2EFDB

Ara7/atvps9a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
165
structure length
152
Chain Sequence
SINAKLVLLGDVGAGKSSLVLRFVAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
total genus 41
structure length 152
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efdB00
2WKRA 3U44B 1UKYA 3DM9B 4GFDA 1G20E 3QF4B 5GADl 1ZCBA 1BIFA 3NHAA 3ZDQA 2WZQA 2AR7A 4Z54A 3WNCA 4LYFA 2ZAOA 1KDTA 1ZM4A 3OAAA 3EA0A 2VBCA 1RYFA 2AXNA 2QAGB 1ZUHA 4HLCA 3ICQB 1W47A 2QA5A 2R6DA 1KTVA 3DMDA 4NMMA 4I81A 4GP6A 4FWTA 5J40A 2ZRBA 3HR8A 1XTIA 2OV2A 2CCJA 1TEVA 3KB1A 2BEKA 2B21A 1YJ5A 4MRRA 4NCNA 4UJ3A 3WMGA 5HKKA 1Q3TA 2QT1A 5J5CA 1SVWA 4TSFA 2O5VA 5FH9A 1C9KA 3BB4A 1IJEA 1TAGA 2JJ1A 3EZ7A 4DT1B 4H9GA 4KFUA 1NIPA 2H57A 1TU4A 4W7SA 5KNDA 1UKEA 3W5JA 4ZDJA 3SDZA 5M04A 3QKTA 1E2MA 2OCBA 3RRZA 2XNSA 1R0XA 3VTKA 4YXWD 1N5JA 1FUKA 2A78A 2O8EB 2ZRPA 2O8CA 4GRAA 1SGWA 3ONWA 3LXXA 1XTRA 1Z8FA 1SXJE 5EJEA 2D06A 2GTPA 3PV0A 1DARA 2BCJQ 2R9VA 3KXIA 4AKGA 2GCNA 2RAPA 3IDQA 3V9PA 3HR7A 1F2TB 2AK2A 2ZE8A 1BYUA 1CJVC 3A4MA 4HB2A 5FBWB 3A1WA 2P6RA 3K70B 2QTHA 3IIJA 3W8RA 4DWJA 1S3GA 1F2UA 3QXSA 4HB3A 1ZCAA 4RCZA 4XJXA 1W46A 1E2LA 2EWVA 3L8YA 4OKSA 1CR2A 1YZUA 3BH7A 2NMVA 1Z6TA 2GK6A 3RRMA 4MQBA 2GVZC 3K09A 4FI3C 2P6UA 4F38A 5JEEA 2QE7D 1GAJA 1AQUA 1R7RA 3N2EA 3U5ZB 2GF9A 2Q9BA 4OQFA 3TW4A 2QGZA 1YRAA 2WKPA 4B3BA 4K46A 2XOKD 4TT3A 1IN4A 2GCPA 3K0FA 1W44A 2DFKB 2BJVA 5CIWA 3L0OA 2PX0A 4ABYA 3B1ZA 3AKEA 5AJVB 3QG1A 1KI7A 1NP6A 4Q00A 2HYIC 4D0GA 3K0CC 1IBRA 1MR3F 2VP5A 4AG6A 4RKEA 2FPKA 3GJ3A 3VKGA 1GFIA 1YZLA 4TQAA 2XGJA 1E96A 2WJGA 4RD1A 1E0SA 3FMIA 2IS1A 3BS4A 1US8B 2UZIR 4G1UC 2IW3A 1KO7A 4OHZA 2WJHA 2YOGA 2C9CA 4OK3A 4QHSA 1E2DA 2ODWA 1S3SA 1SKYB 4F7WA 4ZDKA 3W5IA 4FW9A 4BLSA 3P20A 2QP9X 2V6IA 2CE2X 1VHLA 1SXJB 4DB2A 1AS3A 3OEHA 4PXAA 2FSIA 4X8LA 1DADA 3GJ7A 5SZIA 3FOZA 1KSHA 4DLUA 421PA 4IDHA 3HWSA 2OE2A 1YHNA 2FJUA 2PBRA 2FFHA 4YMVA 1EGAA 2BKEA 2JIZA 3HPRA 4NDZA 2H18A 2A30A 4Q03A 3Q72A 1ZNYA 3SFVA 2CJWB 3UG7A 5EE1A 5JSZB 1Z3IX 2RGEA 3W34A 3GLHE 2B7BA 1XEXA 2XTMA 2XXAB 1GL9B 4XVUA 1QHSA 2ORIA 4KI0A 3TSWA 1NY5A 1UFQA 1ZU5A 2BWJA 2PLRA 4QJ5A 1JPJA 2VL7A 4JVLA 2BVNA 1JR3D 2LKDA 1T3HA 4YC7A 1XTQA 1OIXA 4P3YA 1M7BA 1JR3E 2X2FA 5H70A 3VKHA 5AK0A 4JVSB 3VX3A 1DEKA 3OESA 4K81B 2ERYA 1XPRA 2GJ8A 3WBJA 2ZI5A 1B23P 1XXHE 3MUFA 4RKFA 3THXA 4QG7A 2O52A 4DEXA 2FN4A 5DN6A 2AFIE 3WMFA 5HKKD 2ZR9A 5FR2A 4HAWA 4KYIB 1DAMA 5GJVC 2KE5A 3K0AA 5BN4A 4CEHB 1S0UA 3IQWA 3UWKA 1NKSA 5DN6D 2O8CB 2A5GA 2V4ZA 121PA 3LV8A 2ZI9A 2CL0X 4U02A 5H68A 2OT3B 1CU1A 2O8FA 2CVFA 5FOTA 2F3RA 4UXJA 1CEEA 3KQHA 2ZVPX 4DUGD 1RVDA 1Q0UA 2C5LA 3GMTA 3WP0A 3AV0B 5KUTA 5TV2A 2QENA 3BK7A 3GD7A 1D6JA 4PZZA 3PUWA 3QQ5A 4URUR 4LHWA 4UNRA 5FBQB 4B35A 2O0JA 2B7CA 2WJVA 4B76A 2Q21A 2VHCA 3I92A 3ETLA 3T5GA 4GSYA 1U0LA 1NN1A 3MLEA 5TVKA 1L4UA 1Z0KA 3SN6A 4I4LA 1ZUNB 1UJ2A 2ERXA 5DYIA 3SYKA 3FMOB 5AR1A 1N0UA 1OIVA 3A1TA 2DBYA 5AJYA 1TF7A 4QNRA 2WAYA 3FMFA 3K0CA 3SJZA 1N6OA 2EW1A 2IS2A 4P31A 1W49A 1YKSA 2BV3A 3EIEA 4HEJA 4JL6A 3TAUA 2W0SA 4IVQA 5JWRA 4MUBA 3VQTA 3RS2A 2CCGA 4RSGA 3WYGA 4CIDA 3B5JA 2IUUA 3KDSE 1XX6A 4Q5IA 3NBFA 1W2HA 4CGZA 2FOLA 2F9LA 4AKHA 4F91B 3MWJA 3VR4A 2QZ4A 4UXIA 2WICA 4KLZA 4LHVA 1Q21A 1COWA 1E9FA 4URWR 5FOUA 3OIUA 3RYTC 1YZGA 1E2JA 2PCJA 1IY0A 1QG2A 1IJFA 4MKHA 3THWA 1H8HA 3WBKA 3PCRB 3GJ6A 1DELA 2PL3A 4QHYA 3LVQE 4MYHA 4EPVA 4MGYR 1FTSA 1OKKD 2ZRLA 5DSZA 1XXHB 2QAJA 5FOSA 2Z43A 4LX0A 5IRCD 1XMJA 3K1JA 1MV5A 5EP2A 4MRSA 4LBWA 1Z2CA 1HY3A 1TTTA 2FPLA 4XD7A 4D25A 4EFNA 4RVCA 5HZHA 2JJ2A 3CBQA 4II7A 1DO2A 5C2JB 1R2QA 3Q8XB 3TQCA 1J99A 2D2EA 1KI3A 4BLRA 1G3MA 1RW4A 4HAVA 1NVXQ 4EUNA 1NLFA 4OI0A 1D5CA 3V00A 1UPTA 1P3JA 3H84A 4PHFA 3ZZTA 3TH5A 2IA5A 4C0QC 3KKMA 1VDZA 4LRWA 4BLPA 3QBVA 2NOAA 2ZSAA 3DOFA 2BCGY 4GOXA 4MUAA 2JLZA 4KBFA 3CWZA 2NO1A 4LC1A 3UK6A 4E07A 2ZRDA 1Z63A 4B43A 1OH5A 1G8GA 1U8AA 4BFYA 4A2WA 2AX4A 4JMPA 5AWFC 4DDTA 4ON9A 3K09C 1DAEA 4IDNA 4L5BA 4TYWA 1AN0A 3MCAA 2NG1A 2EFEB 3FKSA 4LBVA 1G8HA 1LW7A 4B3DA 4U00A 1JR3A 1R8QA 3AVTA 1UBCA 3B13B 1II0A 1ZC3A 2FPMA 2RHDA 4QBHA 3BORA 3U60B 4OBEA 2IUTA 2G77B 2XB4A 1L8QA 2VRWA 2ORVA 5EP4A 5TDHA 2FH5B 3FHTA 2HLDD 4DIDA 1T0HB 1Z0FA 2XEXA 4TMTA 4PANA 2ZUBA 4GL2A 2J7PD 4R2IA 5CJ2A 3X1ZA 1A2BA 2ATXA 3BAFA 2OLJA 4KAXA 1KK0A 1L7VC 3H1TA 1E9RA 2AXPA 4HAYA 2CEAA 1VYUA 4QXAA 1AM4D 3QVUA 1PUIA 4CZ2A 2YZ2A 8OHMA 1KHTA 2BOVA 4JLDA 2JLSA 1T5LA 3VKWA 1N6HA 4DLVA 2YWHA 2ECKA 1ZM9A 4DLTA 2B6HA 1Q57A 1KMHB 2GJKA 3QIAA 2VO1A 1JB1A 3IEVA 5L3QB 1WBBA 2BMFA 3KJEA 3ZIAD 2BJWA 1AKYA 4JKIA 3VFDA 1LNZA 2QBYA 1AA9A 3AH8A 3LBHA 5C1BA 5JI2E 2F9MA 1ETUA 3RS0A 2WOJA 4PPQA 1P73A 2WWXA 1OB2A 1ZD9A 2V1UA 2O8BB 1IOZA 3ZD7A 3C5HA 1XZQA 4QGGA 3EZ6A 3MWYW 1ZVQA 3PEUA 1VHTA 4ZIRA 3CLVA 2NPFA 3TNFA 4LC0A 3TR0A 4D4KA 3BH0A 4UNNA 1S96A 2W83A 3TK1A 2OFOA 5FPSA 5BQ5A 3GLGB 5LD2B 2GKSA 1AS2A 4L9SA 4NZYA 2OFXA 4HDOB 1KI2A 3W9YA 4LJ7A 2CL6X 2V7QD 3CH5A 1C4OA 5KU1A 3MRSA 1ELOA 1P9NA 1KI9A 1LVGA 2G0TA 2X19A 4XVQA 1GKYA 3EPKA 3EPHA 3GEEA 3I62A 3K9LA 2N46A 3B8HA 5BN3A 2GHIA 2OEPA 4A15A 3GFPA 2FX3A 4KU4A 3PUYA 1FQJA 1AKEA 4WZAE 1HQCA 3IKJA 1EXMA 3AF4A 3FVQA 1JEDA 1VG8A 4TMKA 3W6PA 4GP7A 2KBEA 2UVQA 1BS1A 3CR8A 1NBME 3CZPA 1Z6GA 2ZI6A 2GJ9A 2W00A 4J0QA 3ND8A 3RWOA 4DLZA 1N3BA 3B1WA 3ZVLA 1ODFA 4QJ3A 3UIEA 2E87A 2H92A 1S1MA 1DO0A 3TJZA 3UATA 4DLSA 2YC4C 1TPZA 2QSYA 2ZU0C 5F2EA 5KSZA 2V55B 2FG5A 2CNWD 4IOKA 3GPLA 3GEHA 3BWDD 2ZRKA 3P4XA 4DSTA 3CR7A 3SBDA 1ZNXA 2LKCA 3FPAA 1X3SA 2CE7A 3N2IA 2G88A 2ZM5A 2XJ9A 5FTKA 3BOSA 1KI1A 5JS7A 1P7CA 3QJYA 5FI1B 4Q19A 5IT5A 4JZKA 4MGKR 4TL9A 5FI0B 2DCUA 2LWIA 2QG6A 4JBYA 5TXGA 4ARZA 3C8UA 5HPYB 4EAQA 2QTFA 1NVWQ 2A9KA 2D7DA 4MKIA 3F3YA 3B85A 3JZMA 3UXMA 4M53A 1YRBA 3LY5A 3NVAA 1MRNA 1VCNA 4M22A 5FBVB 1N6RA 1Z2AA 1VYVA 2Z6VA 2Z5FA 3AVUA 4B33A 1G21E 1ZIPA 5CK4A 3RSLA 2GXAA 1N0WA 1UDWA 4C30A 3X1DA 4ASUA 3V4RA 3ADDA 3Q9LA 4Q9JA 3GFOA 2WWYA 3H2YA 1XDBA 1DG3A 4C0AC 3LWNA 4C0LA 1XEWX 4ACBA 3D31A 3FMPB 2AK3A 4LBYA 4HZUA 1GNQA 1P9RA 1KK1A 2ASEA 4Q4AB 4X8MA 1T9HA 4KLNA 5FUXA 5SZKB 1OHHD 4DJTA 4EPRA 2VP0A 5AJWA 3CM0A 2X1VA 3LX5A 1ESMA 1JXMA 1MO6A 1WMSA 2QT0A 4NU0A 5F9FA 2WIAA 4Q9IA 5DE3A 1X6VA 3IO3A 1Q20A 2ONKA 2J5XA 3TUJC 3ZS9A 4TLBA 4RCYA 2ZRHA 1CRQA 4EDHA 1Z6XA 1VG9B 1OW3B 1FUUA 1OE0A 1WP9A 2NO7A 3FHOA 4MRVA 3I4LA 3EPJA 1NKTA 1RRPA 2ZREA 3FYHA 2NQ2C 2QAGC 2GXUA 2VH5R 1OJLA 2QUZA 3SU8A 2J41A 4ZDWA 2XNDD 4DCSA 3FKSD 2P6NA 4KYUA 4NCJA 4Q4HA 1XP8A 2F1HA 4TWZA 4BFXA 1EFTA 1RYHA 4YQFA 1ZYUA 4B71A 2IK8A 1EG7A 1SVMA 1U98A 3ND9A 2C98A 1G291 5J47A 1CRPA 3QENA 4H1UA 3RS5A 2OHFA 3SJCA 2FU5C 4RD3A 4E5UA 2BBOA 4NYJQ 2ZSDA 5JMTA 4P4SA 2V9PA 3N70A 4OQLA 1DG1G 2WPDD 1UDXA 3ZIAA 1YZKA 1YU9A 4OI1A 3LH5A 4JVNA 1OYWA 1XTSA 1A4RA 1P2SA 5EXXA 1S8FA 1KKMA 4M9SA 3ZQJA 1WCV1 4L8GA 2ZJYA 3RC3A 4V0KA 5K8UA 3NEJA 1SKYE 221PA 2HV8A 2RGCA 4XD7D 5JFGA 2ZYTX 5SZHB 1ZUIA 5FTNA 4DLWA 1XB2A 4FMCB 1E9BA 1YR7A 1U0JA 4NP6A 4D82A 1OFTA 4Q1BA 3ZH9B 1JR6A 5FTJA 5KSOA 2J9RA 4JYBA 5JRZA 1IN6A 4XVRA 4ARZB 4P33A 5KNBA 1DAIA 1KYIA 1KJYA 1T4GA 1WE2A 1JECA 1FZQA 1IN5A 1H8ED 3K70C 1KIMA 2IYUA 5KYKA 2N42A 2ZSBA 4NCIA 1ZRHA 1N6IA 1UM8A 3LDAA 4JVMA 1OFHA 2HF8A 1W7AA 3THYA 4JLBA 5EE9A 3EZ9A 1GDDA 1W4BA 4BASA 1HQYE 1P5ZB 1SVLA 2W58A 3QBTA 2VHTA 2DWPA 5TB5A 4EPYA 1OT3A 3KTAB 2RGAA 3C5CA 1CJMA 2WSSA 3RLFA 1NG9A 1KZ7B 1R8SA 3KX2A 2FSFA 2ZITA 1CJKC 3U7HB 2IEYA 4QGAA 4ZV4A 2H8KA 4R7ZA 4B3GA 1KKLA 1Z47A 2QL6A 4GMDA 4YDHB 2WWFA 3NIBA 4DRZA 2GRJA 3PFIA 3B2EA 1AGRA 4UNSA 3A1VA 1R5NA 3D8BA 2GNOA 1YZNA 1G6HA 1KY2A 4EJSB 2QORA 2OILA 1E2EA 4AK9A 3AB3A 3R7WB 4W9MC 4DLRA 2QM8A 1F3OA 4MA4A 3EAQA 1VTKA 2XZOA 1TQ6A 1IY1A 2AD1A 4XWOA 3TR5A 3QVVA 4KSCA 2IYYA 1UBGA 4QHTA 1G8FA 4DKXA 1ZD1A 1G7CA 1M34E 3KQLA 4L15A 4JBWA 4MYCA 3CW2A 1E4YA 1E0AA 3R20A 2YWEA 1EFRD 1MO3A 3SQXA 4EQ6A 5IHPA 1TQ4A 4R9UC 1UF9A 5AUPB 2VSFA 1M7GA 3AUXA 2IC5A 1E99A 2O0KA 3OFNA 1H65A 2J59A 3E2IA 5EXTA 3EWAA 1DE0A 1TL7C 2C95A 2FMXA 4PTLA 5AJXA 2ZI7A 4ZCLA 2VSOA 4RFSA 1QHYA 1FTNA 1YQTA 1ZM7A 3CF6R 1NLZA 3G82C 1BH2A 1KK3A 2OSBA 5CIQA 5G3YA 4EPWA 2AWNA 1R0WA 1VG0B 4DLYA 2VF7A 1W1WA 1WXQA 4O2LA 3EWSA 5LB4A 1J8YF 3UPUA 4KSBA 3L0PA 3AP3A 4F4CA 4Z1MA 1P72A 1W48A 1G7TA 2GBLA 4D0LB 5JCPA 3BXZA 2XB2A 4P4SB 1XCGB 3SR0A 1HA3A 4KJZA 3ICEA 4GPTA 2GJAA 1Q1QA 1UEIA 3EC1A 3ZJYA 3KQNA 4ZDIA 2IXEA 1VCMA 3IHLA 3C16C 2NO0A 1G16A 1CBUA 2GXSA 3L0IB 2ONJA 1TADA 3TUZC 5JLJA 2YINC 2BIFA 4Z8YA 3GCGA 1KJZA 4OQXA 1FL9A 3DOEA 2IEZA 3N5CA 4OI4A 4D4JA 1P6XA 1RE0A 4Q1FA 1ZNWA 3I3SR 3EA5A 4M1KA 4Q21A 3PUVA 3TE6A 1G3RA 3H86A 4JS0A 1QG4A 1RIFA 3C15C 1YR8A 1YE8A 1PLLA 2XZLA 4GNKA 4LYJA 2ODEA 1XCPA 2Z0MA 1MH1A 4C7OB 2C03A 2GESA 3C41J 2PH1A 1LTQA 5JS8A 1Z6YA 5IF9A 4Q1EA 1G7RA 1VKJA 4CT4B 4ZIRB 3K70D 2P5SA 3F8TA 1XPOA 2ZSEA 1G5RA 3T1VA 3RANA 4BFTA 2CLSA 3EXAA 4G0NA 5HE9A 2Q3MA 3VHXA 4EPXA 3K8YA 1QHIA 4P32A 1NN0A 3TW8B 1N25A 3Q3JB 4AYWA 2W6JA 5JHHB 3O47A 4B3FX 4Q7MB 3KFVA 5EE5B 3P1JA 1Z83A 2VP4A 1R10A 4OJQA 1XJ0A 3U3KA 3UMRA 5A4JA 3BH6A 1RC8A 3CRQA 3DKVA 4LJ5A 4R71A 5H1YA 1SKQA 2EU8A 4OHXA 5UKDA 3O8BA 4KODA 3G0HA 3SJBA 4HI0E 4FN5A 2F7SA 4RZXA 4LYHA 3B82A 3O8CA 2CCKA 2WJYA 2C8VA 4I1OA 3K9NA 2FF7A 3LX8A 5FUVA 4LYAA 1CLUA 3IPYA 2BC9A 1XFAA 4Q47A 3T34A 2IHYA 3ZS8A 1G4AE 4DDWA 1E79A 4I1SA 4DDVA 2HXYA 1P2TA 2J1LA 3SI7A 3U6BA 3GLHB 2HYDA 1IONA 5KSYA 1JXOA 3KXLA 4CYMA 4DCTA 3NEYA 2XZPA 1FQKA 1MOZA 1Z0DA 4YMUA 1T8UA 1FMJA 3JVVA 2AD5A 1VYTA 4HLUA 1DOAA 2DYKA 4N3NA 2KBFA 4S35A 4YONB 2RKOA 3AKYA 1BO6A 3RS4A 4CEJA 2O8DB 4BZPA 5KDDA 4MRPA 4A8JC 2QMUA 1D2EA 2OXRA 2H16A 3QOFA 3KB2A 2BKUA 4F4JA 3ZVMA 3LBIA 3PIRA 1DS6A 5JBQA 5KSPA 1BMFA 1PLKA 3ZZ0A 2AFHE 1TMKA 1GRNA 4HB0A 4AKEA 4B6FA 5GJWC 1E9EA 2IYTA 5L8VA 4LI0A 3QXXA 3GLIA 1KI8A 2CLDX 4LJYA 4YMWA 3UANA 2RHMA 2RGBA 5CYOA 2YWGA 2QRZA 2ZR7A 3VNUA 2F1IA 1XEWY 3GLFA 1IY2A 3B1XA 3CRRA 3QSYA 3ZLJA 2YOHA 2TMKA 3QEJA 4KV9A 4BFUA 4QM7A 4R2HA 4ITRC 3DEFA 3BC1A 5SZJA 4IDQA 4EFMA 5G40A 1P2VA 3VR6A 1OXTA 4AURA 4TYQA 3GJ4A 5IK2D 3ADCA 2X77A 5GVRA 1E6CA 2QMEA 3A6PC 4NE2A 2EVWX 2HCJB 3BFKA 2FFBA 1G4UR 1O87A 5DLQC 2HCBA 4LHYA 4Q02A 2ZVQX 5F9HA 2QMOA 1LY1A 2JJ8A 2FEOA 1R0YA 4IVPA 3CWQA 1W0JA 2YHSA 3B7GA 3GJXC 3KQUA 3SYLA 1FFHA 4M1MA 1DAHA 3I73A 4TYNA 3ZVRA 2HT6A 1V5WA 4A0HA 2X2EA 3MJHA 1T8TA 3BGWA 4RZUA 5CK5A 2R62A 5EZ5A 1BOFA 3T35A 2XX3A 3WRXC 5J4LA 4FMDB 5FPHA 3PEWA 3WYFA 4PAQA 1OH7A 1VPLA 4PQYA 4Q1CA 2QEQA 2QROA 1IXRC 1HTWA 2HUPA 3CNNA 3GLFE 1UKZA 4ZCIA 1JQLB 2MSCB 3MWKA 1OXUA 5KHOC 4US2R 2FNAA 1E1QA 2V7QA 3WXMA 4PHTA 2DWQA 1Z6AA 2O8FB 2QMHA 1LV7A 3B1VA 5KNCA 1XRJA 3A4NA 2GCOB 4HAZA 2IYSA 3E70C 3AGQA 2IHBA 2WV9A 3FWYA 1ZM3A 3H4MA 3H0KA 4RD6A 1KSGA 4EFLA 1D9ZA 1E2KA 5D3MB 2J3EA 3U3JA 4DBLC 3SS8A 1NMZA 3RWMB 5EP3A 1KO1A 1N6KA 3L0SA 2R6CA 3BE4A 3CPHA 2QPAA 3OFND 4TSFD 2NZJA 1E2HA 2GEVA 5DO9A 1P60A 4GOKA 4MYUA 3CX7A 2Q3FA 4DCVA 4E03A 1OPXA 4OHVA 1E9AA 1GZSA 1NIJA 3CIOA 2NO6A 2D62A 4AG5A 5KDLA 4I99A 4C0SA 2QSZA 1GKIA 2G83A 5CJPA 2VSXA 1Z28A 2E9SA 2PEYA 5KPJA 4KVAA 5ELXA 2OO7A 5F98A 1CIPA 5CITA 2ZJZA 2IYRA 1OFIA 4O0MA 1GL7A 2MMGA 2ZRGA 3NHBA 3QKSA 4TL8A 5E7JA 2DR3A 1QZXA 3D6TB 2MMCA 4C0KA 2SHKA 2W6IA 3LAWA 1I2MA 4BQSA 2BM1A 3TAHA 4CRWB 4C7OA 3W6OA 2BBSA 1KI4A 1ESNA 3TKLA 2JGNA 1W0KD 1VCOA 3I8XA 3SNHA 1F2TA 3TVDA 4LUCA 2A7QA 3OE7A 1CP2A 3MMPA 3VR2A 2ZRFA 5EXSA 4DCNA 3PVSA 3RNLA 4F4IA 1ZC4A 4BECA 1ZAKA 2VHQA 4DXAA 5GVSA 4RZ3A 3B9PA 4DSOA 4XH9B 2IUSA 1Z5ZA 4IRUB 1H8HD 3U4QA 2GWHA 3UKDA 5CM8B 4Z1MD 3SHFA 3CNOA 1COWD 1IAQA 4LJ8A 5C4GB 3LXRA 3CONA 2PMDA 4WW0A 3REGA 1NBMD 4UNPA 3DL0A 4BRWA 4D80A 1GTVA 2FFQA 2G1KA 3PEVA 1E0KA 4FD2A 3AM1A 1FP6A 3QF4A 3LQRA 4QL3A 1E98A 3LLUA 3AGPA 2F1JA 2ZSFA 3CNLA 3VMFA 4IEIA 5B2ZA 4GOJA 5CB8A 1NF3A 1ANKA 2VEDA 5LD2C 4A8JA 3ASYA 2PJZA 4C0HA 1P4SA 1NMXA 1A5TA 3PXGA 1T0JB 2FZ4A 2JDID 721PA 4WZ6A 2CDNA 2QBYB 5DI9A 2WWWA 2ZE7A 1PJRA 2EYUA 3PR1A 1AZTA 3BERA 5KOYA 2WVJA 5LPNA 1R5BA 3AVXA 1M74A 1V43A 1VCIA 1JJVA 5GJBA 2C9OA 4G5QA 5JRJA 4JLAA 3BJIC 4Q9LA 3T12A 5DI3A 4O25A 4LBZA 1DPFA 2QY9A 1KDOA 1RRGA 1GUAA 2Z4SA 3THWB 3SZRA 3A37A 4B48A 4RJLA 4CF7A 1KAOA 1GG2A 1OXVA 2GETA 2GZHA 3RHFA 1QDEA 1Z0IA 5FL7A 4WXRA 3KUCA 3RAPR 1X8KA 1HUQA 4BFZA 2OBMA 2VQSA 1NL3A 4CEIB 1ZINA 2CHVA 4LV8B 4TYPA 4QGFA 1Q1EA 2BHRA 4QJ4A 4NL4H 3CX8A 5B58C 2VYFA 3VR3A 3U44A 3KQKA 3AVVA 1G5PA 4KO8A 1G3IA 1E69A 4B73A 4A2QA 4D26A 4BEJA 4DEYA 3THOA 4LDJA 4TL7A 2HJGA 2L0XA 3IIMA 2WMNB 3KZ1E 3A8TA 2YWFA 3AUYA 4QC2A 1QHHA 2IYLD 5TARA 2CJWA 1U90A 4Y0VA 1GVNB 2ZRIA 3BIFA 3BFVA 2WBLC 3OF5A 1WBDA 1G19A 1E2QA 4B74A 2OLKA 2H17A 1W5TA 5FPTA 5LB2A 2XITA 2FE4A 5H8WA 5AUNB 1KNXA 1JAHA 3K9GA 3QKSB 3OHMA 3FFBA 4RD0A 3R9IA 4C3ZA 2RGNC 3G5UA 5A5GA 2ZJ2A 1FOEB 5FR1A 3T61A 3NC0C 4OK6A 5IDVA 1YR9A 2AHOA 2R2AA 1MABA 5EE3A 4UQOA 1CXZA 1G9XA 2W2TA 5CDFE 1JJ7A 4ERNA 3QNUA 1G8YA 4JLNA 4IXNA 5DYGA 4NBSA 4Z51A 3UG6A 3LD9A 2F6RA 3HYTA 1VMAA 2XSZA 3AF0A 1XEXB 2IX3A 4IOJA 1UEJA 2Q9CA 3Q5EA 4YLGA 2GAOA 2PX3A 5BWMA 1JBKA 4U5XA 1GP2A 3FB4A 5FBLB 4QBIA 1NRJB 4PPNA 2GCOA 2QPTA 1T3LA 2QTVB 2ZJ8A 3FTQA 4JSTA 2AKAB 2RMKA 2JLUA 4R98A 2GEDA 3U4QB 2H7VA 2VHUA 3CUEF 2NPIA 4MKGA 2W2XA 4Q7KA 3DPUA 4LGMA 4AY2A 3NH9A 3ZVNA 1DBSA 1P9WA 3ZYCA 2ZROA 1BYIA 3GJ5A 4JT4A 4ILEA 4MRNA 1CR1A 2DWOA 1M6NA 4TMXA 3SHWA 4M1TA 2DY1A 4TMWA 1OH6A 4M1YA 4TMZA 4BFVA 2PJRA 3EIQA 1KO8A 3RRYA 2CK3A 2VHJA 4D2IA 4XTCS 4TL6A 5FL7D 2YJTD 1SVOA 2J46A 2H1LA 3L2OB 4BFSA 4TTRA 2JEOA 4ZO4A 1RJ9A 2FGJA 3ADBA 1RPZA 3W8NA 4WA7A 4Q4AA 3VAAA 3HPQA 1R5OA 2NTYC 2ZANA 2CBZA 1GNPA 1XTKA 1K5GA 1MO4A 4IEEA 4CEHA 1NMYA 4Q9KA 4PQRA 4MDEA 1G18A 2KJQA 2J0UB 3U3MA 3EIHA 5BW8A 2ZJBA 1IM2A 4BEBA 1OV4A 3U7GA 2ODNA 4HUQB 3RSOA 1G6OA 1EFUA 2ZYUX 3DO6A 1KDPA 5JJLA 4BGDA 1C1YA 2R6GA 4D4LA 1CR4A 3PQCA 5CYPA 1N0VC 1OIWA 2P67A 3T15A 1AGPA 1YZTA 3EZFA 5LBIA 1FX0A 3TVTA 1Q3HA 2P65A 3A1SA 2YKGA 1SHKA 1Z29A 4LJ6A 1FPMA 2WSMA 4A8JB 4LJ9A 3EASA 2F43A 3FKQA 3QXHA 1R0ZA 4B44A 4GDFA 2FSGA 3R8CA 3UMFA 4A82A 1II8A 1A2KC 1KO5A 2PCLA 4XSHA 1XJQA 4JJKA 1U99A 4EJSC 1N5KA 1XMIA 4AKIA 3U7FB 3BFXA 3IBYA 2EYQA 1S9DA 4XWAA 1KAGA 3AKCA 1I4DD 4AWXA 1AQYA 4LCBA 3WRYC 1SXJA 4PO1A 4AI6A 2KSQA 4MH0R 1TUEA 1SQ5A 4LK2A 4Q4LA 1BKDR 1WRBA 2WWGA 1D9XA 4V02A 5G3ZA 3S1AB 2JLYA 2JLXA 4WOPA 4A0GA 3VX4A 3THXB 2HEIA 2OBNA 5FUWA 4WBSA 3TSOA 3R8FA 5JJIA 4PO9A 4LHXA 1SXJD 2NIPA 2V3CC 1BMFD 2ODBA 3FFAA 4DSUA 4US0R 1GWNA 4GMXA 4JLPA 2REOA 1F48A 1MABB 2C04A 3F0TA 2KI5A 4B2LA 4NYIR 1P62B 2UZ3A 1JPNA 4PPFA 5JCZA 2G3YA 1DVRA 4ZCMA 2OESA 1W36C 3GLIB 5AUOB 1G8PA 1HT1E 2IXFA 1E4VA 1LS6A 4LPKA 5B57C 4M1WA 2ZYVX 4TLAA 3T1OA 1QHXA 2GVDC 2RGDA 4HDQB 1QBKC 4MKFA 2ZTSA 4DHEA 3C4JA 4B32A 2RGGA 1J90A 1KMQA 4Q01A 4OQMA 4OI2A 1P75A 1I4TD 4B34A 2ZQ5A 3TLXA 3UMSA 3NKVA 1E9SA 1Q1BA 1RKBA 1N5IA 2C99A 4H1VA 4HLUC 4KCGA 4TLCA 3WHLA 3QF7A 5HE8A 3VU9A 5EUQB 5GJCA 4WZBE 4LPSA 3CRMA 3LRPA 3Q7QA 1F5NA 4CEJB 2G0NA 1R6BX 4EIWA 4NKRA 2IYZA 2FV8A 2P2LA 3AP2A 2Q6TA 3NXSA 2AL7A 1E2PA 4HZUB 2CNWA 4JLKA 2OBLA 3NTUA 2W6JD 4DSNA 3FHCB 3L82B 4JIMA 3M1IA 2P3SA 2ATVA 1XF9A 3IEUA 5P21A 3M0EA 2QGNA 2DHRA 4V0ME 3CRVA 4GT1A 4CT5A 1AK2A 4NONA 5DHFA 3M6AA 2RCNA 5JWHA 1OB5A 2OCPA 3VR5A 4BLQA 1TUIA 3A36A 1E79D 1NG1A 3DMNA 2PZFA 4YMSA 3TRFA 1EFRA 4OYHA 1W0JD 2ZAMA 4HLDA 1E0JA 4QKQA 3X1YA 5JHGB 1CULC 2HDNB 3B6EA 4V0MA 1KI6A 2JATA 1W36D 2VP6A 3AF2A 1U9IC 3IQXA 2ZRNA 2YC2C 2V1XA 4IHQA 5JEDA 1S4QA 4Q66C 1SVIA 2R6FA 2ZE6A 4LWZA 1MRSA 3GFTA 1QVAA 3OAAD 4FMCF 1FX0B 2DFLA 2ZU6A 4XIGS 2ZRAA 3KXKA 1UAAA 2FFAA 3R9WA 1GITA 2ZXUA 1KSFX 3ZZUA 2IS6A 2J87A 1DAFA 2VTKA 2R65A 2O8DA 1MT0A 4URXR 4CVNA 4BPBA 4LJAA 4URVR 2OZEA 2GEUA 3AVPA 4FCWA 2VP9A 1II8B 2BMDA 1GKUB 1J7KA 4WVFA 4B2PA 3IO5A 2N1BA 2ZS9A 2CVHA 2J7PA 5DGXA 3MGCA 5L3SB 3ZQ6A 4LSGA 4PAMA 1EWQA 1CTQA 1VECA 1ZP6A 2NGRA 3KKPA 1N5LA 3PEYA 1G3UA 3PITA 4OJKA 1CJTC 5C18A 2OFWA 2ZJOA 3DHWC 3F5FA 2VP2A 4PX9A 4WAUA 1GSIA 2I1QA 4Y0AA 3R7WA 1TNDA 2IWHA 2G1JA 3CF2A 4JT2A 1TF2A 5BXQC 5D3MA 5EP1A 4BFWA 3P26A 3MD0A 4HUQA 4ESVA 1Z0JA 2Z83A 4NH0A 5FTLA 1XPUA 1JI0A 4BLTA 4CW7A 2OAP1 4PC1A 1ZJ6A 1E9DA 3GJ8A 2EFCB 1N6PA 3HU2A 4NYIQ 4PO8A 3V4FA 2OAQ1 1WB9A 5FUYA 2ORWA 2XJ4A 2XSZD 4LY6A 3VNVA 1B0UA 2D74A 5CLLA 3A58B 5C4MA 2OG2A 2AKYA 1ZBDA 2ZJ5A 1NN5A 1RRFA 4A6PA 3CO5A 2WIBA 1AIPA 1RRCA 1ONBA 3BBPA 4N0DA 1HV8A 1A1VA 4KBGA 1EWRA 4XWKA 4A36A 4RFSB 3WP1B 3BRWD 2ZI3A 3E5HA 1PV4A 1JNYA 2JAQA 1W4CA 2HLDA 5JI3E 2D2FA 3K0AB 3B1YA 1EK0A 4QBGB 4HAUA 3TSZA 2GXQA 1HURA 4N0EA 3DDCA 3NG1A 4Q1AA 2IL1A 1X1SA 4B75A 5J4YA 4JLMA 5L3QA 4XSGA 3TBKA 4AC9A 1W36B 2H5EA 2I4IA 1E1RA 4Q1DA 4DUGA 1EESA 2FZLA 4PAOA 1DAKA 2IWRA 1E32A 4POAA 3NWJA 2CK3D 3SJAA 1IXZA 4O2RA 4G01B 3VR1A 3QE0A 1KY3A 1LB1B 4RY2A 4W5JA 3KJGA 1OKKA 4NYMR 5E4FA 4CEIA 1JEEA 3A4LA 4ZI3A 3L43A 6Q21A 1WA5A 1L2TA 1L4YA 1QHGA 3AQ4A 4IJMA 5TY0A 1R4AA 2J45A 4OQNA 5HR5A 1PLJA 3KJHA 3WNBA 2NZ8A 4DDUA 3EARA 1X86B 3D7MA 4PC6A 3TMKA 1YR6A 4HAXA 5EE0A 3GLGA 3X1WA 1DTSA 5TMPA 1E1RD 4AD8A 2WJIA 2BBWA 3U2QA 2K5UA 5LDDC 2IF2A 2ZS7A 4QNMA 4Q7JB 1VIYA 4OHYA 4PHHA 4C4PA 2PZEA 1KDRA 3GP8A 1VIAA 1IN7A 1G1MA 1G3QA 5BYKA 2EFGA 4D4MA 4C2TA 1TX4B 4KHZA 3EZ2A 4Q18A 1KNQA 4W5HA 2UKDA 1ZW6A 1XBTA 5HCIA 2ZR0A 3Q85A 4IDPA 4PR0A 1N2CE 4WIAA 2B8TA 2IYXA 3DVLA 4FXPA 1AJEA 3REFA 3AEZA 4B47A 1ZU4A 3U6KA 1LF0A 5FOVA 4US1R 1Z0AA 3EX7C 3LLMA 4DCUA 1X8LA 2QAGA 3C7KA 4A4DA 3U61B 5F3WB 3K53A 3CF0A 1P2UA 4ASUD 2MSDB 1D8TA 2V54A 2W2VA 4URYR 2XTZA 2ZPTX 1KK2A 2VF8A 1JQJC 5G41A 3GLGE 2DFNA 3HDTA 3QI2A 1K8RA 1FNMA 3NH6A 1TEXA 2GAAA 2FDCA 2F3TA 1ZMXA 3CB4A 3I72A 1NSFA 3QEOA 2XXAA 1W5SA 3AVQA 1Z22A 4GBMA 1G5TA 1Z07A 3LBNA 1II9A 3PENA 2CLCX 2GK7A 2GZAA 2ZEJA 3CZQA 3DZ8A 5B64A 5KTYA 2JCSA 1X1RA 4FWIB 1UADA 5L3RA 4A9AA 1NVVQ 4LV5B 4TYYA 2GBLC 1EFHA 1M1YE 1XTJA 3K9HA 2WKQA 5K8IA 3AVWA 4LJ4A 2BEJA 2BMJA 2MSEB 1E1QD 2A2ZA 2WHXA 1QF9A 2QI9C 1NY6A 3P27A 1OF1A 4EPTA 2WPDA 4UKDA 3JZAA 1Z08A 3WYAA 5J4HA 1XMSA 1KO4A 5KDOA 3SE0A 3QPVA 2PT7A 4ZKDA 3AF1A 1CJUC 1G64A 3CRW1 1RJ9B 3PUZA 3C14C 1AS0A 4URZR 1U8ZA 3M4YA 1TF5A 3GQBA 1NLYA 3HP1A 2I3BA 5BN5A 4HSEA 1U2RA 1XWIA 4LZZA 4S2EA 4M8NE 4TQ9A 621PA 4DB4A 3QUSA 4DLXA 2VA8A 4M2LA 1GILA 4IW3B 5HTKA 1WDTA 4KFSA 4IFBA 2VLIA 3QPUA 2WWHA 5EUMA 4Q9HA 1YZQA 4EJSA 1QHHB 1M2OB 3EW9A 3OIWA 3HYRA 4FINA 5AJZA 1ZM2A 5E95A 4JSYA 3IHWA 2GILA 2ANCA 2J0VA 1KOFA 4PC7A 2CMKA 1Y3AA 4HLQB 1UBFA 5FL3A 2HXSA 1OH8A 1XU4A 1XD8A 2Y8EA 1OXSC 2PZGA 4OL0A 1MKYA 2EFHB 3AKDA 4PSAA 4QOSA 4TZ0A 4RD4A 2J0QA 2EQBA 4MGIR 3OZXA 4EQ6B 2O0HA 821PA 1GNRA 1N6LA 1XD9A 2O8BA 4TLEA 1OHHA 1EX6A 3IIKA 4JJZA 1W0KA 3CH4B 3WMEA 1A7JA 2YNMA 3MG9A 4IXMA 3EC2A 1P61B 2XOKA 2ZJAA 5D3QA 5FFMA 4KITB 4QRHA 2OCAA 2Q9AA 2PMKA 5FOXA 1T91A 2GF0A 3TIFA 3KJIA 4PHGA 4KFTA 3S1AA 1X8JA 1OFUX 2QE7A 4JL5A 4XTRA 5CB6A 1VG1A 1XXHA 4ZI2A 4RFVA 3AP1A 3DZDA 3IPXA 1E2FA 1Q12A 2A5DA 2KWIA 3O8DA 3K0SA 2GZDA 4HUTA 4TQUS 4G5RA 4V0NA 1FP7A 2O8EA 1CR0A 2WTUA 4I1VA 1G7SA 1AZSC 1W2GA 2QP4A 3B78A 3RS3A 1XZPA 4YDSA 2C2HA 3B60A 4PPGA 4TZ6A 1Q1ZA 3VU9B 5K8LA 2ZUDA 2X8AA 1N6NA 1I2DA 4X8HA 5ANRB 2Z4RA 2BDTA 4Q48A 4BE7B 5J4KA 1NI3A 5EXPA 2WMOB 1J2JA 4AYXA 1GL6A 2J0SA 4TT3D 3R9XA 4MYTA 5L3VA 4IFEA 1F2UB 4O3MA 5FTMA 5CDFA 4A6XA 1F6BA 2A5YB 4D6PA 4PZYA 1CF4A 2J7KA 3GEIA 1XJCA 1S2MA 2WWIA 5C46F 2ZUCA 3KL4A 5EQTA 2A3RA 2QM7A 1D2MA 2CHQA 4ESHA 2REBA 2QN6A 2ZETA 1NJGA 2JLQA 4FMBB 4PSVA 4M4SA 5K8TA 3LNCA 4IDOA 1TQDA 3KKNA 2C78A 2ZRCA 3OEEA 1GRQA 2QPOA 4E09A 3I5YA 3LW8A 1HT2E 3ADKA 1NN3A 3WHKA 1EFCA 3AVOA 4UXHA 4RD2A 3QKUA 2JA1A 4DC9A 3L8ZA 3I1FA 2BMEA 4G3XA 2CL7X 4G5OA 1E2GA 4CDGA 1HE1C 4MDFA 4GZMA 4DZZA 3RRNA 2KB0A 2QQ0A 4Q7LA 2ZRMA 5IK2A 2AN9A 1TQ2A 1K6MA 2BM0A 3MAAC 2W0MA 3LA6A 4PC2A 3TQFA 2D4HA 5J4VA 4D0NA 1SVKA 2I1VB 3DKPA 1NVUQ 4PSKA 4BWYA 3ECCA 1IQPA 5FPKA 3W3AA 2F1RA 2ZI4A 4QBFA 1QHNA 3LW7A 1S9HA 2HT1A 2RH5A 3P32A 4DVGA 4EKDA 3T1TA 1LFDB 4IOMA 4M9ZA 2A5FA 4NCKA 4M9QA 1E2IA 1FNNA 4ZKEA 4FCVA 3NDPA 3RVBA 1T3SA 3SC3A 4D81A 4M21A 1RFLA 2FEMA 3MJRA 5L3SA 5KO2A 2IYVA 4RZ2A 3MFYA 4TMVA 1JAIA 3LO5A 3SFZA 3WY9A 5DH9A 3TGPA 4A92A 1PZNA 2YV5A 3T5DA 1FW6A 3EPLA 3KKOA 3SOPA 3U3RA 1D2NA 1XNJA 4TN1A 3PG5A 1YVDA 1MO5A 5JECA 2P5TB 1E2NA 4E22A 4LOAA 1PVOA 4K8OA 4AYTA 3IILA 4HB4A 1EX7A 2QP3A 3TUIC 4YMTA 2EFDB 2V6JA 4MITA 2G9NA 1HE8B 2OCYC 4M1SA 2DPXA 5FBRB 1U0HC 3RDPA 2JLVA 4G5GA 2ANBA 4NHOA 2C96A 4FCTA 2DFTA 1U9IA 1CKEA 3T06B 1A82A 1Q44A 3QXJA 3SBEA 3GLIE 2D7CA 1K5DA 1E94E 2OXCA 2G6BA 4M1OA 1SXJC 3FDIA 3JVUA 4Q4JB 2QNRA 4JLJA 1XMVA 2DB3A 4QFMA 3SYNA 1J8MF 4B2IA 1KSJA 3QXCA 1LF5A 1Z06A 1O3YA 2REXB 4L4UA 2CXXA 2ZYWX 3LQQA 5KPDA 1E3MA 5E7MA 3KKQA 4M9XA 2C9YA 1OXXK 2V8OA 1J70A 2JASA 1IHUA 3WNDA 1Q22A 1TU3A 3KFXA 3NC1C 3Q5DA 4LV6A 2JJ2D 3GLHA 4FMDF 4XOIA 3VHLB 2R8RA 1HH4A 3AF3A 1ZD8A 2NO9A 2LCFA 2WOOA 3HU1A 1PUJA 2VPPA 5E7IA 2RGXA 4IVRA 4PC3A 1KJWA 3ZGXA 3ZD6A 5JZVA 1SZPA 5HZKA 1IXSB 2EWWA 2CHGA 3AVYA 3Q7PA 4Z8XA 3FGNA 2IXGA 1SHZA 2JLRA 3P4YA 4TTPA 2C77A 1LS1A 1JALA 2FWRA 4QM6A 4B3CA 4BUJA 2OM2A 2WJJA 2ZE5A 2FSHA 3U3OA 1M8PA 2B92A 3E1SA 1T6NA 1XD2A 4JBXA 2XNDA 1OSNA 4GI7A 4DT1A 1NVVR 4X8OA 5DIFA 1KI6B 4N1AA 1GIAA 3FE2A 2FGKA 3QKRB 4NTZA 3I61A 1S1CA 1GOTA 3I8SA 4BZQA 1UKVY 1SULA 3X2SA 3NBYC 4V0OA 4PZLA 5DHAA 1ZIOA 4DIEA 5FPYA 5BYJA 3W6NA 3THYB 4JLOA 1OLOA 5EZ6B 521PA 3BB1A 3W90A 3NBXX 3IBGA 4ACAA 3CKLA 2JIZD 4B3XA 4C9BA 4C0BA 4PQFA 4U7DA 3NDBB 3LFUA 3D3QA 2P0EA 3CPJB 4P4TA 3K0EA 2VIIA 2QRNA 3BB3A 5A0FA 3I32A 4OK5A 3RC8A 4A2PA 3O8RA 5E3HA 3U7EB 1WQ1R 2XTNA 3W3ZB 4NYMQ 2WM9B 4WXPA 4NYJR 1G17A 4UJ5A 3MWLA 3UWOA 4BLOA 1HYQA 3QG5A 3HJNA 1XEFA 2AWOA 4L16A 4C2UA 1W4RA 1NBMA 3GJ0A 1SVSA 4HDCA 3IGFA 3DM5A 2OUKA 2IF0A 1E9CA 1UBEA 5JJKA 1KGDA 1H8EA 2GDJA 4P0TA 2A5JA 2PLFA 4BRUA 3SQWA 2E1RA 2IT1A 5CLQA 3IUYA 4A0RA 5B30A 2QQEA 3CPEA 3OIVA 4MGZR 4M0LA 4G5SA 4JL8A 3CX6A 1RZ3A 4LHZA 4JKYA 3MSXA 4Q4JA 2ZIAA 4QGHA 3OE7D 4KFRA 2GA8A 4FIDA 3QPWA 4L9WA 2RGNA 4KVGA 5G53C 3RS7A 2IYWA 4Q4HB 3KTAA 3B9QA 5DNYB 4P4UA 1OYYA 2W6ID 1KZGB 1W4AA 4I1UA 3HU3A 2XAUA 3PUXA 3I5XA 2JLWA 2YYZA 4F92B 2RB4A 2F43B 3BD9A 4NPHA 4PFSA 1US8A 4V0LA 1KMHA 2D3WA 4HZIA 2ZS8A 1U94A 3X1XA 3PJRA 1I4LD 1WF3A 2Q3HA 2IS4A 2PEZA 2WAXA 1CS4C 2BBTA 2HJVA 2HF9A 1Y63A 5HCNA 4ZPXA 1ZNZA 2JDIA 4UNQA 4TTQA 1XCMA 4V03A 2B8WA 1NSTA 1IN8A 3LVRE 4NCHA 4B6EA 1QVRA 2R6AA 3T1QA 3OEED 4GZLA 2F55A 3OEHD 2Q0HA 4HATA 5AUQA 3A1UA 4A0FA 4IOLA 3GLFB 2R44A 5CM9C 1NJFA 2WSSD 4TLDA 2J0UA 2FA9A 4W5WA 3NBZC 2QU8A 1U8YA 2YOFA 3K0FB 4JLVA 1U81A 2IYQA 2PT5A 1M7HA 3J81k 1GM5A 5DI3B 4OHWA 1HEIA 1DAGA 3EG5A 3RABA 5JSZA 3OIYA 2GJSA 5FOWA 3QKRA 4A1FA 2IBMA 4C0JA 3SEAA 3ASZA 4HYYA 4IKEA 4YXWA 4F93B 5JWOA 1NNEA 2ZRJA 3KUDA 2YVUA 1XD2B 1F60A 1QRAA 1T5IA 1G41A 1FMLA 4KXFB 4JYCA 2JJ1D 1GRRA 5DISB 4AIIA 4BZXA 3QY0A
chains in the Genus database with same CATH superfamily
2H3EA 2WKRA 5TS2A 1CJBA 4H0CA 4M0PA 3WGMA 1VPTA 2Q2QA 1KAEA 1RNLA 3DNFA 4KO3S 3T3MB 3W6ZA 1TYDE 1L5OA 3K6KA 3DZBA 1D1SA 4I55A 1GPDG 5AICA 2AR7A 3ZDQA 4Z54A 5ADHA 4DZTA 4QOHA 1QIHA 1FIUA 5HMLA 2H1RA 2FCRA 1D5WA 2PTGA 2X0FA 2JIRA 4A8HA 3OAAA 3EA0A 3GZNA 5E6UB 4FFPA 3V7FA 5KYYA 1NURA 2AXNA 4I6EA 4JJ7A 4B3HA 1KS2A 5EJMA 3DEIA 3ESZA 2LGJA 4XLTA 5DVZA 3KQTA 2AA3A 2Q8NA 1C41A 4EI9A 3D6HA 2QA5A 1EG2A 2R8EA 2SCUB 5EXEA 2P2CA 2WMYA 1ZY2A 4I81A 4N8DA 4GP6A 4F06A 2PQ0A 1IWOA 1TK3A 2DSNA 2RBEA 4I4NA 2QJOA 4FKBA 1TEVA 4XPIB 5IASA 1FMTA 1WHTA 4FKZA 3WMGA 4JELA 5LVAA 4KPFC 2GZRA 2Y0PA 2QT1A 3VV3A 2RHRA 5J5CA 1RLMA 4LTMA 3X3HA 3HUFA 1R9NA 5FH9A 1KWKA 2NN3C 1PJSA 1YD7A 2M1ZA 4UFNA 3RK1A 3OZBA 4DT1B 2H52A 3AI7A 4H9GA 4DDHA 5L45A 3EBOA 4KFUA 1QIFA 1X7DA 2NSYA 3PR2B 3BJMA 3I52A 1E2MA 3G9QA 3U1BA 1EX1A 2O2YA 2XNSA 3PC8A 3RRZA 1RABA 2A78A 2J5BA 3MD9A 2O8EB 4CF4A 4DC0A 1SGWA 3TX2A 1XYVA 4LZJA 1XTRA 1Z8FA 4CU2A 5EJEA 1Y9JA 1ZBQA 5JPDA 1MLDA 2W70A 2AG0A 3IXQA 3PV0A 2PUJA 4ND5A 3PNSA 3LL7A 1ZJZA 3G17A 3IODA 4J0CA 2ZTHA 2RAPA 3QI7A 5K0CA 3V9PA 2FSUA 4L75A 1F2TB 4RKWA 1D07A 3U40A 3A4TA 1Y34E 1CJVC 5DU2A 3K70B 1JJIA 3WAKA 4DQDA 4D8TA 2YICA 3F3SA 1EUQA 2ZFUA 3IIJA 1XTUA 3AR2A 4MUNA 1S3GA 3IOBA 4TUYB 1CJSA 3QYAA 2VTVA 1TI7A 4ZOBA 1QB7A 2DPMA 4BKQA 4HAOA 2F4VB 3CSDA 5KCMA 1E2LA 1FMCA 2PWAA 1MB9A 3HLYA 1CR2A 4HDMB 4L8LA 3CW9A 2NMVA 4PONA 2DLCX 1Z6TA 2GK6A 2ZZMA 4MQBA 4QVKA 4URHA 1BFDA 5F1OA 3WJ7A 1BD4A 1I0ZA 1SCKA 1U7TA 2QLFA 3C3JA 3OPXA 1RBZA 1R16A 1QDLB 1SD5A 2H65A 3A26A 1GAJA 3CX3A 1AQUA 2NXNA 3FZGA 1R7RA 3M6FA 1VOTA 4IILA 5JAMA 3ZWWA 1MHTA 1XMPA 4WUTA 2CVPA 3U5ZB 3ZV3A 1X94A 4AO8A 1EB9A 3ANTA 3IJ5A 2B20A 2PM8A 3OURA 4K46A 2YY7A 1AXGA 2XOKD 1SR8A 3PD0A 3DBOB 1IN4A 1EA5A 2HN9A 1RHRA 1QVWA 1OZFA 2DFKB 4NIMA 4BC0A 5IKPA 3D0KA 1Y37A 3AKEA 4AS1A 1DTWB 5AJVB 1PP4A 1SKUA 4LG1A 1B1AA 2Q3CA 4INAA 3ZWBA 4DIUA 1DXOA 1LK5A 4Q00A 4EG1A 3VZPA 2EXXA 3KPWA 4JNCA 4AG6A 4ADSG 1A88A 1BW9A 2IFTA 3LOPA 1N1MA 1CZHA 2GSDA 5DHSA 2M98A 4G67A 4MV5A 4NZOA 5ICCA 1SZDA 3KOUA 5E7QA 3VKGA 4JK3A 1YZLA 1PX0A 2HSJA 4WTOA 2XGJA 2CXRA 1U7DA 3SZGA 1TZJA 2WJGA 1RXVA 3WRWA 1W1IA 1Q50A 5THQA 5ELMA 3DAHA 4YJKA 4BNJA 1B00A 1Q3KA 1GEEA 4G1UC 4OHZA 1WSWA 1Z4KA 3M6UA 3IR7A 2C9CA 1F0YA 1TOAA 2OCIA 1IOWA 3N7AA 4JLWA 4QHSA 5IUNC 3EGXB 3ZE1B 2RI1A 4D98A 1SKYB 5LA6B 1PV1A 8ATCA 1RR6A 3SM9A 4ZDKA 1USWA 3H5OA 1DMRA 4CLEA 4OYLA 1NQXA 3BQMB 3NWPA 3P20A 4A6EA 4CMHA 1VHLA 2EWMA 1YR3A 1AS3A 4WXEA 1CUSA 2JFYA 4PXAA 1A95A 2I3AA 4ZAFA 3GJ7A 3FNQA 5SZIA 1OFUA 4NDNE 4DLUA 4IDAA 1AHPA 1XWWA 5BT9A 3OWOA 1MVOA 2P4SA 3D8RA 3HWSA 2HA2A 4ZO7A 2PBRA 1C50A 4EVRA 4WUVA 4Y30A 5KOIA 3HCCA 1CUWA 1Z33A 3BF7A 2ZBDA 1IXKA 4FS8A 1OXBB 2WJWA 3HPRA 4G0VA 3CNEA 1E7MA 4WJZA 1CZOA 2A30A 2H18A 2I29A 1E6WA 1OWNA 2WD9A 4TKUA 3SMVA 2CJWB 3M5WA 2H9YA 3JQPA 5KYUB 1BXGA 2XGOA 4ICIA 1B0ZA 2QN7A 3A70A 3UW1A 4O8ZA 3W34A 2GBCA 2XTMA 3WHPA 3PC2A 1GL9B 1TRHA 1SUFA 2EEPA 2GT1A 4QTZA 1MAUA 1VB3A 3I64A 2PLRA 1EFLA 2PYDA 2IOFK 3M3HA 1JPJA 1JIUA 3DDUA 4QJ5A 4YC7A 2BVNA 5BMOA 1XRQA 1T3HA 5ADWA 2WM2A 1OIXA 1GR0A 3H7AA 3GP5A 3PQ6A 5LU9A 4JVSB 5ALTA 1DEKA 1KAMA 2QL7A 2ERYA 2C3YA 4K81B 4PYKA 5JNRA 2GJ8A 1FDIA 1HDCA 3L6DA 4WGGA 3DLBA 1WQ4A 3THXA 2A94A 4DEXA 2FN4A 5CA1B 5DN6A 1I5RA 1YNSA 4M8KA 5HKKD 4RHCA 3C39A 4XR9A 3TM5A 4KYIB 4UEQA 5GJVC 3UUGA 4BMYA 1W88A 3K0AA 4R5HA 1NKSA 3JQ7A 1TA9A 3SDSA 2V4ZA 2DERA 1MP0A 2JB9A 2CL0X 4KDRA 4MDYA 3WA6A 3WYNA 4LF4B 5JXIA 3ELYA 1U0BB 3D8UA 3AL2A 3HABA 5FOTA 5BUZA 2F3RA 2O8FA 2EJVA 4IX9A 3G0GA 4GM4A 2ES4A 4M8LA 1G2IA 4FHGA 4X20A 2M6KA 2V7PA 5KUTA 1TK2A 2AVNA 2D2VA 1W94A 3BL8A 3BK7A 1JYEA 3GEPA 3HVUA 4PZZA 3PUWA 4QQNA 4CQLA 4H77A 4ZVMA 3QQ5A 4UHKA 5EUBA 3NHLA 1SUSA 4UNRA 5B2EA 1U3GA 2OAEA 3X2EA 5ICFA 2AJBA 2VHCA 1G2QA 2WNSA 4JGIA 2QD1A 3P5SA 5I5GA 5ULLA 2PX4A 2F48A 3ZE2B 5J43A 2ZVDA 1YDWA 3HKEA 4YGYA 1L4UA 1Z6PA 3SN6A 1SWVA 3BDAA 4A27A 5JVDF 1ZVVA 3FMOB 5DK4A 4OA5A 2J3KA 3FI9A 4C6TB 3O03A 2WAYA 1QQTA 3FMFA 4V1CA 1U5BA 4URFA 2QYOA 3MMZA 4BO4A 4I6JA 3SIPA 3O9MA 4BYGA 1ZEMA 4YRIA 3ROQA 1PWEA 2I2DA 2W0SA 3KR9A 2P90A 1JG4A 1Z5WA 3FMVA 4PLCA 3EH1A 5GGXA 1ORDA 2A6PA 3VU3A 1UP6A 3PI7A 4PBRA 4GOOD 3C70A 4ESEA 1XRSB 3GVHA 2QTTA 1UPAA 1OZ0A 4H1WA 3R7DA 2F9LA 2RARA 3K73O 1DDGA 3CW8X 1T1RA 1UBUS 3VR4A 2G04A 3O4HA 4KLZA 3BULA 4LHVA 3LMKA 1COWA 4URWR 4RA6B 1L8XA 1W5EA 2FQWA 5JS6A 2LNDA 1H42A 1TZMA 5DXAA 5H81A 1ECFA 1UMCA 2V7BA 4ME6A 4MS3B 4RVHA 3VR3D 1WMFA 3VYRB 1NVDA 3PCRB 3IMKA 3GRFA 3GJ6A 3A4YA 3PDJA 2VI5A 1FFXA 5K0SA 1Z6ZA 1OKKD 4N03A 1IUNA 2OHVA 2ZRLA 1H2FA 2B34A 1OGYA 2QAJA 3I2HA 4X20B 5DSZA 5FFFA 1XMJA 5FOSA 1OJ7A 3TZCA 3VPAA 4BE4A 3U1TA 4MRSA 2EKLA 3IA2A 1CQJA 5C8YA 3WSTA 3D6UA 5HDBB 3D2BA 5KJ6A 2BKAA 4V24A 3T3NA 4D25A 4L28A 1HE3A 3CBQA 2F62A 1YC2A 4RAQA 3Q8XB 1GQRA 2QRGA 1GCGA 4MUGA 5ERGB 4AWAA 2D2EA 2QVCA 1E4EA 1G3MA 3A3NA 3FNIA 3ZE8A 2QNIA 5A5DA 4RULA 1TYCA 2C94A 1SBYA 3KB6A 3V4ZA 4OI0A 4WK6A 1P3JA 1C0PA 3H84A 3KQMA 4PHFA 3D6NB 3L6OO 4KO2S 3LUGA 1VGVA 2IA5A 3KKMA 3FWZA 3S5UA 4EDFA 3S2IA 1M2VA 1Q0TA 3OT4A 4GYYA 1HZZA 2NOAA 3DOFA 3QBVA 5J2TF 2Y6VA 1HC7A 1RRVA 4MKZA 5IVHA 4QWMA 3BN3A 3N58A 4A2WA 2KW5A 2AX4A 2H2WA 2XMBA 3MTGA 4JHLA 4G65A 5AWFC 4I36A 1GO2A 1HLPA 2Q4TA 1NC3A 2B1IA 2GMWA 4L4YA 4ON9A 4QT4A 4IDNA 3C74A 2Q6VA 4TYWA 2EBHX 1MTOA 2WSYB 1VLVA 4O4LA 1U2QA 2ONZA 2NG1A 1CQIA 2EFEB 2PS9A 3PQ8A 4LBVA 5BYAA 1Q6YA 1CX9B 3HDGA 1LW7A 3KJFA 3IAFA 5LNK1 2PMBA 4D97A 2RI6A 3NJ4A 4U00A 1PVVA 1KZYC 5KWEA 1LNQA 4LSWA 4YRCA 2R25B 3KZNA 1UBCA 4OXKA 1ZC3A 2H7YA 3U60B 3BORA 4CQMD 4XIFA 1AUOA 1TMOA 1O97D 1U2TA 2YIVX 2JFUA 4C4OA 2OP1A 2O2HA 5A6SA 2RSLA 2XEXA 3FUTA 4FBMA 4TMTA 5BT8A 2ZUBA 2CDAA 2CV2A 2OPBA 3NKFA 4DSZA 3IVGA 4PLPA 2KHZA 2B8JA 3EA4A 2OLJA 4D1YA 1KK0A 1L7VC 1LLFA 3VJLA 4EI2A 2J6BA 2CEAA 3NT2A 1AM4D 1G8KA 4BMXA 3NYWA 1ZAYA 1M1ZA 3HTXA 1GU1A 3SE7A 4JHXA 4DM4A 5J59A 3GY0A 3UJ9A 2IY8A 3VKWA 1T5LA 3EVDA 5LQRA 1OTHA 1ZM9A 4KXVA 2BR5A 1C1DB 4CKZA 3FZQA 3A3PA 1ZGBA 3LK7A 4WADA 5IXSA 1KMHB 2OV3A 1IRXA 2A1UB 3QIAA 4JDPA 3O2SB 2XUAA 1JB1A 4ISCA 4E5VA 3ZV5A 2NXJA 1C0LA 3EVAA 3PXUA 4YROA 4C6TA 3KJEA 5CLHA 4JR0A 1AKYA 1FUIA 1TLFA 1YDEA 3GGGA 3IV6A 4JKIA 5A5FA 2QTWB 2WKWA 1JLHA 1LNZA 1EP9A 2H1SA 2P1ZA 3AH8A 3LBHA 1F1BA 4H7HA 4LXUA 3EVBA 5JI2E 2F9MA 2CJXA 3R09A 1C4KA 3RS0A 3S28A 3ABZA 3T6KA 2WWXA 1OB2A 4E1VA 2QRHA 2WLTA 3DNPA 3KKEA 5CURA 3ZD7A 3AUUA 4QGGA 3EZ6A 1F3LA 2NYUA 5EL0A 1ZVQA 2PUEA 4ZFNA 3IVMA 2OVBA 4RMJA 5G0UA 4ZIRA 4QFDA 5I8WA 4PZEA 4LC0A 3JQBA 3TR0A 4CIDA 4D4KA 1S96A 3ZI7A 1CNMA 1RYZA 2C1XA 2GKSA 3WQSB 7ADHA 1GLGA 5IM5A 1JT2A 1BQEA 1G59A 4YACA 3AHGA 4MO9A 4UTOA 4XGKA 2DT5A 5H4HA 3SNKA 3AEQB 1JG6A 3UAXA 4ZP1A 3B52X 3BCUA 1XKLA 2V7QD 3CH5A 4ZT7A 1C4OA 4ZZ0A 1DRJA 3FSEA 1ELOA 2X19A 3PC7A 3UHPA 3AINA 2HSDA 4Q37A 4EM6A 2DGDA 3EPHA 3K9LA 2N46A 3MJSA 2Q2VA 3ANLA 3DMFA 5E1OA 4J0DA 1V11B 2XUDA 4IXDA 5BN3A 2OEPA 4A15A 3CVJA 3GH1A 3NVDA 1HQCA 2GF2A 5D1HA 2WF5A 4PY2A 2Z6QA 4WFQA 1PI3A 4ZHQA 1JEDA 3H99A 3OX3A 4WASA 2KBEA 3UT6A 5AVYA 2HCFA 3T1HB 3CR8A 3JQFA 1VP3A 2Z2ZA 1KORA 4JROA 3H5TA 5FWXA 2PSDA 3LFTA 4U8HA 4GXRA 4UM9D 5K01A 1VLZA 2PV7A 4J0QA 4X1OA 1UJ6A 3RWOA 2ZQYA 3V1NA 4LXGA 4DLZA 2H4FA 5ALPA 2I5PO 1GQ2A 2C5SA 3MGAA 3UIEA 3PPXA 5K6TA 4BOYA 1S1MA 1F7VA 3TJZA 5I9LA 2HOQA 2Q5FA 1I51A 2GARA 4N47A 1KTIA 4DJEC 3K32A 5AXAA 1U8FO 5C8DA 3ZV6A 3FNEA 5B1IA 1RM4A 5FJJA 1DLJA 2V55B 2FAXA 2I78A 2FG5A 2FPIB 3C87A 4JGGA 4HVAA 4DIBA 3VNBA 2C5BA 4C01A 4OGFA 2GWRA 4BLWA 2Y77A 3WYBA 2BRUC 5DCLA 3FPAA 1YB5A 4DR4B 2P75A 2PD4A 2WY2D 2XJ9A 3AUTA 1U7PA 2Y1EA 2V8BA 5AT1A 1W85B 4G9BA 3WKDA 4BO5A 3D8TA 1RKUA 3HJCA 3QJYA 5IT5A 4KRYA 9LDTA 4JZKA 4TL9A 4HDSA 2O07A 1U2DC 2DCUA 4CR6A 3IP1A 3AFOA 4B79A 2PZ8A 5JEEA 3FLAA 4R4JA 4MKIA 4G2TA 1NXXA 3B85A 2YCLA 3FVTA 1YRBA 4I50B 2GPBA 3NVAA 5DWQA 1VE7A 3TCKA 2OCKA 4P54A 1N6RA 3GMSA 1KR2A 1Y8CA 4OSEA 2FX5A 2Z6VA 4DNXA 2Z5FA 1CIJA 2GKOA 2X1HA 4PINA 3ORYA 5F7JA 4HQLA 5IZCA 2XVYA 4D9HA 1ML4A 1YONA 2CXHA 4BO6A 1HORA 4JP5A 3V4RA 3E7DA 2FP3A 2VZ0A 3OZVA 1IJKA 3ADDA 3ZH2A 1N9ZA 2WWYA 3R0XA 1DG3A 2JFVA 4C0LA 2TYSB 3ZIUA 2QRUA 3E0XA 2AK3A 3LUPA 4J0JA 3A25A 1Q0RA 3O4IA 1RLTA 4F3TA 2W43A 1Y8QA 5D5QA 2ASEA 4QFBA 3TTWA 3SIWA 4J4HA 2RC5A 2QTBA 2PIAA 4DJTA 4EPRA 3ZW9A 1PNRA 5HM6A 5EHQA 2P68A 1C4XA 2Z3VA 4GPZA 4DWVA 3IEMA 2PL9A 3RROA 3DC2A 5I9BA 5F9FA 3HVJA 1U5AA 4HWPA 3P52A 4AUNA 3DMYA 1V16A 4ILKA 4AN0A 4F4FA 3MCUA 5ERXA 3C45A 2ONKA 4O4IA 3ER8A 3IUQA 1HYBA 3L9XA 3IT1A 4EA7A 1G5HA 4NF2A 1I2BA 1P31A 5F5LA 4EDHA 3GT3A 5H0IA 4K2HA 1WY5A 5C52B 4AY6A 2H8GA 2R6ZA 4EY5A 4HDRA 1VG9B 5LSAA 2XGSA 5C31A 3IBSA 4WD3A 1WP9A 4FWBA 5CA0F 1NKTA 4UD2A 4KE9A 3KS9A 4TS9A 5MF6A 2NQ2C 3KOYA 4IIXA 4DA0A 2XXJA 5EPEA 5IAJA 3PDIA 2BM8A 2XNDD 4ZDWA 3FSRA 3FKSD 2ZIUB 4LHSA 3T7CA 1KYZA 1Z3CA 4J3FA 4TWZA 2AXQA 2BFMA 2X0IA 2P3OA 1ZYUA 4B71A 1NC1A 1O8BA 5CH3A 4RTPA 5A3RA 1EG7A 2R2GA 2VYQA 1YOBA 1MNQA 1V11A 2WC1A 3AOGA 3DPSA 3OZWA 3CH7A 4H1UA 3IAHA 3SJCA 1WZ2A 1GA4A 4RD3A 4DDMA 5B36A 3M70A 5JMTA 1UPBA 1V9CA 4NZPA 1U1FA 1QJ4A 1I13A 1U3CA 1XJWA 2HK8A 2V9PA 1DG1G 3IT2A 3OKPA 3PFCA 5SY9A 2VRCD 3T7DA 3A6ZA 2VNKA 2H06A 2BPOA 4ND6A 1KIFA 3JPYA 4OI1A 1ZN9A 4N5MA 3ZY6A 5JROA 4JVNA 1JRLA 3OC6A 1XTSA 5DOVA 4YFYA 1P2SA 2JAPA 1KKMA 3OTQA 4HMPA 2ZJYA 2HC9A 3WK6A 1YMUA 2Q8QA 1SKYE 1CDOA 3NEJA 3Q40A 4XD7D 5IC4A 1PT8A 1H1TA 1TQHA 1OLSA 2OKGA 1DKNA 1VLLA 3BK1A 1GG8A 4K9KA 4II2A 5EWJA 3UVEA 3QLVA 1XB2A 1AD2A 1TDJA 2DFVA 2ECOA 1GGFA 2C42A 4FMCB 1T1EA 2ZSKA 1OFTA 1DRUA 2OENG 3ZH9B 2J9RA 4JYBA 3CLUD 4HG2A 5CNMA 2C7RA 2XMCA 3ZE7A 5AW8A 1WE2A 1T4GA 4MI3A 1FZQA 1IN5A 1H8ED 2Q41A 1BD3A 4HNAA 5KYKA 1Y1TA 5COQA 1N6IA 1UM8A 3BQNB 1R0SA 1SXIA 3LDAA 2VDLB 4EGQA 3A0UA 4HQRA 2NUAA 5CEEA 2FQ1A 1W7AA 4JLBA 4PGFA 2J30A 5J5AA 2BTQA 4G9GA 3R5HA 1W4BA 2Q4OA 4JJ6A 4BASA 1P5ZB 1SVLA 4KGDA 4RPJA 5JYBA 2HU2A 1ILEA 2EHDA 4P4TA 2JHCA 1E3EA 5EY5B 5JCXA 1SQSA 3D2CA 2RGAA 1VZ2A 2O23A 2PXXA 2D1TA 3RRFA 1NG9A 3R3VA 2FTKE 3UJ8A 1U3UA 3ILSA 3ZTTA 3X0DA 2CJYA 2EKBA 2FSFA 4IJKA 3QXGA 3EOAI 1CJKC 2RBKA 4C89A 2XBUA 3U7HB 1FMFA 2IEYA 4YV0A 4ZV4A 3IQGX 1E18A 2H8KA 3NGMA 5C81A 4B3GA 2IHTA 2V0GA 2P3QA 2LIPA 1IIBA 2ZBRA 3LUHA 3IYLW 4B6JA 4KW7A 3U19A 1W9MA 3ILXA 3F78A 2ZTMA 2VPXA 5JDIC 4JFRA 1DI0A 4MUFA 1UBHS 3B2EA 3NCTA 4RDIA 2VJMA 1RJGA 4OAQA 1BHJA 3TPCA 1XCLA 4GP9A 5LZ9A 3VTZA 3ANSA 2FE1A 3AR6A 1WHTB 2YQ5A 1U2SA 4RF5A 2I62A 2OILA 4RGYA 3AR8A 1SIBE 1H23A 1CUZA 1RHUA 4UBJA 3R7WB 4RSHA 4W9MC 1WB4A 3CVXA 5AFSA 3ZDZB 4CM5A 4R2XA 4XWOA 5BY2A 1Y4DE 4Y2GA 3BD8A 1X1DA 3QVVA 1XV5A 1TTHA 5E1BA 3A6EA 4QHTA 5C3MA 2YFHA 1IPFA 5ALFA 3CVYA 4NCAA 3Q3VA 4I9UA 3WZ2A 2C4MA 3FDZA 4I0WB 4DKXA 1M34E 2NW6A 3L5OA 4L15A 3H5IA 2AI1A 1E0AA 1ADGA 3RJ5A 4Z1OA 3SQXA 3DFKA 3LC1O 5IHPA 3DTYA 4WCFC 5CB8A 4BBZA 3VR5D 3PDIB 1P4RA 1RQLA 1UIMA 3AUXA 3HJHA 2O0KA 3HRIA 3OFNA 4Z0NA 2DUJA 2J59A 2OHJA 4JOCA 3PC4A 3IUNA 3EWAA 4K1LA 4QUEA 2FMXA 1F0PA 5L4NA 2EG9A 2XEDA 2O59A 2ZI7A 2VSOA 1QTRA 3PUHA 3NIWA 3AZPA 3Q10A 5ETJA 1D1TA 1KK3A 1CUUA 1ZJ5A 2H1CA 4JBHA 1EGHA 1OVMA 5G3YA 1N3IA 3GNQA 5LM3A 2RKWA 1R0WA 2XKAA 1BHQ1 1AGNA 2FMIA 4MS4B 3TQOA 1XYGA 1PX2A 4DLYA 3DTVA 1J8YF 1HWYA 5LB4A 3ZE0B 4OGWA 3OOJA 2IDMA 3L0PA 3AP3A 3EFHA 4F4CA 1CUFA 1HFWA 3JQQA 1L5MA 5I7VA 4D0LB 2XB2A 5KYYB 2O3RA 1J9GA 3DB2A 4PAGA 4KJZA 5AVWA 3JPWA 4I1YA 4EYEA 1MC5A 4BNDB 4EGFA 4UFPA 2Y3IA 3K1TA 3BT7A 1NXPA 1UEIA 1JGTA 1NXOA 1Q83A 5AMXA 2XMQA 3U4GA 3V2GA 1DC5A 3HZOA 1UK9A 4LJRA 4UM9B 2Z30A 2NO0A 4TWAA 1OREA 1ADJA 2DUNA 3KVRA 3WKBA 3UJNA 3AB7A 3KZCA 2GXSA 4N0QA 4WCDA 3ICPA 4XWTA 1YCGA 1YS9A 3H8SA 3L0IB 3FBWA 4YI5A 5K2MA 4D8YA 4YRMA 2Q7DA 4L5IA 4NLLA 3AJDA 3TL3A 4Z8YA 2BIFA 3FY4A 4V1CB 4R7TA 5ALWA 1DJNA 2C84A 3DOEA 3E9NA 4S0XA 3R5KA 4FQ8A 1USVA 1OOEA 4R1MA 1RE0A 2E37A 1EVZA 1ZNWA 4Q1FA 2RBGA 1O03A 4Y8VA 3RVKA 2C7GA 2H4HA 2IIVA 3I09A 5F5NA 4DTCA 4YRSA 5KTPA 1G3RA 4AU1A 4W5NA 4IZOA 3TTXA 4DSAA 1QG4A 4EG4A 3RYIB 3C15C 2PVSA 3ICOA 2C0QA 4TLLB 5G0SA 4GLJA 1DKUA 2XZLA 4F12A 3NTRA 4E4TA 1XRNA 3EQ6A 4YT4A 3DDWA 2GESA 2R1TA 4C7OB 1LTQA 3SEQA 2CLKB 1A9SA 1BMDA 1Z6YA 2JHFA 1VHQA 2RHBA 3GWZA 3KSDO 1VKJA 4ERXA 2IYEA 1A9YA 1D7OA 1XALA 4JJIA 2ZSEA 1E1CA 1REQA 4XDZA 4F45A 4ETWA 3WTCA 1J33A 1EX9A 3EXAA 3OICA 1B76A 2Q3MA 3AY6A 4UNIA 4CKCA 4TTSA 1MFPA 1QHIA 3CUSA 2O2IA 3Q1KA 3T52A 4DLPA 2G06A 5JYCA 3Q3JB 1SBCA 3PYXA 1Y33E 5I7HA 5I7FA 2YW2A 4PSDA 4PRZA 5E9AA 4PLGA 4HNUA 2CW5A 1MW9X 5JATA 4FFSA 4UTVA 1T9KA 1Z83A 2VP4A 3WTBA 3V8QA 4BV3A 3JYNA 2I7XA 2WVAA 3UMRA 3BH6A 1RC8A 1YHZA 4GZ6A 2I8CA 1I0IA 3D4LA 4GMFA 2R8BA 3OFSA 4Z49A 4DV1B 4PGHA 2B78A 5UKDA 2NXEA 2JFNA 3PGXA 4HI0E 4HNVA 5B55A 3TRJA 3V3KA 4I1OA 2DQ4A 3LX8A 4EJ2A 1GDHA 4LYAA 3IPYA 3VPHA 1EFDN 4G8JA 4CGYA 3FPLA 1ZIXA 1LBIA 2WW8A 4P80A 1GD1O 1K9SA 2OBBA 1QH8B 3EUEA 4KPUA 2QYTA 3WYDA 4UTPA 1PG0A 2ECQA 4MJ3A 2B4QA 2JGLA 4ZHSA 4IIVA 1NDHA 4X93A 3UC9A 3GLHB 2CDRA 4EA8A 5KSYA 1JXOA 2QV0A 4CKWB 3RJMA 4DCTA 3A6HA 2Y67A 2BSAA 3AFMA 1IQ0A 4BZZA 3RUPA 5FUQA 1Z0DA 5F9MA 1GNSA 1T8UA 1FMJA 4GBJA 5DKFA 2PGJA 3UHFA 1D3AA 1DOAA 3GUVA 4EG3A 3LGXA 1M2JA 1W9HA 5DX1A 2ZP1A 4N3NA 3CNHA 1L7EA 3G59A 3ZU5A 1X1TA 4UE2A 1IH8A 1NKVA 3FF4A 4F3YA 1OZHA 3IUSA 3OKAA 1LLCA 4I4TA 3R3HA 1EYZA 2BKUA 2WU4A 5G0VA 3K9QO 5JBQA 2A1TR 3ZWKA 2J5RA 3L7AA 4RCVA 1TT5A 1X7ZA 1YRWA 1FU4A 2VDJA 3ORFA 5DRTA 5KSPA 3WXBA 4HB0A 3SX2A 4KYTA 3TLBA 2ODPA 1E9EA 1WSDA 5BSGA 1NMQA 3PJFA 5L8VA 1NRXA 2I2CA 4L72A 2CLDX 2Y2UA 4K9LA 4C06A 2ILVA 3E5NA 5LDHA 5CYOA 2QRZA 4JEMA 2W71A 2F1IA 4JJ8A 4AUKA 2JKZA 3NHSA 4QXQA 3SXJA 1IY2A 3QSYA 3RBAA 1C80A 2RE8A 1V48A 1GUFA 4BFUA 3DAFA 1JG2A 2WPNA 4R2HA 1SA0B 2HV9A 3I2IA 2F4NA 1HQDA 4IDQA 1CVLA 2JD2A 8AT1A 1P2VA 2QX8A 4MEAA 4Z9XA 2FEWB 1XC7A 1Y5MA 3D8SA 5GVRA 3DE4X 1Y3DE 3GP3A 3GFBA 1O95C 2QMEA 1YR2A 3EGDA 2IE0A 4LXYA 2FFBA 2XT6A 3TQQA 3C3XA 1G4UR 3R7FA 6PFKA 3MTBA 1HZJA 1EJ0A 1OBCA 4QARA 5ALZA 3U39A 1Y9ZA 3B38A 3EFOA 2FEOA 1R0YA 4LAFA 4CMAA 3B7GA 4C0XA 2OG1A 3ZZNA 3SYLA 5FNVB 4M1MA 4O1MA 3I73A 1CFJA 4TYNA 4PVCA 4FLFA 4ZWNA 3ZJ4A 2TECE 3ZWPA 3ZVRA 2X2EA 4V3CA 1BWSA 4MQFB 2VDUE 4RZUA 4BWFB 2ZVJA 2R62A 3DDSA 5CK5A 5DHRA 3B9BA 2X0EA 1L5WA 1VPDA 1E89A 3BWBA 4LI3X 4FMDB 1Y6ZA 4UBIA 4B3TB 2VF4X 3N7UA 3GMDA 4YAFA 3WYFA 1NATA 4YVFA 4PAQA 5LDGA 3SP1A 1OH7A 2PZJA 3I2JA 2FYTA 4YMGA 2QROA 3AJEA 1JQLB 2MSCB 2L17A 4US2R 5FBHA 1TM7E 3V7WA 3BL5A 1U8CB 2HSEA 1KEEA 5LXTF 4E51A 4PHTA 4N5DA 1Z6AA 4EHIA 3AUJB 1TCUA 2O8FB 4O4JB 3B1VA 3Q6NA 4RA9B 4HAZA 1W93A 1LPPA 3I6YA 1IYZA 5CT9A 5BOSB 1OB5A 2WIKA 3FWYA 3OOWA 2J3EA 4DBLC 1R9JA 3I05A 1KO1A 3DAYA 3UA4A 3BE4A 3DMRA 3ZK9A 3CPHA 3IAAA 1SG0A 2NZJA 3LLCA 3TEMA 1T1JA 1X7WA 1K4YA 1GCIA 4GOKA 3K31A 1E8DA 3ISTA 3LHIA 4BNTA 1ISRA 3HKEB 4KAAA 3CIOA 2VRBA 4OBBA 1ZICA 2NO6A 4EEKA 3WQRA 1XZIA 1YTUA 4F86A 1ZH4A 3WGLA 2AR0A 1GKIA 4INJA 4EW2A 4ZOLB 2VSXA 2C3UA 4ETIA 2ZBFA 5HW0A 5H4GA 1M6VA 1KQPA 2IV7A 3V1MA 4KJXA 4Y2SA 5CITA 2XCOA 3QKSA 3A4IA 3GDFA 2IEAA 3DGEC 5E7JA 3RG2A 2DR3A 1U80A 3KAKA 1J2TA 1QZXA 2CHFA 4HPWA 4C6HA 2GCIA 5FPQA 1BE6A 1I2MA 1AHIA 2CHEA 4CRWB 4L8YA 1DU4A 5KVCA 4RLHA 3PQ4A 3EDRA 1VCOA 1QYDA 4QICA 1OAOA 3FRHA 3OE7A 4L4SA 1H0SA 2BZ0A 2G25A 2ESRA 1UUFA 4FKMA 4MWEA 4E5KA 4Z4CA 5EXSA 4B3MB 5TF0A 3RNLA 2W6QA 3TRIA 1C3LA 3V1YA 1ZC4A 3EVNA 4HK4A 2PFGA 5L6MB 2HMVA 4BECA 4DXAA 3SY8A 4RZ3A 1ZFNA 3R2JA 4YQEA 1JHQA 2GM5A 4G4JA 3HFJA 1MJHA 1SK9A 3KUKA 1LPAB 4IO0A 4IRUB 4J76A 3VI3B 2HTEA 3DWEX 4MAAA 5KX5B 5CM8B 3CYFA 4Z1MD 5CA0A 3RQSA 3CNOA 1IAQA 5CX4A 3S2UA 3BX1A 3QUCA 1CQJB 3REGA 2O05A 5C8YB 5IKXA 5KVQA 1NBMD 1XL1A 3A9TA 1Q16A 4MV0A 4BRWA 3ETHA 4D80A 3EVTA 1PL6A 5ARCA 4DANA 4HLNA 4D45A 2R1VA 4BQPA 4NMHA 1E98A 1S2LA 4OB8A 2F1JA 3ICVA 1RAAA 4XYLA 1RE1A 3MZ0A 1WNTA 1O9GA 1NF3A 1U8TA 1P2BA 2VEDA 1V3QE 3DO8A 3LRTA 1E3IA 1O2DA 3TIXB 3R9XB 4C0HA 3ASYA 2BH9A 2PJZA 3O2JA 3PNLA 1JLLB 3GOHA 1NJ8A 3OE1A 4FYKA 4BJ6A 5DI9A 2WWWA 3TTYA 1PJRA 1V1JA 3GPDG 4OLJA 5A62A 2M32A 3DHEA 4LRYA 3V8VA 1VMEA 1RWMA 1LJLA 3HYSA 3TRKA 1SC9A 3AEUA 2CVOA 3AQIA 4R5MA 2H1FA 4EATA 4JLAA 2HSZA 4Q9LA 1EXDA 4O25A 3U3XA 1DPFA 1RRGA 4CI0B 3THWB 4Y1EA 3UC5A 5EJ8A 2ZBQA 1KAOA 4RZHA 2IELA 2WU0A 2C2MA 2IODA 2F17A 1QGAA 2GETA 1OAAA 3CTPA 4JI7B 1QQ6A 4WNYA 5K05A 1Z0IA 4Q6WA 4IMIB 2J9FB 1K98A 3RAPR 3RHZA 1P9OA 3MLBA 2ZIZA 3I04A 1ZINA 2P9HA 1XQ9A 5AI0A 4EMUA 5HRUA 4QGFA 1BXZA 3RT1A 2QVBA 4HD8A 5GMOA 5CA0B 1UBMS 3Q8MA 4GUDA 3M82A 1FJ2A 2EKPA 4HQKA 3AVVA 4TM8A 4QUJA 1L5KA 2FWAA 1LDEA 5HZMA 1JDZA 1KP3A 1Y3FE 4GPEA 1BROA 4UMVA 5BSMA 3LVBA 2IYLD 4FJ1A 1GN9A 1WDLA 3I0MA 5DTRA 2ENWA 1GVNB 5FRDA 3UWDA 1QP0A 3AETB 4BZWA 2F2TA 2EL9A 3TRDA 3BFVA 1WBDA 1BCRB 4B74A 1E2QA 1NHGA 2ET6A 2H17A 3PBKA 2FETA 3QPBA 2XYRA 4HDNA 2ZDGA 5DX0A 2XITA 3ZDYB 3UJ6A 4AW9A 4PBSA 3K9GA 1CK4A 1I6LA 2Z9DA 1UJBA 3RJ9A 2H4YA 1N2JA 1HBJA 1ND6A 4IXTA 2C31A 2PQ6A 3G5UA 4FZ5A 2DHDA 3SK0A 3WGTA 3FFTA 2ZJ2A 3MHTA 3BXFA 4EGCB 3A32A 5ESXA 4AP9A 3K71B 3QUBA 3O6VA 4OK6A 1MBZA 2Y68A 2NADA 3HKBA 2OZPA 1IUPA 2R2AA 5FTWA 4C07A 3H9UA 9GPBA 2GUWA 5EE3A 4AJJA 1RWWA 4JP3A 1RKXA 4UQOA 5REQA 4ZHQF 4ZGWA 1G9XA 1OAOC 5CDFE 4HDKA 1XK7A 4DBVO 3LUBA 1NXSA 5KSWB 2HDWA 2CT8A 2GLXA 1KMNA 2R6R1 3AHFA 3KCNA 4NU5A 2OA0A 3DYBA 4Z51A 5T6BA 1YAJA 3GGSA 3LD9A 3KYDB 2F6RA 1VMAA 1TO6A 2XSZA 3AF0A 4NE9A 1TKRA 3OLYA 1UEJA 3IJEB 1NW6A 2BGKA 2SKCA 1SCUA 4IOJA 3JRNA 1FF9A 1FNSA 3FCSB 4YLGA 1JBKA 4BU0A 4CLXA 4P7KA 4ZCSA 3LQ1A 1G60A 1HMYA 2GCOA 1DWQA 1JDVA 3SBOA 1G21A 1Y7IA 3BFPA 3FTQA 2ZJ8A 4QYWA 2RMKA 4OAOA 4UASA 1MMFB 3IMFA 4D9EA 4N7MA 4YCNA 1T9ZA 3GJZA 3RASA 2I65A 2H0QA 1IDOA 3AEQA 3CA8A 3NX4A 4XRRA 2VHUA 5KX5F 5K0LA 2H7CA 3CKYA 4MKGA 2Q50A 2AQHA 4Q7KA 3OLZA 3ABIA 3NU1A 2DJIA 4LGMA 5CT6A 5DP1A 4E5PA 1T9AA 4WXYB 5I7UA 5KNLA 2F3PA 3FOEC 2VFAA 1J8VA 1DBSA 1P9WA 1XU7A 2ZBUA 3D8NA 4LC9A 4OL9A 4EHNA 1S8OA 1ML3A 4GE3A 4ILEA 1CR1A 1CUIA 4MRNA 4WV3A 2DM6A 4BV2A 5LQNA 2CZQA 5LOVA 4OTZA 4M1TA 1KRWA 4XPZA 3GRKA 2D1SA 4TSKA 5EQJB 1OH6A