1VGRA

Formyl-coa transferase mutant asp169 to glu
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
427
structure length
427
Chain Sequence
TKPLDGINVLDFTHVQAGPACTQMMGFLGANVIKIERRGSGDMTRGWLQDKPNVDSLYFTMFNCNKRSIELDMKTPEGKELLEQMIKKADVMVENFGPGALDRMGFTWEYIQELNPRVILASVKGYAEGHANEHLKVYENVAQCSGGAAATTGFWDGPPTVSGAALGESNSGMHLMIGILAALEIRHKTGRGQKVAVAMQDAVLNLVRIKLRDQQRLERTGILAEYPQAQPNFAFDRDGNPLSFDNITSVPRGGNAGGGGQPGWMLKCKGWETDADSYVYFTIAANMWPQICDMIDKPEWKDDPAYNTFEGRVDKLMDIFSFIETKFADKDKFEVTEWAAQYGIPCGPVMSMKELAHDPSLQKVGTVVEVVDEIRGNHLTVGAPFKFSGFQPEITRAPLLGEHTDEVLKELGLDDAKIKELHAKQVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formyl-coenzyme A transferase
publication title Kinetic and mechanistic characterization of the formyl-CoA transferase from Oxalobacter formigenes
pubmed doi rcsb
source organism Oxalobacter formigenes
molecule tags Transferase
total genus 142
structure length 427
sequence length 427
chains with identical sequence B
ec nomenclature ec 2.8.3.16: Formyl-CoA transferase.
pdb deposition date 2004-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02515 CoA_transf_3 CoA-transferase family III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1540.10 Alpha Beta 2-Layer Sandwich formyl-coa transferase, domain 3 formyl-coa transferase, domain 3 1vgrA02
3.40.50.10540 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Crotonobetainyl-coa:carnitine coa-transferase; domain 1 1vgrA01
3UBMA 2GD6A 2GCEA 1PQYA 1XK7A 1X74A 1Q6YA 1T4CB 1XA4A 1XK6A 1VGRA 1XA3A 2VJMB 1XVVA 1Q7EA 1XVUA 2YIMA 1PT7A 2VJNA 2G04A 2GD0A 2VJOA 1P5RA 2GCIA 1VGQA 1P5HA 1T4CA 1PT5A 2GD2A 4ED9A 1T3ZA 2VJPA 2VJMA 2VJLA 2VJQA 1PT8A 2VJKA 4HL6A 1XVTA
chains in the Genus database with same CATH superfamily
2ZJZA 3NIGB 3WLRA 5HPYB 1BS2A 3X2FA 1Z33A 3TSZA 1HM5A 3IJ5A 1NV9A 4WESB 3B1KA 2CLFB 4K1LA 4YRIA 5KS2A 3RVBA 2ET6A 5JUWA 3CLHA 1MG5A 1ZCAA 5T41A 4RZIA 3TLCA 1FQOA 2PMFA 1XXHE 4K86A 1G20E 1EXMA 3ITNA 4KFRA 4AF6A 4CDMA 2A5DA 4XVHA 1J5PA 2VUUA 3BERA 2JAQA 4IS3A 1VKRA 1YDMA 1RJGA 2C2YA 3MT7A 1KDTA 1JTVA 4XX0A 5E3IA 5LQKA 1NUAA 1ZMRA 2C61A 3R5XA 4KW7A 5DTEA 1E1KA 3NETA 4FCWA 3ZYZA 2FUEA 4GGMX 3ZHOA 3RBXA 3SLGA 3O83A 3CLVA 1PZNA 1KK0A 1E1NA 1YASA 2YJTD 4MCAA 1W36C 1MR3F 3DXZA 4NDAA 4BVLA 4NV1A 1D2HA 1Q16A 3Q72A 2YY7A 1V11B 2EBFX 3GEHA 2X9NA 3TW4A 3TLGA 4IDQA 5A62A 4PSKA 3MMPA 2A94A 1KJ9A 2H9IA 5EIBC 5F2OA 2G8LA 4PBSA 3NC1C 4BIMA 1IN6A 1NC3A 2DULA 2QUAA 2Y66A 3H8VA 1FFXB 1PW5A 2AN4A 1D6SA 3IUMA 2NQ8A 3L05A 4L4XA 4OJKA 3HEAA 3VOSA 3ORQA 1KMMA 4KP7A 3TX6A 2VHCA 1GJRA 2P1RA 1JJFA 3HWWA 3LGSA 3VU8A 3HDJA 2VHXA 3KRTA 4JYCA 5HIAA 2FPGA 4FE4A 1NQXA 3WE7A 3RWMB 2BM1A 3DE2X 5DM70 3FB1A 4D46A 4MYUA 2Q27A 3FUWA 5FOTA 2XUAA 3QUAA 2AL7A 3AXSA 1NRIA 1R0XA 2ZSBA 1T9CA 3IAM6 421PA 2V6FA 3CPEA 4Q9IA 3DBOB 1Z12A 3DFZA 2QSUA 1GZ3A 4S2EA 2OL4A 3LF2A 4FWTA 2CVOA 2D8MA 4A8JA 4I19A 1EI9A 2IP1A 3T3HA 1ISMA 3E2IA 5K2OA 2GSDA 1SC6A 3I0ZA 3Q3EA 3RVQA 3OZCA 4YJ2B 2TECE 4BNVA 2Z4SA 1GDTA 4JYPA 2ZRCA 1E9AA 2IZ1A 3FZNA 4UFPA 5AJUA 1BKSB 2Q9BA 3R3VA 3TO5A 2RH8A 1PT5A 3KJHA 3RAPR 2J9GA 2EHJA 4CFSA 4MV0A 4F1KA 1P6UA 3T9EA 1Q0QA 3DD1A 1FUEA 2YY5A 3BIXA 3MWEB 1P44A 3DWIA 2WHPA 4FI3C 1JEAA 1ZSVA 2P6UA 4YLEA 1UKZA 3IXMA 1SKMA 1JFFA 4DR2B 3WMGA 3QPUA 1Y1QA 3PUZA 1JJIA 5JFGA 1WXIA 4DRYA 2BZ1A 1YJCA 2V55B 4D41A 2WD7B 2V7QD 3ELWA 2BEWA 3H84A 4YP5A 4O2AB 1QSGA 3L7LA 2YW2A 4GR5A 4MV7A 1DAEA 2XMGA 4FEYA 4D92A 3RADC 3NHLA 4BNFA 5FWYA 3TEMA 4L8FA 1KZ4A 1UEJA 2EFCB 1JQ3A 2HB6A 3R0ZA 2QV7A 1PIWA 4EI7A 2R8BA 2GAAA 2AFHB 4B9AA 1BS9A 5K8UA 1WNFA 3EVTA 1N9KA 2B30A 4H77A 2Q6KA 4HAIA 5HKLA 1Q7GA 1KI8A 3CLTC 3OE1A 3OICA 3RF7A 1IXKA 3GT7A 2PUEA 4JODA 4II2A 4ROSA 5KYWB 2Q5LA 3P0EA 4V2IA 1WVGA 1BTOA 4E22A 2OGWA 4PLHA 2AJCA 1ETUA 1PZGA 1ZZEA 5KSPA 4R84A 4CGYA 4X00A 1XCBA 4N3GA 1OAOA 1Z5GA 2JFVA 5HFAA 4R3UC 4UAGA 4B7UA 2PX2A 1MX9A 2IEBA 2V7XA 4B74A 1N2XA 1C7RA 1XOIA 3CRVA 1WP9A 2E21A 4V0MA 3I73A 1IG0A 1WL8A 3M5DA 1T6ZA 1XNJA 1KA9H 2I4RA 4XOIA 4UHEA 3FUCA 5TS2A 4P3NA 4FDAA 3AILA 3HO8A 1PJ2A 2CXUA 2FP3A 1TEZA 4F5YA 3T1TA 4DPLA 1FP6A 3PTLA 1KKUA 2IU6A 4JIMA 1ODFA 2NADA 3L41A 5I7SA 5I9IA 4AMGA 3RROA 3LFUA 1PEYA 3VMMA 4AY4A 3CH6A 3TJMA 1HLFA 5JMTA 1Z2EA 2B37A 3NO4A 4DVGA 4DXAA 4UVHA 2YVAA 3DMTC 3BE6A 3G1TA 3HZOA 3P9CA 1HEIA 5AHRA 1Q1QA 3OPMA 1PGJA 4L27A 3A1NA 3NOOA 1RS0A 3A1TA 4D1YA 1UKVY 4YT4A 2VJCA 3BXXA 1E5XA 3P0IA 5PNTA 3UVEA 2Q5JA 3PXXA 3NQ41 2CN1A 1FFWA 2VSQA 5EE5B 5AW0A 2JAPA 3WBBA 3MRTA 4QRIA 1D6NA 1IQUA 1MEOA 2HY7A 1MEEA 2NWQA 2RARA 4QU9A 5ADUS 2I0FA 1CHDA 2VTEA 3EXG1 1AJEA 2EZTA 4QWMA 4IHKA 4UM8B 3RFXA 1N3BA 1TECE 4B81A 5LNK6 2GEJA 3EZFA 3D2BA 1KQFA 2GZ3A 4AY5A 5FLXA 4TMXA 1OA0A 1N3IA 5HBRA 1E20A 3P4XA 3T5TA 4J75A 1U28C 3VDXA 2EW2A 4EI2A 1RWPA 2FQ1A 2FQXA 3NVKI 1UFRA 2I4MA 2QLNA 2VQ6A 2C9YA 4KQKA 1NAIA 2NGRA 3JQGA 3MINB 4DV3B 4WE3A 3DAYA 4BQRA 2BLLA 4FW9A 1KK2A 1SR8A 1BHSA 2UZ0A 4JQZA 4B82A 4R54A 2OHJA 1J6UA 2RGDA 4ZGBA 2LDXA 1J0DA 1T9HA 4Z4FA 2GYWA 4PGFA 4B48A 2JLAA 5HX7A 3IQGX 4IGAA 4K9DA 4RQTA 4UXJA 1JQKA 4A6XA 5KTKA 3G2IA 3DE1X 5CAEB 2R8PA 2WYWA 2FUG1 4IXMA 4AJOA 1QKIA 4A0RA 4A2WA 2XODA 3AF1A 2JFWA 2YWFA 3IBYA 4U7PB 4QXQA 2OYRA 3HI4A 4M9UA 5HEKA 4E5PA 2ZVJA 1QQTA 4PSVA 1GFWA 4MYCA 4ZTBA 5ES3A 4GBJA 2ZW9A 2N0SA 2XWPA 1U0RA 3F7TA 3FB4A 3FPLA 5AJTA 2WBLC 3VMFA 3QKTA 5HGXA 1PK8A 1M33A 1YVRA 5G02A 3QE3A 4A1OA 2OAGA 4OQDA 5MGNA 2QNRA 3HP4A 3HHPA 3GLSA 2QQEA 2I3AA 4KHPB 3PNQA 2OZPA 3HADA 4DF3A 3HZHA 3M3DA 3RGGA 4YUZA 1YJAA 2A5YB 3CT6A 4JC5A 3RASA 4FMBB 1HC7A 1JHXA 2OD9A 4GC9A 2WKSA 3RVPA 5HHTA 1FDOA 4PZPA 4E94A 2I8LA 1DQZA 1PD0A 1OD6A 3MLAA 1Y8QB 2AG5A 4LFBB 5G1OA 2YOGA 5F2KA 4NF2A 1CUAA 2A5LA 2GEVA 5IULC 4O4HA 5G4KB 1P17A 4YJ3F 4ITUA 4BVJA 1C50A 1B15A 3OD1A 3ZJTA 1H3EA 1II8B 6REQA 4K6OA 2DEUA 1O5OA 1O8BA 4HYYA 4W6QA 2DLCX 3O82A 1LBSA 4MKZA 2L82A 2Z8ZA 2EZ4A 3OJFA 1QLHA 4OBEA 4PLZA 3MCWA 1IEXA 4JBGA 1CQJB 2CFIA 2JB9A 1QR2A 2XCLA 3WVNA 3BZWA 2QTZA 1EGHA 2YYYA 4LS3A 4KO8A 2G5TA 4KYIB 1SUIA 2PUTA 4NDZA 5I7UA 1HFWA 3FY4A 5MDHA 3QKIA 5LA6B 1NF2A 3PQ3A 2FP4B 3G0HA 1KARA 2PZGA 3BGSA 4OV6B 3SVZA 1PFKA 2XCRB 2F6RA 2VTVA 1YR1A 3Q1KA 3HRHA 3QNWA 2PXAA 5DTJA 5FJIA 3PIIA 5IZCC 2HIHA 2J7KA 2MSEB 3F9IA 4NQZA 4UTNA 1N1DA 4ZT2A 5JCPA 4M7WA 3TLEA 4ES6A 4ZYVA 2UVDA 4JJ6A 1AZSC 4LAFA 4MS1A 5AM3A 2FEKA 1GGNA 4KBFA 3W2FA 4H6PA 3VI3B 3TAXA 1Z0UA 1IY2A 4Y2TA 5ALNA 4K6HA 1U0BB 1SPXA 3AVXA 1P3JA 4UPEA 1BC5A 1NWHA 2XMQA 4GZ3A 4NRDA 5E0OA 1JLMA 5TPZD 3WSTA 2EL9A 2G63A 5BSWA 1E3IA 1A97A 4OJTA 4CCAA 3JPYA 1ACJA 4IJ5A 4K05A 3E9EA 2IUTA 3TXXA 5CRIA 4LK3A 1MZVA 2WJAA 3PX2A 4I3GA 2ZZMA 3BHMA 3UT5A 3CW8X 4Y8VA 1Z4MA 4MWBA 3CEAA 3FD8A 3GCXA 3ZWAA 3B48A 2JFZA 2G1JA 3AVUA 3U0VA 5F7OA 2GEDA 1JPNA 3DQQA 3ENWA 4PC6A 1DDGA 5IW8A 4UDOA 3NOVA 3G0DA 2W5UA 3MJ4A 4X5OA 2IIBA 1JIIA 2GLXA 2XAUA 4KIFA 2YL2A 1JE1A 3AM5A 1YRWA 2QIOA 4HK4A 5GJWC 2WAMA 3RU7A 2OUIA 2XMPA 4PONA 1DRUA 4LYFA 1P9WA 2W6JA 3SZLA 5JR3A 1G0NA 1KHTA 2DPXA 3LKBA 1FPMA 2YNMC 4UOEA 4OK3A 3WRVA 1GZ6A 2BCGY 2L69A 2LW7A 1NVWQ 3INYA 1H3NA 4AN4A 4IEFB 3PFBA 2PKQP 4BUCA 4U9UA 5EEGA 1O0SA 2B4KA 4MS3B 1R4AA 3OQJA 1E62A 4RADA 1G7SA 3AETB 4U9IS 1C9YA 3ZDYB 2FSFA 4I4CA 1EQAA 3SQNA 3JYOA 3LYLA 4KU4A 2B94A 4DUZB 1EFAA 3AM1A 1O94C 5AUQA 3RIMA 2P79A 5H9WA 2O0MA 5DF1A 4Q1DA 3B7WA 4FM9A 3OCXA 4PYJA 2P4EA 4ZMSA 3FWNA 4DQXA 1ST2A 3D5TA 2BFEA 4B6PA 4EJFA 1KDYA 3W5SA 3T41A 4D3YA 4OHMA 5JE8A 4A7PA 4GPEA 4ND6A 4JUBA 1AGXA 1Y8AA 4L8YA 1I2ZA 1PJ8A 4LMRA 4N6OA 4C07A 2REBA 4KE6A 5LD2B 2PLRA 1QAOA 3L3BA 3Q41A 4Y2RA 4PNZA 1PG0A 3GEIA 2VJMB 1DAOA 1HOXA 1SXJC 3MQFA 4LJ8A 4MLDA 4O2BF 2LKDA 1C0EA 1X19A 4MV4A 2ONZA 2J08A 1DBSA 2Y1KA 4PBRA 1M1YE 4WIAA 3LBAA 2CZQA 1I6LA 3EXIA 4L8LA 1AIPA 5GV8A 1F4PA 4M1SA 3VQTA 1E4EB 4O4IA 2O19A 1A82A 1TZ2A 1UJMA 2VLBA 1Q0ZA 1Y48E 3OWOA 1T4GA 3JRNA 3VU9B 2IU4A 1QTIA 4ALJA 3NAZA 1E0AA 2CCJA 4YRCA 3GGGA 4PXSA 1L3BA 2WD9A 2GPYA 1JHOA 3DL0A 3FBTA 3FOEC 3DB1A 1I6WA 2G4LA 1HLGA 1KYIA 3GYBA 3BCRA 1SU7A 4L5CA 4PRKA 1DNPA 2QS9A 4BNXA 3UCXA 5K9ZA 4M99A 1K3UB 2QG6A 3FYCA 3QHPA 4YFYA 5KNBA 1RYDA 1KEZA 2YASA 4P54A 4OBBA 3KFVA 1J99A 2J67A 1Z83A 1KSJA 3SX0A 4B2LA 1B73A 4R7GA 4BMSA 1AM4D 2WWHA 4B76A 2ZTUA 2AOTB 4LKRA 3RT7A 2ORIA 2ZB4A 2ZQZA 1QHFA 1X9IA 3HLKA 4U2KA 2JA1A 3WJ1A 4OOFA 3S1LA 3VHXB 4A0SA 1A1SA 1Q19A 4NYMQ 1H94A 3ABIA 3FGZA 3REFA 5EP4A 5B1IA 2VAMA 3MMSA 2CMGA 2ZSUA 2J46A 2NO5A 5G3YA 3VPFA 4X65B 1F8UA 2HW8A 3H5IA 3A06A 4JU8A 4RV9A 4DQLA 1IBSA 2X3UA 4G0OA 3ROZA 3DMRA 5H83A 1NPYA 1RLUA 3HLTA 1ZLYA 5DRYA 3W2IA 1N8SA 3EQ8A 5FDFA 1FJXA 1Z6TA 4TLDA 1WEHA 3F9RA 3OWXA 6GPBA 5JD4A 3UJNA 1EAMA 4PXYA 2YZGA 1E2NA 2QY9A 3JYQA 3OQIB 3L82B 3IT2A 3MTJA 2IXFA 3TZQA 3VHLB 4BU1A 3IMGA 3AUUA 1P91A 1R4MA 2HJ9A 3BSYA 4HGYA 2MSNA 3DB2A 4D9CA 3MJDA 2EKZA 4PZ0A 4LGVA 1ODLA 3NT5A 1TC2A 4ZZ2A 3F2VA 1MDBA 1JWLA 4OFXA 3T7SA 2C4MA 2FEWB 1RLIA 4GOXA 1VPDA 1YQ9A 1QVAA 3NWOA 4KZPA 2OBBA 2H1VA 4MX8A 2X1VA 3B1XA 1ND5A 1RWKA 4X1KA 5A5FA 2BCEA 5KYUA 1L7QA 4EHDA 5ALQA 2C7PA 1WJGA 4HUJA 1I3LA 2H2IA 2RGYA 4US1R 3PF8A 3EZ7A 3GUCA 2GPJA 3MTGA 2VHZA 4M0CA 2KYRA 4D0LB 4CXMA 4L5YA 2WE7A 1TFUA 2W71A 3CZ9A 3OPQA 3PNSA 3DKPA 4WZAA 5SYNA 3T61A 1XU7A 5CB4B 2DFLA 1JG2A 5DKFA 3I2KA 1Z37A 2G25A 3INGA 4YAKA 5JAPA 3FNQA 4P22A 1L8XA 2A5JA 4PQRA 3ER8A 1K2WA 1BHJA 1HRKA 1Q7TA 3HVUA 4MSUA 3RSCA 2V4MA 4IKPA 4NAUA 1G3RA 4RGYA 4DCNA 2W6OA 1LI7A 5IXYA 2E9SA 3W8DA 5G0SA 3ZEAA 1DC5A 1FP1D 4MRAA 5TY0A 5FULA 4P8RA 1UXIA 4OL0A 1XTUA 2FRDC 4KIGA 4GM1A 4ZJYA 2GI4A 3GMIA 5CFNA 2DHCA 3THXA 4G01B 2IUSA 1MO4A 4NL4H 4BEJA 3ENKA 1ZX1A 2BGUA 1H22A 3T12A 2V5VA 3DXFA 1WB5A 1GAJA 3NRBA 2ONKA 1QIHA 1R10A 1E79D 2WUEA 2RHCA 1GPWB 1TO6A 5JQGB 2ORWA 1OGJA 1KO1A 4FS8A 4RVFA 3BL8A 3KR1A 4WA7A 1UPBA 2J0UB 1JFSA 4LC1A 3AB8A 1A96A 1QJCA 2RI0A 3AHCA 2G9NA 4IJMA 4ER3A 3GRAA 5BSEA 3BCSA 4D3DA 4WK6A 3LCCA 3TXYA 5C8YF 1HYBA 1T0UA 3MJVA 4BZXA 1QIEA 4W99A 3PNLA 4AKGA 4PZEA 3JASB 1JLKA 4IV8A 4OJMX 3K92A 3LKVA 2QL5A 3OQMA 2ZR0A 4EY7A 1OH8A 5EUQB 1VP3A 4R83A 2JL1A 1YZLA 2Q3FA 4JZKA 1T5SA 1KY5A 3F5FA 3EIEA 1YFZA 1DQSA 3IERA 3UOWA 4GR9A 2VDQB 2OD7A 4PC7A 2DTXA 1CG6A 1OAOC 4B87A 3OZBA 1E77A 1QHHB 2R6CA 1QAMA 4YHBA 3ZCUA 4EUHA 2WT4A 3AOEA 4HS9A 4PZAA 3TRJA 3EASA 2OAEA 5AW1A 1BFKA 2O1EA 1E96A 1QU2A 3AUFA 1CD5A 1L6IA 1IB6A 1JXOA 1G8GA 1IU9A 2PWBA 3KB8A 3OY2A 4RVGA 4H35A 1QHYA 4JJFA 3R6TA 1P1JA 2PUVA 4JLOA 4B35A 1QE0A 5J4VA 1JYFA 1CETA 4RHCA 4WBSA 2TMYA 5AM5A 1GUBA 1M2FA 1R0RE 3KT8A 2J5BA 4WASA 2QD3A 4CMJA 2BTQB 2OGUA 4JX9A 4S24A 2W83A 2WFLA 3HY6A 4Q4AA 4EL0A 4H7DA 4HCJA 3E8MA 2CHEA 2ZR9A 1QZ3A 4H7KA 1JSCA 2IT1A 1NLUA 1RQNA 2WU1A 2WWGA 3EVEA 1R8JA 2V7EA 3B8HA 4UM5A 3KHUA 4XAQA 1M5TA 1U2TA 1O54A 4GKBA 4BMNA 1V9LA 4BLSA 2D1RA 4WCFA 4Y1FA 4TWJA 4DIMA 3FYTA 1U3VA 3VKWA 2BP7A 4I55F 3GJTA 2OT3B 2OUKA 4NY1A 5D00A 1T25A 3L1IA 4OKIA 1VJCA 3RD5A 1F1JA 3K9BA 2O8BB 1RBMA 5AI0A 5AKJA 2SICE 4NZMA 2DFDA 1BOOA 1CQIB 2OKCA 3PVSA 1MHPA 1VYVA 1AGNA 4I50A 2YWRA 4OQPA 1Q0RA 1Y7TA 2FEOA 4O4JF 5FWNA 1B26A 3I0MA 4FW8A 3T5AA 1UEXC 4CDGA 2CLSA 5J2UF 3ZCRA 1O0BA 4UDYX 2ZWMA 3FGOA 5HF5A 4BLPA 4JIGA 1E8MA 2PGNA 3WIOA 3DFFA 1RLJA 4J7XA 3BM5A 2FMXA 1ZEJA 1KO7A 3WTBA 3ZHCA 3HU3A 4KC0A 4P35A 3KU1A 4QGSA 1R0BA 1I4LD 4CTJA 2BLNA 2C4HA 2I2CA 2KBEA 2UZ1B 3HS3A 5DCYA 3ZDXB 3PTAA 1GKYA 4N7RA 4E2ZA 121PA 1TMKA 3P0JA 4IIHA 4G0YA 1OFVA 3HCCA 1EINA 1Z5NA 3ZBTA 4CCWA 2EARA 4Y2SA 2O2JA 2V6BA 3CRZA 2DWCA 1YR6A 4PIMA 4W8GA 2JFOA 2VSFA 3JQ8B 3GJZA 3E61A 3NBKA 3MJEA 4L9SA 5ISMA 5DVZA 1Z0ZA 5F64A 3STXA 3QTTA 1QORA 3VM6A 1OX6A 2QVYX 1QPBA 2RH4A 5J9FA 3ZDEA 5H9VA 4EY4A 3RI3A 5DULA 1PFVA 4IICA 2AR7A 4HWGA 4XIJA 2OGTA 8LDHA 1KXJA 3SDBA 4KFTA 1X74A 2YQZA 5C52B 4AJHA 2B8JA 5IAJA 1ODIA 3R3WA 1SCUA 1Y3CE 2JKYA 2X77A 4D3XA 2QMHA 4TXHA 3GCWA 3UT6A 3ZXSA 3RVLA 4XLTA 4CVNA 2HMSA 3O8OA 4RPHA 4R1PA 1H8HD 2PRZA 1JXQA 5J5AA 4HWKA 3WS7A 2HF8A 3EF1A 4HNAB 3S27A 4JI2B 3J7AC 1AU9A 1WCYA 3E15A 4MLPA 4OQLA 3G8DA 3CV3A 3QZUA 3H7AA 3F90A 2WIDA 5IMBA 1E6UA 5ALMA 2NVWA 3NDRA 1D4AA 2CWWA 2Q49A 3CJTA 5JH7A 3N2LA 1X8JA 4M8KA 3T7EA 3FI0A 1CZUA 3QVMA 3K0HA 1TK2A 2R5FA 4KG7A 3TR0A 4FWIB 3FUTA 4CCSA 1Y37A 4E03A 5BW8A 4Y6RA 5F2EA 4KOAA 2EZ8A 4LHXA 4E14A 5H3CA 1ENZA 3TR5A 1CY2A 5IF9A 2JGDB 2DBYA 4J90A 2RHGB 5H0IA 3V1KA 3ER9A 5EJ7A 4BNUA 2XD4A 5DE3A 3S70A 4AB1A 3WLLA 3P2EA 2AC4A 2PHZA 1ZEMA 2G9VA 5B7NA 1RCFA 4I5IA 3LA8A 5D5PA 1SU6A 4LHWA 3VNBA 4W1PA 2Q6TA 4LHVA 1PW7A 4EG3A 2B0JA 2DQ4A 3M6XA 3A1SA 5CW2A 4L0CA 3W5DA 1JAIA 4W9MC 5T6BA 1D4OA 1FYXA 4M86A 5LQJA 3P4UA 1XV5A 2BW0A 2J9YB 4NH4A 2J3QA 4CMEA 2BFCB 2QVZX 1U0FA 2HIMA 1UBUS 2QN7A 3WKEA 2BHNA 3TQHA 1YIDA 5KU7A 3T5GA 2C9ZA 1H2YA 3ZWNA 4Q9AA 1K2VN 3KZNA 3Q6NA 1O5TA 4JLAA 4D9BA 2R0QC 2DSNA 2HV9A 1R64A 1ZRSA 1Y34E 5DN6A 4BFTA 1CRWG 3RABA 3LLVA 3MT0A 3O93A 3WJAA 4EVQA 1I7QB 2WG0A 3N8IA 4HLUA 5A71A 5AFSA 2JD0A 4M83A 3NFYA 1JSLA 2WWIA 2BFPA 4MR7A 2Y0DA 5L95A 4YHHB 1IPHA 2Q3DA 4IJ6A 1M2NA 1WBDA 2DLNA 2R8XA 2HRBA 3GBSA 3FDXA 3JZDA 2PRIA 3F3SA 1F60A 2DBVO 3FPAA 5HOQA 3MB8A 4P3KA 5FOUA 5EAIA 1NLZA 3UMGA 5IC6A 5KVSA 2ZS8A 5BMVF 5A6SA 2ZJ7A 1WCIB 1UJ6A 3KVOA 4FEGA 4M2LA 1KYVA 4Z2YA 1NG9A 4GL2A 2FXIA 2Z6UA 4YWJA 1KYWA 1Q3KA 2CJWB 3VJLA 2FWNA 4MZDA 4EGFA 4LF6B 1MFZA 5HS6A 4PE5B 3TTSA 1RRKA 3M2TA 2X14A 1PJQA 1ZR2A 1BDJA 3KR2A 4B73A 2ZYGA 4PR3A 5CBPB 4EITA 3T0GA 1JAZA 2LKCA 4L4YA 2QMYA 1VJTA 1M0TA 2GXUA 4UTPA 1EWYA 1VE1A 3U4CA 3THYB 5GONB 3U7HB 3S2FA 2VIIA 1AB6A 3V2HA 4M0MA 1NSYA 2FSIA 1U5BA 3E6AA 2M9MA 3R7SA 1IIRA 3MT9A 4AXXA 2GK3A 2YQ5A 2VDRB 3UB2A 3NDIA 5CLQA 3ZIAA 2PUCA 1JYEA 1VPEA 2WPDA 3H4TA 3T4PA 9ABPA 4PANA 2IYXA 4AVYA 2XXJA 3I9MA 4TQGA 3H11B 2QVBA 4XGRA 3RHSA 5IUJC 2P2ZA 5ALJA 1YA4A 1Z2PX 2ADOA 5FL3A 4CKCB 5IYZA 1L8LA 5IT9A 2IEIA 3PEWA 2BN4A 3UMSA 3PFCA 2BSQA 1LZKA 3KLNA 3A4NA 4EELA 3IO3A 5LFAA 1XR3A 4LX0A 4CKBB 1Y33E 3IIEA 5ALTA 2ISQA 3LLSA 5IAKA 2X0EA 4IRMA 2XXAA 3N58A 4M46A 4I9GA 4KXXA 3RVOA 3I5XA 1D9XA 3P9PA 1XEWY 1H4SA 1CY7A 4XWKA 3VOBA 4PTZA 5JPDA 1HX7A 1IN8A 3MUEA 2NYRA 2Q7XA 5ALYA 1F2UA 1ZUIA 2PFKA 3OEHD 3OI7A 4LXHA 1LLQA 1ZD3A 3V6MA 1XD9A 4K0RA 5IUNC 1CJSA 1GLGA 4ZVRA 2QRVA 1H1LA 2R2AA 1ML3A 4G5GA 1DRJA 1KH1A 2VI5A 3R7NA 3UJ8A 3ZKWA 2ZE7A 3KWFA 2DECA 1H6DA 4EEXA 2BF7A 2VHQA 2NXEA 4KRGA 2QTAA 2VDVE 2AFRA 4LGMA 3TLBA 4N01A 1YHNA 1B14A 2P5SA 1I4DD 1ZH8A 1HE3A 2IPNA 1RJDA 4G0PA 4M6WB 9GPBA 1FSPA 3O1IC 4UZEA 2XRMA 4FZ5A 5DSTA 5KOJA 2DJIA 4D2IA 5JFOA 1CJUC 4J0IA 2ZUWA 1KMIY 2TSYB 3HCBA 2VPXA 1IM2A 4L0QA 1Y6FA 1LB1B 2I22A 1ID8A 2WHXA 4J6FA 5AOBA 4AP5A 1V3QE 2OP1A 3QLEA 4B1FA 4DZRA 1BX3A 1Z29A 3EWSA 3H2YA 4WSOA 2NVUA 1MOQA 1GPYA 4FD3A 1UL1X 2DB3A 3V1UA 2HTFA 1S7GA 3IV7A 2PX0A 5FAKA 1VZ3A 3FNGA 3MWYW 3FNEA 1WF6A 2PA0A 4C03A 3U6BA 2FPMA 4JI3B 1VE9A 2E3JA 4NJMB 4DABA 1KVSA 2E5FA 3IP5A 2HK7A 3NBUA 5A04A 1QGYA 3MHPA 3KJIA 2Q7OE 1EVZA 1E2MA 1SA0A 2W0SA 3DDUA 1O89A 3JYLA 2X5OA 3N86A 4EZIA 3AR4A 1NL3A 4JYAB 3UKOA 5HQ3B 4AN0A 2VDOB 2R1VB 3G88A 4OLFA 1FTYA 4HTFB 4PYOA 3S2EA 1F0YA 2F3SA 2PR2A 4P31A 4AZ3B 1UBTS 2RHLA 3VC2A 3F3YA 2ODWA 2JHFA 4HYTA 1G8PA 5K0TA 1GNVA 1RLTA 4BFXA 3KD3A 2CNWA 4KQXA 3THRA 4AJJA 1ZXLA 2EW1A 2HT1A 5BN4B 3ONEA 1BROA 3EVAA 3L0SA 4ZXPA 1OVGA 4QDZA 3E84A 5T5QA 4D6PA 1IYZA 3CZRA 1I30A 4M1YA 1W4RA 2FLVA 3SYMA 2AJDA 1C1XA 2BDEA 4LTNA 1LCIA 2PLAA 1M34E 1BMFA 1QFZA 1KFCB 1IZ7A 2X7XA 1XMOB 1KE1A 1E3DA 1TKCA 1VMDA 1M6NA 3I2FA 3PD7A 4JKIA 3Q7EA 5DISB 1HT3A 4BBJA 1J2UA 3D3WA 3SLRA 4FQ5A 1FNMA 1IHXA 3O75A 2ID4A 1TVKA 3HU1A 5E7JA 5JJCA 2HBZA 3ETHA 5ALXA 3PFNA 3RBVA 4NU8X 2CXQA 4ZIRA 2H2GA 5LP6A 4DA9A 3S8YA 2CSUA 3W78A 3OFND 5KYYB 4KFUA 2Q3HA 1OLOA 4DLWA 4IGIA 3KZXA 3LPAA 5DIZA 4YWHA 1ZI8A 1NFQA 4BFWA 4CNBA 2FPRA 1E66A 3DE3X 4RDXA 2PJDA 4Q39A 4W7IA 4YAJA 1EMDA 1GR0A 4LRTB 2IY8A 2GJSA 3W4JA 2Y0PA 3DW1X 4DLTA 3DHEA 5LMNB 1WMSA 1GU1A 2N46A 1MN6A 1B16A 3QF4A 4F6RB 1NBMD 1FFBA 1PJTA 1P5JA 4BNDA 4F21A 3T3OA 5TJHA 4XRRA 1TZMA 1LS1A 1Y6ZA 2HWKA 3G68A 4YN3A 1C4WA 2CKMA 5K45A 4QT0A 3PC4A 5CK4A 1TA4A 1W85A 4NSNA 1AMUA 1FW8A 1EFPA 4IF6A 3UH0A 1QDEA 3ITKA 1EZZA 4IFBA 3MCTA 3RANA 1VSTA 4MA0A 4TWZA 1XVVA 2PWAA 5K6AA 3PRJA 4B3MB 3PX7A 4TSFD 3ZGZA 4P3PA 3IVCA 1U1EA 4PZUA 4RF5A 1F2TA 1M1YB 1SVUA 2R85A 3BH6A 3PGJA 3EVGA 2R48A 4ZQIA 3R9KA 3SHQA 3WIVA 2YXLA 3L01A 4TVSA 4EKEA 1OBOA 1Q0PA 4YJKA 2JDIA 1Z6PA 3JALB 2QWXA 1F6WA 1Z47A 2EG5A 2ZE5A 1PR9A 3IPYA 3PYLA 5ECWA 4P33A 3UICA 1AKEA 1E58A 1GVNB 1UAYA 2I4NA 3DOCA 3I3SR 3L7BA 3V80A 3O3OB 1T8TA 2Q3JA 4D8YA 2NV6A 4FE3A 4DWOA 4OLJA 5CIYA 3AOEC 5EHGA 2HMWA 3RGWS 3EXFA 3ZK7A 1MABA 1GTMA 3GF4A 3UXEA 1QZTA 4PGGA 4FGLA 3NM4A 2H4HA 2O0JA 5AJXA 2JK0A 5HG0A 5KYTA 1J7JA 3HWRA 1QQ5A 4BATA 5EHXA 4JI7B 2I2AA 5ICEA 4JAVC 1MMFB 1N5KA 2KB0A 3I1YA 5AXCA 1TYEB 1M73E 4GDMA 3AHFA 2PUGA 1W4BA 1G42A 2AI1A 5BNFA 2WJ6A 2ZAMA 4OUDB 2X0DA 1NVBA 4X1YA 1HETA 4KITB 3BQ9A 2F3QA 3UJPA 3E3OA 1L0BA 4BVFA 1YK1A 2HHLA 3N2EA 3P9ZA 5BUZA 3A6FA 3HCRA 4U8GA 3T1NA 3EODA 1QXSA 2VDUE 4WCFC 1T6XA 2FMHA 5B37A 4QM6A 4UEQA 1E5LA 2DY0A 4C1NA 3FCOA 1KZGB 4CETA 3SYRA 1Q2UA 6YASA 1O95A 4WLVA 5IJZA 2WR8A 2DUNA 4RE6A 1RWMA 4M36A 2PSFA 1J70A 3V00A 2Q1UA 1G8KA 4IM7A 3AJ8A 1Q11A 5BOSB 4PM4A 4QUIA 1KGSA 5K8IA 4KQEA 4Y1GA 5B58C 5E9WA 3GMDA 3NBYC 3WICA 1UM9B 1YFLA 2GN8A 2AF4C 5EJAA 5G0WA 1L9XA 1BHQ1 1RPNA 4M54A 1DO8A 4D8TA 1TA0A 3ZTYA 3EZ2A 2O52A 3HA3A 4XUEA 4DIKA 4HVLA 1P4JA 4AW9A 1U8ZA 5ALGA 6Q21A 2Y0BA 4NCAA 3CZMA 1WCWA 1SURA 2C4UA 3MIIA 1N92A 2VH5R 3LPCA 5EIXA 3G6WA 3G9TA 4E1AA 1E99A 3GIWA 1TZCA 5HKOA 2P3OA 2GCGA 4EQ6B 4IRUB 2CZCA 3G2OA 3LTEA 4GNRA 4RZHA 3TQCA 3NDBB 5CEJA 2YVQA 4CLOA 5CYOA 3BCUA 2OOKA 4ZAXA 5BOVA 5I9LA 2O8FB 1YQEA 1FJ2A 1SD1A 1UBJS 1W1IA 1Z3IX 4I4NA 5FKJA 1JDBC 1R4NA 2QUBA 1NN0A 3MWLA 4ZDIA 3HJHA 1T1GA 4OQXA 2LIVA 1R4ZA 4YFVA 2VTBA 2ZYIA 1X87A 1P1FA 3OM0A 2YZKA 1ZBDA 2C7VA 2B1GA 4EARA 5KTSA 3WBFA 5MGBA 1A4IA 1AQJA 1ZMBA 4UCFA 3LK7A 4DDWA 3EBLA 3WB9A 1E2EA 3OIFA 1YCFA 4DV0B 1YU9A 5GMOA 1NVKA 3REQA 3ETNA 1ONNA 1AC5A 4WZBE 3L0ZA 1OXTA 3O3NB 4L3VA 1S5PA 1SUWA 3RS7A 2MINB 3ROEA 3BCHA 1H0HA 4OGLA 5DXAA 3ZV3A 4GT1A 1Z82A 1ZK4A 3D6NB 3PC6A 4HN2A 5L4SA 3GJQA 3C3DA 2EGHA 4FR2A 2ZM5A 1GFIA 3HL4A 2PV7A 3KYCB 5EE1A 2EQ5A 4RLQA 1XDWA 3EQ9A 1FTWA 1KQOA 1UCFA 2QT0A 3BJEA 2K7ZA 3DTVA 1C81A 3HCOA 4O4LA 4FGZA 2ZBQA 1QK4A 1IE3A 2I2XB 3UY4A 2VDJA 2NMVA 3S5UA 1GKUB 4K1XA 5M2QA 5I8WA 1U1CA 2XMCA 3CNHA 1QO7A 3TSWA 1CJKC 4NP6A 3W04A 2MR5A 3TS1A 4JENA 9MHTA 4BFUA 3IAXA 2P30A 2XWSA 3BMOB 4NZOA 3O4VA 4FZ3A 5BY2A 1EWQA 3N0VA 3AW8A 4AZWA 2B4AA 4E5KA 1TPYA 2V7WA 2P9BA 3DYVA 3EBPA 4UHKA 4F71A 1G5IA 1VBFA 3BYZA 2JGRA 4NV3A 1HNWB 1C14A 5JHGB 2CSXA 2A57A 4U2GA 2G5CA 1QOQB 3D4LA 2I7XA 2BR4A 4WKOA 2V0CA 3H9JA 2BWJA 2Q9AA 5MN5A 1OX5A 4QEDA 2Y3IA 4HDCA 4KYTA 2XADA 3M82A 2A1UB 1AHIA 3AG6A 4FYPA 4NWIA 4CMEC 2F3PA 2GYUA 1YZHA 4JGIA 3W1VA 3AFOA 5IJ0B 4Q3EA 1P77A 4URYR 1ZMXA 3IVGA 3SG0A 3N3BC 2VJPA 2DPGA 1CQZA 4J3FA 3T3IA 3W3AD 4ODIA 1L4LA 4Y9RA 3AF6A 3GJYA 4CN8A 3HEBA 4EW1A 3T7TA 5TRTA 2D2XA 2GZSA 3ZD9A 4WL0A 5IHPA 4HLUC 2DVMA 4CMIA 3PKIA 1F7UA 5LYJA 4A82A 1JAYA 5AWFC 2IUFA 4UTVA 1DKMA 4MRSA 4GI3A 4WZBA 1DJLA 2AHOA 4YXWA 1EG2A 1RBQA 1E2BA 2AA3A 3AF4A 5KKNB 4YCDA 2C94A 2GBPA 4KFSA 4OHXA 3ETDA 3PI7A 1L2TA 3UWPA 1LS6A 2V9CA 3I9JA 3HB4X 3BWCA 3QI7A 4A6DA 3S29A 2BI7A 5DGIA 4XWWA 5E7IA 2VATA 4AIIA 3AP3A 2FPWA 5KNCD 1R9GA 5AXBA 3CGWA 1YR3A 1VSQA 4Q6BA 1BE6A 5HFNA 4A91A 2JGFA 4XSHA 1GN8A 3CTMA 4NR0A 5IPFA 4LJRA 3HKCB 1ATIA 1K6EA 2HHJA 3NEAA 3ZIDA 1UJ4A 1ULUA 2HA6A 3PUVA 5K3CA 2IU0A 3VZPA 3ZVLA 4BWGA 1OH7A 3SF8A 1WTCA 1VFNA 3AEKA 3MYYA 3LUCA 1BXGA 3UNXA 2QBYA 4GEGA 5DGDA 3LL7A 1KYZA 3C3CA 5AVKA 3BF7A 3EDMA 5D3KA 4ZVOA 3GLGA 2CLMB 2UZAA 4P0PB 2ZUSA 3ETGA 1ZM3A 2Z5LA 3QVTA 4G41A 4LBWA 3MPUA 4MGIR 5A2QA 2DETA 3BGOS 2A7XA 4RVHA 3FFXA 1TTPB 5BQ3A 3VFDA 1HO3A 2ID9A 1ZIYA 2QUIA 2PRJA 1SRQA 4Q3KA 3PEYA 3C6BA 5LZ4A 3U4QA 2IHZA 4TVBA 2HXSA 3R3JA 4MLCA 3V3TA 4I7EA 4DNFA 4E12A 4PYQA 2E87A 4AJKA 4P3YA 1L5OA 2P0AA 3KV3O 2RAFA 1XAGA 2VRBA 3ND6A 4DG9A 1OLXB 2OOSA 4E2FA 3H3JA 3PYMA 3RRZA 2GKGA 3PWZA 2G1AA 3R2JA 4NZYA 3OTWA 2WF6A 3DGFC 1L4YA 2FWBA 1I0LA 5JJ5A 5DP1A 2W8ZA 2GO1A 2R1TA 4B4KA 4BLUA 4DMLA 2ZB7A 4RMNA 5CCXA 3EXHA 5EHNA 2PKYX 4EFDA 3JARB 1S2LA 4MGZR 2Y1EA 3R9WA 1VSVA 5B7GA 4TLCA 1T43A 4WZZA 1SKBA 3F8TA 3OEYA 3BWVA 2AUMA 2P7IA 2Z2XA 1XRNA 3I0NA 1URPA 3W7VA 4ZHQF 1UKAA 3CW2A 1GTRA 5CLIA 2RGBA 3IV9A 1WV0A 2HMUA 3W5VA 1QYWA 4BXOA 3E8SA 2IDMA 2ZJ3A 3NNSA 3MBIA 4NS4A 2WFZA 4CKXA 3W7AA 4IOLA 3OJEA 2X76A 3PC7A 4JVMA 4F2GA 2OK7A 2CMKA 3DNFA 3GK3A 4BQPA 1C30B 1N6NA 2V6GA 4EBFA 2ZBVA 3AXTA 4JXKA 2RCNA 2ZI5A 2INGX 3FKQA 1VE5A 4DYVA 3DO8A 1X0VA 4I4LA 5FHQA 3WX0A 4OLAA 2JGNA 1UPXA 2PN1A 4QXMA 2N75A 3QYFA 4XVQA 4XUDA 3D7SA 3DBHA 4FOOA 1O9HA 4L8GA 4DY6A 1A9QA 4X62B 1IY9A 1ZJYA 3Q7TA 4RIFA 4BNJA 1A72A 1HK7A 2P1ZA 5D6OA 4OK5A 5LLTA 1NQ5A 1T5HX 2HMAA 3U9TA 1DKRA 3BEDA 4KJXA 3T5CA 2ST1A 2Y6VA 3GJ4A 4O2BB 3CVJA 5ITZA 3TPFA 4K9OA 2W93A 4R01A 2H92A 3DMGA 4I5DA 2B4RO 2CMDA 1BXRA 1GQOA 4Q47A 2H59A 3QGMA 4J0DA 3MD0A 1CUYA 4G5RA 4BZPA 5JYCA 1FXWF 1I1OA 1TA9A 4LF7B 2XSZD 1YK0A 2BKLA 3PP8A 1V26A 4G86A 5FHRA 1A5TA 2ON6A 4OYHA 1FFAA 2CWDA 3CB2A 4OH7A 1MVOA 3D6AA 3EEBA 1J0AA 4IPTA 1ZCFA 4BS9A 4QOFA 4BE4A 4BKOA 3I9OA 3LT0A 5JEEA 3QSYA 4EMUA 2JFBA 4ZJPA 3W34A 4DDMA 2GPBA 8ATCA 1TF2A 2R751 3TUZC 3A6HA 3R8XA 5DGCA 1XEAA 2UYOA 3EG9A 3QVSA 2ZSEA 3A27A 4EENA 3QPAA 3IB3A 4U3JA 3KT6A 3FRHA 2B25A 3ZDBA 3VYSB 4S3MA 3EAQA 5I9SA 5TT0A 2OWDA 1Y4UA 5B3LA 1U2DA 2GCEA 1GZHB 1XEFA 1QK3A 3JCZA 1H6CA 4L4UA 4LECA 2HJRA 4AM8A 2NUPB 3GPBA 2FQWA 4FSHA 4MUEA 1DJNA 3T9AA 3TW8A 1NJSA 1NDQA 4CT0A 2R62A 1G4AE 3KPWA 4CLEA 1DADA 2J6BA 3CCCA 3LXUX 1WXGA 4J2TA 5AM1A 4B71A 5K51A 1V16B 4HNGA 5LP6C 2BE9A 2D1FA 1GVHA 2OO5A 3DE7X 3ZY4A 3A1VA 3ZHBA 3CUKA 3BT7A 5ALLA 3AIMA 1ZQ1A 5F5LA 5JXIA 5T7BA 1PS9A 1J0CA 5I48A 1KJNA 1NQTA 1PHRA 2RK6A 1WKBA 5BNWA 2IEGA 4C4PA 5JS8A 1Q84A 2BGRA 3U3KA 3B1VA 1CJBA 1OFHA 3O47A 5DX1A 1B6RA 1L4FA 4OIMA 1ZVJA 2L2QA 2SHKA 3QXXA 2BY4A 1GDDA 1GGMA 2Q50A 4LN1A 4LPKA 3FG9A 3R5JA 4AG3A 4GQBA 3OOSA 4IQFA 2WWVD 4WBNA 2QGNA 1N5MA 4ER5A 4OO3A 2JVJA 2NZYA 5E1MA 1G4HA 1TVEA 4OATA 5ED4A 1I24A 1XDSA 3LUAA 3L8DA 3HP7A 4JROA 3ZDZB 4C04A 4HUTA 1VCIA 1JWAB 2B8TA 2I34A 4BNNA 3EUAA 4NI5A 2RAVA 3T7CA 3O4IA 4QPJC 5JRJA 3R5FA 4X1IB 3ZQ6A 4KZKA 1KJQA 4ENVA 5K6AC 1FQWA 2WZDA 3M4ZA 1W47A 1Z8DA 4RSHA 1OKKA 4K88A 4N49A 4OHBA 2HCFA 4WEQA 3HB1A 4I1YA 2J9RA 1OW3B 4HNRA 2QGZA 1TYDE 3A26A 1USKA 4L7VA 4BNKA 4PLTA 4BO9A 3F6RA 2AN3A 2F3UA 2ISSD 3W5IA 5JJBA 1KZHA 2X8JB 1NJ8A 3CG4A 3RH0A 3QE0A 1JYSA 4NU0A 1KYTA 1VECA 3L7CA 4DJAA 5F3DA 2VJYA 1D2EA 1X9HA 1B3BA 1ZJJA 1RW4A 3EMKA 2NUTB 2WJVA 1YZTA 2O3TA 3T5PA 1RCUA 3EH2A 4RF4A 3SJZA 1XFAA 4GYJA 1CBUA 4FFWA 1NYRA 1PG2A 2UV8A 3PKZA 1KH3A 4KIJA 5FTJA 1XTTA 3ZWYA 3CRW1 3D6FA 4EEKA 2WILA 4CQMD 1T8PA 4QOSA 1EFUA 2DX7A 1ZD9A 2FE4A 3N2GA 1TMYA 4IUCS 3UFXA 3V1MA 4ZVSA 1CQPA 1TM2A 2ZQ5A 4JR0A 4LNUB 3PGXA 1DQRA 3LBYA 1F0KA 3SZ3A 3C70A 1H2RS 3QWHA 2AFVA 4KV7A 4CM3A 5JMWA 3RC7A 5C3MA 2DY1A 1KOJA 1XP5A 1AOXA 3UJ9A 5GY7A 2H2DA 1X94A 4IFIA 4N3CA 2YC4C 3DL7A 4HLCA 3FCSB 5G1PA 1RWOA 4KOEC 1KC1A 4ZI5A 4A2PA 5LXTA 2F3RA 4YQYA 5C8YB 4YRPA 2QRKA 3N2KA 3RRNA 4DMKA 5HVNA 3OJLA 3IELA 2H54A 3VVCA 1MB9A 3K6SA 1B7GO 5EP3A 1I2BA 3A9VA 4BJ5A 1MJHA 3PJGA 4J0EA 2B36A 4MIOA 1FP2A 1QPZA 3PXCX 3H7IA 4QHSA 1W5SA 1KIFA 2XCQA 1MU0A 4AD8A 1RRPA 5FBKA 4Y2UA 4KUHA 3O74A 1K68A 1NMYA 2A9QA 5J5CA 4CT4B 1JFTA 1QGUB 3HVJA 4QJ5A 2AN9A 2JZCA 2QTTA 1VQ1A 3GRVA 3ZZUA 3WIEA 3AUAA 2D00A 4Q18A 3A6GA 2HO5A 1WSDA 3MOGA 1QBGA 2X7HA 2FZGA 1ULTA 4FBLA 3N7UA 3PFHA 5JDIC 2ZIZA 3M6WA 1CUVA 1P29A 3O1JC 5A2GA 5KPDA 5FBVB 1K06A 1ZMTA 3ONNA 4C0LA 3KWJA 3M83A 4MJ7A 1YOBA 1J2YA 3I6IA 3IIJA 3PGMA 4M1QA 1JR4A 4MR9A 2B1RA 3RNOA 4AWXA 1LNZA 3TJZA 1Q0SA 2FMKA 1WMDA 4PRYA 4B5LA 4L5BA 4MGEA 3UK7A 3M89A 3RR2A 2DUMA 1E2GA 4Q9LA 1Z4IA 3VZBA 4QFCA 5EESA 1PQ4A 4GLOA 1MC8A 2YVUA 3RBZA 5JT1A 4PQYA 2QM7A 2BEVA 5JCZA 3K30A 2I99A 1E3WA 1FDIA 4GSLA 5AJWA 4BC1A 4I55B 1TJ3A 1X7YB 3CQ9A 3K6KA 5AP9A 3GNTA 2QE7A 4G23A 4BQQA 4FN4A 5IWCA 1P7WA 3LGXA 1E1QA 3H0EA 3MMXA 1ZOSA 1KF0A 4HATA 2WTEA 3EB9A 1X7ZA 1E0JA 3COJA 1NZDA 3PC8C 4IOKA 4MARA 1Z36A 1MO6A 2H5IA 4UOZA 4B3HA 1PUXA 3WG9A 2XXBA 5HE9A 4MP3A 3V2IA 3ZX5A 4ESOA 2PX6A 3QH4A 4PRLA 1DB3A 1MHTA 2OO3A 2WHEA 3L04A 4O4JB 4AXBA 1X7GA 3FTNA 4Q5IA 4AY6A 1EESA 5J2UB 1A77A 4EJ6A 4C89A 4QFDA 5AXAA 5BWNA 1NVVQ 1YDHA 2IVZA 1JQBA 5CHYA 5JPIA 3E7FA 5KWVA 1IK4A 5C2JB 2WDPA 5A1TA 4OU5A 2O14A 4Q3NA 4ZZ3A 1M2JA 4DCOA 3K0SA 2UZ3A 4UUNA 1NSFA 3B78A 4QOHA 1OAAA 4HUQA 1O97C 4ZRDA 4RJKA 2PT7A 3NS7A 2QM3A 1MT3A 2C2MA 3GHYA 2QAIA 4RD4A 1ZKMA 3AUJB 2ZPUA 4YMVA 4NESA 3QX8A 3JWHA 3C8HA 5K8JB 1L7RA 221PA 1M2HA 2VPZA 5TT1A 3RYFB 1W6RA 2HGSA 3DE4X 3K9GA 2B78A 3WLFA 1CF4A 2CY0A 2WZCA 1BE8A 3OQ6A 4IDHA 4JSTA 4MO2A 3TKLA 1UXHA 4II7A 4D6YA 4RU1A 5CLHA 1P0CA 2PH7A 5JAZA 1APBA 2H0RA 2QXYA 3DM9B 5IUKC 3VZQA 5KSYA 3QMWA 4A0HA 1XZQA 2ZRJA 4XH9B 1N6RA 1ZK1A 2NU9B 1NASA 3CNEA 1LH0A 4E31A 1ZBQA 3BAFA 1JR3D 3K35A 4JDPA 1IMJA 4PNHA 1Y9DA 3E9ZA 4MNTA 1OXXK 4J49A 4YP9A 2P9ZA 1DAPA 2C59A 2ADMA 2E55A 4NAHA 3MRSA 3WNCA 1AQUA 5DNYB 2C2WA 1Z6XA 2R2GA 2V96A 2WE8A 3PL1A 4Q1EA 2RKBA 1PZHA 4AURA 1SOMA 2OORA 5C4MA 4FMCF 4JVSB 2B6NA 4KO4S 5AW5A 3AL0C 3X1DA 1Z38A 3ORSA 3R7FA 4EYKA 1VLHA 2DP4E 2QLTA 4IDGA 4R1SA 3TAHA 1RT9A 4YPFA 4HQOA 4MUHA 1MNAA 1NW3A 3BFKA 2VP9A 1EP3B 3C6ZA 4PZZA 4FR5A 4YRLA 4ZMRA 4JP8A 1NHGA 2VZ9A 1DEAA 1A7UA 1Z2DA 3BX1A 4MYDA 4D9MA 1XTJA 2H2FA 2P4UA 4P08A 2DRIA 3K0BA 4TV8F 4X3PA 1PT8A 2TMDA 4QASA 2CXOA 3KUDA 4X60A 4YRGA 3L6CA 4YP0A 4L07A 1AZWA 4FMDB 3U1VA 2V4UA 5JSZA 1DC8A 3EXEA 1UOEA 5E7QA 5M29A 3ELDA 3HMKA 4WJKB 1RBYA 3G89A 3KLMX 1FJGB 3AERA 2JRCA 1F8GA 1HDOA 2P0EA 3TL3A 4HNUA 2G71A 1VXOA 2HF2A 1DLIA 2WNSA 1LBTA 1XZDA 3TDNA 4EMTA 2FZLA 3NCHA 1T2UA 1DEXA 5EWLA 2BEKA 1S2MA 2H31A 2WJIA 4MGHA 3OUUA 5B3JA 5HDBB 3UGTA 1VMIA 3M4XA 4B3JA 3NTLA 1FFCA 4YMLA 2HF7A 1HKHA 2ZRQA 3B5IA 2PBZA 3U7QA 5DTQA 1ZH0A 4NCIA 5EJ4A 1JDUA 2R6GA 1KL7A 2FSUA 2AYYA 2QAJA 4AYWA 3WGZA 1JHAA 1OH5A 1OZFA 3K2EA 4KLZA 3HCEA 2XUHA 5KU1A 3QX3A 4D9EA 4KRFA 1A95A 1G0OA 3NTXA 1NULA 1C2YA 1P61B 1XB2A 2REXB 1XF1A 2W4IA 1G21E 3GR6A 4I6GA 3KWLA 1B8OA 5IT5A 3DZBA 4QXOA 2QZ9A 3MS4A 1Y6JA 4V38A 1ZN8A 3S6JA 2BDTA 1L3CA 2Y71A 4DR3B 1QO9A 2PUWA 3PDWA 5IAAA 3EVZA 5J4LA 3Q7RA 1BEUB 1ND6A 2X86A 4JCOA 4Y2HA 4RHYA 4L75A 1A5SB 1ST3A 2P9FA 2P75A 3FDZA 2W2NA 3HEMA 3IALA 4IS2A 2BFDB 1S9DA 1DOAA 1ZH2A 4K26A 1IZ0A 2W4QA 2W43A 4KDEA 4G81A 1XRQA 4TRJA 2PSDA 5TQVA 2VYND 4OGKA 5JZMA 4OPMA 1SBHA 4S04A 3K9NA 1J1ZA 3RTCA 1QV9A 1DWPA 4RVNA 2B4YA 2VK2A 3SC2A 1VBKA 4C14A 2VKTA 1CLUA 4N0PA 3U49A 3DFUA 3EXHC 5BQXA 4BQOA 1D7OA 4H4CA 1QE5A 4MTLA 2PT9A 4C9BA 2I91A 3QA3E 1YB2A 2P9CA 4DR4B 4RTNA 2Q99A 2Z8YA 1KP3A 4CL2A 1TM7E 2CNDA 4HDAA 1G17A 2ZEJA 3NEJA 3OZDA 3Q9SA 5DOZA 4W1QA 5ALDA 2F43B 3HB0A 1YBHA 2XQGA 1JT9A 1NUSA 3D7MA 3PQ8A 3EH1A 3QVLA 5HKAA 1ZR4A 2IYRA 1XZPA 1BSVA 4MW6A 4ZCMA 1YRLA 1IBMB 4UJ5A 4YRMA 3QM1A 5AVXA 1E9SA 1LXCA 5CA0A 5I47A 1Q1EA 3FOCA 3NHJA 2HA7A 1K6XA 3W90A 1BD4A 4KL8S 3U62A 3ABZA 3MXOA 2NUAA 2KLHA 4G07A 4BGEA 3H42B 3Q98A 1BA3A 1U8AA 3A37A 4C7JA 1JEYB 4TT3A 1NBHA 3BMQB 3WV5A 3H9BA 1E32A 3L43A 5B1DA 1KVTA 4S1VA 3UG6A 4BQEA 5B2FA 3MMZA 3GDHA 5IVPA 2R00A 2ZSFA 1DAHA 4I14A 1GRQA 3ZIUA 4CMGA 3OBBA 2H1RA 3GJ8A 3C7AA 1CHNA 2KX7A 4WJZA 3VNSA 1AA9A 2NXCA 2HPAA 3KKPA 3T1QA 1N33B 3MERA 4TOIA 2TMGA 2FHSA 3C3PA 1U9CA 2I6XA 2QGFA 1FYFA 2H1OA 3EGVA 3PNYA 4PBTA 2AZMA 1SXIA 5DHTA 3JR7A 2V7UA 1N1EA 1SIBE 3IUYA 2I67A 2OCYC 4LK2A 4X24A 5H80A 3ZE6A 4CM9A 3QBVA 4KSBA 2X58A 4M88A 1ZN7A 3RTGA 4G56A 4GP7A 1Z4NA 3W2TA 4DKJA 2PSSA 3EMDA 4EW6A 3NHAA 3U17A 1JA0A 3CX4A 5EZYA 1RFLA 5K3EA 3A6EA 2OEPA 2QN6A 4CIAA 2Z8YM 1B8VA 3MGAA 3DVAA 2P6NA 4YGYA 3GCZA 2D2VA 4CDNA 3TRFA 1TUGA 3D3EA 3BPSA 5CHEA 1P2BA 4XGIA 2QRUA 3HUTA 3GRPA 2G0TA 3BB3A 3QTLA 1K7SN 1XQXA 4V3BA 4Y9UA 4AF8A 1KAOA 1RC0A 5FBRB 3RS3A 1RXCA 2XKKA 1U2RA 2A9FA 3GPIA 1U5CA 5HF8A 2UYQA 4DR5B 4LEIA 1F5SA 3ANMA 2X1MA 1N8NA 4ZYYA 3HG7A 1FRZA 1RJFA 5CIQA 2H9YA 4EJSA 2JHGA 1T24A 2OO5C 4N8DA 1XLTA 4N5HX 4YJGB 1CUZA 4WPGA 3UPTA 4UMVA 2DOKA 2PZKA 3PFGA 2XCOA 4C5AA 4Y6GB 5B55A 3GV0A 1T4MA 1C4OA 2D1TA 3LSYA 4QG7A 4ZVMA 5K0ZA 1X7DA 5D85A 2CFTA 1ZJ4A 3M8KA 1LTHR 1SOVA 4XYMA 4YRTA 1CR0A 3RSGA 2C5GA 1F6BA 1RWBA 4MVJI 1X8LA 1EA7A 1L7EA 4XWOA 1HTWA 3O26A 1UBFA 4KMMA 4EATA 4RZQA 4KQ1A 1LK5A 4TTJA 1SCJA 3SFZA 3GGSA 4LJAA 4O0MA 3NONA 2V7TA 1ADCA 4Z4HA 4KNWA 4R6WA 3H9GA 3VC7A 2HWUA 1FW6A 3A14A 3QLTA 4JLJA 4FXPA 4OXYA 1TCBA 4GP6A 1KK3A 4UUMA 4Y9TA 1JTFA 1KVQA 2A0XA 1S8FA 2R7KA 4WN9B 1P2DA 5L6LB 1PEKE 1E3SA 1YKFA 2VHJA 3WYDA 4ZC8A 2IZZA 2ZCVA 4PZYA 5EXXA 3BMNA 2JLUA 2ZUEA 1ZH4A 1ZDMA 4Z7JA 3L8FA 1EJ6A 4MI6A 4QODA 5KINB 1Z7YA 5CDFA 4Y2PA 2GCNA 1A5ZA 2ISCA 1ORRA 3HUUA 2JFUA 2I5PO 4PFQA 4GXNA 3DWGA 1W2WB 4W6ZA 4J1SA 2NPFA 2XNHA 2OBLA 1Q7RA 4GC5A 1ESNA 2OV6A 2P3SA 3EDOA 3EFBA 1IZ8A 2IXBA 3B3FA 3PX3A 4PY2A 5CT5A 2QA5A 1CUFA 3QBJA 3H9EO 2UYHA 1XVTA 2GETA 4YX9A 4DLKA 3WADA 1TK9A 3FKSD 2CF5A 2JPDA 4Y2VA 2XNCA 3KYJB 3INTA 2ACWA 2WM3A 3EBOA 1MO2A 4Q16A 3VJKA 4JB2A 1BKDR 3QE2A 4LRUA 4Q24A 3RAFC 2JJMA 4YP6A 4RVUA 4KQHA 1P2SA 5EOVA 4Z54A 2QW1A 1CW2B 1II0A 3COYA 1NRJB 2PMBA 2X41A 3FPBA 4H27A 4WKBA 1DC3A 2PQMA 2RDMA 4LVCA 3GGOA 2NU6B 3NW9A 3OHPA 4KPUA 4PCUA 2Q0SA 1Z7WA 4V0RA 1SC3A 4N18A 2NZ8A 5ITVA 1EUYA 3PJRA 3KCQA 2AD1A 3VTFA 1Z2NX 3X1YA 3MVEA 4JGGA 4GI1A 3CHYA 3OIUA 4RCVA 5FYQA 3WZMA 5ESXA 2A9JA 3EY4A 2WU3A 5A4KA 1FLVA 1PLLA 2FUNB 4L0MA 2QVLA 4NBNA 4BBZA 1PKEA 5AI5A 3KOUA 3HFSA 1CF9A 1YOVB 2NAFA 4H4DA 4LPSA 1PRYA 2W6ZA 2AH5A 2HU8A 3CMMA 4C87A 2GEFA 2PKWA 2IHYA 2OGZA 2COUA 3QENA 2EOAA 1T15A 4FFBB 4IVNA 4B33A 3HJTA 2VA8A 4HNQA 1VJGA 1WLSA 2YWJA 4D81A 3A6LA 3B7GA 4ERNA 2YRFA 3S2SA 2BR3A 1TJPB 2WTXA 4NJEB 4CM7A 2EYQA 3AKDA 2O54A 5CYFA 2YWEA 4R2MA 5E2BA 1DAKA 4QELA 3SZGA 3I52A 1CY6A 2EGUA 3BN3A 3LO8A 3FHCB 3GQBA 4N4AA 3TE6A 1OC2A 3ZGOA 5KAPA 3II6X 5JVDA 1S3FA 2RIRA 2WWRA 2ZRLA 1V1MB 3VR2D 5AOCA 1TTTA 4DJ5X 3EAGA 3QVXA 1AXGA 1RJWA 2ZTHA 4IG9A 2CDNA 2REQB 2VOJA 2YMMA 3CR3C 3I76A 3KKNA 3M4JA 5A9TA 2GK7A 3ZHVA 1K3FA 1T2AA 2OD2A 1TW2A 3VTZA 1XHFA 3I4CA 4YI5A 2E7ZA 1KPIA 4C05A 5HCUA 1U7XA 3BH0A 1BX1A 4L1KA 2H8KA 2OA0A 5EZ5A 4XPIB 4W82A 4GZLA 2ZROA 3T3MB 1U6KA 4BN0A 1REQA 1P5FA 1GNRA 1QOPB 2J5XA 1ZUNA 1A4UA 1X14A 4H0CA 3TNLA 3U3OA 4Y3UA 2W6QA 4KN5A 3GPLA 1UFOA 4MVWA 4OM7A 2P6OA 4Q3LA 3RAEC 3DLHA 2QLMA 1TUBA 1MBZA 5J1TB 1MRNA 2B0CA 1V7QA 5GGXA 5B1YA 2PRYA 2BIFA 3MSCA 2A5FA 3H4MA 4F1JA 2R6R1 1U3DA 3NVAA 4JC4A 3U16A 4UQLA 3KAQA 2CB0A 2XI4A 4LZZA 4RPGA 4WXHA 3RHFA 3TRDA 1LJ8A 3QYAA 2RCYA 5SZIA 2ZJ5A 2FZ5A 1K7XB 3H2KA 3PT5A 1DIOB 1H5UA 1W2HA 4A6EA 3I5UA 3P8ZA 4LI3X 2BP7B 5K4HA 1U0NA 5IXJA 4TS3A 1H9BA 3W6OA 4NU6A 1U0SY 2OGSA 5JY6A 1RYEA 3ULKA 3PVCA 1S01A 3HNRA 1QIDA 4PAOA 4EECA 3PD1A 1SVKA 1H8HA 1YB6A 3SN6A 4POOA 2JGIA 3ZU5A 3IPLA 4LY6A 4Q12A 1J24A 5C7IO 3HVIA 2Q8NA 5CT6A 3X0DA 2Z4TA 1EDOA 1UXKA 2WWTA 3R40A 4GYWA 4L6AA 2ANCA 4UMDA 5KQLA 4Q7JB 3PNPA 5GINE 4BQIA 1UC9A 3O9MA 3T95A 1W4ZA 3EGXB 4M1MA 5EMLA 3SWWA 4HDQB 4RH1A 3FUUA 5EY5B 3VYUB 2F9MA 4QUEA 4RTJA 1A2KC 4X7PA 4QGBA 4LKOA 3AZPA 5IVKA 1D3AA 4ZDJA 5L3SB 1YZFA 5LZ2A 2X9VA 4A36A 1XFDA 2AFIA 1VJ5A 2B1QA 3K8ZA 4DSAA 2AG0A 1XKLA 3JYNA 4CEHA 1RADA 3KZKA 4MUJA 3D31A 4DR1B 3K72B 3H5RA 1UJNA 2I6GA 4DS3A 3RYCA 2MOKA 3WHKA 4LVUA 2O6LA 2WM9B 4CQLA 4NX2A 1SUEA 2CNKA 4KJZA 1SHTX 2A9OA 4F8YA 1TCVA 3CLRC 3STVA 2IEDA 4ANFA 1CUIA 3T8YA 2PBLA 4IJQA 3EZLA 2J45A 3AG5A 1IXZA 2CL0X 3IX7A 3L93A 4Q4DA 4Q93A 5FTWA 5T6MA 3RODA 4FDTA 1EE9A 2YY6A 5EKXA 2HSEA 4JI1B 4L72A 1KEVA 1PWXA 1YWGO 1G60A 2AI3A 2C99A 3SU8A 2WUFA 2OORC 5HA5A 2JK1A 5J63A 1P3DA 1TT7A 1ZM2A 2GS9A 2XTJA 1T8SA 2CZGA 3GVIA 3VAZA 2FW8A 2I78A 1IVYA 3D6VA 4DLYA 4JJ4A 4ZPJA 1F2DA 2C20A 5DYNA 1CB0A 4UATA 4ZHSA 4YR9A 5CFPA 2ETVA 3TH5A 2YIVX 2EP5A 3CC8A 3ZCSA 2HN9A 4CIVA 5A3QA 4D26A 4XM1A 4ZYXA 1NSTA 4DDKA 1U8CB 4BHTA 2IPMA 5DJ5A 3E9CA 5KJFA 5C1PA 1EDZA 1KO5A 4ATNA 4IX1A 1TUEA 3EYAA 1XZCA 3MUFA 4IWYA 1NDHA 4WESA 3ABSB 3TFWA 3T54A 1RYZA 2CE7A 4DVJA 1EM8B 2AXQA 2B20A 3PHLA 4JX8A 3ZY6A 5JI3E 5F3WB 3SJUA 1T3SA 7GPBA 2XCTB 1NZFA 1XKXA 2ONCA 1WOMA 1TX4B 5IAGA 3ZY2A 1BFUA 4HDSA 4LXXA 4ZGWA 3M81A 4JJ8A 4BJ6A 5B3JC 2KSQA 5E0KB 3UJDA 2I71A 3VSEA 1O6GA 4E5UA 4MUAA 4XFJA 4HZUB 4H6WA 1T91A 2QD2A 3ZI4A 4HAVA 2W22A 1OIXA 2D3TA 2RGWA 2I2WA 3OPVA 3PLNA 4RS4A 1CE8B 4YJFB 4A9AA 5GVRA 1GCOA 1ORIA 3FJ1A 3HC7A 3Q3JB 4JOSA 2IE0A 3PSAA 4LC0A 3LYHA 4WOJA 5AJYA 4KV9A 5L3RA 2YZNA 3BWBA 4UNQA 3KDPA 3OBIA 1ZCBA 5JSKA 3RT1A 3VO8A 2YUTA 4MULA 1LQ2A 2P9EA 5JBIA 3E5NA 3ZHXA 3FCAA 5CGZA 1V5IA 3L8YA 1X80B 1SXJE 4FS3A 5H68A 1KAEA 5AW3A 3IEKA 1MJNA 3IS3A 4MA4A 4NXNB 1FFXA 4R98A 5CEEA 3QY0A 3NIDB 2XGJA 4KLRA 4GPZA 1OLSB 4GMGA 3WNDA 2DHDA 1N6PA 4LYDA 5C32A 4PS0A 2H4FA 3KUKA 2IUYA 2ZJ2A 4V39A 3WLTA 4WY8A 4L9RA 4MR7B 3AFGA 1XQ9A 1PV2A 2AN5A 2Q0HA 4HEQA 3NRJA 5EI5A 5HJ7A 3OJCA 2C8VA 2Q4TA 3T0FA 1R6TA 4GKVA 3ZK9A 2IUEA 3H2SA 3IOBA 2DFNA 3OZ7A 4IP0A 1OI4A 1ULBA 2OCLA 2YVLA 3H75A 4S0XA 2PO7A 2C3UA 1L5VA 4I2NA 1YRHA 2V1XA 5GV7A 1KEEB 3THSA 4J2HA 3FIUA 4Y67A 1Z0AA 3JATA 4INAA 2VZLA 1OXBB 1VKJA 3A6PC 4YJ2A 3RU9A 5SZJA 3TPZA 3KAKA 3U61B 3UHPA 1J97A 3PCTA 1OFUX 1KMHB 3HCWA 3TD2A 3MYRA 5IRCD 1H6AA 3HBJA 1XPOA 2ZRBA 3WWEA 1XDDA 2ZWPA 3ABRB 2WFMA 3DG9A 3GPDG 3R7DA 3F49S 3BGIA 3GUYA 1LFAA 2DWUA 3OIVA 4OP2A 1GL3A 1G5TA 3V7YA 4EPWA 4HNVA 1K9SA 2MHCA 1RKBA 3GROA 2VYVA 3DHVA 3MWEA 4NBKA 3OFVA 4OP1A 4Q02A 4ZZ1A 4D8XA 1TQ6A 1RWXA 1PR4A 2NNLD 4KLNA 5TEVA 2J32A 5C5DA 1B6GA 3KZMA 3VOAA 3TQRA 2YOHA 4ZWNA 3KTOA 1WQ1R 1U3UA 2D7JA 4F3CA 4N7BA 3NM5A 5KC8A 2GASA 2PUBA 1E1MA 1GWNA 4Q1AA 1CUSA 2WD7A 2XZDA 3OF2A 5U9CA 3OZWA 2C4TA 1R5BA 3FWHA 2ZPTX 4O2AA 3MWDA 4RKQA 1MORA 2I6UA 5TF4A 4XYBA 3DV2A 4BZQA 1F8YA 4B43A 1IMOA 1DV2A 3TDMA 3KZOA 4B3SB 1E2IA 1JEQA 3LLMA 3P27A 3ZHYA 1ZY2A 1C9NA 3OCZA 1CZLA 1JB1A 5K3OA 4IGKA 3E82A 4MKHA 4B45A 1RRVA 2PJRA 2GAIA 3L84A 4R1OA 3ORYA 1VIDA 3DDOA 3E22B 3IAAA 3MOSA 4RACA 3U26A 3AY6A 4JBHA 1H2FA 4L2IB 3PNVA 4QYSA 3IC5A 3RHTA 5B2EA 5KYWA 2RGGA 3KL2A 3U09A 1EFRA 3BFPA 3EDRA 1NYTA 3A36A 2H08A 3NH6A 3Q3IA 1GAWA 2H9AA 2P2NA 3LCUA 2WSSD 3GP5A 3EA5A 1GN9A 1WX1A 4NOJA 3DOHA 4O4IF 5I4IA 2GOYA 2IXEA 3UG7A 3WQHA 2CJXA 1WHTA 2AI2A 3D5QA 1RWNA 3VR4D 4BGDA 2PAFA 2DWQA 4CMCA 3CSSA 1MPXA 4RPLA 5GOTA 2Z2ZA 4UVEA 3MUNA 1CC1S 3OT5A 4F7WA 3TM5A 1QQBA 3ERCA 2A58A 3MS7A 1V7PC 3R8CA 4GKJB 1YKSA 5JECA 4YCJA 4MAFA 4EJSC 3WLOA 1VPWA 3ZXYA 3FWZA 1KEKA 1XLTC 2BHRA 2DMRA 1T8RA 1I36A 1MZPA 1ZM9A 2ZIWB 3BRCA 1JG4A 3AONB 3KETA 4ADSG 1JPJA 3AIOA 3BIFA 2C07A 2P2SA 3WC4A 1FFDA 1NZJA 5HYVA 3C98A 2NSYA 2ZSHA 2IF0A 3GELA 3WAGA 4BQSA 3K53A 1SCNE 1JKIA 3CRNA 4ENUA 4ZI2A 2AXNA 5H4HA 1DPFA 3HH8A 2NTVA 4GSKA 4M1KA 1ONBA 4QATA 5G1NA 3TMYA 3VKVA 4ZZIA 2O59A 2E6KA 1UH5A 3WB2A 1OXMA 1ZG3A 3BKWA 3HCNA 5EMHA 1SC4A 4BRSA 1EBUA 2Z6QA 1DJQA 1KI9A 3U4HA 1WW8A 3UJCA 3IQWA 1HY3A 4TS1A 3F46A 4GI2A 3ZBUA 5A3RA 3K8OE 4LX8A 4CUZA 1U1DA 1KDOA 4HC4A 1FVFA 1Z34A 2D0PB 1K8QA 2R4QA 3ENZA 4EW2A 3MINA 5EIEA 2CL7X 5T3YA 2F8MA 4LRQA 3GRCA 2LNDA 5CXUA 5IFLA 2GPNA 4IDAA 2GQ0A 1DT5A 2V3CC 4QC2A 3DCNA 5FRDA 4F91B 2RKOA 2PZLA 2H06A 1I4OA 4TSFA 1WXXA 1QMPA 5GWXA 4DQUA 5CAEA 4D42A 5KTPA 5EWJB 1C1XB 1P0PA 5IZ4A 2BTEA 1I4TD 1KMNA 2IKSA 4PWZA 3RVJA 5KB3A 3KVRA 2JJ2A 2RHRA 4TZTA 4JL8A 3AFNA 3NYQA 4DLRA 3FBGA 4C4ZA 1E3EA 2KLBA 1SPBS 2GUGA 4I4IA 2DH6A 3D3WB 1RXEA 1G9TA 4GU5A 3H8JA 3CF2A 5T64A 4YXFA 5K4GA 3CVYA 1F06A 1UANA 5ALZA 4NARA 1T9GS 2ERYA 3D1VA 1F3LA 5SICE 1RTKA 3GGDA 5JG7A 4ZIRB 1E1RA 1XALA 2NZ2A 5DLYA 1T2NA 2ZR8A 2D2IA 4HFNA 4FILA 3AUSA 1KXZA 5A7FA 4X92A 4QVIA 1NA5A 1FIUA 1LPNA 2FWMX 5F1OA 3LH5A 1OQAA 2N42A 3M9LA 3CKKA 3WQBA 1G2PA 3LE8A 2V8OA 1FNBA 3OCWA 4ZFNA 1C3EA 1Y8QA 4II3A 2PYIA 3ZVKA 4MYSA 5IMSA 2BM9A 2X0KA 3PXGA 3N2ZB 2QLLA 3WL6A 2ZUDA 4PVCA 1M8JA 2JFXA 3LDGA 3ECAA 3S99A 4O6VA 2F9FA 2VPQA 4OKSA 5G4KA 5AXDA 5H3LA 1C7QA 1YZNA 1K89A 2QG4A 2XB6A 2WB4A 3KEFA 4F4DA 1II8A 3OZVA 3DUFA 1BWQA 5D2CA 2W2MA 2XCSB 5IBRA 1DC6A 1EUCB 1YXMA 4NMXB 3WGGA 1JI0A 4JBNA 1MD9A 4DTIA 3L6BA 4G0UA 1S1CA 2FEMA 5E8JA 2QQ0A 1SXPA 1EA5A 1COWD 1CQJA 4EHNA 5JO0A 2P4SA 3CKLA 1U7HA 2FKNA 2VKQA 4CG1A 1UBEA 3VV2A 1YZUA 4R3NA 1RRFA 3I8XA 3G2MA 4NCNA 4BB5A 2LUOA 3AVPA 3DKVA 5BNIA 2RGAA 1H9CA 4AX8A 2RGUA 1TB4A 5LA6A 3QFSA 1H4QA 2FP4A 2W48A 4RA6B 1MENA 3HJBA 1EVYA 4HFMA 3ELYA 3IAUA 3U44B 3PGVA 2D59A 2QX9A 3FVVA 1MAWA 2ODPA 2XYPA 3BRWD 2HSDA 1NF9A 1J9EA 1Y4DE 1ZSYA 2Q28A 2OKGA 2YS7A 4XCXA 4XYGA 3GZ4A 3SP1A 1VM6A 3UGKA 1NV8A 1VBMA 2JZOA 3EXG2 4IGFA 5I45A 2YJ5A 1TM3E 2WNIA 3AHDA 2YZ7A 3AF2A 1G3IA 4I5FA 4LBZA 1CUGA 4A03A 3VHRA 1CR6A 2M98A 4JVOA 2EFGA 5BYAA 2JJQA 1GGJA 1EWRA 5DYIA 2PT6A 3B6KA 3DVQX 4QX6A 4XARA 521PA 2M6LA 4P80A 3FTEA 1D2NA 2OO7A 3O4HA 5HF6A 3IRUA 2C78A 2QTVB 4PEVA 2QMEA 3HCFA 4RV4A 1CU1A 1F51E 2O0HA 1TQ8A 4BE7B 4N0DA 4YACA 1SBTA 1QX3A 4PLCA 2O8VA 2B8EA 3K31A 4N65A 4UM9B 3AF3A 4YPVA 3RUFA 3BDVA 3ACCA 4MAMA 3WLAA 2QL9A 1IULA 1TF5A 3QQPA 1GDHA 3RWOA 5IBPA 3TW0A 2B5VA 4WDQA 2ATIA 5LR6A 2MWMA 4JA2A 2GUWA 1M6WA 2HDNB 3B1ZA 4QLAA 3IUPA 4FP9A 3OESA 4QVKA 2Q62A 3FJYA 4TLAA 1PGPA 2D1QA 3AKEA 3F74A 5AMXA 1KS9A 4D25A 3O8LA 3ETLA 1EE1A 4P53A 4ZOBA 4A23A 2QX7A 3I45A 2AQHA 2PJUA 1TRHA 1NQAO 1L5YA 5A3SA 3UMVA 3COWA 3V8PA 3URKA 1H0SA 2OSVA 5EYPB 1ZL0A 2BD0A 2Q07A 3MUOA 1WXHA 1C3VA 5TGDA 5FPSA 2UYGA 3FR7A 4B83A 4BNZA 3CVWA 3PQEA 3DJYA 4LHSA 3SBDA 3GLFE 1PTJA 2AZTA 4I50F 2ADFA 1BEEA 3A05A 4MS3A 3DEHA 1A8SA 3FOZA 5M7EA 1P1BA 3AETA 2AMYA 4HL6A 3ET5A 2IHKA 4CNQA 3I9NA 1H4VB 3QE9Y 3KOZA 1T4BA 1DUSA 1QVZA 2WJZB 3ND7A 3KE9A 3PGKA 1OX4B 1Y63A 2IYUA 4YO8A 2HLHA 2VF2A 2QT1A 1E2LA 1H2HA 2BUCA 2ZOSA 3U4DA 1U65A 5IDWA 1NJ2A 4ZI3A 2VUTA 2XHZA 1SC1A 1V5EA 1YSCA 2AXPA 2ZULA 4NHOA 1DJMA 1MUUA 3NIWA 2J3LA 2RJ3A 1T1EA 4FC7A 4YQEA 5CJ2A 5ALHA 1IZYA 5C0OE 4RAOA 4FFDA 4J8PA 1D03A 1DC7A 1V1RB 4U2CA 2XKBA 3AP2A 3K70B 3OC0A 4CMAA 3B36A 1TLTA 2EHDA 1FS4A 4TWIA 3CYFA 4D4IA 2VJMA 2WSMA 1EUQA 3GEPA 3H4IA 1NTOA 4X90A 4F04A 1RI2A 1WCV1 3QOWA 3D5EA 2A4MA 1X39A 1OMOA 4I8DA 4TYMA 3M9XA 2PQ2A 2ERXA 2ZBUA 3O1HB 3P1JA 4Y0AA 1E4EA 4GPD1 5CLGA 2NV2B 4EX6A 5A6SB 1WMFA 3ANXA 3CMCO 3C74A 3EGEA 3VU9A 5LQDA 4P1ZA 4D57A 1RM5A 3QMVA 2XUQA 3Q7PA 2XH8A 5FR1A 1SUCA 2VDKB 4WKNA 1NP6A 3SJBA 5EIWA 1A76A 1W0JA 1EZ1A 4Q9NA 3EISA 4QHTA 4BL5A 1LLUA 4EA9A 2I3ZA 5JS6A 4JBIA 1E89A 3RIYA 2VP6A 2Z8XA 3M2PA 1OXKB 1WHSB 1NOIA 3E1GA 4G6ZA 3Q8XB 4AX4A 4F3YA 3SNKA 3KTDA 3DEIA 4TN1A 4KE9A 5DNDA 1E9CA 2AOTA 3IPAA 1V4BA 5JH7F 1GY8A 4QNRA 4DNXA 4KN6A 2VF5X 4R2HA 1LBIA 2W2TA 3VHXA 3JYPA 2NG1A 1LPPA 2XDQA 1KR5A 1SVLA 4G8BA 4RE5A 2AKYA 1QDLB 1UQRA 2F64A 4JI5B 3KXIA 2YHIB 5KKAA 3BL5A 3GEGA 2XUIA 1D2GA 1F4LA 2YIMA 2QOEA 4A5SA 5LPNA 3P2YA 3DZDA 5JZ9A 5F1YA 3UIEA 5K0GA 1I7DA 2WJ3A 5EFZA 4WLOA 1HLDA 1YRYE 3BXHA 3ASUA 1W0KD 3P45A 1GRVA 4YCCA 5LU8A 2XB2A 3BSFA 3I9V1 1TQ2A 3QI2A 2O8NA 3NAMA 4GWKA 3TVTA 1WQ4A 3KB1A 3EC2A 4LXYA 3T5MA 4QPNA 5KIAA 2F8SA 3EJ6A 3DCJA 5E4JA 2ZRGA 3PL5A 4FMCB 5FOSA 3SI7A 4S1PA 3ZS9A 3KJEA 4K6FA 1NNUA 3OQIA 2XA1A 3WBKA 3FROA 4CL8A 3H86A 4GXRA 1FYWA 3FSEA 3NG1A 3U37A 4CU2A 4F06A 3DVRX 3PSHA 1E5VA 1VGRA 3FE2A 5IEJA 1R6XA 4FDMA 2ZDHA 4TV8B 1FMTA 4QAJA 2BT4A 1Y98A 3LBIA 3UM9A 2NZXA 3QVWA 4TYWA 5TS3A 1ODSA 5TPWB 1AGRA 5KNDD 3K96A 5DTIA 2BVNA 2C0PA 2ZWIA 3QSGA 5K1ZA 4KAFA 1U02A 1NT4A 1U5AA 5CB4A 5IN4A 2CV1A 4IQGA 3ZZNA 1C3LA 2VQDA 3CXRA 1GV1A 3KJZA 3SM9A 1VMEA 4BQFA 3X1KA 4ZOLA 4XTCS 4B3FX 4G8CA 3P52A 3LUDA 1UK9A 4Y0NA 1B1AA 4BMVA 3CM0A 4Z7OB 1OB2A 2EJTA 4DV2B 4DMUB 5KJCA 3WK6A 3E7XA 4B8WA 2PA3A 4WVFA 2O7RA 4PO1A 4ZTZB 1XRJA 3HV2A 3K1ZA 4L9WA 3LX6A 4FR0A 2PZFA 4X3CA 4YRAA 4BCCA 3OHSX 4DBLE 1E64A 3Q5GA 5EQFA 1UZLA 3SC6A 1VIAA 2C96A 5THKA 1G55A 2EF0A 4KUGA 2C5FA 1MQAA 2YDXA 5I7AA 4NEGA 5JAQA 3T3DA 4BTEA 3RVSA 3QU2A 4Q1CA 5JQGA 1E9RA 2ZXUA 1WSBA 2ZVDA 3BA6A 5J5VA 4HFJA 4TGLA 4URHA 2EIXA 4V02A 1ZC3A 2J0UA 3RS5A 1TADA 3SBXA 2A3NA 3EZ6A 1XCPA 1JMVA 2FEAA 2TMKA 3HN2A 4I1PA 3WWYA 1GZ5A 1JEDA 2WMOB 5EMJA 3ISTA 1LSJA 4O1MA 2JH8A 1PSZA 2YH2A 3FJOA 5IH7A 3IRVA 4OL9A 4ZYLA 3FUXA 1ILWA 3RKUA 1SK8A 3JASA 3F96A 2EJWA 2YN2A 3A9WA 3PFKA 4DJDC 2HREA 4BJ3A 2AMVA 2ZSJA 2PZ8A 1KU0A 3NHMA 1I5RA 1WPGA 2ZVPX 4NBWA 1ENOA 5FOVA 4DYDA 5KTNA 2W6ID 3OCVA 1U9ZA 3I2GA 3VNQA 2F62A 5AKZA 1TKAA 1E9EA 2QJTA 3Q0EA 2R1TB 2P9HA 5DHAA 4V1CB 1XMJA 5EXSA 1QHHA 1J7KA 2Q1WA 1SO8A 4Q3CA 3BILA 3EXHB 5LZ8A 4O02B 2JCSA 4WZAE 3MTIA 1TI7A 5FXMA 2CHQA 1N7JA 1KYYA 4JT4A 5BW6B 1OC4A 3O84A 3DULA 3N0TA 1M1XB 4ON9A 4EQZA 4LWZA 4JDUA 4TYPA 3QE4A 3IHTA 4NXMB 2D1YA 4BKPA 5A02A 4H3VA 1MIHA 1T3ZA 1XXHA 2ZIUB 2BTQA 4OLHA 3TOXA 3LVFO 4XVCA 4J2OA 4P83A 3J7TA 1PNOA 3IEIA 3LDAA 1A7JA 3PTZA 2G40A 4C7BA 1KDPA 5A0VA 2OP0A 4B8ZA 3NPMA 4LZJA 2WM2A 4J4BA 4R81A 5CA1B 1VKOA 3ASZA 1XPRA 1GUAA 1W5FA 2CMFA 3PV0A 4G63A 4JZYA 3VSAA 3ADCA 1NUUA 2F1RA 4FFPA 4P5DA 4D4JA 2H1IA 3U60B 1AV6A 5JTUA 1I3NA 1I6MA 4XPZA 1QVRA 3DNPA 3KSUA 3DTNA 3PNOA 2EX1A 4EBBA 3D6MA 4URVR 4PG6A 4BV9A 3FPSA 3DFIA 1OROA 3GU3A 3PPVA 3O95A 1RKVA 2D4AA 3PRHA 1OJ7A 5A4DA 4JXZA 3HKDB 1QRAA 2O8BA 1SELA 1JVSA 4D80A 2UZ4A 1QHXA 2Q2NA 3L7IA 2BPOA 2Q3CA 5KJ6A 1V6SA 5DM4A 1CZHA 2VDLB 4CLRB 2R6AA 3C48A 2G06A 3PPWA 1BXRB 2X8LA 5CLLA 3T3PB 1P8JA 3HBFA 3LHIA 1SEVA 4MW5A 4MUMA 2Z0MA 3C16C 4HNSA 1YUBA 5BV1A 1L7VC 5LKAA 1O96A 5DGHA 4ZA2A 4Z2AA 4FHFA 2PU5A 1KETA 4D3FA 1WXWA 4ZU6X 4AJLA 1RM4A 1W4AA 2DFTA 4U2EA 1E6LA 3OT4A 1XTZA 1Z22A 1FVOA 1GUFA 1XEXB 2YC2C 3C5VA 1I8TA 3LT1A 3L7AA 3IR6A 3NZEA 4Q4LA 3ROXA 3I23A 4AC9A 4LDAA 1TZBA 1MAAA 1Y7LA 3DZIA 1OZAA 2PBFA 2UZ1A 3NBZC 3IUBA 3PDHA 1VSBA 4CG3A 2WINI 2BL4A 3P26A 3SZUA 3GFPA 1NJFA 5AD1A 3Q5EA 1P2FA 3BICA 4KE8A 1KR2A 1NBWB 3JAKB 5DNCA 3HYNA 1O8CA 2ZWOA 3IPRA 1ZOLA 4JA0A 2E4AA 1DBQA 3JQ8A 3QVKA 2V54A 5T4HA 5FOXA