4B3BA 3ZQJA 1ONBA 4LJ4A 1E99A 3ZD6A 2IS6A 2EW1A 1JPJA 3B13B 3CR8A 4QJ4A 1MOZA 4A1FA 2JLWA 1FUUA 3WYAA 1VYUA 2NG1A 2OFWA 2F3RA 1F2TB 2RGEA 1MH1A 3TGPA 3E70C 1NIJA 4TYYA 1ZD9A 3PITA 4NYJR 4HI0E 4OK6A 5GJCA 5EP1A 3NDBB 2QAGA 2XTMA 2AFIE 4IFBA 3RHFA 2A5JA 1W1WA 1XTJA 1JR3D 4CEJB 2NMVA 3AQ4A 4UNNA 4GL2A 5JI2E 4P0TA 4TTPA 1WXQA 4L8GA 4LC1A 5EE5B 2F6RA 3QPVA 2C98A 3S1AA 1DEKA 4Q03A 2FEOA 4TLCA 1EK0A 1EFCA 2H57A 1Z5ZA 5FUYA 3MJRA 1G5TA 2R6AA 1S1CA 2JJ2A 4E09A 5DI9A 2CCKA 2QL6A 2ZYUX 5J4YA 1NY5A 3AM1A 3BAFA 3DHWC 5JWHA 2GXSA 2PEZA 3BGWA 4Q7MB 5EE3A 1E2GA 1Z0AA 2D2FA 1NKTA 2FNAA 1WBDA 1AGPA 4GSYA 2F43A 1E0JA 2DWQA 4TMZA 4OQNA 1SULA 2B6HA 4F91B 2ZE6A 2WKPA 3L0OA 2O8BB 3BC1A 4PO1A 4V0LA 1FZQA 2VP2A 2J41A 1ZP6A 2ZROA 1GILA 4BFXA 2VHJA 2VYFA 3LO5A 1DG3A 4V0NA 4W5WA 3CZPA 4Q9JA 1RIFA 2C2HA 2IYSA 1IONA 5HE9A 1FTNA 4G01B 5G53C 1VYTA 3FFAA 1GUAA 4IOJA 4QJ5A 5H68A 1ZINA 1KGDA 4RD1A 4OHVA 4CEHB 3D6TB 3OIYA 2H92A 2QT1A 1N6IA 1Z83A 5L3RA 1YZTA 2AXPA 4IVRA 1UAAA 1QF9A 1IY0A 1C9KA 1I4DD 1Q1EA 3IKJA 1XEWX 1N6HA 1SGWA 4FMDB 2GBLC 4P4UA 4QNRA 3RS5A 3OAAD 2O5VA 4PPQA 4BZQA 5BYKA 1RJ9A 5KSOA 3U7GA 2H8KA 4RD3A 1IN7A 3NXSA 5JJIA 4L9WA 4C0KA 4QHYA 1QG4A 4BRUA 4JMPA 5AUNB 1W44A 2BV3A 3DL0A 3TVTA 3QQ5A 1QZXA 2JDIA 4JLKA 5CM9C 2Q3HA 4C7OA 2GCOA 1UDXA 1T3HA 2BJVA 5CK4A 5JWOA 3K9LA 5SZKB 2ZUDA 2G9NA 5DI3B 1K6MA 2OFOA 3C14C 3SNHA 1NBMD 2BIFA 4IOMA 3VR6A 1JALA 4F7WA 1OF1A 1WE2A 2IYTA 3IQWA 3U7HB 4JVSB 3ZZUA 2G0NA 1OYYA 1AS3A 1Q21A 4W5HA 3G5UA 2O0HA 2GESA 4AG6A 4EQ6A 4BECA 2WWFA 2JLRA 2GETA 3FMIA 3I8SA 2HF9A 2P6UA 4HLDA 4AYWA 1L8QA 1KI3A 2DWPA 3CIOA 4EUNA 4RY2A 2FWRA 3EC2A 4URYR 2J7PD 1GL9B 1TQ2A 4DDVA 3O8DA 4HB2A 2CNWA 3LD9A 3KJIA 1WBBA 4KITB 3A37A 2DHRA 3O47A 4NYMQ 2I3BA 3WMFA 1COWA 1A2KC 4QL3A 2GEVA 4DBLC 3QG1A 4A4DA 4N0EA 3QNUA 3K0EA 1ZM2A 5D3QA 1VDZA 4OKSA 2OZEA 5FUVA 4JL5A 4OK5A 4XWOA 4YMTA 4KFSA 1TEVA 2I1QA 2VPPA 4FI3C 4QBHA 1U8ZA 1W0KA 2CE2X 1KI6B 1O3YA 5CB6A 1RFLA 3GJ8A 1KOFA 2BM0A 2V9PA 4KXFB 3ADCA 4DUGA 2HT1A 4JLNA 2QTVB 3NBFA 2QAGC 3KKMA 2VL7A 1ZRHA 3Q72A 4A0RA 3WMEA 4EJSB 1QHHA 5DNYB 1Z6YA 1N6NA 3KL4A 1UBEA 4IVQA 4LJ6A 4MQBA 4JZKA 4OHXA 1XZQA 4N1AA 1Z0KA 1GNQA 3LLMA 4DCSA 1A82A 4GPTA 1IOZA 3GLIE 5LD2B 4HB4A 2CCGA 3U6KA 4U7DA 1E2DA 2VQSA 4RZXA 4Q4JB 3UANA 4ZV4A 2DFTA 4P4TA 3CF6R 4JVLA 2FFBA 4RKEA 3Q5DA 5FBVB 2ZRPA 5D3MA 4A8JC 2HYDA 2V1UA 2RGGA 4B3CA 4GNKA 3R8FA 2FH5B 1P2TA 4I4LA 4D0GA 1CLUA 3IIKA 4M53A 3KJGA 2WSSD 3EIEA 1UEIA 3CM0A 1HURA 1Z29A 3VKWA 5JSZA 1OXXK 4Z1MD 4Y0AA 1LW7A 1KY2A 2WPDA 4TTQA 3WNCA 3U7EB 3SYKA 3QKSA 4DIDA 5IRCD 2GKSA 1NLFA 4URVR 1YHNA 4A36A 5F9FA 2JJ2D 3GJ4A 1OXVA 1RYHA 3A8TA 4B74A 5C18A 3NC1C 2IUTA 1X1RA 2F1RA 1E9RA 1Z08A 2QP3A 4II7A 4D2IA 4M9XA 1S0UA 4Q4HB 4X8MA 5KUTA 3QF4B 1MO3A 2GF0A 2CEAA 2J45A 2MMCA 3MJHA 1NMYA 5JFGA 2FN4A 1E2QA 1ETUA 3CNNA 1E0AA 1KAOA 1NI3A 4B33A 4UNRA 1NN3A 3F3YA 2ZUCA 1KAGA 2ZE7A 1RRGA 3K0AB 4Q4LA 3C4JA 3K9GA 3BB1A 1ZIPA 2X2FA 4EPXA 4B6FA 5KHOC 2ZR7A 3NBZC 1D2MA 1TQ6A 4DLTA 1DELA 1ZM7A 4GT1A 2FFQA 1WRBA 3CPEA 4LHXA 4MKHA 1AIPA 4JLPA 4XIGS 2EWWA 2YC4C 4LWZA 1R10A 2VBCA 3AVWA 4ZKEA 5EJEA 1P9RA 3H1TA 4YC7A 1YZUA 2WJIA 4JVMA 1TEXA 4M9ZA 4Q48A 3L8ZA 4KU4A 1Z0DA 1AS2A 2CE7A 3NTUA 1N5LA 4ZI2A 2ZSFA 1J8MF 2D74A 2VSOA 4S35A 4V0OA 3E2IA 4PAQA 4YDHB 4KCGA 4KJZA 4DCVA 3X1DA 3T35A 3F0TA 1KO5A 4GMXA 3NBYC 1XNJA 3J81k 1HQYE 1F2TA 4XVQA 4DT1A 5A0FA 2JDID 1KKMA 4M1KA 3AVQA 5FTKA 4CF7A 2AR7A 4V03A 3TMKA 5JI3E 2IUUA 2GHIA 3CRMA 4CT5A 1BKDR 4TYQA 4J0QA 1YU9A 2PX0A 4CEJA 3HU2A 1TTTA 1P75A 2OAQ1 1JEDA 2QGZA 4DWJA 2H16A 3GEIA 4X8OA 1DG1G 5K8UA 3UATA 4LHVA 2FFHA 5L8VA 3GLFB 1ZJ6A 4GZLA 3PR1A 1II0A 4LPSA 2D7CA 2FPMA 2RKOA 4DLRA 1V5WA 1YR8A 2H5EA 2ASEA 2UKDA 3NWJA 2B92A 3A58B 4PPFA 5C1BA 3VKGA 3EZFA 3W5JA 1MRNA 2CNWD 4A2WA 1EFTA 3K0FB 4LBVA 5K8TA 1PLKA 2X19A 3MAAC 1G7TA 4BWYA 1VIYA 2O8BA 3MLEA 3SYLA 2KBFA 4Q7KA 2WOJA 2ZJ8A 3QBTA 4P33A 5E3HA 5JWRA 4F4JA 1ZD8A 4R71A 4PQFA 1KKLA 3KZ1E 4M1OA 2QP4A 3KFVA 4MDFA 3N70A 5AJWA 2ZR9A 1JAHA 1VG1A 2VHCA 2Z6VA 4DLUA 3TQFA 3UKDA 2ERXA 1W0KD 2QT0A 3SS8A 4M1YA 4TYPA 4URXR 4CEHA 1TX4B 2QGNA 4C0BA 5UKDA 3VNVA 3AV0B 1LTQA 1NJFA 3MG9A 5KDDA 2W83A 2ZU6A 4U02A 1R0XA 4ITRC 4AC9A 5KU1A 3A1UA 4OQLA 1Z0JA 1QHSA 4O2RA 1II8B 3HYTA 4GMDA 4PAOA 4RFVA 1SQ5A 1P72A 4JJKA 1G16A 3T1QA 1YVDA 3U2QA 1GKUB 4EPVA 2FU5C 4IRUB 2EFHB 1XEXB 2GAAA 2XB4A 4PC3A 3I62A 3NG1A 2ZRDA 3QKTA 1XD2A 4GOJA 2C9CA 2IYXA 4LRWA 4AG5A 3GD7A 4ZPXA 3SBDA 3LAWA 2BBWA 2CL0X 2WKQA 4LDJA 5FTNA 2QEQA 1LB1B 3LW8A 3A6PC 2IC5A 2OBMA 3A4MA 3P4XA 1JR3E 4PC2A 5DI3A 4PZYA 1NG1A 4YXWA 3ZJYA 2CMKA 5DSZA 4XSHA 1Z6XA 1ZCBA 3LBIA 4NCHA 2YVUA 2RMKA 4MGZR 2WWGA 1A1VA 2LWIA 3BB3A 3NKVA 5J4LA 1AK2A 2Q0HA 1NSFA 4S2EA 3K09C 3TJZA 3RRNA 3HPQA 1KK2A 1SVOA 4V0KA 2H7VA 2J0QA 4ZKDA 1CF4A 4LY6A 3PUXA 3R9WA 1G5PA 1EWRA 1J2JA 2WMOB 3IGFA 2IS4A 4NKRA 5LBIA 3T61A 4WZBE 1EFRA 3E1SA 2ORWA 2VHQA 1AN0A 4G5RA 1OXSC 3DMDA 2CK3A 3QXSA 1DS6A 1GP2A 2ODWA 3QG5A 3VU9B 821PA 3VR5A 2DFLA 3P26A 2GNOA 4JKIA 4DDUA 1E6CA 4LYJA 3TW4A 4PSKA 2O8CB 4O25A 2QENA 1ZM4A 3X1ZA 3QIAA 4TL8A 3EC1A 2X77A 4BLSA 4HUTA 5K8IA 1YZNA 4B76A 1CJMA 1P3JA 2ZI7A 1X86B 2QRNA 1KI6A 3GLHA 1KNQA 3UK6A 1JEEA 4ZIRB 2GA8A 2G77B 3HWSA 4QHSA 5KPJA 1KHTA 5JJLA 1VG0B 1JXMA 2BBSA 4EJSA 1CTQA 4GP6A 3AVTA 3QXCA 3W6OA 3K70B 2OBNA 2OSBA 2YOGA 4TQ9A 4Q01A 1ESNA 2IYYA 1FUKA 4KLNA 5FOTA 4LUCA 5EXXA 5CB8A 1JAIA 4QHTA 3M6AA 3IILA 5E7IA 3PQCA 4O0MA 2J0VA 1FMJA 4URWR 3FKSA 4XD7A 5IHPA 1GG2A 3I1FA 4Q4JA 2GWHA 3TAHA 1KIMA 2QRZA 4XTCS 5EQTA 5EZ6B 4R98A 5JBQA 2DBYA 2FSHA 2RCNA 3KUDA 4CVNA 1G9XA 3NBXX 2D2EA 4FWTA 2X1VA 1IN5A 1R5NA 2DCUA 4X8LA 4BUJA 2PMDA 2W58A 3WMGA 4C0AC 1J7KA 3H84A 4EFNA 2FF7A 1Z6TA 5G3ZA 4DKXA 4MITA 1KYIA 2Q6TA 1U0JA 3ZVNA 3AVXA 2CLCX 1XJCA 1OXUA 2YZ2A 1Q12A 5BN4A 5EP4A 1T3LA 5JRJA 4Q4HA 3EZ9A 3K0CA 3QF4A 1MT0A 5GJWC 5SZIA 121PA 5TVKA 1BO6A 3I5XA 1TF2A 4PFSA 4F4IA 2GJ8A 4ESVA 1JQJC 3LX5A 4CDGA 3QOFA 2FV8A 1VCNA 3BERA 1KK1A 4AYXA 2REXB 4IW3B 3W8NA 4DXAA 3GJ7A 3K0AA 4M1MA 4YLGA 3RC3A 3HP1A 3VR2A 4MH0R 5DH9A 2ZSBA 5JZVA 3LV8A 4O2LA 3WP0A 1CP2A 2JAQA 3RDPA 5F9HA 3TW8B 5FPTA 2P5TB 2K5UA 2V55B 1E9CA 4BLRA 3PEVA 4NCNA 1DO2A 4GFDA 5EE9A 1G4UR 3AGPA 3RANA 3DM5A 2FFAA 3FGNA 1AM4D 3N2EA 2JLXA 4TZ6A 1KJZA 2GAOA 5H8WA 2V7QD 2FMXA 4DDWA 2I1VB 4PPNA 3UG6A 3ZH9B 1HTWA 1X8LA 3DZDA 1B23P 2X8AA 1L7VC 1W5TA 3PEWA 5G3YA 4NHOA 3OIUA 5A5GA 1YR7A 3U3RA 3GJXC 4G5SA 1JNYA 4A6XA 4OI4A 2ZJYA 4HZUB 5KNDA 1UBCA 1XDBA 3PG5A 1MKYA 5BQ5A 3ZQ6A 3R9XA 3B60A 1U2RA 1E3MA 1VECA 2EU8A 2OCYC 2RGAA 4YXWD 1NNEA 1FL9A 3SJZA 3SE0A 3C15C 4AKGA 4ERNA 5TB5A 1DAHA 1GRRA 3GEHA 2OM2A 2Z5FA 4BFSA 3GLFA 3LXXA 1LVGA 1U98A 4EDHA 4UQOA 4MDEA 3REGA 1GKIA 3FYHA 5KDLA 3CF0A 4UXHA 3I73A 4QOSA 1NJGA 3FVQA 3L43A 4DZZA 2D62A 2FSGA 4G3XA 4EJSC 1EGAA 2GCNA 3EA0A 1E1QA 4D4LA 1EFRD 1XRJA 1G8YA 2AK2A 4B44A 4BGDA 3K0FA 5E95A 3A1WA 4XOIA 4HUQB 4C3ZA 2CK3D 4LC0A 5CDFE 4Q9IA 2DR3A 1G3MA 3LXRA 1NG9A 2YC2C 4M22A 5KSPA 4A92A 421PA 5DHAA 1CBUA 1KSFX 3TH5A 5LD2C 2VF8A 2ZSDA 2R6CA 5C4GB 3H86A 3HDTA 1GITA 5FOSA 3AGQA 2Z83A 2YWFA 1DARA 3C7KA 3I8XA 4HDOB 4WVFA 5J40A 2XXAA 2V54A 1OV4A 4Q4AA 2PEYA 2ECKA 4X8HA 1ZUNB 1SVMA 1BMFD 3AF3A 3GJ3A 2HUPA 1AKEA 1M8PA 2RH5A 2OXRA 4LCBA 1XF9A 3BBPA 2ZE8A 3IDQA 1NN0A 3DM9B 4PQYA 3TLXA 3QEJA 1DO0A 1KK3A 2N46A 3T15A 4E5UA 3PEUA 1CS4C 2P6NA 4NONA 4UNSA 5CYOA 5JMTA 1EESA 2QQ0A 4WAUA 1A7JA 1II8A 4P31A 4F92B 4GBMA 4A0FA 4I81A 1W36B 5IK2A 2A30A 1N5IA 1FFHA 4V0MA 1XJQA 2IF2A 3D7MA 4E07A 1XEXA 2R9VA 4B43A 2IT1A 4I1OA 4Q66C 1NRJB 3CBQA 2A2ZA 2O0KA 2VIIA 4Z8YA 4HAWA 3K0CC 1I4TD 2IWRA 2CLSA 3VQTA 4WW0A 3UXMA 3H4MA 4MYHA 2N42A 2Z43A 1HT2E 4JVNA 4K8OA 1SVKA 3M0EA 4TSFA 3T1TA 3EX7C 1II9A 3GLIB 3JVUA 3REFA 1TADA 3JZAA 3GPLA 4MRSA 1ODFA 4KYUA 4RD4A 3RSOA 1OHHD 5E7JA 4PO9A 4HAXA 2ONKA 3TR5A 2QORA 1HT1E 3A4LA 3KX2A 2PJRA 3EW9A 2G88A 1N6RA 1CR1A 1JECA 3MFYA 5TXGA 2JEOA 3BFXA 2OCPA 2TMKA 2QPOA 721PA 3GLGE 4A8JA 5AJVB 2WIAA 1KK0A 5KOYA 5CM8B 4LV5B 1H8EA 1R7RA 3BOSA 3I32A 5JLJA 3THYB 1US8B 2F55A 1KI8A 2EWVA 4ZDWA 4AD8A 3VTKA 4KFTA 3CONA 2FZ4A 2ZANA 4JL6A 3CKLA 3WXMA 3VU9A 4B2LA 3AVOA 3OZXA 2ZR0A 5JRZA 3X1YA 3Q85A 1KJYA 5SZJA 4PQRA 1XMIA 2OCBA 1JXOA 1K5GA 1Z0IA 1Z2CA 3WP1B 4IOLA 3THWB 3MRSA 3EG5A 5M04A 1XTIA 2OT3B 3H2YA 3DVLA 2IK8A 1I2MA 1ZU5A 3W5IA 2QTFA 1W4AA 5BXQC 3CW2A 1VCIA 1L4UA 2YHSA 2KE5A 5FFMA 2ZSAA 5CJPA 5DO9A 1YZKA 4GI7A 5AUOB 4BLTA 1ZM9A 5DYIA 2HEIA 2WBLC 2NQ2C 3GFTA 5GJVC 4TL7A 2IEZA 4FMDF 4PO8A 1D9XA 4B47A 2QP9X 3FHCB 3RNLA 2QUZA 3L2OB 2FJUA 2J1LA 2ZYWX 3R7WB 2V8OA 3JVVA 4JT4A 4CEIB 4IOKA 1XMSA 2ZPTX 4KV9A 4QFMA 4TMKA 2FA9A 1N0UA 2GJAA 3KFXA 2QMOA 2ODBA 4LX0A 3HU3A 3FHOA 1RRFA 1WF3A 4MRPA 4PSVA 1VCOA 2Q3MA 2QM7A 3OEEA 4P3YA 3EZ7A 1RVDA 2KJQA 2ZYTX 4H1VA 2OBLA 3KKPA 2QN6A 3B5JA 1G8PA 2IW3A 3FFBA 3BORA 5K8LA 1G8FA 2VP9A 2ZI9A 5FOWA 4LJ7A 3Q3JB 2EFGA 1KZ7B 3RVBA 2DFKB 2PMKA 1IXSB 4M2LA 2WJVA 1DBSA 1I4LD 3BB4A 1OT3A 1C4OA 5E7MA 1Q1BA 2EYUA 3WHLA 1XEFA 2RHMA 1S4QA 1U9IC 1Z06A 4B2PA 1E1QD 3BXZA 4MYTA 2ODNA 3B85A 4JT2A 2ZTSA 1TUEA 1LF5A 4LV6A 1NP6A 2FDCA 2ZQ5A 1W2GA 5DGXA 1IBRA 3IUYA 2W00A 2JATA 4FCVA 3EWAA 3FKQA 4C9BA 2XZOA 2B8WA 4DSOA 1KDOA 4OQMA 4RFSB 5J5CA 2WJYA 1E96A 1W49A 1F2UA 2BMJA 1E2LA 2OFXA 5CLQA 4A2PA 4US0R 3B9QA 1HE1C 1TUIA 3QPWA 2LKDA 3NDPA 2BC9A 5LB2A 3B1VA 2IYWA 1ZAKA 2JASA 4LZZA 4MGKR 4EPWA 4CZ2A 2O8FA 4IVPA 2QNRA 1GAJA 4G5QA 4OK3A 4XVRA 3QXXA 4MGIR 2NIPA 1KSGA 4EPRA 1Q3HA 3L0SA 3SYNA 5CIQA 1N0WA 1TQDA 4TLEA 4PHGA 4D4JA 4DVGA 5JEDA 4D0NA 1EG7A 2ERYA 1WCV1 4JS0A 2CJWA 3LRPA 3ZGXA 5IK2D 3MUFA 3AUYA 3MWJA 2FGJA 4WXRA 4TL6A 1S9HA 4Q9KA 3KDSE 1E9AA 3CPJB 3QY0A 1UADA 521PA 5L3QB 3IEVA 1JBKA 3P20A 3L8YA 3RS0A 1YR9A 3LH5A 2GJKA 2F9MA 2FE4A 4HZUA 3WRXC 1G3RA 4ACAA 4CGZA 1CJKC 1ZYUA 1UBFA 2IBMA 4NE2A 4PC7A 2Z4SA 2PLFA 2O0JA 1U8YA 4EKDA 2BHRA 3CR7A 4TSFD 1G41A 2VA8A 1NLYA 2C03A 2O8DB 3OFNA 2AK3A 3NVAA 3THOA 1G4AE 3SQWA 3B1WA 4YMVA 3U6BA 1KI2A 5HR5A 5F3WB 4N0DA 4IDQA 2VH5R 1TPZA 3CH4B 5H70A 1S8FA 1FTSA 1LS6A 5FUWA 1T0JB 5FI1B 4DSTA 1DADA 3WBKA 4DC9A 3CWZA 2PT7A 2BEJA 1BIFA 1G18A 1E79A 1ZIOA 4H9GA 4JJZA 4B48A 2REBA 4IXMA 4XH9B 3OE7A 3TVDA 3W8RA 4ESHA 2IYUA 3TBKA 5AR1A 2PH1A 1H8ED 3P32A 3ZYCA 2BBTA 2RB4A 3FMOB 4NYMR 3TUIC 4D82A 3K70C 4BEBA 1QHXA 2A5YB 3K53A 4HUQA 3LNCA 3B2EA 2JLUA 4N3NA 5EUMA 1XTSA 1AQUA 2GXQA 2KI5A 1VHLA 2NO6A 1GWNA 2OXCA 3L0IB 2GEUA 4MYUA 2WIBA 5JS7A 2ZI3A 1Z07A 3K09A 3PFIA 1OFUX 1FNMA 1U0LA 4G5GA 4NYIQ 2D06A 4AURA 3GCGA 3QJYA 3U60B 2W2VA 2FG5A 2C78A 2ZJAA 3KXIA 2ORVA 5HCNA 3NH6A 4OQFA 3TKLA 3TK1A 2B8TA 3HYRA 3KQUA 3WRYC 1DTSA 1CU1A 1DVRA 1E2MA 2GZDA 3L0PA 1R0YA 3KXLA 2NOAA 4I1SA 2NO1A 4JKYA 2IUSA 4QNMA 2ZRMA 5SZHB 5JHGB 4A15A 4Q9HA 2A78A 2IXEA 3OIVA 2GTPA 1TF5A 2A3RA 2W6IA 4QC2A 4MKIA 4TMWA 5BN3A 2WJHA 1KI9A 4OJKA 2OEPA 3B8HA 1N25A 4W9MC 1G1MA 1YR6A 4NCKA 5A4JA 3I92A 1GFIA 2OLJA 1G7RA 2KBEA 1N6OA 1OLOA 5TMPA 5FUXA 1KMQA 1DAEA 2H1LA 2XNDA 2OCAA 3UMRA 1N5JA 1GZSA 3FB4A 2CL7X 1HV8A 4DJTA 5DISB 3O8CA 4JSTA 5EXTA 1N2CE 1FNNA 2JA1A 1JI0A 1JJ7A 3OEED 3A1SA 3VX4A 5EE0A 4DLZA 4JLVA 3GLIA 2AKYA 1XXHE 4GP7A 1AZSC 1NN1A 4QBFA 3ZVLA 3ASYA 5B64A 2C77A 3EPKA 2G3YA 4IKEA 4WOPA 4G1UC 2IYQA 5EXPA 3PUWA 2GEDA 4MRNA 1OFHA 1XFAA 2CVFA 2NO0A 3EZ6A 3W90A 3NC0C 5FPKA 2OUKA 3TQCA 2IYLD 4QBGB 4BASA 2J0UB 1XBTA 2ZRKA 2EFCB 4K46A 2WV9A 2ZJBA 3THYA 1COWD 3P4YA 4B32A 1OXTA 3B1YA 4QJ3A 3U44B 1R4AA 2ZITA 5FBLB 3TR0A 2H17A 3KTAB 3EZ2A 2JCSA 1IY1A 1CRQA 4YONB 2HCBA 2W6JA 2HLDA 1RZ3A 4HATA 5F2EA 1GIAA 2IX3A 1VPLA 221PA 3IBYA 3THWA 2O8EB 1SXJE 3LX8A 4Q18A 4PX9A 3VR4A 3QXHA 4NU0A 2YNMA 3TRFA 2ZRLA 2XOKA 3VHLB 4DUGD 1N0VC 1Z0FA 1PJRA 3KQNA 2A5GA 2QMEA 2Y8EA 5AK0A 3O8RA 1G64A 3CLVA 3A1TA 3CB4A 3SZRA 3IPXA 4AKHA 1EX6A 1EWQA 3BIFA 1W47A 4NTZA 2PZEA 1O87A 1WMSA 1DE0A 4D81A 5B58C 5FTLA 4MKFA 4OYHA 1RYFA 1W4CA 3QE0A 1J99A 1OJLA 3ICEA 4DDTA 4B3XA 4RD2A 4CEIA 3KKOA 5ELXA 1XTRA 1XJ0A 2C04A 5BW8A 2LKCA 4D0LB 3AH8A 4BLQA 2IL1A 1C1YA 3CX8A 4I1VA 3OF5A 2WPDD 1F60A 1VCMA 3SHWA 4HB0A 1KDRA 1SKYE 3BS4A 4RCYA 3SN6A 4QGAA 3NHAA 2Z4RA 1NMZA 1K8RA 3Q9LA 4HDQB 1S3GA 2VSXA 3T1OA 2QM8A 5J4HA 1IN4A 2QZ4A 2XSZA 1E79D 5KO2A 1ZD1A 3OE7D 1GRQA 4FCTA 1OIWA 4KSBA 3EWSA 1XP8A 2E9SA 1QVRA 4LHWA 2AN9A 4TMTA 4B75A 4DCTA 3UG7A 3AVVA 4P4SB 4Q7LA 2VSFA 3EIHA 4JSYA 3ZIAA 1KDTA 2Z0MA 3K9NA 1W36C 4IXNA 4RFSA 3V4FA 3BD9A 2VP6A 3RSLA 3IHWA 3SU8A 5CIWA 2NZJA 2BCJQ 2VEDA 4WIAA 2ZAOA 5ANRB 4D26A 1ANKA 3FOZA 3QPUA 3R20A 2ZETA 5KYKA 1N6KA 4F93B 3FWYA 1NL3A 1AQYA 1AGRA 1OB5A 2G1JA 1NKSA 3BFVA 1RC8A 4OI2A 2QMUA 3NEJA 1N6LA 1S2MA 4Z51A 2CCJA 4M1WA 1IXRC 1Z3IX 2EQBA 1D5CA 1BH2A 1HYQA 2WWIA 1W46A 3AVPA 2GILA 3FMPB 4OQXA 2XJ9A 4XSGA 5HE8A 4YMWA 2W6ID 1CJVC 1R5BA 3QUSA 3T06B 5AJXA 3T1VA 4ZDKA 2JJ1A 2W2TA 4OI1A 1R8QA 3C8UA 5JCPA 5L3QA 3ZVRA 4AY2A 3SEAA 2XNDD 4A0GA 3UIEA 1KDPA 2MSEB 3IO3A 2C5LA 4PC1A 1VTKA 6Q21A 1U90A 1NBME 2GVDC 2RGNA 3GP8A 2QQEA 3RABA 4FMCB 1RJ9B 3TUJC 4AWXA 1D2NA 4DB4A 1CR0A 4GZMA 4UNPA 2WJGA 2G83A 3W6PA 2O8DA 1NLZA 4B3GA 4M21A 1UPTA 4L9SA 3QVVA 4L15A 2FZLA 2HT6A 1P9NA 4JLDA 4JLBA 4ZO4A 4Z54A 5F98A 1EFHA 2IXGA 1KI4A 2ZU0C 5FH9A 4K81B 2VHTA 2XZLA 4CT4B 2G0TA 4Q1CA 4Q7JB 2P3SA 1LFDB 1G6HA 1RW4A 4Q1EA 4W5JA 2PBRA 1TNDA 2CDNA 3OEHA 1MRSA 1NVVQ 2ZYVX 2NO7A 2F1IA 1JR3A 3MWKA 3U3OA 4A6PA 5CYPA 1UJ2A 4Y0VA 4Q02A 3CO5A 1J70A 4R9UC 2RAPA 1ZM3A 4AYTA 1IM2A 1P7CA 1E1RA 5FPSA 4IJMA 3SR0A 3SDZA 5DHFA 4EQ6B 3THXB 5FTMA 2DWOA 4JBWA 1P2VA 1QG2A 1WQ1R 1W7AA 1R5OA 2HLDD 2OE2A 2ZUBA 1MABB 3HPRA 3ND8A 4G5OA 2ANBA 4C0HA 4DIEA 5B30A 5FBQB 2AXNA 2R65A 2A7QA 3T5DA 4RSGA 4BFVA 1E9SA 1XD9A 2J5XA 3GLGB 4ACBA 1R0ZA 2KWIA 2XOKD 1Q57A 3RS4A 1X3SA 4B35A 1UFQA 2HJVA 4US2R 2WZQA 2J59A 3B82A 2WAYA 3HR8A 1CRPA 2IF0A 1ELOA 1SVLA 1NVWQ 4PSAA 1CKEA 2V6JA 2QY9A 2CXXA 2Q9CA 3KKQA 2BM1A 1F48A 3W34A 3IBGA 4EFLA 1P2SA 3AEZA 4JBYA 4ZDIA 4MYCA 3RS7A 4CYMA 2C99A 4JYBA 2N1BA 1LS1A 2C9YA 4B34A 1K5DA 1M1YE 4RJLA 2GXAA 5FR1A 2R8RA 5FOUA 4D80A 1KSJA 3GQBA 1ZMXA 2JLSA 4KHZA 1KO7A 1ZUHA 2O52A 4QG7A 2CBZA 2IXFA 3RAPR 1P2UA 2QE7A 1QDEA 3WYGA 1QBKC 1Q1QA 1H65A 3OAAA 2WVJA 1CJTC 3ZS9A 4GOXA 2B7BA 2HF8A 3CPHA 5KPDA 1L4YA 3ZS8A 1KMHB 1FQJA 4JL8A 2IS1A 2FX3A 2SHKA 3DOEA 4Q1BA 2ZVQX 3FMFA 4IFEA 3MWLA 3WY9A 2ZJZA 1M7BA 3K0SA 1XEWY 4NYJQ 4JYCA 2P65A 2R2AA 2XSZD 4C0QC 1N3BA 4QGHA 3SJCA 4C0JA 4LGMA 1YE8A 5L3SB 2J0UA 4B3DA 3QKSB 4YMUA 1E4VA 2Q3FA 4GDFA 1MO6A 3HR7A 4AK9A 4KBFA 3U44A 2NZ8A 2ZRAA 1FOEB 4RD0A 4FD2A 3ZIAD 3VNUA 3KTAA 3RRMA 3LQQA 1P5ZB 2ZEJA 3TSZA 4NPHA 3MSXA 1Q1ZA 2QI9C 2HJGA 1N6PA 4TLAA 3R8CA 1XTQA 5FPHA 4RZ3A 1YZGA 4BQSA 2EFDB 2O8EA 4KFUA 1G21E 5TV2A 2J7PA 5DN6A 5C4MA 1TMKA 1UKEA 2UVQA 3PCRB 4M9QA 1OH5A 1T5LA 4M4SA 2RGNC 1E2JA 1Z63A 3AVUA 3ND9A 1R8SA 2GJSA 3QKRB 1U9IA 1TQ4A 2ZI5A 3AKEA 4M1TA 1Z47A 2XAUA 4OI0A 5TDHA 3SC3A 1XZPA 2OV2A 5JCZA 1E2PA 2D4HA 4LYAA 4QBIA 2ZJ2A 1YQTA 4Q00A 4FINA 1Y3AA 4IDPA 4HAYA 4W7SA 2WJJA 4AIIA 1YRAA 3MD0A 3GJ0A 2IEYA 2WMNB 2XB2A 3IHLA 2UZ3A 3M4YA 3FKSD 3O8BA 1E9EA 1ZUIA 2AHOA 4XD7D 4AKIA 3QKUA 4UJ5A 3LDAA 1E0KA 1Y63A 1JB1A 2BVNA 1FQKA 5HKKA 1L2TA 2WHXA 4HZIA 1W48A 1E2EA 2BKEA 4YMSA 2P2LA 1CULC 1F6BA 4JLOA 4ZCLA 1MR3F 1YZQA 1N5KA 1GSIA 2ZJ5A 3LA6A 3KB1A 3LBHA 3QEOA 4ARZB 2JLQA 3PENA 1FW6A 1S9DA 2PJZA 3KQKA 4HLUC 1F5NA 4TLBA 1IHUA 4DT1B 4A82A 2REOA 4FWIB 2AWOA 2DPXA 1ZBDA 2ZI4A 4DLXA 1IJFA 2KB0A 3W9YA 4BLOA 4G0NA 2F3TA 2WOOA 3OEHD 3B9PA 2WSSA 3BH0A 4EAQA 3AF4A 3CUEF 3T34A 3TNFA 3QSYA 1LNZA 3B7GA 4HAZA 1G7SA 1PLLA 2OESA 1XTKA 4JLAA 5FL3A 4Z1MA 1WB9A 3ECCA 3QXJA 2ZS7A 2JLVA 1W2HA 5B2ZA 2HXSA 4TLDA 1E1RD 3R9IA 3GFOA 1KNXA 4P4SA 1D9ZA 2F1HA 4NMMA 4BFUA 2YYZA 1Q44A 4UJ3A 3I4LA 2O8CA 3HJNA 3BJIC 4BZPA 2BJWA 1WDTA 4H1UA 1KO1A 1P73A 3G82C 2BMDA 2CLDX 3LWNA 4ZIRA 1XD8A 2YINC 4FN5A 4LV8B 1J8YF 1GOTA 3KQHA 2ORIA 1AS0A 2PZGA 2OG2A 4MKGA 1EXMA 4B73A 4KVGA 2P6RA 1V43A 1P60A 4D6PA 3GEEA 3MCAA 4TN1A 5J4VA 5CDFA 2ODEA 4BRWA 1X8KA 3B1XA 1NVUQ 2GJ9A 1QHGA 3D3QA 4IEIA 5E4FA 1SVIA 2RGBA 4BFWA 4HYYA 1Q20A 2GXUA 2V4ZA 3N5CA 4A9AA 1T3SA 3RYTC 3FTQA 3IEUA 1BYIA 2R6DA 1W4RA 1ZC3A 4KFRA 3ZZ0A 2YWHA 3KJEA 3ZDQA 1JR6A 3A4NA 2AKAB 1VYVA 4KAXA 3CNLA 4XJXA 4RKFA 1OH6A 1NSTA 1X8JA 2B7CA 3I61A 3AP2A 3EIQA 4PR0A 2QE7D 1HY3A 2XZPA 2ONJA 5BWMA 8OHMA 2ZXUA 4TQUS 3AVYA 3C5CA 2VF7A 4QRHA 2ZM5A 2QG6A 3WNBA 3UWKA 2F7SA 1QHYA 1G6OA 1GNRA 1YJ5A 2QTHA 1UEJA 2PL3A 2WAXA 1XD2B 4LHZA 3VFDA 3A1VA 2LCFA 2GK6A 2FOLA 1X6VA 4LBWA 3CRRA 3TSWA 4B6EA 2BKUA 1U94A 2PLRA 4TYWA 1UF9A 2HXYA 2WWWA 4YDSA 4ZCMA 3T12A 3ASZA 1OKKA 2CVHA 1T9HA 2OLKA 4KO8A 1E32A 3EAQA 3HU1A 3WHKA 4Q47A 5CK5A 1CR2A 1XXHB 3F8TA 3E5HA 4M8NE 3RWMB 1AJEA 1F3OA 1FP7A 3AKDA 4KODA 3LY5A 4PHHA 3THXA 5AUQA 2VLIA 1ZNZA 2VHUA 3IPYA 1GM5A 1DAGA 3KKNA 1E2FA 1MABA 4TZ0A 3F5FA 1PUIA 4EPTA 3GMTA 2XGJA 2DB3A 5DN6D 3GLGA 3CRW1 4D4KA 4C2TA 1IY2A 2BCGY 4I99A 3CRQA 2EVWX 5J47A 2QBYB 1XU4A 1TL7C 2YWGA 3I3SR 5TARA 3W6NA 4DEXA 4TYNA 3EPJA 1RRCA 5GVSA 5HZKA 5FPYA 3DMNA 3PEYA 2WKRA 2ZJOA 3GFPA 1T5IA 3AB3A 2GCPA 5P21A 3LLUA 1IN6A 2G6BA 1OIXA 4HLQB 4LI0A 3EPLA 3NHBA 4QXAA 4LJ9A 2FPLA 1G5RA 4U00A 3OIWA 3KUCA
chains in the Genus database with same CATH superfamily
2IYZA 2BFBB 4LPKA 2AT1A 1FYXA 3TOVA 1ZNQO 2GBIA 2O2JA 2YWDA 2FW9A 1PUJA 2WWHA 3E5MA 4NEHB 5BY2A 1AKYA 1R4NA 2IGTA 4JNCA 5ISMA 4KWCA 1ZOOA 2IYRA 2ZWVA 3FPAA 4WBNF 6PFKA 2DR0A 4ZEXA 1MFZA 3O2NA 4DCPA 4URZR 1EFDN 2RIRA 2PZKA 4L5AA 1KSHA 1L5YA 3ANTA 1J90A 1AZTA 4XX0A 4ND6A 1RYDA 3IUEA 3N7AA 3BIWA 4G9GA 1KZGB 2ZTUA 4K9QA 4NP6A 4MUFA 2XGMA 4YJGA 2VF4X 5DMXA 2Q5CA 3LBNA 3ROXA 4OYYA 3SD7A 1E98A 2WKSA 3JASA 5AVTA 5D51S 3USES 1EDDA 1QH8B 3GPCA 4PLFA 4JEHA 4CIYA 1ZC4A 2AJBA 2W2LA 5JADA 1HUQA 1FDTA 3C45A 1RRKA 2DT8A 3CPSA 3N2GA 2XEXA 1TGYA 1CR4A 4FOLA 2IY9A 4UDNA 5DBFA 3PQDA 5L95A 1WZCA 4BO5A 1M7HA 2PCLA 1RWXA 3GRYA 4OH7A 1E9BA 3HI4A 3KT6A 1J8QA 2R00A 2BOVA 4M0LA 3WIDA 1JVSA 1W6RA 1LFAA 4JBLA 4G25A 2VHXA 1JG2A 1PW7A 5DFAA 4YIKA 5TEVA 3IALA 3VVBA 3ZTYA 3V9PA 5EFOA 3SQDA 1Z39A 4UPEA 1FPMA 4IEEA 3STYA 2EFEB 3CH6A 1C9YA 1CJUC 1FVHA 1QGAA 1SKYB 4WZAE 1I7PA 3PI7A 2VP4A 2DBQA 1WUTA 3BGIA 3U7FB 1Z22A 2YWEA 4D97A 1L4HA 1Z0UA 1RBQA 2ZUVA 4G65A 2XWQA 3NHJA 2RHDA 4JLMA 5EJ8A 1ZCZA 4MWBA 5IVKA 5I3ZA 4BPBA 2KYRA 3GJQA 3LT1A 1BQ4A 1DU4A 2XUHA 4R7ZA 1KMNA 1H2XA 1I1QB 3S7ZA 4RVCA 3B1FA 1JSXA 2ORED 2I2XB 4RE6A 3PUVA 4XTRA 3H1FA 1BNCA 4AY6A 3K70D 2YJGA 3O9MA 3NJRA 1RQNA 2AA3A 3O8QB 5EGSA 4NL4H 1RZUA 3ZWKA 4TTRA 1YVEI 3N2KB 2HCFA 4M3NA 4QKQA 4WZ6A 6ADHA 4OHWA 3JQ9C 1BFUA 2DH5A 2XTZA 3EPHA 2ONZA 3ESDA 2JH3A 4AWAA 4BGEA 4QM7A 3NH9A 5ALRA 1I5EA 5AK3A 4P7GA 2WM9B 1A2BA 3VTAA 3UV7A 3GDFA 3PDIA 2OB2A 2ECOA 2PD6A 4XM0A 5EJ6A 2AX4A 4YMIA 3FOBA 1FYVA 1WL8A 1IPEA 3F6YA 1K4KA 3O7MA 1S2DA 2C7GA 3WLTA 2R0QC 4O2BF 3TNLA 2GRJA 1S2GA 1T9GR 4R05A 5J1TB 3SFZA 1E58A 1U0RA 2CLOB 1XV5A 2B21A 3N58A 1M6YA 1XZJA 1YFZA 1NIPA 3A2NA 4ZQGA 5K0TA 3D31A 3WLLA 2G6TA 4NCJA 4BV2A 3UCEA 2FUKA 4HXYA 4ZT7A 1M74A 1QLHA 4JFRA 4RDXA 1CEYA 3M5WA 5KYXA 4U8GA 3DLAA 1WOMA 2ZS9A 2CFCA 3MXOA 5JE8A 3GG2A 2R6ZA 3F9RA 5H1YA 1FMFA 3RC8A 3V4VB 5BVHA 2ZSKA 1GL7A 1IBLB 4WLOA 3C7CB 2QVCA 1DXYA 2A9VA 2A88A 2J3KA 2GPBA 4HEA1 2PHZA 4HNSA 4JUBA 3P0EA 3SLGA 2BP7B 3ZD9A 1ZMRA 4V1CB 2GF9A 4YP0A 2XNKA 3CTMA 1OKKD 2H00A 2P7IA 2Q5EA 4OLJA 5DBOA 1PVDA 2CLKB 1C3OA 1W0JA 2C9MA 1GZUA 3C41J 4JEIA 2X8JA 5GMOA 3PXGA 1NJ2A 3DDOA 3II6X 3SDBA 3VSCA 1UIRA 5CVDA 3W3AA 4MW1A 1H22A 1JQKA 1UZMA 1IRIA 1NUAA 1GQYA 4V1CI 4HDNA 1E1CA 2OCLA 4KRGA 3W5DA 1WTAA 2BMEA 1P0QA 2J9FA 3CJRA 4O4JA 4WCVA 3V4ZA 4YTEA 4MI9A 3KVYA 2ET6A 4D0RA 3M4JA 4RGYA 4EG4A 3GCDA 2OAEA 3SPXA 1CUSA 5FPPA 3M1IA 1IEVA 2RG1A 1PNVA 1XMJA 1TVMA 2ABWA 1SR8A 1ZIDA 4KN5A 1WA5A 4LQCA 1POXA 1YXMA 1WO8A 4DW8A 3WBJA 1K3UB 2YRWA 2H2AA 3HFSA 1GPNA 1XN1A 1XX6A 3A31A 3B1JA 4PZZA 3WQBA 1E7YA 3AY6A 1QFJA 2VDLB 4TWBA 4WCFA 3T95A 2H0RA 2R5FA 2YOFA 4CLDA 4KAAA 2J6BA 5A9RA 1XZDA 3C3PA 4RHTA 4CLOB 1IQUA 1P5RA 2EQAA 2I78A 3K6JA 4L16A 5EXSA 3PQ5A 3P1JA 4Y2XA 4N12A 4JGGA 1FFAA 1NXQA 1Q0UA 2B4TO 2OV8A 1N8TA 2XKAA 4YROA 5C3MA 1Z4PX 1D03A 1L8LA 1TJYA 4GPIB 3R7WA 2PT5A 2ZJ6A 3JQ6A 5F2NA 5LQUA 3A1FA 5KNCD 4GRAA 3LPCA 5DDIP 4C07A 4Z5XA 2V7QA 2ZE5A 3KEQA 3U5ZB 4P53A 5HSGA 5BR1A 2OD2A 2FN3A 5ENZA 1NVXQ 2PJUA 3RB8A 1LRLA 1IMOA 2NUPB 1SKQA 4I9NA 5HZMA 2GN4A 1MVLA 2JCXA 1NQTA 1VOTA 2G80A 3MTJA 4W5TA 5EP2A 4E5PA 1PWZA 3AB7A 4DCGA 2PIDA 2EKLA 3C2QA 3C8ZA 4MINA 3D6MA 1S3SA 4R1TA 5D1HA 4TZKA 3VJMA 4B8ZA 4BNLA 4EUFA 4KRXA 4HDSB 5HCIA 5A9SB 4OX9Y 4F6RB 5I7HA 3QVGA 6CHYA 2BR5A 4PLWA 4LHYA 4NMLA 5LZ7A 4UD2A 4ALKA 3S4YA 3UHAA 4UVEA 1M1NB 3FDXA 2Y92A 4QYMA 2D0PB 3EARA 3LJKA 1ODTC 4RIGA 4CKWB 4YQFA 3D3EA 3IVMA 4D4MA 4CMCA 1LQ2A 2E4XA 2B5OA 2ZWPA 3MWYW 4CKYA 4Z1MA 1IVSA 5I3CA 4PLYA 1TM3E 3K1AB 4GNRA 1KR2A 4NJEB 4D25A 1ECGA 1ZK3A 2EZUA 3TKAA 1JYFA 3BN3A 3NT2A 4L4YA 1QQ7A 1VBMA 1W52X 1BXRB 1NY6A 3SR4A 4E03A 5KSYA 3I0MA 1YK0A 1PFYA 2GDJA 5G41A 4NCAA 2E6UX 2PRYA 4BVGA 2YDXA 4RGQA 3VR1A 2J4DA 2JLZA 4IWNA 2AOUA 1X7WA 4PIVA 2F43B 1A9XB 1OJ7A 3I1JA 2AYXA 4MKXA 2BWJA 3HADA 2HK9A 2NNWB 3WC4A 1U2PA 2OTCA 3IXMA 3ROFA 1RMTA 2HF2A 3PIRA 4B8WA 2GD6A 4GRIA 3G79A 5C35A 4P4NA 4EDFA 4PLVA 3GFQA 3IUSA 2IHYA 4X61A 4ARBA 3OURA 4P58A 4CLXA 5K0GA 1XKTA 4V02A 4BJ1A 3TEJA 1VP3A 5L4SA 1ISRA 2DPHA 2DU8A 1VP9A 2Q9BA 1W19A 3RYIB 3DDHA 1ZH6A 2VPIA 2P3LA 4TQAA 3BK7A 4TSRA 4ON9A 2ODTX 2ZRGA 4YP7A 4AROA 3KYCA 3PJRA 5EWLA 3PQ7A 1G291 4YWHA 1QIDA 1NM5A 2YX1A 3RRFA 1BMFA 2QU8A 1EUDA 1LY1A 1M6EX 2H63A 2I6GA 2WG1A 1FJHA 3BRWA 1T1IA 3KXKA 4KI0A 1USUA 1W9MA 2GARA 3T52A 1YOBA 3EFEA 5DLQC 1JMYA 1SMKA 4CKCA 4RZUA 4Z86A 1JP7A 4DM7A 4LZOA 2PVSA 1KFJB 1Z2AA 2I4RA 2VBFA 1ZO8A 1VKHA 1RQLA 3KLMX 3OWOA 5AUPB 1N32B 3EOAI 4G41A 4OJQA 1SG9A 3DCNA 3UAOA 2WDPA 4PPGA 1V1JA 5L3VA 1KR5A 4AVYA 2X0JA 2OB1A 4CE6A 2RGRA 3OQMA 5E8JA 5KC8A 4Q6BA 2BF4A 3HKEB 1UKYA 3G2IA 1D8TA 3KB2A 3MJDA 1NVKA 2VJKA 3NIBA 2FJPA 3FRIA 1TTPB 3OBBA 4D8YA 1XA3A 4PGGA 5HG0A 4AO7A 4RK4A 2F9LA 2M6SA 4M36A 5JDIA 2QSZA 2WSYB 1NMQA 3E4CA 5J2UB 1HYGA 4H35A 3ADDA 5AWFC 1RWVA 5JVDF 1UINA 3THSA 5KTNA 1ECCA 5DLPA 2C3OA 1XZHA 2ESRA 4X1KA 2GA9A 4KO3S 4BLPA 1X1SA 2V7GA 3OCJA 1T6YA 4CM6A 4ND3A 4UVHA 1U2GC 1SXQA 1OHHA 2ZSJA 2ZRIA 3GYGA 2J3DA 3CSDA 1SEVA 3HXTA 3JQPA 5ECWA 3D4BA 2AMYA 4G23A 3G8YA 2FPGB 3OZGA 5JECA 3WO0A 1JR2A 2CMGA 2Z3WA 3X1WA 4C05A 3WGKA 4MDHA 2QA5A 5EE1A 4LBZA 3JQAB 1QHNA 3L18A 3B7WA 1ZCJA 1V5FA 4HADA 1PJ3A 4OM8A 4XIFA 4Y6PA 5IT0A 4PZLA 1U2TA 3F6SA 4LMBA 4WFJA 4DV1B 3QV1A 2C96A 4BJ6A 3DOUA 3ERCA 4BEJA 2X2EA 3FPHA 1M34E 3FDIA 2Q27A 3HJTA 3LTEA 1W4BA 1GDDA 2MMGA 2Z5VA 4LJ5A 1ISSA 1ACJA 1W73A 3I72A 2R8XA 1Z0ZA 2DECA 16PKA 2AI3A 1PRYA 4EMSA 1KI1A 1OIVA 5HMMA 5IBRA 3QWIA 4E3WA 5KYTA 3NEPX 2PGOA 1F2UB 2YBDA 2ZWMA 1H1LB 4FCWA 5ALLA 5G40A 4CW7A 1DZIA 3ECSA 5I7SA 5D1NA 2CDCA 4Y2RA 2BGJA 5DBGA 1HSZA 1QJ4A 5AXCA 5THXA 3HRHA 4C0LA 3ZY6A 1CIVA 1LA2A 2YCBA 4LYGA 1SH7A 2NU7B 4OYRA 3SC4A 3CU5A 3ZU5A 2R62A 1Z8FA 1XZMA 1T4CA 4XKJA 1ECLA 1FDWA 2VTKA 2AKEA 1N4DA 1LNSA 1SZDA 2G4CA 3GBSA 2V5AA 4WE3A 3U1TA 3VM6A 3ZZTA 4AJJA 3VHRA 3NHZA 2XT6A 4LKOA 4R8KA 3W77A 1QVAA 3WK8A 3D1JA 1BX0A 2XYQA 3H1GA 2WLSA 3SBXA 1KO4A 1E9FA 1P6QA 1ZCAA 2X9NA 2QLTA 3AQIA 1I4EB 2BN4A 3M6LA 4Z0NA 4C78A 2ZS8A 3EYAA 4CCSA 3FCCA 4DIMA 3ZJUA 5GV8A 1AB5A 1RYEA 3GDGA 4DLVA 3STUA 3PUZA 5JNWA 2JGEA 4G9BA 3BD6A 3WK7A 2I8LA 3WLOA 5LOVF 2WU3A 4I3HA 5I4IA 1EB9A 3UMFA 2DUMA 1JZSA 4B6RA 4HDAA 1MB0A 1NVVR 4KYIB 1V4VA 1HE8B 3CT6A 3MCWA 4FU0A 4KQKA 1LLDA 4LNHA 4R69A 4CDMA 3HKCB 5CDGA 2Q9AA 4NX2A 2MTBA 4DCNA 4FXPA 4E5DA 5JSZB 2J0SA 2C8LA 2JRLA 4NNJA 1Y9AA 5CLHA 2GZ1A 2QN9A 5JS6A 4ZANA 2HGZA 1PLJA 4TMVA 3KR2A 3BIXA 4MJXA 1U7XA 2VKTA 3OJLA 2QYOA 2YV2A 1F1JA 1P0MA 2C4TA 3IT2A 1RE0A 4FZ3A 1L5HA 3HL4A 3SOZA 5BMVA 1SXJC 3I39X 5GJBA 4M9SA 4QGBA 1SA0B 3PKIA 1ONSA 3EA5A 4JEMA 3DXFA 2CB9A 3VKUA 1RWKA 3CN7A 1EBBA 5FL7D 1UJBA 3DE6X 4DG5A 4KWHA 4M0EA 4EX6A 3GN2A 1HKUA 1XVLA 2G7MC 3L7AA 4KQWA 3WJ7A 5CLLA 4D3FA 3JQBC 5K4GA 2ZUFA 5ALFA 4NDZA 5F7XA 4LRYA 2M32A 2OM6A 4IGKA 1WXXA 1Y81A 5LB4A 1T6NA 1MN6A 3I2GA 4TKZA 4C0XA 3QELA 3CY6A 4N7MA 5HNKA 1P19A 3NR2A 3RK4A 2V3CC 4EHBA 1HDOA 4TWAA 2ZBPA 3NT5A 4UUMA 3OCCA 3PNPA 3MLAA 1ZW6A 2XQKA 1NURA 3I28A 5BRAA 2QX7A 2VJAA 2Q0SA 4IHJF 3BMNB 4LQLA 5D6NA 4YRCA 3LW7A 3A26A 5KTPA 3P0JA 1E2IA 1ULSA 4DR1B 5HUHA 1KEKA 1IJEA 3N2IA 4L74A 3ZKWB 1QHIA 5KNBA 2FVYA 3PYLA 3AJ8A 3ZXYA 2VP0A 1DEOA 5JIBA 3UJNA 5I7UA 1KJWA 5BN5A 1FFEA 4UDYX 3TZHA 4IDOA 3FTCA 1JPNA 2FQXA 2GAIA 3RLFA 3FNHA 1E3IA 3QBJA 4E2WA 4B3BA 3FDJA 3UFXA 4DCOA 1ONBA 1E99A 3ZG6A 2OG1A 4CL0A 2IS6A 2EW1A 3MCUA 1RXIA 3OM1A 5HZGA 1F9EA 3DPIA 4QRDA 4CKBB 2OFWA 5K0FA 2RGEA 1H4VB 1MEJA 1MH1A 3E70C 4MV4A 4NU5A 4V38A 3KBBA 3VOSA 1QE0A 4AMZA 3BWEA 1RHMA 4YPOA 3DTNA 5JTUA 3KJFA 3ROPA 5HF9A 5EP1A 5K6TA 1BS9A 4V24A 2AFIE 3LLSA 1IVNA 1HNWB 3GLSA 4CEJB 1J8DA 3RFFA 4L6AA 2JH8A 4KO4S 3G7SA 2RHGB 4LC1A 1R0SA 2F6RA 2XMCA 4N03A 1DEKA 2B94A 2FEOA 2GK4A 2GBCA 1EK0A 1EFCA 2C2GA 1Z5ZA 3ZGZA 1QO0A 1V5IA 1G5TA 1A8IA 2IKQA 2QN8A 1S1CA 3E6AA 3PR2B 4E09A 2ZYUX 2QL6A 3A3YA 5CT4A 5AKGA 3CZAA 5J4YA 2XBUA 2V6FA 4M89A 4NIMA 2BM9A 2GXSA 5L4NA 1OAOA 3DV2A 1QRRA 3BGWA 4FFBB 3H19A 4FW8A 1E2GA 1Z0AA 1IY9A 2FNAA 4S1WA 3L7IA 2FB9A 2C42A 3V8MA 5JNSA 1WBDA 2VR1A 2EJCA 4MWZA 1HFWA 1OZHA 4KPYA 5B3KA 5JJCA 2QNBA 4OQNA 3VPHA 1U3DA 2QD5A 5EFZA 5L51A 3M89A 2W48A 2JHPA 1DAOA 1TZCA 4PO1A 4V0LA 2VP2A 4UUAA 2J41A 2ZROA 5AI9A 4WN3A 2OD9A 2YQ4A 1JDNA 3BGDA 4P2BA 4BFXA 1HDGO 1WZIA 3KJXA 3TINA 2IYSA 4YECA 3RSCA 4G01B 5ALYA 5AYVA 3GZTB 4AQYB 2O1XA 1CUFA 3ZUPA 1Y80A 3HXMA 3D2BA 1KGDA 3QW4B 3G9ZA 5GGYA 5AXBA 4CEHB 2CMFA 3C7TA 4ENRA 4UBNA 4ZRDA 4ZT5A 3OIYA 2B7LA 1N6IA 1Z83A 1ZWKA 3G1TA 4MVJG 2CXOA 5D84A 3HVJA 3DOCA 5ELLA 3I5MA 2H2DA 3MGKA 4EHIA 1FDRA 1XEWX 3RVNA 2UUCB 5J63A 4DAEA 4V0RA 3LOQA 1OLSB 4JUFA 2O5VA 3A6JA 4PPQA 1DJOA 5E9AA 4DBZA 5BYKA 4LG1A 1CUDA 2HA4A 4PBTA 1IN7A 2JGFA 2WT8A 4ZZ1A 2QUHA 5F9MA 1VMDA 2PM8A 3FNEA 3QM1A 5AOVA 4UEJA 5LSAA 3ZWWA 1Q14A 2BV3A 2I4LA 3DL0A 1KAMA 2P1DA 4FGUA 3E9ZA 2AOTA 1T2NA 2AFRA 3QQ5A 4RC9A 4JLKA 4YRAA 5L6LB 4C7OA 1TCAA 1O1YA 1YR1A 1PEDA 3NBMA 3DKIA 4LVCA 1F8YA 4UARA 5CK4A 5AW7A 1EUCB 2R48A 1BWPA 3CZRA 2Z58A 3C14C 1HOXA 4Y2GA 3UW3A 3RYFB 4IOMA 3PQEA 4BTEA 1OF1A 2IX9A 3IQWA 4RZIA 3GYBA 4N6OA 3ZDYB 4JVSB 1DRKA 2G0NA 4INZA 1FTWA 4YCAA 2QPLA 5CA0F 2CV1A 4RHYA 4W5HA 4U1RA 2D5CA 3RKSA 2QL7A 1YT5A 1RM4A 3PC2A 3SSOA 4AG6A 5KX5B 2JI8A 3IEIA 3EY4A 1LDNA 2BFDA 2ZSIA 3TIVA 2WWFA 2JLRA 4RULA 4IZ6A 5DJ5A 3UC5A 2ZTVA 1JDZA 2W8ZA 4NOJA 5D8DA 3LRTA 4HQ6A 1DSSG 4EUNA 3SQMA 3I6IA 2R8OA 1KQ3A 1SQ6A 3HHPA 1GL9B 3HWRA 3O8DA 1KAHA 5TE9A 5CEJA 2CNWA 1SC1A 2OHOA 1FNDA 3KJIA 3L7OA 2VHYA 5L7YA 4AJHA 2PTGA 4DJDC 4YRIA 4KITB 3OQNA 4G5XA 1APBA 3PNMA 1WBBA 2PSFA 5EJ2A 4PNZA 2XUZA 3OJCA 1RI4A 1ORVA 4ROTA 1KYXA 4IYRA 1CYDA 5AVJA 1TM7E 3GRFA 2AG6A 4LTDA 4N9QA 2YV4A 1JLLB 2BAGA 3C0KA 5D3QA 4OKSA 1CQXA 5KQGA 4IS3A 1I0LA 2IU6A 1H2RS 1NAIA 1TCCA 1Q0QA 2F59A 4MVJF 4OK5A 4OYLA 2FWIA 3GGJA 4KFSA 4CNBA 2YHAA 4ZYTA 1PT6A 3IRUA 3R6DA 2JJYA 1U8ZA 3ENQA 1W5BA 1VHJA 4UEQA 5HDQA 1UZLA 2A1TR 3H6KA 1KOFA 1NBEA 4DUGA 2XY4A 1QS0A 4G8DA 3NBFA 2HMTA 2QAGC 2I8AA 3W4KA 4FILA 1G59A 3VR4H 3G17A 1MEEA 5KB3A 5DNYB 1N2BA 1N6NA 1V48A 2DFPA 4HGQA 4HWTA 4QFCA 3RHSA 4DXDA 3RAFC 4IO1A 2G07A 1JEOA 2ACEA 2D0DA 2C58A 1Q7RA 1XZQA 1GNQA 3PE4A 4QQ8A 4TMFA 1F0NA 1P0IA 1A82A 3MSCA 4GPTA 3T9AA 5LD2B 5CX1A 5BSKA 1V9SA 3RJZA 3R5FA 2CXHA 4MA5A 4ZO7A 5REQA 3V34A 2CHEA 4XQEA 3RQSA 4X65B 2VYQA 1IB0A 3JD0A 3RT7A 3PSHA 3U6KA 5BSRA 4U7DA 2VP3A 4BATA 2XT9A 4Q4JB 5LOVA 3DLCA 4P4TA 3P97A 2WIFA 3OHPA 1W87A 2A9QA 4RKEA 1I7DA 1FFXA 3V3KA 2HLHA 3EBPA 1KBQA 2IHKA 4GGPA 5SV2A 4QUEA 2Q6VA 1ENPA 4G0OA 4GNKA 1F5SA 1VJ5A 4I4LA 5CCDA 4PZPA 3SGLA 2D5BA 2GO1A 3COYA 4GEGA 3M6WA 3VU0A 3M81A 4S05A 2XDQA 3C6BA 2X9VA 2PX5A 3WDKA 3EIEA 3CM0A 1E6KA 1HURA 4RTMA 4EGCB 5I9LA 4YQZA 4Y0AA 1LW7A 1XZLA 2WPDA 4JASB 4B40A 1EXVA 4P34A 3WNCA 3DTVB 1SUFA 4NZ9A 1EDEA 1YR3A 3U7EB 1BDBA 2XLCA 5LMCA 1DC3A 2H9AA 5CNMA 3O9VA 4LZAA 4U2FA 3TX2A 4DWVA 2UUOA 5JV5A 4L57A 2VEOA 5K99A 5LQAA 1RYHA 3A8TA 4DF3A 2JFUA 5C18A 4B3SB 2RH8A 5BOSB 2YYSA 4PRLA 4BMVA 5BN4B 1EVIA 1WX1A 2F1RA 3O4VA 1Z08A 4OHUA 3WGUA 4II7A 3SF0A 4X8MA 4Q4HB 2FSSA 1CUVA 1EGQA 1ST2A 1IJBA 1PJBA 4WEOA 2MMCA 4O29A 5MFPA 4I3FA 1OOEA 1TECE 3T7SA 1I6KA 4CLHA 1NW9B 2GF2A 5BURA 1F7VA 1NN3A 5A0TA 4AL4A 4XGNA 1X15A 4OA5A 1KAGA 1LPBB 4ZHQA 3WLRA 1L5KA 1JKFA 4ERXA 3J7TA 3LBFA 2Q5LA 4C2BA 3BB1A 5DASA 1B3RA 3PTZA 4ZAFA 1DBQA 5JXWA 5IJ0B 3F8WA 4B6FA 2BY4A 1D0IA 1DELA 4FNGA 4BGIA 5LQCA 1K9SA 4I5IA 4ARSA 3JARA 2FFQA 1WRBA 4WFIA 2M1ZA 1AIPA 4BC1A 1MO2A 2GKGA 3KPWA 2JJQA 3AR9A 3H8VA 2C20A 2CJYA 2VBCA 3R0XA 2DOKA 2P3QA 5EJEA 2CNKA 2ZG6A 1YZUA 4JVMA 4M9ZA 4RVOA 4YC7A 5IC4A 5J23A 4KR2A 5EINA 1E7QA 4KU4A 1Z0DA 2QN7A 4ND1A 1N5LA 4ZI2A 4QPNA 1N3YA 1I2AA 1GPJA 1RRMA 3OEWA 4XM2A 4V0OA 4PAQA 3GMSA 5CFRA 1JA9A 2WU1A 4F3KA 1OC4A 4WGFA 3DVAB 1DQYA 4B1FA 4DCVA 4EP1A 3GUZA 3G2HA 4KGXA 2P8JA 6LDHA 3A4IA 5KYYA 4GMXA 4E70A 1OZFA 3T7JA 4LXXA 2WQ6A 2G0AA 1HDXA 1Q0RA 1U3WA 5EIWA 5A06A 3J81k 2JKZA 1F2TA 4XVQA 4DT1A 1KKMA 4M1KA 2NADA 3AVQA 2YY6A 4GI3A 4LDNA 4XWGA 2AVDA 3RTDA 2EXXA 5EZQA 3ZNOA 1MJHA 1LLCA 1R8XA 2FW7A 4HYTA 1UBJS 4P8RA 1PJ2A 2GHIA 3FNBA 4XI9A 5B3AA 4NEQA 3X1KA 1XNHA 1BKDR 4IGFA 2O19A 3TAXA 2HJHA 1YRHA 3AR6A 2OAQ1 1JEDA 1QB8A 4M76B 1HE2A 3GEIA 1OZGA 2V7VA 3TZLA 4X41A 5AI0A 4J90A 4R7TA 3UY4A 4EO7A 2VI5A 3E9YA 3UATA 4JQZA 1RJGA 1YIAA 4DJEC 4BJ5A 2P8SA 5K8UA 5L8VA 2G72A 4B4KA 3RYCB 1Y1KE 4JCCA 1NYLA 1ORWA 4JXXA 1Z6PA 3HP7A 3HVIA 1II0A 1YJAA 4QYWA 1HYBA 5GOTA 5C8YB 4DLRA 5EPUA 2WF7A 3UWDA 1UMDA 1B8NA 5ECYA 1GG5A 2NSYA 3L49A 3O4HA 4H7HA 1YRWA 2Z2ZA 2HXGA 2B92A 2QN1A 3A25A 1URPA 4A8PA 4F2DA 2NZ2A 5C1BA 3UICA 3KIPA 3BXPA 3PEFA 1VBFA 2FHSA 3W5JA 3P52A 1A77A 1UP4A 2FSUA 5LLSA 3JWIA 3SE7A 4W99A 2ONCA 4TS9A 1DO8A 1EYZA 4ECEA 1GCGA 1UH5A 4JLWA 4GWLA 4R5HA 3E03A 3FWKA 1HLDA 3KZKA 5JXJA 2AEJA 3CWCA 2IELA 3TCKA 3TRIA 3DMTA 2XR1A 4PG4A 3EXHC 5ALQA 4M1OA 1OVGA 2P91A 1E5LA 3QPBA 2NT3A 1JAHA 1EAYA 2Z6VA 3TQFA 4BQFA 3D02A 1LXCA 1FSPA 2Y6UA 4YIHA 2A9JA 1KBZA 3E5NA 2QT0A 2VPYA 5FP0A 2X76A 1PGNA 4HSGA 2O1SA 5CBPB 4FR2A 3FWPA 1OBCA 2QGNA 4C0BA 5IT4A 2PWPA 1LTQA 3T3PB 1TD1A 1JKXA 2IU3A 1DWQA 2B5VA 5EMKA 2B30A 5ITWA 4OQLA 1MA3A 3VH4A 4KX3A 1WDLA 1TPYA 3S8EA 1O5TA 3MINA 3HYTA 4ARAA 1Z4QA 1ZK1A 4RFVA 4EF4A 3BFJA 3LNTA 1DX6A 5MN6A 3E7WA 4JJKA 2OP1A 5JARA 3SS9X 1QZZA 1C81A 3CJQA 4II3A 3BWBA 2ZP1A 3HDVA 1XEXB 4B9AA 2GAAA 4PHCA 4X20B 4M0CA 3AIOA 3E3NA 2HWXA 4GOJA 4FDVA 3ER8A 1NGSA 2OO5A 4DVJA 1CDZA 1ZAYA 3PHIA 1A9OA 1IWPB 2PGDA 3CZ9A 2BBWA 2G82A 3R0QA 3SBDA 4CFSA 2NXEA 4AXXA 3OVMA 3KT3A 2QW1A 1C8LA 3QYPA 3IIEA 1AB6A 2NVBA 5CR9A 1B14A 2IC5A 4ZVKA 1UT5A 1LBHA 2W22A 2HA5A 5LYJA 2I22A 2BKVA 2RHHA 2OGSA 5DI3A 3TEFA 5JNUA 3F3MA 4YXWA 1EUQA 2D6FA 2UXBB 4CQNA 1N78A 2CMKA 2H1FA 4QAJA 4ENTA 1T2DA 3LBIA 3CVWA 3BSFA 5DYYA 1GGVA 3Q0EA 3QBDA 1OU4A 1A1VA 4OOFA 4AN4A 4DE5A 3OLCX 4RV5A 1BS2A 5CH8A 2Q0HA 1T9BA 3C3MA 4WPGA 3RRNA 1PIWA 1PYOA 1KK2A 1SVOA 2A1UB 2H7VA 1Z2PX 4V0KA 5JCOA 4BO0A 2FYTA 4ZKDA 1N77A 1CF4A 3PUXA 2W90A 1DJLA 4RMJA 4XDZA 4YV1A 1G5PA 3ZWAA 1J2JA 2WMOB 4RENA 3ZWYA 3OFSA 3DE2X 2FKNA 4ZJZA 4FNMA 3NHSA 2O5EA 3IP5A 2EF1A 1EFRA 4EJ2A 3CZMA 3E1SA 1X1BA 2N3ZA 3TQQA 2W2NA 3UTDA 1VFPA 4J1SA 4G5RA 3HWWA 1A97A 3UPTA 4MW0A 3QXSA 4MDFA 3QG5A 1IYZA 1OX4B 2RFLA 3KWLA 1ZJ5A 2DFLA 3VR5A 4MVJA 2GNOA 4JKIA 2BFEA 3TW4A 3KOUA 1K68A 1OBOA 5SYMA 3W9SA 1KZ9A 4L6IA 1GSAA 2OHGA 3QIAA 4MP3A 4TL8A 2HPAA 2J9YB 1WDKA 3HV2A 4R5MA 3LPNA 3V48A 3KZNA 1PNTA 1PJSA 1YOVA 4W4TA 1FLDA 3NHLA 3OOYA 3GK3A 3QPDA 1QFYA 2W7TA 4TXHA 3V2GA 4ZIRB 1LRKA 3N28A 4H60A 2W2MA 3EZXA 3KG2A 4MW5A 4EG7A 5JASA 4ESEA 4QHSA 2FZCA 3GG9A 3KR1A 1VG0B 1JXMA 1D2RA 2BBSA 3WLFA 4GP6A 2PBLA 4ZVVA 3QXCA 4W8GA 1V3VA 4HVTA 1BCSA 4ZQFA 3W6OA 2BJHA 1SD1A 4TQ9A 4BHTA 3LXUX 3QEBZ 4IMJB 5LNK1 3W05A 1ESNA 2IYYA 4LUCA 5EKSA 1T4MA 5EXXA 1RYYA 4QHTA 3DYVA 3M6AA 1GZ5A 3IILA 1ZSNA 1W0CA 4O0MA 4OJNA 3SM9A 1GTRA 4C89A 3M70A 4KR7A 2SKDA 3ZXXA 1R64A 1RDFA 5TPZA 1T8WA 3RS8A 5KVCA 2RE8A 4URWR 2DHDA 2WM2A 2X7HA 4XD7A 5CJJA 1WU8A 5IHPA 2P9TA 5BORA 2GWHA 4J16A 2BRUA 2HLPA 2PUTA 3GUUA 4BZWA 3L0YA 1T9CA 4L8FA 3NKLA 5JALA 3NC4A 3B2QA 5CD1A 1T0BA 3VMMA 1AKMA 3V1MA 3RVLA 1PS8A 4WVLA 2PN1A 1S5PA 3E3MA 3WYCA 1GT6A 4CVNA 3HB4X 2D2EA 4FWTA 2CWDA 3CNEA 2WPNA 3X0DA 5J2UF 4X8LA 1K7YA 3HN2A 1KPIA 1LSUA 2PMDA 3HMKA 3NAQA 1J7KA 5EG5A 4HN4B 5HIAA 3ZE2B 5G3ZA 1U0JA 5TQ0A 2CLCX 1DC8A 2BD0A 3ESRA 5CPFA 1Q95A 2BFNA 1OXUA 1ZVJA 3M5PA 3NYWA 2QLBA 1NVAA 2PL1A 4KMRA 1Q7EA 1MOQA 1W6UA 2WUVA 2XD4A 3DHEA 3QF4A 4BX9A 4AS1A 3J7AC 5I01A 4S3MA 4L27A 1Q5PA 2GJ8A 2QQ5A 2SBTA 3HXOA 4ESVA 5BN1A 1QRTA 4XZ3A 3AHHA 1A9PA 4W5NA 5DLYA 1ARZA 2OUIA 3BERA 4K9NA 1L7MA 5FJJA 4PN7A 4JNKA 4TV8A 3IBCA 3K0AA 2ZT5A 3DGFC 1V3UA 3RC3A 3VR2A 2WUEA 3ZLBA 4BFCA 4MH0R 3U19A 2ZSBA 3AINA 3LV8A 2MSKA 3GPIA 4ZYXA 2JAQA 4Y1GA 1OYOA 4GVXA 4KN8A 2ZAYA 3HKDA 1Q17A 4ZK6A 1NXPA 3C8DA 2Y2UA 3PD1A 1XJWA 1MUUA 2GGSA 3OE1A 1SCAA 1G4UR 1JZQA 3JZFA 2VNHA 2Z5GA 3DM5A 2FFAA 3FGNA 3P5BA 3EDMA 3PYMA 4FVTA 5IUNC 3VYVA 3MCTA 5HFJA 1FJGB 1VBKA 3INNA 1SB9A 2ZM6B 2FMXA 2Q6KA 4Z4EA 2O3JA 5LU8A 1P7ZA 4DDWA 3FHLA 1NUPA 3FOEC 2V7EA 3L8FA 3ZH9B 1IEQA 1HTWA 4BNGA 5M29A 1B23P 1QKJA 4YAEA 5H82A 3TD2A 1HDCA 2HWKA 1PGOA 5HM8A 4UTOA 4EHNA 1YR7A 2BONA 1L4MA 1XALA 4AQ7A 1X9HA 4G5SA 4CXMA 2FEKA 5FWYB 1A95A 1IBSA 2EFYA 2HQ1A 2OHXA 3R3VA 4EB3A 1I4OA 2R86A 3IT1A 4UE6A 1N2EA 2ZJYA 1BQ3A 1PGPA 1UBCA 1B1AA 4PVCA 1D09A 2GB4A 3FF1A 4KWEA 2V6BA 1O58A 3WYDA 4EBBA 3R9XA 2XWJI 3KOXA 3WWOA 2EU8A 5EHNA 5BNIA 1B42A 1C1DA 1REQA 4V1CA 2CNOA 2P2YA 5FX2A 3VZBA 3OECA 1J0CA 1C29B 1WNFA 4ERNA 5TB5A 1XF1A 4R1UA 4KPEC 3N8GA 1RC0A 1JQBA 4QOGA 4O2AA 2HZ7A 3E9MA 3OU7A 4IGIA 4MI3A 1EA7A 2Z5FA 1JHXA 3H65A 3GLFA 5LZ4A 1UDCA 5DZSA 1AGNA 2BF7A 2PA0A 4YCSA 5F3DA 1G0OA 1QIHA 1RWBA 2XDYA 3LTNC 2IIPA 4IILA 3AM4A 4H0NA 4KN9S 4AZVA 4U7PB 4GXNA 4GPAA 1H5QA 4DR4B 1V26A 5JYDA 3VR5H 2G63A 4YRGA 1XEAA 5CMLA 1ZOPA 2EGHA 2HM7A 2FSGA 3AF6A 1I7QB 3AXTA 3B9BA 2WY2D 3RG2A 1EGAA 4EJSC 5I9IA 2C5FA 3TZKA 1KH1A 4B44A 2IZOA 2IGBA 4FJ1A 1BRTA 5J5AA 5CXUA 4YLEA 1RQXA 3F4KA 4D9EA 3TBFA 1DP4A 4LC0A 5CDFE 4R9SA 4Q9IA 2YVQA 2VDNB 3AEUA 2YC2C 4WESB 1UPAA 3DH0A 5GZ1A 1NG9A 1CUZA 1YDWA 5FO0A 2R6CA 5IANA 5GQSA 5FOSA 5CYFA 1SWVA 1U28A 3AGQA 3FX2A 3G49A 3JQ8B 1O95A 2R1VA 1HLPA 3H2JA 3CC8A 3C7KA 3P0RA 2HBQA 1OV4A 1Q2XA 2CXPA 3EIUA 3GJ3A 4LNUA 4KHPB 2DQ4A 3GGCA 1V1MA 1C3LA 1P8JA 2HA0A 2IIVA 1PR2A 2OXRA 3CT4A 3BBPA 3IDQA 3KZMA 3LWBA 3TCNA 5PNTA 1UWVA 3F74A 1DO0A 3D7LA 1QYDA 2AS0A 3IC5A 4JLUA 1CS4C 2P6NA 4P1ZA 2B69A 4DPLA 1CY0A 1U5BA 2QQ0A 3DMPA 4NULA 4UVGA 1OAAA 1A9YA 5H5JA 4QU0A 3DEJA 3L7DA 4GI1A 4ZTZB 1PT7A 1ADBA 1NXWA 1VJRA 2P69A 5ITSA 3LKVA 5FUBA 4B6OA 1W36B 2G1PA 2E5LB 4AXBA 2Z56A 1N5IA 3EGEA 4V0MA 4HDKA 3TLEA 1PQPA 5A1JA 3DV9A 3WGVA 1QQBA 4FONA 4PAWA 1QQTA 2UAGA 1SUEA 1GRVA 4QX6A 4ADSG 1MJGM 1NRJB 4Q66C 4D3YA 5C8ZA 1H2EA 1TUBB 4KXLA 2O0KA 5EWJA 2VIIA 2HNKA