2EFDB

Ara7/atvps9a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
165
structure length
152
Chain Sequence
SINAKLVLLGDVGAGKSSLVLRFVAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
total genus 41
structure length 152
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efdB00
1JR3E 2GJAA 5L3VA 4RY2A 4R9UC 4EDHA 5CJPA 2FGJA 2Z83A 1JECA 4JSTA 3UWOA 2D06A 2ZIAA 2OBLA 1FUKA 2G83A 2C99A 1TF2A 2FX3A 2HF8A 2PLRA 2RGXA 3PIRA 3QKUA 3EX7C 2YOHA 2YC4C 1EWRA 3F8TA 3OIVA 2NTYC 2GCOA 3K9NA 4POAA 2BVNA 2FPKA 2PT7A 2QORA 4NPHA 3GFOA 3T5DA 2AWNA 2IS1A 3AKDA 1X3SA 2I3BA 4AKIA 2OG2A 3ZS9A 3RRMA 4Q5IA 5CDFE 1TUIA 2G88A 4DLUA 4PX9A 2UZ3A 2YKGA 3T61A 4XVRA 1XPUA 2ZVPX 3D7MA 4LYAA 4M53A 3W6NA 2L0XA 2XTMA 3I8XA 3WXMA 3KQUA 1Q44A 4BFVA 4L4UA 4Q1DA 2ATVA 1GG2A 3A36A 2F3RA 4TMKA 3FMIA 3I3SR 5L3RA 4XTRA 1F2TA 3VR2A 1E2PA 1IN6A 2IYLD 3LD9A 1KJWA 2CL0X 1CRPA 3P26A 2QTFA 4TYPA 1W2GA 2H8KA 2FH5B 2J59A 2YWGA 3C7KA 2OXRA 2F9LA 3GCGA 2DFLA 1DG1G 4XIGS 4MYTA 3TUIC 2VF8A 4RD2A 721PA 1P2TA 2O0JA 4JBYA 3IHWA 1UKZA 1G6OA 4A0FA 4S35A 1A5TA 4BLOA 4TZ0A 2ZM5A 4J0QA 1EFTA 4BASA 5KNCA 2FPLA 3EPLA 4OHYA 1EFUA 2IYUA 2A5YB 3B1XA 4G5QA 1JPJA 2NPFA 4KAXA 1RJ9A 4FXPA 1II9A 4F4CA 2GEVA 3BC1A 2BMFA 1HH4A 4DC9A 3L0SA 4MDEA 1Q1ZA 1J8YF 1F60A 1KHTA 1XTQA 2ZI4A 3W5JA 4KO8A 2X19A 3AH8A 3TVDA 4V0KA 5J4HA 4DLWA 5G3YA 2HLDD 4P33A 3EZ6A 1G8FA 3PXGA 4GOKA 5AJZA 3TH5A 1CRQA 4DT1A 3FWYA 4P32A 4BECA 4TYWA 1ZBDA 4DLTA 2AN9A 4AKGA 3VQTA 1UF9A 3NDBB 2A78A 2R2AA 2GWHA 2JIZD 1LVGA 3GJ3A 4LC1A 2P0EA 1NBMD 4Q4AA 5SZJA 4DSOA 4XWOA 3MRSA 4A36A 1T9HA 4JVNA 3RHFA 3JZMA 2BBSA 1ZM4A 1NLYA 4GZLA 1YU9A 2EFCB 4LJYA 4NKRA 3TK1A 1OFHA 5DN6A 4BFWA 5J4VA 4QM7A 1VIAA 2ZS9A 2R6CA 5FL3A 1BMFA 3K0AA 1KSGA 2O8DA 2IL1A 4JLMA 3OESA 2VA8A 4DLXA 2G9NA 2F55A 4A6PA 1SVIA 3LBNA 2IYQA 4IVQA 4KCGA 4QKQA 5HR5A 2RGCA 3QBVA 4PTLA 1E69A 2B21A 1IY0A 1ZW6A 3KJIA 4LDJA 2YV5A 2FFQA 2JJ8A 3RS4A 1E1QD 1MOZA 3A1VA 3IDQA 1NVUQ 4D0GA 4BFXA 2CCKA 1KI9A 4NE2A 5HCIA 1VMAA 4B32A 5L8VA 2ERYA 1G1MA 2IBMA 4RKFA 3TQFA 1SHZA 4TYQA 2C77A 3FMPB 3ZGXA 4CDGA 3BAFA 3CR8A 1U98A 3LH5A 4NCIA 3TBKA 2W6IA 4OK5A 4FINA 4FMDF 2JLVA 3CX7A 4Q9IA 1QRAA 1G17A 4JJZA 2C2HA 4MKFA 3WYAA 1KZGB 3IGFA 2JASA 2QGZA 1OH7A 3LQQA 4EFNA 1EGAA 1E2QA 1MO3A 2PCLA 3KQLA 1GKYA 1P2UA 1X8JA 3BRWD 3W8NA 2QG6A 4M9SA 5EE0A 3OZXA 4V0OA 4B44A 1CJMA 4A2PA 1S9DA 3WHLA 3U44A 2J0SA 1NSTA 2ODWA 2IYYA 3DOFA 3C8UA 4JVSB 4JKIA 3EA0A 3CB4A 2NO9A 2QE7D 3GJXC 4RCZA 3VHXA 3EWAA 3U5ZB 1N3BA 3ZVMA 5FBQB 1FMLA 3NC1C 2DWPA 1NY6A 2ZI5A 5F2EA 2WJIA 4YONB 4URVR 1LF5A 4R98A 1TF5A 5FTLA 5L3QB 2D2EA 3Q9LA 3GQBA 4DSUA 1R5OA 4CEJB 4DLZA 3SZRA 1EFHA 3IPYA 2G0TA 2EWVA 3KKQA 3QNUA 1N6HA 2ZJAA 4Q48A 5EUQB 2GETA 5IRCD 1G3UA 3KXLA 5G3ZA 2CK3D 2ODBA 5TARA 2GF0A 3FFAA 2XZLA 2WJYA 4O2LA 2WSSD 5EJEA 3BB1A 1A7JA 1NBME 1Y3AA 1K5DA 4DUGA 3B1WA 3ZVRA 1H8ED 3RS3A 3WNCA 4BFTA 3DPUA 1S1CA 2Q0HA 4D0NA 2PZEA 1QHYA 1H8HD 2I1VB 1HE8B 2JA1A 3DKVA 3FHCB 3L82B 3ZS8A 3HJNA 3DO6A 1XD2A 1JEDA 3W9YA 3WYGA 2C9CA 1FPMA 2IYVA 3PUXA 1T91A 4C3ZA 2IXGA 1FX0A 4KFTA 2ZE8A 3SEAA 1FNNA 1R10A 5EXXA 2ZROA 1T3SA 3OFNA 5BW8A 3PUVA 2XJ4A 4ZCMA 4B6EA 1LFDB 4D26A 2ZJ5A 3AVYA 2W0MA 2NO6A 4R71A 3V4FA 4PQFA 4CT5A 4Q7JB 3K9GA 1EWQA 3MG9A 5P21A 1WQ1R 2B8WA 2AK2A 3T15A 2WWYA 2C5LA 2J3EA 4MUAA 4EAQA 1M74A 5E7MA 4LJ5A 3SBEA 1LB1B 5FUXA 3U3RA 3WRYC 1DAEA 5FPTA 2ZJ2A 3FHOA 2X8AA 4DLVA 1Q21A 3QF7A 1HY3A 1W47A 2P67A 3CF0A 1W4RA 4QHYA 1XU4A 2AWOA 5DYIA 4G5SA 4XTCS 4A9AA 5AWFC 4B3GA 1JB1A 2VHJA 3EC1A 3NHBA 3L8ZA 3K0FB 3GLFE 3LVRE 1WXQA 4XD7D 1X8LA 1FW6A 4MGYR 4L9SA 1R0WA 1TEXA 1P9WA 2O0KA 2O8CA 1GRNA 2ZQ5A 3BORA 2GBLA 4LJ4A 1FP7A 3L0IB 3ZD6A 1E2HA 1NI3A 3I8SA 4JKYA 1CP2A 4GPTA 1G5PA 4GRAA 1OKKA 2IYSA 1IXRC 3RRNA 4BEJA 2HUPA 4Q19A 1DAKA 4WVFA 4EQ6A 2OESA 3QXSA 4JYCA 1XJCA 3SC3A 4GOXA 1ELOA 2GTPA 4JBWA 2GHIA 4W9MC 4JLNA 4DEYA 2A9KA 3THYA 1WE2A 4O3MA 5CLQA 4HZIA 3W34A 3K70D 3N2IA 1SHKA 5C4GB 1Q1BA 2CMKA 1LTQA 2EFHB 2PMKA 2ZYVX 3IBYA 4FW9A 3LV8A 1GAJA 4LK2A 5FL7D 4C4PA 1CJUC 5JI3E 3NH9A 1JNYA 2ZS7A 1Z2AA 1T6NA 4UJ5A 1KDRA 4ASUD 2X2EA 2QAGC 4Q47A 4QGHA 5FBLB 5TDHA 4QBGB 2O8CB 2ZI3A 1Q22A 2CCJA 4JYBA 4M1SA 1OJLA 3SI7A 2REOA 2VP0A 3CKLA 1G4AE 1Z08A 4MRVA 5AUOB 3GLFA 2DR3A 1XWIA 4NYMR 3X1XA 2H92A 4NYMQ 3FHTA 4TMXA 1SQ5A 2NMVA 3LDAA 1D9XA 5KSZA 1ZYUA 2R9VA 1EFCA 5CYPA 2QRNA 5TV2A 2WAXA 2XXAA 5TY0A 4S2EA 1ZM7A 5GVRA 5EP3A 1U81A 4IKEA 1AS0A 4QHSA 1MABA 4YMSA 5GJCA 1P72A 5JEDA 2O8BB 1E9DA 4KLNA 4BQSA 1OYYA 2J0QA 1KK0A 2J0VA 3CR7A 4NZYA 3BGWA 3LQRA 2BEJA 1DO2A 1PV4A 2PX3A 2PZGA 2WZQA 3AGPA 3GFTA 1D2MA 1UBGA 3QUSA 4HUTA 1KAOA 3SYKA 3HYTA 4L5BA 4DDVA 1KAGA 4QNMA 2WWHA 4KFSA 2W00A 1QHGA 1AQYA 1CJTC 3MCAA 5E4FA 1NF3A 3NXSA 4UNNA 2QP3A 4LJAA 2H17A 4BUJA 1K8RA 2ZRHA 3AP3A 3VHLB 1NL3A 2GRJA 5AUPB 1ZU4A 2WKQA 4MDFA 4U00A 2ZRBA 1E79D 1AA9A 3U7GA 1KI8A 2P5TB 4GNKA 1AZTA 3AF4A 2ZJZA 2NZJA 4ZIRA 5FR2A 5GJVC 2Q9CA 5BYKA 1AJEA 2OCYC 3FMFA 2JGNA 4MYHA 1E2KA 1EFRD 4WBSA 3RLFA 5FTMA 3NBXX 3A37A 1G6HA 1SVOA 2FPMA 1C9KA 3GJ6A 4TYYA 1XCGB 3PITA 2H16A 1B0UA 4UXIA 5CIWA 2YVUA 1W5SA 2D3WA 4BWYA 1SXJD 3I5YA 5E3HA 1Z22A 2ONKA 4C0BA 4XWKA 3FKSD 3SJCA 1P73A 2IYRA 5CM8B 1TF7A 2IYZA 3BIFA 5AK0A 2EU8A 1U0HC 2PL3A 1G5RA 5HTKA 4B3CA 4GMDA 2GCOB 4RSGA 2IWHA 5B57C 4PQYA 3W3AA 3B13B 3SJAA 2HV8A 1KKLA 2CK3A 4TQAA 4IXNA 4V02A 5IK2A 2AD1A 2H7VA 1CJVC 3PEWA 5E7JA 2O8EB 1DAHA 3U7EB 5LPNA 3KQKA 4OQFA 2QI9C 4P4TA 2OE2A 5EZ5A 3MJHA 3PVSA 3GLIB 3U60B 3WBJA 3K70C 3GMTA 1SXJB 3B78A 3OEHA 1DELA 2J87A 4MGIR 3RDPA 1IXSB 3N5CA 2JIZA 4EJSB 3REFA 1GIAA 3JVUA 4A0GA 3QI2A 4TQUS 2BMJA 2VP4A 4G5RA 4KVGA 5FBVB 421PA 1ODFA 3JVVA 4HLUA 2XSZA 3QKTA 3I1FA 4FMCF 4L9WA 3B82A 3W6OA 1VCNA 4TQ9A 1COWA 4RD3A 2VBCA 3GEEA 3WHKA 5EXPA 3AP1A 1AKYA 3B7GA 4NCJA 2O8EA 1ZD1A 4E5UA 3LW8A 3NBZC 4AKEA 5TMPA 2GESA 4ARZA 1ZM9A 2FFHA 1D2EA 5KOYA 3PEYA 3BB4A 1BIFA 2A5DA 4LHXA 4P4SB 4TT3A 5FOWA 4TLBA 5KPDA 4QBHA 1W49A 3QF4B 4Q7KA 5CB8A 3C41J 3PUZA 1KK1A 1XPRA 3SJZA 1E1RA 2W2XA 5KTYA 3EW9A 4PC1A 4YQFA 1G291 4NBSA 3P4YA 1FTSA 1S8FA 4URWR 1X1SA 1DE0A 2DFKB 3VR5A 3EIHA 4RKEA 3TGPA 1KI6B 1NLZA 2D62A 3BK7A 1E2FA 4YC7A 2G1JA 2CL6X 1E1QA 1NG1A 1WCV1 2YWHA 3K0AB 5AJXA 2N42A 2O8DB 2V4ZA 2J41A 4JL5A 4QGAA 3AKEA 4KXFB 2GJ9A 2XJ9A 3TAHA 3SS8A 1RW4A 4QL3A 1OLOA 3LVQE 1E0AA 4EJSC 4IDPA 4BEBA 5EE5B 4IEEA 1DVRA 4JL8A 3CZQA 5K8LA 2KBEA 2FSHA 3X2SA 2JAQA 1XMIA 5FTJA 2QMHA 2ONJA 2WKRA 4B47A 1YZUA 2XNDA 4AI6A 1FOEB 1RE0A 1Q20A 1OHHA 4OI1A 3T1VA 3KKNA 2ZANA 3OAAD 2OT3B 2BM1A 4MUBA 1II8A 2DBYA 2FEOA 2GF9A 2VTKA 5B30A 1XTRA 3BE4A 1T8UA 4IXMA 3OEEA 1P5ZB 4YXWA 3HU3A 3MAAC 2A3RA 4NHOA 4ZCIA 2MSDB 3KKPA 3B1VA 1R0ZA 2G1KA 1F2UB 4PHFA 4V0NA 2N1BA 2OFWA 1GKIA 1KOFA 3H84A 2H57A 1G5TA 1KNQA 3I72A 3GJ8A 1P2SA 5BQ5A 4OI4A 5EE9A 4C9BA 4UNSA 3ICQB 4AYXA 2F1JA 1KMHA 1BOFA 5KDDA 3SDZA 1CKEA 4IFBA 3UXMA 2ZR9A 1E2MA 1YR9A 4C30A 3T12A 1KYIA 1E1RD 3DKPA 1Z0KA 4LYFA 4PHTA 4JT4A 2JDIA 3FVQA 3CWZA 1GWNA 1QZXA 1D9ZA 2HF9A 2PX0A 4KBGA 4Q1AA 5F3WB 4PHHA 2CVHA 1L7VC 2QMEA 3P20A 4MRPA 3U61B 1R8SA 2ODEA 3QVVA 4DKXA 5J47A 1KI4A 5BN3A 1NNEA 3GEIA 2UZIR 1Q3HA 3MJRA 2JLRA 1X6VA 1R0YA 2ZI9A 4PPQA 4B43A 1ANKA 2NOAA 1CBUA 1COWD 4XSHA 5LDDC 4B2PA 1EK0A 1WP9A 4LV5B 4QBFA 3BXZA 3EZ9A 2ZJ8A 1S2MA 3BS4A 1Z6AA 4LBWA 1CS4C 1Q12A 1KK2A 4JLAA 3AP2A 3PJRA 1XTIA 3KJGA 5HPYB 2WWXA 2O8FA 1KI7A 1ZU5A 1KJYA 3AVXA 1IJEA 1XEWX 1I4DD 5LB4A 1NIPA 3OEHD 3QF4A 1QG2A 3ZZUA 1GL9B 2GVZC 3TKLA 4G5OA 3UMFA 3RRYA 2C8VA 2CEAA 4B34A 1GZSA 4EQ6B 3G0HA 2A7QA 3ADBA 3S1AA 4PPNA 4B3XA 3FYHA 3BH0A 4OHZA 2BBTA 4QHTA 2RB4A 5DYGA 1O87A 3ZQ6A 4O25A 1E0JA 5CB6A 4RD4A 1Z07A 1Z29A 5DI3B 2XZOA 3GJ7A 4A4DA 2VIIA 2DY1A 4QRHA 2ZJBA 4WOPA 1T3LA 3LWNA 4RVCA 2F9MA 1QBKC 2ZRNA 3BFXA 3DVLA 4BFUA 1TMKA 1MKYA 5FTKA 3QENA 3ECCA 3UMRA 4LJ6A 3FKSA 4QBIA 4YMVA 5FOVA 1DG3A 2QAGB 2AR7A 2OLJA 1J8MF 2WICA 4UNQA 1SXJA 3O8DA 8OHMA 2GDJA 2QGNA 1II8B 3K70B 2DYKA 2ZE7A 2ZR0A 2AK3A 3GJ5A 4DIEA 3GLHA 4FWIB 3GLIE 2AKYA 2J5XA 4D4MA 4WW0A 4EUNA 1M34E 2V54A 4IJMA 1IY1A 4B48A 5HE9A 4HUQA 5D3QA 1BH2A 1AQUA 4N0DA 3H86A 4NCHA 2J7KA 4TTQA 1YZQA 4F92B 3CNNA 1OKKD 1AM4D 1TAGA 3C15C 3RNLA 4Q1FA 3UANA 3FOZA 2JLZA 1HYQA 2V6JA 3Q7QA 4DLRA 1Z83A 3ZLJA 5G53C 1DS6A 1OXSC 1ZCAA 4HDCA 3QG1A 2CLSA 3MMPA 2IUTA 1LS1A 1N6OA 1VKJA 4JL6A 2BM0A 4AYWA 2D2FA 1JR3A 3GEHA 3RABA 2QROA 4NYIQ 1W48A 4D81A 4HYYA 4XD7A 2JLWA 4WA7A 2EYUA 3WYFA 1YRBA 2FEMA 3LY5A 1XJQA 1G7TA 1ZJ6A 3P27A 3U3JA 4G5GA 3DMNA 2AL7A 2GCPA 3Q8XB 1WMSA 4E22A 1XB2A 4X8MA 4HZUA 1AGRA 3AVPA 4OHVA 4FWTA 4A6XA 2IUUA 3U7FB 1XP8A 5CJ2A 3RVBA 2FV8A 3FTQA 4ZIRB 3WNDA 3B9PA 1OF1A 1PUIA 4I1OA 5FH9A 5G41A 1L2TA 2HYIC 3I61A 2K5UA 2GNOA 2W0SA 5FUVA 1JI0A 3TAUA 4V03A 2IEZA 2DCUA 2ASEA 1RRGA 3U4QA 5JECA 1EXMA 3OFND 2FFAA 1GRRA 5FBWB 3WMEA 1CTQA 1Z2CA 2V1XA 3AB3A 1ZM3A 1JXOA 2RGGA 3QPUA 4C2TA 3OHMA 4Y0AA 2IXFA 3PUWA 1H8HA 4EPXA 4KSCA 1IONA 1MV5A 2OFXA 4AYTA 4DUGD 1XMSA 2C9YA 5H68A 3DM9B 3MD0A 4BFYA 2OZEA 1M7GA 3EAQA 2XB2A 1NP6A 1KJZA 3WBKA 1OB2A 1IM2A 4CF7A 3KZ1E 3RRZA 2WIBA 3UIEA 4URZR 3ZDQA 3UPUA 2QMUA 4Q03A 4C0AC 4A8JA 1UADA 2W2TA 2ZR7A 4ZI3A 3SU8A 1X1RA 4KFRA 4D25A 4NL4H 1Z0IA 3J81k 3UMSA 2YC2C 1GL6A 2VHCA 5JS7A 5JRJA 3CUEF 4KJZA 4F38A 1E32A 1JEEA 4DHEA 4Q4JB 3EPHA 3KL4A 4US0R 4G0NA 5DHAA 2P65A 2JLQA 4HAWA 2OFOA 1DAFA 1T0JB 2JLSA 3A1TA 2QM7A 1FQJA 1C4OA 4FMCB 4OHWA 1ESNA 2NO0A 2BOVA 1V43A 2ZE5A 3ASZA 1G7SA 4BLPA 1UKYA 2WPDA 3LLMA 3ZD7A 1G18A 4LBVA 2XB4A 5JS8A 1RIFA 4WZ6A 1W4CA 3CLVA 1AS2A 1E2LA 4GBMA 4BZPA 5DIFA 1ZNYA 4M22A 5KYKA 5JZVA 4YMUA 2GZAA 3IPXA 4UKDA 3VU9B 1G8HA 1U0JA 1VG8A 3VMFA 3REGA 4Q4AB 2WWWA 2ZTSA 3QKRA 1XZQA 3SJBA 5KNDA 1OXXK 5JWHA 3LLUA 2BV3A 4QGFA 1E94E 1G3IA 1UBFA 4OI0A 3KTAA 5AJVB 4A8JB 1NVXQ 2ZETA 4A0RA 4M1MA 1W5TA 4Q7LA 1G8YA 3O8CA 1JAHA 5TB5A 3TRFA 4LOAA 4B73A 3DM5A 3ZZTA 2BEKA 2VPPA 3L43A 4Q01A 2OCPA 3VR3A 3DL0A 2XEXA 5FOUA 4OL0A 4M4SA 4URYR 5K8UA 3LXRA 4LWZA 3FGNA 3SR0A 1DADA 5DLQC 3ZIAD 2C95A 5JFGA 4HATA 4TLEA 5JJLA 1ONBA 5K8TA 3VR6A 2OAP1 2WSSA 2WSMA 1LS6A 2NGRA 5F9HA 1KIMA 2IS6A 4EPTA 2Q6TA 5JJIA 1D6JA 2DPXA 4M2LA 4JLOA 3TUZC 3EPJA 1GKUB 4D6PA 2O5VA 3TSOA 1J99A 1TL7C 4LGMA 4DJTA 3EZ7A 4DSTA 2W2VA 3EA5A 5A4JA 5FOSA 3GD7A 1A2BA 2BJWA 2A2ZA 1MO6A 2OAQ1 3EIQA 3QIAA 4Q4LA 1W4AA 4M0LA 3NWJA 4JT2A 4F4JA 521PA 3D6TB 3AF3A 4IW3B 5C1BA 3H0KA 4QJ5A 4F4IA 3AVUA 1E2EA 1K5GA 821PA 4GZMA 3SYLA 4LBYA 4OQMA 3KB2A 2VQSA 2F3TA 4JLPA 2ZRPA 4XH9B 1IJFA 1G21E 2BC9A 2OUKA 2QY9A 3KUCA 4QGGA 4MRRA 4FCTA 2OBNA 1Z6YA 4PZYA 4B74A 3HP1A 2RCNA 2MMCA 3T34A 1NN0A 2WKPA 1CF4A 4JZKA 2G0NA 1KI6A 3TJZA 4YLGA 1TQ4A 2XX3A 2QT1A 4MGZR 1Z28A 1CU1A 1G3RA 1CXZA 2RGNC 2W6ID 4DDTA 1QG4A 3KKOA 3KQHA 1E2GA 2PT5A 2ZUDA 4ERNA 2ZXUA 2ZU0C 1EX6A 4JS0A 1UDWA 4BLQA 3WP0A 4WXRA 1W7AA 2OSBA 4LY6A 1HV8A 2IWRA 4X8HA 4DIDA 4URXR 2BCJQ 4NCKA 5JCZA 4OQXA 5GJBA 1KO5A 5L3QA 1N5IA 2WBLC 2FGKA 2QA5A 4LPKA 1UJ2A 4PFSA 4PQRA 4URUR 2LWIA 4GFDA 2W6JD 5IT5A 3NBYC 2XZPA 3MGCA 2LKCA 4PO8A 1LW7A 5JHGB 2C03A 4B3BA 3AKCA 5CM9C 3U3OA 1W1WA 1ZRHA 1LF0A 2CXXA 2FNAA 3NH6A 5FOTA 5C2JB 2GKSA 1ZUIA 1OYWA 2ZI6A 4CRWB 1E2IA 1GTVA 2E9SA 4JIMA 1SVWA 1PLLA 1ZC4A 4AKHA 3IBGA 5FFMA 1XD8A 3IO3A 2VP5A 5ANRB 3AEZA 4R7ZA 4X8OA 4F91B 4AY2A 4IDNA 2JDID 4ILEA 3R9IA 3NBFA 1N6PA 1AIPA 1JJ7A 2ZE6A 4AG5A 1U9IA 2IHBA 2OLKA 1F2UA 4GI7A 1XBTA 1GL7A 2NO7A 2FF7A 2HCBA 4PSAA 2VL7A 3RS2A 5KDLA 1HQYE 2RGEA 1F2TB 2IF0A 2REXB 1FZQA 1CEEA 4HSEA 1YR8A 5FPHA 1AZSC 3DEFA 4LC0A 3H2YA 4B71A 3CH5A 3K9LA 1Z6TA 3R7WB 5AUQA 1UKEA 3NC0C 2RGAA 1BS1A 2ECKA 2JLUA 3QJYA 1IBRA 2QBYA 3K0CA 1J90A 3M4YA 1HEIA 1SKYE 2AFIE 3IEUA 1OIVA 1N0VC 1DTSA 4YXWD 3DMDA 4RD6A 4V0ME 3KB1A 4LV8B 4LSGA 4A2WA 4B3FX 3SQWA 5KU1A 3QG5A 3RWOA 2R62A 1XZPA 4PC3A 1KDTA 1MRNA 2GILA 1UBEA 3RS0A 3FMOB 3RC3A 4HLUC 4KYIB 4B3DA 1XNJA 5BN5A 4RD1A 2XNDD 1G41A 1I4LD 2PEZA 4CW7A 1VYTA 2IA5A 1S96A 2REBA 1W0KA 4RFSA 2P6UA 2VP6A 3HDTA 4OKSA 4B75A 1XEFA 2V8OA 3PEUA 4EIWA 1P60A 2GXQA 5EZ6B 2RGDA 1RRCA 5HCNA 1MRSA 4DB2A 2LCFA 2RMKA 3WNBA 4LV6A 3H1TA 3AF1A 1UBCA 2FJUA 4L15A 4M1WA 3VR4A 4BRWA 4WXPA 1E4YA 2EW1A 2GA8A 2ZSDA 4KODA 1FQKA 4JJKA 4MRSA 2CLDX 1S3GA 1R6BX 1YVDA 2HJGA 2CL7X 2FZ4A 3AVWA 1YJ5A 3MLEA 2C78A 4BPBA 1YZLA 2QN6A 4N1AA 1T0HB 2EYQA 1IAQA 5AJYA 4KBFA 5FR1A 4ARZB 3IKJA 4KITB 4A15A 3ZZ0A 3DOEA 1QHXA 1KO4A 2Q3FA 5JRZA 3PEVA 1U94A 2J45A 3CX6A 3EG5A 1OE0A 4M9ZA 1G7RA 5DI3A 5HE8A 2HT6A 4M1YA 3PV0A 1FFHA 1FNMA 1XTKA 3L8YA 4QNRA 2JLXA 5FUYA 5JHHB 3UWKA 4EFMA 2IEYA 2MSEB 3K8YA 3I4LA 1U8AA 1WBDA 3RSOA 1SVMA 2VHQA 2GJ8A 3MWKA 1G64A 3QEJA 5SZHB 2XNSA 1M1YE 1YRAA 4A2QA 3U4QB 4M21A 4K8OA 1ZNWA 3QKSB 4LUCA 1XD9A 4IDQA 3THXA 1ZC3A 3NG1A 2VO1A 3A4MA 2ZSAA 2ZVQX 3CH4B 4DVGA 1BYUA 2HT1A 3P1JA 4LYJA 4N0EA 4CYMA 1W36D 1PJRA 4HEJA 1ZAKA 4OJKA 1S3SA 2A30A 5AJWA 3CX8A 1ZM2A 2AD5A 3V00A 3UG6A 4O2RA 2R6AA 1QF9A 4TN1A 3VFDA 4BFSA 1Z5ZA 3CWQA 4C2UA 1OHHD 1ZCBA 1E9BA 2YHSA 3IIJA 1MO5A 1FMJA 5IK2D 1KI3A 2C96A 3N70A 2Z4RA 1ZD8A 2ERXA 3Q3JB 3R9XA 621PA 5KSPA 3CONA 5JLJA 3BH7A 3PUYA 1VHLA 3D31A 2J46A 1TADA 3K09C 2ANBA 4JVLA 1Q1EA 1E98A 1T4GA 1SXJC 4DDUA 2PJZA 1F5NA 3QKSA 5H8WA 2QP4A 1L4YA 4PSVA 3HU1A 5CK5A 1KMHB 1R7RA 1N2CE 1W44A 3OIWA 2EFGA 3CIOA 4ACAA 4IVRA 5C46F 1PLKA 3Q5EA 3SFZA 1UM8A 5CITA 4GOJA 3W5IA 1X86B 2WJGA 2XXAB 2E1RA 5FPSA 4GL2A 1G3MA 2ZRMA 2GAOA 3D3QA 4HDOB 1NVVQ 2RH5A 4IOLA 4C0LA 1GRQA 2IYXA 2QENA 1SKYB 4A8JC 5KSYA 1II0A 3H4MA 1PUJA 1KKMA 1EG7A 2ZYUX 3V9PA 3GLHB 2PCJA 1TU3A 2Z0MA 2JJ2D 1VCIA 2VHUA 2GVDC 1G7CA 4CEIB 4TT3D 3A6PC 1AN0A 2QP9X 3BD9A 1OXTA 3LO5A 3SNHA 4LRWA 3WP1B 3VAAA 2WPDD 1NN1A 3T35A 3GPLA 2JCSA 4Q1BA 2RHDA 2QL6A 1TU4A 1W46A 4GP6A 4DBLC 1WA5A 2J1LA 1NKTA 3U3KA 2R6FA 2KBFA 1G20E 4WIAA 5C4MA 5GJWC 4PAMA 1ETUA 1A82A 1Z0JA 2BCGY 3KTAB 1XXHA 5E7IA 4B76A 4KVAA 2C04A 2F43B 3U2QA 3PR1A 2NO1A 4BRUA 1Z0AA 1FL9A 2B6HA 1N6IA 3WMGA 3TW4A 2QSZA 2OBMA 2QUZA 1CJKC 5F9FA 1W4BA 3L2OB 1RKBA 2GBLC 4Q1EA 3QOFA 2RHMA 4RFSB 2KB0A 4UXHA 3TE6A 3U6BA 3Q72A 3KX2A 1P6XA 4ZCLA 3THWA 1Z0FA 5GVSA 3K1JA 1E2DA 2PH1A 2CE2X 4TMZA 1SXJE 3D8BA 4XWAA 4IOMA 1ZVQA 2WTUA 5EQTA 4U5XA 3I73A 2JJ1A 1JQLB 1GOTA 4OHXA 3ADCA 2J0UA 1UKVY 2FFBA 2OEPA 4Q02A 4FI3C 2V55B 5CDFA 3VTKA 3AM1A 3G5UA 2R8RA 2OCAA 2GAAA 1LY1A 3OF5A 1YQTA 2ZUCA 4Y0VA 4ASUA 3RC8A 2H18A 4MRNA 3EPKA 3ADDA 1OV4A 1NMYA 3QVUA 1WDTA 2N46A 3F3YA 5IHPA 1W36C 1U8YA 3B8HA 5DI9A 4ZPXA 2P6NA 3BH6A 2IC5A 4OQLA 5KNBA 2NQ2C 5EUMA 1EFRA 4Q4HB 1NKSA 3MSXA 4NYIR 4GDFA 2P2LA 1S4QA 5JCPA 3KKMA 4OI2A 3TR0A 4P4UA 1TTTA 2ZRLA 3NIBA 4JLDA 1E79A 5J4KA 2E87A 4Q18A 3NEYA 1NJFA 1E0KA 1QVRA 4H1VA 2QTHA 2GCNA 2DWOA 4GP7A 3RYTC 1N6LA 4EJSA 1D5CA 5DGXA 2VP2A 1XCMA 4WAUA 3C4JA 3ZVLA 2DFTA 4DRZA 1UFQA 1ZP6A 2D74A 1RYHA 5A0FA 3NTUA 2ZSBA 3CF2A 3GLHE 4TSFA 4Q4HA 2Y8EA 1GVNB 2XITA 1M8PA 1OIWA 2MSCB 4JLBA 1JR3D 4DEXA 1P7CA 4G01B 4YDSA 1UDXA 1I2MA 3TSWA 5FPKA 4PPFA 3IO5A 3OE7D 4TSFD 2QMOA 2XOKA 2YWFA 4LJ8A 1FX0B 1JALA 5HZKA 1U2RA 1R5NA 4TL7A 3FE2A 1NMZA 1N0WA 2NPIA 4XVUA 2OM2A 2ZREA 4HLDA 1VTKA 4LJ9A 3SOPA 1U90A 1OT3A 1SGWA 1NG9A 1F48A 3WY9A 3LXXA 4I1UA 1KI1A 1LNZA 4Z51A 2O0HA 1OB5A 2WM9B 1B23P 3E5HA 2QEQA 2VYFA 3AQ4A 4LCBA 3K9HA 4MGKR 3CM0A 4QG7A 2D4HA 4ZV4A 2JATA 4H1UA 3U7HB 2PBRA 4BGDA 4MITA 4G3XA 5FI1B 1J2JA 4ZKEA 1TUEA 1XEXB 2QSYA 4B35A 4NDZA 2XGJA 3MWLA 1P4SA 2XAUA 2IW3A 4CEJA 1WF3A 3AVTA 1Z6GA 2GK6A 4FMDB 3T1OA 2YYZA 2MMGA 1G4UR 4F7WA 3W8RA 4RZUA 4HB2A 1QVAA 1Q1QA 4M9QA 3P4XA 3A4NA 4IDHA 2ZJOA 2UKDA 2KSQA 4X8LA 1VG9B 1H8EA 3NEJA 4DT1B 1YKSA 4EFLA 6Q21A 4EPYA 1S0UA 4Q9LA 3QPVA 1SULA 2JJ1D 2ZSFA 4QOSA 2FOLA 1L4UA 2AKAB 3UG7A 1I4TD 5JMTA 1CIPA 3B2EA 1XEWY 1E6CA 4YMWA 3ND9A 3A1UA 3QXCA 2WWGA 2Z5FA 4CEHB 3BOSA 1XPOA 1RRPA 5KHOC 1N6RA 1TPZA 2CHVA 2FSIA 1VDZA 2Z6VA 3AUXA 5JWOA 4ACBA 3KXKA 2IS2A 1IHUA 3CRW1 4LHVA 2D7CA 3CF6R 4QXAA 4TLDA 2XOKD 1Q0UA 3W3ZB 3OE7A 1MO4A 3NDPA 1TQ2A 4GSYA 1XCPA 1Z6XA 4RFVA 1W2HA 3IIMA 3S1AB 5IF9A 3CPHA 2B7CA 4PANA 2X77A 1AGPA 1T8TA 1XDBA 1CR1A 3X1WA 4RZXA 4KSBA 3CW2A 2GEUA 3T5GA 2WIAA 1E4VA 3GLFB 1DARA 2CHQA 5LD2C 3GFPA 3Q85A 2P6RA 5H70A 1GILA 4C0HA 5L3SB 5HKKA 1IQPA 1VG0B 2ZS8A 2ZITA 5CK4A 1MH1A 1DBSA 2ZRGA 4Q9JA 1M2OB 2R6DA 1JR6A 1E9SA 1N25A 4Z1MA 3QKRB 4NONA 3I92A 3GLGA 3EZ2A 3DHWC 3I32A 3SHFA 5B58C 3GP8A 2CCGA 2QBYB 2FSFA 2KJQA 2BJVA 4C7OA 4M1KA 5J4YA 1N5KA 2B92A 3IEVA 4MA4A 1KSJA 2SHKA 1QHSA 3MWYW 4M1OA 4RCYA 1KGDA 3CNOA 4US2R 1EESA 1RC8A 1U0LA 4LPSA 4Q00A 1CR0A 2QAJA 2LKDA 2Z4SA 1HTWA 3R20A 1OFIA 1Z3IX 3IQWA 2I1QA 3OEED 4ZKDA 1N6KA 3UATA 1YZKA 3FFBA 5JBQA 1OW3B 2F1HA 5DE3A 4LJ7A 4D0LB 2NIPA 4LHYA 2ORWA 4QFMA 2DHRA 2IXEA 2QQ0A 2YOGA 4US1R 2R65A 1G8PA 4C0JA 1XXHB 3AVVA 2KI5A 2F1RA 4CEIA 3ZH9B 5KPJA 2CLCX 4KHZA 2W83A 4YDHB 2FA9A 1XRJA 3HWSA 3RAPR 3Q7PA 2OXCA 3EASA 4M8NE 3U6KA 3VNUA 3CBQA 4BZQA 2A5FA 1SKQA 3KDSE 3ETLA 3MUFA 2HJVA 1JQJC 2QAGA 2YNMA 4KU4A 1SVSA 3SHWA 2CVFA 2YOFA 1A4RA 2ZRDA 3CO5A 2BHRA 5DNYB 1VG1A 3K0SA 4BE7B 1U8ZA 4F93B 3R8FA 3QE0A 2OHFA 4DCTA 1O3YA 4IOJA 3FKQA 3HR8A 5FBRB 1M7HA 2FSGA 1US8B 2V6IA 2EFDB 1JBKA 1G3QA 2ZAOA 2VRWA 3TUJC 1E9EA 2VSXA 3TSZA 2AXNA 4KV9A 1R4AA 2F6RA 3KJHA 4P31A 1TQ6A 3PG5A 1OXVA 4IRUB 1ZUHA 1SZPA 4Q1CA 2BMEA 2BKEA 3L0OA 2EWWA 2R44A 3ZYCA 3BFVA 1N5JA 2ZSEA 2O52A 1XD2B 2O8FB 1P3JA 4AC9A 4XOIA 4E03A 121PA 2B8TA 4TYNA 3CRMA 4MH0R 1G8GA 2HEIA 3GLGB 1XTSA 3B9QA 1IN4A 2FG5A 3GJ4A 1HT1E 1R0XA 3O47A 2Q21A 5DO9A 3HYRA 2C9OA 1KMQA 1ZIOA 4HB4A 4R2IA 4Z8XA 3NHAA 3AVQA 1W0JA 1KDOA 1D2NA 4PHGA 1ZINA 4QJ3A 1M7BA 3R9WA 4BFZA 2PMDA 3WRXC 1IN8A 4PO1A 1NIJA 1NVVR 2YZ2A 2YWEA 2ZUBA 1HE1C 4KFUA 4AIIA 4AWXA 1AK2A 1W0KD 3OAAA 4P4SA 3LBIA 4ZI2A 1UAAA 4PC7A 1A2KC 2HCJB 3SYNA 1BMFD 3GLGE 1J70A 4IEIA 5J40A 4PZLA 4NMMA 1Z8FA 5KDOA 1XF9A 3TVTA 1RJ9B 1DOAA 1LV7A 1TX4B 3C16C 5G40A 3KFXA 2A5JA 2GEDA 2GXUA 1GFIA 4N3NA 1IXZA 1XX6A 1P9RA 2VH5R 2Q9AA 3Q5DA 2IHYA 4U02A 3K0FA 3RS7A 3IQXA 3P32A 1ZD9A 1W0JD 2P3SA 2QPTA 2QT0A 4B2IA 3QY0A 4XVQA 4TL6A 4AD8A 4CZ2A 4JLVA 1W36B 4ZDJA 2QPOA 1FUUA 1XMVA 4CT4B 3BBPA 2Q3MA 3F0TA 4I1SA 5JEEA 2WV9A 4ESVA 2ZEJA 1JXMA 3GLIA 2FZLA 5BN4A 3M1IA 1NJGA 2OO7A 3QBTA 5BXQC 2HLDA 3KQNA 2X1VA 4DCVA 3EIEA 3THOA 4HAXA 4DLSA 1ZMXA 4PR0A 4TTRA 4Q66C 4UXJA 4Z1MD 4DZZA 3QSYA 1CLUA 5J5CA 4Z54A 4A1FA 1XMJA 2OCBA 1FP6A 2RAPA 4TLCA 1OH5A 4NYJR 4BLTA 2IYWA 3ASYA 2RKOA 4KYUA 1HURA 1UPTA 2QTVB 5TVKA 3LNCA 5JWRA 2XTZA 1E9RA 4AK9A 2BIFA 4OYHA 3HPRA 3LBHA 1BO6A 5FUWA 4RD0A 4DCSA 1PZNA 1GDDA 4OQNA 1NSFA 4D82A 1OFUX 2XSZD 4MKIA 4Q9KA 3SQXA 1A1VA 2BBOA 4RZ2A 4M1TA 4C7OB 5JI2E 2QRZA 4CVNA 1Y63A 2F43A 3G82C 1OFTA 2W6JA 1X8KA 4L16A 5TXGA 3RS5A 4L8GA 4D2IA 4EPWA 4UQOA 1VPLA 1ZNZA 2TMKA 1OIXA 1T5IA 4EPVA 3UK6A 2AHOA 3FPAA 2VF7A 4DB4A 4OK6A 3WMFA 2FN4A 3VKGA 3MWJA 3VX4A 4AG6A 3PQCA 3AVOA 1MT0A 5EE1A 3SN6A 1MR3F 4DLYA 4JVMA 4NP6A 1NRJB 3VKHA 1P9NA 1QHHA 3LAWA 4DSNA 5LD2B 2ZYTX 1R2QA 2ATXA 3CPEA 4YMTA 3PENA 3VNVA 3ZQJA 1OH8A 3X1ZA 1MABB 2R6GA 4ZDIA 4A92A 3CRVA 1GUAA 4JSYA 3TW8B 2IT1A 1XFAA 3BB3A 2WMOB 4CGZA 3FDIA 5EXSA 4GMXA 3RSLA 2FU5C 3C5CA 3IILA 1NN3A 4HUQB 4W7SA 4P0TA 4QJ4A 1S9HA 4KI0A 4DWJA 3R8CA 5FL7A 2XTNA 2I4IA 4HAZA 3RANA 4I99A 4IDOA 3EARA 3HU2A 3HR7A 5DH9A 2NZ8A 1BKDR 2PEYA 1E9CA 3LRPA 3AKYA 3CRRA 3VX3A 2PJRA 1DAIA 3B5JA 4FD2A 1NVWQ 2F7SA 3PCRB 1N0UA 4V0LA 1OH6A 3QQ5A 4NYJQ 1E2NA 2CNWA 1XXHE 2KE5A 1Z47A 4MYUA 1CULC 2V7QA 2YINC 1D8TA 2V9PA 1NLFA 2FMXA 2VSFA 3EWSA 4HLQB 4Q21A 1JPNA 1ZIPA 2ZRIA 4V0MA 5HKKD 5EE3A 5FTNA 2ZRJA 2IS4A 1DPFA 4PAQA 4HAYA 4OBEA 4LHWA 4TLAA 4IHQA 1K6MA 2DB3A 5CIQA 3T1TA 3EC2A 5E95A 2FE4A 3SE0A 3W90A 3BFKA 2CJWA 1EX7A 4JLJA 3A1SA 5SZKB 4HAVA 4LHZA 2BDTA 2VSOA 3T06B 1P62B 2ZJYA 3ZIAA 3E2IA 1SVKA 4FMBB 2YJTD 3V4RA 4C0SA 1HT2E 4II7A 4TMTA 4HB0A 2FDCA 1F3OA 3ICEA 2Q9BA 3ADKA 3K09A 3E1SA 4D80A 1NMXA 1U9IC 1KTVA 2D7DA 3KXIA 5IDVA 3U3MA 4HLCA 2B7BA 5EXTA 1QHNA 3UKDA 3OIYA 1NY5A 2F1IA 2CBZA 5DHFA 2EQBA 3EZFA 3X1DA 1Z63A 3OIUA 4PO9A 1T5LA 1GNPA 1US8A 2ZYWX 2ANCA 2G6BA 2H1LA 2IK8A 3B85A 3LX5A 1TQDA 1YZTA 3IHLA 2J7PD 4I81A 1J7KA 1KNXA 4JBXA 4MYCA 4ON9A 1VECA 3ONWA 4UJ3A 1WB9A 3M0EA 3I5XA 5L3SA 1XTJA 2QU8A 4I4LA 2OILA 3B60A 4IFEA 4BZXA 3EXAA 3KJEA 5M04A 5UKDA 1OXUA 1GP2A 1TNDA 1E0SA 1IY2A 4LYHA 2VHTA 2WAYA 1VCOA 3AF0A 2ODNA 1KZ7B 2IYTA 3QXJA 2ZI7A 1R8QA 1YHNA 1N6NA 4PPGA 2GK7A 4LI0A 1GNQA 2AFHE 2EVWX 4PXAA 4B6FA 4EPRA 2V1UA 2GXSA 4E07A 1L8QA 3NKVA 4LX0A 4NH0A 3CPJB 4HDQB 4KLZA 2X2FA 4R2HA 1KDPA 4IOKA 4Q7MB 5H1YA 2GZHA 3I62A 2W58A 1KO7A 4ZDKA 2VLIA 5D3MB 3IIKA 1C1YA 4CEHA 4XSGA 1CR4A 3TMKA 3B6EA 1E2JA 4ESHA 3LX8A 5GADl 2WOOA 4ITRC 2CE7A 3BJIC 2WJJA 2HXYA 5JSZA 3T1QA 1E96A 4UNPA 3VU9A 3ZVNA 3TIFA 3DDCA 1IN5A 1M6NA 2HXSA 3C5HA 5AUNB 4WZAE 4TL8A 2CJWB 5K8IA 3AV0B 4QC2A 1AKEA 1PVOA 2ZRKA 2AX4A 4XJXA 1KK3A 2Q3HA 5HZHA 4CIDA 4Q9HA 1Z0DA 4TMVA 4NU0A 4PZZA 1SVLA 4OJQA 1G19A 4H9GA 2KWIA 2ORIA 3FB4A 4FCWA 4TTPA 1V5WA 1YR7A 4TZ6A 2EFEB 3AUYA 1QDEA 5ELXA 1P2VA 1YE8A 1P75A 2G77B 2J7PA 2RGBA 2WOJA 1E3MA 1UEIA 2VP9A 3U44B 3LA6A 4D4LA 1PLJA 2QQEA 3MFYA 1WBBA 5D3MA 4NTZA 3THXB 4TMWA 5B2ZA 2GJKA 3ZJYA 4JMPA 4HB3A 5KUTA 1GM5A 1P61B 2CDNA 5F98A 1CR2A 4Q4JA 3K0CC 4HI0E 2HYDA 3A1WA 4PAOA 1G9XA 1YR6A 2AXPA 1H65A 4P3YA 3A8TA 3KUDA 2G3YA 3B1ZA 3CRQA 1Z06A 3B1YA 4QM6A 3ND8A 4U7DA 2QM8A 4D4JA 2DFNA 4O0MA 4TL9A 1DAGA 1AS3A 1T3HA 4BLSA 5A5GA 2OV2A 1BYIA 4IVPA 1WRBA 2VEDA 1HUQA 2PZFA 4AURA 5AR1A 5KO2A 1QHIA 4ZO4A 1KI2A 2GXAA 4Z8YA 2IF2A 1ZUNB 4RJLA 3BERA 2IX3A 1VYUA 4HAUA 2WMNB 1FTNA 1KO8A 3TNFA 4W5WA 1I2DA 4RZ3A 5B64A 2JLYA 3VKWA 2V7QD 5BYJA 4A82A 3THYB 1YZNA 4A0HA 1R5BA 2A5GA 2BBWA 3AGQA 2PLFA 3KFVA 3O8BA 1DEKA 3SFVA 2WVJA 3GJ0A 1DO0A 1TEVA 3K0EA 1QHHB 3DZDA 1E9FA 4I1VA 2QE7A 1XEXA 2J0UB 3K53A 4DCUA 4FIDA 1VHTA 5EP1A 4HZUB 2NG1A 4G1UC 5FPYA 2GZDA 2ZU6A 3O8RA 2P5SA 4ZDWA 2UVQA 4OK3A 1IOZA 1KSHA 2JJ2A 4FN5A 1YZGA 3LFUA 3QXHA 1KO1A 1ZNXA 4LBZA 1RVDA 5DSZA 2ZPTX 2WHXA 1RYFA 2ORVA 3RWMB 3SBDA 5J4LA 3QXXA 5JSZB 3X1YA 1DAMA 1HQCA 3E70C 4MKHA 2IUSA 1G16A 1RPZA 2RGNA 4WZBE 2V3CC 3JZAA 4B33A 4W5JA 3QEOA 5JJKA 3TLXA 2BKUA 3THWB 1S1MA 2Z43A 2BMDA 1GSIA 1UEJA 3M6AA 4DCNA 1OSNA 1GNRA 2ZRCA 2JEOA 3TQCA 1HA3A 1F6BA 2J9RA 1E9AA 2O8BA 4W5HA 3N2EA 4B2LA 1IN7A 2WJHA 3HPQA 4DDWA 2ZRAA 1RRFA 2H5EA 4PC6A 2QPAA 1KY3A 1JAIA 1VIYA 3R7WA 4TWZA 1VYVA 4K81B 5KSOA 1U99A 3IUYA 3PFIA 3NVAA 4EKDA 4M9XA 5LB2A 1Q3TA 221PA 5FI0B 2QNRA 4D4KA 3CZPA 1XJ0A 1NN5A 5CYOA 2GJSA 2CHGA 2FWRA 1VCMA 4FCVA 3L0PA 1GITA 2ZRFA 1N5LA 1E99A 1KSFX 3AF2A 4JLKA 4PC2A 2QZ4A 3F5FA 5EP4A 3TR5A 3LW7A 2HDNB 4NCNA 3A4LA 3BWDD 4K46A 4MKGA 5DN6D 5BWMA 4UNRA 3C14C 4LZZA 4GT1A 4DXAA 4BLRA 2C98A 1OPXA 1ESMA 3CNLA 1RFLA 3QPWA 5LBIA 1Q57A 2BWJA 3A58B 1NBMA 1JJVA 2CNWD 5CLLA 2WWIA 2ZAMA 5FOXA 1RZ3A 5SZIA 5EP2A 4E09A 5C18A 4PSKA 5DISB 4C0KA 4MQBA 3VR1A 2WJVA 2WWFA 3DZ8A 3W6PA 4C0QC 2DWQA 1KY2A 4ABYA
chains in the Genus database with same CATH superfamily
4O6VA 1JR3E 1OXMA 5L3VA 1JKMA 3I9MA 3GQBB 1FXWF 2QL7A 2FGJA 5CG1A 2Z83A 1JECA 3LY8A 4JSTA 4EZIA 2F17A 1K97A 3QHQA 3WIBA 2NP6A 2HWXA 1FUKA 2I7VA 8MHTA 2PLRA 1Y81A 3PIRA 4PZ0A 3ENVA 4MV9A 2YC4C 3OIVA 1AHNA 1S7CA 2P3QA 2NTYC 3JQDA 3K9NA 4H7IA 4POAA 2WE8A 1I2CA 4TSKA 3KOWA 1VGQA 2PT7A 4MV7A 3T5DA 5IM4A 3GFOA 5E4JA 2AWNA 3MWDB 2WI8A 3O9VA 3HYCA 4JA2A 4FFVA 2IU0A 4AKIA 4CLDA 2OO3A 3H2KA 4P8RA 5DCYA 3RRMA 4Q5IA 1K06A 1A27A 2ES4A 2EF1A 3IOMA 1DL5A 1SZDA 4MUHA 3A6DA 2G88A 4MZDA 1FDUA 3H8JA 2WMYA 2ZSUA 5ECGC 3TEJA 3T61A 2P4HX 5IJ9A 2YKGA 4FGKA 1ZJWA 1XPUA 2PO5A 5IT4A 1A97A 1KEZA 4LYAA 3ZBQA 2C4TA 1QLHA 1N75A 2L0XA 2XTMA 2I6QA 2RAFA 3CIFA 1AMOA 3UJNA 3EOZA 3RS9A 1XAJA 1GG2A 4RJJA 3A36A 4OEHA 1ZLYA 1JW9B 4JI3B 1DWOA 3A2LA 2QRHA 4IQ4A 5EHGA 1F2TA 2PZAA 3VR2A 1E2PA 3C5WP 1CZRA 2QD1A 3KZOA 2CL0X 3CUYA 4F4FA 4I1IA 3PS9A 3J81A 1CRPA 3STTA 4K88A 4TYPA 1W2GA 5TLSA 2FH5B 4BNNA 3CVYA 1K9VF 3C7KA 2PKQP 3TGWA 1JTEA 3IT3A 3FX2A 2BFFA 3GCGA 4WUVA 3A14A 1DG1G 3OQVA 4MYTA 2XBUA 1UBMS 4XIGS 3TUIC 4BCDA 1P0CA 1PS9A 2HPHA 4QOIA 1H22A 1LBSA 4OOFA 4XJVA 2JFWA 1P2BA 3RHSA 5CLFA 4PLPA 2GZ3A 1CYDA 1Q6YA 3J7AC 1G6OA 4BLOA 5JNUA 3V8VA 2FVXA 4J0QA 4MXDA 1U8FO 5KNCA 1OCEA 2P2DA 4XM0A 2XA2A 1CZUA 3B1XA 2DX7A 2A5YB 1I2AA 1U1IA 2O3SA 3KR9A 2P78A 1N92A 3LP8A 4KAXA 4O2BA 4P53A 4F8JA 4G0VA 2AEEA 3E3LA 5CHEA 2E5WA 2AB0A 4C22A 1Q1ZA 3G2QA 2ZI4A 2Z6AA 3ZZNA 1FLVA 2EZ8A 1UC9A 4V0KA 5J4HA 2H08A 4ZCRA 3D4PA 4IR7A 4KB5A 3OWOA 1UPCA 1QYXA 2R4TA 2REQA 3DEIA 3CUVA 3EZ6A 4O02B 1A8SA 4HDSA 4TVKA 1HM5A 3AIMA 3M3HA 4ZXFA 3JYOA 3K6JA 5A7GA 3JR3A 4CR6A 4U2EA 4E3ZA 1CRQA 3OX2A 1X7YA 3FWYA 2X5XA 2NU9B 3KLPX 4DLTA 3IKVA 1MQ8B 4OO3A 1LZLA 4RL4A 3KOXA 4N03A 3VR4H 4BYGA 4YRZA 4IFTA 1CDZA 4R2LA 1UF9A 3RK0A 3OZCA 2DSNA 2HLPA 5CFPA 1EUYA 4XDHA 2R2AA 1LVGA 5JY6A 3QX3A 4Q4AA 1B8OA 1XZHA 2Z3VA 5TC4A 2EZUA 1EZ4A 1T9HA 3R4VA 3GELA 1UBJS 3JZMA 5CNKA 5EZYB 2W37A 3S68A 2EFCB 3KAQA 4NKRA 2EGUA 2HGSA 3M6VA 1ULTA 4HQLA 4YAJA 5DN6A 5HG0A 5J4VA 4OHYA 2FJ0A 2R6CA 3T3NA 4FGJA 5BR8B 1BMFA 2O8DA 1KSGA 3PQ3A 1BDIA 3H5AA 3STXA 1P1HA 3OESA 3DFMA 4UM5A 3CG4A 1GU7A 3E05A 2LCQA 4DLXA 3TQSA 4A6PA 4S1WA 2RHJA 3EGXA 5G1OA 3OWXA 4IKPA 4U0JA 2BYTA 3UY4A 2ZYGA 3G9UA 3L6OO 4HNAB 4IIDA 4G37A 3RFXA 3CE6A 4PTLA 4EBFA 4F71A 5JUWA 4ZTUB 1Y33E 1XR3A 5BT9A 3O73A 1OA0A 1FDIA 3F6BX 4KGXA 4LVUA 4TLMB 5ULLA 5LP6F 4AQYB 1B1CA 1GTL1 1UJBA 2OCDA 1EUCB 1T9AA 2R3SA 3DOCA 5AXCA 3ZE0B 4CM4A 4N7JA 3V1MA 5KYWB 3X2EA 5A6SB 3NB0A 1ZGZA 1Y6GA 3ZDDA 1O6BA 1PT7A 3ZDEA 3R6DA 5AW6A 3ZGZA 2XF8A 3AETB 4HDNA 2C77A 1P7WA 4XX0B 2QD4A 3BMCB 3FMPB 3I1JA 4B4VA 3BAFA 2GGSA 1NE2A 2YX1A 2GQ0A 3WA6A 3ZBUA 2LDXA 3LH5A 5DLYA 2Z1DA 4NCIA 1BQ3A 3DTVD 5AM5A 1I3OA 1GPUA 4DNFA 4YJGA 2XUGA 2B61A 3IVMA 2JLCA 4FMDF 3VUEA 4AJ4A 2C2KA 3T0GA 1LX7A 3KL2A 4JJZA 2H5IA 5CVVA 3WYAA 3H05A 1L7NA 5K3FA 1W88B 1P4HA 1V5FA 1KERA 2Z2XA 3R44A 1JR4A 2FZVA 4GX2A 1YIDA 1P2UA 2V3VA 4DYVA 2QG6A 2WZDA 3H3XA 4M86A 5EE0A 2A9JA 5F1OA 1IHPA 2A92A 1CJMA 3WR5A 1RXWA 3VDNB 3QP9A 4DIBA 2QV7A 3HCPA 1F8YA 2PUTA 3JQFC 2PUCA 3C8UA 1XLTC 1JEYA 5ER6A 3AFOA 1G42A 4RK6A 1D1SA 3IMEA 4I46A 2VAXA 3NORA 2WJWA 5CB4A 3ZJVA 3OT5A 4G8CA 5EI5A 4XAQA 3K2QA 2O0LA 3IT2A 4XSVA 3T0FA 2XMGA 3INRA 2HA0A 1NY6A 4X3OA 3TKYA 1LPOA 3R77A 1B15A 1LF5A 3R6TA 4FMPA 4JMLA 4R98A 2D2EA 9LDTA 3U9TA 3LE8A 3SLGA 1DIOB 1IATA 3K8ZA 2E4WA 1DIAA 2RHWA 2BR5A 2G5CA 3C87A 3TI7A 3KKQA 1JU9A 1N6HA 1JG2A 1OGYA 3PXUA 4G4GA 4Q48A 1A50B 1HK7A 2JI6A 2XYGA 4E1BA 4CIBA 4R7TA 5G3ZA 4UD6A 4DE5A 3PLAE 3WSVA 5D5PA 3NAMA 2WSSD 3ZI0A 5BQPA 2OBFA 1Y3AA 3HRKA 4QT4A 3MRVA 3NIDB 1KVTA 3Q1KA 1QIKA 3S44A 4FLMA 2WD7B 2I1VB 3DKVA 3FHCB 4RK5A 1RYDA 5EZYA 3RTDA 4DCOA 1O96A 2A3NA 3H2JA 2BH9A 4MPRA 4BO5A 2BEVA 1O97D 1FPMA 2IYVA 3AFIA 4MCAA 3VR3D 3ZWDA 4EBBA 1N2GA 5D1HA 2IQIA 2A57A 1FX0A 2O23A 3I4FA 2ZE8A 4WKNA 2HBQA 3W3AH 1KH1A 3KU1A 3OFNA 5F73A 1VBNA 5BW8A 2DERA 2YFYA 5EPUA 3H2BA 2Z30A 1LFDB 4B6EA 3EDMA 3RS8A 4UBJA 4EKEA 4BNYA 5JO0A 2XMSA 4JP5A 4PQFA 2HMWA 3ANMA 2BI8A 1QRSA 4DNQA 2A4MA 3SF0A 3I04A 4OUKX 2P8JA 1YF3A 3WK8A 4XI9A 2AK2A 1VI5A 2KQUA 4B6RA 2H9AA 2J3EA 1A2OA 3PPYA 1DB3A 1M74A 4DMMA 1V8BA 3GGOA 4QDTA 3CHYA 3T7DA 1H6BA 3CRZA 3C3PA 4HTFB 4RLSA 2ZJ2A 5FBZA 4EA6A 4KV7A 2G9RA 1Z4NA 3MWGA 1MAHA 1AQLA 1HY3A 1TCBA 3FY4A 4L6IA 4MA0A 3ZE9A 4QG3A 1H4QA 2VH1A 3HDYA 1W1IA 4DMFA 1KE2A 1XU4A 2AWOA 3DS8A 5DYIA 1O6CA 1M83A 5C7LO 4BMPB 3NHBA 4XZ3A 4MR9B 1P4RA 3K0FB 2DUWA 1TLTA 4XD7D 3VRHA 1FW6A 3T9AA 1R0WA 1EEXB 3NR2A 5ILGA 2IY9A 3T4PA 6AT1A 5EHZA 1NBWB 2J9YB 1H0SA 1GRNA 2LV8A 3P2EA 5D3KA 2FPPB 2FZCA 1SUAA 1L3CA 4LJ4A 3RVNA 4TQGA 4BQQA 3HB5X 5F5LA 4M37A 1F9AA 1Z62A 2IE0A 3V8NA 4JKYA 2RCYA 4G0QA 3ZCTA 4EO7A 1Q2UA 5DNWA 3RJMA 3OFKA 3ERCA 5C37A 1IXRC 2AIRA 5FLKA 1NPDA 3RRNA 5C3MA 2FMFA 4BEJA 4F2PA 1DAKA 2GEKA 4CETA 3LRTA 3QXSA 3GCXA 3K30A 3SC3A 4P80A 3TD6A 2CJXA 1ELOA 4MVJH 2P2YA 2K7FA 1JR2A 3QBDA 3ND7A 4G4IA 4JLNA 2ILVA 2AZDA 4PRYA 4TLLB 2AJTA 4HZIA 5EHIA 3RQIA 4HVCA 3WO1A 1R9NA 3AUSA 1RXEA 3PQDA 4D57A 1FF9A 3TL2A 4OHRA 3FVWA 3FYCA 3T99A 4NZZA 2C4UA 5JPIA 2Z1MA 3R7NA 1BEUB 1EGMB 1USVA 3L05A 5ECDA 1JRLA 2MT9A 4KXYA 2B9VA 4YH1A 1LTKA 2O3TA 5IAAA 2PLAA 5EFOA 1Y5RA 1EDZA 4DHWA 4U7GA 3GYGA 2OM6A 3EMBA 5EJ7A 1U2GA 3CCCA 1JDBC 4QBGB 2ZI3A 4CMIA 4JYBA 4M1SA 1NSYA 3SI7A 5K6TA 4CLOA 2BEWA 3CSUA 2X41A 3IB3A 3K05A 1OZGA 3B52X 1JQ3A 2IQ5A 5AUOB 3GLFA 3OPNA 1MVNA 4FOOA 4OIFA 2G63A 4NYMR 2H92A 2QT9A 3TVYA 4TMXA 2XBMA 3FHTA 1J1IA 1ULUA 2IYFA 3HJCA 3E5NA 2A86A 4OCZA 4P2BA 3W2TA 1QH1A 2BMVA 4UM8B 1H5QA 2O50A 5DRYA 4YJFA 2XCOA 4PV7A 5AI4A 5CYPA 4E6PA 1QH8A 5TY0A 2I6UA 2IBTA 1EZZA 5HIJA 4MEAA 1PS0A 4HWTA 3F5SA 3WGZA 2IV3A 4D8WA 3UHFA 4Q3BA 3PWTA 3IAS6 1MX3A 2WUDA 3E1GA 2W2NA 2O1EA 3AJ9A 2PKQO 4UC0A 4YP7A 3JAKA 4BRZA 1OAOC 2V4MA 1M3SA 2J0QA 3CR7A 2J0VA 3OKPA 3IIEA 3WG9A 3H1PA 1OPRA 3BGWA 3NHLA 3VC2A 3QVWA 1PV4A 1JE0A 2PZGA 3WHPA 3AGPA 1QVZA 1I32A 3HQ4O 5SV2A 4YMGA 1P7YA 4I2NA 4V0SA 2OYRA 2DR0A 5DBFA 4LZLA 5DNAA 4C78A 1KAGA 4HH1A 4QNMA 2WWHA 4CLEA 2X86A 4YT4A 4MV1A 3WL7A 2UZ0A 3OC0A 4BKQA 3PCXA 4S1VA 1DX4A 2E48A 3DAPA 3MCAA 3MQ2A 3HJGA 5EGSA 4WFKA 4KNYA 1RAEA 3QA3E 5IWAB 4RE6A 5ECYA 4P4NA 2H9YA 2Y1XA 4M1QA 3TNDA 2WABA 2I34A 4H7DA 3VHLB 3AP3A 3GWGA 1ZU4A 4WESB 1YCGA 4U00A 1E1CB 3F2IA 4GE0A 1E79D 2P5YA 4ARAA 3D3KA 3VTZA 4B80A 3PC8A 1PSDA 4GNKA 2XCUA 4ALLA 3HEMA 3U7IA 3OZRA 2ZJZA 4F46A 4PLGA 1B26A 3R9XB 5AJTA 1BEZA 4ND7A 5BW4A 3EF3A 5FR2A 4BJ5A 5BYKA 3VVBA 2JGNA 5TIIA 1E2KA 4WBSA 3RKSA 3RLFA 2PX8A 3VO2A 5FTMA 3WGNA 2F9FA 1C9KA 3GJ6A 5TMBA 4TYYA 3EY4A 2RG1A 3PITA 5CIWA 5ISMA 3H8SA 1SXJD 2HWKA 1HYEA 2XADA 2TMYA 4C0BA 3HA5A 3OKFA 1Y6QA 1FXWA 1S8OA 1MTZA 2FWAA 1Y3HA 2YHBA 2ZYRA 3ELWA 1P1FA 3FKSD 2IYRA 3OCJA 4G8JA 2IYZA 4WCDA 6GPBA 1Z8DA 5IJZA 5AIAA 2JARA 3NLLA 4DJEC 1XHEA 1VA5A 2J31A 1G5RA 1PJ4A 1WMAA 4Z7QB 3EXFA 5EWMA 3GH1A 4D3YA 4EM6A 3P2JA 5JALA 3ED1A 3KB8A 1SEPA 2IWHA 1WWKA 3OZVA 3R23A 3W2GA 3ZIUA 4ATNA 5B57C 2DWUA 5CFNA 2IJGX 1KKLA 4IDAA 3FCCA 3UT5B 3ZV3A 5JQWA 1KS2A 2C4WA 1JYFA 4TQAA 4BEVA 4BMNA 5DXAA 1DHTA 2AD1A 2ZTVA 3FYUA 3IMKA 4JLSA 3O5AA 3LX6A 5A3RA 5E7JA 1E3WB 3WLAA 3U7EB 4OQFA 5F2NA 2JH3A 4JBNA 3KB6A 4KQMA 4PIVA 4W6QA 3U60B 1M2HA 4RTMA 1L5KA 3H4VA 1JFFA 3HCRA 1A7AA 2FPGB 3AFNA 3NP9A 1GTG1 3K1AA 2O3QA 5P8WA 3WJAA 1MHTA 1P5HA 2NTEA 4G4SO 3N5CA 4LXYA 1DXYA 4EJSB 3REFA 1NOKA 1CSEE 4H7KA 4MQ4A 1WZCA 1RBMA 3GFVA 2VP4A 3JD3A 4FOPA 2ONYA 4G5RA 4UOQA 4PO3X 1CDDA 1ODFA 3EZXA 3PC6A 2IVFA 4HLUA 3B2QA 3FTEA 4YJDA 2JH8A 4JBGA 5AVRA 4F9TA 3EYWA 3OT1A 4PYLA 2IZZA 1TCVA 5KHLB 3AP1A 3QI7A 1H0HA 3B7GA 3SMQA 1X1EA 1ECJA 3OLVA 3DJYA 5I9BA 2I8AA 4ARZA 1ZM9A 1WLSA 1FMCA 4BWGA 5KOYA 3U0BA 4F2GA 3T38A 4LHXA 3ETDA 4TT3A 5ES4B 3PEYA 5K0BA 1QIGA 3HH8A 3UJBA 5CLJA 3WDLA 1P77A 3IB6A 1DDOA 2QSUA 2OHIA 3R3ZA 3VJKA 2WHPB 2AG6A 2IOQA 3AOEC 4IP0A 4D6XA 1G6Q1 3MINA 5AKEA 1YS6A 1LJLA 2NVBA 4ZMSA 1JLMA 3CB2A 2W2XA 5KTYA 1WSDA 2Q1WA 4DB2A 1YB1A 4DQXA 4NBSA 3L6BA 4TS3A 4MS4A 4URWR 1R8YA 4RKEA 1PL6A 4JOQA 3TGPA 4EG5A 4NU8X 3K1YA 3IAS1 3HE3A 2DQKA 1M1XB 3DF7A 3GRCA 3WKAA 3W1EA 5K8CA 1X13A 4FYXA 4WESA 4YC7A 5G0TA 3F71A 3JTMA 4ZHQF 1XDZA 3RVQA 1XLTA 1E1QA 1OAKA 2CL6X 3N39C 3KQVA 3V7NA 3VGPA 1DBVO 2YWHA 5AVXA 5IZCC 2AJLI 2XT9A 1RCFA 1ENYA 2GJ9A 4AUKA 4UMEA 5DV9A 4R1TA 4AUNA 4YUXA 2QSJA 3LVQE 1E0AA 1U1DA 4G1MB 2HREA 1SIOA 3C6MA 4ID3A 3UKOA 4AAYA 5EE5B 4BEBA 1UT8A 4JL8A 3J80A 2OQRA 3CZQA 2P30A 3ON5A 3R9KA 3OU2A 2HIAA 4X41A 3LQ1A 1A88A 2QMHA 1O0CA 4L6AA 1I5EA 2X9QA 2P9YA 5DT2A 3S1SA 1RE0A 1QOQB 2C59A 3FMGA 2I87A 2CD7A 1CS0A 1ZOIA 4CIAA 2DBYA 1HDIA 2GDZA 4KGZA 3VTFA 2ODTX 5B30A 2B25A 3G9XA 1QH9A 1J24A 1D0VA 1GPAA 1NU6A 1KDYA 1Y1TA 2FSPA 4YVFA 4BBJA 4NOJA 3A4YA 2WLSA 1Y98A 3KKPA 4PHFA 2OHXA 5CM2Z 4ZVTA 1AB6A 1T4DA 2NZUG 4RVHA 5ARDA 3VYRB 3RVRA 3GRUA 5FUBA 1LBTA 1TD1A 1G5TA 3L9WA 4LYEA 5DTJA 3VV3A 3I72A 3GJ8A 1CRZA 4TV8F 4UBNA 5BQ5A 2G06A 4LAFA 4NK4A 2PZJA 4EUEA 2ECPA 3G9QA 1SCIA 2ONCA 3FWHA 3KQWA 3FFXA 1L7BA 5K6AA 3IXQA 5IM5A 3LGAA 5LU8A 2DR2A 3EDCA 2C4HA 4G4SP 3T12A 1KYIA 2BZ1A 3BXEA 3N7AA 4M0FA 1U0EA 1L1FA 2F90A 1JLLB 2VT6A 1Z0KA 4PHTA 4N39A 4FYWA 3FVQA 3DFKA 3RYFA 1GWNA 4C87A 4Q1AA 2IYAA 4BOYA 1YS9A 1NP3A 2DQ4A 3RJ9A 3ZXSA 3PX2A 4CQNA 4UOEA 3QVVA 4DKXA 1XA3A 1KI4A 5J47A 5M2QA 3GEIA 4PYIA 2UZIR 1IZ9A 4Y2XA 1L4HA 3PA6A 1IQ0A 2Q7XA 1X6VA 3K0KA 3MJRA 1I80A 1DC7A 1ZGHA 5HWSA 3U62A 1NW7A 4KXQA 3C8DA 3I6ZA 4GWGA 3WE7A 1COWD 1JSCA 2NSYA 2G6TA 4XSHA 4Y7DA 1HE3A 4MAFA 1NC1A 3EZ9A 1PFYA 4EGFA 2GN0A 1S2MA 1EM8A 1Z6AA 3BS4A 3OKAA 5K3SA 3ZN2A 1IZZA 4F8EA 2CV0A 3NYIA 1I0LA 3BD6A 1Q12A 2C5AA 2NTJA 1KK2A 2BFDA 2JF0A 2WWXA 1T2EA 2MSNA 4B85A 4I4NA 3AVXA 3PHLA 2BGMA 2QOEA 4D79A 3ZEIA 2X13A 1QG2A 2GA9A 3VPHA 3WXBA 3ZZUA 3IEKA 2WT8A 2ABWA 1G0OA 4G5OA 3JQ7A 2C8VA 3KJFA 3ZWVA 3G0HA 4KGDA 5C8XA 3D0QA 5JBIA 1RLIA 5LA6B 4EA7A 2X1MA 2BBTA 2GMWA 2AG1A 4EUSA 5K0JA 2E37A 5DYGA 5IZCA 1MDBA 1T36B 1FU7A 1M2JA 2VUTA 4J75A 1VSUA 3ZQ6A 1N2EA 3IDSA 3P94A 1ZK3A 3B6KA 4QEKA 2FJPA 1Z29A 4FFBB 5BURA 2NSJA 4B82A 4F21A 2DY1A 3DL7A 2ZBFA 2XUFA 1Z37A 3OP1A 4GKAA 4Q3DA 3TZEA 1N7GA 1OFUA 3PR2B 1QO0A 4GZ3A 4WOPA 3TIVA 3GXBA 4RVCA 3TQOA 1QBKC 2ZRNA 3GB9A 3BFXA 1PT6A 1XVAA 1Z16A 2YCLA 4GX0A 3W4IA 4EG8A 2JFHA 3QENA 3ECCA 3UN1A 5JDIA 3KEGA 2PD6A 2SBTA 5LR6A 2QAGB 1NBIA 4D6YA 2OLJA 1J8MF 4UNQA 3LDUA 2GAFA 3AM4A 3HM9A 3AZQA 3IP5A 5IC4A 4G0UA 4OJYA 4I6GA 2HHJA 4ZREA 1WUHS 1E6WA 1XXLA 3K70B 1B16A 4YRCA 2HZBA 2AZMA 4N8DA 1F8FA 1H94A 2ZR0A 3AX6A 1Z6ZA 1TCCA 1QV7A 4P54A 4Q3AA 3U31A 2O5CA 1KJJA 2DPMA 5GZ6A 2DHEA 2ZUTA 5E9WA 3FPBA 3QLTA 3SQOA 1G59A 2Y3IA 4ZRNA 4X24A 4D4MA 4WW0A 1M34E 4L7QA 2G1UA 4UZFA 4DYDA 4NBKA 2AZXA 2QR5A 1ONSA 4WK6A 3M4XA 5D87A 2JK1A 1NOJA 1IULA 3K72B 2PWZA 3ZK8A 3I8OA 1BH2A 1AQUA 1MIOB 4NCHA 4GMGA 5TVGA 4A0QA 1YZQA 1UUFA 2VDWA 1NNI1 3IQIX 3C15C 4KYVA 3HO8A 2QTNA 4HDMA 1ACJA 3K9WA 4HGRA 2HLNA 2OLEA 3O84A 2V6JA 1I3LA 3FWNA 4Z9XA 3FLBA 3HXTA 1BGVA 4Y2YA 3QVGA 4TV8A 3RARA 1BFDA 1YA6A 1U1CA 2WRZA 1PW7A 2EBFX 2CLSA 2ZB7A 3M2PA 3MMPA 4TVBA 1YIAA 1LS1A 1Z2OX 2D8MA 3NCTA 4L1KA 4KE7A 4R5HA 1BU8A 1QGAA 1H85A 3MTBA 3QV2A 2Z4TA 4GXTA 3TQQA 1WMEA 2CT8A 3G3EA 2B4YA 3EAGA 3N5KA 4YRIA 1KQFA 4R2XA 3HGTA 1TKCA 1R1DA 5E1DA 2EYUA 5J2UA 1ZJ6A 3FOWA 2VZ8A 4I8XA 4KXUA 2AEJA 3FCUB 3RG2A 3VPCA 1MEEA 4L3VA 2PX2A 3O2SB 4JI6B 1P2GA 4LXGA 1NJSA 1QE0A 1LLUA 1KORA 3HKDB 3O2NA 4HQOA 4WY8A 4DNXA 1PHPA 1C8LA 1MMFB 4Y2TA 4NH4A 2NU8A 2CNOA 4HR7A 2JBAA 1ODCA 1NYLA 3PTAA 3BE5A 3PNLA 3KXPA 2QW1A 3UT6A 3ZWWA 4YP1A 2IUUA 3U7FB 1OGJA 3FYSA 5LJLA 1JHRA 4ZRDA 2P4UA 5ECWA 4AO7A 2IDMA 3ZWPA 3AUFA 1PKEA 2G36A 5DM0A 5G41A 1PFQA 1GEEA 3BHIA 3I6QA 1DC6A 2P6OA 5AKJA 1NVKA 3I61A 2XKBA 2MYTA 2W4MA 4X61A 4Z0HO 1JI0A 2ID9A 5KREA 3G79A 5LUAA 2DCUA 2WQ6A 2UU9B 5I45A 3GK3A 2WTMA 2XOEA 1EXMA 1L8XA 1LSSA 1MJNA 1SA0B 3I6BA 3C3MA 4M87A 3HG7A 5B7QA 1D4OA 1ZFNA 1FU4A 3QVTA 4X92A 2HU2A 4YT8A 2RGGA 3QPUA 4XIYA 3DLAA 3FSGA 4C2TA 5I7HA 2IXFA 3PUWA 1N1EA 1H8HA 1RI4A 4BKUA 5DNUA 1TUBB 3Q40A 3HVJA 4XFKA 1Z82A 3RVDA 3FI9A 4KSCA 4BQIA 5ADUS 3PXCX 1XMSA 3U7QA 1Z9BA 2C9YA 3V1NA 5EJ6A 1SUFA 3N7TA 3GYBA 1MPXA 4BAZA 4JJ6A 4RMNA 4ZOBA 3S2ZA 1XCOA 4Q05A 3KZ1E 4S0XA 2A9PA 1UZLA 2VHVA 2G28A 3A26A 3HA3A 3ZDQA 3C6ZA 4X64B 4EB0A 2ISCA 4R1SA 2P91A 3SU8A 3HB1A 1WXXA 1ZI6A 2QF7A 4IV5A 4J1QA 1Y42X 4KE8A 3VOAA 2UZ4A 1FTGA 1GL6A 2UYHA 5JRJA 5T6MA 4IRMA 3CUEF 4COKA 5KYWA 3EFBA 1NXPA 4U7JA 4DHEA 3RYIA 4ENWA 3PGJA 2HBZA 4D3XA 2OCIA 1IIBA 5GZ1A 2FG7C 4E70A 4V39A 3WGOA 2JLQA 4HAWA 3IXLA 2HI0A 2JLSA 2QM7A 2BF7A 4RH0A 4RV4A 1R64A 2DU8A 2NO0A 3ILYA 4OHWA 5E1BA 4ZP1A 5TS3A 3EEQA 3QLEA 2N3ZA 1PNVA 2B2XA 2ZE5A 3A9UA 4DF3A 3RTGA 3QVOA 3BT7A 1RXVA 3DMTA 3R2JA 2VRCA 4RIGA 5H02A 2XB4A 3ZV7A 1RIFA 2Y93A 2AOUB 4WZ6A 3CLVA 4BCCA 3UA4A 3STWA 1AS2A 2X2PA 5A3VA 2HU5A 2PMFA 4GBMA 4BZPA 4L0DA 3BILA 2I55A 3K1ZA 3LUBA 4NBNA 3MCUA 5F9MA 3TTSA 5KYKA 3I53A 1U3CA 3SE7A 9GPBA 4YJ2F 4Z9AA 2A59A 1ZXLA 3QKRA 3AFGA 1XZQA 4Q4AB 2QRVB 3SJBA 3SY8A 3W0LB 5JWHA 1QCDA 2XDQA 1YH3A 5B53A 2JA2A 4WE3A 2BV3A 1RQGA 1T1JA 2IV2X 1UBFA 1B8PA 1ZMBA 4TTTS 3UBMA 3SZGA 2HIGA 4C4XA 1W5TA 3WFJA 1O94D 1ZGAA 3TRFA 3HUTA 4LOAA 1Z4OA 1GD1O 4LGVA 1JEQB 2BEKA 4M0UA 4KWHA 2IOYA 4ERXA 4UZEA 4K0RA 4HNUA 4Q01A 5FWYA 4UDOA 3RWBA 4YXFA 3NCHA 4G5YA 1ISPA 1WXHA 5JVDA 5IKXA 1N0IA 3AJAA 3DONA 4OL0A 5AI5A 3TEFA 1EHIA 5J63A 3SR0A 1DADA 2GEBA 5TT1A 3HCBA 3H9JA 2CJYA 3COPA 4OXIA 4PRZA 4TLEA 1NMQA 4TTAA 3L7YA 5FADA 5JJLA 1ONBA 2DMRA 4JFRA 2RH8A 4MVJM 1GUFA 2WSMA 2M32A 1FSSA 1CRWG 3DEYX 3FCOA 3TLYA 4E5SA 3ZDRA 4JI2B 3DVQX 4C08A 4PWYA 4CI9A 2GBPA 1RS0A 4EPTA 2FXIA 2F00A 3KK0A 2YBDA 3PE3A 4U6QA 3WYCA 3UBTA 2VZLA 3ACCA 4X97A 2IZ7A 3TUZC 1GKUB 4D6PA 3TSOA 2CUZA 1J99A 1Y9EA 3Q3VA 4UVEA 1AXRA 1DTWA 1TMGE 4WXMA 3VPAA 4ARSA 4DSTA 1WMFA 2D54A 3R7AA 3RC1A 4KDRA 3G8AA 3WIVA 5E3JA 4IHJA 3RK1A 3ORQA 4HQRA 2AJ8A 3L1IA 3JPWA 5FPQA 3RIHA 4E88A 3BIXA 3ELBA 4X91A 4AJEA 1G20A 1PCXA 1UT6A 1W4AA 2JI4A 4LDQA 3OE5A 3BE8A 4Y2JA 3TW0A 3WKCA 2VNJA 4MWCA 1X1TA 2CUKA 1YRLA 3L7LA 4Y6PA 1UINA 1XDWA 1XQXA 4JQCA 3H0KA 4GBED 4X1KB 2RH4A 4F4IA 2DTDA 3HLYA 5BSFA 4QDXA 1FPQA 2J9ZB 1KPGA 1SXIA 5C81A 1N33B 2CFTA 4PCLA 2LE0A 4B09A 1Z3CA 3TR6A 5TPZD 4CQMA 5ABPA 1RWWA 2ZRPA 4XH9B 3JTEA 2BC9A 3ZTWA 2QY9A 3GBPA 4ML3A 4FCTA 4PZYA 4B74A 4DDMA 2A9RA 1BZYA 2WT4A 1EFVB 2RCNA 3KEOA 2MMCA 3OEWA 4C7BA 3ZOZA 2E5LB 1BVUA 3GN1A 1KI6A 2DQSA 1L5FA 4LHSA 3ZZ1A 4LRTB 3DZCA 4MGZR 3GNSA 4YPOA 2XCQA 1G3RA 1W75A 1CXZA 2NU6A 1ACMA 1Q0RA 2H11A 4DDTA 3IUEA 2ZBEA 1Q5PA 3EIFA 1SMKA 1J33A 2Y1CA 1ESDA 2ZUDA 2ZXUA 2VDRB 2AN5A 2BE9A 2E5FA 1XZFA 4JS0A 4L8YA 4TWRA 4IIBA 4UTOA 3V32A 3AXTA 4WXRA 3WP0A 1TLFA 3MD9A 4BV2A 5LQMA 4O4HB 4M0CA 2MSLA 4DBZA 2W71A 4EVRA 1H4SA 2PQ6A 3FPSA 2BCJQ 2NXJA 1X7ZA 5HILA 4LKOA 1PU2A 3OLQA 2HRDA 4PBTA 2XVZA 4LPKA 1UJ2A 2O5RA 1CHDA 5D6OA 4IPTA 1KOGA 2E1PA 3MGCA 4PO8A 1F2VA 4R1LA 3S1LA 3GAMA 2C03A 2VDQB 1XO1A 3RT7A 4B3BA 3AKCA 2RC6A 5AM4A 1RYEA 2QTBA 2ZIXB 1E3DA 1IUKA 3NH6A 4QD3A 3I9KA 2QQFA 1IVYA 2H63A 1ZUIA 3DKKA 4QYXA 1UKBA 5FOTA 3WX0A 1GTVA 3CJQA 1FFAA 3G1UA 3HCDA 1NVFA 3DHVA 4ZT6A 3RJZA 4UFPA 4WLFA 4AKHA 4GF5A 3W2FA 3IBGA 1XD8A 1FW8A 3OQNA 3ZCVA 4YCLA 4OQYA 5H81A 2CXTA 3AEZA 2NYUA 3QFSA 4ZAXA 3RFFA 3SEFA 4CU5A 1GUYA 4AY2A 4R8SA 3U9LA 2Y76A 1U2SA 4MW4A 2JDID 3BEDA 2O2ZA 4HHEA 1PN3A 3W1WA 1JJ7A 1O9HA 3NQ41 4H59A 4RUKA 2CLFB 4C4YA 4C76A 2VXCA 1NZFA 3RS2A 3CC8A 2HCBA 1HDCA 1JDZA 2RI0A 2A1IA 3EBPA 3GGGA 2BW0A 3PUIA 3SNKA 2REXB 3KYJB 3A1NA 4MR8B 4BKRA 3BMOA 1T9BA 2FR8A 2WU4A 3C4VA 3MYYA 1W96A 4JBHA 2WLTA 3VPFA 1YR8A 5FPHA 1HTBA 3MJCA 2X7XA 4ALIA 5JNWA 2HA5A 3LHSA 5FAXA 4UZSA 4UDXX 3KSBC 3MN1A 3H2YA 4FYJA 3T3GA 4B3SB 3CH5A 4DC1A 1B0AA 3K9LA 4IIUA 3R7WB 4O33A 4IVNA 4CCSA 3GMDA 4D56A 3KP1A 2BJHA 4L22A 3WGMA 3WK7A 1IBRA 3RYCB 2JLUA 3M9LA 5G0VA 3WJ7A 2VDLB 3K0CA 3PYXA 3E7PA 4N9QA 4ER0A 1DTSA 4QSHA 3QIVA 1QIDA 3P52A 4KN5A 3KB1A 4RD6A 3Q87B 3TRDA 4DY4A 5B4TA 4LTMA 3NHPA 4HYQA 3D2CA 2R62A 4XYBA 5CXSA 1I1OA 1Z2NX 1D09A 1LBQA 3ELUA 4U7HA 1UBEA 3FMOB 4I3FA 3GUCA 1UZMA 5ALZA 1CUZA 1QF6A 2Q29A 2QMQA 3HSSA 3JSAA 2Y0CA 2XNDD 3HDJA 4E08A 2A5LA 1U3FA 2R7LA 4ANFA 1TKBA 1W0KA 3GJYA 1ZOLA 4O2AA 1QYIA 5GAJA 1U3GA 3IJ5A 1RI3A 4B75A 1RHMA 5JCJA 4ZODA 4YALA 3PEUA 1P60A 1YGYA 4R1PA 4PFKA 3D1JA 1MH9A 1MRSA 4IF4A 2LCFA 4MVJA 4PX5A 4LV6A 3ZK9A 3AF1A 1UBCA 1R16A 1DKRA 4P5PA 1ZUNA 1IAVA 4PTZA 3IMCA 2ZULA 1FQKA 3N87A 4UUAA 4LSMA 2CLDX 3HKBB 2FZ4A 1DX6A 2NSHA 3RU3A 4BPBA 3AZOA 3B7PA 3NHFA 1M6YA 1YB5A 1O5IA 1QFSA 3A10A 4HQ0A 4OHMA 5DBIA 4KBFA 5B6IA 3SIRA 3Q0IA 5DB4A 3WDKA 3ZKWA 2ZUEA 4LK3A 4ARZB 1T6ZA 3NUZA 3TMAA 1QHXA 2WJ6A 1GPMA 1KO4A 1NXQA 5DTMA 4H4CA 4L4XA 5FRDA 2GM4A 1C7FA 3KHUA 2J45A 1C0LA 3LKZA 3JWJA 1FYEA 5CB4F 1JU3A 3RV4A 1AGXA 3UJHA 1E3TA 4F56A 4C3UA 3N2GA 2HT6A 4JSRA 1FNMA 1JJBA 2XODA 4U4AA 5HM8A 2VPYA 4L4RA 4JUFA 4WKPA 3PC7A 1BKSB 4YRRA 4NABA 3FPCA 4AICA 1Z8NA 3O75A 4OJMX 4B6JA 1ZIYA 2XNSA 1YRAA 1TCAA 5GM1A 4A2QA 5HEKA 4AN0A 2G9VA 4M21A 3U4QB 4YN3A 3QKSB 4F5DA 4LUCA 4EMSA 1ZC3A 3DO8A 2ZSAA 1DJQA 3P1JA 4J2TA 1FDVA 3VA7A 1W73A 4LYJA 4HWKA 4YRLA 1ZAKA 4CFSA 1H4VB 4OJKA 2IHVA 2D1SA 3V00A 3N2LA 1QOPB 2AD5A 4O2RA 3GUYA 1QF9A 1ZOPA 1JKJA 1Y37A 1X7XA 3F6YA 5L9AA 5MF6A 5LWQA 2J6HA 4MRAA 2G71A 5JXWA 1EUDB 3ZWCA 3CWQA 4LOKA 1E9BA 4IIGA 2YHSA 1L5NA 3RSSA 1WB5A 4E1VA 1S01A 1FMJA 3MT8A 4NMHA 5IK2D 4RETA 4UE6A 3N70A 3Q0EA 4DLLA 3H17A 3Q3JB 4PAGA 3RI3A 2Q6IA 2SICE 2WHPA 2BGTA 3CONA 5F4ZA 2RG7A 2LPMA 1YDHA 3PUYA 3TWOA 3CEHA 3GR6A 3JYLA 4EVQA 3D31A 2G08A 2J46A 3DDWA 4JVLA 1VHQA 3ODPA 5A2QA 4L51A 4WN9B 1FDWA 1SXJC 2R25B 1GSOA 3VBEA 2PJZA 2E55A 3VPGA 3VZPA 3WL5A 2EXXA 3QKSA 4MRMB 4QO7A 2QP4A 3WLIA 4S1NA 1MQSA 1KMHB 2XMCA 1N2CE 5JNVA 5BWNA 5CD1A 3ITDA 4LDAA 1J0BA 3GDHA 1PLKA 3SFZA 1YE3A 1UM8A 2WIFA 3MS4A 1WD5A 5FA6A 1X86B 2E1RA 5FPSA 3AKZA 3G0IA 5HRCA 4YT5A 2DULA 3DAHA 4PN3A 3AR3A 4O08A 4C0LA 1JT9A 2WAMA 3LXUX 4XX1A 1II0A 3H4MA 4GX5A