1ZNYA

Crystal structure of mycobacterium tuberculosis guanylate kinase in complex with gdp
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
183
structure length
183
Chain Sequence
VGRVVVLSGPSAVGKSTVVRCLRERIPNLHFSVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSGTLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQARLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanylate kinase
publication title Unique GMP-binding site in Mycobacterium tuberculosis guanosine monophosphate kinase
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 57
structure length 183
sequence length 183
ec nomenclature ec 2.7.4.8: Guanylate kinase.
pdb deposition date 2005-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00625 Guanylate_kin Guanylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1znyA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1znyA01
3HJNA 4LHYA 2WM9B 3KQUA 4JLJA 1EFHA 1E9CA 2A3RA 3TVDA 4DLTA 3M1IA 1AZSC 2GWHA 2NO1A 3VR6A 2GEDA 4E03A 4JKIA 2ZS7A 1XTRA 2XAUA 4R2HA 1E2KA 2XZOA 5CK4A 5DNYB 4B2PA 4IKEA 3L0IB 3HPQA 4HLQB 621PA 4KVAA 1US8A 5FPTA 3FGNA 1MV5A 1A82A 2BBWA 2C04A 4MA4A 1R0ZA 1X86B 2PT7A 1XTQA 4G5RA 3ZVRA 2ZJ2A 1G3IA 2AKAB 4RKEA 2O52A 4D0LB 3H0KA 2YC4C 5C18A 4LDJA 4OQLA 2ZJYA 4XD7D 5J5CA 1UPTA 4DXAA 3BOSA 3MLEA 4DUGD 4TYQA 2OM2A 1J7KA 3FFBA 5L3VA 2ZRPA 2FA9A 2RHDA 2IA5A 5IRCD 3LXXA 3FE2A 2E9SA 1G3UA 1N6IA 1OH8A 1E9RA 2JASA 1YR7A 2LWIA 4RFVA 4W5HA 3GPLA 1UEJA 2WWYA 4R7ZA 3DKPA 4OK5A 4JSTA 2DYKA 3ZS8A 2CBZA 4E07A 1YR8A 4TL9A 1WF3A 2G1KA 4OHXA 4R98A 2V54A 4Y0AA 4FMDF 2WHXA 4QGGA 4BLRA 4L8GA 1W0KA 3B85A 2J1LA 4BASA 2ONKA 3R8CA 1NMXA 3PIRA 4GOXA 3QF7A 1P2UA 3WMEA 5CITA 5JSZA 3EPHA 2A5YB 1JAIA 4XTCS 5F98A 4CF7A 1JXMA 2QBYA 1N6OA 1E9EA 2YWEA 1U0JA 3EZ2A 2F1RA 2RGXA 4JT2A 3MWKA 4Q7MB 3V4FA 5SZIA 1UBFA 2JDID 3CR8A 2NO7A 3L8YA 1CS4C 1TUEA 3VU9B 4ZKEA 3I5YA 1JBKA 4A8JB 3ZLJA 4CIDA 2O8DB 3OHMA 1OIXA 2J87A 1S0UA 3ZDQA 1E3MA 2NO0A 3Q9LA 5KSOA 1CF4A 1P73A 3OAAD 2F9LA 2JLRA 3FMPB 1R0YA 5JRJA 3GLGE 3U6BA 3O8DA 4TTRA 1E0KA 1GVNB 1KI2A 3E2IA 2ONJA 1XEWY 3MWLA 2ZRDA 1NG9A 4NYJR 4RCYA 5JECA 1LS1A 1Q0UA 4P33A 3K09A 4I1OA 2ODEA 4G5SA 4KU4A 1OIWA 4TYWA 4PHGA 1ZU5A 1XXHA 1SQ5A 2VSFA 4RY2A 1YU9A 2IYXA 1DOAA 1G8PA 4JL6A 3VR5A 4U5XA 4DCSA 2AX4A 4JBWA 3QXHA 1KIMA 3KJHA 1ZINA 2V8OA 1VG8A 4HLCA 3T5GA 4TZ0A 3Q5EA 2P65A 3FKSA 4GBMA 3IILA 4BLPA 2REOA 3I61A 2GAOA 4KLZA 3SJBA 2GEUA 2R65A 4GOJA 4TMVA 2NO9A 2HDNB 1E94E 2F43A 4X8LA 4B33A 3LRPA 5CK5A 2N42A 2DB3A 4IDOA 1C9KA 3WMFA 2ZUBA 2QAJA 5FL7A 1DPFA 5FUVA 4TT3D 2OLKA 4IXNA 1H8EA 3QKSA 2ZR7A 4WAUA 1RYHA 2WKQA 5CLLA 4PR0A 2CL7X 1B0UA 2ZRJA 4B2LA 3U44A 4NU0A 4Q47A 3O8RA 5P21A 4M1TA 1OSNA 4GFDA 5HKKD 2G9NA 3WYFA 4DC9A 4XSGA 4Q1AA 1QHHB 4M1WA 4Z51A 1XCGB 1WMSA 4OL0A 4DDWA 1E79A 3RS0A 2NIPA 1SXJA 2QBYB 3FHTA 2JA1A 1PJRA 2WKRA 3AVTA 4EIWA 1W47A 4M8NE 3RYTC 3X2SA 4TQAA 3N5CA 2WIAA 4EFNA 3B60A 1H8HD 2PLFA 2ZRNA 3E1SA 4MITA 5C2JB 1XDBA 1XCMA 3H84A 4Q4JA 2IYWA 2FEMA 3RWOA 3VFDA 1YZUA 4KLNA 1C4OA 4MRPA 5JCPA 2ZRGA 3B2EA 2JJ1D 4A0RA 1HQCA 5F9FA 2P6UA 3UWOA 1RRFA 1SZPA 3R9XA 2BMEA 2BCGY 2ZYVX 2ZANA 4A2PA 3PEWA 4LBZA 4OI2A 2XOKA 4F7WA 4C4PA 3AF3A 3KKQA 2GKSA 2PEYA 1U9IA 1KO1A 2GZDA 4IOKA 4CVNA 2C99A 2GEVA 4J0QA 4Q9LA 1LF5A 1OXTA 3CNOA 4X8OA 4ESHA 3AUXA 3RC3A 3D3QA 4D25A 3THXB 1XJ0A 1NVXQ 1Z22A 1E9BA 5E7IA 5B58C 4G5QA 4AKHA 1D2EA 1E2PA 3LV8A 1VG1A 2QMHA 4IFEA 2WWFA 1Q44A 4TQUS 4ERNA 3X1YA 2AXNA 3IQWA 3K0AB 3K0CC 5JJKA 4WXRA 4WZAE 3PG5A 1G9XA 4DLXA 5KSYA 1E9DA 4DLZA 4F4CA 5IDVA 3SOPA 1R5OA 1Z6XA 1M2OB 2D2FA 1E1QD 3KZ1E 5J47A 5CDFA 1JAHA 4BZXA 3GCGA 2O8FB 2DFNA 2ZAMA 2VPPA 2D2EA 3RS5A 2QSYA 2OT3B 2BBOA 2BKUA 3ZH9B 2EFDB 4QNRA 2VRWA 2VH5R 1IJEA 2KE5A 4S2EA 2YHSA 5CM9C 1WDTA 421PA 2WVJA 5SZKB 4RD6A 1RJ9B 2J5XA 1W36B 3U60B 1CTQA 1TEVA 3SBEA 2AWNA 2VHCA 2ZJZA 4BZQA 4DT1A 5A5GA 1OFHA 1NN3A 2W6JA 1P2TA 5KPDA 3EIQA 4US0R 2GF9A 4B2IA 1BO6A 1KI3A 4LPKA 3U44B 2QTVB 2AFHE 1Q3TA 4XVRA 1XJQA 4B44A 2IYZA 2GVZC 3CH5A 4UKDA 2ZAOA 3LO5A 4HI0E 4PC1A 1KTVA 5L3SA 4XD7A 1XTKA 1HA3A 3P32A 3LW7A 4P31A 3SBDA 1ZYUA 2IS2A 4P4SA 3UMFA 1ZIOA 4DUGA 1NMYA 1T6NA 3NEJA 1VYUA 5G3ZA 1E6CA 1JI0A 1YZKA 2CDNA 4P3YA 1LNZA 121PA 2FH5B 3IGFA 3SR0A 3B82A 2J7PD 1CR4A 1GP2A 3IHWA 4DCUA 4IW3B 1I4TD 1Q1ZA 4MRRA 1ZC4A 3NHAA 4O0MA 2IL1A 1FX0B 1U9IC 5IHPA 2EVWX 4B32A 2F1HA 2YC2C 4I1UA 2I1VB 1CU1A 4PAQA 2CCJA 1I2MA 5AJWA 1BIFA 5CB8A 5H1YA 1KGDA 2IXFA 1KO4A 3LQQA 4B43A 1U2RA 3NEYA 1KKMA 2ZUDA 3W5IA 4XVUA 2ZS8A 4MYUA 4WA7A 3KUCA 2J45A 2J3EA 2CL0X 2FN4A 1SKYE 1VECA 3L0PA 3KKPA 5EXSA 3G82C 4TLCA 4BLSA 4JLNA 1CRQA 1ZNXA 5LBIA 2JDIA 3L8ZA 1N5KA 1CJVC 2GXQA 3JVVA 3U7HB 1E2GA 1JR3D 1Q12A 2CCKA 1XD2A 2O0HA 2UZIR 5K8LA 1U99A 4PO8A 4D80A 1EFRD 3KKOA 2KSQA 2I3BA 2PBRA 3AVOA 2VEDA 4IOMA 3PJRA 2BHRA 3GEEA 4XJXA 1ZM7A 3D31A 3K0EA 4JKYA 3RSLA 2CVHA 4IVRA 5FI0B 1HQYE 4FMDB 3OAAA 5HE9A 1WP9A 3AF2A 5HZKA 3TQFA 5KSPA 1OYWA 3R7WA 2AWOA 2FX3A 1Z3IX 1YZQA 4NPHA 4C0JA 3OFND 4ZIRB 3K0SA 4NCJA 3QXXA 3GJ3A 3HU1A 4D4KA 2IHBA 3M0EA 4KI0A 3VNUA 4PC3A 5CIWA 3BFVA 3IQXA 5AR1A 4Z54A 3S1AB 2IYTA 1AQUA 1FW6A 1MO4A 4LJ8A 3TLXA 4QKQA 1EK0A 2OO7A 4LI0A 2VF7A 3R20A 3QVVA 4Z1MD 4Q00A 5A4JA 4KODA 2V55B 2H57A 1M6NA 4HUTA 3BERA 2JCSA 1OV4A 3EZFA 2C9OA 5BYJA 3Q5DA 5B2ZA 4HDCA 1MT0A 2QA5A 1YQTA 4AG6A 4KVGA 2PZEA 3IPYA 4AYTA 4R71A 1NRJB 1T3SA 4FIDA 5TARA 4P4SB 2LKCA 2OFOA 2R6FA 3ZVLA 2WZQA 1G8YA 3GEIA 1Z6AA 3HU2A 2WICA 3T61A 2MMCA 3EA0A 1OKKD 1Q1EA 5CB6A 2OFWA 2H5EA 3Q3JB 3PQCA 4TT3A 3NDBB 3QBTA 3GLIA 3OEHD 1D2NA 4MGIR 3CX6A 2MMGA 3CR7A 3GLHA 4ARZA 2AD5A 1XB2A 3F8TA 4M1MA 3Q7PA 2ZPTX 4UNRA 1VHTA 1NN0A 1DS6A 5EXPA 4B35A 5HKKA 1NVVR 4F38A 1QHIA 2HUPA 2BBSA 4P0TA 2QPAA 4C0HA 5LDDC 4O2LA 4V0LA 4A2WA 2NG1A 1H8HA 3TJZA 4YMSA 3QQ5A 1UKYA 1JECA 1UKZA 3AEZA 3A4MA 1DO0A 1BS1A 1IM2A 4GI7A 4DZZA 2B21A 4EQ6B 2JLQA 4P4UA 3GLFA 4MGYR 2JJ1A 4ACBA 2H16A 1E2DA 5K8IA 5JHGB 5FOSA 1S1MA 3W6PA 4Q48A 2J0SA 1E0AA 3GFOA 3O8CA 2W0MA 4A92A 4KSBA 5KDDA 3ONWA 5G40A 5DE3A 4Q03A 721PA 1ZNYA 1P60A 1MO6A 3DZ8A 4YDHB 1N3BA 3R7WB 1NLYA 3RAPR 1NVWQ 4BRWA 4FCWA 3QEOA 3ZZUA 2XZPA 3P20A 3K0FB 4QL3A 2CLDX 1NLZA 2X1VA 4OHYA 1DAFA 2YWGA 1W0JD 3KB1A 4AC9A 4DJTA 5K8UA 5DI3A 4NL4H 4PXAA 3AVVA 5KNDA 2W2VA 3AF0A 5DHFA 1GNQA 5D3MB 1RVDA 2XB2A 4M21A 4OHWA 2GZAA 4JLOA 5J4HA 5EXXA 5SZHB 1LS6A 2CEAA 4UJ5A 1RZ3A 1S4QA 1JALA 1Q22A 1UKVY 4PQFA 4HB4A 1E1QA 1N5IA 1SVIA 1A4RA 3AF4A 3WP0A 2DFTA 1QG4A 1XRJA 3AP2A 1F2UB 3QJYA 2C9CA 3PUVA 1W4BA 2AFIE 1QDEA 1AGRA 2V1XA 4HAWA 2NPFA 3I32A 4B76A 2LCFA 3DMNA 4LBVA 2OESA 1YJ5A 2PZFA 1W46A 2IXEA 2FOLA 3LLMA 4JSYA 1XPRA 4L16A 1KI1A 5DYGA 4PQRA 2FU5C 2WJHA 3VHLB 3MJHA 2RKOA 2ZI5A 2G3YA 1MO5A 3THYB 3CPHA 3NWJA 4OQFA 2JLVA 3CNLA 2HYIC 2Q9BA 4LOAA 4TYPA 5EUQB 4C0QC 1GKIA 1KI6A 4PPFA 4M9XA 2H17A 4U02A 1XCPA 2XTNA 4ARZB 4IDQA 2N46A 3A1TA 1S3GA 1CR0A 1R4AA 4URUR 1VG9B 2ZYTX 2IXGA 2OZEA 1Z0FA 2YINC 4KO8A 4A82A 1T4GA 3P4YA 3LQRA 3GLIE 1QVAA 2ZYWX 1Z0KA 5FTKA 5IT5A 2ZJAA 4CEIB 1ZUHA 4RZUA 1IN6A 1G21E 4QBGB 2XJ9A 3GLHE 1VCNA 1M7GA 5FBQB 5CJ2A 4I4LA 5EP4A 2GXAA 5C4MA 2FPMA 2RMKA 2QMEA 5J40A 1NJFA 2O8CB 3HYTA 3DMDA 2RHMA 5JJLA 4IDNA 4TYYA 1VIAA 4I81A 4PQYA 2J7PA 2QM7A 3UPUA 3BK7A 3T06B 1AKYA 2J46A 2B8WA 3GLFB 5CYOA 3LX8A 1DE0A 1NF3A 3U3OA 3AQ4A 5GJVC 2ZRHA 4NHOA 1X8JA 3B1YA 3UXMA 4O25A 3DZDA 3VKWA 3K70C 2XTZA 1CEEA 2Q3HA 2OBMA 1HURA 4ILEA 4XSHA 1G1MA 3SHFA 2QU8A 3CW2A 2O5VA 4B74A 4TMTA 1NI3A 1Z5ZA 4CEJA 2NTYC 1D8TA 2C2HA 1Q21A 2QP9X 5DI3B 3B7GA 1A2BA 4QM7A 3T34A 4BFVA 4ZCIA 1Z6YA 3EIHA 3L0SA 4TMZA 1E2LA 2E1RA 4KFUA 2CK3D 1HY3A 2BMJA 1CJKC 2FZ4A 4GRAA 4I1SA 4OKSA 4U7DA 1OIVA 4XH9B 3NHBA 3DPUA 1JR3A 5FL3A 3MWJA 2RB4A 4JLKA 2HT6A 3NKVA 1EFRA 2WMOB 2XTMA 3CKLA 1HUQA 1KMHA 2FFQA 4DLSA 5JS8A 2XXAB 3IEVA 1TF2A 3B1XA 3DVLA 4FXPA 1XPOA 1WCV1 2D4HA 3VR1A 2GNOA 4LJ7A 4JZKA 1I4DD 3LBNA 3VQTA 1KDTA 3GJ0A 2VP0A 1IXRC 4AKGA 1W4CA 1DG1G 2BCJQ 4Q4AA 2ZI6A 3OFNA 2W6ID 1YRBA 3A4NA 2NOAA 4LHWA 1N2CE 5FTJA 4S35A 3GLGA 4ZCMA 2XB4A 3REGA 4LV8B 3VX4A 4L15A 3PXGA 5C46F 4POAA 2EFHB 4BFXA 2QAGC 3BH6A 2QMOA 3KQHA 3MCAA 4URZR 2JIZD 4QJ5A 3I5XA 1CRPA 3KJGA 4HLUC 2O8BA 4A2QA 4MKGA 1J8YF 4WVFA 1Z07A 3TIFA 5CJPA 4Q21A 4OHZA 1YHNA 3GJ5A 1QHXA 3NBZC 5EE1A 1AA9A 1EGAA 2PCJA 1S8FA 1D9XA 1BMFD 4HB2A 1X6VA 3QEJA 1FZQA 1E2FA 2WTUA 1M8PA 2BBTA 2ORWA 3AVWA 2ZROA 3OEHA 1Q1BA 3IBYA 1ZD8A 4LJ5A 1GM5A 4ZCLA 1VTKA 2BJWA 2GXSA 2IUTA 1LB1B 2XZLA 1FL9A 3NBFA 3EAQA 2O8EA 1LY1A 1ELOA 3EG5A 3O8BA 4RCZA 3CX8A 2JJ2A 1JPJA 4QGAA 4TLDA 2VYFA 4B3GA 1MRNA 2PLRA 2IWHA 3B1ZA 4BQSA 2QZ4A 4U00A 1XEWX 2AD1A 2ANCA 3CRQA 4CEHB 4RD4A 4W5JA 5L3QB 5LB4A 3B9QA 3V4RA 4PSAA 3CUEF 3TQCA 1D6JA 4DEYA 4UXIA 5KPJA 1N6NA 2RGEA 4GMDA 3R8FA 3TGPA 3A1VA 4B3CA 1HTWA 1KY3A 1IQPA 1IN7A 1AIPA 2ZRBA 4RD1A 1WBDA 3G5UA 4I1VA 4DCTA 1EFUA 3RS2A 3LW8A 4NYMR 1MRSA 1E99A 1E69A 4JLVA 1KJZA 3AM1A 4LBYA 1SHZA 2TMKA 2R6DA 3H1TA 4LV6A 4MH0R 2NMVA 4MRSA 2L0XA 3ZIAD 1JR3E 1E4VA 1P6XA 4Q4AB 1F3OA 5J4LA 4AI6A 2R9VA 3IKJA 3MG9A 1CULC 3BB3A 4OK6A 4TLBA 2QG6A 1U81A 3N70A 4PO9A 5JLJA 1X8KA 4QBFA 4PSKA 2ERYA 3GLGB 4YLGA 1BOFA 4P32A 2ORIA 3ZQJA 4TL6A 2XEXA 1GG2A 2OBNA 2GJKA 2F3RA 3IBGA 1G8FA 3D6TB 4B73A 4EPTA 4FCTA 2DBYA 4L9SA 3V00A 3FOZA 3CF6R 2J0UB 3TSZA 4A8JC 2O8BB 1E2IA 5DYIA 1T8TA 2HJGA 2JLSA 3DM5A 4XOIA 4HZUA 4B3FX 2Q9CA 4IEIA 3T5DA 4YMVA 5FPHA 1W2GA 4LSGA 4Q19A 4DLYA 1P61B 4DVGA 2DFKB 3EXAA 1NY6A 1KO8A 5E3HA 4LHXA 4IDHA 4GL2A 4D0GA 3FMFA 1KNXA 1W4AA 2OG2A 2VA8A 2HCBA 4MUBA 1KK2A 4PAOA 2R2AA 1HT1E 2FMXA 1TADA 2P2LA 3CZQA 3A58B 4KXFB 1US8B 2RGNC 3QKUA 4MYCA 3K0CA 4Q1BA 1P7CA 2F6RA 221PA 2WWWA 2ZE8A 3DOFA 3FMOB 4I99A 4ABYA 2ZRIA 4QGFA 1A1VA 4C7OA 4LJAA 1YVDA 1ZM2A 4MYHA 1TQDA 2REXB 3QG5A 3CPJB 1CLUA 3H86A 3QXJA 2OHFA 2EYUA 2A5DA 3T12A 2P3SA 5IK2D 2FEOA 1VKJA 1TNDA 1KAOA 2Z83A 1CJTC 3A1SA 2OXRA 4BLQA 3GQBA 5CM8B 2DFLA 3BXZA 1IN4A 1R2QA 5TDHA 3KTAA 4F92B 2VL7A 2WJGA 2Z6VA 3DM9B 1XZQA 1IXZA 2VQSA 4DSNA 1NN5A 3U3JA 3WRXC 2PX0A 3VTKA 2IS4A 4Q4HA 1NLFA 2OCYC 3L2OB 3NH6A 2Z4SA 3FDIA 2ECKA 4URYR 2WJVA 1BKDR 4BFYA 2V6IA 4KJZA 2RGGA 4OYHA 2HXYA 3RS4A 4L9WA 1ZJ6A 2VP2A 2MSCB 2OCBA 5JSZB 2AKYA 2CLCX 4KYUA 1E32A 2VBCA 4NYJQ 5F2EA 5KDOA 1LTQA 2QUZA 4UJ3A 2IK8A 2Z43A 4DLVA 1KZGB 1OXUA 2XX3A 4UXHA 4WZBE 2O0KA 2GDJA 1ZVQA 3BFKA 1G64A 2SHKA 2QY9A 4YXWD 4B6FA 4CW7A 1Q57A 1TAGA 2QPTA 1J2JA 1UBGA 1GWNA 4AURA 3THOA 4AYXA 2CK3A 1YZGA 2OCPA 3RRZA 2FGJA 5TV2A 2H18A 2CLSA 1VCIA 2ODWA 4D4JA 1N25A 1W5SA 1KK3A 3LA6A 5FI1B 3W34A 4JMPA 1ZD9A 6Q21A 2ZE7A 4JL8A 2QM8A 5LD2C 1G7TA 4RKFA 4EJSA 1AZTA 1HT2E 4IOLA 3ZD6A 5GVRA 2WSMA 2D7CA 2Z5FA 1O87A 1UKEA 4TSFD 4DIDA 2A5GA 1VMAA 2KB0A 5HE8A 3K70D 1FMJA 2VSOA 4W9MC 3X1XA 1RPZA 4YC7A 1UBCA 4Q7KA 2W6IA 2FZLA 1WE2A 4LPSA 2REBA 2UZ3A 4G1UC 1NKTA 2HV8A 3HR7A 3KKNA 3SJCA 2AL7A 1II8A 4PC6A 4DSOA 3BB1A 1XXHB 1XU4A 4AK9A 3WP1B 2AR7A 4M53A 4E5UA 4N0DA 5LPNA 2QNRA 2IW3A 1H65A 3UMSA 4DKXA 3SFVA 2C78A 2JIZA 4YDSA 4ZV4A 1QRAA 3REFA 1YZTA 3ZJYA 1DADA 1M7BA 2F43B 4P4TA 3T15A 3TKLA 3PUZA 3BFXA 1KO7A 3NTUA 5FTNA 4OHVA 2GTPA 2I4IA 3CRW1 4PANA 1S3SA 1Z0DA 4X8MA 1DARA 3KTAB 2VLIA 1CXZA 4AIIA 3SQWA 1S9HA 3U4QA 2AXPA 2C77A 3QKSB 4OQMA 1BMFA 1KI9A 4Q5IA 1JQJC 2GBLA 5TMPA 3E5HA 1P3JA 2B7CA 3K9GA 3VAAA 2WSSD 2VP4A 2EWWA 2IYRA 3AKEA 1E1RD 3PEUA 4FWIB 2HXSA 3FPAA 2FFHA 1KOFA 3NXSA 3K9LA 1XWIA 2AN9A 3UATA 4B3XA 1J8MF 4M9SA 2GRJA 3BE4A 1OE0A 4JLBA 4TLAA 3ZS9A 3CRVA 1E9SA 1LF0A 1SXJB 2ZI9A 5DLQC 3KXKA 1OHHD 3DEFA 3LWNA 4JLPA 3DOEA 2IWRA 4RJLA 2YNMA 1S1CA 4M2LA 5BN3A 2ZE6A 1GKYA 1N6KA 1ZNWA 1GL6A 4Q4JB 3C7KA 3ETLA 2V1UA 3FMIA 2CMKA 5AJZA 3VKHA 2ZE5A 4HATA 2EU8A 4NP6A 4PZLA 2P6RA 2R6CA 4AG5A 5AJXA 2DR3A 4BRUA 2ERXA 3HPRA 2HF8A 4EJSC 3KL4A 2W58A 2HCJB 1DAKA 2MSDB 3QOFA 4DLUA 3SYKA 4EPYA 2V6JA 2GA8A 1D2MA 1F60A 3AP3A 2XGJA 1T9HA 3WMGA 5EJEA 8OHMA 1COWD 3LNCA 2HYDA 2QP3A 2XSZD 4PC2A 3J81k 5AUOB 4M1SA 2J0QA 4BUJA 3QKRA 4JVMA 2VP9A 2R6AA 2CNWD 1UF9A 4EDHA 1W44A 4JL5A 2X77A 3ZIAA 2KWIA 2FPKA 1NSTA 1YR6A 4LY6A 4A36A 2ZI4A 4Q1DA 1QVRA 1ZM9A 5KTYA 4RD0A 4HDQB 1G18A 3QE0A 3KJIA 1AK2A 2H7VA 5ANRB 4A6XA 1Q1QA 3A1WA 4NCIA 3JZAA 5JWHA 5JEDA 3L82B 5BN4A 1E2JA 3AF1A 1IY0A 2ASEA 2ZU0C 3SJZA 1X3SA 3C15C 5KSZA 4Q01A 3W8RA 4R2IA 2XNSA 3GJ4A 2YKGA 4NZYA 5SZJA 1U8YA 2ZSDA 5BQ5A 1LVGA 4NCNA 2QE7D 4HEJA 3QY0A 4KCGA 3VMFA 3TVTA 4MRVA 4URVR 3UK6A 3P1JA 2GBLC 3E70C 1EESA 1HE8B 2X2FA 2KBFA 4LC0A 4RFSA 2A5FA 1NL3A 3TAUA 1GRQA 1X8LA 3BD9A 1OXVA 4TMWA 1GTVA 4FMBB 1E9AA 4DT1B 5JHHB 1UBEA 2OBLA 2QI9C 5L8VA 1T0JB 5DI9A 3KQNA 3OE7D 3U7GA 2XNDD 4NMMA 1GKUB 1I4LD 2GHIA 2O8DA 2ZIAA 1Z6GA 821PA 4B34A 4TL8A 4OJQA 3HYRA 4G3XA 3EZ9A 3RVBA 3UANA 3VR2A 1TU4A 4K46A 2CL6X 3BGWA 1KJWA 4LHZA 3RDPA 3AVPA 1K5GA 1S2MA 5EE5B 2ZYUX 1D9ZA 4A0GA 3PV0A 4BFUA 3IPXA 5L3SB 3QVUA 2YZ2A 4HAZA 4JS0A 3EW9A 3G0HA 5IK2A 5EP3A 3CZPA 3EC2A 1Z8FA 1DG3A 4GOKA 1CIPA 4FW9A 1OFTA 1R5NA 3QF4A 4IJMA 4HAUA 1U98A 4MQBA 3AUYA 1OYYA 4MGZR 1IY2A 3KXIA 3UKDA 1JQLB 5JWOA 1F6BA 1KI4A 1RRPA 1T91A 2GCPA 3FHOA 4JBXA 4CGZA 4GSYA 2QORA 1XEXA 3UG6A 3W6NA 4B3BA 5FPYA 4NH0A 3A8TA 2FF7A 2DY1A 4H1UA 1FTNA 1GNRA 2J41A 4DLRA 4JYBA 4UXJA 3CO5A 3ZZTA 3CH4B 3FYHA 4IFBA 4V0KA 4RD2A 3IHLA 4OQXA 2JATA 2WIBA 5EE3A 3MRSA 4CDGA 3ECCA 1TQ6A 1UADA 3SC3A 1EFCA 1GOTA 2P0EA 3B13B 1QHNA 1IONA 3B1VA 1T3LA 4RZ2A 3C14C 4WOPA 2ZRMA 5AUNB 1UAAA 1XD2B 1V5WA 1ODFA 4XWAA 2C5LA 4CT4B 4DCVA 2D3WA 5DH9A 5KUTA 3BH7A 2C03A 2FG5A 1L4YA 5EE9A 1Z06A 4QJ4A 1ZRHA 2IF2A 4EPXA 1CJUC 3FB4A 3IUYA 2WAYA 1G291 3N2EA 4Q7LA 4HZIA 3KJEA 3U5ZB 4F4JA 3TK1A 1JJ7A 5J4VA 1U0HC 3KUDA 3GFTA 4D4LA 4H1VA 1HYQA 1J99A 1VDZA 2ZR9A 4GT1A 1NVVQ 1GFIA 3EC1A 3A4LA 4M0LA 1FUUA 5EUMA 3UG7A 3KQLA 4OJKA 4EFLA 4C0LA 3OIVA 4H9GA 5KDLA 1M74A 2DPXA 3RNLA 5CYPA 4B6EA 3C5HA 1W5TA 1SULA 4TYNA 4LBWA 1PLLA 4LYJA 4C0BA 3BWDD 1SVLA 3F5FA 3WNDA 2GJAA 3ZD7A 5JFGA 1KDPA 1ZU4A 3M4YA 2WMNB 2BKEA 3ICEA 2CVFA 3OIYA 1F5NA 1U8AA 4Q02A 3DO6A 4II7A 3LVQE 2Q0HA 1SVKA 2IYYA 1E2NA 1G7RA 3GLIB 2H1LA 3LFUA 3SYLA 1CR1A 5FUWA 3SEAA 4DRZA 1HH4A 3GLHB 2PCLA 2CE7A 2WSSA 3QF4B 4PAMA 3EX7C 3ADBA 1PUIA 1E1RA 3KDSE 4IVQA 3ZVNA 4BECA 2ODNA 3EWSA 3MUFA 3SS8A 2YVUA 1XMIA 1MABA 4IOJA 4DDUA 4UNQA 1T8UA 1XEXB 1F2TA 3I92A 2QAGA 1L8QA 2J7KA 3I1FA 1L7VC 3L0OA 4NYIR 5D3QA 3T35A 1BYIA 4JLDA 5DGXA 5FPSA 4HLUA 2PMDA 1OHHA 2WWXA 4DB4A 4B71A 3AKYA 1YKSA 2MSEB 3U6KA 4PHFA 3FKSD 2IS6A 1TUIA 4C2TA 1Z47A 2ZVPX 4M1YA 3FFAA 4LZZA 2W0SA 4DB2A 2ZRLA 2B7BA 1U90A 1E2MA 5E4FA 1XD9A 1VYVA 1IN8A 4DIEA 2JLZA 2V4ZA 4FMCF 4TQ9A 2NQ2C 5G53C 1W36D 1XJCA 1ZBDA 3C16C 3WNCA 5J4KA 3QG1A 2IF0A 4IVPA 1DELA 3DDCA 4QBHA 4Q9HA 5FL7D 2BEKA 4QHTA 4GDFA 4OQNA 4FN5A 2GETA 3I3SR 1KYIA 3EPLA 2XSZA 3WXMA 3B5JA 1U94A 5FOWA 1IHUA 1W2HA 1OH5A 3QIAA 1AN0A 3Q8XB 3K70B 3MSXA 3JVUA 2JLUA 1R8SA 2LKDA 1PVOA 3C5CA 1ZM4A 5LB2A 3RHFA 1AM4D 4G0NA 2QN6A 3A1UA 5ELXA 3OESA 3NBXX 4ZI2A 2Q21A 4D81A 2DCUA 3VR3A 3C4JA 3ICQB 2VP5A 3MWYW 3KQKA 1FOEB 1W1WA 1E96A 2WJJA 3GJ6A 1N6LA 1UFQA 2J9RA 4EPVA 3OIWA 4C0KA 2QE7A 3RRNA 3CF0A 2JJ8A 3SFZA 5F3WB 4Q4LA 4BZPA 3MGCA 1N5LA 1ZP6A 4XTRA 4Q7JB 2FGKA 2B6HA 3OEED 3X1DA 1P4SA 3SZRA 2QENA 3RABA 4DLWA 4D0NA 3FKQA 2BM0A 1E2HA 2KBEA 1UJ2A 2F55A 3SI7A 2ZI3A 1KJYA 4PTLA 1KI6B 2ZR0A 4NCKA 3T1QA 4D4MA 1BYUA 2W2XA 2QT0A 5JBQA 3OE7A 4RZ3A 2DWPA 4Z1MA 4BEJA 1EXMA 3CONA 4IRUB 2F7SA 1R7RA 1XMVA 4C9BA 4E09A 1CKEA 1YE8A 4TLEA 4HAVA 3NC1C 4M4SA 1JEEA 1MABB 3AKDA 3EWAA 2FFBA 4GZLA 4NTZA 4NE2A 3CWZA 1J90A 3DL0A 2DWOA 2QAGB 1P62B 1ZUNB 2BEJA 1V43A 1XZPA 3KXLA 3VU9A 1TU3A 5FTLA 3TE6A 1GL7A 2IYQA 2C9YA 1NJGA 2C8VA 5F9HA 4UNNA 1FP7A 4A8JA 4BGDA 4KBFA 1ESMA 1MH1A 2GF0A 2JAQA 2ZSBA 2A5JA 3CLVA 4WXPA 4KFSA 1ZM3A 1R10A 3U3MA 5JMTA 2Y8EA 2FV8A 1OKKA 2OEPA 1X1RA 2ZI7A 3K1JA 4V0ME 4B3DA 4E22A 3WNBA 3BS4A 3I72A 3NBYC 3TSWA 4LWZA 2GXUA 2QTHA 2ZJBA 3A36A 5G3YA 5BXQC 4HUQA 3PUWA 3QNUA 5K8TA 1SVOA 4F4IA 3SYNA 3BBPA 3NVAA 4ZO4A 3LBIA 2DWQA 2RGNA 1NBMD 4BFSA 1O3YA 2Z0MA 1G17A 2FNAA 4NKRA 3SU8A 1S9DA 3RLFA 2B92A 3H4MA 2BVNA 4D2IA 2W6JD 5BW8A 1AKEA 1M34E 1E2QA 2VP6A 1A5TA 2ZUCA 2ZJ8A 3TSOA 3HDTA 2A78A 3BH0A 4LHVA 1XX6A 2IYVA 3B8HA 1B23P 1WQ1R 4CEJB 1NG1A 1VCMA 5IF9A 4M9ZA 1OJLA 1Z83A 2QQEA 4YMTA 2X19A 4KYIB 4O3MA 3VHXA 1DAIA 2ODBA 2O0JA 3K53A 2G0TA 3GD7A 1TQ4A 1OF1A 5FBWB 4ACAA 2AK2A 4JVNA 1DAEA 3GJ7A 3QSYA 1FTSA 5KU1A 2UKDA 4ZKDA 3VKGA 2IYUA 5FPKA 4KBGA 1KI8A 4TWZA 1KMHB 1SGWA 1LFDB 5EZ5A 4IXMA 2VHQA 5H70A 4D6PA 3TW4A 1E0SA 2Q6TA 2IYSA 1D5CA 2OXCA 4TTQA 4QJ3A 2D7DA 2F1JA 1NNEA 1CBUA 1OLOA 2JLWA 5JI2E 4DHEA 5FFMA 1TF5A 3TMKA 2E87A 2GK7A 3O47A 4PPNA 4BLOA 1P75A 2BMFA 2FSGA 2EFEB 1W0JA 3LD9A 5AJVB 2IT1A 1QHYA 4GZMA 1XNJA 2G0NA 2RGDA 2YWFA 4QGHA 1RRGA 1SHKA 2ZRKA 1QHHA 3BJIC 4LV5B 1ZCBA 1KO5A 1T5IA 1TTTA 2QEQA 4EPWA 5DIFA 1Z0AA 2GK6A 1MO3A 3TNFA 3WYGA 5KYKA 1N6HA 3ASYA 4ITRC 1P2VA 1T5LA 3BAFA 5FH9A 1OFUX 1W7AA 2OCAA 2WWHA 4ZDIA 3ZZ0A 1RE0A 4ZI3A 3LXRA 5FOTA 3AKCA 1OT3A 3BC1A 3VR4A 4C30A 3AGQA 4EKDA 3W9YA 4JJKA 3U61B 1MOZA 5KNCA 1R8QA 5GJBA 3CPEA 4M22A 4O2RA 4PHTA 5B57C 4FD2A 2BMDA 1YZNA 1OH7A 5FR1A 4DDVA 4AKIA 2VHTA 5AK0A 4OK3A 4MKFA 4NYMQ 2H92A 4XWOA 4FWTA 5JJIA 1ZW6A 1OW3B 4AYWA 1F48A 4BFZA 3X1WA 1IY1A 4HUQB 2BM1A 3ND9A 2OSBA 2CHGA 1TL7C 3THXA 3QUSA 3PUXA 5DHAA 3QPVA 4EFMA 1ETUA 2O8EB 2JEOA 2VTKA 1KZ7B 1NSFA 1JEDA 2EFGA 2EFCB 1XBTA 4GMXA 1E98A 5FUXA 5J4YA 3K0AA 1XTSA 1HV8A 2XJ4A 3OZXA 4JLMA 1LV7A 3T1OA 5H68A 3C41J 1UDWA 3K9NA 3FWYA 5JS7A 3PEYA 4X8HA 4TMXA 3FTQA 2ZREA 1DTSA 1G6HA 1KDOA 4C2UA 3K8YA 1WXQA 5EE0A 1EX7A 4ON9A 2OFXA 1Z28A 2NPIA 1Z08A 4JLAA 1G8HA 2O8FA 3KB2A 3A37A 3FHCB 3I8XA 2PEZA 4QNMA 2W00A 4QFMA 4KFTA 1GRRA 5FOXA 4M1KA 1P5ZB 4DSUA 2AHOA 4UQOA 4W5WA 1I2DA 1FP6A 2NGRA 3GMTA 1N0UA 4OBEA 4KSCA 3ADDA 1RJ9A 2CCGA 2P67A 2ZU6A 4L4UA 2JLXA 2FDCA 2P5TB 1FFHA 3SE0A 3PVSA 3A6PC 1G5PA 2A30A 2FSHA 1JPNA 2OLJA 3PEVA 4JJZA 5TB5A 2BV3A 1ZCAA 4PZYA 4WIAA 2JGNA 1GRNA 3IIMA 4QG7A 1JJVA 3F0TA 1KSJA 1P72A 4Q1CA 4A0HA 2ZJ5A 3NC0C 1RYFA 3IDQA 1QZXA 2VHUA 1AS3A 4LC1A 2UVQA 4V02A 5KO2A 2GJ9A 3MFYA 2N1BA 1GAJA 4KV9A 3CX7A 1XTJA 3L43A 4TTPA 3PR1A 4US2R 3QKTA 1JNYA 1T3HA 2QP4A 1GDDA 2ZJOA 1GIAA 2BJVA 4FMCB 3DHWC 4G5OA 2FE4A 1G8GA 2F9MA 3I73A 3IIKA 4JVLA 1RIFA 5BYKA 1EG7A 4HZUB 2PMKA 2YV5A 3WHKA 1XPUA 3I62A 1WA5A 1IAQA 2AK3A 2V9PA 2YOFA 2IBMA 4HLDA 5LD2B 3QXCA 1KAGA 4DSTA 4CRWB 1FX0A 2FSIA 2Q3MA 3QBVA 1NIJA 1G3QA 4C0SA 3B6EA 1OB2A 4HDOB 4ZDWA 3OEEA 4MGKR 2GJSA 1NN1A 2WOOA 5GJCA 4LK2A 1QBKC 4CT5A 3GEHA 3SNHA 4KFRA 1UM8A 2I1QA 3U2QA 3K09C 3KX2A 3QXSA 5M04A 2IHYA 4YONB 1FQJA 4URWR 5CLQA 5GVSA 4C7OB 1R0WA 1Z6TA 2PJZA 3IEUA 2D62A 4BFWA 2RH5A 1GILA 2W83A 3I8SA 5JZVA 2J59A 4CYMA 2HEIA 3LVRE 1U0LA 1RFLA 1UDXA 3H2YA 2X8AA 3B1WA 1HEIA 1SKQA 3AVXA 3NIBA 2VO1A 1Q20A 1R5BA 1N0WA 1G3MA 1Z29A 2OUKA 2VSXA 3PUYA 4LCBA 4N3NA 3GP8A 3X1ZA 4DBLC 4K8OA 2ZVQX 3P4XA 2PJRA 2V3CC 3PITA 5H8WA 3P26A 1PLJA 4QOSA 4V0NA 4Q4HB 1W36C 2WWGA 3F3YA 1XXHE 1C1YA 2PL3A 3PFIA 1PV4A 1NMZA 4ZIRA 1E9FA 1TF7A 5EXTA 2ZS9A 3K9HA 1IOZA 2ZRCA 1OH6A 1FPMA 3N2IA 1IN5A 1IBRA 1G3RA 4AD8A 1WRBA 4TMKA 1NBMA 4JBYA 3S1AA 4A4DA 5UKDA 1GSIA 5E7JA 5CIQA 4Q1EA 5BN5A 3WBKA 1ZMXA 1QHGA 3IO5A 1KKLA 3EPKA 3RANA 5FBLB 1P2SA 2EQBA 1S96A 3OIUA 1SXJC 5TXGA 4PFSA 1SVSA 1TX4B 1HE1C 5HCNA 1Z63A 2XITA 4A15A 4EAQA 1W48A 3V9PA 1NVUQ 2HF9A 3SDZA 2PX3A 3UMRA 3AGPA 3GJ8A 2HLDD 521PA 2BDTA 2WOJA 3EASA 2R44A 2A9KA 1CR2A 1SKYB 2ATXA 1Z2CA 1ZC3A 1Y63A 3T1TA 4Q9JA 3CF2A 4FCVA 2C98A 1MR3F 1NY5A 1XF9A 2FJUA 2CHQA 1RW4A 4HB0A 2QQ0A 2ORVA 1IXSB 1XMJA 4EJSB 4QHSA 3Q72A 1Y3AA 1R6BX 1ZAKA 4IDPA 3RWMB 2WBLC 4RSGA 4LYHA 2OAQ1 4PZZA 5DN6D 3UWKA 1SXJE 3CRMA 3QENA 4LGMA 2G83A 1R0XA 4XVQA 5BWMA 5HCIA 1JB1A 4URXR 2WPDD 1A7JA 1KDRA 3CM0A 2F3TA 2ZXUA 3ZVMA 1ZIPA 2IYLD 2RGAA 2NZ8A 3W3ZB 4AY2A 4YQFA 4PHHA 4MKHA 5C4GB 2J0VA 1FQKA 1II8B 4BFTA 4CZ2A 2JLYA 3EPJA 3W8NA 3GJXC 4EUNA 4QRHA 3LBHA 1K8RA 2PT5A 4NONA 2NO6A 4PPQA 3DKVA 4LRWA 2OV2A 4NDZA 4TZ6A 4PSVA 3AB3A 1DAHA 1ZUIA 4HAYA 1XMSA 3HU3A 4US1R 4BLTA 4F91B 2IEZA 2V7QD 2P6NA 3D7MA 5EZ6B 4ZDJA 1RC8A 3CRRA 1P9NA 1N6PA 4QBIA 2NZJA 1Z0JA 1TQ2A 1J70A 1ZD1A 3ADKA 5TVKA 3W90A 4EQ6A 3B9PA 2B8TA 3TUIC 2YYZA 3WRYC 4QC2A 1Z2AA 5JRZA 4ESVA 4JIMA 3ND8A 1AS0A 3U4QB 5JWRA 4OI0A 2OE2A 2RGBA 4HYYA 2CHVA 2ZSAA 1E4YA 5FR2A 1OPXA 1ONBA 2FSFA 1VYTA 3Q85A 4DWJA 3EA5A 2FFAA 2YJTD 5KHOC 1FNNA 5G41A 4OI1A 5DO9A 1M1YE 4QXAA 1G5RA 4RD3A 3K0FA 3P27A 3HWSA 4YMUA 5CDFE 4NCHA 4FINA 3TW8B 3U7EB 4K81B 2ZM5A 2WAXA 5D3MA 1KHTA 2GCOA 2GCNA 1UEIA 3QPUA 4ASUD 2G1JA 3OF5A 1PLKA 3C8UA 1VCOA 2RGCA 1DAGA 1JR6A 4B75A 2HT1A 1E0JA 4LJYA 1IJFA 1TEXA 2KI5A 2GILA 1BH2A 1ESNA 4LJ4A 1QF9A 2WKPA 3R9WA 2R62A 1NBME 1F2UA 4LJ6A 4Z8XA 2ZSEA 2BIFA 1VHLA 4QM6A 3VX3A 2YOHA 1KK1A 3CIOA 1RRCA 1DAMA 2C96A 1OB5A 3MMPA 4YMWA 3RC8A 1L4UA 1LW7A 2OAP1 3IO3A 4JYCA 3THYA 4MDEA 1TPZA 4ZPXA 3QKRB 5EP2A 3Q7QA 4AKEA 1KY2A 3KFVA 4Z8YA 1Z0IA 3BORA 1E2EA 2PZGA 1GZSA 4MKIA 3AV0B 4YXWA 3TR5A 1DO2A 4LX0A 2QRNA 3JZMA 1SVMA 3AVUA 5AJYA 2JJ2D 2QTFA 4CEIA 4GNKA 1N6RA 3WHLA 4IHQA 1YR9A 2BC9A 1G7SA 3LAWA 1X1SA 2BWJA 2G88A 5FOUA 4UNPA 2HJVA 4MYTA 3R9IA 1II0A 2WWIA 2GZHA 3KKMA 1T0HB 5FBRB 3W5JA 5AUPB 2O8CA 5A0FA 1ZNZA 2A2ZA 4GP7A 2IUUA 2D74A 3AVQA 3I4LA 1K6MA 3AH8A 1XD8A 4TSFA 4MDFA 3CB4A 1GNPA 2G6BA 2K5UA 3TRFA 1EWRA 1SVWA 1W4RA 1PZNA 3B78A 5JEEA 2QPOA 3LY5A 2ZRAA 4R9UC 4B48A 1JXOA 2ATVA 1W0KD 4RFSB 1GUAA 1WB9A 3QPWA 4DCNA 2WV9A 1G5TA 2CXXA 4G01B 3U3RA 4W7SA 4Q9IA 2CJWA 4M1OA 2IX3A 4GPTA 5EP1A 1QHSA 2QL6A 4WBSA 1U8ZA 1XFAA 2QSZA 1AQYA 4HAXA 4LYFA 3CWQA 2OILA 4IEEA 3THWA 4BEBA 5E7MA 5KOYA 3RS3A 3MAAC 5E95A 3RS7A 4V03A 3TBKA 4A9AA 4LUCA 3AVYA 3LDAA 3BRWD 2GESA 2EW1A 4LYAA 2GCOB 4PC7A 4C3ZA 2Q3FA 3ADCA 3WBJA 1XP8A 2Z4RA 4B47A 3BB4A 5FUYA 1N5JA 3WYAA 2QT1A 1GITA 4V0OA 1AJEA 5HTKA 2X2EA 3CBQA 2XXAA 2RCNA 4DEXA 3BIFA 1M7HA 1QG2A 2VF8A 3EARA 1TMKA 3NH9A 3HP1A 1G41A 3WY9A 4QHYA 3MJRA 1G16A 2R6GA 4UNSA 4V0MA 4N1AA 3LH5A 3TR0A 3HR8A 3ZQ6A 4AWXA 1Q3HA 1FUKA 4BE7B 1YRAA 2A7QA 1II9A 1KSFX 1G19A 2QMUA 4JT4A 4PX9A 5EQTA 4M9QA 2YOGA 5L3RA 1EFTA 1FNMA 1KMQA 1GL9B 2EYQA 3PENA 2GJ8A 2Q9AA 2W2TA 5FOVA 4RZXA 4C0AC 1KI7A 5JCZA 1YZLA 3RRMA 4ZDKA 4D82A 4PO1A 1OFIA 2ZSFA 1AS2A 3EZ7A 3GFPA 4KAXA 1G4AE 2IS1A 2HLDA 5TY0A 3UIEA 2QRZA 4MUAA 4L5BA 2WJIA 1DEKA 5FBVB 1H8ED 2KJQA 2VHJA 3M6AA 4F93B 4OI4A 1VPLA 1COWA 2IUSA 3SN6A 1L2TA 5DSZA 5JI3E 3RRYA 5KNBA 1WBBA 2ANBA 2CNWA 5DN6A 5C1BA 1KK0A 2G77B 2ZITA 2YWHA 1DBSA 2WPDA 1MKYA 4TL7A 3U7FB 3TH5A 4Q9KA 5HZHA 1KNQA 4A6PA 2VIIA 4WZ6A 3ZYCA 3D8BA 2C95A 3SHWA 1N0VC 1E79D 4JVSB 4BWYA 2CJWB 1SXJD 1CP2A 1XEFA 4NYIQ 3CNNA 1AGPA 3KFXA 3NDPA 3GLFE 4A0FA 1K5DA 2ZTSA 3THWB 1XTIA 4GP6A 3T1VA 4CEHA 4NBSA 1ANKA 2ZRFA 3NG1A 3RSOA 3ASZA 3SJAA 2ZQ5A 5L3QA 1CJMA 2V7QA 1NKSA 2FPLA 2WJYA 1G20E 1W49A 2D06A 2EWVA 4HSEA 4RVCA 3EIEA 5GJWC 3FVQA 1KSHA 3EZ6A 5HPYB 4BPBA 5B64A 2QGZA 2F1IA 1RKBA 4EPRA 2XOKD 1OXXK 5B30A 3VNVA 1VG0B 3W3AA 3LLUA 2BOVA 3TUZC 3LX5A 2RAPA 5DISB 3ZGXA 4HB3A 2QGNA 1NP6A 1VIYA 2XNDA 4XWKA 4KITB 4DDTA 1OXSC 2CE2X 1DVRA 4Q66C 2FWRA 3AP1A 5FTMA 4PPGA 3MD0A 2R8RA 3W6OA 2GAAA 2GVDC 1A2KC 1F2TB 4Q18A 2QROA 1NIPA 5AUQA 1P9RA 2P5SA 2IEYA 5AWFC 5GADl 4MRNA 4D26A 4XIGS 4ASUA 3SQXA 1PUJA 4N0EA 3QI2A 1G7CA 2DHRA 4A1FA 1FMLA 5HR5A 2H8KA 3IIJA 2ZETA 2IC5A 4Q1FA 1G6OA 2PH1A 4G5GA 1KSGA 1P9WA 3PCRB 4LJ9A 3U3KA 1G4UR 4Y0VA 3TUJC 1EX6A 4TN1A 1EWQA 2ZEJA 4KHZA 2J0UA 3TAHA 4WW0A 4FI3C
chains in the Genus database with same CATH superfamily
1QRUA 1H4TA 4MAMA 1GPDG 4ZI7F 4JLJA 2WF5A 3CNQS 3PXCX 4L0QA 4AT1A 4NBNA 1VZ2A 3DXZA 1UJ4A 2NO1A 4IJ6A 3M6WA 2XWSA 2I4LA 4L72A 3ITKA 1JIKA 2J3QA 1ZIDA 3LSYA 4JKIA 1XWWA 1XTRA 3O9ZA 5JAPA 4WK6A 3LP8A 1D6MA 5AMXA 3SK0A 3ZE0B 2XZOA 4C3UA 2MTBA 4CQJA 2WZBA 3HPQA 4BBPA 4Q3AA 2OHOA 3JYNA 1ESDA 2P2NA 2R85A 4XUEA 5K2OA 1MV5A 1A82A 4JMLA 5K3FA 1XTQA 2IOFA 2H06A 3QHAA 4Y9DA 1OWPA 2HRZA 5LYJB 2DBQA 4G89A 1R66A 1GO2A 1H9AA 1P8JA 3KQTA 4J0GA 1FP1D 3DZKA 3AQIA 4PIPA 4PU0A 5H7XA 2OVFA 3ROGA 5I8WA 1LSOA 2Y76A 4BJ6A 1Q7CA 4ROSA 1EA5A 2UVPB 2CVZA 1Z2PX 4D3YA 5L3VA 2PA3A 5IH7A 4MPPA 3PC6A 1BFKA 2QL9A 2IA5A 5AFSA 1TM5E 3FE2A 3AMVA 1I2AA 4O4JA 3N75A 5TS2A 4ZHQB 1H1LA 5LQAA 4CEHB 4C5CA 1GUBA 1UEJA 2RARA 5AK5A 2WWYA 1TCUA 3PLNA 4U1RA 1K8YB 3I2KA 3IHKA 2FQWA 1TUBA 3DBLB 3GY0A 1AN9A 2JAUA 3GI1A 4FZ3A 2IVZA 4OH1A 4R98A 4Y0AA 5H4GA 3LX6A 4LSWA 4BLRA 5CFOA 1T0PA 1BVYF 4GMHA 4L8GA 5JD3A 4GOXA 2JH8A 3I45A 1P2UA 3QF7A 4XLZA 3QFTA 3WSVA 1IQRA 1I6LA 1RP1A 4AP6A 4PNEA 2A5YB 3N0TA 1JAIA 4UNIA 2QMZA 1DXHA 1JXMA 1PR4A 3JQGB 3PXUA 4D0SA 2CB0A 2I6TA 1QSGA 4TXHA 1MJHA 5JJCA 1CT9A 2EZ8A 3REOA 3MWKA 3GUHA 2O54A 3A05A 1OX4A 3D6MA 3PX7A 1HE5A 4YEDA 1AZLA 2ZBFA 1PO7A 1YZYA 4ND7A 4JDUA 2X7XA 4UVIA 3CR8A 2PRJA 2CJPA 2LCQA 3JQ8A 4GC9A 1E3WA 4ER0A 1UZAA 1CPYA 1TUEA 3EXG2 1P18A 3KVNA 4H6XA 1D7AA 3QX3A 4HWRA 3UICA 2C2BA 1O58A 2RGUA 2JFOA 1C3XA 5BSEA 3A25A 1E3MA 5AXDA 5EEHA 1A5SB 1SCAA 4R9SA 2RAVA 1P73A 1J5PA 1T24A 3H0CA 1GARA 4J03A 2VHEA 3CSDA 4P3OA 5FV7A 2F9LA 2JLRA 1EM6A 4JBLA 4EELA 5KTPA 1JQAA 4NV3A 5C51B 2QHXA 2ARKA 3KT8A 4YJ2F 1GVNB 1GN9A 3EXIA 3IH5A 4YQZA 5C9ZA 1FFGA 1JBQA 2O2EA 3DDWA 3LHSA 1YCHA 4K0KB 3EVTA 4Y2HA 1ZZGA 1Q0UA 3B12A 3GUUA 2GEJA 2Z9BA 4J3FA 1NRWA 4J0DA 4UHBA 4DQLA 1ES9A 1I0IA 4JT9A 4NEQA 3UXEA 4HDAA 4HY3A 1ZU5A 3GDHA 1XXHA 3BGSA 3ENKA 1E20A 1YU9A 3L7CA 1DOAA 3KZOA 4JL6A 4DCSA 4U5XA 3PTAA 3QXHA 3WIBA 1M6WA 4JWKA 1ZINA 2C59A 2R1TB 3T5GA 3V7YA 4ZAWA 3UNXA 1UZNA 1BJKA 4NBLA 5I7AA 1LEHA 4BLWA 5BWMA 3JYHA 3VR5H 1SUIA 3N87A 3P5SA 1FVHA 2YJ3A 3TM4A 3T52A 1LH0A 1TJPB 1E94E 2F43A 3DE3X 4I3GA 1Q92A 3TQOA 4LCJA 1BG6A 1C9KA 4ND3A 4DLPA 5FA8A 3PYLA 2WAMA 5FL7A 4F1JA 2C3PA 4MVCA 5F2NA 4E2WA 2RC5A 3EUAA 4CCYA 2CFTA 3WBFA 1N7HA 3T7JA 3HKBA 3CUSA 4W99A 3ZZMA 4FDAA 3ICWA 4WAUA 5J2UA 4U2EA 1WU8A 3L0DA 4PR0A 1VP9A 3QFRA 4EMSA 3GWGA 3QLTA 3U44A 1ZLXA 1M6VA 3FNRA 4NU0A 4Q47A 3FYUB 4JSRA 4ER7A 5IKPA 1KFEB 4FHEA 3SVZA 3H99A 2P6MA 2Z56A 3Q7RA 1AUPA 4R3NA 2G9NA 3DMFA 3WMRA 4R1PA 3N5KA 4XSGA 4BY9E 1EKXA 5JUWA 3D0RA 3NHWA 3OY7A 3CZMA 2DETA 2Y0EA 1O5OA 4U9IS 1MQAA 4W5RA 3EZYA 4N41A 1K5PA 2PZAA 3H05A 1SMKA 4N9QA 1BXGA 1PJRA 3U62A 1WXGA 4JP2A 4CCSA 1W47A 1B42A 2DUMA 4M8NE 3LHIA 4DA4A 1THTA 1E3DA 1RYDA 3B60A 1H8HD 2PLFA 4G56A 4LXUA 4Y98A 3AB8A 4H17A 4QYTA 2OV3A 4Q4JA 3BDVA 4R1TA 4YJ3F 2QZ9A 3ZW8A 1C4OA 4GUDA 1U02A 3F6CA 3FR8A 3EXHB 4EW1A 2XDAA 4D7AA 2JJ1D 2ZKLA 3UJ8A 1KEPA 5AKYA 1QR2A 1ZA2A 3ZWOA 1FZTA 5C32A 4WT7A 1O2DA 1RRFA 1SZPA 3GFRA 2BCGY 3E9NA 4MV9A 4A2PA 4AUNA 4OI2A 2XOKA 4REQA 2C2KA 5DM0A 3KKQA 1ITZA 2PEYA 2Y9PB 4TZKA 2GM5A 2H4YA 2OO3A 3R40A 4GPIB 4IOKA 3D7KA 4FYVA 4WTOA 2C99A 4PSUA 2AN1A 5I01A 1ECBA 3R0VA 4J0QA 6ABPA 4X8OA 4BNHA 5ALLA 1ODKA 4ESHA 3D3QA 1WV0A 3K2IA 4QDZA 1XJ0A 3L7DA 2CMGA 3OZVA 5TIIA 4AO8A 3FNQA 3QE3A 1VGVA 1E2PA 3G0BA 3LV8A 3UN1A 4IFEA 2QMHA 5CEJA 2CNKA 2WFLB 3F8SA 3OZRA 3FNEA 3FYDA 2VCYA 1L0BA 4WXRA 4WZAE 3PG5A 1G9XA 1TW3A 2R96A 2QTMA 4G4SP 4MV3A 1T0UA 4FFWA 4O1MA 3ZK8A 4DJAA 2OY0A 5DNWA 1P45A 2PQ2A 3O8QB 1LNSA 1XLUA 1FDTA 1R5OA 3QFHA 1U7XA 2D2FA 4PXYA 4ZD6A 5IDVA 4AG6A 5CDFA 2EFYA 2O8FB 4V24A 3KSAC 1TK2A 1YUMA 3T7CA 4TRJA 1C3VA 3TCNA 5KYTA 1PFGA 1GZ6A 1J5XA 2BZ1A 2VPPA 2YL2A 3UMBA 2GRAA 3UQYS 2BBOA 2XA9A 4HKTA 4CKXA 2EFDB 2VBFA 4OHCA 1USUA 3RUCA 3IA7A 4FT4A 4OUKX 2KE5A 3JXEA 4N8DA 4JLWA 1NHWA 4WVLA 4MDYA 3AY6A 4RD6A 4R1MA 4ZK6A 4BTEA 3U60B 1VRWA 2VATA 3SBEA 1K2VN 1QOQB 2LPMA 4KDRA 3V5NA 1TB4A 1SBYA 3GFVA 4I0WB 4TXLA 3TDMA 4IUCS 3DCNA 4CV1A 1OFHA 4YCMA 4P1ZA 3UFXA 4EAAA 1VMEA 2LE0A 4US0R 4B2IA 1XPJA 1H1TA 3KE9A 3FSRA 1Q3TA 2FEWB 1BW9A 1C8LA 1LPMA 3NORA 4EUKA 2QLNA 4AJIA 4QT4A 1X1EA 2XB8A 3BYZA 5I7SA 1CCWA 4G8BA 1SHUX 2BR5A 5AOAA 4EG7A 3LO5A 2YQ5A 3FRHA 1JHXA 3RVMA 3IXQA 3OCXA 5JJ5A 5LQMA 3KOUA 3ICCA 4E08A 5L3SA 1KC1A 1ZYUA 1T9DA 1ZIOA 1CZKA 1X7YA 4MVJA 1VYUA 1G8KA 3DR3A 3L8HA 4Q39A 5AM1A 1JHOA 4ZI7B 3MWEA 3PZRA 4EKIA 5JO0A 1O96B 121PA 4RW0A 3ZHRA 1PTKA 3IGFA 4LXYA 1Q84A 2WI8A 3QSGA 3RGGA 3C4QA 4CMAA 4JKOA 1I4TD 2HMYB 3U4IA 2XR1A 4BMNA 4S0ZA 3NHAA 3RASA 1LI4A 1FX0B 1K3TA 3HVHA 3VU1A 4ZJZA 5IUJC 5I45A 2EVWX 4B32A 2F1HA 2X4IA 4OHPA 4CMHA 2I1VB 2H7CA 2O2HA 3C6BA 3I52A 5EZYF 5K0LA 3UJAA 5LN1A 3EUEA 5IZCA 2J3DA 5GONF 3TPFA 2Y1LA 3L49A 3NNNA 4ZYVA 1HLFA 1TA0A 4K87A 2IYNA 1KGDA 2C97A 5AD1A 2YWXA 1KKMA 4YJFA 2VSYA 2MSNA 5FULA 4OMFG 5JPIA 2PBZA 3W5IA 4RZHA 4B7AA 3KUCA 5C31A 4OREX 4OFXA 3BXOA 2I22A 1OLSB 3OQIA 1YBFA 1Q7GA 1CRQA 3VUEA 1NPDA 3JX9A 1JDSA 1N5KA 4AF8A 1EP2B 2IHZA 3RIXA 1FUYB 1D2HA 2UZIR 4JNCA 5EFOA 2BMWA 1XAIA 1Z37A 4ZVUA 2I3BA 1T35A 3MIIA 4JXZA 2NNLD 4MR9A 3K72B 3GEEA 1GGMA 2AF4C 4JKYA 4E1VA 2CVHA 1QJCA 3MINA 5FI0B 1XNGA 3S27A 5FUBA 3COYA 4K40A 3ZU4A 1NVBA 4CI9A 2Q6IA 5M2QA 1WOMA 3LQYA 4R2XA 2AWOA 4CE6A 3BE6A 2PUHA 2RB5A 1KYXA 3OFND 3RK0A 2WZCA 3ZCVA 4NCJA 4QUIA 4UUAA 2C2XA 4D4KA 4KI0A 2P4QA 3IURA 4RUKA 3IQXA 2OHHA 3EIFA 4WCDA 3ZV7A 1M54A 1R4NB 2OD7A 1LPPA 4N7JA 2CHEA 4QKQA 4TWAA 5E8RA 2VTBA 4CFZA 2OO7A 1UUFA 2VF7A 2BEUB 2OA0A 5LQKA 1HWYA 2VJNA 4JBHA 3VJKA 4DV0B 3QVVA 3LLSA 2F90A 4Q00A 3EXEB 2BJHA 2V55B 4J49A 2VUHB 5FLXA 1SOMA 1B8PA 4KLAA 1SBHA 4WOBA 4O0LA 4RX1A 1JLLB 2JBAA 4MQFB 2C9OA 4WE3A 5B2ZA 2WUEA 2E4UA 2X4DA 4HDCA 3NFRA 3R7AA 3TDKA 2HR1A 3GGSA 3K1ZA 1AD2A 1RM4A 4FJ2A 4RK5A 3NJ8A 4QEKA 5IU6A 2ZAIA 2AUTA 5TJHA 3TG2A 2AHRA 1IOWA 4FHCA 2YIVX 3CEJA 1T3SA 1V8ZA 1ZSYA 2PH5A 3D0QA 2NV0A 2OFOA 2PJDA 3HCFA 3GEIA 4YJ2B 1HMYA 1H2FA 3ZWPA 5A4AA 4LWOA 3JALB 3PQCA 4X3OA 3NDBB 3ILSA 3MJEA 4NFSA 4LMPA 3GLIA 4RVNA 2WJWA 2PQ6A 1SUWA 1LJUA 4BAGA 1DT5A 3HJBA 5K0JA 4W7IA 3AZPA 3ZD9A 1CE8B 2BPOA 1HE3A 3GLHA 1XTVA 2PMEA 3TSYA 1B4DA 3N2NA 1WXEA 2P3QA 2O4UX 3QVJA 1JKXA 4XDZA 3D3WA 2RSLA 3OBBA 3DFKA 3HU5A 3Q7PA 4GLBA 2XCLA 3AIMA 3VPCA 5BXYA 4XVCA 3TXAA 1N1DA 1NN0A 1EEXB 4YAWA 2E6UX 5HKKA 4QU8A 4F38A 5LL6P 4AQYB 2OENG 4ESEA 3L7LA 2CLKB 3RVPA 3G5LA 3QUQA 1WXHA 3G2JA 1ZOSA 4ZVLA 2QPAA 1FYXA 3LHKA 4X1YA 4B1FA 2BGUA 2BR3A 2ZIEA 1GXSA 2VXCA 4OIMA 1U7DA 4CG1A 4GPZA 1JEJA 5IJ9B 2FDRA 5JXJA 4UATA 3CR3C 3KV1A 3FLBA 2UXCB 4OB6A 2QOEA 4WCFA 1DO0A 4RXUA 2NXCA 3GA5A 5MGNA 1IM2A 1RRKA 4YRRA 2QRKA 2GBFA 3ZXIA 3AL2A 3OKFA 4MZXA 4ZRNA 5HUQA 4Q48A 3NTOA 5E38A 1UBUS 3HH8A 4I14A 4KE9A 4A92A 1PNTA 3JASA 1X7WB 4KSBA 5KDDA 3EGWA 2BKXA 4Z4GA 1G20A 5ALTA 4Z9BA 2YN0A 3KT0A 3HUDA 4ZTZB 1MO6A 1WM1A 1Z75A 1ADJA 3DZ8A 3T1NA 2KPOA 3RAPR 3V1UA 1NONA 4FCWA 1ORIA 3P20A 3BD6A 3KJXA 4MRMB 4WN3A 4QL3A 1L1FA 3OM0A 4P7FA 3NJRA 3WLIA 3GNTA 3KU4A 1DAFA 3GWZA 2R60A 4AC9A 4DJTA 3CT4A 5DI3A 4NL4H 4JASB 1W6RA 4PXAA 3AVVA 5KNDA 2W2VA 3EWIA 5A62A 5D3MB 1L8XA 1TQHA 4QYIB 5HUJA 4B6JA 3CVVA 1RQ2A 2MR6A 3VSAA 3L7MA 1WUIS 5DRTA 5J4HA 4YJ3B 2ZDHA 3Q3EA 1LS6A 1SFRA 1Y6RA 3EC7A 3VOAA 3PXAA 3OLYA 5ALFA 2QZJA 2QW8A 2VXOA 1NI5A 1L7AA 1JHUA 4IZOA 5GGYA 4D79A 5JNRA 1MIOB 1DEXA 3A10A 3O75A 2DFTA 4RA9B 2K6GA 4H2DA 5BN1A 1SG9A 5KREA 2LUOA 2JPDA 2AFIE 2HOQA 4OP2A 2BM9A 5IT4A 2YFQA 1KQPA 4QUDA 5J58A 1AV7A 2QX9A 2CKMA 5D87A 1RHQA 1A2OA 3P0HA 3KETA 4MSUA 2AVDA 2PZFA 4IIBA 4BBJA 3HR4A 3L7KA 5NLLA 2A0WA 2WJHA 4Y9RA 3MJHA 5EJ2A 3VHLB 4KYTA 1AMNA 2RKOA 1UBSB 1RWBA 1MO5A 5HWSA 1AUOA 3GYGA 4BVFA 4I8IA 4IX9A 3CNLA 4MR8A 2FQQA 1MZVA 3AY7A 3PNLA 2V9ZA 1GKIA 1DBRA 2ORYA 2YYYA 1L5NA 3KK0A 5J1SB 3HXMA 4WXMA 3A1TA 2ZDQA 3PT9A 3RWBA 1CR0A 1HFWA 1R4AA 3PHLA 4X60A 2IXGA 2OZEA 2ZWMA 2VF2A 1B6GA 3I37X 1SCUB 3LSTA 3UY4A 3GOHA 3A9VA 4R5HA 3MBOA 5FTWA 1Z0SA 4A82A 3LQRA 1QVAA 4JR0A 1MQ9A 4GEKA 5FTKA 1E8DA 4M54A 5IT5A 1XTBA 3IBCA 3VYVA 4CEIB 2WW8A 4YYZA 1L5QA 3ZZNA 1B43A 1ODIA 2XUJA 2XADA 5FBQB 5AHRA 2CJYA 3FFXA 3K6SB 3MJ4A 2B3TA 4WCFC 4XGRA 1AQJA 3O8OA 1RQ7A 2X0NA 1E6KA 2RMKA 2QL7A 5EPOA 4F2PA 1AK1A 2F8TA 2O8CB 1WXWA 3CF4A 1DJNA 4WI1A 3PPIA 4NARA 1VIAA 4PQYA 2X0DA 4P22A 2GBCA 2X3FA 1E58A 3BK7A 3QW4B 3T06B 1AKYA 1VIMA 2B8WA 3K20A 3E2MA 3VDRA 3CEAA 1PNRA 2JIBA 3X43A 4WASA 5KNBH 1QGED 1KR5A 3NB0A 4Z4HA 4EX6A 4HH3C 3AETB 4WLUA 3SNKA 1M33A 2AKEA 4N54A 2Q2NA 1FEZA 1V6CA 1Q91A 2QG9A 4O25A 1WXXA 3ODGA 3K70C 1V4BA 2XTZA 3RARA 5E6SA 4ILEA 1G1MA 3SHFA 1TYZA 2HU5A 2GO7A 1Z5ZA 5GY7A 1CW2B 3R0QA 1PL6A 4JUDX 1PFUA 3FTEA 2CDCA 2NTYC 2C2HA 3A1CA 5U4XA 1FFBA 3IEPA 2E4YA 2XGGA 3T34A 5HM6A 3A06A 3QUAA 4K6KA 2Z8YA 5JCJA 1I7PA 3EIHA 4BRSA 1E2LA 5M5BA 4I1SA 1BWPA 2BMJA 1CJKC 4BE4A 3IPLA 1B14A 1ZDMA 4BCDA 3IKTA 3PC8A 1TCAA 3SSMA 4DCCA 3DPUA 3MWJA 4TS1A 1AO3A 1V4NA 3IV6A 4JLKA 1OC4A 4YJKA 2E18A 2WMOB 2YMLA 3HADA 4QAQA 2XVMA 4R2JA 5E9AA 5LMUB 3DZJA 1KMHA 3UENA 3F4BA 3AERB 3A9SA 2RHTA 1VGQA 1VFNA 3QWHA 5EZYB 4E5MA 3IEVA 1TF2A 2OCDA 3W4IA 5GONB 3W3AH 5F77A 3UT6A 3EEFA 2A9FA 4EI2A 1KU0A 3OCZA 2GNOA 4YJGA 5AI8A 3TOZA 1D4ZA 1VIDA 2B2CA 1KDTA 3GJ0A 3OFVA 4AKGA 3OZWA 1E4EA 1KEVA 2QR2A 1QXSA 5J2UF 3TTSA 1TGVA 1YRBA 2DECA 3AFOA 2H63A 2DOKA 3BWBA 3SJ7A 3A4NA 2NSJA 2P4SA 4PTYA 4ITUA 5A5EA 1JKMA 1NUAA 1EM8B 1JN0A 1O94C 2GN1A 3DW1X 4HGZA 3UOWA 1F6WA 3W5VA 5KVCA 3PXGA 8ABPA 5KYYB 4YAGA 1P1FA 4POAA 1DPGA 4Q82A 5BT9A 2Z5VA 2QMOA 3BJMA 3OMLA 2ZCJA 3REQB 4AKTA 1GA1A 1M2JA 1RMQA 2JIZD 2FY8A 3EVZA 1AXRA 3EBPA 3ON5A 1PRYA 3L93A 3MMZA 3TM5A 2RHGB 4AY3A 2XI4A 4A2QA 3OU7A 2JLCA 3VZDA 3UJNA 1AKVA 1J8YF 2PG3A 3FWKA 1Z07A 4JOQA 3T0FA 3UAXA 3TIFA 1NR1A 4IGIA 4AZ0A 4Q21A 2IXAA 3LWDA 4XLLA 3VO1A 1UZLA 5JDIA 2NUAB 4OHZA 1YBHA 1JT2A 1WWKA 4MS1A 4P84A 1OX5A 1QHXA 5KEIA 3ME5A 1T43A 3TCKA 3MERA 3GA0A 2RK3A 1XZHA 3HE3A 3O4JA 3QEJA 4ZMBA 4G37A 4WJZA 1UP4A 3OC0A 4RQBA 1P81A 2X9GA 1YBAA 4TTTS 2HA7A 2H9IA 3STVA 4FZ5A 2RHRA 3KQOA 3OEHA 3I5MA 3NIGB 4JUBA 2H1IA 2FUG6 3VPFA 1T29A 3R3WA 2HMSA 2OB1A 1UMDA 4ECEA 1BAPA 4HRVA 2J3KA 1DUIA 3FUXA 3MB5A 1RM0A 2XZLA 3NBFA 4EF5A 2O8EA 3I4CA 1XVAA 1AOXA 3O8BA 5IAEA 4QGAA 2JJ2A 1JPJA 5HK8A 3LLVA 4F7DA 4AN0A 4TLDA 2VYFA 3EF3A 1JW9B 4L5CA 5AI6A 3C87A 1U2EA 4KWEA 4DCGA 3RNOA 1EXNA 2ANCA 3CRQA 3AB7A 2Z95A 3FD8A 2PIDA 3JQDA 3HEMA 1PK7A 2B83A 4OXYA 4V2UA 5ARCA 3PC8C 3VH3A 2H1OA 2V03A 3X0DA 3SHTA 5JJBA 5LB4A 3TQCA 3D8HA 1TO2E 3IMFA 1LKZA 1HNZB 2RGEA 3AESA 3IDAA 3R8FA 2DP4E 3TGPA 4JP5A 3RG8A 3TZBA 1AIPA 4K2HA 4RD1A 3LDHA 1WBDA 3NPMA 1JVBA 4ADSG 4I1VA 2X2PA 3BGOS 2IPLA 5FO1A 3WFIA 4NYMR 3GGGA 2PHZA 4GVXA 2E89A 5F23A 1WZUA 2ZIVB 3P9CA 4TLLB 2JCGA 1BMQA 4KAJA 4AMZA 3FTNA 2P68A 3R3HA 1JV2B 2NMVA 4OJNA 1YJQA 3DMPA 3UM9A 3HCAA 4L3WA 4CDNA 3Q87B 1JR3E 4M87A 3VJMA 2HRBA 4FGUA 3DT8A 1WY5A 2JGFA 3QP9A 1P6XA 3G17A 3IDFA 1F3OA 2UU9B 1CULC 1MJFA 3AFNA 4JH0A 2K87A 5FKJA 3SZGA 3ZNOA 3N70A 5DEOA 3G1UA 4DZTA 3U48A 1J21A 3GVXA 1VFPA 9MHTA 5CNIA 5FLKA 3QV2A 3H6HA 3A6DA 3RTAA 3DAFA 4L6AA 1T6ZA 1BOFA 2X0RA 4PYNA 4IJKA 3PHJA 5DM1A 1ILEA 3D81A 4TL6A 5EMKA 2XEXA 4XZ3A 2XRMA 3HUFA 2QYTA 5CCBA 1UZUA 3GUYA 2VHXA 1SIUA 3HXOA 1VJRA 1YAHA 4KK4A 1IYZA 3U3DA 1G8FA 2CD9A 4EPTA 1T26A 3IAM1 4FCTA 4L9SA 2G67A 2MIIA 4UAGA 1CUIA 3ETDA 3WBBA 5DYIA 2PUFA 2HJGA 1QQ6A 3S99A 2D8MA 4HZUA 2JG3A 4YMVA 4MVJF 2ADMA 1UAYA 1NU6A 3LUJA 4Q19A 3HB1A 2OQIA 2PD4A 5ALRA 3L4KA 1NY6A 1CZLA 1K0UA 3NAQA 4TN5A 4IDHA 2X0FA 1JDJA 1IE3A 1N8TA 3FAKA 3FZYA 3WV4A 1MB3A 4N40A 1REQB 1I24A 3KVOA 2Y1DA 1XTZA 4UMEA 2HCBA 2RG1A 4QJ5A 2GYVA 4WPGA 1OWMA 2VZ0A 3L7IA 5DNCA 3PHCA 2QSUA 1W59A 1IBCA 5CVJA 3ACBA 3WNZA 1FC0A 5HBGA 4I99A 3DOFA 4C43A 5EHGA 3HG7A 5LOVB 3H5OA 4G65A 5K3FB 5HDBB 4YPOA 2VPIA 4C7OA 2HU2A 3VU8A 4L8FA 1YVDA 3OZDA 2C9MA 4MYHA 3NONA 3WK9A 2Q99A 4MIKA 2REXB 3CPJB 1Z35A 2C2ZA 3QXJA 2P9CA 3CKMA 1EUDB 3R5FA 1J8FA 1Y6JA 1IBMB 2FEOA 1TNDA 4MW6A 1JTFA 4U7JA 1PJ4A 3FKJA 4D3XA 2DFLA 3HYSA 3KTAA 2Q5QA 2HSEA 4AXBA 3C0KA 4ZGGA 1H05A 2Z6VA 3DM9B 1BSVA 1QDLB 5BSHA 2PX0A 2H59A 1H1LB 4G1MB 2NPOA 4E3WA 3VTKA 4FFSA 2J4DA 2IS4A 2B1GA 3EIOA 1R0CA 2HGZA 2I4TA 3ZCSA 2Z4SA 5IKXA 2XUHA 1LWOA 1TUBB 3BTOA 3G3EA 5L6MB 4Y6LA 2RGGA 3DZHA 3OEWA 1JSXA 2J0EA 2PGXA 2CLIB 4L9WA 3RS4A 1WSAA 4R84A 5DCLA 5BQXA 2MSCB 1F06A 1KPGA 2CHUA 2CLCX 1E32A 3WLNA 5JYBA 1MMFB 3AEKA 4YRJA 5HIMA 3HJCA 3DEAA 3LUHA 3QXGA 2IK8A 2Z43A 3BWYA 5F73A 2UZ0A 3EGOA 2O0LA 1B00A 1QC5A 5EJIA 3FY4A 3AKZA 2VYCA 1TAHA 4YQEA 1JHDA 13PKA 1OX4B 1Z12A 2GDJA 5A0TA 1L3BA 4XEHA 3KQSA 2CNNA 1TYCA 3HZHA 1S02A 4B6FA 1YHYA 1YAJA 3JQ8B 5EJ9A 1JDBC 2W2MA 2QPTA 4EY7A 2JAWA 5EJ6A 4I9NA 2PQ0A 2P0AA 3AJDA 4FX2A 4G5XA 1M0EA 1UBKS 4L4XA 4FIZA 5F1PA 4AYXA 1TI7A 5TV2A 3A3KA 5DM60 3G2NA 4B4DA 1VCIA 2ODWA 3PQDA 4MEJA 3S40A 4PWZA 4D9BA 1DWQA 3FOFC 1KK3A 1L4MA 1QKJA 3EBOA 3TLGA 4HUJA 4XFDA 1MT3A 4JMPA 1QIFA 2ZE7A 4RKFA 1KORA 4IOLA 3NIDB 3R76A 1DIOB 1NC3A 1Q83A 2D7CA 3GLSA 1O87A 4RMJA 2PA0A 5L3ZA 3UOGA 5HRAA 3HN7A 5HE8A 3LHDA 4O63O 3K70D 2VWQA 3VTFA 3P4UA 4YC7A 2B5VA 2FR1A 4Z99A 4DR6B 5DBOA 1GPWB 3MMSA 3PQ6A 5LJIA 5IVKA 1DIGA 1RT9A 3ZWDA 3PQ2A 5K4HA 4H59A 3HRIA 5FA5A 1FMFA 2FB9A 2PR7A 5CLIA 5HKOA 5JROA 4G1UC 2HV8A 2UDPA 3C3DA 3RC9A 2YCLA 1DJLA 1PKEA 1XXHB 1PZMA 2GKGA 3BB1A 3E9CA 5F5XA 3KG2A 3VZRA 1E61A 2I66A 3D3JA 2HK7A 3PP8A 3ROEA 4N0DA 4PQEA 1KXJA 1OFGA 1H66A 4B7UA 5LPNA 4EECA 5DASA 3N2KA 3L7JA 4XJTA 3UMSA 4DWWA 2O2XA 1QIGA 3L6OO 3SFVA 3T7TA 1Y1QA 1BHJA 2C78A 4WFJA 1NVTA 4YDSA 3U81A 1LRLA 2X14A 3ZJYA 1DADA 4ZAGA 1IPFA 1OFVA 3NKLA 3RSGA 1G38A 2F43B 3T15A 1D03A 2D59A 2P9HA 4XQGA 4RTOA 2C7QA 4KDCA 3B9BA 3GRZA 1BDIA 4P5DA 3S2UA 5FTNA 4BNLA 2GTPA 3S2GA 3GQBB 4LW8A 4ZOEA 3EHDA 1Z0DA 4X8MA 4YRBA 3L7YA 4CCYB 3U4QA 2AEFA 2XF8A 3OKAA 3HKBB 3AHEA 4UBMA 1KI9A 4JBIA 5J2UB 1TTHA 2BMVA 2EKBA 3A1NA 1PT7A 5B6IA 2BSXA 3E5HA 3E82A 1XG5A 3F2IA 3VNBA 2VP4A 1RE1A 3J81A 1Z82A 4AZVA 4GKBA 1E1RD 1O94D 1DJPA 3CEPB 3H8SA 1M6VB 5JXWA 3ZTYA 2AYYA 5BR8B 3FPAA 4MO9A 3SF8A 1AX9A 2XTJA 2XMRA 3DQPA 2AN9A 2VAPA 3K9LA 3VYWA 4KL8S 1XZIA 2GRJA 3NAGA 4KWIA 4JLBA 3DTYA 3GFQA 1N1GA 3ZS9A 2BUCA 5L7TA 1B0PA 5BSMA 3K32A 3QOYA 3U17A 2Q3LA 5IEBA 4AJNA 5JQGA 1LF0A 2CLLB 3DEFA 1V1RA 3R2JA 4JXKA 5I7OA 3CLKA 2VRBA 3ND7A 4QXMA 2G6TA 3DOEA 4G85A 1M6YA 4RJLA 2QZPA 1S1CA 4O4LA 2TYSB 2ZE6A 3OJLA 4Q4JB 1GL6A 4RDCA 2V1UA 1R6XA 3V1MA 2QRHA 1J0AA 1W29A 4HATA 5AOCA 2OQRA 1PJTA 2CL5A 4DUZB 4DAEA 3F98A 2VJCA 2QRVA 3ZQKA 3F7MA 5AHXA 2HF8A 3AW8A 3O9VA 4BVJA 2B1QA 2C8JA 5DSTA 1SHLA 2VQDA 2Q6VA 3KSZO 2G8LA 3SYKA 4LSMA 4REQB 3BXEA 2G63A 2V6JA 1DO8A 5AVYA 3AP3A 1K8QA 2C1XA 3G0CA 2WJ4A 4C0XA 1QLJA 2HYDA 1X1CA 3SX0A 2L18A 4UZEA 5ER9A 1NV9A 1JYEA 2J0QA 1MAWA 2ZT6A 3ZY6A 3PWSA 2CNWD 4EDHA 3ZIAA 2IEGA 3MM4A 4LY6A 1YRWA 5CCDA 1QVRA 1NBWB 3LVBA 4RD0A 3LJKA 2NZUG 2J3LA 4L08A 3M34A 1VLJA 4RGYA 3UCEA 2QTLA 5HVNA 5C8DA 3JZAA 3LO8A 2EG9A 4Y7CA 4W5TA 2POQX 1SXIA 5BN4A 2OWDA 4NZNA 3V1LA 2PUBA 3JWEA 2Q5JA 3EZGA 4MW5A 2YVLA 4JP8A 4R31A 4WKCA 4R2IA 2XNSA 5SZJA 3ID6C 1P31A 1Y8QA 1THGA 3TE7A 4BQOA 4EI7A 3R44A 5L51A 3IAS1 2OORC 2BFWA 1Z45A 1HL3A 2OGSA 2XVAA 1WETA 2VT6A 2P62A 1FDIA 5ICMA 1LU9A 2H65A 3QY0A 1R12A 4H6PA 4KCGA 3VRHA 1KQFA 4IJVA 3FWZA 3U1VA 4FI3F 4RULA 3HDJA 1PZEA 3TNLA 3WISA 3P1JA 4EBBA 1GTSA 2F2TA 2VAXA 4NSNA 1EJBA 1NM5C 2XCIA 2ZB4A 1Z36A 2G82A 3NTVA 1GRQA 4ZCPA 5THXA 3TZLA 3A7DA 4AF6A 1ZKMA 4ENVA 1OXVA 4JYAB 1BDJA 1NT4A 1E9AA 1UBEA 3D6FA 4I8XA 3VOBA 1PJQA 3KLNA 3EAGA 3NDRA 4JJIA 4Z9FA 5I5EA 3U7GA 3DB1A 4NMMA 1GKUB 1I4LD 2GHIA 2AG1A 1QPGA 1WSDA 3QWFA 1IATA 3LCJA 1BW9B 4KQFA 4TL8A 2PX5A 2H4XA 4IIJA 4LTDA 3JSAA 2CL6X 4LHZA 1R16A 2FPWA 3RDPA 2XGSA 3AVPA 5EE5B 4KO2S 3ST7A 4A0GA 3UA3A 3EH2A 4BFUA 1ZW1A 5L3SB 3FBGA 4HFMA 1LK7A 2O1XA 4RSHA 3H1FA 3G0HA 3FHLA 2WRZA 3HZZA 4FNGA 1X7YB 3CZPA 3RC1A 1Z8NA 3MWEB 2F4VB 4YY3B 4MYRA 3BREA 2Q3BA 1X1AA 1EB9A 4FW9A 3DTVA 1OFTA 3TL2A 2HSZA 4G1FA 1DIAA 4LS3A 5CDSA 4OJTA 1F38A 1MAUA 4JQZA 4DV7B 4MVJG 1L6RA 1RKVA 2IYEA 1V7QA 2RJ3A 1FYVA 4MQBA 5HTOA 2WKSA 2WTMA 5J43A 1ZVJA 4KPUA 3JQ9A 2QTGA 4UD2A 1OLUA 4BKUA 3NTLA 5CDGA 1KI4A 1T91A 3E0QA 1AA6A 2GCPA 3FHOA 3ESDA 3P45A 4JBXA 4NG4A 4GSYA 3ZWVA 5IFLA 2VXYA 1IWPB 4KXMA 3T3PB 3I6IA 4B3BA 1Q7TA 1U3FA 5DGIA 5HDQA 2HV9A 1UFVA 1WR8A 4KO1S 2DY1A 4XASA 3CWCA 5DHQA 3IKLA 2A92A 1FTNA 2J41A 1J06A 1GNRA 4FS8A 4LG1A 1W9MA 1BX3A 4NZZA 5E2BA 1H93A 2YBEA 1N34B 4BPRA 4JEHA 3RM3A 1CRWG 1Y9DA 3CH4B 5D00A 3TXXA 3ZIDA 4GVLA 1H22A 1X77A 2Y4NA 1SCJA 3OQIB 4HMPA 4LOLA 1MPTA 1ZGZA 4NBUA 4OQXA 3IQHX 3OF2A 2OOKA 3QPDA 3TOVA 3UMVA 1DT3A 2J9YB 4NBKA 4QTZA 8ADHA 1KEEA 3ECCA 4F2WA 5EKUA 4COOA 4XB1A 3GIWA 3W4KA 1QHNA 1IONA 1T3LA 3B2NA 3NR2A 3RIMA 1GAQA 5LM3A 5JNUA 4XR9A 1UAAA 2PRZA 3FWPA 1TMYA 1HOXA 3UBTA 1P2DA 3E5NA 4MR9B 2HCFA 1ZHFA 2CXHA 4I9GA 1E7SA 5EVCA 4WKOA 2QMQA 2E4ZA 3MINB 2MINA 4ZQIA 2GF2A 4FOLA 2FWAA 3FB4A 2ZUFA 2PL9A 2JFGA 1HT0A 4MUFA 2HQBA 3FYSA 3DLTA 3TRIA 5LDHA 3N2EA 4Q7LA 4AZ3A 1T3TA 3PQ4A 2HHCA 1LNQA 1RQRA 2FW8A 2RCYA 2CT8A 3GGOA 1JJ7A 3E9QA 4YROA 2EKPA 1JJIA 3C3MA 1U0HC 4KLCA 2GK4A 3GFTA 5I5GA 2JFXA 4R5MA 5D5QA 1GRVA 3ZCQA 5HF9A 4WBNA 3TTYA 2VTBB 5CX1B 2ZR9A 4D99A 1PD1A 1NVVQ 4GT1A 3UBMA 1FUUA 3Q7SA 1P7VA 4DC0A 3AUKA 4BNXA 4EFLA 3OZCA 3UJ6A 1IQ0A 3E9ZA 3OIVA 2ZYAA 4H9GA 5KDLA 4C0LA 4B6EA 3RNLA 2OYRA 4TYNA 1CY0A 4AMYA 2PX8A 2VYVD 2XHZA 5F76A 3H0EA 2JBAB 1XZJA 3GN2A 3BWDD 2ZCUA 1E60A 3ROMA 3P8ZA 3C3WA 3L0BA 5K4AA 1U0FA 1KDPA 2NVBA 1OWNA 1XYYA 1EE9A 2HBZA 3H1EA 1HGXA 1W88A 2B0JA 2J08A 2NU7A 3DEJA 3H9QA 1V26A 2BKEA 3ONVA 2VYND 1MLDA 2M6SA 3R3UA 2NXJA 1Q0RA 4DQDA 4ETMA 2WE7A 1AGNA 2FW1A 4Q02A 4II7A 2GWRA 4RENA 4BMXA 3KPUA 5CYGA 5FF9A 3FH0A 1GZ3A 4DCJA 4YMUA 2CMDA 3L1JA 4ZOAA 3VO2A 1E2NA 1P29A 4L5JA 1G7RA 5JZBA 3GLIB 3HACA 3V6MA 4XDYA 3C3JA 4RXTA 1K4MA 3SEAA 2W2KA 2C31A 1M0SA 2GN6A 1S8NA 3GLHB 4C78A 2WSSA 2XUOA 3QF4B 4IICA 4PAMA 1PUIA 3D3WB 3T9DA 2CW5A