2EFDB

Ara7/atvps9a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
165
structure length
152
Chain Sequence
SINAKLVLLGDVGAGKSSLVLRFVAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 41
structure length 152
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efdB00
2YWGA 3GFPA 3PR1A 2IS2A 2Q0HA 4P4UA 4BASA 2ZRKA 2PEYA 2GEVA 2ATVA 1ZM9A 3QPVA 4QBIA 5CK4A 5DYIA 2WBLC 4WZAE 1CR2A 3SFZA 3ZDQA 1ZD1A 3RS5A 4TMXA 4MKIA 4B2PA 1X8KA 2YKGA 2BBSA 1IBRA 2QP4A 5HKKA 2RGNC 1UAAA 4EFLA 2VHTA 1KSJA 4LJ7A 4FW9A 2FV8A 2HCBA 1SVMA 2F9MA 2QNRA 1DPFA 4V0MA 1SVLA 3TVDA 3ZVRA 3EZ9A 1H8ED 3T1OA 1KO7A 3F3YA 3B1WA 5DNYB 4Q66C 1BMFA 2C95A 4OK6A 2RGDA 4RD6A 1MRNA 1CF4A 3EPLA 2IL1A 3T06B 3ZH9B 5KSZA 1DBSA 3FGNA 1XTQA 5DN6A 3H0KA 3PUXA 3PUVA 4LBWA 2GDJA 1QVRA 2W6IA 2WIAA 1Z2AA 4RVCA 4U5XA 1DAMA 1E96A 3SYKA 1Z07A 2Q3HA 4MGZR 1Z0AA 4TLBA 2WV9A 4TMWA 1W36B 3KDSE 1XTIA 2GAAA 1DO2A 3KKQA 4RD0A 4DCSA 5KHOC 4EPVA 2W58A 1OH8A 1R7RA 1NLYA 3ZZTA 1Q1EA 1NN1A 2C5LA 2XNSA 3NBZC 1YRBA 4B3GA 2GILA 1CS4C 5JI2E 1LS1A 2VQSA 3SNHA 4IVPA 2YWFA 1MRSA 4BPBA 4ESHA 3NIBA 4WVFA 2ZRDA 4A36A 1UBFA 1WP9A 1HUQA 1CJVC 2F6RA 3M1IA 1GNPA 4TL8A 3U7GA 2GKSA 3TW4A 1KIMA 4AKHA 1W1WA 1MO4A 1RYHA 4XH9B 3VR3A 3KQNA 4US1R 3LWNA 3P4XA 2OXRA 2P65A 1S1CA 1DADA 2C04A 4A82A 1KDPA 2IF0A 1WDTA 1OF1A 1HQCA 4KFSA 5L3RA 2CNWD 1G18A 4EDHA 2V6IA 1SQ5A 4LDJA 4MYHA 3EC1A 1Q44A 4YMVA 1BS1A 2FEMA 4BEJA 2ZITA 1JJVA 3NDBB 3TAHA 4DLUA 1UFQA 2I4IA 2HXYA 2KSQA 3UG6A 3X1WA 4PQRA 3RS2A 1COWD 1OJLA 1DEKA 1G5PA 2G9NA 3QKRA 4RD2A 5CDFA 1OH7A 2R65A 4YLGA 4ZCLA 2DPXA 2ECKA 2O8CA 2NQ2C 4IEEA 1KO5A 4HUQA 1EX7A 2OXCA 2ZE8A 2JA1A 4KU4A 1S0UA 4Q19A 3REGA 2QL6A 1ZNWA 3N2IA 2IS1A 1DO0A 1G6OA 1XCGB 2WAYA 1R0XA 4G1UC 1NF3A 3CO5A 3KKMA 3ND8A 4CW7A 1L2TA 2A5FA 3C5HA 4LJ9A 4LZZA 4W5HA 1Z3IX 1JAIA 1TUIA 3CRRA 1JAHA 4TT3D 2DWOA 5E7JA 1LY1A 4LV5B 3VHLB 4F4CA 3D31A 4A6PA 1N6OA 5CK5A 4M1WA 4DB2A 1Z0JA 4PSKA 4URWR 1VKJA 3CLVA 3WNCA 2GXQA 2ZVQX 5LD2B 3BIFA 1KI6B 4P31A 4Q02A 4B2LA 3MJRA 3RDPA 5FOVA 5BYJA 5FPYA 4ZPXA 5FI1B 1M6NA 2JCSA 3A4LA 3KXIA 3NG1A 4LBVA 1G5RA 2V3CC 3FKQA 1IN4A 4TYQA 3Q72A 1X6VA 4BFZA 3UWKA 5LDDC 2HDNB 6Q21A 4PPNA 4RZ2A 4DCTA 5K8TA 1R5OA 2IC5A 3BH6A 3P20A 4PPGA 4Q1BA 1U90A 1OH6A 3AUXA 3GJ3A 2ZM5A 1OXVA 5JMTA 1TEXA 4UXHA 5CIWA 5HCNA 5AK0A 3M0EA 1L4UA 2JDIA 5TARA 1KSGA 1NVUQ 2V8OA 5HE8A 3OIUA 2ZRCA 4F92B 1LF5A 1L4YA 121PA 3KKNA 3AF0A 1GL7A 4E22A 1KNXA 2QMEA 3AF4A 1NN5A 3GJ4A 4H9GA 1SXJC 2Y8EA 5TDHA 4BLRA 2OM2A 4E5UA 1SKYB 2ZYVX 4V0OA 4MITA 4YMSA 1N6IA 4NCJA 3HU2A 3MRSA 1A82A 3DZDA 2IWRA 1P60A 3T34A 1A2BA 2F3RA 4ZDKA 4Q9LA 1WQ1R 2C99A 2CCKA 2G1JA 1NJGA 3T61A 3THYA 3T15A 2WWHA 2OZEA 1N6NA 2J5XA 5J4HA 4ARZB 2J7KA 2Z0MA 3RS3A 4K46A 3R7WA 1E2FA 2RHMA 3O8RA 1KHTA 1XF9A 4DDTA 1AA9A 4NPHA 2F1JA 4JT2A 2ZEJA 2W0MA 1GVNB 1Z6TA 5EXSA 1G16A 1QDEA 1WMSA 3BB4A 3SJAA 3DL0A 3HWSA 3W5IA 5KDDA 2KI5A 2XJ4A 3ZVMA 5J47A 4ITRC 4M4SA 3QQ5A 2IXFA 2WSSA 4M1OA 1M7HA 4B3DA 3EX7C 4C9BA 2QTVB 1QHSA 4Z51A 4UXJA 2OV2A 3AF2A 2JATA 2BEJA 2O8EA 2GAOA 3CPHA 2GRJA 4DLWA 1U99A 1EWRA 1FW6A 3H1TA 4GT1A 2G1KA 4KBGA 4O3MA 2RGNA 2IS6A 2BM1A 2VP0A 5IHPA 2P6RA 1J8MF 3MMPA 1N3BA 1UM8A 4LHZA 4MDFA 4OKSA 4TZ6A 4M1KA 3G82C 4ASUD 2NO9A 3BC1A 3BH0A 3RRNA 3QIAA 1WE2A 1G5TA 1XMJA 2DFNA 1CRQA 1OKKD 3THXA 2BMJA 2H1LA 1CXZA 1SKYE 3KKPA 1SZPA 2GCOA 4CZ2A 4TYNA 5LB2A 4G5RA 4XVQA 4QHSA 4EPTA 1F48A 1NBMA 1ZNYA 4X8OA 3QG5A 3ECCA 1VYVA 4YDSA 1XEFA 1Z6YA 4JBYA 2QSYA 4B74A 2FF7A 4D80A 4E07A 4EQ6B 5C4MA 4KITB 5EZ5A 1YZUA 2JIZD 1NKSA 1XD8A 1R5BA 1BOFA 2H16A 1P2SA 5FBVB 2RMKA 3MFYA 5JBQA 4A1FA 2JLXA 1AGRA 3NKVA 3I4LA 2CK3D 2IYXA 4QGGA 3X1XA 5DE3A 3EIHA 1E2IA 2BDTA 3QY0A 4H1VA 2QRZA 1KI3A 2R2AA 1VG1A 2AFHE 2LKCA 1JJ7A 2CCJA 3B1VA 1NLFA 1Q1BA 2J1LA 3QUSA 1R8SA 3IHWA 1M7BA 1U81A 1E2DA 1UPTA 5FTKA 3THWA 2C98A 5KPJA 2QP3A 4Q03A 4PC7A 3QKRB 1IXZA 4C4PA 1E2LA 1G41A 3GCGA 5KNDA 2HLDD 5KPDA 2O8CB 721PA 4V0ME 3B78A 4PO9A 4KHZA 3FMIA 3ZQ6A 3H84A 4Q4JA 3HP1A 3TUZC 1NLZA 3K9HA 2B21A 2BWJA 3W8RA 3M6AA 3A1WA 2EU8A 4AD8A 1ZINA 1M1YE 2NO6A 1E2EA 1JXOA 4KYUA 4BLQA 2KBEA 3KX2A 1UBEA 4HDOB 2PX0A 4M8NE 4A92A 2QM7A 2ZSDA 4KXFB 3E70C 2IYSA 4D0GA 4PX9A 3KQUA 2J87A 2ZR9A 2DB3A 3TR5A 3TRFA 3CWZA 4DLTA 4G5SA 2J45A 3OEHA 5G3ZA 3TNFA 1GUAA 5AJXA 1FQKA 1KMHA 4M1YA 3U60B 3MGCA 1KDTA 2WIBA 1ZM4A 1P7CA 3B2EA 1G3MA 2H92A 3AP1A 1XU4A 2J46A 1T8UA 3WP0A 5DYGA 4FMCB 3L82B 3K9GA 1N6PA 3AQ4A 1G4AE 1NSTA 1U0HC 4M22A 1FNNA 1Y3AA 3W6PA 3EZFA 4LSGA 1TAGA 3TK1A 1E1RD 4GP6A 2H17A 1X8JA 2J7PD 3SFVA 4JLDA 4Z8XA 1E2HA 3FKSD 3HJNA 4A8JC 1GRRA 2G3YA 3K0EA 1Q0UA 1OYWA 4CYMA 1BH2A 1H8HA 4DCVA 3IKJA 1ZVQA 2X2FA 2WTUA 4A2QA 3L8YA 5HCIA 4IDPA 4B48A 2N46A 3ZD6A 1ELOA 1KJZA 1Z08A 3E1SA 3AKYA 4AYWA 2OBLA 1TU4A 1AN0A 2R6CA 2C77A 3PEYA 3I62A 3CONA 4Q7LA 4F7WA 4MRRA 1U2RA 4P4TA 2XITA 2FN4A 3FVQA 1SVOA 4QGFA 4DBLC 2R62A 4DHEA 2FU5C 1K8RA 1VCNA 4MKFA 3EW9A 4F4JA 2ASEA 2H57A 1YRAA 1II9A 4DT1A 1SXJA 5FOSA 4R9UC 4M9ZA 2RGAA 4DSUA 3QF7A 2CL0X 2WAXA 2QG6A 1VYUA 4YONB 1E9AA 5FOWA 4HYYA 4ZI3A 3VNUA 3THYB 2W6JD 4YDHB 2QQ0A 3R7WB 4TSFA 2G6BA 3GJ6A 3DO6A 1FP7A 1RRGA 2QGNA 2HF8A 1P75A 1RRFA 3AVQA 4IVQA 3C4JA 2O8DA 3OIVA 3KZ1E 1ZBDA 2YHSA 1NY6A 5AJYA 4XSGA 1RRPA 1LTQA 3HR7A 1T5IA 4I1UA 4Q7KA 2IYZA 2ORWA 3TSZA 3TR0A 2QTHA 1Q1QA 2FZLA 5CM8B 1LB1B 1E9FA 4UJ3A 2AWNA 2IXEA 3VFDA 2F43A 2ZI5A 4PAOA 4PZZA 2PT7A 1T91A 1ZP6A 1WA5A 1NP6A 1E9RA 5CYOA 4QXAA 1XP8A 5GJVC 3EZ2A 2FA9A 5EXTA 3W90A 4DZZA 1PLKA 4W9MC 2O8EB 2ZJ8A 3FHOA 1W47A 3LQRA 2A5DA 2JASA 3CF6R 4IXMA 5AJVB 2ZS9A 5DO9A 3PUWA 2XOKD 2OSBA 3W6OA 2VSFA 1FNMA 2LWIA 2ZAMA 4TZ0A 1HURA 2QAGC 5KTYA 3WBJA 4TN1A 4RSGA 3DMNA 2F9LA 5CJPA 1VCMA 5KSOA 1TF2A 1C4OA 3RSLA 4M9SA 1Q22A 2ZTSA 4A2WA 1XMIA 3RS0A 1E69A 2GJ9A 3TKLA 3EPKA 2NTYC 2OLKA 3WHKA 2Z83A 3SYLA 4RKFA 3DVLA 3OE7D 3THXB 4D4LA 2A3RA 4A0FA 4F91B 3V9PA 3RYTC 3ZYCA 1HYQA 2GCOB 3LXRA 5JWHA 1EWQA 3CKLA 2NGRA 2JIZA 3OEED 1G8YA 4BZQA 2FG5A 3BE4A 5H68A 5J5CA 3ETLA 2ZI7A 4HB0A 1NY5A 1QF9A 3SJCA 1IN7A 3VU9A 1G8HA 4HB4A 1FUUA 1GL9B 1TTTA 1RE0A 2PT5A 5HE9A 3PEUA 3RNLA 5BN4A 2C9YA 4C7OA 3LQQA 5AUQA 1YR7A 3B60A 1A2KC 4Y0AA 4Q1DA 4Q9HA 2JJ1D 1OIVA 1XFAA 3JZMA 3EG5A 1GDDA 3IQWA 1O3YA 2ZQ5A 3KQLA 3W3AA 3R8CA 5BW8A 3B5JA 4ZI2A 3NXSA 3U7EB 5L3SA 4F93B 1RZ3A 3RHFA 5FPTA 2E87A 1K5DA 3DM9B 2QN6A 2XZLA 2XZPA 3FTQA 3THWB 1BKDR 4HLDA 3HYRA 4DDWA 3VX3A 1KZ7B 3TAUA 3P32A 1W0KD 1ZMXA 4AI6A 4GMDA 5AR1A 4Q01A 1IHUA 4QBGB 5KSPA 3U44A 4Q4JB 2ZUCA 3GEEA 4JL6A 1PUJA 4DVGA 5FBLB 3VNVA 4X8MA 3JVVA 4HSEA 2OFOA 1EFRD 1VPLA 3ADDA 1KSHA 1ZCAA 3FFBA 3UANA 1CRPA 1AGPA 1KK2A 2GESA 2J59A 1SVWA 5HZKA 3AEZA 2ZYUX 1SGWA 2C9OA 4BZPA 2DYKA 1E0AA 1EK0A 2QE7D 3F0TA 1E9CA 4HAWA 4LBZA 4WOPA 2B6HA 4JLKA 5JJKA 3ADCA 3BBPA 1ESNA 1I2MA 5SZKB 2OESA 5FR2A 1LF0A 5EUQB 1VG0B 2GJAA 2IUUA 4KAXA 3WMEA 4US2R 3U5ZB 3FFAA 1J2JA 1NBME 2VA8A 4TMTA 4A2PA 1ZJ6A 3QKSB 3DDCA 1XCPA 4F38A 5K8IA 4G5OA 4U02A 2W2XA 2Q3FA 4L5BA 4TYPA 4KCGA 1OXTA 4HUTA 3D6TB 1XEXA 1G4UR 1YZGA 2YYZA 4NYIR 1O87A 2I1QA 3A6PC 2VBCA 1OFIA 1IONA 1MABA 3N2EA 1U0LA 4QC2A 4RD4A 4AIIA 3CRW1 1QZXA 1OHHD 5JWRA 4D4JA 1JXMA 1NMXA 5BXQC 2YZ2A 1VG8A 2AXNA 1T3HA 5HZHA 3A1SA 2CLDX 4MQBA 1OXUA 3A37A 3C8UA 1YJ5A 3CIOA 5FOXA 4DB4A 4DUGA 2CDNA 4Q7MB 3RWMB 3C5CA 4A8JA 1Z0IA 2RGBA 4IOMA 3VMFA 1N5LA 4XTCS 2KJQA 1ZRHA 3W9YA 4LJYA 1E6CA 5E3HA 3ZIAD 3QBVA 2ODEA 1JNYA 2H7VA 2IEZA 1V5WA 3H2YA 2WWXA 4JKYA 2BJWA 1D2EA 4C0KA 4A0GA 3TSWA 2ZR0A 3CX6A 4TTRA 4DT1B 4OQNA 5G53C 1JEDA 2WSMA 4GOKA 2JLUA 3I32A 1J7KA 1Z0DA 4NTZA 3QPWA 1NI3A 2P6NA 2B7CA 4Q9JA 3CNLA 4BLPA 2QENA 1NJFA 3GLGB 3U4QB 1KI2A 2IYUA 1D9XA 3R9IA 4LUCA 2C9CA 4OK5A 3AV0B 5FTNA 1TU3A 4A0HA 4M21A 3QSYA 2O8DB 5A5GA 3NHAA 3AKDA 1VIYA 1XBTA 1R8QA 1E2QA 3KJEA 1TL7C 3C41J 4A9AA 4DXAA 1KKLA 2GXSA 3GLHB 1PLJA 2JJ8A 2V1XA 3O8DA 2CXXA 4DEYA 4UNSA 1WF3A 4M9QA 4NMMA 3I92A 4BFVA 1Z63A 1P9WA 1T8TA 1G7SA 2LCFA 2XTNA 5DSZA 1L8QA 2F43B 1XZQA 1JR6A 3LFUA 3Q5DA 4Q4AB 4URUR 4I99A 2ZSBA 4RZ3A 2ONKA 2HYIC 2AXPA 4LK2A 1W7AA 3FPAA 2F3TA 4UNQA 3EZ7A 2WZQA 4PC1A 4JL8A 1KMQA 4MRNA 2X2EA 3RAPR 4QGHA 3OIWA 3OAAA 2BKEA 1S4QA 2BKUA 5EE5B 1IXSB 1VCIA 2IYTA 2WPDD 2OHFA 1CEEA 4Z8YA 4FMDB 4E03A 4L15A 4JZKA 3RSOA 2PMKA 1IY2A 1F60A 3CF2A 2ZJAA 3W8NA 4URXR 2FFHA 3BK7A 2JJ2D 3CWQA 3GD7A 1KK3A 2V4ZA 3OFNA 3T35A 5CITA 2GXAA 4YC7A 3WMGA 1J70A 3ZZ0A 2QAGA 1UEIA 1G3QA 4M0LA 5EP2A 3UIEA 2E1RA 1GSIA 4YMUA 5FH9A 1J99A 1ODFA 2EWVA 1KY2A 2C78A 1X1SA 2ERYA 3TW8B 3NHBA 4CT5A 2ZRHA 2CJWA 2DR3A 4HATA 3K70D 1R10A 2QPAA 3J81k 5D3QA 4KFTA 5IK2D 4WXRA 3K0FA 3N70A 3VU9B 4Z54A 3P27A 2JJ1A 1D8TA 1X86B 4I4LA 4NYMQ 1P73A 4LHYA 4OQLA 1DAFA 2FPMA 4PXAA 4PZLA 3GLGE 3IQXA 4C7OB 1YZKA 1ZNZA 1OB2A 4WZBE 2NPIA 3S1AA 3AB3A 1Q20A 1ZD8A 2WJHA 5F9HA 4LOAA 5GADl 2UVQA 4BFXA 4TQUS 4WZ6A 4EAQA 1DG1G 3GLHE 3NH6A 5CLQA 1LFDB 5L3SB 1RC8A 4B3CA 4IDQA 1TF5A 2BMDA 2GJSA 1US8B 2AD1A 5FUXA 1NIJA 4JLVA 4IFBA 4K8OA 3PEVA 1GG2A 4LYFA 2GETA 8OHMA 3FOZA 2Q6TA 2BEKA 3THOA 1ZNXA 1XXHA 2CHGA 2YOFA 3CUEF 4EIWA 2Q9BA 3CRMA 4BECA 3ADBA 1G17A 3BRWD 3K0AA 1Z5ZA 4V0LA 2IXGA 3U44B 1G8GA 1P4SA 3W3ZB 2B92A 3TLXA 5AUNB 1JR3A 2P5SA 3WYAA 2D2FA 4C0JA 4M53A 2PEZA 3MAAC 2CE2X 2GNOA 2PZGA 2EVWX 3MD0A 1GP2A 5JCZA 4XTRA 2VRWA 4JJZA 2VLIA 4Q1CA 1GNQA 5TMPA 2H18A 4JKIA 1BIFA 4LC0A 3AUYA 3QI2A 2Q9CA 3L8ZA 2N1BA 4JSTA 2VF7A 4DLSA 3PJRA 3M4YA 1W48A 1R0ZA 3WYGA 5KDOA 1MT0A 4MRPA 3SE0A 4A4DA 4FWTA 3LY5A 1E1QD 1E4YA 1HTWA 2CHQA 4LYJA 3A36A 3C16C 4MYUA 2YOHA 2AD5A 2ZU6A 4P33A 3WRYC 2WKRA 1JQJC 4TMZA 1XTJA 1XEXB 4LY6A 4Q4HA 3V4FA 3UG7A 1QHNA 3K0SA 3KFXA 2IHBA 4JYBA 5FL7D 3AP3A 1A1VA 3U3RA 3ZQJA 1MABB 2J0UA 4PAQA 2GHIA 4IDHA 5DHFA 5LB4A 3QXHA 4NP6A 5DISB 1Q12A 2HT6A 2QA5A 4BFYA 4QJ5A 2F1HA 4XJXA 1RKBA 1NG9A 4B76A 3CZQA 4CDGA 4A8JB 1A5TA 4AWXA 5JRJA 3I3SR 1PV4A 5ELXA 2PMDA 4I1VA 4MH0R 1S1MA 2O0JA 5DH9A 2AWOA 2ZJ2A 1ZD9A 2VPPA 1EG7A 1FOEB 4PAMA 4BWYA 4UNRA 2JEOA 4URYR 2WMOB 3CH5A 3QF4B 5JSZA 5FUVA 1F2TA 1Z29A 5DHAA 4FMDF 4ZIRA 2XGJA 2FMXA 3X1DA 1EESA 4P3YA 2PZEA 4YXWD 4LHXA 3WRXC 3UPUA 2D7CA 3K9LA 2NO7A 2X8AA 2ZRLA 1CKEA 2FFBA 2ONJA 3GJ5A 4GRAA 5IF9A 4Q47A 2DFKB 2YC2C 5EUMA 4O25A 1W4AA 2ERXA 1S96A 2PBRA 1KDOA 3FWYA 3PEWA 5FUWA 1EX6A 3LX5A 3BH7A 3CH4B 2FPKA 5LBIA 2OFWA 4WIAA 2ZJYA 3Q5EA 3BWDD 2ZJZA 3K53A 2QP9X 4DLZA 4YMWA 1NVVR 3CPJB 1JB1A 1E2GA 4XIGS 1R0YA 2V55B 3CNNA 1N6LA 4TTPA 4UQOA 5B64A 3HDTA 4IJMA 2W83A 3D7MA 1JI0A 3LD9A 2DFTA 3K9NA 3MWYW 4WAUA 4IDNA 2K5UA 2YC4C 4X8HA 5CM9C 3KUDA 4RD1A 1GFIA 1TADA 1XTSA 4ZDJA 2QT1A 2CE7A 2OAP1 4P4SA 3DOEA 2ZE5A 3VR5A 4CRWB 5EJEA 2D62A 1XTKA 4KO8A 1H8EA 3NBFA 4B47A 1W49A 4DLXA 4OHWA 4TYWA 3VKGA 1ZCBA 1KOFA 4N3NA 3W5JA 2EFCB 2UZIR 3X1ZA 3BB3A 5FTLA 2WKQA 3QE0A 1E9BA 2VYFA 1G8FA 1FZQA 2FGKA 2WWIA 1N0UA 3PFIA 2MSDB 4FCWA 5L8VA 2CL7X 3AM1A 4OBEA 2OBMA 5EZ6B 4B71A 1XPOA 2QAGB 3B1YA 1Y63A 2NOAA 1AQUA 3Q7PA 1TMKA 1UF9A 1DOAA 3GFTA 5DGXA 1VDZA 4FD2A 3EA0A 1Z22A 1XJQA 3O8CA 2CJWB 2HCJB 4IOJA 1S3GA 4HB2A 2AK3A 1KK1A 3CR8A 4HB3A 2ZS8A 3HYTA 3CZPA 2PX3A 4PPFA 1K6MA 1NNEA 2JLVA 3K0FB 4B35A 3Q7QA 2ZR7A 2BCGY 1P2UA 2JGNA 3SU8A 4NE2A 4JBXA 3L2OB 4CEHA 1U98A 4XD7D 4C0AC 3SHWA 3S1AB 1AZSC 4MYCA 1S9DA 1K5GA 4TLEA 1M7GA 4HLUC 1IN6A 2DBYA 3FHCB 2BVNA 3MG9A 2QMOA 2GVZC 2O8BA 4FINA 2B8TA 3KQHA 2CNWA 4NZYA 4TL7A 2A5GA 5J40A 5SZHB 1LW7A 1X8LA 4Z1MD 4CIDA 1JEEA 5BN5A 1GKUB 2IUSA 4ZV4A 1EXMA 5F2EA 1XCMA 2VP2A 4S35A 4R98A 4AYXA 1JPNA 5FUYA 1VTKA 2GVDC 3RABA 1COWA 2QMUA 2Q9AA 2XNDD 1P61B 4RZXA 1Q3HA 1XXHB 3AF1A 1Z8FA 4TL9A 3GJXC 2R9VA 5GJWC 2RHDA 4I81A 1W36D 2VO1A 3GPLA 4G3XA 3AGPA 1E99A 3TIFA 4LPKA 4C0QC 4D0LB 4YQFA 5C4GB 1XB2A 1T4GA 1UKYA 3WXMA 1W5TA 4RJLA 3EWAA 2LKDA 3TE6A 4L9WA 3KXLA 2GA8A 4HUQB 2XAUA 3LH5A 2F55A 1W2GA 4TLDA 1U9IC 2ZSAA 4DIDA 2F1IA 2ZSFA 4TT3A 1ZIPA 3LLUA 4MRSA 1Z6XA 1C1YA 5GJBA 3CRVA 3SZRA 5JFGA 4EFMA 2GZAA 1F5NA 3TQCA 5D3MA 1EGAA 4V02A 2QPTA 5JEEA 3DHWC 4OJQA 5M04A 2FJUA 3BB1A 2ZJ5A 1CP2A 1W44A 3QVVA 2SHKA 1TQDA 2HYDA 5L3QA 1WRBA 3U7HB 3NDPA 4C3ZA 2PH1A 4JIMA 2F1RA 1VHLA 3JZAA 1X1RA 3DKPA 4NYMR 1WBDA 4KJZA 3IO3A 5CJ2A 5JECA 2R44A 1NN3A 4PR0A 2DWQA 1NSFA 1QVAA 2ZRBA 2O8FA 1NMYA 4A15A 4HZUA 2P67A 1E2PA 3BS4A 2ZI6A 4JVNA 4KSCA 4GZLA 2J0UB 1KJYA 1LS6A 1MH1A 4BFWA 2EYUA 3ICEA 1OXXK 2V7QD 3W34A 2J9RA 2X1VA 4B6EA 4BLOA 4TMVA 3AF3A 2ATXA 3A58B 5LD2C 3SHFA 5J4VA 2A78A 5BN3A 1S2MA 1D9ZA 1W4BA 3CR7A 2VEDA 3K8YA 2R6AA 4PC3A 5E7IA 5FFMA 4PHFA 3SI7A 4QRHA 4EPYA 3MLEA 2DHRA 2OEPA 3OHMA 1QHIA 1XXHE 1D2MA 4LV6A 5JSZB 5EP3A 4ZIRB 1D2NA 5K8UA 4DIEA 4DSTA 4QBHA 1E2NA 5KUTA 2XSZD 5CDFE 5JWOA 5K8LA 4LWZA 1W0JD 3T5GA 4QOSA 2A5JA 4BUJA 3LW7A 2F7SA 2ZS7A 3K1JA 4DC9A 1F3OA 3DPUA 1QG2A 3KJGA 1DE0A 1HE8B 4OL0A 4XVUA 2WMNB 3LX8A 3NWJA 2R6GA 1P62B 3B8HA 5G40A 3CRQA 2IYVA 3PCRB 2WHXA 4UNNA 3WHLA 3EPJA 2GF9A 1P72A 3C15C 1T0JB 2GBLC 5UKDA 4ZCIA 2EFEB 3A4MA 4PPQA 3F5FA 3B1XA 2QY9A 1G8PA 2FOLA 1R6BX 2ZANA 2G88A 1G9XA 5FPSA 3CX8A 4MKHA 4Q7JB 2YWHA 2TMKA 5KYKA 4O0MA 3K70C 4MUAA 2DWPA 3RRMA 1PJRA 4B6FA 4DCUA 1S8FA 2GJ8A 1P9RA 4OHVA 2CMKA 2G0NA 4NKRA 3P1JA 4EPRA 1E79D 421PA 2NO1A 4P4SB 4DDUA 2ZRGA 2NMVA 1RFLA 1KDRA 1W4RA 2VF8A 5EE3A 5EXXA 4ZCMA 4KFRA 1E0JA 4QJ4A 4UKDA 3FMOB 3LDAA 1T6NA 1XWIA 1XEWY 3Q3JB 1II8A 4XSHA 1KTVA 221PA 3DZ8A 1SHZA 3U3JA 5JJLA 1XTRA 3UMSA 4ASUA 1DAIA 4GPTA 2BBWA 1DAKA 4US0R 4F4IA 2R8RA 5DLQC 2CBZA 5JLJA 2PJRA 4EJSC 4NU0A 1AKYA 3MWJA 3TUIC 1OKKA 2ANCA 1YE8A 2I3BA 3R20A 5B30A 3SQWA 1XDBA 3IGFA 5G41A 4AURA 3LBIA 2IYRA 4MGIR 5GVSA 3ZD7A 3R9XA 2IUTA 5HR5A 1OFTA 2J41A 3EWSA 3NTUA 1CU1A 1D5CA 1W4CA 1YU9A 1T3SA 4PO1A 1ESMA 1GNRA 3IPYA 5B58C 3U6KA 3B9PA 3IBYA 1YZQA 2QROA 2JLZA 5HKKD 2FGJA 1G3UA 2CK3A 3O8BA 3NEYA 4V03A 3E5HA 4B43A 4ERNA 1U8AA 2MSCB 2VIIA 4HDCA 4JJKA 1T3LA 3IILA 4LJ4A 1KAOA 1BMFD 2VHQA 5SZJA 2BCJQ 3NH9A 2BC9A 3UMFA 5E7MA 2WOJA 1CULC 4TLCA 5L3VA 821PA 4DRZA 4KFUA 4HLUA 4N0DA 5JZVA 4GL2A 3B13B 4KVGA 4BFUA 4DSOA 5DN6D 3L0OA 4TLAA 5AUOB 2W6ID 2Z4SA 3ZVNA 3C7KA 1KI7A 1G21E 3LO5A 1KNQA 4NL4H 5F9FA 4KI0A 5F3WB 2HLDA 3I61A 2G0TA 1HT1E 1JALA 1LNZA 2NG1A 3WMFA 1AKEA 5IRCD 3AVWA 4HI0E 2B7BA 2HV8A 3K09C 1DAGA 1VECA 2WWFA 3FMPB 3LRPA 3PG5A 3PUZA 4S2EA 4OI0A 4PQYA 5A4JA 2QSZA 1RPZA 4M1MA 1G7TA 4TWZA 3V4RA 2WVJA 1U8ZA 4IEIA 2V1UA 1KGDA 3EARA 2WJGA 3GQBA 4GDFA 3KXKA 1AQYA 1XPRA 4TQ9A 1R5NA 4NCHA 1TUEA 1UKEA 3U3KA 1M74A 4Q1AA 4AK9A 4BE7B 1U9IA 3SS8A 4D4MA 2XEXA 1P2VA 4U00A 1OFUX 2OBNA 4MRVA 3B85A 4OQMA 2QZ4A 1KMHB 2OILA 5L3QB 1EFTA 3IPXA 2FNAA 1GL6A 3NBYC 2BM0A 4FI3C 5KNBA 1E32A 2A30A 2QUZA 4RCZA 3AVUA 1E9EA 1WCV1 4RKEA 5JRZA 1FFHA 2IYYA 4GMXA 4HZUB 1E1RA 3EIQA 2PCJA 2OLJA 2J7PA 5JEDA 3FKSA 5KU1A 5TV2A 4JSYA 2WJJA 1HT2E 3X1YA 1D6JA 3GEIA 5CB6A 1OIXA 5CYPA 1UBGA 4DJTA 3I1FA 3LW8A 4PHHA 4OI1A 1GRQA 2YOGA 3WNDA 3P4YA 1ZM2A 3GJ8A 1N0WA 4L4UA 2R6FA 3QXJA 1I2DA 1QHHA 2JLQA 2FEOA 1ZU4A 2MMGA 5EP1A 3RANA 3VX4A 5JHGB 3KB2A 4L8GA 3D8BA 2GXUA 3P26A 4L16A 2AKYA 1MO5A 3I72A 4MGYR 3T12A 3ZS8A 2ZRMA 5J4KA 1KI1A 1E9SA 2C8VA 4RFVA 2E9SA 4JLJA 4RCYA 5GJCA 1TEVA 2BBTA 4I1OA 1OYYA 3BJIC 3TSOA 3N5CA 2NO0A 1XEWX 2IF2A 2HEIA 1DELA 3WY9A 1YHNA 4U7DA 2W6JA 1SXJB 2ZJOA 4FCVA 1KO8A 2ZRPA 2WJIA 1GRNA 4X8LA 2QU8A 1HA3A 1MKYA 2CCGA 4GOJA 4POAA 1E0SA 2VH5R 1ZC4A 4IHQA 1UADA 1OSNA 2XTZA 1U8YA 1P3JA 1TX4B 1YZTA 3IIMA 5AJWA 2HUPA 3SJBA 1H65A 4ZKEA 5FPKA 2V54A 2JLSA 2Z4RA 2OT3B 4HDQB 3RS4A 4HLQB 2GJKA 2W00A 2ORIA 3EIEA 2JDID 1AIPA 3PITA 3TVTA 2Q3MA 1N6HA 2QAJA 3RWOA 2GBLA 2GTPA 1BO6A 2N42A 3F8TA 2NPFA 3Q9LA 5H70A 2QTFA 2WOOA 1YZLA 3ASZA 2WWGA 5AJZA 5LPNA 1W5SA 1B23P 4ZO4A 3W6NA 3EAQA 2VP9A 4J0QA 4LHVA 4PANA 3ZJYA 2QT0A 2MMCA 1FP6A 3L43A 2UKDA 4CVNA 2IS4A 4MKGA 2FSHA 1N6RA 5EP4A 2CLSA 1OH5A 2XOKA 2UZ3A 4GOXA 1G3RA 1II8B 4IVRA 2QEQA 3BFVA 4ARZA 4BRWA 3BOSA 1P2TA 4FCTA 2HJVA 4GSYA 1Z47A 4D25A 4B2IA 4DKXA 5AUPB 1SHKA 1XNJA 1VG9B 2ZYTX 3ASYA 4KVAA 2C03A 4LV8B 1E2JA 1G1MA 1OE0A 3OE7A 1OV4A 3TQFA 1DS6A 1F6BA 5E4FA 1G64A 2D3WA 1IJFA 2EWWA 3HU3A 3CB4A 1DAHA 3SR0A 3VR1A 3AVPA 3PUYA 2P5TB 3FHTA 1DVRA 3OEEA 1OIWA 2X77A 3FE2A 4CGZA 1YR9A 1IM2A 4EJSA 3LBNA 4C0LA 1Z2CA 1FTNA 1QRAA 5E95A 3RRYA 1N5JA 4QJ3A 3QXCA 2GWHA 1ZUIA 2CVHA 3BXZA 2WSSD 4ON9A 4B3XA 1XD2A 4D81A 2VP5A 2EFDB 2X19A 1SXJE 3CF0A 4XWOA 4LC1A 2XZOA 1XX6A 2ZSEA 1ZYUA 3LNCA 4XWAA 3AKEA 3SQXA 2RKOA 3QOFA 4LJ8A 2AX4A 5FOUA 4Q4LA 3AVXA 2FSFA 4OJKA 1J90A 1GWNA 4ZKDA 1IY1A 2ZVPX 4LYAA 3QEJA 4NCKA 3TGPA 4Q9IA 1M2OB 1NL3A 4AC9A 4QL3A 1AS0A 1GKYA 4DLRA 2ODNA 4LX0A 1OFHA 4IFEA 4JS0A 2PZFA 4EFNA 2VP6A 1I4DD 2ZI3A 2ZPTX 2ZRFA 1AS3A 4Q1EA 4C30A 3AH8A 1W0KA 3NVAA 4JBWA 1ONBA 1VIAA 4KBFA 3HR8A 4LI0A 4Q9KA 3TMKA 1SULA 1UKZA 1R2QA 4LJAA 4A0RA 2G83A 4EQ6A 4MYTA 2OUKA 2D06A 4JLPA 2PCLA 3A8TA 2RCNA 2OCYC 2CHVA 4R7ZA 2VL7A 3PIRA 1CR0A 1NBMD 4PSVA 1KAGA 1UBCA 1EFRA 1NIPA 1YVDA 4IXNA 4C0SA 2QPOA 2FPLA 1TNDA 1G6HA 5KOYA 3K09A 3KQKA 2QE7A 4LRWA 4RD3A 1P6XA 2DY1A 4R2IA 4LYHA 3SN6A 2O52A 3CX7A 1SVIA 1NG1A 1QBKC 3L0SA 5TY0A 1PLLA 2BJVA 3NEJA 1KK0A 2ZRJA 1AK2A 3KB1A 3B7GA 4ZDIA 3JVUA 4XVRA 3B9QA 4C0HA 1CR4A 3L0IB 2VSOA 2ZRNA 4D2IA 4OHXA 1KI9A 3SC3A 3UXMA 3NC0C 4MA4A 2ZIAA 2ZUBA 2OCBA 2QRNA 2WKPA 3GJ0A 4OI2A 3MWLA 5KSYA 2ZUDA 4KSBA 2A7QA 1MV5A 1EFHA 5EQTA 2QBYA 5C1BA 1A7JA 1OHHA 1XD9A 2XTMA 3MJHA 3A1VA 4BFTA 1SKQA 1CTQA 2DFLA 4QNMA 3AGQA 3UMRA 1Z0FA 1DG3A 1ANKA 1E0KA 1GTVA 2FFAA 4AY2A 3DOFA 1FPMA 1ZW6A 1QHHB 4HAZA 4FXPA 5HTKA 2BIFA 3DEFA 4GP7A 5DI3A 1NN0A 3TUJC 3ZIAA 4LGMA 2REOA 3IEUA 5BQ5A 3GP8A 3OEHD 3Q85A 3QKUA 3GLFA 2J0SA 4QBFA 1P9NA 2JAQA 4IOLA 4CEIA 3ND9A 1HE1C 2OG2A 2OAQ1 1BYIA 2JLRA 2XX3A 3WBKA 3KTAA 1Z28A 3OZXA 2XXAA 3UKDA 3VKWA 4DSNA 3IBGA 1VHTA 2CVFA 4KYIB 4UNPA 3E2IA 3GJ7A 2DCUA 2BOVA 3H4MA 2GK7A 2HF9A 3GMTA 4AYTA 2EYQA 4TTQA 3I8SA 1W2HA 3SYNA 2GF0A 3AVVA 4OHYA 1ZUNB 2GK6A 2J0VA 3QJYA 4QKQA 3SJZA 1ZAKA 3EC2A 4R2HA 1J8YF 3G0HA 2ODWA 3NC1C 3R9WA 3T1TA 3LLMA 4RFSA 5CIQA 1TPZA 4RY2A 2WWWA 1H8HD 5J4LA 1C9KA 2FSIA 4JLBA 1ZU5A 5JCPA 1Q3TA 2AFIE 3BAFA 3C14C 3PXGA 2IW3A 3A1TA 4D26A 3MUFA 1AJEA 1P5ZB 4JVSB 2VHCA 4QFMA 3U3OA 2QMHA 1N0VC 1S9HA 2P6UA 2ZYWX 4DWJA 3CBQA 5JHHB 4NYJQ 1IJEA 2ODBA 4BQSA 5SZIA 3FMFA 3I5XA 4B34A 5C46F 3CPEA 5TB5A 4PTLA 4O2RA 4PSAA 3KJHA 3EPHA 1SXJD 2WPDA 2C96A 3LVQE 3PQCA 3ZS9A 3AVYA 3DMDA 4QHTA 2A5YB 1BYUA 2AKAB 2ZE7A 4MUBA 4B3FX 1FUKA 3QPUA 1TF7A 1MOZA 1IN5A 2JJ2A 3IO5A 3HPQA 4LJ6A 1ZIOA 3U3MA 3DM5A 1Q21A 4TSFD 4DDVA 3ZZUA 2ZI9A 1E2KA 2VSXA 4P32A 4EJSB 3VTKA 2AR7A 2GEUA 3HU1A 2VHUA 5F98A 3IIJA 3KKOA 2PJZA 2IEYA 5IK2A 4WW0A 4QM6A 4OQFA 1GOTA 4HAXA 2BBOA 3QNUA 3EXAA 1XD2B 1L7VC 3KJIA 2C2HA 2VP4A 2VTKA 3PENA 2GCPA 3IIKA 3QG1A 1RVDA 2AHOA 1E98A 1HH4A 4D6PA 2D4HA 2YJTD 2QM8A 4Q00A 1KI8A 3DKVA 3FB4A 1XJCA 4C0BA 4BEBA 2IK8A 1CLUA 1II0A 3WP1B 1G7CA 1TQ2A 1IXRC 2QGZA 2FSGA 5EE0A 3A1UA 4BFSA 4JMPA 3T5DA 2XJ9A 3RC8A 1E3MA 3I73A 4JL5A 4A6XA 3L0PA 3BORA 2O0HA 4HLCA 1W36C 2QQEA 2IT1A 1Z83A 4Q21A 1CJMA 1YR8A 2Z5FA 2BMFA 2IYWA 1R0WA 4WBSA 1OLOA 4DCNA 5KDLA 1Q57A 3RC3A 1T9HA 3T1QA 1UJ2A 2YINC 3AKCA 4JVLA 1XMVA 2IHYA 1DTSA 1GAJA 3EASA 2PLRA 1I4LD 3U6BA 1Q1ZA 4GFDA 2OE2A 1GZSA 2GZHA 4PO8A 3SBEA 1NVXQ 3K0AB 1WBBA 1N2CE 2ZRAA 1E9DA 3K0CC 4NYIQ 4PC2A 4HEJA 4B73A 2ZETA 4FN5A 2ZXUA 2RH5A 5P21A 2AK2A 3NBXX 1ETUA 5JJIA 1Z0KA 1XJ0A 2KBFA 4PZYA 2WICA 3QEOA 1XPUA 2ZI4A 2ZROA 4OHZA 2ORVA 1N25A 4QG7A 4IDOA 4GBMA 521PA 3REFA 3QVUA 1KI4A 1GILA 3VR2A 1E1QA 5FBQB 2YVUA 3FDIA 2O5VA 2O0KA 2OCPA 3B6EA 1FQJA 2EQBA 2FH5B 2IBMA 4MDEA 3ZLJA 4N1AA 2RGCA 2EFGA 2CEAA 5FOTA 4BLTA 1HV8A 1YR6A 4Q18A 5GVRA 1TQ4A 5FL7A 1XMSA 3I8XA 5C2JB 1KO1A 2QBYB 3MCAA 3AVTA 1AM4D 1RJ9A 2REXB 4ACAA 4JVMA 2L0XA 4Q4HB 1E4VA 4Q48A 1N5KA 1UEJA 3LXXA 1IY0A 4I1SA 3RLFA 3GLIA 1FL9A 3TBKA 1MR3F 5IDVA 3LVRE 1YQTA 3V00A 4B32A 4II7A 4KLZA 1KJWA 2WJVA 3BD9A 1U94A 4AKIA 1Z6GA 3IUYA 2P3SA 3HPRA 4FWIB 3QXSA 3GEHA 3B1ZA 2ZE6A 1E2MA 4BZXA 5DI3B 4G01B 4Q5IA 3QKSA 3GLFB 3T1VA 3RRZA 3KFVA 2WJYA 3QENA 4NCNA 4YXWA 4LPSA 4N0EA 4CEIB 1JQLB 3BERA 4EPXA 4DEXA 3VQTA 2P0EA 1F2TB 1MO6A 4NHOA 3BFKA 2XB2A 3KTAB 5FI0B 2XXAB 1CJKC 4JT4A 2YWEA 3WYFA 1EFCA 2NIPA 4FIDA 4PQFA 4QGAA 5DIFA 1G3IA 1JR3E 4NONA 4B33A 3VHXA 4ACBA 4QNRA 4QHYA 4BRUA 1RRCA 1CR1A 1F2UA 2IYQA 5H1YA 5CLLA 2W0SA 1UDWA 1KSFX 3D3QA 1HEIA 4M2LA 2W2VA 4CEJA 4RFSB 4BLSA 1ZM3A 3TH5A 4PHGA 1I4TD 1IOZA 3AVOA 3B82A 1PUIA 1LVGA 4NCIA 2ZJBA 4DUGD 5H8WA 2BMEA 4HAUA 1S3SA 4XWKA 4V0NA 3ADKA 3BFXA 1CJTC 5KO2A 4C2UA 4EPWA 1CIPA 2BHRA 4NH0A 1FMJA 1FTSA 2FE4A 2HJGA 3AP2A 4K81B 1T0HB 4M9XA 2RAPA 4GNKA 4ESVA 5B2ZA 2AL7A 5B57C 3BGWA 2OO7A 1OXSC 4G0NA 3GLGA 3U4QA 1QG4A 3R8FA 2GEDA 1B0UA 3X2SA 1UKVY 2RGXA 3Q8XB 4CT4B 5BWMA 1NMZA 1ZM7A 2ZAOA 2RGGA 1FX0A 2ZRIA 2HT1A 3GFOA 1YZNA 4G5GA 3SDZA 3GLHA 2VHJA 4CF7A 2OFXA 3PV0A 1G19A 4HAVA 4IRUB 1HQYE 3GLFE 3K70B 1T5LA 3PVSA 1SVKA 4FMBB 4Q4AA 1OPXA 3UK6A 3ICQB 1IQPA 4JLMA 1M8PA 3A4NA 3QXXA 1QHYA 3QKTA 1GKIA 4O2LA 1AS2A 3KL4A 2BV3A 3MSXA 1HY3A 3LBHA 4MGKR 3OF5A 4DLVA 3SEAA 4XD7A 3QBTA 5ANRB 1TQ6A 1GITA 2HXSA 2W2TA 4GZMA 2D2EA 2V6JA 3ONWA 3IDQA 5AWFC 2GCNA 4CEHB 2CL6X 3CNOA 3OAAD 2ZU0C 4Z1MA 4E09A 3RVBA 4AG5A 1KZGB 4LCBA 4C2TA 1UDXA 4WA7A 2O8BB 2G77B 4IKEA 4URZR 4W5JA 2IWHA 1Z6AA 1VCOA 2B8WA 2XNDA 4D0NA 3OFND 5TVKA 3TJZA 5FPHA 1OT3A 2NZJA 4NYJR 5TXGA 4DLYA 3VKHA 2MSEB 2REBA 4PFSA 3U2QA 1VYTA 4ILEA 4EUNA 2PL3A 1KKMA 2ZREA 1RIFA 1OW3B 1QHXA 1N6KA 2YNMA 2KE5A 1NKTA 4IW3B 2FX3A 2Z43A 3WNBA 4URVR 2H8KA 3IEVA 2EW1A 3G5UA 1W46A 1RW4A 4B3BA 4W7SA 4M1SA 3FYHA 3U61B 2P2LA 4AKEA 1Z06A 1GM5A 1JPJA 2A9KA 4D4KA 4H1UA 1JBKA 1QHGA 4W5WA 3ZGXA 4YMTA 4FMCF 4GI7A 1ZUHA 3LA6A 4KV9A 5G3YA 3K0CA 3RS7A 1G20E 2FWRA 3EZ6A 3VR4A 1PVOA 1MO3A 3OESA 4R71A 2XB4A 4HAYA 4BGDA 2IX3A 4TYYA 1US8A 4M1TA 2CLCX 2Q21A 2YV5A 1VMAA 1NVWQ 2Z6VA 2I1VB 3H86A 4RZUA 5D3MB 4TL6A 4B44A 3I5YA 5DI9A 1KY3A 4L9SA 4OQXA 3SBDA 1OB5A 2ANBA 1PZNA 4UXIA 1XZPA 2QORA 1LV7A 1DAEA 621PA 4XOIA 2D74A 1X3SA 1RJ9B 2IYLD 1WB9A 2JLWA 4AKGA 5JS7A 4QM7A 4D82A 1N5IA 2O8FB 1EFUA 2V7QA 3UWOA 3GLIB 3MWKA 1E94E 1R4AA 1JR3D 1ZC3A 4P0TA 5FBRB 5HPYB 1WXQA 4JLOA 2JLYA 4OK3A 5EXPA 4JLAA 3CM0A 3VR6A 1KYIA 3KUCA 4LHWA 2RGEA 2H5EA 4UJ5A 1SVSA 2QI9C 1U0JA 3CW2A 4AG6A 3EA5A 1NVVQ 4IOKA 2J0QA 2J3EA 4NDZA 5EE9A 3ZVLA 4WXPA 3LAWA 4G5QA 4EKDA 4JYCA 3SOPA 2XSZA 1KI6A 2AN9A 1CJUC 1G291 1W0JA 1IAQA 5FTMA 1M34E 5FL3A 1G7RA 4NBSA 4ZDWA 1GIAA 2RB4A 2OCAA 2PLFA 4ABYA 4LBYA 4OI4A 5C18A 3UATA 2FFQA 1AZTA 2IA5A 2KWIA 4JLNA 4TMKA 5IT5A 2D7DA 3VAAA 1A4RA 1F2UB 1CBUA 1RYFA 1YKSA 5FBWB 2FZ4A 2R6DA 4LJ5A 2FDCA 4CEJB 2WWYA 4KODA 2KB0A 4Q1FA 1KO4A 5JI3E 1FMLA 1IN8A 5J4YA 3QF4A 2NZ8A 1E79A 3O47A 3U7FB 1DARA 5A0FA 2WM9B 1V43A 5CB8A 4OYHA 5BYKA 1JECA 4TQAA 4V0KA 5JS8A 5EE1A 4HZIA 2V9PA 2EFHB 3GLIE 4PC6A 1NRJB 4B75A 3LV8A 4KLNA 2GZDA 4Y0VA 4PHTA 3OIYA 2A2ZA 5FTJA 3IHLA 5FR1A 5KNCA 1FX0B 1XRJA
chains in the Genus database with same CATH superfamily
3PDHA 2YWGA 1SQSA 2H1CA 4PLWA 3PR1A 2JZOA 4YAOA 2IS2A 4XGNA 4X1YB 1TEZA 2VDOB 4P4UA 4J07A 4QJIA 2GEVA 4KQGA 3J80A 2H48A 1Z25A 3NT4A 1XAGA 3Q2IA 3QPVA 1YQXA 4QBIA 5AHXA 4BVHA 1LDNA 1SB8A 1FXUA 4OH7A 3RS5A 2HH9A 1U80A 1UFKA 2D1QA 2HUNA 4ND5A 5EJAA 3U1VA 4B2PA 4CKCA 1JMYA 5IHXA 3O93A 2QP4A 5HKKA 2RGNC 4YWJA 1T2VA 5TQJA 5KYYB 4YI3A 4LVOA 2J4FA 2P9BA 3SSOA 1KSJA 1QTNA 1ZGHA 2FV8A 1SVMA 4V0MA 1DFIA 1RWQA 1SVLA 3SIXA 3ZVRA 1QKJA 1FFDA 1VJDA 3EZ9A 1H8ED 3T1OA 3ZNOA 5LNK6 2VG8A 1CJBA 3T4XA 1JLLA 1NQOA 4YRRA 1BGWA 2X4LA 3NIDB 5CTAA 3U0VA 3X43A 5DNYB 1XFDA 2YRWA 1CF4A 3TNJA 3T06B 4TOIA 5MFZA 1DBSA 3MRVA 1XTQA 2JVJA 2XDYA 3MQ2A 1C30A 4G0XA 1FMFA 1YBMA 3PUXA 3PUVA 1LV8A 1QV6A 1QVRA 1N2SA 2WIAA 3EAGA 2VATA 3ME5A 2WHPA 1UFVA 1XHLA 3OD1A 1E96A 3UXEA 3O7MA 3TD2A 3IQDB 1Z07A 1QMPA 1Z0AA 4KR2A 3FW1A 2D54A 1ADGA 2O48X 3OM1A 4FK8A 3KDSE 4MYRA 4RY9A 5C8YB 3EH2A 3KKQA 5TMBA 5TPZD 1G2OA 2PKRA 4UMVA 3A6JA 1OPRA 5JW6A 3M3HA 3RAJA 2QTNA 1OREA 1PGNA 1RRMA 2P9GA 1Q1NA 4EUHA 2C5LA 3PFNA 2XWPA 1JIXA 4H77A 4N12A 1X38A 2GILA 2HL6A 4HGYA 2ZJ6A 1PJ4A 4K1XA 4IVPA 1RLIA 1MRSA 3GFRA 4I0WB 4WVFA 5KYVA 4A36A 3WK6A 1HUQA 4BMCA 5HK9A 1KAEA 1V16A 4M55A 4PXYA 5AI9A 3TW4A 1KIMA 3V8RA 4C78A 2L17A 2CVPA 1DBVO 1MO4A 1QH9A 1GUZA 4MP6A 2NSDA 4S24A 1WTCA 1RYHA 3PUIA 4PYOA 4XH9B 3WNZA 2WMDA 5I9SA 4CLRA 1D1PA 2OXRA 1S1CA 1Q7TA 3E27A 1TQHA 2AR0A 1KDPA 4P6VF 4UU8A 4F97A 1OF1A 5HXAA 1HQCA 4XR9A 5K0SA 3NORA 3RFFA 1G18A 3TEFA 1E3EA 1HT3A 1SQ5A 2V6IA 5JNTA 1HC7A 1UOEA 5DFAA 3F49S 4Z6KA 1RAHA 3EC1A 1Q44A 3DZHA 4N3BA 3STWA 4YMVA 1BS1A 2PJDA 3ZV4A 5K0ZA 1JYFA 1FNBA 2WP8J 3F6EX 1WZIA 4MW9A 4YUWA 1UFQA 1V8BA 1LD3A 4ZYVA 1NF2A 5BSRA 3UG6A 3WXBA 3RS2A 5IKOA 4P7KA 3RTAA 3MGBA 5IC4A 1WWKA 2QK4A 4P38A 4HP8A 3A9RA 3RT9A 1SKBA 1OAOC 3DEHA 4HWGA 5I6DA 1ISSA 2NQ2C 1E18A 1EX7A 1T9GR 1WSWA 2A14A 1R4NB 3OU2A 4MJLA 1JA1A 3REGA 2Z95A 2NVBA 1C3VA 2C1XA 2GCGA 2ZSIA 3DFMA 1ZNWA 3LJKA 4Z4IA 2FEXA 1JKIA 1XCGB 2A57A 1R0XA 3CO5A 2LUOA 4UDNA 1SQ6A 5EJ7A 3C5HA 3IR5A 3HLYA 3SX2A 3FR8A 3VR4H 1TUIA 4NU8X 5AVQA 1NC3A 1JAHA 2YMLA 5DTMA 2FY8A 2QF7A 3D31A 3DJFA 3AL3A 4PLYA 2XDQB 3URMA 5I3CA 5JY1A 2ET6A 2LVBA 1PT5A 4LXUA 1Z0JA 4URWR 4DB2A 5FWDA 3OBBA 1VKJA 1BGVA 1PZHA 4C4TA 2ZVQX 1CVIA 2OBYA 3BIFA 1KI6B 4P31A 4Q02A 1MPTA 3Q0TA 1ILWA 2BHLA 3FZQA 3NHYA 4TWRA 4NFLA 4UPVA 1IY8A 1QGUA 1RM5A 4QVKA 4MI1A 1NBAA 1A4UA 5IJXA 2UZ0A 4M8SA 1M6NA 4PONA 3OU6A 1NJ2A 3NG1A 1G5RA 1C9EA 4LBVA 2VZLA 4JB8A 4RMHA 1H2XA 1IN4A 4MEJA 3TQOA 3AETA 3LWDA 1NX6A 1V2GA 1YC2A 4JJAA 4MMYB 4ND8B 5CNIA 3WLFA 4PPNA 2NP7A 3CCFA 3PQ4A 2I3GA 3MJDA 3F67A 1R5OA 5DJ5A 1HMYA 2CXRA 3BH6A 1VLLA 3PDIA 5ITVA 1U90A 3JQGA 2EOAA 3C5VA 1ONOA 3EHEA 3QUCA 4HNRA 5EQJB 4DCOA 1X2EA 3SVLA 5JMTA 4ZI7A 4KXWA 1TEXA 3CLRC 2OQVA 1AMUA 2O2XA 5HCNA 4ND4A 1OFUA 5HDQA 3M0EA 1Z38A 2JDIA 5F78A 4QQ8A 2BISA 3OIUA 2ZRCA 1SUDA 3R0JA 1LWOA 1LF5A 3GB9A 1SD1A 1ND6A 121PA 3KKNA 4I9HA 2IXAA 1KNXA 3GJ4A 3QE4A 4O4JB 3GEMA 2UUBB 4JUDX 2Y8EA 1P1HA 4MVJE 3ZPXA 1EB8A 1YBHA 4FD3A 4V0OA 5EESA 4MITA 1N9GB 4YMSA 5G2OA 3P71T 1T1JA 3UWSA 1A82A 1YVEI 2Q1SA 3GLSA 1UPAA 3BJZA 5JRDS 1BQEA 1XALA 3ETDA 3VYSB 5A3QA 4R9SA 1M2NA 1VSUA 3T34A 4BIIA 5B1IA 1HDYA 3BSYA 5A3RA 2CCKA 1VL6A 1JQ3A 1U65A 2G1JA 2Q5JA 1M8GA 4WK6A 3SS9X 4AJNA 1IBMB 1C1HA 1YRQA 2W93A 3T15A 2EEPA 3AB8A 4TKVA 5J4HA 3I6YA 4ARCA 4KKXB 3RS3A 3T3MB 1EUCB 1A9XA 3JQ7B 1FFWA 4IIUA 1FP1D 3IS3A 3O8RA 3F6PA 4CCSA 2CDAA 1K86A 2A35A 2QSJA 3EGWA 1FYXA 3VNQA 4DDTA 1C1DA 3E7FA 2F1JA 1X15A 1M6EX 1GVNB 2CFIA 1WUKS 2X2PA 1G16A 4UUQA 3HB4X 4EVRA 3SJAA 3W5IA 3HWSA 4M6WB 1C4XA 2ZBQA 2I91A 1MHTA 2GOYA 3B2NA 3COYA 4ISBA 2NWQA 1TM1E 4TUYA 3RQSA 2H8GA 4B3RB 5T6BA 4RV5A 3ZQUA 2C5GA 2VJOA 4CKCB 4NOMA 1RZVA 1AK9A 3TR6A 4KREA 3WV5A 4MRAA 4B3DA 3M9LA 2QTVB 1QHSA 1TVCA 1V48A 3O4HA 4Z51A 4FFMA 3LHFA 2DBRA 2HQRA 2OV2A 1I0IA 1XZEA 2FRDC 2BEJA 2D2IA 2HWKA 2Y66A 3I1YA 4EFDA 3EULA 2BRUA 4KBGA 4C88A 1Z5PA 1JLLB 2VP0A 2P6RA 5CLHA 1TU0A 4QLBA 2HSZA 1N3BA 4LHZA 4C6RA 4EVSA 3KB6A 5IM4F 3EOAI 2QXYA 1K3UB 3I2YX 4M1KA 5BUZA 1C30B 2YRFA 3DYVA 3NHPA 5D5HA 1R16A 3L0ZA 4FS8A 2I55A 2WHPB 2PWBA 2VLBA 3NW9A 3OJEA 1CY0A 5BWCA 3QIAA 1M73E 1WE2A 1BMTA 5HKBA 3IP6A 5U4QA 1IVNA 1OKKD 4RF2A 3THXA 3BWMA 2H1LA 1FQOA 1CXZA 2HD4A 3JQAD 1QYWA 5J23A 4AJ9A 2R4QA 1HBJA 1J2EA 1SZPA 1I2BA 1X1AA 9LDBA 1VHQA 2Q3EA 1GLGA 4UBKA 1ECBA 2BFNA 2PD3A 4HH4A 1WD7A 4EPTA 3KHTA 3OY2A 4L2IA 4AQDA 3EWNA 3TSAA 1VYVA 3ZGZA 3ZDFA 2WV7A 3ANMA 1Z6YA 4B74A 3RVSA 4E07A 4NK4A 4J91A 4JJIA 4YWHA 2VRCA 4NFSA 4RM2A 3WWPA 4B7XA 1XJWA 5LSAA 1V16B 3G68A 2GMWA 3KZMA 2HK6A 1P2SA 3HWWA 4EI8A 2B9VA 5JBQA 4A1FA 1AGRA 1I4EB 4YFVA 3U09A 2P6OA 2CK3D 3U9LA 4QGGA 3L02A 4CLRB 4DMKA 1MB9A 3V8QA 4E4YA 3C97A 4JQCA 2QRZA 2FWPA 1EI9A 2TYSB 3PC7A 1IN1A 4PEVA 5F51A 2LKCA 4ZAFA 3W7VA 1T5DX 4BV3A 2EF1A 1ODCA 3ZLBA 5JDIA 3GDGA 3JASA 4PZCA 1B2RA 2J1LA 4U8GA 1R8SA 2CDBA 3IHWA 3OIDA 1QAMA 2D1SA 3VSDA 4C43A 1E2DA 1MB4A 3QU9A 3WHIA 5IBCA 5FTKA 2CC2A 3A1NA 4RJJA 1A2QA 3D7SA 3O4VA 1DBQA 3N86A 4PC7A 2DQZA 1DIAA 3OKPA 2A9OA 4Y2SA 1E2LA 4P5DA 3TSCA 3CLKA 4J8PA 3BCHA 1S2OA 1MN6A 2AQHA 1AHIA 1XT6A 1W5FA 3TLYA 3FMIA 3WLLA 3C3EA 4DIUA 4FC7A 1QPGA 2VF5X 4BXOB 1NJSA 1NLZA 3PNKA 3K9HA 2B21A 3RSQA 2I66A 1V3UA 1QYVA 2EU8A 3JU3A 4EMBA 2H2DA 3PYMA 4BLQA 4JKOA 4CQJA 2ADFA 4HDOB 4K40A 2D1YA 3LECA 4OHRA 4A92A 1VBMA 3JALA 4ZAVA 2IYSA 1IB0A 1XMPA 2ZXEA 1MVLA 4D0GA 3KQUA 1VP9A 4Z7JA 1Q1AA 2J45A 4JI1B 3QSGA 5G3ZA 3U4CA 3QFCA 4JELA 4L7QA 4F8JA 4X6UA 1KMHA 3G0BA 3OD5A 1JEYA 2PUBA 4P08A 3PK0A 2RHLA 1ZD5A 3ZDBA 5DX1A 2WIBA 1P5HA 5ICEA 3I2GA 2CNDA 1I9GA 4JI5B 1T0BA 2EKQA 4EGJA 4NENA 3AIOA 1OGJA 1Z56C 1T8UA 2ISCA 4FIZA 4DIBA 3L82B 1N6PA 1U0HC 3AETB 4IH1A 2FZVA 1U8CB 2V5UA 3BCSA 4CUKA 1YT5A 3OG9A 1OI3A 2K2WA 5J1SB 4YVFA 1FNNA 3CEAA 3FPFA 4M54A 1G6KA 1Q7GA 4AG5A 2D13A 3PHIA 4LSGA 3TK1A 1X9GA 3T1YB 3KJNA 2PN1A 1Q16A 1E1RD 1E5XA 1PCXA 1RQLA 1Y4UA 3JQGB 3PDIB 2ZBFA 2QD3A 5A7GA 3W4JA 1O6GA 1U28C 4A8JC 4EY8A 4WGGA 2G3YA 3HUUA 1P33A 2QW1A 3CH6A 2P27A 1Q0UA 3K0EA 3DZFA 2C4KA 3GLRA 4ROTA 1BH2A 3CUKA 1ZH4A 2J6HA 3IAM1 3N8HA 4TRMA 2BFBA 3AX6A 3FPGA 3TRIA 4B48A 2FX5A 4IG9A 3ZD6A 3ZVKA 1CVLA 1ELOA 4M3NA 1KJZA 4QTYA 3ZNPA 4RH3A 1ZVJA 1XDGA 2XMSA 2XXJA 1BVRA 2I4NA 3E1SA 5ERGB 3SAJA 3SDBA 3WFJA 4LSMA 4AYWA 2HSJA 4YRBA 4H1WA 2PL1A 5E2BA 1V47A 4Q7LA 1UMBA 3EZGA 1EDBA 2FN4A 1SVOA 2N3ZA 4KAJA 4I1IA 5BWLA 1O95C 3CG0A 2FU5C 3SHTA 2ECQA 3TIXB 1TJYA 3OY7A 4GM4A 2V45A 4ARSA 4CQMA 1OZ0A 2H57A 2WVGA 2RIPA 2WU8A 1RI3A 1CDDA 2HK7A 4H7FA 2WAXA 3NOVA 1SCIA 2C54A 2YMMA 5MFPA 3TZLA 4K28A 4F5DA 3ZI7A 1VPWA 2PUDA 2SBTA 5FOWA 4RXTA 3UEOA 2FSUA 3ZWVA 2IYEA 1CZNA 4Y2GA 2BELA 1VE6A 2D2XA 2W6JD 4XUGB 2CF6A 2OHIA 4D44A 2B1QA 4LZOA 3BT7A 4BLVA 1PT7A 1U7PA 2G6BA 2NO4A 3DO6A 4EUSA 1PBNA 2QGNA 4DV3B 1RXWA 1O95D 1E7MA 3AVQA 2VZ8A 5THKA 1C1DB 1OTHA 5DCYA 3LOQA 1ZBDA 2OWDA 4EYGA 1E4EB 4I1UA 2OZPA 2B98A 2VDNB 5EKTA 5EZSA 2ORWA 2WJ4A 3JRXA 7MDHA 5L6MB 3D6HA 4MGHA 1MJGM 5CM8B 4RHTA 2FRVA 4M98A 3ROTA 2F43A 1R6AA 4LJLA 2EARA 1T91A 1MVNA 1WA5A 2YV2A 2RK4A 1NUAA 3ILYA 3GEDA 1E1LA 1PJ2A 4M8KA 2X5OA 2FA9A 1S8OA 1OA0A 3W90A 3PTAA 2R6JA 1DBRA 1VIMA 1WMEA 3M6FA 4YGXB 5HUHA 1W47A 1U8TA 3LVFO 4IJWA 4UQPA 1YA8A 3PS9A 2JASA 1DLJA 3QOYA 4WKBA 1QIMA 1QMGA 3K6JA 1KZ6A 3MWDA 3NYIA 2QAGC 3HGMA 3S5JA 3WBJA 4TN1A 1MAAA 4XFDA 4F1WA 3K9FC 1KJ9A 3RUCA 3BQ9A 2F9LA 2XPCA 2G4LA 3H5AA 2YXEA 1P1KA 5AHOA 3AOEA 2BY4A 4IHAA 1FK8A 4M9SA 3RSLA 3F7OA 2H7CA 3RUFA 3RS0A 3EPKA 2GJ9A 3PVCA 3NTOA 3NALA 4K03A 4MKZA 3TKLA 2O5EA 3SYLA 4E4TA 3T9FA 1L4FA 1I7SB 3THXB 4KXUA 1JDPA 4JCCA 5AVSA 3G13A 3RYTC 4O02B 4IY1A 1XQXA 3ZYCA 4Q6BA 4PYIA 1SIWA 1CD5A 1SOAA 2XV1A 3H13A 3PC4A 3OZGA 1E61A 1AT1A 4GI1A 2FG5A 1LI4A 4GL4A 4L2IB 1D6SA 2O3UA 3KOUA 3U7RA 1UXHA 4EA9A 3ETLA 4Z3KA 1QF9A 3KOYA 4D46A 4EI2A 4QREA 1IN7A 2JAUA 1G8HA 1OXBB 2B4RO 4HB4A 1VL2A 2CN1A 4DBVO 1H6DA 1XVIA 4LN1A 2E6KA 1RE0A 5BN4A 4EAAA 3R09A 4GOND 2O20A 1SELA 3F90A 4RVOA 3CW9A 4L5JA 3KELA 4KJXA 5CLFA 3LUFA 4D9KA 1YR7A 2Z8YM 2A1TR 4Y0AA 3MCVA 3QLTA 4Q1DA 1J8QA 2VTVA 1OIVA 3H17A 3JZMA 3AJ8A 3SYTA 2X1MA 1BCRA 3OTWA 1SKAA 2PYDA 4HC4A 2WYHA 2I6FA 4UM5A 5BRNA 3ZYZA 5HWSA 1SEVA 4CCWA 3ZY3A 2UUCB 3JASB 1MT3A 2VT2A 1Z4JA 5DHUA 3PC2A 4OLHA 2QN6A 5IEJA 2KPOA 4OMCA 5BVHA 4FFDA 4NFYA 1ZMBA 1BKDR 2YQ5A 3HRHA 3HYRA 4DDWA 2JVKA 1OWMA 3IR7A 4FBLA 3TAUA 3VX3A 3P32A 1Z7GA 1W0KD 3TLMA 5CT8A 4YP1A 5LQNA 4Q15A 1FBNA 1IHUA 3D02A 4H7JA 5KSPA 4E6PA 2CLFB 1EWKA 4DR5B 3WAJA 3Q3GE 5DX8A 2Y1OA 4JL6A 3KHKA 1PUJA 3HVKA 3UHAA 4DVGA 3LC7O 1Y5LA 3JVVA 5K0TA 3VNVA 2OFOA 3EW7A 1HG1A 1IEXA 2IEGA 1ZHFA 2OORC 2WC1A 3FBGA 3M6WA 2QZJA 2GESA 2Q49A 1CUUA 3AEZA 3JALB 4ZP1A 2C9OA 4CQLA 4G5FA 3RRXA 4BZPA 3EUAA 3GI1A 1K75A 4IXWA 3ZH2A 3LP6A 1VIVA 4HAWA 3UA3A 1ECPA 1ECJA 1EK5A 1P19A 4NV1A 3IQHX 4KPUB 3BBPA 4UAJA 3O38A 3DE3X 1JEYB 2YR0A 1FY2A 1YULA 1ZQ1A 2AFIA 4CM6A 1C0KA 2GJAA 2IUUA 4KAXA 4BMYA 3H1FA 1YCDA 1WHTA 2PXXA 3SFTA 1CQIA 4NENB 1ISJA 1JMVA 1AUQA 1G5IA 2RAVA 4F38A 3CN9A 3MRXA 2H65A 1U3WA 4U02A 2W2XA 4L5BA 4LDZA 4PCLA 4YBZA 2NVWA 1OXTA 2ONCA 1NWHA 5LA6F 1XEXA 1G4UR 2YYZA 3F74A 2J9XB 2YW2A 3E0QA 2W2NA 1THTA 4ICIA 5K8VA 2G4CA 3EUFA 4ESEA 3GNQA 4EHDA 2UU9B 1FRVA 3K4PA 3QPCA 4QC2A 2GHQA 5D8DA 3M5CA 4QUGA 3V42A 3ZJ4A 1JE1A 2WZDA 3LQ4A 1URPA 3PQ3A 1JXMA 3CSSA 5BXQC 4EY6A 1VG8A 2AXNA 1ORTA 5HM6A 1T3HA 4H7IA 3IEKA 4HQLA 3O95A 2CLDX 4H1TA 3A37A 4JAVC 3C8UA 2QD5A 1C81A 2BFBB 1UFRA 1RTTA 2ZK7A 4P36A 1JHAA 3ULKA 3MQFA 3TZHA 3AILA 3RWMB 2P2CA 1FFYA 1Z0IA 2H5JA 3AHIA 4XX0A 4BQQA 2WAMA 1J56A 1GZ3A 2AV6A 2WHEA 5KYUA 5ALXA 2OGSA 3KV3O 4LJYA 3O4GA 4UD2A 3WGMA 1UMBB 4GUDA 3S55A 3WWYA 4DJ5X 2IOQA 1ZI6A 1YONA 1JNYA 5GZ3A 2GPNA 1UC8A 2WWXA 4CQMB 3OLQA 4C0KA 1JAZA 3QPAA 3CX6A 2BL4A 4TTRA 4GKAA 2JFBA 1TJNA 2AB0A 2CD9A 2W7TA 3Q9NA 3GNLA 1JEDA 1C3LA 1ZCJA 4JQSA 4MWDA 1CE8A 1HQKA 4KC0A 1O5IA 1R64A 1Z0DA 1UMDA 4YP9A 4FX5A 2HDWA 4DDKA 3VYRB 5LKAA 4HGNA 2DQYA 4YIHA 1L3IA 2HCFA 4ZT5A 2H1FA 3CISA 4RSMA 1T9BA 3QA3E 4LUCA 5E2IA 2PMBA 4O2AF 2YXPX 2XOXA 3AV0B 4A0HA 3QE9Y 1J07A 2XCIA 3S2UA 5AOVA 1ECFA 4WUVA 3C41J 3GT3A 4HSGA 5FRDA 1IHYA 2AC7A 2M9MA 2V1XA 2WQZA 2CXXA 3DMRA 1RYZA 1GPJA 3DZGA 1WF3A 3JYPA 4UE6A 5JALA 1P9WA 1EPUA 5JD6A 4P92A 3W78A 2F43B 4RTRA 4JYAB 1B76A 1CDEA 2H0RA 5FD8A 1K7SN 1U04A 1NU8A 3Q5DA 4ZQFA 2DQ4A 5HF8A 4Q4AB 3T6KA 1ADBA 1UJMA 2DWCA 2PTGA 3D54D 2CGEA 4I99A 5FPPA 2WNHA 2AXPA 5FWAA 4YHHB 1VMKA 1VBFA 3QPBA 1YFLA 3AR2A 3D6FA 3HM2A 4X6LA 2Z3WA 1MQAA 1R8XA 5ICGA 2P79A 1YE5A 3OT1A 3QE2A 4Z0HO 2P7HA 2QLBA 1RQ7A 5IM5A 5LQRA 3NUZA 1VGRA 3NHZA 3OQPA 2PBLA 2RB5A 4CM1A 2BJHA 4H4CA 2X5XA 1S4QA 2BCEA 4FQ7A 3MWDB 2J4CA 1RP7A 1IXSB 1VCIA 2IYTA 1ZO8A 2BD0A 2OHFA 4XXHA 1EH5A 2ZBUA 3A9UA 4Z8YA 5TEWA 3M6VA 1NBHA 2HDHA 3R6LA 5K3DA 3RI3A 3RSOA 1F60A 3PNPA 4GNRA 2FFHA 3CWQA 4XJTA 4K87A 4G1MB 5FQNA 3RKSA 1CY7A 3UMVA 1GCGA 4WXHA 4K3VA 3PUHA 3ZZ0A 4R0MA 4YV2A 2F8SA 1OBHA 5ESRA 3KSZO 4O6VA 4XLLA 1GSIA 2WF5A 2WDZA 1J99A 1BA3A 4EBBA 1MHPA 1T3ZA 3DTYA 1KEWA 3NHBA 3VHRA 4D3SA 1R10A 2QPAA 4HH0A 3D8SA 3E9RA 5DBEX 4B5LA 1UDBA 2QW8A 4KE6A 1F20A 3OZCA 5J63A 1P4AA 2GBCA 4ZVRA 2PJUA 2YH2A 1JTVA 5BO5A 3RVRA 4CMAA 2JJ1A 1D8TA 1TZ2A 1X86B 2IZ5A 4I4LA 1DAFA 2FPMA 3HUDA 4IGAA 4PXAA 5JSYA 1YZKA 4G4JA 1OB2A 2AMFA 1NVAA 2SNIE 2XKAA 3AB3A 2YN0A 3ZD8A 2WJHA 5F9HA 2NU6A 4LOAA 1YUNA 5GADl 1BVHA 3GRKA 3N8GA 4BFXA 1BCRB 4I4CA 2AZXA 1B14A 4EW1A 4IDEA 3HXTA 1MB0A 2ICAA 3LG2A 4R9NA 4HMPA 4KO2S 4CF6A 4WLUA 5B12A 1APBA 3Q9SA 1G98A 3C5WP 4GDMA 4PG8A 4BO9A 1DTWA 1QWSA 3OJOA 2ZUEA 1US8B 2AD1A 4HY3A 1Y8ZA 1W35A 2Q2WA 4K8OA 5BVHB 4LYFA 3IV6A 8OHMA 1I1OA 1N7IA 2XDWA 2Q6TA 5DOVA 4DLKA 2BEKA 3LDHA 3THOA 1KQ3A 2YOFA 2BKXA 4LGVA 4N4AA 4D5GA 1JQ5A 1DEXA 1LBQA 4J1TA 4EX7A 3AOGA 2QN9A 1NVBA 2O2IA 1P4SA 2V7XA 2QUBA 1L5VA 1DJNA 1JHVA 5A02A 2DKNA 4U6NA 3IMFA 1YA4A 2ZIXA 4LOJA 1B8PA 1R4MA 1UBSB 3GGJA 4D74A 2H0AA 3L7IA 2PZGA 5F12A 1EAYA 3MD0A 1FDUA 4MQEA 3LK7A 3HJRA 4B6JA 1EVIA 4J0JA 3F1LA 1GNQA 1JIQA 2EJVA 4PYQA 4YHBA 4CQLB 1EGMB 4L22A 3DV9A 1YBAA 4MR8B 3V4VB 3EA4A 3H65A 1PGJA 1IHXA 2Q5IA 4DLLA 3AUYA 4WSOA 3W3AH 5CVJA 1FYVA 5FPQA 1QPZA 1Q3KA 2WB4A 4B7AA 3PJRA 3M4YA 1Q74A 1RI5A 2YJ3A 3CN7A 4X41A 1ZMTA 2AFIB 4GPZA 2Q4TA 1F0KA 4WFKA 4LK3A 4A1OA 1WHTB 1PI3A 1SRQA 2CSUA 9GPBA 5LD2B 1CQIB 3P2KA 2GA9A 4FWTA 1LJUA 1IK4A 1E1QD 4QYMA 1I01A 3UWDA 4JVOA 2Y1LA 4UULA 5AVTA 3C16C 4HQ6A 3T8YA 4MYUA 2YOHA 1OY1A 2O7VA 1JQJC 1NYQA 4PAWA 4QQFA 1XZDA 1D09A 1XEXB 1M66A 1V3TA 2YVAA 5I8PA 1UL1X 2G28A 3NRCA 3CX3A 4OMFG 3U3RA 3ZQJA 3O5AA 1QZUA 2Q07A 2PWYA 3CKKA 4FFRA 1PT9A 5SICE 5FIUA 5DHFA 5LB4A 1ADCA 2G63A 2PVCA 1HDIA 3M3DA 1FSFA 4A6DA 2J6CA 2AFRA 1CUAA 1Q12A 4C76A 4CKEA 1D4OA 3OA2A 2QA5A 2J9GA 4MKRA 2F1HA 1Z17A 2BZ1A 1NG9A 4B76A 2AH5A 2CMHA 1ZESA 3CZQA 2O07A 2LCIA 4XX0B 4MH0R 1CRZA 1ODJA 1U6JA 1YCFA 2O0JA 3F5DA 4N0MA 4XPIA 3MMXA 5CVDA 2BSXA 5KYUB 1YL6A 1GT6A 4PAMA 5CFZA 5JZSA 1OAAA 4URYR 3RU7A 1XAHA 2FYTA 2XYVA 3QF4B 4QDJA 4X0EA 1F2TA 5H9VA 2B5OA 2UUOA 2I2WA 3ESCA 2AMYA 3X1DA 1FFBA 4JWTA 4KXQA 5DASA 1XC7A 1PJCA 4YXWD 4F60A 4ISCA 1Y89A 2Y1DA 3UPUA 4QLOA 1L5YA 2DQSA 2NO7A 2EG9A 2X5JO 2QRQA 1JZQA 3AO0B 1CKEA 3ML1A 4I50A 4DM7A 1XLWA 1ZLYA 1CE8B 1WEKA 3JD4A 4GRAA 4MV3A 1DJPA 4MX8A 4Q47A 1CQZA 2SECE 1XI2A 4TVOA 3ZEAA 1QHFA 4BX2A 1OI7A 1W4AA 2ERXA 2PBRA 2WD8A 1KDOA 3FWYA 3KQMA 1YHZA 4K1LA 4TZTA 3TQHA 4NZNA 4EARA 5LMNB 5L51A 5J2TF 1SG9A 4P53A 2FEPA 3MYRA 1OILA 1K8ZB 3MWGA 4DMMA 3K53A 2ODQA 4DLZA 4Y9SA 2UDPA 4YMWA 4CTOA 1QE3A 4BKUA 1CY4A 5G1OA 5M5BA 1JB1A 1YUMA 2C7PA 1ES9A 4ENSA 3IELA 3OQMA 3OOEA 4MCAA 4TTPA 4D97A 1NBWB 1N6LA 4FFNA 4UQOA 2PHZA 3GARA 3T1HB 3HP4A 4EIWA 1NTOA 1XO1A 1SC6A 2CD7A 1W85A 4FFOA 2F3PA 2YYAA 3FVWA 5GMOA 5CM9C 4RBNA 4F3CA 3WFZA 3T3OA 3KUDA 1FEZA 4BJ1A 1G21A 3I9NA 4UUBA 1GL3A 4XZ3A 2QT1A 3S29A 5KYXA 2VJCA 3DOEA 4KEAA 3LXMA 5EJEA 2D62A 4WEOA 3KLOA 4ITUA 4KO8A 3OT1B 1H8EA 2JFZA 5HFJA 3O74A 3O91A 3VKGA 4HDSA 4OHWA 3MTDA 3BUSA 1R9MA 1ZCBA 4JR1A 4R2LA 4XQGA 4YCAA 2Y0CA 2JIRA 4XASA 4UU0A 1R9JA 3EE6A 3K5IA 1EJ0A 3X1ZA 4WMLA 3V46A 5K4GA 5KOJB 1OI4A 1QJCA 5MN6A 4CGZA 2ETVA 1OFGA 1EXDA 3PXDA 1FZQA 1JKMA 2OBXA 2QX6A 4ZOQI 3HBNA 4WDQA 3PFIA 1E3LA 1KJ8A 1JE0A 1KFJB 5TSDA 5KI6A 2PS1A 1ULBA 4B71A 1XPOA 4BNXA 1Z62A 1UT5A 2X8JA 4N0QA 1Y63A 2ZAYA 2DR2A 1ONPA 1A9TA 1FDVA 1FYDA 3GFTA 4XCXA 2BAGA 1VDZA 5JT1A 3H1GA 1ID8A 3EA0A 4J76A 2VBFA 2ZWVA 1CZKA 4HB2A 3QLVA 4R8RA 5DDIP 4PIPA 2AIRA 2IZ0A 4UHFA 3QJ5A 4JQYA 3ENWA 5BORA 4KZPA 3DT8A 1TVKB 2BM9A 1ZIYA 2C9BA 2Q0QA 2Y1WA 3LPCA 4P3OA 4KUHA 4AUKA 2AG6A 3Q3VA 5E0KB 1L5WA 1V5IA 1YKFA 2PL5A 3Q7QA 1YIDA 2NN3C 4JU8A 4FKBA 2IY9A 1VHDA 2XUHA 1GDTA 1UAYA 1A9SA 3BWEA 2P77A 3KLMX 3ZY5A 3LPAA 3IAS6 4XD7D 4MYCA 1ZLXA 3ITNA 3N0VA 3HLTA 4HLUC 2DBYA 2FDRA 4WACA 2FP3A 3TZKA 3TTWA 2QMOA 3DA8A 3NHUA 1SG6A 3L6EA 4TVSA 3HVUA 5BRJA 4M7WA 1FFAA 4DXHA 4FINA 2VXYA 1A0OA 1XQYA 2A5GA 3DOOA 5TGDA 4XJSA 1LW7A 2AYXA 4XQEA 3F7MA 4CIDA 1JEEA 2EJTA 3IE0A 1DTWB 1GKUB 2IUSA 4NDAA 1XRRA 1HTTA 3L7OA 2PK3A 3IAXA 4GC9A 4MUHA 4GW3A 2WJWA 2JZNA 3V32A 2JAWA 1JPNA 1ODSA 3ED5A 4M37A 3BXHA 3BDVA 1I3NA 4PWZA 3IJEB 3RABA 3U39A 3I23A 4P93A 2XNDD 4L75A 3W8EA 1Q3HA 1TGVA 4MPDA 3CLHA 4R5MA 5BN1A 5GJWC 1JDSA 3LDFA 3BRQA 2XUIA 2NNWB 2VO1A 1PDWA 3QMMA 2CY0A 2V6MA 4FHZA 4V39A 1LBEA 2G82A 1DCMA 5TGZA 4YQFA 4U2FA 2YNMD 4FLEA 5C4GB 1PG5A 1PR0A 2X0RA 2ZIXB 1R4MB 1W5TA 1DNPA 2WVAA 3D5TA 2LKDA 4N39A 3RT1A 4CG2A 2GA8A 1EUDA 3G6KA 2GN9A 1SCQA 1W2GA 2LCQA 1EYZA 2ZIFA 1TJ3A 1JRLA 3ONNA 1EGQA 3AR9A 4CETA 2ZSFA 3ORFA 1MJGA 1PBTA 3DAFA 2JGKA 4MRSA 5E9WA 1SBTA 4OQYA 1SWWA 3MTIA 1PS8A 4B4VA 3LF2A 4EFMA 3R0QA 2GZAA 1RJFA 2ZWOA 5FP0A 3ROEA 4LQDA 2QPTA 3E5NA 1GQOA 5EKXA 4DJDC 1H2RS 5C52B 5M04A 4GPEA 4GVLA 1SBIA 4CL2A 1NFFA 2FKNA 3JAWA 2HM7A 4KYVA 3B6ZA 3U7HB 1TQDA 2HYDA 2P40A 4C3ZA 1NBEA 2PH1A 4MARA 4E11A 1Q6YA 3NPAA 2F1RA 4QGSA 3DAOA 2E5FA 3MMNA 4NYMR 1F8UA 5CJ2A 1X9HA 5F7XA 2R44A 1NN3A 1UQRA 2YW9A 1QVAA 4PR0A 4MVJD 4N3GA 2WFLB 2O8FA 2IOFA 3RFTA 3UCFA 2O8VA 3ZHSA 3KUXA 2AC2A 1AC5A 2ZI6A 2DWUA 4JVNA 1TIBA 1WVMA 1KJYA 4NZPA 3COPA 4RIGA 4TTJA 4A8TA 4ABTA 3TZQA 4A10A 4BFWA 3ENKA 4EOGA 2EYUA 4MZDA 4U0KA 1OXXK 2V7QD 3V1LA 3W34A 4AF8A 4BLOA 4TMVA 3AF3A 3A58B 5LD2C 2QV0A 4CKEB 2O4UX 2A78A 2B0JA 4C0WA 2VEDA 2R6AA 1U3VA 2XY4A 1U8FO 4FCCA 5F3RA 4BNFA 2ZP1A 4OXQA 5E7IA 5FFMA 1WXFA 1X92A 4JOQA 3SI7A 4EPYA 1NJ5A 3ZUGA 4BYGA 1MDFA 3DR3A 4GLFA 1XXHE 2QWXA 4NBLA 2DJIA 3BJMA 3N58A 1KARA 1SK9A 1R1DA 3SHOA 1MC8A 1T29A 3KEGA 4DSTA 5KYNA 2JRCA 4C5CA 2JFXA 1GO2A 1PGPA 2P69A 1ZOIA 1UBHS 1GZ7A 1HTBA 4I50B 4FONA 1W0JD 1U8XX 3RPEA 5M2QA 3SD7A 3K1JA 4R51A 3DPUA 3WRXA 3KAJA 4C89A 1HE8B 3IYLW 2WT4A 4XVUA 1Z39A 2WMNB 3RJ9A 5LNK1 3HGTA 2ZQZA 2R6GA 1P62B 4JBLA 2RHJA 3CRQA 3P2OA 5K01A 2FW7A 3ZWPA 2I6UA 3RRBA 1P72A 4YLYA 2GBLC 1HF3A 1EWYA 2WZCA 3W9BA 4EEKA 4YRAA 4ZN6A 1JKFA 2VUUA 1UC9A 1KXZA 1E3TA 1DFGA 2CLOB 3F5FA 4PVDA 5KVQA 1IPHA 4JI6B 5C1OA 1SPXA 2ZJ7A 3S81A 4N40A 2AYZA 1Y42X 2GZMA 2GYUA 2DWPA 2GYYA 1XZMA 3E15A 4MUAA 3RRMA 4EA6A 1W85B 3ESAA 4Q05A 1BN7A 1P9RA 2GJ8A 3OJ0A 5BV0A 5KQRA 2VNHA 2D5BA 1VFPA 2RIRA 1G21B 4OHVA 3AWIA 3P1JA 1J8DA 4G0VA 3WQBA 2DT5A 2YFQA 2ZRGA 3D4PA 1RFLA 4AY3A 4ZT4A 3U1BA 1FDRA 2NV6A 2X1LA 2XCUA 1UJ5A 1SXHA 1E2UA 5EE3A 3M83A 4HDSB 3A4VA 1IY9A 1I3OA 2DH6A 2R84A 2HJSA 1XWIA 2XRFA 3JV7A 5CDSA 3JYQA 1KTVA 1CW2B 3DZ8A 1B73A 3U3JA 4AMVA 1XTRA 1KF0A 4V24A 3MQ4A 1Y80A 3HQ4O 2BBWA 4OVKA 2YFKA 4US0R 2R8RA 5DLQC 2CBZA 3HXPA 1NVGA 3QVMA 1WF6A 1I0LA 2IP4A 3CLUC 3MWJA 1STOA 5G1NA 1OKKA 3F6CA 3ETNA 1EZ4A 2I3BA 2FDXA 2X8JB 3R20A 3JQAA 4HGRA 1O96B 1XDBA 5HA5A 2G71A 2P41A 1HDEA 3G1UA 5ADWA 4EY4A 4URFA 6ADHA 2FUKA 3HCWA 3HKBA 1JDUA 3AZPA 3GBVA 3LBIA 5GVSA 2WWRA 1AQJA 1BHO1 3MCZA 1W87A 5KKCA 3JD2A 4I55F 4YRFA 4D5EA 1H0HA 4MW0A 4ZJUA 4C14A 2JEYA 3EWSA 3K94A 4MJ7A 1U1CA 3LTNC 3LKDA 1JEAA 1D5CA 1TJPB 2Y99A 4JHXA 2HQSA 3LCCA 3HACA 4HADA 1U2GA 5L53A