2EFDB

Ara7/atvps9a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
165
structure length
152
Chain Sequence
b'SINAKLVLLGDVGAGKSSLVLRFVAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 41
structure length 152
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efdB00
1WXQA 4JT2A 3TLXA 3UG7A 1FP6A 5KUTA 3B5JA 2ZJZA 4D0LB 3ND8A 2Z5FA 3I92A 4TQ9A 5J4HA 1SZPA 4L4UA 2A30A 1R5OA 1OXXK 4CGZA 1QG2A 5FOSA 4XWOA 2HDNB 2P6UA 1HURA 3U3JA 4Q4JA 1K5DA 4GNKA 2HYIC 1KMHA 1ZIOA 4X8OA 5L3RA 2PX0A 3X1XA 4TLEA 1NI3A 4B35A 4YDHB 4ZDJA 5IK2A 5AK0A 1VYTA 1NN0A 3W8RA 1T0HB 4JZKA 1UF9A 3B1VA 5F9HA 3GEHA 4QXAA 4DRZA 4YMVA 2QA5A 2V7QD 4P0TA 3CRRA 4DJTA 1HUQA 2IYTA 4DUGD 3HPRA 1TUIA 4FMDB 2ZSAA 3DMNA 3K0CC 4I1SA 4A8JA 5GJBA 4JIMA 4NDZA 4PANA 2MMCA 3LV8A 2IYSA 5J5CA 1IJEA 1SKYE 1XCMA 1EFHA 2JASA 3BC1A 1KJYA 2IUUA 1DAIA 2VP4A 3AP2A 2AR7A 1HQYE 2IF0A 2YOHA 3BH0A 4Q48A 4UNPA 1RZ3A 3VR1A 4A4DA 3K0SA 1IOZA 3GJ0A 2QTVB 5JRJA 4OHYA 1GKIA 2R65A 4KFRA 2QM7A 3GFTA 4N1AA 521PA 1AGRA 3PUZA 4PC2A 1HE8B 1KGDA 4HDOB 3U7GA 1BMFD 5P21A 3MRSA 2WAYA 5FPTA 1F60A 3KJHA 1JQJC 1ODFA 1IONA 4FMDF 4EJSC 2FFAA 1WQ1R 1SXJB 2SHKA 3K0EA 4WBSA 4DC9A 1UPTA 2Z83A 3M4YA 3GLHA 4NYMR 2WIBA 2CLCX 3TW8B 5JBQA 2GAAA 4YMWA 5F2EA 3SEAA 3W90A 5KOYA 1EX7A 2PBRA 2VHQA 3HJNA 4PHTA 4DLVA 2J5XA 4OK6A 3PG5A 1CBUA 3TKLA 2VP9A 3DL0A 2GRJA 4MITA 3AVWA 5EE0A 1G5PA 2KI5A 2H1LA 4XSHA 1O87A 1W4RA 1W4BA 4NCJA 3TQCA 3CNOA 1H8ED 3CZPA 4B2LA 5D3QA 5EP1A 2MSDB 1QVAA 1XEWX 3P1JA 3SBEA 1A7JA 1OFIA 4D81A 1DAMA 5L3SB 2CLDX 3GLIA 2XB2A 1Q12A 3B1ZA 3ND9A 3ETLA 4GI7A 4HSEA 3RDPA 3W3ZB 4URXR 2XXAA 3MAAC 2EFGA 2GXQA 4DVGA 4BFVA 4JLAA 2RGXA 2JCSA 3MJRA 3LW7A 4B43A 2IWRA 4HUQB 3F0TA 5DI9A 1NMYA 3Q7QA 2VRWA 1C9KA 2AKYA 4JVNA 2GKSA 4DWJA 4G5GA 2IWHA 2ATXA 2H8KA 4Q9IA 5KO2A 2J7PD 2IYZA 3AEZA 1N5JA 5JS7A 2E1RA 3CPEA 1OYYA 1VHTA 2PJRA 3C5HA 4LI0A 3GLGB 1W49A 3AUYA 2B21A 4TMKA 2OG2A 1M74A 5TY0A 4CEJB 2ZSDA 3OAAD 3QQ5A 2G3YA 2XSZA 4BFXA 5DYGA 1YJ5A 5EP4A 3PEYA 1RIFA 2C95A 2OXCA 1PLJA 4AD8A 1SXJE 1CTQA 2IYXA 1EG7A 1Z6AA 1Z0DA 1OW3B 2CHVA 3MD0A 5C4GB 3WRXC 1TAGA 4BLOA 3AH8A 4RFSA 1G4AE 1XU4A 2A5GA 4LJ4A 3RABA 1BMFA 2ZI7A 2OV2A 2WKQA 2ONKA 1IXRC 2OCYC 3QKUA 2VSXA 4UKDA 4QBGB 3BJIC 4FCWA 2PEZA 3M6AA 3O8BA 1G7TA 3GJ3A 4C0SA 1GUAA 2BM1A 1U0LA 2W2TA 2IW3A 2O8EB 1OIWA 4M8NE 5BYKA 2UZIR 1UKVY 4RKEA 4TYWA 1JR3A 1XX6A 2GCOA 3KJEA 4PZZA 4D4MA 2A3RA 3GLIE 1ZCAA 4AKGA 4EPRA 1GKYA 1XEFA 1XNJA 3IUYA 1KI6A 2IUTA 3RYTC 4HEJA 3MWLA 4V0OA 5FBRB 4TYQA 2O8DB 2AK3A 2HJVA 1QHXA 3EC1A 5FFMA 4HAWA 4C0JA 4V0ME 5AJWA 1VECA 2Z6VA 3W6PA 4TZ6A 1MRSA 5JS8A 3W6NA 1G7SA 4D26A 3NWJA 3TUIC 3OE7A 4RD6A 4Q1FA 2C8VA 1YZUA 3TQFA 4MQBA 4CW7A 3GLGE 4Q9KA 1UBGA 2QNRA 3CRQA 1E2JA 1NBME 1FQJA 2YC4C 2RGNC 2W6IA 1DS6A 3CF6R 2GXSA 2WOOA 3QKTA 3OFNA 1N5LA 4LPSA 1YR7A 2WKPA 3CO5A 1G3UA 4MRVA 5TVKA 5HE8A 2XITA 1Z29A 3I5XA 1KO1A 4KBGA 1EFCA 1W5SA 2GJ9A 2A5JA 1N3BA 2QRZA 3QXJA 2V1UA 1L8QA 5DHAA 3AF4A 3FMIA 4R2IA 1Z07A 2ZXUA 3NBFA 3T1QA 1P75A 1ZJ6A 3X1ZA 5EUQB 3PCRB 2QL6A 3K0AB 3QPVA 4IVPA 1G21E 4BECA 3TR5A 4HDQB 2ERXA 2X19A 5GJVC 4U00A 4IVQA 4ZIRA 4LYFA 2VF8A 3EG5A 2WWXA 2ZRFA 1XXHB 4OHWA 3VR6A 2GVZC 3I4LA 4HB3A 5FL7D 4KVAA 4UNSA 2OAP1 2P65A 4JVMA 4CYMA 4V0LA 1N6NA 1VIAA 4IJMA 4B44A 1NLYA 4DBLC 2QMHA 2ANCA 1U9IC 2FV8A 5JSZA 5DSZA 2J9RA 4ILEA 3NC1C 1GZSA 2Q9AA 4BE7B 3C15C 1DTSA 2ZYWX 4V0KA 4W7SA 3QG5A 1AS3A 3A4MA 5EP2A 4AG6A 1T3HA 3S1AB 1DO0A 3CB4A 3H0KA 1GSIA 3UMSA 2VHJA 2HUPA 3ZIAD 3ZYCA 1VG1A 1CJMA 1GFIA 3CUEF 2GXAA 4DHEA 3VX3A 1DPFA 1KSJA 1D2NA 4KFSA 2QENA 3C7KA 5L3QA 2ZRDA 3THYA 2C9OA 1W36B 1MO3A 1JAHA 4B71A 3SJAA 4WA7A 3IPXA 4B32A 3GJ4A 4Z54A 3OF5A 4LJ6A 1T5IA 1Y3AA 3GJ7A 4C0LA 1MO4A 1G3QA 3AQ4A 2ZRBA 1N25A 3HYTA 1Q44A 1HT2E 3QF4B 2AD1A 2XAUA 3SFVA 1D6JA 1US8A 3CPJB 3RS5A 1GILA 2CXXA 2FEOA 2WIAA 5BYJA 2IS6A 3C5CA 1X1RA 2W0SA 3L0IB 4Z8XA 1VMAA 4AI6A 1D2EA 2FSIA 3NHAA 4KO8A 2K5UA 2ZPTX 2G1JA 2NIPA 2ZIAA 3R7WB 4AC9A 2PT7A 1Q1BA 3QPUA 4H1VA 1OFHA 2PMDA 1SXJC 2ASEA 1ZD1A 4EFNA 2J3EA 4MYTA 1XXHE 2ZUCA 5EP3A 4YONB 4CT5A 4PAQA 4NCNA 1SVMA 5IDVA 1GP2A 3DZ8A 3QKRA 1KO8A 4ZCMA 1VYUA 4MH0R 3EAQA 4DLTA 1N6HA 4MUBA 2ANBA 1KI9A 5FOXA 1P60A 2WICA 2V8OA 3OZXA 1S8FA 4O3MA 4TT3D 3LW8A 1TMKA 3TNFA 2XOKD 3I72A 5LDDC 1I2DA 3QXSA 3EARA 3K70D 4V0NA 1UJ2A 1W0KA 3U44B 1CJKC 2WWFA 1CR2A 5HKKA 5AUNB 3THXB 4Q47A 3A6PC 3PR1A 1P73A 2PX3A 2O8FA 3BFVA 4R2HA 4HLUC 3QG1A 2NO9A 2MMGA 4DCUA 1LTQA 1OHHD 4V03A 1OB5A 1R7RA 3GFPA 3H86A 4OQLA 4Q00A 4YDSA 3K09C 4HATA 2MSEB 2F1HA 2HF9A 4C0QC 1E2DA 2QORA 5JZVA 1JXMA 3U4QA 4S35A 2BMJA 5D3MA 2RCNA 4LBZA 1TF5A 4PO8A 5KSZA 2ZETA 4GFDA 3TVDA 5DYIA 3RWOA 4FCVA 4JLJA 1ZYUA 1FNNA 2CNWD 3NEYA 4GP7A 3U7EB 3ECCA 1N0UA 5AWFC 4ASUA 4KI0A 5JHHB 1PV4A 1E79A 3ZVMA 1I4TD 4JBYA 3FOZA 2QT0A 2EFDB 2ZE8A 1KK0A 4NH0A 4A92A 4PZYA 4XVRA 3K0CA 3PXGA 3TW4A 1ZD9A 2JLZA 1EESA 3FGNA 1NKSA 2Y8EA 4BPBA 3PV0A 2REXB 1F3OA 2KWIA 1R10A 2EFHB 1SULA 4L5BA 4BUJA 5EE9A 3ICEA 4C0KA 2C2HA 4JLVA 1NY6A 1QHIA 3HPQA 3RS3A 2P6RA 2IYWA 3CX7A 1ZAKA 2R6CA 5CYOA 3KKNA 5KDLA 2OBLA 3W3AA 3F5FA 1JB1A 3LX8A 4XD7D 3DKVA 3OIYA 1Z3IX 3BS4A 5GJCA 1S3SA 3Q5EA 2AK2A 1TEVA 3QXHA 3KB2A 1QHNA 1W47A 4FI3C 1VCMA 4EJSA 3QXCA 2YKGA 3MFYA 2B7CA 5F3WB 4QJ3A 1AKEA 2PMKA 3V00A 2V3CC 1EXMA 2LKCA 2GDJA 3MWJA 2D2FA 1ZVQA 4FMCB 1ZRHA 3NXSA 1E1QD 4Q7MB 4TT3A 4PPFA 3NG1A 3CONA 4Q9HA 1CR4A 3VU9A 3T5DA 1ZNXA 3EWAA 3NKVA 3CX6A 2XB4A 3QI2A 3U3OA 2J59A 1ZNWA 1NJFA 4BFWA 2A78A 4I1VA 1FL9A 1E32A 1S2MA 4LHWA 4LHYA 5FR1A 3WHLA 2OXRA 4PHHA 2VO1A 5B58C 4A36A 3RSLA 2R2AA 2ODWA 1RW4A 221PA 2FX3A 1D8TA 5SZHB 5EUMA 1NNEA 4CEHA 4URYR 1KI2A 1Z6TA 2EYQA 3WMEA 2ZYUX 2CVFA 5DIFA 4XWKA 4D2IA 3WBKA 4NBSA 2XGJA 1SQ5A 2G88A 5EZ6B 4GZMA 4GPTA 4NHOA 3GFOA 4WIAA 4F4JA 3WY9A 3D31A 1UAAA 1CR0A 1KAGA 1KI8A 1KJWA 2JLYA 2ORVA 1TF2A 3D7MA 2FA9A 4NTZA 1TTTA 4U02A 1Z63A 1G8YA 2BEKA 2OESA 1WDTA 4QBIA 1T5LA 5JWHA 1IN4A 2QAGB 2J41A 4IEEA 4QGGA 4XVUA 1XJQA 2Q3MA 1XMVA 4PC1A 1P72A 1GVNB 3FYHA 3I5YA 3HWSA 1QF9A 1FX0A 5KU1A 4L9SA 1U0HC 2Z43A 5JLJA 2FG5A 1FUUA 1H8HD 1UADA 3FPAA 3U3KA 1KDTA 3VX4A 2WWGA 5DNYB 2QN6A 5C4MA 4PHGA 3FMPB 2DHRA 5KTYA 5GADl 3A1WA 4ZKEA 2ZAMA 2HCJB 3E1SA 4D25A 4PR0A 3T06B 4OYHA 4E5UA 1EFRA 2C04A 4AKEA 4DDUA 3OEEA 1GIAA 4MYHA 1JJ7A 3ZS8A 4L8GA 3CR8A 4GOXA 4IW3B 4AK9A 2GEVA 2WJHA 1E1QA 1IN6A 2PCLA 3SJCA 2CL7X 4ESVA 4PQRA 3CNLA 5KDOA 1NG9A 1DAHA 3K0FA 1F5NA 4MDFA 3VFDA 4EAQA 2CL0X 1GDDA 3I73A 5J4VA 3KKMA 3IEVA 3KQHA 1W36C 5IK2D 4B2IA 2NO7A 1OSNA 2NPIA 4G01B 1VCOA 4H9GA 3TUJC 3KTAB 2H18A 2CK3A 5A4JA 4IDNA 1UBFA 2F1IA 1FW6A 1JR6A 1KO5A 5AR1A 1OH6A 3WHKA 1ANKA 3K9GA 4UXHA 2W2XA 4M21A 2J0SA 2WMOB 2OBNA 2QU8A 4G5SA 5HZKA 4XH9B 3P4XA 2AFHE 4R7ZA 4M2LA 2IC5A 4MDEA 1MABA 1ZBDA 4M1SA 2G77B 2JLSA 3KDSE 4NZYA 2ATVA 3C8UA 2ZITA 3ZVRA 4DSUA 2FJUA 4M1YA 3L0PA 2PL3A 1E4VA 1E99A 4PQFA 2PZEA 3RLFA 2RGNA 2OAQ1 1KTVA 2BWJA 1YRAA 1U8YA 2NOAA 3JVVA 3AVVA 5FBVB 4TL7A 2QTHA 3WYAA 5FTJA 3NTUA 4BWYA 3MLEA 5JJIA 1P9WA 1S3GA 2DFKB 1FQKA 4OJQA 2QSZA 1AQUA 3IBYA 2WJIA 4RZUA 5GJWC 1AN0A 1C4OA 3SJBA 2FPMA 1JNYA 3FMOB 4IDQA 4TL8A 4EQ6B 2JLXA 2OCBA 1E98A 4DKXA 4BRUA 3GLFB 1VPLA 1D9ZA 5KHOC 2G0TA 3QEJA 2ZRCA 2ODNA 5FI1B 4QNRA 1XTIA 3SU8A 3SZRA 2C96A 1FNMA 1L4YA 3KXIA 2QP9X 3SYKA 4OBEA 2CCGA 2FH5B 5EXSA 3U6BA 2VP0A 1XTKA 3H4MA 2R6DA 1TX4B 2QGZA 3R9WA 2XTNA 1KZ7B 2F43A 4OQMA 2WHXA 4C30A 4Q9LA 3RC3A 1U90A 3H1TA 1OFUX 4RVCA 3RVBA 3UIEA 1Q22A 1E1RA 4A0FA 1EWRA 1A4RA 1YR9A 1FMJA 1G4UR 1U9IA 4BZPA 3BB3A 2DB3A 2D4HA 4LC0A 1X1SA 3QBVA 2JLUA 1SVOA 2VYFA 5DI3B 4JVSB 1Z2AA 1HT1E 4PC3A 4NPHA 3R8CA 1G8GA 2QG6A 2BIFA 3LFUA 4QRHA 4UJ3A 2H57A 4LV5B 3QJYA 5G3YA 2OCPA 3V4RA 4US0R 2OILA 4IVRA 2CMKA 2Q3FA 1LV7A 5FTKA 5TB5A 3LRPA 2GJAA 1ZM2A 2XZOA 5JJLA 3CIOA 4QM7A 1G3MA 3U6KA 1E94E 4GL2A 1SVKA 1U99A 3DEFA 1P62B 4LHVA 1W0JA 1C1YA 3SS8A 3QE0A 4DIDA 4HZUB 4TYYA 3P32A 3FVQA 5LB4A 1KNXA 4KLNA 5LD2B 1GAJA 2ZREA 5EQTA 3N2IA 5FTMA 4JJKA 4OKSA 1AZSC 4BFYA 1Z28A 1VYVA 1ZP6A 4II7A 2F7SA 3TSWA 3PJRA 2DYKA 2XSZD 3E5HA 3KQUA 4Q7JB 5FTNA 2BEJA 1DOAA 1NVWQ 3E2IA 2N1BA 1QHSA 2R6FA 3RRNA 3AKCA 3C41J 5GVRA 1II9A 2DBYA 2HLDA 4WZ6A 1XWIA 3ZZUA 4A2QA 4XTRA 3GLFE 3B85A 4HI0E 4AKIA 3WP1B 3FWYA 4Q4LA 4UXIA 1A2BA 2W2VA 2IF2A 3WP0A 4W5WA 4JL6A 1SXJA 3UMRA 2IXFA 3AP1A 4OJKA 4EUNA 3N5CA 3RAPR 1NKTA 1Z6XA 2FGJA 3FKQA 1KSFX 4B76A 1H65A 3Q9LA 5JEDA 1NLFA 2QMEA 5DN6A 5J4YA 1GTVA 1Q3HA 2QRNA 3MMPA 2PZGA 1G3RA 4PFSA 4HZIA 5EXPA 4BQSA 3ZD6A 3A1TA 3EA0A 2HEIA 3AVXA 1JEDA 3UWOA 2MSCB 4LJYA 5E7JA 4LBVA 3LBNA 4MKFA 1RRCA 3T15A 5BQ5A 3EX7C 4N0DA 4AYWA 3ICQB 1JR3D 4WW0A 4E07A 2O52A 1IY0A 1DAGA 4M9QA 4XJXA 5L3SA 5J4LA 4QG7A 4BFUA 2FOLA 4WZBE 5EXTA 2VTKA 2A5FA 2ZE6A 1WBBA 1IBRA 1X8LA 1BYUA 1KAOA 2V4ZA 4HLUA 1E9FA 1DVRA 1NRJB 1EX6A 3BE4A 2YJTD 3EW9A 3SFZA 3T1TA 2D06A 3LXRA 4Q1DA 4AY2A 1G64A 3X1YA 1E9EA 1E2EA 2AL7A 3K09A 1MO6A 3IDQA 4EFMA 4HUQA 4DLWA 5IRCD 1E6CA 2ZJYA 2JGNA 4FIDA 2ZJ8A 3OE7D 1LY1A 2ORWA 1LF5A 3QPWA 1U0JA 4P4TA 3WNBA 5CB6A 2BBOA 3AV0B 3IKJA 1RKBA 3PUVA 4LWZA 2REBA 4QOSA 2W6ID 4TTPA 4V0MA 1KKLA 2KBFA 4HB2A 1XMSA 2CBZA 4NYIR 4Q4HB 3RC8A 2YZ2A 3OFND 5G40A 5JFGA 1W2HA 2QAGC 2KB0A 3GLGA 2HYDA 2QE7D 1NBMA 1SVLA 2XX3A 4PSAA 4RD1A 1KI3A 1YVDA 4L9WA 4D0GA 2X8AA 1VHLA 2BKEA 5F9FA 3AVOA 2FN4A 1TQ4A 3CRMA 4ZV4A 4CEJA 2R6AA 1COWA 4G5QA 1UBCA 2FFQA 1MO5A 2FGKA 2WV9A 2G83A 5C18A 2YWEA 1OXSC 2GBLC 2XTZA 2JJ2A 4HLQB 4RZXA 2GXUA 3QENA 2DCUA 4NYJQ 1YQTA 3KFVA 1R5BA 3B1WA 3QVUA 4DT1B 4DCTA 1BYIA 1J70A 3IBGA 3MJHA 4H1UA 1D5CA 3U7FB 2JLQA 4HB0A 3BFXA 1T3LA 3QY0A 4KFTA 1N6KA 3EZ6A 3ADCA 2I1QA 2Q3HA 1YR8A 2HT6A 1OJLA 2PZFA 1XFAA 3LLMA 3MGCA 4RD3A 3VQTA 2OEPA 3ZQ6A 2PH1A 4IOKA 1XB2A 1DEKA 4LYAA 5E7MA 1XP8A 2B6HA 1A5TA 2ZROA 2IYRA 1Z0FA 2F1RA 2NZ8A 5A0FA 3SI7A 4A9AA 1HTWA 4RFVA 4NL4H 1A82A 1Q21A 4HDCA 3I32A 1M7HA 4ZDKA 3FFBA 4ERNA 2GK7A 4DB4A 3GPLA 4HUTA 3SC3A 3MCAA 4V02A 1LB1B 4B33A 1MR3F 2FWRA 5DH9A 5M04A 2O8DA 4CIDA 1IXZA 1G5RA 3CKLA 3OESA 2ZI9A 4ZCIA 1CULC 3A4NA 5KNDA 1GNRA 2WWHA 3EWSA 1XD2B 4PXAA 4AYTA 4M53A 3AVYA 1JPNA 1OIVA 1KK1A 3ONWA 1PLLA 1XZQA 3REFA 3TMKA 1G8PA 2ZRNA 1Z5ZA 2CVHA 5LBIA 1S1MA 2WVJA 6Q21A 2Q0HA 5KYKA 4WAUA 4JLKA 1E2KA 1D2MA 4QGHA 2FU5C 3IIMA 4CT4B 4ZI3A 2GHIA 2EU8A 1NSFA 3HU3A 4KAXA 2QE7A 3DOEA 4GDFA 3ZQJA 4ZDWA 2JIZA 4OQNA 5ANRB 4TL9A 4C3ZA 2GETA 2I3BA 3LXXA 1I4LD 3K0AA 4OQFA 3WMFA 5FPKA 4W5HA 2FEMA 3D3QA 2QPAA 2ZVQX 2WZQA 2WWYA 2JAQA 1KO4A 1M7BA 4R98A 3B60A 4TSFD 1XXHA 1NLZA 5SZKB 3K8YA 3KZ1E 3NEJA 1IAQA 3SBDA 3WXMA 4X8MA 3EXAA 2D2EA 1GRNA 5C1BA 1U98A 3BBPA 3MSXA 1CJTC 3Q85A 3SOPA 2GILA 3VR4A 1OT3A 4LK2A 3U5ZB 1WP9A 1NY5A 1W0KD 3T1VA 1BH2A 5HKKD 2FFHA 1P5ZB 5LB2A 1OH5A 1II8B 4YQFA 1DAFA 3HU2A 4KCGA 1V5WA 2Q21A 3PFIA 3RRYA 3Q8XB 5CK5A 2XEXA 2XZPA 4Q1BA 4ESHA 5E3HA 3FDIA 3F8TA 1QBKC 1CP2A 2CL6X 3NBZC 1S4QA 3B7GA 3S1AA 4E03A 4CVNA 2CJWB 3IO3A 4X8LA 5FPYA 1EGAA 3CF0A 3K9LA 1Z83A 2AWOA 2F3TA 5UKDA 2XNSA 4AURA 2FNAA 1E2NA 3TJZA 1E96A 2BKUA 3EPHA 2RGCA 2ZJ5A 2QMUA 1Z47A 2DPXA 1AA9A 2CE7A 3OIVA 4C7OB 1E2GA 2ODEA 3A36A 2REOA 3SYNA 2C9CA 1G8HA 3KFXA 4O2LA 621PA 5JECA 5LD2C 4ASUD 1E79D 2QM8A 4RSGA 4YMTA 4GBMA 4AKHA 4MKHA 2DFNA 2DFLA 3QF4A 4PTLA 1NMZA 3B2EA 2ZRAA 3WBJA 1E9BA 4QC2A 2XJ4A 2OZEA 1AS0A 4TLDA 1E0JA 3TIFA 2ZI5A 3M1IA 1WRBA 4M1MA 3THWB 4TLAA 2RGEA 5EJEA 1M6NA 2D3WA 1DG1G 2Z0MA 5E7IA 3R7WA 5JCZA 3QUSA 3RSOA 1G16A 2J46A 2HT1A 4KVGA 1UFQA 3DDCA 5IF9A 4PAMA 4RD2A 1OPXA 1PJRA 2QP4A 4KLZA 4XVQA 2BBWA 4TQAA 5K8LA 3PUWA 5JEEA 2EFCB 1KMQA 2J45A 4RY2A 3QXXA 4P3YA 1XBTA 4DCVA 4IOMA 3EASA 3K1JA 2WJGA 4TSFA 3THWA 3KKQA 2ZVPX 3K53A 1F2TB 3KUCA 3I62A 3TVTA 4WXPA 1UBEA 2W0MA 3LBHA 2G1KA 3U44A 2GAOA 1G3IA 3THXA 1FOEB 4DLSA 1JQLB 4QNMA 2R8RA 1XF9A 2CE2X 1E2PA 2J0UB 5G53C 3RNLA 3HYRA 4Q9JA 2KBEA 2V55B 4RJLA 4DDWA 3OIWA 4RZ3A 4U5XA 2A5YB 3OIUA 2IK8A 1Q0UA 2KSQA 3G5UA 4MGYR 3F3YA 3E70C 4JSYA 2VHCA 2ECKA 2NTYC 2QBYB 5HPYB 2CLSA 2GWHA 3AKDA 2C5LA 1IN7A 3AF1A 1TUEA 1EFTA 1Q20A 4DSOA 1RFLA 1N6PA 1X8KA 2ZYTX 4OI2A 3CM0A 3TAHA 2BV3A 1N5KA 2ZR0A 1XTSA 5JCPA 2P5SA 5L3VA 1OKKA 4OI4A 1CLUA 2ZJOA 5AJYA 1RJ9B 3H2YA 5K8IA 3EPKA 4F93B 2YWFA 3AKYA 3EIQA 3B9QA 1G1MA 1DG3A 2WJVA 1JPJA 3VNVA 1E9CA 3X2SA 4GSYA 3OEHA 5DLQC 5BWMA 4G3XA 4NYJR 4Q1AA 1KK2A 2HCBA 3TR0A 1VKJA 3VHLB 1ESNA 2A5DA 2BJWA 4QGAA 1U81A 2C99A 2LKDA 2H17A 2X2FA 2ZJBA 3O47A 3A1UA 3B9PA 2DR3A 2ZRGA 4DIEA 1E0SA 4NCHA 1IQPA 2IA5A 4BFSA 2GF9A 1E9AA 2P3SA 2V54A 5AJXA 4URUR 4BLTA 4PAOA 3RRZA 2O8CB 3NVAA 5KSOA 3RANA 1U8AA 4NONA 4BASA 4F4CA 2OUKA 4OK5A 2ZE5A 1KY2A 1ZW6A 5SZIA 3RS2A 3BB1A 2ZEJA 1G18A 1RE0A 3LX5A 2VEDA 3ASZA 4QJ4A 5J47A 1VG9B 1GNQA 2VHUA 2ZSBA 1G5TA 2J0QA 1XZPA 3JZMA 1EFRD 3LNCA 4C0HA 2ZUDA 1ELOA 3OEED 5DE3A 5JHGB 1HH4A 2BOVA 3BGWA 4HAXA 2R9VA 3PIRA 2RH5A 1ONBA 3DOFA 3DZDA 4JT4A 4F38A 4DEXA 1XEXB 2CHQA 1B0UA 4R71A 1GL6A 1UEIA 4M9XA 2FPLA 5L8VA 4TMXA 4CEIB 1DELA 5JWOA 3THOA 2GCNA 1KK3A 1UM8A 1YRBA 1P2SA 2YINC 4JMPA 4LY6A 3A8TA 2AFIE 2QQEA 3EPJA 3LA6A 3L82B 4KV9A 1YZQA 2AKAB 4UQOA 4CRWB 3I3SR 3LQRA 3R9IA 1W44A 1XMIA 4B3FX 4D82A 2CK3D 4Q02A 5B2ZA 4YMUA 5KPDA 4E22A 5DISB 3ZLJA 2JLVA 2ORIA 4EPVA 2GA8A 4JVLA 4EKDA 3TSZA 3NIBA 4LJ7A 4FMCF 3NHBA 3KKPA 3VR3A 2NZJA 4JLMA 3H84A 4M1TA 1AIPA 1Q1ZA 5TDHA 2ZS9A 1XRJA 3L8YA 1E69A 4ZI2A 1E9DA 3OHMA 3VU9B 3K70B 3DM9B 5JI3E 4PPGA 1Z22A 1QG4A 2QAGA 2C77A 1SKQA 3KXLA 4PO9A 2L0XA 1JXOA 1JALA 5JWRA 2VA8A 4Q4AA 5EE1A 1OH8A 1Z0KA 3CWQA 2E9SA 1Z0IA 2AXPA 2FF7A 121PA 4NYIQ 4QM6A 1AKYA 1KI4A 1S9HA 2Q9BA 2GBLA 2F9MA 2WOJA 2XNDA 4YC7A 5TV2A 3BWDD 3CZQA 4GP6A 3KQLA 2O5VA 1QHHB 3VAAA 4P4SB 3EZ2A 2GK6A 2H92A 3PUYA 1KO7A 2B92A 4DEYA 2OO7A 2GJKA 2FSHA 2EVWX 1W46A 4XIGS 1IXSB 1X6VA 3KXKA 2F55A 4ARZB 2B8WA 4P4UA 1E1RD 1DAEA 4BLRA 2PEYA 4IXMA 2AN9A 4TMVA 4B48A 3SDZA 2FDCA 2VP6A 2EFEB 4LHZA 3VR2A 3BH6A 2FE4A 2JLWA 5CLQA 4TYNA 2NO1A 1KKMA 5K8UA 4EPWA 3ADBA 2F9LA 3KTAA 1XTRA 1Q3TA 4QBHA 5IT5A 4D80A 4D4KA 1XPOA 2DWOA 2QP3A 4ACBA 5H8WA 4ZO4A 4I4LA 4I1OA 1QZXA 2QT1A 4NMMA 3CH4B 2ZRIA 1W0JD 1CF4A 2RKOA 1OXTA 1J90A 2DWPA 1ZM7A 4A6PA 4HLDA 4PO1A 2IS4A 4QBFA 2OFWA 4UXJA 1CEEA 2WBLC 4JS0A 3W6OA 4TMTA 1S0UA 3VR5A 1AM4D 4J0QA 2RMKA 3IILA 1CRQA 2W6JA 1XMJA 4HAYA 1E2MA 2P6NA 2ZS7A 4FXPA 4MRSA 3VKGA 3MWYW 1VIYA 2LCFA 2V6JA 2ZI6A 4URVR 4KYIB 4RKFA 2NO0A 5KDDA 4C2TA 1HQCA 4EPTA 2QQ0A 1UKYA 2HLDD 1R0XA 1F2UB 1ZCBA 3LO5A 4MGKR 3CRVA 1KIMA 4I81A 4I99A 3LLUA 4K81B 1E2QA 2VQSA 4Q21A 3WNCA 1E2FA 1XCPA 4EQ6A 2ZR7A 1T9HA 4DSTA 1GITA 1DADA 1SVSA 1SXJD 1DE0A 5FOUA 4B6EA 1R5NA 5B30A 2IT1A 2IUSA 1UDXA 4L16A 4PPQA 3TE6A 3NDBB 3GLFA 4DLUA 1WMSA 1ZM3A 2O8BB 1S96A 2FPKA 1K6MA 3CX8A 4AWXA 4LSGA 2GEUA 5DN6D 3UANA 3EC2A 1ETUA 1G6OA 2BCJQ 2VPPA 3ZDQA 1YR6A 2FSGA 4UNQA 1KJZA 4NCIA 4DLXA 2WSSA 1M1YE 2IHYA 1SGWA 3U7HB 1MH1A 1ZIPA 3T35A 2J87A 1N0VC 4LDJA 3UXMA 1KHTA 3UWKA 2JJ1D 4UNRA 3LQQA 4QJ5A 4Z1MA 4G0NA 4OHVA 3FKSA 1E9RA 1Z6GA 3CR7A 2ZSFA 3IHWA 1WCV1 3P4YA 4LZZA 1G17A 2GJSA 4DB2A 5DI3A 3C14C 1TQ6A 2IHBA 3FHCB 1S9DA 2FSFA 3AB3A 4JLOA 1GM5A 2FZLA 2W00A 1ZUHA 2AD5A 3BERA 5J4KA 3SNHA 1TPZA 1KY3A 1CR1A 3IPYA 1W1WA 1OH7A 2HJGA 4LYJA 3X1WA 4OI0A 1Z06A 2OCAA 3TRFA 1NIJA 4Y0AA 2OBMA 4YXWA 3ZH9B 2VSFA 2IEZA 2GZHA 3D8BA 4HZUA 2A7QA 3HDTA 2A2ZA 5CK4A 2ZRJA 3G82C 4GT1A 2F1JA 3BOSA 4MKGA 3QKSB 1NBMD 821PA 1FP7A 4R9UC 4BZXA 4Y0VA 1TF7A 2WPDA 4BFZA 1G19A 3Q7PA 1COWD 3X1DA 5GVSA 3B6EA 4M0LA 1T3SA 4TMZA 1S1CA 2YWGA 3IQXA 1N0WA 4BLSA 4F7WA 5HZHA 1ZC4A 2P67A 3O8CA 4AIIA 1IN8A 3QSYA 4Q4JB 1PUJA 3L43A 1KMHB 2JJ2D 4FW9A 4K46A 4LJ9A 2R44A 3KQNA 3DKPA 3ZGXA 3R8FA 1BS1A 2ZE7A 5KNCA 1JAIA 4ZDIA 1YKSA 1TEXA 4IOLA 4OHXA 5AJZA 1LFDB 3AF2A 2QY9A 1AK2A 1ZUIA 2B7BA 4QFMA 4UJ5A 3AVTA 2EWVA 2EWWA 4Q1CA 2UKDA 4PC7A 2GNOA 1KSHA 2QPTA 2IS2A 5CIWA 1ZUNB 1E2HA 4A8JB 1NG1A 2VP5A 3C16C 2HXSA 3BD9A 2CCKA 2QROA 1M2OB 3W9YA 4LYHA 1UEJA 2GF0A 3AGPA 2WSMA 2JATA 3FMFA 4NP6A 1JEEA 1QHYA 1E0AA 3W5IA 5FPHA 1U2RA 4KJZA 2JJ1A 1IM2A 2CCJA 2I1VB 5DO9A 4M9ZA 4IDOA 5C46F 2HXYA 3BB4A 2OT3B 1Z0JA 1J7KA 4MRNA 4NCKA 3DM5A 2WTUA 4AYXA 1BO6A 5TXGA 1LVGA 4MGZR 5KSPA 3AP3A 3RHFA 4DLZA 3WRYC 3LBIA 4D4JA 1XEWY 2BHRA 4FMBB 3PITA 5FL3A 1YZNA 5CDFE 1AS2A 3GLHB 1Z0AA 4OL0A 1HYQA 4ZKDA 1UDWA 4TL6A 3K70C 3PENA 4B34A 4Q4HA 5FOTA 4URWR 1LS1A 4BGDA 4RD0A 4F4IA 4LGMA 1NL3A 2ZUBA 3UG6A 3CH5A 2ZR9A 2IL1A 5HCNA 1KI1A 1ZNYA 1E0KA 2ZS8A 1NN3A 5FR2A 4C9BA 2FZ4A 3M0EA 5FOWA 3VHXA 3QIAA 3PQCA 2IYQA 2JIZD 3KJIA 2JLRA 3LD9A 1KDRA 1CS4C 1KNQA 4A1FA 3GLIB 4G5OA 2WM9B 5K8TA 4W9MC 2DWQA 1CJVC 4C0AC 2XXAB 1N6OA 2ZI3A 3A37A 1IHUA 5CITA 1YZKA 3B82A 3BFKA 3O8RA 2G9NA 4DT1A 4QL3A 4TWZA 3NH6A 2ZRPA 4D0NA 5CB8A 1UKZA 4P33A 3PEWA 1D9XA 1M8PA 1P3JA 2V7QA 4EIWA 1U8ZA 2DY1A 1M34E 3EZ9A 2VLIA 3IO5A 2OFOA 1II0A 5TMPA 3R20A 4KFUA 4LPKA 5CYPA 2ZI4A 4G1UC 4DUGA 4B6FA 5E4FA 3RS4A 1ESMA 1Q57A 4EPXA 4E09A 3UK6A 5H70A 3AUXA 4TLBA 2UVQA 3PUXA 4C4PA 4WXRA 4HYYA 4ACAA 2NQ2C 1X3SA 1CJUC 1B23P 1IY2A 1E2LA 1TNDA 1ZM9A 2O8EA 3SYLA 3PEUA 1R4AA 1ZC3A 5AUOB 1R6BX 1WA5A 3UPUA 2YV5A 4TN1A 3UKDA 3EPLA 3GQBA 3EZFA 2WAXA 1NMXA 4YMSA 1A2KC 1RC8A 5EE5B 3IHLA 4O25A 2BC9A 1AGPA 2ONJA 4B3CA 2XTMA 2A9KA 1WB9A 2YC2C 2X77A 2HF8A 1VCNA 3NC0C 2IYVA 1W36D 1LNZA 3GLHE 3RS0A 5FUYA 3QNUA 421PA 1W4AA 2G0NA 2ZAOA 4B3GA 5HCIA 4RFSB 1XD2A 1NN1A 3B1XA 4IFEA 3SR0A 4QGFA 3TGPA 1N2CE 1OF1A 1ZM4A 1GOTA 1PUIA 3LVRE 4IDPA 2VL7A 2W58A 3ZVNA 5JJKA 2QSYA 4HLCA 4KBFA 3SN6A 1R2QA 5LPNA 3AKEA 2ZM5A 1G8FA 4JL5A 2GJ8A 2IXGA 1UKEA 3HU1A 1NJGA 1J8YF 3RS7A 3AM1A 2V1XA 1VG8A 4Q19A 3QVVA 3T12A 4F91B 2UZ3A 4KODA 2AWNA 1G20E 1H8EA 3RRMA 1OE0A 3GJXC 5TARA 2GCOB 4LOAA 4M9SA 1VCIA 1N6LA 4XOIA 4MRPA 1T6NA 1W7AA 5CJPA 3A58B 4TTRA 2ODBA 4MUAA 2JDID 1KI6B 1IJFA 3GJ6A 4TYPA 5AUPB 2BM0A 3SE0A 4B2PA 5KSYA 2GESA 1E9SA 1VG0B 2D74A 2R6GA 2ZJAA 5F98A 2G6BA 5FOVA 4JYCA 3RWMB 5DHFA 3CNNA 1JI0A 3N70A 4GZLA 1V43A 3L0OA 4IEIA 2OM2A 4Q7KA 1AZTA 1O3YA 3TUZC 1RVDA 5JMTA 1KDOA 1ZU4A 4FWTA 1MKYA 1T8TA 2X2EA 2H7VA 3R9XA 1II8A 2GEDA 2J7PA 3ZJYA 1PVOA 1P9RA 1DARA 3AVQA 3L2OB 4DCSA 1PLKA 2F3RA 3QEOA 4MYCA 2IX3A 4Q5IA 1W48A 2BDTA 4CF7A 4OK3A 2CJWA 5FI0B 2FFBA 3T61A 4OQXA 3OAAA 3NBXX 1JBKA 4X8HA 1NF3A 4GRAA 2O0HA 1NVUQ 3EA5A 4Q7LA 1KI7A 4M1WA 1QVRA 1P2UA 1RYFA 4B47A 4DCNA 2PJZA 5EZ5A 1P4SA 2VBCA 3HR7A 1NVVQ 1G7CA 1L4UA 2PCJA 4JLNA 3B1YA 4NE2A 2IYUA 2N46A 2YNMA 2ZJ2A 3ZS9A 3FTQA 1L7VC 3PVSA 4ZIRB 4C7OA 4AG5A 2QPOA 2JA1A 4JSTA 3I8SA 2ZRLA 1HA3A 4FN5A 3I8XA 3IIKA 1Z8FA 1OKKD 3DMDA 4QHYA 1P6XA 4PQYA 1OB2A 1GRQA 1MV5A 2ZU0C 1NN5A 2NGRA 2ZYVX 5BXQC 3IGFA 1QRAA 3Q72A 4JLDA 3A4LA 1JR3E 2ZRKA 3OEHD 3QF7A 5JSZB 2IEYA 1CIPA 4LUCA 4LBWA 4Z8YA 4MYUA 3SJZA 3BXZA 4B3DA 2VIIA 5C2JB 1BOFA 3TBKA 5FTLA 4GMDA 1HY3A 4HB4A 2WWIA 1E2IA 4IKEA 3WMGA 3C4JA 3P27A 1YE8A 3T1OA 3DHWC 3NDPA 5CM8B 2YYZA 4OHZA 3UMFA 1TU3A 3CW2A 1P7CA 4DSNA 2BBTA 3BRWD 1KDPA 2QEQA 1G41A 2OE2A 5CLLA 3K9NA 4URZR 4M1KA 4PHFA 2JJ8A 5SZJA 2C9YA 4WOPA 2N42A 5L3QB 4P31A 2JDIA 3THYB 1XD8A 2Q6TA 3BH7A 1ZU5A 4PSVA 4B3BA 1I4DD 3PEVA 4A8JC 5G3ZA 4DXAA 1R8SA 2ZRHA 2DFTA 2WJYA 1TL7C 2ZANA 3K9HA 4A2PA 4CDGA 2IXEA 1FTNA 2BBSA 1U94A 3FFAA 1AJEA 5A5GA 1F2TA 4A0HA 4BLQA 4PSKA 2J1LA 3KKOA 4Q1EA 3B78A 1LS6A 3DO6A 2QMOA 3L8ZA 4GMXA 1GWNA 3NH9A 1US8B 5E95A 3LY5A 2J0UA 1G7RA 3P20A 2IS1A 3Q3JB 4Q03A 2RAPA 3LVQE 1T0JB 4TQUS 2E87A 2QTFA 5FUXA 1P9NA 3BAFA 3KJGA 4FD2A 1KOFA 2CEAA 2C78A 3VNUA 5BN5A 4KITB 2QBYA 1F48A 1W5TA 1P2TA 3TH5A 1J2JA 3KX2A 4NU0A 5FPSA 5H68A 5BN3A 2BVNA 1SVIA 4I1UA 3QKRB 4B74A 1TQ2A 3KQKA 1W2GA 4U7DA 3AVUA 1RRPA 1ZINA 4JLPA 1EFUA 2Q9CA 4LBYA 5FL7A 3W34A 5EE3A 1RJ9A 4US1R 4DLYA 2KJQA 5JI2E 1XTJA 4BEJA 4WVFA 2P5TB 3WYFA 4OI1A 3SQWA 2V6IA 1JECA 2H5EA 3U60B 2RHMA 3TK1A 4XTCS 4DDVA 4JYBA 1R0ZA 3UATA 1GKUB 1OXVA 4LJAA 4MKIA 5BN4A 2O8FB 1XPRA 4W5JA 4POAA 3GCGA 1E4YA 4JKIA 3U3RA 4ABYA 5FUWA 1HE1C 1J99A 2FMXA 3GMTA 1IY1A 3CBQA 1EK0A 3ZIAA 2J0VA 2ZQ5A 3A1SA 4TZ0A 5HE9A 5CJ2A 3WNDA 3U4QB 2O8CA 2XNDD 2J7KA 3AGQA 3ZVLA 5D3MB 1KSGA 1DO2A 2O0JA 1HEIA 1FUKA 2RHDA 4BRWA 4O2RA 3FHOA 4LC1A 2D7DA 1FZQA 3FE2A 4D6PA 2QGNA 2X1VA 4L15A 5FBQB 3CPHA 1FTSA 4WZAE 4HAUA 4US2R 3TSOA 2RB4A 1A1VA 2C03A 1ZNZA 5FBLB 5H1YA 1K8RA 3VKWA 3KUDA 2IYYA 3SHWA 2D7CA 4D4LA 1XEXA 4LJ5A 3VKHA 1OXUA 4BZQA 1E3MA 1XD9A 1AQYA 4CEIA 3A1VA 1RPZA 2GTPA 1XCGB 2Z4RA 2QI9C 2IYLD 2OFXA 5B57C 1SHZA 3MG9A 4B73A 4LHXA 4Q66C 1XTQA 4RCZA 4P32A 2BMDA 2OLKA 3D6TB 4A2WA 1N6RA 2EYUA 3BIFA 2AHOA 2NMVA 4A6XA 2QZ4A 1R0YA 3REGA 2NPFA 1ZD8A 1LW7A 4KU4A 3EIEA 3VMFA 4KYUA 1I2MA 1T91A 4EJSB 5KNBA 4B75A 1OV4A 2XJ9A 1HV8A 1FPMA 1GNPA 2VH5R 4FWIB 3HR8A 2XOKA 2H16A 2LWIA 3CWZA 4PZLA 1WE2A 2W6JD 5ELXA 1G9XA 2YWHA 4B3XA 3U2QA 1LF0A 1R0WA 4NYMQ 2GVDC 4C0BA 2NO6A 2BMEA 1OYWA 2V9PA 3I1FA 2XZLA 1XJCA 1YU9A 1OIXA 3GJ8A 2IBMA 4GOKA 1KYIA 4A0GA 2ZRMA 1FMLA 4MRRA 5DGXA 3EIHA 1OHHA 1DAKA 3ASYA 2I4IA 1OLOA 4M1OA 5CM9C 4Q01A 3GEIA 4F92B 4CEHB 3W5JA 2VF7A 4BFTA 2TMKA 4PC6A 4BLPA 4YLGA 5G41A 1BIFA 1IN5A 1YZTA 1QHHA 2NG1A 4LRWA 4P4SA 5B64A 4GOJA 2B8TA 3LDAA 2GZAA 3GJ5A 1F6BA 2EW1A 2CNWA 4QHTA 1T4GA 1Q1EA 4RZ2A 2WSSD 2F6RA 2CDNA 1CRPA 2HV8A 1YZLA 4MGIR 2AXNA 2YOGA 3AVPA 1YHNA 3AF3A 3Q5DA 4KXFB 2Z4SA 4TMWA 5J40A 2YHSA 1GG2A 3ZZ0A 4ARZA 3G0HA 3V4FA 4Z1MD 4TLCA 3FKSD 3ZZTA 5AUQA 1CXZA 4FINA 4KSBA 4DDTA 1NSTA 2EQBA 4BEBA 2RGAA 1SHKA 4IRUB 1J8MF 1VDZA 2CHGA 3GD7A 4S2EA 2AX4A 2C98A 4EDHA 3J81k 1NVVR 3DPUA 3LH5A 3P26A 2BCGY 4EFLA 1RRGA 4Q4AB 4JL8A 5FUVA 3HP1A 1P2VA 1NVXQ 3O8DA 4ON9A 5KPJA 1KZGB 3I61A 3IQWA 3MWKA 2ZU6A 4NKRA 2KE5A 3CF2A 4KSCA 3WYGA 4IHQA 3DVLA 4A82A 1FX0B 1X8JA 2BMFA 2PLFA 4PX9A 4IDHA 5BW8A 2VP2A 5HTKA 2OLJA 4JLBA 4YXWD 2WKRA 4Z51A 4XD7A 5EXXA 1L2TA 3LWNA 2GZDA 5CIQA 3U3MA 3EZ7A 4QKQA 3BORA 2OHFA 3TAUA 1CU1A 1Q1QA 2D62A 4JJZA 1GL7A 1GL9B 2R62A 3GEEA 3SHFA 4KHZA 1MT0A 1RYHA 4LV8B 4N0EA 3V9PA 2WPDD 3L0SA 5JRZA 4JBWA 4TTQA 4N3NA 2RGBA 1N5IA 1JJVA 1BKDR 2WMNB 3N2EA 1TADA 2GCPA 3B13B 1NP6A 4G5RA 4JKYA 1F2UA 2PT5A 3QBTA 3K0FB 4RCYA 4MA4A 4A15A 2P2LA 3FB4A 1W4CA 1PZNA 4LV6A 3T5GA 3T34A 4LCBA 4EPYA 1TQDA 5FBWB 2ERYA 2YVUA 1Z2CA 1YZGA 721PA 1Y63A 2JEOA 3JZAA 1WBDA 1SVWA 2O8BA 8OHMA 1DBSA 2QAJA 3CRW1 4M22A 4LJ8A 3B8HA 3NBYC 4CZ2A 1G6HA 4DZZA 4ZCLA 2BJVA 4XWAA 5AJVB 1K5GA 1NIPA 5HR5A 1QHGA 2VHTA 1CKEA 1M7GA 3GP8A 1MOZA 4IFBA 5IHPA 3ZD7A 1MABB 1XDBA 1R8QA 2ZTSA 4K8OA 4PPNA 4UNNA 2YOFA 3IIJA 4XSGA 3KL4A 1EWQA 1XJ0A 2P0EA 1Z6YA 2W83A 2WJJA 4A0RA 1XPUA 4O0MA 3U61B 2QUZA 1SKYB 2VSOA 4M4SA 3CLVA 3ADKA 1OFTA 4HAVA 1GRRA 4JBXA 1X86B 3SQXA 3JVUA 3ADDA 3KB1A 3QOFA 4RD4A 4C2UA 1P61B 2WWWA 2OSBA 2O0KA 2ZSEA 3MUFA 1H8HA 1WF3A 3W8NA 4HAZA 2PLRA 4IOJA 4IXNA 3FHTA 3IEUA 1Z08A 4ZPXA 4Q18A 1G291 1N6IA 1RRFA 2RGGA 4LX0A 1MRNA 5CDFA 1TU4A 3BK7A 1ZMXA 1QDEA 3LAWA 1T8UA 3QKSA 2RGDA 1FFHA 4QHSA 3VTKA 5FH9A 4FCTA 4DLRA 2F43B 4ITRC 1VTKA 3AF0A
chains in the Genus database with same CATH superfamily
4CMJA 3S4YA 1IWOA 3MJSA 1WXQA 4PLVA 3DV9A 4URHA 1HDGO 2ZJZA 4OAOA 4IDGA 3H9BA 3V6MA 1R5OA 3IUPA 1W88A 1WETA 2HDNB 4RH0A 2Q4BA 3U3JA 3HBLA 4QASA 1OLSA 2XLBA 3SQLA 4AP9A 5K0FA 3FKJA 2Q5LA 5DSXA 1ORIA 4DGSA 4ZCRA 4LQDA 3QPBA 5EQJB 5HQ3B 1NQAO 1XDWA 2B5OA 3OZ7A 5JZOA 5JFGA 5IK2A 3B3AA 1NN0A 1MB9A 3HJRA 4N5LA 3B1VA 4Y6QA 4ZZ0A 3DTNA 2IHVA 3FDZA 2VDWB 4H6PA 4H7HA 2GZSA 4JBHA 5C5CA 4IGEA 5IJ0A 4LVUA 4JYZA 3O92A 2V98A 1U2ZA 2P9GA 2VG8A 1GGKA 3M49A 1XRRA 2ZIXB 1PIWA 1Q6YA 3HCBA 4UFOA 5DU2A 1CRZA 1DNPA 2FVXA 3PZBA 1KF0A 1TUIA 4FMDB 3PLAE 3QA3E 4A8JA 1J1IA 5AH0A 3U7QA 4C20A 4K28A 3T7RA 1VM6A 4FNMA 3OE5A 4JSRA 4TN5A 1AMNA 3OT1A 3V3KA 5DTIA 5E6RA 4PANA 2YUTA 2MMCA 1NQTA 2B25A 1EA7A 2QTLA 2JASA 3R3ZA 1GGFA 1XROA 2WABA 2AR7A 1MNQA 2XUIA 1C1DB 1FFSA 1R8YA 1ODTC 2YVKA 3FOBA 4K05A 4BTLA 4G85A 4ENWA 3BRSA 4OHYA 4BB9A 1AGXA 2HWWA 3DF7A 4IMJB 4N1AA 3GRRA 4XWGA 1G66A 1LZKA 5D00A 4DNQA 5J5VA 4OL9A 2BKXA 4PC2A 1HE8B 5KYGA 4HDOB 2OD9A 2ZJ7A 4WNAA 5P21A 4BRZA 4MPJA 1J2EA 1RYDA 4JYPA 4YJ3F 1V0JA 1FQOA 2HIMA 3MWFA 4CCWA 5TGDA 3V4RA 1ZJ4A 2SHKA 1WQ1R 1WEKA 2XGOA 4DC9A 4CKBB 3E9CA 4IGIA 3TN7A 3C7AA 4FTWA 4D57A 3GLHA 2CLCX 4COKA 4YMWA 3NWEA 1L7QA 4QAJA 5F2EA 3R9KA 1B2LA 1G2OA 3DKRA 1S2OA 3MQ2A 3W90A 3NRCA 1T9DA 3K5PA 1DCTA 1YKFA 1EX7A 2O3SA 3HJNA 1G1AA 1IJKA 4PHTA 4V1CA 4K9SA 1K9VF 1CBUA 4FBMA 5HZGA 4DBLE 5KTTA 2REQB 2JFUA 3QU2A 4G89A 1X7ZB 2PGAA 5EE0A 4BP1A 1T2AA 5B3KA 2H1LA 4XSHA 1O87A 5T4HA 2QLLA 1ODJA 1FBNA 2ENWA 2W4MA 3CZPA 5D3QA 4XWYA 5ITSA 4UHCA 3JQDA 1HE3A 1H94A 1JI3A 1SBYA 1XEWX 2MSDB 5FRDA 3SBEA 1OFIA 3UJ8A 4J8PA 3IESA 3QK7A 3M9LA 3WHLA 2ZYGA 4NZZA 1G20A 1DO8A 4JJ4A 4IUBS 1NXWA 2UYYA 3ETLA 3ND9A 2IDZA 4J0GA 1Y7LA 4URXR 3ZLUA 1T5HX 4PS1A 4DVGA 4FT2A 2GKGA 4KO3S 2JVIA 1WUTA 5BSTA 3W79A 1UP6A 2AYZA 2A9PA 4ZYUA 1N4DA 2RGXA 2WUVA 3RVNA 3LW7A 4B43A 4YWHA 3EHEA 3F0TA 5DI9A 5IDQA 4P35A 3E15A 1NMYA 5IJXA 4QRDA 1RT9A 4X45A 1C9KA 1WIWA 1HDCA 3KZNA 5DTRA 3IIEA 2H4FA 2O05A 1C1XB 2E18A 2B1QA 4ZEOA 4G5GA 2R68A 5NLLA 3M33A 4Q9IA 1DMSA 4FR0A 2M6KA 3PQ5A 1AF7A 2Y0BA 1N5JA 2Q41A 4MVXA 1BU5A 2EX0A 3DULA 3O1HB 1VHTA 2IEAA 4NICA 4TT8A 4QTYA 2PJRA 2QD2A 2AW5A 1DTWB 3VDMA 4S05A 3C5HA 4F8YA 3GLGB 3DAFA 2B21A 2PO7A 5LP1A 4CI9A 4FBGA 1JLLA 3WKEA 3G88A 4F5EA 2OG2A 4B31A 1IATA 4F60A 1WNTA 2FZGA 3MIIA 3O2QB 2JEZA 3EXG2 2EW2A 2OXCA 3E3OA 1JQ5A 2W2PA 2F64A 4AD8A 1ZJZA 1Z6AA 5H59A 4D9HA 4OQ4A 4C6HA 1W73A 2ZT8A 1CJSA 2CHVA 3ABZA 3WGGA 5C4GB 5IDXA 1NW4A 3L9XA 1HEYA 4BLOA 4EH1A 4DV5B 2QLFA 4RFSA 4B3RB 1G21B 1XU4A 1Z82A 2A5GA 2V96A 4R3UC 3OU6A 3SG0A 1BMFA 5CLGA 1DBPA 4HQ0A 1WZCA 5EIOA 5LQRA 1BE0A 1W96A 2AFVA 3OETA 1F0NA 4FCWA 5JQGB 3S2EA 2PXHA 1YB1A 3VPGA 3ZV5A 2PMFA 2QRGA 5CLIA 3GJ3A 1TT5A 3U19A 1SHJA 3DLIA 3M6UA 2Z2XA 1GUAA 4I8DA 4B85A 4LHEA 1KEWA 2AGVA 3QKIA 1UKVY 4WLFA 3K0HA 4TYWA 2PUBA 8MHTA 5LQKA 2DU8A 4FDVA 4LZLA 5CBPB 2YR0A 4TRNA 1Y7PA 4IGAA 1TCCA 3JQGA 3KIPA 1CY8A 4M3NA 5B2EA 4RACA 2NPOA 2RIPA 3KC2A 1M6VA 3DMTA 1ZCAA 5ALIA 4EPRA 4AMVA 1SUDA 1W52X 3PI7A 3OC6A 1XQ9A 3IUYA 2GI4A 1QX4A 3I2FA 1OX4B 2ZWVA 4K6FA 4HEJA 4V0OA 1PR1A 4PRLA 3RBZA 3SXUA 2VWGA 3I45A 4HAWA 4UU1A 3DT8A 2CNOA 1U0TA 1VECA 2BSAA 4MW4A 3HLYA 3ULKA 3W6NA 1G7SA 2OMKA 5D6OA 1TXGA 3AERB 1BHQ1 1E3QA 3NWJA 3OE7A 3TUIC 3WB0A 4IG9A 4ZK2A 4QARA 5BMVB 3GLGE 3AB7A 2XYHA 3BDIA 1GJRA 3D1VA 3MMXA 4H7EA 3FWZA 1V4NA 1TZBA 2CFCA 3KVOA 1J0AA 4PCLA 4EK9A 3QKTA 4MQFA 4KUEA 3V2IA 1J2YA 4Z9AA 3RT7A 2Y67A 5HUQA 1G8KA 2EV9A 2I8AA 2Y0DA 4LPSA 3CO5A 3R5FA 1JMVA 1SU7A 4R54A 5JLAA 4EW2A 5IU6A 4RJIA 4EYGA 4QYWA 2NU6A 3EFOB 5COQA 3QXJA 1SXIA 2A5JA 2YXNA 1RNLA 2XMCA 4ZAWA 2HMUA 5DHAA 4B4WA 1V1RA 1RU3A 4Z7OB 4NFSA 4KYTA 4QFCA 1EIWA 2CXNA 4YDQA 3NHPA 4MUYA 5CX1A 1QVWA 3NAMA 4ARIA 4G09A 1ZK2A 4K6GA 1P7VA 1G21E 3GG2A 3NVKI 2XQFA 2POCA 3TR5A 4FNGA 3QFFA 2CBXA 3F47A 1E5XA 4AMYA 4EBBA 3HXMA 1RBMA 4IVQA 2RBEA 4ZIRA 3DE4X 1TO2E 3EG5A 1C7FA 5A4FS 1Q0TA 1XXHB 4OHWA 1B26A 3VR6A 4FOOA 5EZSA 5AOBA 3T9DA 3T4EA 1E7MA 4MO9A 4WOKA 4E31A 1O96B 1QLHA 4WK4B 1PZHA 2XOXA 1NRIA 2I99A 4CTOA 4G4SO 5FWDA 3KXDA 1GCGA 3QPDA 1LSOA 3GJSA 2DUUA 5JISA 4DBLC 2QMHA 5JCXA 4ROSA 4TS9A 3ETNA 3WQBA 4ILEA 3FCYA 2Q9AA 2Z9BA 4NE7A 2FCAA 4MV3A 1OI2A 1G98A 3ENQA 5TQ2B 2G0AA 1GADO 4FNAA 1DTSA 6YASA 4KR7A 4ECEA 3QG5A 1FQWA 1XKXA 5EP2A 1LNSA 2QR3A 1RVV1 3RROA 3UMSA 4LXYA 3PXCX 3ZIAD 3ZYCA 5LA6B 1VG1A 4IVNA 3LY9A 3S2SA 3NAGA 2O7RA 1GFIA 1F9EA 2ISQA 2W2QA 3KYDA 2GXAA 5IVPA 1DPFA 1VPWA 1KSJA 2V7PA 4XDHA 1FDOA 4E2WA 1ULSA 1PKEA 3VH4A 2FG6C 2QN7A 3F74A 2GZ1A 4EQZA 3EVDA 4MVCA 1M2JA 3IPXA 1V3TA 1Y4DE 4Z54A 2PQ2A 4L28A 4DN6A 2CUKA 3HUDA 3OFSA 1L4EA 1RQRA 1BWQA 1G3QA 1XZHA 4G81A 1NONA 4ZZ2A 2ZZMA 3H5OA 4EG5A 5H1YA 3DWGA 3JWIA 5JCJA 2R8YA 3K16A 2XAUA 4DBVO 1D6JA 4ZV7A 2FEOA 2FSVC 1FSSA 1HYHA 2JFVA 1X1RA 4JOSA 2P2YA 4DQXA 1IUNA 2O5CA 4LC9A 2EKBA 3KHKA 1D2EA 2YFQA 3AM3A 3PL5A 3KPWA 4DCCA 2K5UA 2ZPTX 4RL6A 4C05A 4UHFA 1Y48E 2ZIAA 2OORA 3R7WB 1FMCA 3QPUA 3IULA 3KR9A 2ACEA 3ZE9A 2Q4RA 5A4MS 1ZD1A 1K75A 3RSGA 1FFAA 1DRKA 1H2RS 1XXHE 2F3PA 4YONB 5M3BA 6GPBA 1GSAA 4RGQA 1EFKA 1DI0A 2HUNA 3ENKA 3LQ1A 1JDVA 3COWA 4NCNA 4RPIA 5IDVA 1K7SN 2X13A 3ROXA 2MT9A 2BFEA 3BRQA 2OY0A 1C9MA 3QEAZ 4MH0R 3KUUA 1N6HA 1IU9A 4MUBA 1WU7A 3MTDA 3WB9A 3AJDA 1G2PA 4C6TB 5ICSA 1ULZA 2P5YA 3HZOA 4MLCA 5KNBD 5KWEA 3OJCA 2NSJA 1JHDA 2WLSA 5CT9A 1TMKA 3I72A 4C5BA 1GDTA 3VHRA 2O1WA 4IHJA 4A6DA 1AQIA 2C92A 1JMKC 2IW1A 2QK4A 4UM9D 1W0KA 5CXUA 2H2FA 3FFXA 2WWFA 4D79A 4CMGA 3RK4A 3P9NA 4R3WA 1KBQA 2GEJA 1PTJA 1DRUA 1KYVA 2AOUA 3PR1A 2WF5A 1I6MA 1M2KA 1JQ3A 2AN1A 2AZTA 2JB9A 2LTAA 2O8FA 1LPBB 3MT9A 4HLUC 4UW9A 1U8UA 1YL6A 2MMGA 4JK3A 3VO1A 5CEJA 2XT6A 1EBFA 3DHYA 4IHAA 4K26A 2QRMA 4Q00A 4R9SA 3VDRA 1XV5A 3ZBQA 2Y3IA 2GR9A 2MSEB 3H1FA 4E1BA 3EXEB 1Q6ZA 2H9YA 4IZHA 5C4IA 2VJQA 3E4CA 5H5JA 2HPVA 4LQLA 1JP7A 2CKDA 4GKAA 4M9CA 2BMJA 1IZ7A 4S35A 1XDSA 3WJAA 1ENPA 2FUNB 3EBOA 1WHTA 4PO8A 1PWEA 3T94A 4TKUA 3AIKA 1WDKA 3HCRA 4PGGA 3A7DA 3TVDA 4S1OA 3P7MA 2O3UA 4WL0A 1X15A 4DXHA 3PQ2A 3SDBA 3U7EB 1XJWA 3QTBA 4H3KB 3IUQA 1W5AA 1UBMS 4DPMA 2J85A 4FGLA 3N6XA 1HWYA 3KAPA 4YH1A 5BWBA 3ZVMA 3FOZA 1PV4A 3B70A 3SZ3A 1GPNA 3PLNA 3QYPA 2OHOA 5B58T 3G8DA 4PZYA 1RBYA 3K0CA 3PLRA 3WNQA 5IZCC 1ZD9A 1O8CA 4DGQA 1D07A 1NKSA 3RVKA 3FXAA 3JQBC 4BPBA 1KDVA 5C1IA 1F3OA 1TVKA 1SN7A 3BD6A 2X3YA 3I6IA 3PI6A 4YTEA 5DNUA 1LJUA 4OG2A 3OI7A 1X7XA 5GTDA 1SOMA 2FMHA 2M98A 5GMOA 2P7IA 2C2HA 3BILA 1NY6A 4E12A 1MOQA 2WHEA 4IJQA 1L8XA 4IAOA 4MPDA 5TPWA 4CNQA 4XRRA 1KORA 4KQMA 4QUBA 5B55A 6REQA 3DTVB 2Q3LA 4NECA 2HLPA 5KJFA 1W2WB 1SB8A 4A6EA 5HS4A 3GEBA 5IW8A 3H65A 5TX7A 1BFDA 1R0CA 1P0CA 5TQ0A 3WDKA 1JB1A 1QCYA 2FPRA 3JYNA 3ABOB 4XD7D 5COAA 3E9DA 3OIYA 3BS4A 1JDUA 1BHO1 1S3SA 1SUIA 5GQSA 4FI3C 1VCMA 3Q7TA 4KJXA 4BNGA 3Q3EA 4EJSA 1T5OA 1SC3A 1HTBA 3MFYA 3UWPA 1Y8RB 1X1CA 2UYGA 2PUCA 1DIAA 1QM5A 2LKCA 2Y2VA 1YQWA 3MWJA 4RTQA 1ZVQA 4FMCB 3L7YA 4I9GA 3T0IA 1E1QD 2PANA 4L85A 3K94A 2Z8ZA 4N03A 4YYZA 3NG1A 3S5UA 1YS2X 1RQ7A 1I30A 5JJBA 4KPFC 5AXAA 2G25A 1ZNXA 2CDCA 4IQGA 5THXA 2NU9B 2PFSA 3MIZA 1QO9A 1AUQA 1V25A 4Y6LA 1ULBA 1VRWA 1QQAA 2J59A 2OV6A 3QKWA 4BFWA 4LHYA 3N6VA 4UPVA 5B58C 3AWIA 1WSBA 1B8PA 4RHUA 4QICA 4GOND 1O2DA 2R2AA 3W2FA 221PA 2HA4A 1RHJA 5HF9A 4URYR 2CN1A 3OSZA 4JD5A 4KRGA 1SUBA 1KVSA 3VYUB 1DQZA 2BGUA 3WMEA 2ZYUX 4X90A 1ZO8A 3K9BA 4IJWA 4XWKA 5CGQB 3TM4A 4D2IA 1UBUS 3WBKA 4NBSA 3EVEA 2X3UA 4GBGA 3FUWA 4N0PA 2WFLB 2ATEA 2A1UB 2G88A 1X77A 4ILKA 1YK1A 3GRKA 2D0IA 3WY9A 3E9EA 3T9BA 4OKNA 4NBNA 4F4UA 1XVUA 5F23A 4NHEA 1KI8A 1QTQA 3HN7A 1T9GS 5DT9A 1TF2A 4CQMD 3FPSA 3QX3A 1EJ2A 3RVQA 3PGLA 1Y3CE 2HNBA 3GT0A 3A6PC 1WDTA 2YFYA 1T5LA 1CNFA 3JQ8B 4OU4A 1OA1A 2GFHA 3FMVA 5JWHA 1L8OA 3JY6A 4ZT2A 3VAYA 4XVUA 4QGGA 3QJ5A 2FPIB 3UH0A 1NYTA 3KV1A 1Y6ZA 4BNDA 4Q34A 4EOGA 2QRVA 2PGDA 3NFRA 4MIOA 3IRUA 1P72A 1B1AA 3OJLA 3TMYA 1GVNB 2P7HA 2CZCA 3MUOA 4B81A 3H17A 1GHTA 4IWYA 1KC3A 1FX0A 3N58A 5FA6A 2Y76A 4L9SA 1YOVB 7AT1A 3RRXA 5DDIP 2Z43A 2BHLA 4E5KA 3KWJA 3R24A 1LVHA 4NATA 4MRAA 3ZU6A 4EHDA 8ATCA 1ISGA 1H8HD 2CJYA 2XDAA 5AI4A 2JIRA 2QRKA 4RJTA 3VX4A 2HHJA 2N9UA 3KS9A 1PI3A 5AI5A 4L8VA 2FRDC 3A6HA 4MVJF 4DQ0A 4P86A 3FMPB 5JATA 1Y1SA 1ZGGA 1EUQA 4BMCA 1GGNA 1ML3A 3PT5A 4MUKA 3I0NA 2DHDA 3ICCA 5GADl 4ZKEA 5K3AA 4D25A 4PR0A 3T06B 3TLEA 4YYEA 3IMFA 1SC6A 2VYVA 4KPUB 2HIHA 5BNTA 2QLNA 3W3AH 4RV5A 3PDIA 4EDFA 1K7XB 2DKNA 2QM3A 1EFRA 4R9VA 4V39A 4MYHA 4WADA 3RK0A 4V2UA 2CW5A 4GSLA 3RVSA 3UT5A 2WIFA 3FW1A 3D6MA 2YV3A 4GOXA 4IW3B 5TS2A 4AK9A 1J21A 4N7MA 1PU2A 3ECAA 1NQUA 5EEGA 4Q3CA 3E82A 2VKQA 4G86A 3ZXUB 4ESVA 1UC9A 2IUFA 3K0FA 2I29A 3VFDA 2VJMA 4MMZB 1LRLA 1QV7A 1XKLA 3HCOA 3OO1A 4W8OA 3HBFA 4R1LA 5A06A 3CO0S 3DLBA 3KKMA 3DZJA 5IK2D 5KSWB 4L6AA 2NPIA 4DILA 1CQXA 2IHUA 4G01B 5AKHA 5LMZA 1DGQA 3U4MA 4M6WB 1MD9A 1I3LA 4QTTB 3FHJA 4XEHA 3KKLA 3RREA 4E5SA 5SY9A 1Q84A 1BKSB 2CK3A 1QH8B 4CXMA 1IHOA 1N9GB 1P2DA 3HJUA 4YRIA 1YQQA 5A4JA 1JR6A 3NYWA 5AR1A 3PFGA 3T5MA 3ILHA 3WHKA 2XY4A 1OH6A 1LD3A 2W2XA 4BDSA 1BX0A 2W6QA 4BXOB 2OBNA 3ZJUA 3NHSA 3KJNA 1ND5A 3AHHA 5CUQA 4C7XA 4YA6A 1QPBA 4R7ZA 2XNCA 1NJSA 5JVDB 1VBFA 1XAIA 2G77B 4Z0PA 2ZB3A 3C8UA 3FOCA 3HFSA 4M1YA 5JSFA 3L0PA 4PQFA 1FA9A 2OAQ1 2QPLA 2VDVE 3ZN2A 3FNFA 2BWJA 2KS6A 3AVVA 2NOAA 2OTCA 4H3VA 4U0JA 2E4UA 4D74A 4WY8A 3AB8A 4F0JA 1VE3A 4R1QA 3ZGYA 4BWYA 3DEAA 4KREA 3TLGB 1IPEA 2VAPA 1FQKA 2WFAA 4Y98A 4RULA 2NXNA 3IBYA 1P4RA 2HPZA 3LY7A 4M0FA 5EJGA 1PZGA 1VE5A 1AN0A 2WDZA 4C4SA 3FMOB 1J09A 4FN4A 1L5ZA 1NM5C 2YUIA 2ISCA 3GRFA 1JXQA 1EDOA 1PZXA 1E98A 5DV9A 4L78A 2FDRA 3GLFB 3D0OA 3GR6A 1FDTA 3IR5A 5B53A 2NNLD 5AHKA 3SU8A 2XLCA 2B30A 4HKTA 2A1TS 1LBEA 1FNMA 4CDRA 4M8SA 4F3RA 1XNGA 5EXSA 3LX4A 1ZESA 1XTKA 2XRYA 3LUDA 1E3WB 3EULA 4AU1A 1UDBA 1TM3E 5IJZA 1QP4A 4OF4A 3CJTA 2CYAA 3TRHA 3V7UA 3HTXA 3R9WA 4J75A 4UAGA 5D2CA 3GT3A 3OOHA 2QW1A 1FRFS 1LTHR 4HDMB 4Q9LA 4MWBA 3H1TA 4RVCA 3ESQA 3UIEA 3UMBA 1Q22A 3EWIA 4EABA 1E1RA 3H1BA 2BN4A 3PTZA 4D3XA 4MYDA 4F3KA 4Z1OA 1A4RA 2PGJA 1G4UR 4BZPA 1X1SA 1UBKS 4FZ5A 5EYPB 2IOFA 4NPHA 1NF2A 1G8GA 4LDNA 4IZOA 3I6ZA 5C81A 1LWOA 2QLMA 3TIXB 2QG6A 5KX5F 1Q7RA 1ZLYA 3LFUA 3U80A 2CXQA 4YJ2F 3QJYA 1Y5NA 4KB5A 4TRJA 1CSEE 5G3YA 2RGWA 4EJ2A 4WZBB 3OWOA 4XI9A 4ZP1A 2QKYA 1V7CA 2SKDA 5EJIA 5IP5A 3VNBA 1VA4A 4L2IA 4BQNA 1N2EA 3EGXA 3TTVA 4UAJA 3VYTB 5LQAA 5JJLA 1YJQA 4JEIA 2F62A 4U1RA 4WTOA 2PAFA 2CXPA 4H3SA 4E5PA 3U6KA 1D7AA 1Q7TA 5GZ6A 3G6WA 3DEFA 1P62B 5CMLA 1M0SA 4YJ3A 1PJ8A 1ZXLA 4KBYA 2R6JA 4GYKA 1DC6A 1P77A 3P32A 4QREA 3S44A 5LB4A 3UY4A 3W1EA 5IASA 3FOFC 1JFSA 1FS4A 2ZREA 4AM8A 3GY0A 5HGJA 3KETA 1M0WA 1AZSC 2Y68A 1QYWA 5A1TA 3WWCA 4ZVTA 1NQXA 2HPHA 3GLKA 4D9EA 5ADUS 4ZT6A 2VPTA 3EQ9A 1KMIY 3K72B 2G8LA 1IFXA 4CL8A 4DIDA 2BEJA 3EK2A 1NVWQ 4YCDA 2A58A 5KVQA 2YJ5A 2Z6UA 1FX1A 4D46A 3CPSA 1REQA 3C41J 4IJ6A 2F8TA 4BWVA 3WLEA 3GAZA 2DBYA 1SKUA 2WKSA 4DWWA 3GLFE 4BKUA 1B8UA 4EO4A 4AKIA 4Q4LA 4OXQA 4DIBA 2Y71A 1N2BA 1A2BA 3L7OA 4UXIA 3RUAA 5IJ0B 3WP0A 5JYDA 4PZUA 2WC1A 3QLVA 4W5WA 1QYVA 3AEUA 4WOCA 3UMRA 3UJ3X 2DY0A 5K3FA 5FORA 1Z6XA 4ZMBA 3TW8A 4RTMA 1D3AA 3HJHA 3JQ7A 5FFFA 4B76A 4FP9A 1YD7A 3CVOA 3NW9A 1NLFA 1DXQA 4HNSA 5LP6B 5DN6A 3HXLA 3EWNA 3ENVA 3U7QB 3ZIDA 4EG8A 3U48A 3MT0A 2PIDA 2W6CX 5DTJA 1ADGA 2PZGA 1G3RA 5J23A 1DC8A 5EXPA 4X65B 1O95A 4GBJA 3PCXA 3A1TA 3EA0A 3HFJA 1M1NB 3AOGA 4K2HA 4RHEA 1W25A 2JNWA 4LJYA 5E7JA 4ZT7A 5IN5A 1WAMA 4LBVA 3LBNA 1TGVA 1M73E 1TM1E 1ILWA 3FWNA 3C8DA 4R40A 4N0DA 3EX7C 1W30A 1U2GC 3PFBA 1O1YA 2FZKA 4O29A 4M9QA 5L3SA 4PX3A 2G4VA 4A0SA 4Z4HA 4BFUA 5LQJA 4MV1A 4WZBE 5B37A 2UV8A 2AKEA 4JUFA 4ZYWA 1DVRA 3BE4A 1V3UA 4RKRA 3SR3A 3VMMA 1G64A 1UINA 1E9EA 2CHFA 2AL7A 1HGXA 1Q15A 3V7YA 4MI9A 2HA3A 4C08A 1HZZC 3EEBA 4EFMA 1WW3A 3CJQA 4OREX 3VU0A 5I6DA 1E6CA 3FFWA 5KJ1A 3NTXA 1VMIA 1F8FA 1HO3A 3ANXA 3I1YA 3JR7A 4OM8A 2ZJ8A 1EE2A 2W2LA 3IQEA 1N2IA 3JTEA 1S2DA 3OE7D 4P4TA 3QLTA 5CB6A 4MQUA 3DE0X 1NPTO 5KTOA 1EHYA 1XDZA 1AH2A 3PUVA 4LWZA 4QOSA 2P2NA 5IJ9A 4U3JA 2UZ1B 1XLWA 4MAAA 3RU3A 5IXJA 4AF6A 4NYIR 3B3FA 3NNDA 1THMA 4DIKA 1SRRA 1YQXA 1QQ6A 2AG0A 1AKWA 4ER3A 2NQTA 3ESXA 2YH2A 1PSDA 3D0RA 2X8AA 1YNOA 3FNHA 3ONVA 5L3ZA 3AVOA 3CRMA 5F9FA 1BRMA 4X5OA 1H6AA 2AOWA 1IOLA 1TJ3A 1F9AA 3AI2A 1G20B 1UBCA 3SC2A 5CR9A 4G56A 5KWSA 2UU9B 5CTAA 1MO5A 4H7KA 1X13A 4ALIA 5D5PA 4RWEA 2R2GA 1UWCA 1LNQA 4Z2YA 3DUFA 3IAEA 1T3ZA 2ON6A 4AQYB 4CTKA 2P6OA 2PS1A 1JQBA 3FNBA 4QTXA 1R5BA 3LDGA 2JK0A 3VR6D 5YASA 4DT1B 3OPVA 4DCTA 4GKVA 1MUUA 3IBGA 1J70A 4GLLA 1L4BA 4H1UA 4P36A 3IXLA 1UM9A 2RFLA 2WHQA 4HB0A 3BFXA 1T3LA 3QY0A 4ZEWA 1N6KA 5SY6A 2HEGA 2OHVA 3KHSA 4IM7A 3UK0A 3F4LA 5EKSA 2P75A 2HT6A 5H9WA 3ZQ6A 1IOVA 1CUJA 1IEWA 2I7DA 3UCFA 3ZNQA 5JO9A 1I4EB 2RJOA 1LRKA 1SOVA 1VKOA 3A9WA 3E22B 4RXUA 2Q5OA 3LHIA 2IYRA 4QUDA 5EFOA 3TWOA 3MYRA 1DAOA 1EG2A 2JGEA 1HTWA 2WIGA 3KQMA 4WN3A 5A0FA 3UXHA 4A9AA 1A82A 1E5QA 1Q21A 2I67A 1GPYA 3QELA 1CZRA 1DUSA 3R5JA 5F77A 2GK4A 3A11A 2GD2A 2WUFA 4DB4A 1JN0A 3TLAA 2ZYIA 3PFHA 4AUKA 1R1DA 2HJHA 5CCDA 1MR3F 4IJUA 2FWRA 3MGGA 4LTNA 5DH9A 3T9AA 1FZTA 5ALQA 4ND8A 1WSDA 3INNA 4ML3A 4HN2A 1B15A 4JX9A 5HBRA 2P35A 4NU8X 1SCNE 2ZI9A 4NOLA 4GC9A 4ZCIA 1CULC 1TOAA 4MR7B 3WZ2A 5LYJB 3A4NA 2WWHA 1USKA 2HBZA 3BULA 3DWIA 3R5SA 1FYWA 3KE8A 4M53A 5K1ZA 5I7EA 1JPNA 1OIVA 1QSGA 3KU4A 4GICA 2WB2A 1KYQA 3H6GA 3RC1A 3NTOA 2B1IA 3FCAA 5CW1A 1PLLA 1XZQA 3DBRA 1SD2A 2JIPA 3LTEA 3FPLA 3D4OA 3GXOA 3N59A 1FFXA 1G8PA 3TMKA 2IH2A 5ALDA 4BE4A 2WVJA 3OMLA 2Q0HA 5THKA 1RXIA 3G9TA 1NYLA 2GLXA 1CHNA 4C29A 4DC0A 4DPLA 5MHTA 1D2MA 4TS1A 5FKJA 2AOXA 3JASB 2OO3A 3NDJA 3K2EA 5FP0A 4CT4B 4ZI3A 1ZA1A 1IHDA 4UTPA 2EU8A 1N0IA 2J30A 3PNMA 2QE7A 1LUAA 2VQ3A 3DOEA 4KAXA 4PLTA 2GUGA 2CV2A 1XVLA 2IJGX 1HQDA 2VJKA 1I4LD 1I0LA 3K0AA 4IXDA 4TQGA 1FW8A 3WMFA 1I13A 1FU8A 2EEPA 4KQKA 4WJLA 2FN8A 4KWHA 1ZZGA 2QPAA 4G9EA 3OP1A 3ZHRA 2ZVQX 2JI8A 4DY6A 3S1SA 2V7XA 3L1HA 1TM2A 3S2UA 3HGMA 4O0LA 3GDOA 2HJSA 1DAPA 3SR4A 3NEJA 3TTUA 1R6AA 3P9YA 3E18A 3SZMA 1IAQA 4Q9AA 2FOXA 4LF6B 3NTVA 3O2SB 3FUUA 1IK4A 1ODIA 3AUSA 1GRNA 3HO8A 4KE9A 1F14A 1YH3A 2AI2A 4JC8A 2AA3A 2CD7A 2GILA 4J4HA 1OT3A 2WU0A 4MJLA 5DEOA 5TMEA 1W0KD 3VNRA 1YA4A 3V1UA 1WQ3A 1N8NA 1P5ZB 3J7TA 1BXRA 2X42A 3H8VA 2B9VA 4N5IX 1V5WA 4KO1S 4TLMB 4YQFA 4KIWA 3DG9A 2XQVA 3HKCB 4L08A 1K3TA 4K6CA 4J91A 1GAEO 2IY7A 4J07A 1CS0B 4AJ1A 4JAVC 2HRZA 3TRDA 5BR4A 1UP4A 1M66A 1SC9A 1FYEA 3B7GA 3LX6A 4CVNA 2OBXA 2QWXA 1P44A 3WNZA 1JLHA 2XNHA 4BMSA 3CF0A 3H1AA 4ZRNA 1Z83A 3ORYA 2H2WA 1MT3A 3V8EA 5KI6A 5UKDA 4TSKA 1E4EB 3NX4A 4MIYA 3OFVA 1E96A 2BKUA 4IFIA 3AIMA 4QPZA 3H83A 1SUCA 3Q8WA 1PL6A 2QMUA 4BTEA 2HMSA 3BSWA 4GNRA 4PN7A 4NZPA 3AF6A 1Y3HA 3GX1A 5ADVA 5HF6A 1KBZA 3R74A 5BRAA 3EG9B 4O2LA 3ZWAA 1R4MA 4G8BA 4RETA 4OGFA 2NSLA 2VZ9A 5C53B 3MTAA 2QM8A 4EG1A 1JHXA 3LP6A 5CW2A 2GUWA 1OWMA 3PPXA 3EOZA 3S7ZA 1QYDA 4HR7A 3JALA 3QF4A 1NMZA 1KERA 2C29D 2ZRAA 4EY6A 5LIRA 3ED5A 1CY4A 1I5RA 1Q7BA 1CEQA 2CF6A 1UT5A 2X8JA 4QX6A 5BP7A 2HQBA 1E0JA 2AEEA 4XA8A 3A2KA 1SCUB 3THWB 2OHJA 1T9GR 1XDUA 2M32A 3VBEA 1QB8A 1NW7A 2X6TA 2Z57A 4MQ5A 3BBLA 3N8KA 1NUTA 1XL1A 2D3WA 3MQFA 4WNYA 3UJHA 2O1SA 3NANA 5AW4A 5IDWA 1JAYA 1G5QA 1YCHA 2VPYA 3QUSA 4PZ0A 2X0DA 1SXPA 5IPFA 3KYDB 3HVUA 4QPPA 3HH8A 4KG7A 4PYRA 4DANA 4KVGA 2OCXA 2HT1A 5IF9A 4OD0A 3UT6A 2QP4A 5KQPA 4W5TA 4UU0A 5KKCA 1ODCA 3KKEA 5JALA 2PV0A 4F9EA 1MEJA 5C32A 4FEGA 4TQAA 4GLJA 3DMGA 5LP6C 4WPGA 4MDYA 3RGWS 1KMQA 2J45A 2DKOA 3N0RA 3OC0A 5EWJB 3VC2A 1L9KA 1XBTA 5BV8A 3K73O 2NYVA 3EASA 1JG1A 3UUFA 3DXXA 3GGDA 2E49A 4FOPA 1J0EA 1QDLB 2V3WA 3JRWA 1V3QE 2KPOA 2WJGA 3QFTA 2Z5GA 2QRPA 4MA5A 4FYVA 5IDYA 3KKQA 3V8NA 3SHOA 5DM70 4QD3A 1K7FB 3I62A 1M8GA 3E2PA 3PYMA 5A3RA 1ACMA 1JFVA 2G1KA 2O23A 2ZXFA 1KEPA 3VPSA 4PNHA 1JQLB 3AESB 3MPOA 4Z4QA 1U2PA 5ED0A 1Z0SA 1DBVO 2I7XA 4UCWA 3HYRA 3PP8A 4QULA 5LXTF 2QD4A 3LP8A 2IZZA 1RTTA 3FZEA 3KAKA 3P2YA 3TOSA 2FWJA 1Y1LA 3UQZA 4CHTA 2D4AA 3PKIA 4DSZA 1W19A 1XNRB 2PKEA 4MGYR 3CF4A 1H1LA 2FKNA 3D6UA 5BQXA 3M89A 3ANMA 2DLNA 1IC6A 2PUEA 4FFRA 1YU6A 4HWPA 3L7KA 3P2MA 2C5LA 1IN7A 4Y67A 3CSSA 4HK4A 1U8FO 4OJYA 2SKCA 5A4AA 3R6WA 4E7OA 3OICA 3VYRB 1RFLA 3E5NA 2ZYTX 3SMVA 3HJGA 1PK9A 2VZEA 1WG8A 1VKNA 3ZNNA 3GNTA 4S1WA 1T4CB 1R0KA 2O6LA 2XA2A 2ZR0A 3TXXA 3NHYA 2QT9A 3EMVA 4FFLA 5E8JA 5AICA 1RJ9B 3F2VA 1O94A 5KAPA 3I42A 4Y1RB 1LZLA 4ZQIA 2BFCB 1CB0A 2Y1XA 4PVDA 3R3JA 3FJ1A 4N40A 1T0BA 4MO2A 5IXYA 4ZVUA 3L4SO 3RUFA 4GSYA 5DLQC 3H5AA 4GLBA 2ZBGA 3N8GA 3TR0A 3EMDA 1VKJA 2VSYA 3AFIA 3GEDA 1ID1A 2NU8A 3QVKA 2A5DA 4J2HA 4PY2A 3LC0A 3DYVA 1U81A 3AI3A 3H9EO 4KXXA 4ZOLF 3O47A 5TS3A 2PTGA 5LL6P 4NBTA 1N7HA 3UFXA 4CKEA 5LDHA 5B4TA 4NCHA 2IA5A 4BFSA 5EGSA 3VV3A 2GF9A 3OCJA 3STTA 4MR9A 4P53A 5AJXA 3A3OA 5JQWA 1QMPA 4GDMA 4X54A 4HCJA 1U8AA 4II2A 1MB0A 4AY3A 2ZE5A 1KY2A 3PEFA 5SZIA 1VP9A 3ML1A 2NP7A 4WBNB 3A2MA 3ASZA 2VYVD 3IMKA 1YBHA 2I2WA 5B6PA 2UAGA 1B7GO 2J0QA 1H0HA 3JZMA 3AR8A 1EFRD 3LNCA 2A1TR 2JKVA 4WCDA 2Q7DA 5DE3A 4C0HA 5JBIA 2BOVA 5FAKA 3BGWA 1GUBA 4TV8B 1BZYA 2R9VA 3NP9A 1ONBA 2HRDA 3DOFA 3TG8A 3FPHA 2CHQA 4UHDA 3BWYA 3G0DA 1UODA 2ZT5A 1IG3A 3D7LA 3JWPA 1XTUA 3OBIA 5KWIA 3WDMA 3FRIA 1DELA 3W6UA 3DS8A 3FR8A 3NT4A 4IIXA 2DECA 3ICOA 4KGVA 1TM7E 1P2SA 2C1XA 2FZEA 4ZQHA 5CDUA 4MVJG 5K0BA 4CUKA 1GAWA 3PNLA 2J3HA 3GEMA 3KB6A 3PJFA 3CLRC 2MSWA 3A0UA 3OOYA 1UBRS 4FZVA 2CK3D 2V74B 5KPDA 5DISB 4LS3A 1QWSA 2E4XA 1KL7A 2ORIA 3O8LA 4EPVA 1GNLA 3I1JA 3IMCA 3UBTA 4JVLA 4X97A 2R7NA 3TSZA 3OJWA 1AMOA 4LJ7A 1CDDA 3V46A 1Z39A 4EVSA 4CR6A 3KKPA 4GR9A 3NIGB 3IL2A 2J3LA 3JQQA 4YCBA 2NZJA 3MS2A 2H5IA 4JLMA 4ZYZA 1E1CA 5KREA 1QH9A 1W85B 5TDHA 4B80A 4AP6A 1FYVA 4MVJA 1E69A 3O2NA 3L4KA 4Y6PA 2W2KA 4I8XA 3K70B 1XPJA 1U6JA 1CY0A 4ZVMA 2H31A 3FRJA 4RY8A 3RGGA 4EHLA 2VKTA 3V3TA 5IWAB 2XBLA 3OO0A 4V2IA 1GRCA 3E4DA 2C77A 4QQNA 2BEUA 1SKQA 4REOA 4EHBA 4PO9A 2FPGA 4X95A 1JALA 2IPNA 4PSCA 2VA8A 4Q4AA 1U2DA 2E4AA 2BE7A