2EFDB

Ara7/atvps9a
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
165
structure length
152
Chain Sequence
SINAKLVLLGDVGAGKSSLVLRFVAAFFSQTLAVNDATVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVFDVTNQASFERAKKWVQELQAQGNPNMVMALAGNKSDLLDARKVTAEDAQTYAQENGLFFMETSAKTATNVKEIFYEIARRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Similarity to vacuolar protein sorting-associated protein VP
publication title GDP-bound and nucleotide-free intermediates of the guanine nucleotide exchange in the Rab5/Vps9 system
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 41
structure length 152
sequence length 165
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2efdB00
2HYDA 1G41A 2BM0A 2GBLC 1U0LA 3MCAA 4YMSA 4DSOA 1AKYA 2LKCA 5F9FA 3K53A 3VAAA 1DO0A 1J99A 3U3RA 4A2WA 4WZBE 3KX2A 3RYTC 4H1UA 4TLAA 2X2EA 1XD9A 1YU9A 2W83A 3B1YA 3DPUA 1KDTA 1Q3TA 5G40A 1KZGB 4L16A 2EFCB 5DHAA 4B76A 3ZH9B 2KE5A 3UANA 4CEHA 2D4HA 4DT1A 3ZYCA 2NO7A 2ZJ5A 3H2YA 3FMOB 3B85A 2H16A 4BLTA 2XEXA 2GA8A 5DNYB 3KXIA 4US1R 1KSGA 4A0GA 3EXAA 2QEQA 3TVDA 4CEJB 4MKFA 3KQLA 1NVVR 4RD0A 1II8A 3F3YA 3SNHA 1KI3A 1XFAA 4HDOB 1CIPA 4IOKA 3UMFA 3PV0A 3QXHA 4X8LA 3LO5A 4Q7KA 3DZ8A 2J1LA 3HYRA 2J0UB 2GETA 5GJBA 4PFSA 3GLGA 2O0HA 4TLDA 4LV5B 1OF1A 1P60A 2E9SA 3OEHA 5EE3A 1KGDA 1GOTA 4JBXA 3PUZA 1XZPA 4MKGA 3DO6A 1Z3IX 2BEJA 4MGKR 5JWHA 1E9FA 4OQXA 2H92A 4OI4A 3SR0A 1QHSA 1TQ6A 1MRSA 2W2TA 4XD7D 3CWZA 1AK2A 1XEXA 4GP6A 4TZ6A 4QBHA 2C99A 2PZGA 4UJ3A 1XPUA 2OBMA 4AKHA 4PC6A 1H8HD 2DPXA 3NG1A 4RJLA 2VP5A 3ND8A 1KHTA 4UNNA 2IYQA 3EPJA 2GXQA 4Q7MB 1R8SA 2MMCA 1ZW6A 5SZJA 3RS7A 1UKVY 4LWZA 5C2JB 1CU1A 1T6NA 1XXHA 3UMRA 3QF4B 2XTNA 4EUNA 4V0ME 1U0JA 2CXXA 5FOXA 1RE0A 1WF3A 2ZVPX 1M1YE 4OJKA 3C14C 4YQFA 5HPYB 1KI6A 2Q3FA 5JRJA 4N3NA 4D25A 1GZSA 2V8OA 1YZTA 2ZRPA 1FQKA 4TMZA 1E79D 2MSDB 1G16A 3QG1A 4HB3A 4LBZA 1EGAA 1T9HA 3TAHA 1FUKA 1SVIA 2YYZA 1AGRA 1U98A 2D7DA 3C4JA 3TR0A 1F2UB 1OFTA 1KI4A 3LX5A 4OHWA 2OBLA 3BAFA 1Q0UA 1DAFA 1A7JA 5AUPB 3RS5A 1OE0A 2WJIA 1HT1E 3A4NA 2H7VA 4Q48A 4ZPXA 3Q85A 2KB0A 3B78A 2IS2A 1KK2A 4HAYA 2BM1A 4HZIA 4BFZA 1ZJ6A 2FSIA 3QKRB 5KNDA 5DHFA 2OAQ1 3ADKA 3B1XA 4PO8A 2IUTA 3VR5A 4ZCMA 1DAIA 2RGGA 4IRUB 1XNJA 3WMGA 5BWMA 3KKMA 2Q0HA 1C9KA 2CCKA 3C8UA 1JECA 2QP4A 2VHQA 3CRQA 4JKIA 2IF2A 3ZDQA 1GNQA 2ZU0C 3CNNA 3U2QA 5K8IA 4DSNA 1ZCBA 1X86B 1XJ0A 1IY0A 1BKDR 4YMUA 3K8YA 3H1TA 3MRSA 2OEPA 1FZQA 1QBKC 2QMOA 2F1IA 4A82A 1Z2CA 4QXAA 3W34A 2P6UA 3BBPA 4PPQA 1KJZA 1OFUX 3KJHA 1KIMA 1SQ5A 1T4GA 3P32A 2PEYA 1DG3A 3IO5A 2ZUCA 3I8SA 3DKVA 4EFNA 2FV8A 2W58A 4KHZA 4CW7A 3VKHA 2CJWA 4MRSA 421PA 1S0UA 2WAXA 1AJEA 3OEHD 5EP2A 1ZBDA 1W5TA 3GJ8A 2PZFA 2NQ2C 1G8PA 4M2LA 1VIYA 2CBZA 3GJ5A 1KO7A 1KK0A 2E87A 1Z0FA 3GLHE 4Q9LA 4Q4AA 121PA 3U61B 2FOLA 4NCNA 4RSGA 5HCIA 1SKQA 1W49A 2RGBA 1IN4A 4WA7A 1TU3A 1W4BA 1E2FA 2IYRA 2HDNB 3FB4A 4NCIA 1W36C 2VF8A 1F60A 3SEAA 2O8CB 1UF9A 1NKTA 1X1RA 1KDPA 1JJVA 1ZNYA 2W6IA 1EXMA 1IXZA 4E07A 5DYGA 1XP8A 1F3OA 2BDTA 2FNAA 2GZHA 2FWRA 2NPFA 4POAA 1EWQA 3AF2A 4QRHA 2NO9A 3EZ7A 4AWXA 4QHYA 2WKQA 1BO6A 4M21A 1G3UA 2RGCA 4Z51A 1HUQA 4NYMQ 2W2XA 5D3MB 5A4JA 2FDCA 1WA5A 3QVVA 3SQXA 3CPJB 4R71A 4HLQB 2PT5A 3B13B 1FNNA 3ZIAA 1COWA 1G19A 4W5JA 2ZI5A 4LY6A 4FN5A 3GFTA 3MJHA 1IY1A 4D2IA 4OHZA 1TEXA 2D2EA 1UAAA 1DG1G 4DRZA 3GJ7A 3VKWA 3PEYA 2Q3HA 4HATA 4NDZA 4Q02A 4Q19A 5GVSA 3EAQA 4PQYA 1N5LA 5DLQC 1CEEA 1FMLA 1K8RA 3QQ5A 1Z08A 2GCNA 5AJVB 1N3BA 2XNSA 4ZIRA 5H8WA 5SZIA 4WXRA 3I92A 2XB4A 2F9MA 3PITA 3FMFA 3TE6A 2P0EA 4JS0A 2QENA 1CJMA 1JEEA 2C78A 1Q1ZA 1R0YA 1ZM4A 4MYUA 4BEJA 3K70D 2XSZA 4PSAA 2OBNA 1XX6A 3PVSA 5B30A 3AUYA 4IDNA 5DE3A 3O47A 4QGGA 4DLZA 2JLWA 1E0AA 4DT1B 3PEVA 3LVRE 5JI3E 1NI3A 3CWQA 1JR3A 1KO4A 1MO5A 2WWHA 2EYUA 2ZU6A 3I1FA 4GOKA 1ZU4A 4C0SA 2QI9C 3ZJYA 3BOSA 3CNLA 4LJ9A 2FEMA 3DZDA 5DYIA 2DCUA 1E4VA 2A5GA 1Z07A 2RAPA 1LS6A 4KJZA 4DIDA 3ASYA 3NC1C 3RSOA 4KO8A 4EPVA 2HXYA 2ZRKA 4PR0A 1A1VA 3OZXA 3D31A 5GJCA 1U81A 2BKUA 2VL7A 4D80A 3K0AA 4QJ5A 1VMAA 3KKQA 5LDDC 1Q1QA 1T91A 1KY2A 2GXSA 3OIUA 4OI1A 2V3CC 1DVRA 3LBIA 1VDZA 3QXSA 5H68A 5FPKA 3U44A 1IJEA 1W7AA 4B2LA 1P75A 1XEXB 4X8OA 2GVZC 3SJAA 3Q9LA 3ZVMA 4C2UA 5LPNA 4IHQA 5BXQC 5E95A 3QEJA 1ZUIA 4MRNA 4DEXA 3THXA 1SXJC 2VP4A 2W6ID 3ADDA 2WTUA 3MUFA 2Q9AA 2ZR7A 1CR1A 2O8EA 3KXLA 2X1VA 4PZYA 1U99A 2CDNA 4I4LA 1OIVA 1KO8A 2WKPA 2C96A 1XXHB 1PLLA 1W0KA 4MDEA 1TPZA 4NYIQ 1W5SA 2HUPA 1J8MF 4JT4A 1IN7A 1JB1A 1IN6A 2PLFA 4HB0A 4QHTA 1GWNA 4QGHA 4ZKEA 4FINA 2C95A 3QBTA 1COWD 3TUJC 3ZIAD 4CT4B 2I3BA 3A58B 3KB2A 2KSQA 2VRWA 3RDPA 2O0JA 5JWRA 3FHCB 3REGA 2VH5R 3VHLB 4UNPA 3CF6R 1TTTA 5KSOA 4IFEA 5JMTA 1CR2A 2GESA 2F1JA 4GSYA 2QT0A 4F7WA 2AK2A 2NO6A 1NIJA 1W36B 2GXUA 3H84A 2ZRMA 2F55A 1GRNA 5IT5A 1JQJC 3AVXA 4L9SA 2XGJA 1RJ9B 4MKIA 4RZXA 4TYQA 4MUBA 3EPLA 3EIHA 3I3SR 4M53A 1DARA 2GZAA 3Q3JB 4QGFA 5CJPA 1G3RA 3B6EA 1P5ZB 3PENA 4JLDA 3E70C 5EE5B 3V4FA 3B9QA 1UBEA 2XSZD 1ZAKA 2F3RA 4JBYA 1DS6A 4EPWA 4LK2A 3IIKA 5FR1A 1Z0KA 5EE0A 3B82A 1SVSA 3AVWA 2HF9A 5BYKA 1JR3D 1ZU5A 1VKJA 1R10A 2ZPTX 4AC9A 4PHFA 3L0IB 3VHXA 2A5YB 2ANCA 4TMWA 4G1UC 1R2QA 4HZUB 4U7DA 3O8DA 4NYJR 1N6NA 4DCSA 5CDFA 2RHMA 3QENA 4G3XA 4OI2A 4KVAA 1IHUA 4QFMA 1UFQA 4TSFA 5KDOA 3RS3A 3PUVA 3U7HB 2J5XA 4NL4H 3KTAB 2JLQA 2GK7A 2WZQA 3G5UA 3BGWA 2P67A 3KQKA 3W90A 2FFQA 3C5HA 1R0ZA 2CE2X 1IXRC 1SKYE 2CJWB 3FMPB 1AQUA 3QVUA 4P3YA 2CHVA 4DJTA 3FHTA 1P61B 3IIJA 1RKBA 2RGDA 3EWSA 4Z54A 3OIWA 1VHTA 4PAMA 5FUVA 1T8TA 5KPDA 2W00A 4Q4AB 621PA 2ERYA 4PXAA 2Z4RA 1M7HA 4CRWB 1YR9A 1RC8A 2XZPA 5GJWC 1LV7A 4JVLA 1S3GA 2OCAA 2WOOA 3IPYA 4M4SA 1CKEA 1OYWA 2A3RA 4V02A 1OH8A 1E2LA 3SOPA 5JJKA 3W6OA 2QGZA 3KFXA 1E1QA 3UG7A 1E9RA 1XD2B 4OYHA 2NO0A 3PEUA 2A2ZA 4RKEA 4OHXA 5J4HA 3ZZUA 1YE8A 3WYGA 3THWB 1XEFA 2V7QA 3BFXA 2DY1A 1W0KD 2WJJA 2CLCX 2NO1A 2NOAA 1XF9A 2FPKA 1A4RA 3TKLA 3ICEA 1XEWX 1GKUB 5BN5A 1NL3A 1CJTC 2F9LA 3SJBA 4YMTA 4D4JA 2OE2A 1VG9B 2CL7X 4BRWA 2CCJA 4M1OA 3PEWA 4M1TA 2ZM5A 1E2EA 1S3SA 4IJMA 4BZQA 1G9XA 2KWIA 2ZRLA 5KNCA 1ZM7A 2F1RA 3CO5A 3NH6A 1F5NA 2ZRAA 1DAHA 1G18A 1JEDA 3LW8A 1T8UA 2PMKA 4DEYA 2IX3A 1T3SA 1LY1A 2R62A 3GPLA 2FF7A 2GK6A 2VHTA 1NVVQ 1SXJB 3H86A 4JL6A 2CVHA 4LCBA 4WW0A 1E2JA 1G291 2HJVA 4B3BA 4GNKA 4GL2A 2JEOA 2HXSA 4URUR 3AM1A 3FMIA 4LV8B 3I4LA 2HLDA 4AG5A 2ZAOA 4LYFA 2O52A 4R7ZA 3WHLA 4ARZA 1KJWA 3ZVLA 4AD8A 3AP3A 4DC9A 4QM6A 4B44A 5UKDA 4FMDB 1SVKA 4M9ZA 4L9WA 1DOAA 4CGZA 4GOXA 4DDVA 1NSTA 5KSPA 3R7WA 2JCSA 5FR2A 4F38A 5CK5A 5L3SA 3F5FA 1U8AA 2RH5A 4KV9A 2OCYC 3L43A 2HCJB 5HZHA 3LRPA 4XVRA 2D2FA 2BCJQ 2IC5A 5SZKB 5KPJA 2RHDA 4TSFD 2ZRGA 3DEFA 3EZ6A 1N5IA 3E1SA 4M22A 4S2EA 5CK4A 3U4QA 1NN5A 1ZP6A 3HPRA 1BS1A 4QNMA 1NMZA 4D4MA 1IXSB 1KK3A 2W0SA 3NXSA 1HA3A 4NMMA 4NBSA 5CM9C 4Y0VA 2G77B 1KMHA 3THYA 2QPAA 2BCGY 1MO3A 3KKNA 1JAHA 3JVUA 1C1YA 2KI5A 2XXAA 3T35A 4NPHA 1XTKA 4TT3A 5IDVA 3ADBA 1W0JA 1DAKA 4DB4A 1KTVA 1E2GA 1S1CA 4RKFA 2DFNA 2WBLC 3VNUA 2ZI6A 3OE7A 1EFUA 2IK8A 4D0LB 5HE8A 1P62B 1GIAA 2PH1A 4MA4A 4UXHA 3QBVA 1MO4A 2HT1A 2MSEB 3GEEA 1VTKA 5AUQA 5KSZA 4QBFA 1E1QD 3CPHA 3U7EB 4TTPA 4Y0AA 4JLKA 3THXB 5FUWA 3W3ZB 5KDDA 1Q20A 4YONB 3TIFA 1QG4A 2QG6A 3RRMA 4RCYA 2ZI7A 4RD4A 2ZUBA 1FFHA 2C77A 4M1SA 1XTQA 1Z63A 1OH6A 1KAOA 1RW4A 3K09A 2ZRBA 2ZS7A 3WHKA 4OQMA 1LFDB 5FPTA 1RRPA 1LB1B 2B7CA 3DVLA 1J2JA 1ZM2A 3LDAA 3Q7PA 3SN6A 2WMNB 2D06A 4TTQA 4CEIB 1CS4C 3GCGA 2OFWA 1P9NA 3CIOA 3O8CA 3OIYA 2Z0MA 3FDIA 5L3RA 2VLIA 5KTYA 4KVGA 5BYJA 4M1MA 5HKKD 1E2DA 2IYVA 2CL6X 4LUCA 5AJYA 3CONA 4WXPA 2J9RA 2YINC 3K0EA 4Z8XA 3ZD6A 2Q6TA 4B32A 1JXMA 1GTVA 2HLDD 3ND9A 4HUQA 4B73A 1BOFA 4UXIA 3VFDA 2JGNA 3AF3A 4QC2A 1KY3A 2OFOA 2ODNA 4EFMA 1AA9A 4M1WA 3NEYA 4LDJA 4C0BA 5JCZA 1OXXK 1U0HC 1EX7A 3WP0A 3IQXA 2FEOA 3HU3A 3EZ9A 5KO2A 3VU9A 5EE9A 4Q9KA 4NONA 4FIDA 4LJYA 1QHNA 1ZC3A 3TUZC 2G3YA 3T1VA 2GHIA 4UNSA 1GG2A 3RRNA 3SHFA 2P65A 3IEVA 1CJVC 2JJ2A 5IRCD 2VP9A 1YR8A 1ELOA 2ZYWX 4EPRA 3U6KA 1Z0DA 3QJYA 4CVNA 4FMDF 4HLDA 3DKPA 3BE4A 3SYKA 3ICQB 4AI6A 1KDRA 4L4UA 4U5XA 1D8TA 2IYTA 3LXXA 1Y3AA 4CDGA 3CPEA 4W5HA 4GMDA 4TT3D 2ZROA 1W0JD 1KYIA 2X77A 5B2ZA 3K09C 2P5SA 5E7IA 4C9BA 1R6BX 3GLGB 2GJ8A 3OE7D 4DCTA 4DZZA 4RCZA 2IEZA 3IIMA 2J46A 2FSHA 1ZYUA 1G8HA 1YQTA 5LBIA 2CCGA 1ZD9A 1VYTA 2NPIA 4KSBA 5B64A 5JCPA 2FPLA 1E9BA 4KXFB 3L8ZA 1IN8A 1W4CA 5J4KA 5G3ZA 2CL0X 2J0QA 4HDQB 2ZRIA 2F6RA 4TLBA 4NZYA 3CNOA 4U02A 4HAUA 6Q21A 4K81B 2JASA 4AKGA 1RIFA 4B33A 2YOFA 1E98A 1U94A 1E9SA 2OO7A 1EFCA 3LBNA 3N70A 3ZGXA 1S8FA 1CULC 3MWLA 1CR0A 3KUCA 2PJZA 1XMJA 3VR6A 4PPGA 4JLPA 2WWFA 1F2TA 1JALA 1UEIA 4P4TA 5IF9A 4O2RA 2R6CA 1O87A 3M0EA 3NHAA 1SHZA 1T5LA 5FBWB 5DH9A 2DB3A 3AF1A 1Q21A 1S2MA 3TSZA 3QPUA 3GLHA 3IQWA 1JJ7A 4QOSA 4Q4HA 1E2KA 4LX0A 4Q5IA 5TV2A 1D2MA 2HCBA 2QQ0A 1KI1A 2FGJA 4B34A 2J7PD 1XZQA 2IL1A 1N6HA 3BB1A 1GSIA 4XWAA 1E6CA 1J8YF 2PL3A 3B8HA 4F92B 4JVNA 3P4XA 4IXNA 2H5EA 5HTKA 5JHGB 2VEDA 3DOEA 5AR1A 4C4PA 1KNQA 5FBVB 3BB4A 1ZMXA 2QORA 4D0NA 5JSZB 2OLKA 1R0WA 2PBRA 4O3MA 3UMSA 1FP7A 3K1JA 4KFSA 1YZKA 2BC9A 4KYUA 4ZDIA 3CRMA 1RYHA 1P2TA 3L2OB 4ARZB 2H1LA 2QROA 4M9SA 1VYVA 3MWJA 5FOTA 2H17A 1AS2A 4R2HA 2FFBA 1OB2A 1MABA 5JECA 3MFYA 3NWJA 4ACBA 4QJ4A 2GJSA 4AKEA 3SJCA 4EAQA 4AURA 1LS1A 1NJGA 4JJKA 2JJ2D 3WMFA 2PMDA 3TSOA 1HEIA 1L2TA 5JFGA 3SQWA 1VG8A 4Q9JA 4HI0E 3TSWA 3U4QB 4XWKA 2OV2A 1E99A 5EQTA 3D3QA 4A0HA 2B8TA 1AZTA 1TNDA 4S35A 4L5BA 4MQBA 1T3HA 1KMHB 3LW7A 3THYB 2QMHA 4W5WA 4Q1EA 2XNDA 4AIIA 1OHHA 1XU4A 1XCPA 4YDSA 5F2EA 2XXAB 3L0PA 3TVTA 2NGRA 1Q44A 3T1OA 4KCGA 2G83A 3AKYA 2FGKA 1ZRHA 2G88A 4QBGB 3R9XA 4OHVA 4P4UA 3HPQA 1N6PA 1RYFA 3ZQ6A 4A6PA 1LNZA 2MMGA 4BASA 5KOYA 4C7OA 1Z22A 1RRFA 3D6TB 4JLMA 1PVOA 4DSUA 3UWOA 3RRZA 3U60B 2QTVB 2IYZA 2IWHA 4ZCIA 2YVUA 3CW2A 4NCKA 4KBFA 1U8ZA 4A4DA 3CLVA 1OH7A 2FZLA 3QOFA 4GOJA 1IY2A 2O8BB 3AKEA 2GKSA 5TY0A 1YR6A 1D2EA 1Q3HA 3MG9A 4CF7A 2RKOA 1N0WA 2DWPA 4JVSB 5KUTA 3N2IA 5FUYA 1OB5A 4FW9A 1GL6A 4ILEA 3FKQA 2JAQA 3MAAC 3CRW1 3AVTA 2R6FA 4ZV4A 4O0MA 2H8KA 2X8AA 2PEZA 4QGAA 2JJ1A 2JLRA 3A1SA 1TU4A 3AVQA 2AWOA 4KLZA 4BQSA 4V03A 1UBFA 4LYAA 1GILA 2ZAMA 3BORA 1U2RA 2CHGA 4NYJQ 4BWYA 1FW6A 5JJLA 4PHHA 1NN3A 3ZZTA 1CJKC 4KLNA 2F43A 2ZYVX 2A30A 2QAGA 4LGMA 4C0LA 4PAOA 2ZYTX 1Q1EA 2AXPA 2GEUA 4JZKA 1GM5A 4BZXA 4HUQB 5K8UA 2O8FB 5FTJA 3WMEA 2FU5C 2ZRJA 4KBGA 1R7RA 2YHSA 4Q4LA 1QHXA 2XZOA 4ACAA 1R8QA 1W47A 3A1VA 2VBCA 1OIWA 3RWMB 3DMDA 3ZZ0A 3EASA 4Q1BA 3VU9B 4IEEA 1U8YA 1BMFA 5KDLA 1G4AE 2BMFA 2ZXUA 4FD2A 2WWWA 1X1SA 4OBEA 3GP8A 4XIGS 4BRUA 1IONA 4NCJA 1TUEA 3IDQA 3K70C 4URVR 4LPKA 4ZDKA 4DBLC 5FTMA 2ZI9A 4LJAA 4B47A 1OKKA 3I72A 5G53C 1XD8A 721PA 4EFLA 2QN6A 2XNDD 1OHHD 3LY5A 3FYHA 3P4YA 4J0QA 4Q21A 4DLWA 4EQ6A 1E0KA 1ZIPA 3GEIA 5J4LA 2IYLD 2ZJZA 1P7CA 2ZR0A 3EARA 3MJRA 4O2LA 4QHSA 5FOWA 1VCMA 1NIPA 5FPHA 4CT5A 2ZSAA 2ZJ8A 3E5HA 3VR1A 1YRBA 3LXRA 3TAUA 3GLIE 2OSBA 3D8BA 1I4DD 2WM9B 4A8JA 1GKIA 1TUIA 2H18A 3KJGA 3KL4A 3TBKA 4NP6A 4F4IA 5KU1A 5DI9A 3LX8A 3IO3A 1AQYA 2IS6A 2CMKA 5CLLA 4KITB 1EESA 2EFDB 4LPSA 4C2TA 4CEHB 1HT2E 3TH5A 1AKEA 2I1QA 3OFNA 2BHRA 3K0FA 5E3HA 1X6VA 2EW1A 2IYWA 2FX3A 2QAGC 4A0RA 2Q3MA 4IEIA 1G64A 2QMUA 1OXUA 1XB2A 1NBME 4ITRC 4HUTA 4PHTA 5DSZA 4OQFA 4RD2A 4A9AA 3DL0A 5L3VA 4RY2A 3X1ZA 5H70A 2N1BA 1P2VA 5J40A 5KSYA 3M1IA 1F2TB 2PCLA 3SHWA 5HR5A 5F3WB 2NG1A 2R8RA 1W44A 3SS8A 1OJLA 1II8B 1VECA 3T5GA 3AP2A 4YC7A 3TW4A 1JR6A 1LW7A 1ZNZA 3AKCA 3BH0A 5C46F 2JJ1D 2QGNA 4TQUS 2NMVA 2DHRA 3ETLA 2ZJBA 4Q4HB 4PTLA 4PHGA 3CZPA 4IFBA 4XVQA 4JLAA 4IOJA 1TX4B 2QE7A 4FI3C 4DLXA 4RVCA 1IOZA 3WYFA 3GEHA 3X2SA 4DWJA 1X8LA 3L0SA 4A1FA 3A8TA 1OYYA 1E2PA 2AR7A 4L15A 4I1UA 2HF8A 3BERA 5C4MA 1TQ4A 3K0CA 4Q7JB 1HY3A 4AK9A 4AYXA 4E09A 4URZR 3FOZA 4V0OA 2P5TB 1G1MA 1G7RA 2KBFA 3QUSA 4OK6A 3NBXX 4JYCA 3OF5A 5CM8B 1BMFD 2ASEA 3T1TA 3SJZA 4B3FX 4ZI2A 3I8XA 3ZD7A 3I32A 3T15A 1VYUA 2QUZA 3EW9A 3NKVA 1R0XA 1XTRA 2ZETA 2DBYA 4F91B 4JBWA 4EPYA 5JLJA 1YKSA 2QPOA 4MGYR 4HAWA 4I99A 4BLSA 1KI6B 4QNRA 3SU8A 5DO9A 2ZS9A 1OKKD 2EQBA 3GFOA 2C9YA 1Z6TA 1E94E 3L82B 4URWR 4F4JA 3JZMA 4MRVA 2VP0A 4ABYA 4HLUA 4M9QA 1S9HA 3B1VA 3A6PC 1HQYE 3C5CA 2B21A 3V00A 2CVFA 1D5CA 1I2DA 4KFRA 1L4YA 4BLQA 2PX0A 5CB8A 2A7QA 3NBFA 2WAYA 3PUWA 4P4SA 3U7FB 2V1UA 5E4FA 1TL7C 2GRJA 3FFAA 3ZVNA 3TRFA 1G8GA 1VG1A 1HTWA 1KZ7B 1OLOA 3P26A 3E2IA 3EWAA 3TR5A 3IBYA 2OCPA 3IKJA 4B74A 1N25A 2B6HA 4B2PA 1GDDA 2IHBA 4QG7A 1AM4D 2GTPA 4HB4A 1P2SA 2REBA 4JLJA 5FPYA 3RANA 4AY2A 1AZSC 4QKQA 3OFND 1JQLB 4U00A 2CE7A 4FMBB 1UJ2A 3K70B 3CR8A 2VYFA 3NVAA 4TYWA 2BBSA 1Q22A 1G5PA 3M4YA 3RS2A 4TZ0A 2PLRA 1FX0A 3TMKA 4G5QA 3VR2A 1GFIA 1NG1A 2BWJA 4GRAA 5F9HA 4KFTA 4B3XA 3PR1A 4URXR 3U5ZB 4RFVA 2JLUA 5CB6A 2HEIA 3AVVA 1P9RA 1IQPA 1FL9A 3GLFE 3J81k 2O8DA 4OHYA 1UBCA 2QE7D 4IVQA 4C0AC 1SHKA 3ZQJA 1N6IA 3ASZA 3B1ZA 2JIZA 4HYYA 3L8YA 4HEJA 2F43B 5BQ5A 1G17A 2BMEA 1WQ1R 4AYTA 2QAGB 1NLYA 4WOPA 4HLUC 2VF7A 2HT6A 2J3EA 1AGPA 2AD5A 2DWQA 2GJAA 2R2AA 4TL9A 3A1TA 1L7VC 3GMTA 3C16C 1E2NA 3KB1A 4PC2A 5BN3A 2GCPA 3QXJA 2JA1A 3SBEA 5E7MA 3TK1A 2GAAA 2FSFA 5AJXA 3AVUA 4DVGA 4AYWA 2UZIR 2RMKA 1KI8A 2C9CA 4G5RA 4WIAA 4WVFA 4PPNA 3Q5DA 3S1AA 4YMVA 3IEUA 4IXMA 4AG6A 3UWKA 4IOMA 3RS0A 4B43A 4JLOA 3LH5A 3PJRA 2XITA 4XTCS 1MRNA 5FBLB 4B71A 2BIFA 1RZ3A 3GQBA 4RFSA 1TF2A 2ZREA 4BFYA 1XJQA 1TAGA 1JPNA 2IW3A 2V6JA 1MV5A 3NC0C 1BH2A 5HKKA 5DN6A 1KSJA 2REXB 3MD0A 3RS4A 4EQ6B 4TLCA 4FXPA 3AGQA 3QI2A 2QY9A 1I4TD 5FFMA 1BYIA 1YZGA 4YLGA 3KQUA 1EWRA 2VSOA 3B7GA 4A15A 4ZIRB 1WBDA 4JL5A 1TQ2A 2CLSA 2YC4C 2ZJYA 3OHMA 1I2MA 1PJRA 3CKLA 1YJ5A 2FH5B 1B0UA 4DCUA 3HWSA 4Q1CA 2YJTD 2ZRCA 3FVQA 1KSHA 4L8GA 2RGEA 3CX8A 3F0TA 3LQQA 3PUYA 4H9GA 4BE7B 3VMFA 3OESA 4NKRA 4K8OA 1IAQA 4TQ9A 5FTKA 5C4GB 2VSFA 2GEVA 2GJKA 4Q47A 1E9EA 3K0FB 1RVDA 4K46A 1VCOA 3BK7A 1N0UA 4TYPA 4DLUA 4E22A 4IDQA 3EG5A 4RD3A 3T5DA 4B6EA 2ECKA 1SKYB 3CRRA 2GCOA 1NN1A 4TMKA 2JLYA 1GVNB 3CX7A 1SVMA 3BFKA 2G0NA 2UVQA 3Q8XB 3QXXA 2OT3B 3WP1B 1P9WA 1P72A 3AB3A 2EFGA 2I1VB 3RVBA 2VA8A 4M9XA 5G3YA 3K0AB 2XTMA 4LI0A 4O25A 2JIZD 1Z6XA 1IM2A 1GRRA 4LBWA 4BEBA 3FE2A 1FTNA 4PSKA 1BYUA 2WSSA 5EZ5A 3HR7A 2YOHA 4RZ2A 3IBGA 1UDWA 3U44B 4OQLA 3EPHA 3T34A 3M6AA 4C0QC 1E2MA 5ELXA 5EUMA 5G41A 3AH8A 3C7KA 2GVDC 1RFLA 1DO2A 1N5KA 2VP6A 3LVQE 1LF0A 1LF5A 2GDJA 2O8EB 3CX6A 2KBEA 4PC3A 1YHNA 4XSHA 3KKPA 3CBQA 2V1XA 2N46A 3QKRA 3R8CA 4TQAA 4LC1A 2XZLA 4LHWA 4XWOA 3AUXA 5A5GA 3FTQA 3V4RA 5A0FA 1M6NA 1P4SA 1B23P 2GNOA 3TNFA 2ORIA 2GAOA 5C18A 4MRPA 2VO1A 1WB9A 1RPZA 3TJZA 5CIWA 3A1UA 3QPWA 1W4RA 2C98A 2J7PA 5DN6D 4PC1A 4US2R 4NCHA 4N1AA 4PSVA 2GF0A 4WZAE 5J5CA 5EJEA 3KQHA 5HZKA 1CF4A 3B5JA 4BFUA 3BXZA 1BIFA 3BFVA 2YWHA 2G0TA 1SVLA 2Z83A 3HP1A 2XX3A 3PG5A 2FE4A 3RABA 2HV8A 3R8FA 4H1VA 2J87A 5EP4A 3RNLA 3B60A 1A82A 3TUIC 5TMPA 2YZ2A 2FMXA 1GUAA 2K5UA 1HYQA 1ANKA 1JAIA 5EXXA 2WV9A 1EFHA 2R9VA 4LHXA 2A78A 4XTRA 4LHZA 1XMVA 4MGZR 3AKDA 3VR4A 2AFIE 4YXWA 1DTSA 1GNPA 3MWYW 3QG5A 2VP2A 2XTZA 1HQCA 2QU8A 5FOUA 3K0SA 2AWNA 1KK1A 2WJVA 4NHOA 1KI2A 4B6FA 1LVGA 2AKYA 2BMDA 4UXJA 4IVRA 1GRQA 1D9ZA 1F6BA 2OLJA 3PCRB 4G5SA 4BLPA 1FX0B 2VPPA 4HAXA 3OIVA 4LSGA 5HCNA 3MGCA 1G3IA 1GNRA 1N6OA 4LJ4A 1NKSA 4UNRA 2WJHA 2WSMA 4NU0A 3UXMA 2BBTA 1VCIA 2ZQ5A 2BKEA 1NLZA 2QQEA 2RGXA 2LKDA 2ZSEA 3VX3A 1XPRA 1F48A 5FL7A 3UG6A 3WBKA 3A1WA 3RHFA 2ZUDA 1IBRA 3TGPA 3ZVRA 4M8NE 2ODWA 1TQDA 3V9PA 4TL7A 3K9NA 1NMXA 4W7SA 2WSSD 4DDTA 4RD6A 1QHGA 2ZJOA 2PT7A 2C9OA 2QTFA 3QE0A 1E4YA 4D6PA 1NN0A 3LQRA 1OXSC 2DWOA 2BBWA 5CIQA 5TVKA 5FTNA 1QRAA 3BH6A 4TMVA 1UEJA 1J90A 2F3TA 5LB4A 2WIAA 3CB4A 4TYYA 3NDPA 2QSZA 2IUUA 3AVPA 2GJ9A 3IHWA 1M2OB 4EPXA 3CUEF 2OHFA 1PUJA 2EFEB 2YOGA 4LJ5A 4NH0A 4NTZA 3QEOA 3W3AA 5EXSA 1E0SA 2VHUA 5DISB 3U6BA 3S1AB 4Q9HA 1GP2A 1O3YA 2DYKA 3FKSD 4DDWA 1G4UR 3UPUA 3I5XA 5FBQB 2IYXA 2WWGA 3HU1A 4YMWA 1T0JB 1WE2A 3ZLJA 1WMSA 4US0R 2RGAA 2C03A 3I61A 2IS1A 1OFHA 2CHQA 5FPSA 3B1WA 4RFSB 4LOAA 2QTHA 5AWFC 2WHXA 1H65A 4G01B 4A6XA 1FPMA 4HAZA 1A2BA 2RGNA 1W48A 2RCNA 1PLKA 4UNQA 4FMCB 4DUGA 2FFAA 2D74A 2PCJA 2JJ8A 1S4QA 4Q9IA 1OIXA 4CYMA 1IJFA 1UDXA 3P1JA 2FZ4A 1Z5ZA 4A0FA 2ATVA 4Q4JA 1NG9A 2QRZA 1EX6A 1EK0A 4P31A 4PO1A 1FOEB 1W2GA 4FCTA 3REFA 2V4ZA 3SFVA 4YXWD 2ZJ2A 4DDUA 821PA 4WBSA 1NVUQ 3A36A 1T5IA 3RLFA 4GZMA 4CZ2A 1JBKA 1J70A 5AUOB 1TEVA 1KSFX 221PA 3Q7QA 2ZRNA 2QP3A 3R7WB 2QBYA 3GJ3A 1R4AA 4FWTA 4Z1MA 3SC3A 5EP1A 5L3SB 5DGXA 4CIDA 1V43A 1W4AA 4TN1A 1E2IA 2J0VA 5AUNB 3K9LA 5EZ6B 4B75A 4ERNA 2IA5A 3NTUA 3TQCA 2AN9A 3VX4A 2OILA 2AK3A 2YNMA 1HURA 1ONBA 4LJ8A 1CXZA 2C8VA 2IYUA 2P6NA 4FCVA 4IDOA 4WAUA 2GCOB 3EX7C 3GLIA 1Z6YA 3FGNA 2AD1A 4DLRA 5FL7D 3T1QA 5LD2C 1EFRA 2V6IA 3VNVA 5EXPA 4EJSA 2ANBA 2J41A 5K8TA 1X8JA 1CLUA 3I5YA 3EIEA 1UPTA 3SDZA 2WKRA 4PX9A 1XTSA 1E3MA 5LB2A 3IILA 1W2HA 3P27A 4G0NA 2R65A 1YRAA 3WRXC 1AS3A 1MH1A 1NBMA 1TF5A 1K5GA 1WRBA 2F1HA 1XTJA 5B57C 2Z43A 2RGNC 4QBIA 4Q1AA 4JL8A 5FL3A 1RJ9A 2EWVA 1FUUA 4C0JA 4A36A 4IVPA 2R6GA 2ZSBA 2G9NA 2CK3A 3T12A 1OPXA 3OEEA 4MRRA 2TMKA 4GFDA 4IDPA 1E9DA 3KZ1E 3VTKA 5M04A 1CRPA 5TXGA 4PZZA 1VG0B 2CNWA 3CRVA 3H4MA 2ZE5A 5K8LA 2ZS8A 4LRWA 2V55B 4DHEA 2GWHA 2FJUA 2JLVA 3MWKA 3C41J 4C30A 1XEWY 1YZNA 1P2UA 4PANA 2P3SA 2E1RA 1KKMA 2ONKA 2JLZA 3B9PA 4HZUA 1GL7A 3BS4A 4KODA 2J0SA 1YR7A 2WJYA 4DUGD 3LV8A 1S9DA 4TMTA 3SZRA 1DBSA 4BZPA 5C1BA 3C15C 1ZINA 3W6NA 4EIWA 2XOKA 4Q18A 1KJYA 3VR3A 1NP6A 3G0HA 2GILA 2QL6A 1E96A 5CYOA 1KAGA 3KTAA 3TLXA 1QZXA 4HAVA 1G8FA 2ZITA 521PA 4XOIA 4QM7A 2GF9A 3QF7A 2G1KA 3PQCA 4FWIB 2EVWX 4MGIR 4EJSC 3W8RA 3BWDD 1CP2A 2WWIA 1M7GA 3LD9A 4YDHB 3SYLA 2A5JA 4QL3A 3U3JA 1NSFA 2ODBA 4FMCF 4I1VA 4Z1MD 5JS8A 1D9XA 1IN5A 2W0MA 1ESNA 2VHCA 1OW3B 4W9MC 1G7CA 2A5FA 4B3DA 3KKOA 1II9A 2ORVA 1OV4A 4DSTA 2JLXA 2Q21A 4DLTA 3EZ2A 3QY0A 2P2LA 4OK3A 3EPKA 1XD2A 4LZZA 3HR8A 1MR3F 5DI3A 3PUXA 3AF4A 3O8BA 4JLNA 3TQFA 4C3ZA 1L4UA 1TMKA 1C4OA 2NTYC 4JMPA 4MITA 5BW8A 3THWA 2EFHB 2VHJA 1EFRD 1ZNXA 3RSLA 3WBJA 1T0HB 3KUDA 4LYJA 4DCNA 3N5CA 3BH7A 4DB2A 2OXCA 4PAQA 2IF0A 3GJXC 4E03A 2ZJAA 4AKIA 1D6JA 1VPLA 3SFZA 1OXTA 3QNUA 2F7SA 2BV3A 3NBYC 2G6BA 1EFTA 1P73A 4UJ5A 1NBMD 1KNXA 1GITA 1XXHE 1KI7A 2LWIA 2QMEA 3IUYA 2IXGA 2H57A 4TTRA 5IHPA 2N42A 3I62A 1KO1A 4GPTA 2X2FA 1HE8B 2UKDA 1Z2AA 3RWOA 1W36D 4RZUA 2UZ3A 1KDOA 2A9KA 4LV6A 2OXRA 1Z8FA 1ETUA 1A5TA 1SXJA 4DLSA 1DAGA 5JEEA 2CK3D 1ESMA 3QSYA 3OEED 4MH0R 1GAJA 3MLEA 5HE9A 3T06B 4ZDJA 3GLFA 1Q1BA 4JJZA 1G7SA 5LD2B 4X8MA 3R9WA 4BPBA 2CNWD 4Q1FA 1R5NA 4KI0A 1XCGB 4MYCA 2KJQA 2J59A 1ZNWA 4LBYA 4ASUA 5L8VA 1E69A 2YV5A 3GLHB 2GZDA 2L0XA 2ZR9A 3LBHA 3QIAA 4BLRA 3WYAA 3QPVA 4A2QA 1X3SA 4I81A 5L3QA 2NZ8A 1Z0JA 1Z28A 4JVMA 4B3GA 2FPMA 4Q03A 4OI0A 2XJ4A 2WMOB 3U7GA 2NZJA 3QKUA 5EXTA 1Q57A 4P32A 2OAP1 4I1OA 4IKEA 3THOA 2XOKD 5AK0A 1UKYA 2BMJA 4PQRA 5D3QA 3K9HA 1NVWQ 1DADA 1WXQA 1UADA 2ZRHA 1KOFA 3DDCA 3ADCA 3AF0A 4RD1A 2P6RA 3QKSA 4TL6A 4Q4JB 4ESVA 4Z8YA 1NNEA 1VIAA 3R9IA 5J4YA 1G5RA 4DLVA 2QM7A 1G20E 4OKSA 2EYQA 2MSCB 3UATA 3KQNA 4UQOA 3DM5A 3MSXA 3HDTA 1MT0A 2IT1A 2IBMA 1MABB 4A8JC 3KJEA 3O8RA 2AHOA 1KI9A 2QA5A 2QBYB 2PJRA 4GMXA 1P6XA 4MKHA 1H8EA 4JLVA 4Q1DA 4LJ7A 4V0NA 4X8HA 2Y8EA 1G6OA 3AGPA 3ECCA 3W9YA 3DOFA 1NMYA 5DIFA 2C2HA 1Z47A 2RB4A 4D82A 5JI2E 2JLSA 2WPDA 2ZE8A 1Y63A 2NIPA 2DR3A 4HB2A 4JKYA 4Q66C 3GLIB 2C04A 3JVVA 3FFBA 3DM9B 1JI0A 1JPJA 3WNDA 1QHHA 1D2NA 2V54A 2O5VA 2VIIA 5P21A 1R5OA 3WNCA 1Z0AA 4EJSB 1TF7A 1W46A 4M0LA 3NEJA 4QJ3A 2AXNA 1G8YA 3MMPA 4PO9A 2ZI3A 1E32A 1ODFA 1DELA 1YZUA 3BC1A 3FWYA 3IGFA 4KSCA 4CEIA 4C7OB 3BB3A 1FTSA 4HDCA 3LAWA 4MYHA 3EA5A 5JS7A 2ZVQX 1RRGA 4N0DA 1JXOA 2VSXA 3U3OA 1EG7A 1HE1C 4LC0A 4KYIB 1SXJD 4D0GA 3NBZC 1E2QA 2D3WA 2VTKA 4II7A 4JYBA 2CLDX 2YC2C 4B35A 1US8A 2ZRFA 4GZLA 1TADA 2Z4SA 1MO6A 4R2IA 3ZS9A 4KAXA 1DAEA 1P3JA 3Q5EA 1CR4A 1ZM9A 2WIBA 4TLEA 2WWYA 1X8KA 1CJUC 3K0CC 5J47A 1E9CA 4PC7A 3RRYA 1S1MA 2XJ9A 3NIBA 1N6LA 1ZUHA 2AFHE 3GFPA 1ZD8A 4R9UC 4FCWA 2ZIAA 3FPAA 5TB5A 3SBDA 1J7KA 2QNRA 3W6PA 4ASUD 1SXJE 3X1XA 2IYYA 2IS4A 1N6RA 4UKDA 4P33A 2Q9CA 1UBGA 1SGWA 2PX3A 3VKGA 1XBTA 3UKDA 1G7TA 3D7MA 5FOVA 2DFKB 5EUQB 1CBUA 1FMJA 1M7BA 1XTIA 1RRCA 2ATXA 1ZVQA 2ZE6A 3RAPR 3OAAA 4G5OA 1OFIA 1ZUNB 3CF2A 3NDBB 1XWIA 1QG2A 5IK2A 2ERXA 2VQSA 4OQNA 2Z6VA 2JDIA 3KXKA 4D4KA 1S96A 2DFLA 5TDHA 2J7KA 1JR3E 3QKTA 3LLUA 3RC3A 5KYKA 1DE0A 4DKXA 1ZCAA 2OM2A 1VHLA 2R6DA 3HJNA 2FG5A 1Z29A 2ORWA 2ZYUX 2QZ4A 3KDSE 3N2EA 4BGDA 4IDHA 2FFHA 3DHWC 1XJCA 5H1YA 4LHYA 4URYR 2V9PA 2GEDA 1T3LA 3KFVA 3X1WA 2D7CA 1ZM3A 4ESHA 1QF9A 3WY9A 3GJ4A 1H8ED 1E2HA 3EC1A 4ON9A 4GBMA 3SYNA 3FHOA 1YVDA 1YZQA 3EIQA 2D62A 1E1RA 4NYMR 4XSGA 5JEDA 2PZEA 2G1JA 4F93B 1FQJA 2WPDD 2B92A 4MDFA 1II0A 4A2PA 5DI3B 3NHBA 1OH5A 3SE0A 3ZS8A 5JZVA 1QDEA 2IYSA 2FN4A 4Q01A 3KJIA 4TYNA 1U90A 2B8WA 2OCBA 4MYTA 2EWWA 1U9IA 3CH4B 4CEJA 5CITA 1M34E 2QAJA 2OESA 4LYHA 3LA6A 3G82C 3X1YA 1G5TA 5KHOC 4P0TA 2O0KA 5J4VA 2R6AA 2OZEA 4IW3B 1XPOA 1SVOA 2QPTA 4A8JB 2J0UA 2GXAA 2J45A 2EU8A 3LNCA 2I4IA 4V0LA 2X19A 2YKGA 4WZ6A 4DIEA 1UKEA 2R44A 2QM8A 1UM8A 4EKDA 5FOSA 2B7BA 4M1KA 5FI1B 1NVXQ 1A2KC 2ZRDA 1Z83A 3PFIA 4B2IA 2ZSDA 1G21E 1HV8A 4G5GA 3LFUA 5KNBA 1GL9B 4B3CA 5EP3A 3WNBA 5JSZA 1K5DA 3LLMA 3GLFB 5JWOA 1E0JA 3CZQA 3QXCA 3F8TA 1QHIA 2SHKA 3X1DA 4TWZA 5AJZA 1Q12A 1FP6A 1YZLA 1LTQA 2JATA 3UK6A 4EPTA 2ZSFA 1NRJB 5FBRB 3T61A 1OT3A 4BFXA 1PUIA 3QF4A 4XJXA 4GP7A 4JLBA 4OK5A 4GDFA 1JNYA 1Z6AA 3OAAD 4PPFA 4PZLA 1K6MA 1XCMA 4HLCA 4ZDWA 4NE2A 1KO5A 5JBQA 3VQTA 3CF0A 5L3QB 3H0KA 5IK2D 1SZPA 3JZAA 2BJVA 2BOVA 2JDID 4DXAA 2IHYA 1AIPA 5GVRA 2FSGA 3EZFA 4ZKDA 2W6JA 1NY6A 2Z5FA 2XB2A 1R5BA 1E9AA 4HSEA 4OJQA 2IWRA 1V5WA 1QVRA 1F2UA 4KU4A 1XMSA 2YWGA 1G3QA 1WCV1 4DCVA 3QKSB 1NF3A 3CM0A 1XDBA 3A4MA 1U9IC 3EC2A 2BEKA 5CDFE 4GI7A 1Z0IA 4LJ6A 1WDTA 2IUSA 5JHHB 1ZC4A 3U3KA 3AP1A 4ZI3A 2C5LA 4D26A 3GD7A 1ZIOA 2QP9X 2HJGA 3CR7A 2ZI4A 2XAUA 1MKYA 5AJWA 2A5DA 3W5JA 1CTQA 4NYIR 5CJ2A 2AL7A 4C0KA 3B2EA 1E1RD 1SVWA 2OG2A 3GLGE 3AEZA 1NJFA 1GKYA 3FKSA 4Q7LA 1OSNA 4TL8A 2O8BA 2BBOA 1N5JA 4D4LA 4BFVA 1KKLA 2BVNA 1VCNA 3BJIC 2V7QD 2IXFA 5FI0B 5JRZA 3SI7A 2HYIC 4V0KA 2GBLA 5FUXA 1QHHB 1MOZA 2OUKA 3HU2A 1Z06A 4XVUA 3PXGA 1HH4A 2Q9BA 1XMIA 2CEAA 1QHYA 1G3MA 3BD9A 1KMQA 3LWNA 4P4SB 4JSYA 3GJ6A 4E5UA 3RC8A 2WOJA 5FH9A 2LCFA 3WRYC 2IEYA 1DPFA 4JIMA 1SULA 2ZTSA 1PZNA 5SZHB 1I4LD 3I73A 3TW8B 1NY5A 2QT1A 5CYPA 1AN0A 1M8PA 4JSTA 4KFUA 4BUJA 1FNMA 2AKAB 4I1SA 2WJGA 2REOA 4RZ3A 5BN4A 2DFTA 2AX4A 3CH5A 4XH9B 2YWEA 3HYTA 4Q00A 4B48A 3W8NA 4EDHA 2ONJA 5B58C 2ZEJA 1US8B 1ZD1A 4BFTA 1N6KA 1XRJA 2BJWA 2QRNA 3R20A 1DAMA 4C0HA 1W1WA 1WBBA 3BIFA 4XD7A 2QSYA 4PQFA 2O8FA 1G6HA 1L8QA 3DMNA 4DLYA 3IPXA 4V0MA 5CLQA 4BFWA 1N2CE 5JJIA 8OHMA 2O8CA 3P20A 4GT1A 1H8HA 3PIRA 3W5IA 5GADl 4D81A 3IHLA 4LHVA 1AS0A 4BFSA 2YWFA 3AV0B 4BLOA 3AVOA 1QVAA 2WVJA 3WXMA 2WICA 1M74A 1CRQA 3BRWD 3GJ0A 4OL0A 2OFXA 1WP9A 5FTLA 2ODEA 5TARA 3A4LA 2O8DB 3UIEA 4IOLA 2IXEA 2FA9A 3A37A 1DEKA 3EA0A 1PLJA 4F4CA 1OXVA 5ANRB 4TMXA 1UKZA 4MUAA 4JT2A 5GJVC 5D3MA 2W6JD 2WWXA 4M1YA 2ZE7A 4A92A 4BECA 3K9GA 3U3MA 1NLFA 3L0OA 3AQ4A 1E79A 4LBVA 5EE1A 4ZO4A 4ZCLA 5E7JA 3Q72A 2W2VA 3ONWA 1PV4A 1Z6GA 3NH9A 4N0EA 3AVYA 1N0VC 2ZANA 4R98A 5F98A
chains in the Genus database with same CATH superfamily
3MCAA 3ZXXA 5CH5A 2QB5A 1LDBA 2BUCA 2FUKA 3V4SA 4C4YA 4HWOA 1HDIA 2XGGA 3HADA 1GPJA 2BTQA 5ICCA 2PZLA 2EJBA 3DZKA 1T1EA 3D7SA 4LRUA 5BV2P 1P2DA 1QOZA 4FHEA 4PQGA 3JAKB 1VC2A 1VHDA 1UZAA 1GZ3A 1J99A 1M67A 2VPWA 3B70A 5IP5A 3DVSX 4A2WA 1F8GA 4H1UA 3A3NA 2X2EA 2JB9A 1GFZA 1RXWA 4F4UA 1Q3TA 3HB9A 4F8YA 4L16A 1WZ2A 2EFCB 1Q77A 2WQZA 3SY8A 5D85A 2FR0A 2KE5A 2O6LA 4CEHA 2D4HA 3QBJA 5JNVA 3ZYCA 5HRCA 4YJFA 2BFAA 3EAFA 4G8DA 2ZJ5A 2JIRA 2PV0A 3B85A 5C51B 3GQBB 3WA6A 3QA3E 2VNHA 1G60A 4G1FA 2FDXA 2XEXA 4JC8A 5CTAA 4BLTA 4YLYA 3WMRA 4LGVA 4JI6B 3V2GA 2AT1A 1NXSA 4R54A 4QU5A 3V1MA 4ZT5A 4K40A 1I51A 1ZQ1A 4B3JA 4CEJB 4EHFA 4MKFA 4FFSA 2AFVA 5I7EA 2Z1NA 1YK0A 4UTVA 1KI3A 1XFAA 1NBAA 4HDOB 4P7FA 3NBMA 5DYTA 4IOKA 3IEPA 1V7QA 3TQRA 3QXHA 4JOCA 3EXHC 3V48A 5EL0A 5FWXB 4HJRA 1XTVA 1Z34A 2JFPA 2FKNA 3V3KA 3HYRA 1QKIA 2J0UB 3CX3A 3R3YA 3VYWA 3AXTA 4PFSA 1OGJA 3RC2A 4CDNA 1TD1A 3W7VA 2IIPA 2QN8A 2QZPA 1ISFA 1KBOA 2CJXA 4P22A 4E2YA 1P60A 2E9SA 3IHTA 4L5YA 4N01A 1KGDA 1EQUA 3PUZA 1XZPA 3I04M 2GN6A 3DO6A 1F0NA 2WFZA 4KACA 3ZHRA 2BLNA 3WKEA 1QGUA 1A96A 3SR0A 1MEOA 2IYFA 2V7WA 2W6NA 1PSZA 1QHSA 3DKIA 4GPBA 4CL0A 3R6LA 3KRTA 5B3JA 4F3KA 2PO7A 1A69A 5E2BA 2C99A 4NNPA 1IEQA 4PC6A 2BF7A 1RHJA 2IYQA 2WC1A 4P35A 1LLDA 3MTDA 4PSDA 1R0LA 3DOUA 1WM1A 1ZAYA 2PLAA 2HSDA 5C2JB 1CU1A 5HGJA 2IXAA 1IYZA 2SBTA 1XXHA 1ZIXA 4TKLA 3AJRA 3BSWA 4V0ME 4ZC8A 4PYKA 3ULKA 1WF3A 2QXYA 1M1YE 3M2TA 3C14C 3OPYB 3CJRA 1KI6A 4IMJB 1I5EA 2AJLI 3DC2A 4G24A 4MS4A 4P3NA 1PG2A 4CM6A 4CKCB 1L5FA 4G36A 4BY9E 1H4SA 2ONZA 5DVZA 2DULA 1QE0A 2HZ7A 1V3VA 2WU1A 3KHTA 3ZNNA 4LBZA 5JH7A 5KTPA 3JQGA 1SVIA 1TJ5A 2PMBA 2WM2A 3D2LA 4LTMA 1NWCA 3K31A 5EI5A 1E8MA 2GCEA 2QQ5A 3LC7O 3U40A 1RCUA 5K5EA 4WKNA 3WWPA 1OFTA 4OHWA 5FTWA 3AOEA 2OBLA 3MWDB 2CLKB 4INPA 5BT8A 4KNVA 4MRAA 3RS5A 4K1XA 1DIAA 4OYLA 2FLVA 1L5QA 2X9NA 3GGDA 2FPIB 3A3OA 3HEBA 3RU9A 3VPFA 3I1JA 3RT9A 4HDSA 3QWFA 5DCLA 2SECE 4O5OA 5HIKA 1ZUWA 2Z9BA 2YZMA 1K6EA 2VQDA 4KMRA 1QORA 4HAYA 1RP1A 3TCNA 3C43A 4FB4A 2VJMA 4BFZA 5E6RB 1C1XB 1Q7EA 3KJFA 3QKRB 1WPQA 1MTZA 2D3TA 2PN1A 1KE2A 3SC2A 4PO8A 2PTGA 3B1XA 4O4IB 3ZVKA 3NOOA 1W96A 4PYMA 4IRUB 5BWMA 1XNJA 4OEHA 4W4TA 1ZLXA 3WMGA 3IURA 2Z2JA 4JUBA 3FNIA 3R8XA 2YXDA 4N48A 1Y9JA 3CRQA 1LTHR 1Y1TA 2X5KO 4OAPA 4JKIA 2IF2A 1RHUA 1YNOA 3HWRA 2ZU0C 4L5AA 4GC9A 2C5EA 3UXEA 1X86B 1K9VF 3OI7A 4DSNA 4EG3A 4YMUA 1YS9A 2NV6A 1GFWA 1ZD5A 2RG7A 3NHZA 2CV2A 4F2GA 2UXCB 3A6JA 4A82A 3ORFA 1MD9A 1E6UA 3LGAA 4QXAA 2ESRA 3C7DB 3G2IA 3L6CA 4S1OA 1KU6A 4U9IS 1RWOA 2VBIA 4R1TA 5D87A 1OFUX 1JSXA 1DV1A 4ND1A 1B42A 1T4GA 3P32A 4Y2YA 2VHVA 4IS2A 4PNEA 3L5OA 2V97A 4I9HA 2BYTA 4C2AA 2PEYA 1YI1A 3I8SA 4ZVNA 4QTTB 4MQ4A 2BI4A 1IZ8A 2F3SA 4XX0A 2CJWA 5BQOA 2WAXA 4KEAA 3RIEA 4O08A 4F96A 4IDEA 1HF3A 1QH1B 1X7WA 5HZMA 4UM9D 3TLAA 4ETIA 2NQ2C 4CHTA 3GJ5A 1KO7A 1TKCA 2EEZA 3GLHE 4XI9A 5D86A 3ZDAA 4GAEA 121PA 3HCNA 4GO1A 3C8DA 1KR5A 4NCNA 5HCIA 4AMGA 1YE5A 2H65A 3EA4A 4PSCA 3EBLA 3RUFA 2AZDA 4TLLB 1IN4A 1EP9A 4OBBA 1W4BA 4YAWA 2IYRA 1YZ3A 3EDOA 4YV0A 1W36C 3G8BA 3H9QA 1CJCA 1V48A 2HA2A 3QI7A 1KMNA 4I3FA 4Y18A 2W6IA 1XTBA 2O7RA 4J9VA 3SIXA 3CXRA 3SZUA 5HKAA 1IXZA 3OOSA 1OFGA 1F3OA 1XP8A 2BDTA 2FNAA 2XCQA 4J1NA 2NPFA 4BNZA 3BWCA 1EWQA 4HN4B 5LZ9A 2Q07A 2OZLA 5H3CA 1ZK1A 4X20B 3VKVA 5EUCA 3ZDXB 1MJGM 1RSZA 2E4WA 2JBAB 5EFZA 5BVHA 1JYFA 5A4JA 2WHEA 2FDCA 5FF9A 4KR3A 3SQXA 3D54D 1XTTA 3KOXA 2PT5A 4RF2A 3L7IA 4QBTA 4W5JA 3GFTA 2ZSHA 4D2IA 3S8YA 1TEXA 1LBTA 2D2EA 1DG1G 3H7IA 4PZUA 1WVIA 4LG1A 2G9UA 4QUKA 4Q02A 1DCTA 3CSUA 2FEWB 3TFQA 2YXEA 4JP3A 2DETA 1WOMA 1CEEA 1PIWA 3U80A 3QQ5A 4AO7A 1TFUA 3DEAA 3OZIA 1AF7A 1DTWB 4PLGA 5SZIA 3EUWA 3W2GA 3X1KA 5DCWA 5ENVA 2P0EA 1KQOA 2JIBA 3B53X 3QMMA 4JS0A 2QENA 4N9WA 3UJ7A 5KS2A 4H7DA 4EJ6A 3C6YA 4BEJA 4MYUA 5A0TA 3UFXA 1X8XA 4OX9B 2NACA 3HJUA 5HFAA 5B30A 4DLZA 3O47A 3HKBA 3LCCA 3TTTA 4DT1B 2RC5A 4HY3A 3H2JA 2VJYA 2NUAA 4HH1A 1DPGA 2OBXA 4CKZA 1AMUA 2WWHA 2OCLA 3D6FA 3ZOZA 4EX7A 2QI9C 2PUJA 3KPJA 1IH8A 3CG0A 4WQMA 1MN6A 2UVDA 4KN8A 4BCBA 1R3UA 1XQWA 1B0AA 3AR4A 3NIGB 1WKVA 5EQFA 1TVMA 4B3SB 4WNAA 5DTIA 1M54A 5EKUA 1E1CB 2DQ4A 3IERA 4J07A 3EVCA 4JOQA 1OWOA 3N3AC 4EFKA 2UXDB 3H3XA 3L6EA 5TEVA 5FO1A 4TRJA 3HCOA 3T0IA 3DFMA 3ZZ1A 4RNDB 1A95A 4X00A 4RV9A 3ROPA 1Y48E 2HXYA 4HPWA 4OXQA 1OA1A 2XXJA 2H54A 3B5EA 2RHHA 4IX1A 3W9UA 1A1VA 1Y0BA 1V1RA 3VI3B 2H2HA 4JFAA 4JU9A 3HCPA 2VL7A 4D80A 3K0AA 5LLSA 4R9VA 1Z4NA 5DWDA 5K8CA 3JQBC 4UMVA 3M6IA 3MTGA 1UMCA 1ZY2A 4OXXA 4TXNA 5DGIA 4BMOB 2OZPA 2V3CC 5J9FA 3FSRA 4FX5A 3BAZA 1VDZA 1Z5VA 2VATA 3B6KA 3QXSA 3U44A 1A8HA 1EZZA 4P2BA 4WCDA 5KTSA 1DNPA 1IUNA 1XEXB 4X8OA 4C2UA 2KMLA 1P1CA 5CX4A 1M34A 5BXQC 3JZDA 1Z5PA 3NAMA 3QEJA 1ZUIA 3V8RA 4DEXA 1ZNQO 1XZIA 3K2QA 5I4CA 3THXA 3FPSA 4XFKA 1PJTA 1VMKA 3MMSA 3ADDA 1KFEB 3MUFA 4BV3A 2Q9AA 2ZR7A 2C2XA 3KXLA 2X1VA 4AJIA 1M10A 2UV8A 3V55A 3LHFA 3T7IA 4AIRA 1U99A 1OIVA 1KO8A 4ZT7A 4KXWA 5LUBA 1B1AA 1IM5A 1W0KA 1A2QA 3N53A 3OCVA 1R8JA 1W85B 3BE5A 3HUDA 3M81A 4MEAA 5IMBA 4BX8A 1ZJWA 3MQ4A 3NTOA 4LF6B 2CFCA 1CW2B 1TTPB 5JYEA 1IN6A 4IX9A 3EFHA 1GWNA 4QGHA 4TTVA 3OJ0A 1B8OA 3T5MA 3OMLA 3WK6A 5KVVA 2XOEA 2DBRA 4XB2A 1KP3A 3I9MA 2FZEA 4IH9A 4RA9A 4CT4B 4C6TA 1PBNA 2TRSB 4K9PA 2C0QA 3HEMA 1CUJA 5AW6A 2PTHA 4HCJA 2I4RA 3GRKA 3CF6R 5KSOA 2JFXA 2IH4A 4GSYA 4RPLA 1D07A 2QT0A 5KJFA 2AK2A 1CUFA 1NIJA 2MYUA 3QFCA 2HK9A 1ODTC 3KALA 5EC8A 4E5YA 2ZRMA 3EYWA 1GRNA 1VRVA 2DQSA 3OPNA 4TYQA 1ZOSA 3EYAA 4UHEA 1NXVA 1J0EA 2XUIA 5I5GA 1V35A 3UBTA 4J7CA 4MEBA 5KYXB 4MWOA 3ORHA 3MZ0A 4QGFA 1G3RA 2J5BA 3PENA 1X87A 4JLDA 3V4FA 3NAQA 4ER5A 4DMRA 4MCIA 1U3GA 2P91A 3E4CA 2YMMA 1A5ZA 3L4BC 2SKCA 4L0CA 5CXUA 1TCVA 3IIKA 4LK2A 3N0WA 4U6NA 1LPPA 4LE1A 1O58A 2OLEA 3B82A 3EPRA 4XLZA 5F51A 4L8YA 3PC7A 1C3VA 2I4NA 1NR5A 2VWPA 3QH4A 5DYNA 3KSAC 1XK7A 5G2OA 1ESDA 4DA7A 5AVUA 1O0SA 3WLRA 3A6DA 2H1FA 5E8RA 4ALKA 3VHXA 3ZDRA 1SPXA 2ANCA 1XQXA 5AM4A 4TMWA 2NAFA 1R2QA 1E3SA 4FEYA 3K9QO 3D0QA 3LC0A 3HB5X 4OA5A 4V38A 3O8DA 4DNPA 3A32A 5CDFA 4YMIA 2HMTA 3AERB 4KVAA 1AB6A 2HPVA 4OGGA 5CBPB 1QLJA 3RS3A 4MIYA 1M1UA 1Q0QA 2HMSA 2D2VA 2J5XA 1Q11A 3S5JA 3KTAB 1P1HA 5T41A 3KZNA 4E15A 4E32A 3G5UA 3AEUB 4IJUA 2Y92A 5IYZB 2I4MA 3ZV3A 1UANA 3CSSA 2CE2X 4DWOA 1FXWA 1SKYE 1FUYB 3FMPB 1AQUA 4MVWA 4MW0A 2CHVA 5CX1B 4Q4CA 1K1EA 5B36A 3FHTA 2RGDA 3VO9A 4ABTA 5DGCA 1OLSA 4OG2A 4KSYA 5I7RA 3HY6A 3QW4B 4KAJA 4Q9NA 4M8LA 4B82A 4C6RA 2P79A 1IRIA 5JFTA 3SZMA 4WN9B 5FUVA 1K97A 3LDGA 2OOKA 3O4VA 2OXIA 3PQ5A 5DX8A 2Z4RA 2YS7A 3U4GA 2X6QA 3OT1B 3MB8A 1FJXA 4H6XA 2H7CA 2IX9A 3Q12A 4E51A 1GTG1 2WOOA 1CKEA 4JEIA 2IELA 3KPWA 4AJ2A 5JJKA 3NPAA 2A35A 5L7WA 2O3JA 3Q6NA 5BR4A 1XD2B 4OYHA 5KAPA 2NQTA 5AHWA 3PEUA 2H85A 2GLXA 3SDSA 3FX2A 5B2EA 5TQ2A 5A0VA 1P77A 3LKBA 5J4HA 3ZZUA 4HXYA 1M2JA 1QIEA 1VA4A 1QG6A 1RYMA 3QFFA 4KIJA 3BFXA 4R2WA 1EFKA 2CLCX 3N6XA 5F35A 4EY8A 3SX0A 5IM4F 1XF9A 2WZCA 1NJSA 1L4KA 2FPKA 1A4RA 1QCCA 1E1NA 1Z36A 3JR7A 1FF9A 4NZ9A 5HNKA 3I9FA 3JAMA 3Q41A 1FK8A 1SHLA 1WMEA 4AB1A 1CJTC 3DL2A 1UWCA 3PEWA 1W29A 5AM1A 3OVMA 4M1OA 4YK7A 3G9ZA 3ODPA 1E2EA 4FPXA 1S3SA 4CKBA 3O3CA 3SOZA 3ANSA 3R24A 4G63A 1V11A 2HK6A 1SD5A 3FSGD 1ZM7A 3B3GA 2OZKA 1FSGA 3HCBA 3NH6A 4IMIB 5I7SA 4EHBA 1G18A 4Z0TA 1N2CA 2WJPA 4R8RA 4MJXA 2HRDA 4DEYA 1T3SA 1WDWB 1KHHA 1WBJB 2NNWB 2J3MA 2ZBQA 4V0RA 2ZJ6A 3RVSA 4LCBA 3ZWKA 4JL6A 1SXJB 2M6RA 2V3VA 3FETA 3LT2A 5FADA 1E2JA 3FDJA 4G0VA 2PFKA 3K9BA 3MAGA 4GL2A 2ZRQA 1K7SN 1FJ2A 3Q3GE 4M6WA 3RVOA 3AM1A 4LV8B 4OBXA 3EC7A 1O4VA 4QUDA 5ALHA 5JH7F 2J0EA 1FFYA 2HLDA 3K9WA 3JU3A 2CDAA 4LYFA 3VAYA 3WHLA 4ARZA 2CV0A 2R48A 3AP3A 5J23A 3BWXA 5H83A 5K7SA 2IEGA 3DXZA 1J23A 2C29D 4M9ZA 1GO2A 1F9EA 2BEUA 1DOAA 3A6LA 3C6QA 4D9MA 3ESDA 3WL4A 4YR9A 3D2CA 1CUAA 3GBVA 4UMFA 1GZ7A 2QTRA 3T4EA 6YASA 3R7WA 2XYGA 4LOIA 1YUMA 2P7IA 4LY0A 5FR2A 3X43A 4HGPA 3ROKA 4WHMA 1U8AA 4M0CA 1RQNA 3TNJA 4S1VA 2Y68A 5SY4A 4M98A 5SZKB 4O59O 1TGVA 4JQYA 1FVOA 1XZNA 1KE1A 5I7UA 3U4QA 1N5IA 4M22A 4R0VA 1RNLA 4AJPA 3HPRA 3R4VA 1BS1A 4QNMA 1NMZA 4RS3A 2VQFB 3ZJTA 3I0NA 1HL7A 4TTSA 3S2FA 4YT8A 1K3TA 3R3VA 2JFHA 3OURA 4UVDA 4HMOA 5CM9C 3JWPA 2G77B 1KMHA 3ND5A 3IVRA 2QPAA 1VB3A 3GEGA 4WZBA 4Y0VA 1UBLS 1QIFA 4BC1A 1C8KA 1JWLA 4EMTA 4TT3A 1SXHA 4EO4A 4GECA 2WUDA 2WYHA 3TLMA 1S1CA 1AT1A 2PL9A 2IH2A 5H4HA 2IK8A 2ZQZA 1YDMA 9ATCA 4DMCA 5JDCA 3B1KA 1TLFA 3KYIB 3GVXA 2AN5A 4MA4A 1ORTA 4UXHA 3IT3A 3CUSA 5A1TA 3LF1A 2C20A 4YPFA 1KXZA 3BWMA 4L0DA 4QBFA 2L18A 1BEUB 1FRVA 3UJ8A 2AC7A 3NM5A 1Q17A 1TYZA 2ZBGA 4H4EA 4JWKA 3G79A 2PHZA 3SYMA 1FSZA 3UVEA 3KT3A 5HFJA 5JD5A 1K8XB 5A3RA 3W3ZB 4EJ0A 3TIFA 4YONB 5B5SA 3FWKA 4PGGA 4J16C 1LI4A 1EUCA 1YHZA 3PNBA 3IP6A 4RCYA 4G67A 2NSYA 4QTUB 4QXMA 5DBGA 4UCWA 3YASA 3HXPA 1FFCA 1XTQA 2ONYA 1IVYA 2Y1CA 1PT6A 3O1IC 4NPAA 2WTAA 1XKTA 2P9QA 2PQ2A 4EDFA 4UCFA 4P92A 1APBA 1YTUA 3CSDA 2PAFA 4FYYA 4CIBA 3Q0EA 2P2NA 1Y7PA 3IDFA 1ZVMA 2GPWA 1YQQA 2WIFA 3HUTA 1Z2DA 4UBKA 4RTQA 4AZ0A 3F67A 3KE8A 4NJMB 2B7CA 3DVLA 2RG1A 4TKZA 5I9BA 3PUKA 4LJRA 2Q5CA 2WMNB 4TTQA 1CS4C 3N8DA 3GCGA 3G2OA 3X2EA 4YT5A 1BNCA 3TAXA 2IP1A 2C5GA 1ZG3A 1I5OA 3FDIA 3MELA 3R74A 1M0TA 4KVGA 2NUBA 5BYJA 4M1MA 4RLSA 4JI4B 3FKJA 1E2DA 1L4HA 1XRRA 1SIWA 4JELA 1H2YA 2J9ZB 4WXPA 2J9RA 4AT1A 5HJ2A 1F06A 4F86A 2I7DA 2AG5A 5ESXA 3DW3X 5KVQA 5FV4A 2PU7A 3G7NA 1C0IA 1IBCA 3P4UA 4M99A 4EELA 2HA3A 4Z7NB 4GOND 4YDQA 5DK6A 4HGRA 1JXMA 1GTVA 4B73A 4UXIA 4ALIA 3S2YA 3F6RA 4W7IA 1WO8A 1IOVA 1J49A 1KY3A 1OLUA 1U6JA 2R8YA 2HKIA 3SSNA 1FTWA 4C0BA 2QTWB 3U7IA 1OXXK 2AYXA 1U0HC 1EX7A 1WCIB 4MQEA 2AN3A 3BXGA 5AVKA 3W06A 4XSVA 1NATA 4HHEA 1PKXA 3ZTWA 3PXDA 2IDMA 5EE9A 4KQKA 1A7KA 2BY4A 1B0ZA 3GAAA 3WR5A 4F45A 5K3SA 3PLNA 2G3YA 1T0BA 1TMYA 3BREA 3QOYA 5ELLA 4D74A 4BEWA 2MWMA 5H5JA 4ID9A 2P77A 5AJUA 3VJRA 2HLHA 3MJEA 4XYBA 1EVLA 1V1MA 2OHHA 3M3PA 1LPMA 5EOVA 3RGGA 2JJ2A 3SHFA 4DPMA 1K2VN 4LYGA 4EG1A 4DG5A 2EBFX 1JH9A 4LGYA 3QJYA 1PEAA 4EY5A 2IHTA 4PIMA 1VJ0A 1SIOA 2FJ0A 3FZQA 3PHBE 1PS8A 3U7QA 4AI6A 3KAJA 1TK9A 3PS9A 2IYTA 2BI7A 1WXXA 2CZQA 4FU0A 3RK0A 1H6CA 4AICA 3OLCX 3KU1A 3KTOA 5ALVA 5IKOA 2DX7A 5HP4A 1VLLA 2O59A 4UBOA 1JE0A 2Q2WA 3HXTA 4HH0A 1SRRA 5F2KA 1MEEA 1P8AA 1R6BX 2IH5A 2Q3LA 3GLGB 3OE7D 2OFFA 2IEZA 4MR8B 4J0HA 4ZAZA 3MJ4A 3BXFA 3KWLA 4HADA 3GJRA 4M83A 4XDHA 3ZWOA 5HRAA 1T35A 4K86A 4DQLA 4DKJA 1REQB 2FPLA 4KXFB 1IN8A 5HBRA 2D00A 1W4CA 1SVNA 1U1CA 1DEOA 2YS6A 4DR6B 4FFLA 2XVXA 3I52A 3EFEA 4M87A 1G6KA 1K8YB 4U2CA 4WZAB 5CPFA 1JPUA 1ONPA 2FMKA 2J0QA 1ZMTA 5REQA 1FP4A 1O6ZA 5EZQA 1CVRA 1OAOA 4B33A 1POWA 3Q7IA 1E98A 13PKA 1EFCA 4YJ3F 3N70A 1B2LA 1OBHA 3WGLA 4QSMA 4Y67A 3LKDA 3ENVA 2ZGVA 4C05A 2PJZA 2WA2A 3AEKA 1XMJA 3EPPA 3LBFA 1F2TA 5KVCA 1FNDA 2FJPA 4I1PA 3H9GA 2W2KB 3DAGA 3UXYA 3RYCA 1C0LA 3G7UA 1Z6ZA 3K3PA 5BN5B 3UT5A 3VC2A 2FEXA 4UTPA 4CTJA 3QPUA 3BMCA 3IQWA 3FIJA 3PNKA 1IY9A 4QOSA 5EYPB 3G2LA 3BGSA 1D2MA 1TJPB 2QQ0A 1EA5A 2FUEA 1QPBA 3FPLA 4RLQA 4H7HA 2J7PD 3S27A 1DO8A 1Q50A 1P4JA 1E89A 2OHXA 4XWAA 5AKIA 3W5VA 2PL3A 1IE3A 4TTTS 5L4SA 1U04A 5F7JA 2I9PA 4DCGA 3TOZA 4DNFA 2GNAA 5A4FS 4LJSA 2ZDGA 1ODSA 1R0WA 2OLKA 2AVDA 3S7ZA 3EVGA 4BYGA 3VPDA 1XVLA 1EG2A 4L6IA 3UMSA 1FP7A 2E6KA 1C3OA 3E9CA 4KYUA 1IHDA 1RYHA 1WY5A 3ITEA 5AVXA 2FPSA 3DBLA 4X1IA 3PRJA 4JI7B 5TRTA 2W4IA 3DDWA 2QROA 4M9SA 1BCSA 1BN6A 2CDRA 4MVYA 2YYSA 3PEFA 2F3QA 3ORSA 2H17A 4BQRA 5B6PA 5KYWB 3IKTA 1LSSA 4R3UC 5ESRA 1OB2A 1MABA 3UZUA 1EXWA 2YBEA 2PMFA 2XUFA 2XYVA 1K4KA 2GJSA 5GWXA 3Q88A 4FUTA 4MXDA 4JJKA 5HJ7A 3WMFA 3G2HA 5DNAA 1JI3A 3FYUC 1AKUA 2I2FA 1F0PA 1YB7A 2OV2A 1E99A 3FUXA 3D3QA 2B8TA 1AZTA 4N3CA 2GRUA 3OLWA 4L5BA 5EWMA 4P3OA 4EHJA 3AL2A 4KXYA 3EXIA 5EZYB 4BU1A 1K7XB 4UVIA 3M3DA 5CB4A 3LW7A 1Z7YA 3R7BA 4AROA 1OHHA 1XU4A 5K20A 5FLYA 3RFFA 4PFJA 5SV2A 5EIAA 2H52A 2NXCA 2GYUA 3TVTA 2NGRA 3W5SA 2QJFA 3HMKA 2G83A 3AKYA 1AY0A 5LNK6 3R23A 5A5EA 5DBEX 2G40A 1N6PA 1U3FA 1V5FA 1Q19A 1YJAA 1Z33A 2MMGA 5KOYA 1PKEA 4P7JA 5BWLA 1PR3A 1XYVA 2IIBA 2Q2QA 5CFNA 4ZCIA 3CW2A 3D5TA 3K92A 1HI9A 4NCKA 2HCRA 1KPGA 4XM1A 1WPGA 1OH7A 2FZLA 2JCGA 4GOJA 5AHRA 5CAEB 2ECFA 1XLVA 2VTVA 1FXWF 1Z56C 5F3RA 2PWAA 2PZAA 3AJAA 1XZ8A 2JFZA 3O0DA 4EO7A 3DWFA 4RSRA 3WDKA 2ZCJA 1Q3HA 1T4DA 3GLSA 2V65A 2AMJA 3K1ZA 4Y6GB 5TJHA 4BLVA 4CF7A 3MCWA 5CT5A 2JI4A 5EIEA 4XGIA 1QYIA 3AONB 3IMGA 5KZMB 1OB5A 4FW9A 1U80A 1GL6A 1K98A 3TE7A 3MAAC 1BVYF 3CRW1 3D6AA 4CTMA 2WIJA 3NNNA 4YV1A 1O97C 3KJNA 5JSQA 2R6FA 3N8KA 2IOFA 4O0MA 2JEZA 3H8JA 4M1EA 3W6UA 3A1SA 3AVQA 1YONA 1R4MB 4B84A 2DR0A 1RYYA 1A8QA 4LYAA 1GILA 4DV2B 3P9XA 3BORA 4HX5A 5EMJA 4DJ5X 1ZI9A 2CHGA 2RJ3A 4NYJQ 3RVKA 1RRMA 3TKAA 4BWYA 5JJLA 4PHHA 5BN4B 1S02A 3NO4A 1H85A 3Q6IA 4CKWB 5C8YB 1HZZA 2LBPA 3LX4A 4PAOA 1Q1EA 3B9BA 1GG9A 3G5TA 1ZICA 3BGVA 4J0JA 1QFXA 3QFSA 4G1BA 4MVJD 4PRLA 4DMHA 1GM5A 4FDMA 4D9IA 4HUQB 2O8FB 2A1UB 5IAKA 4KBGA 2AQHA 1R7RA 4RZHA 2YHSA 4Q4LA 4B3RB 4GM0A 4CQMB 2Q2NA 4V3BA 2JCVA 2WTXA 3CEHA 1NNUA 4RV5A 1M1YB 5JD6A 2XZOA 3CEMA 5DTMA 1W47A 4QSHA 5H80A 2X1HA 3A1VA 3FCCA 4MRMA 1PHPA 3RWMB 3DMDA 5B1YA 2CNLA 3K96A 1UMBB 2QRVB 1I94B 5KDLA 2LZ0A 2HSJA 1NYTA 4YJHB 4UZFA 3O26A 1Y8AA 2ZUTA 5HW0A 1KVTA 2JD1A 2OC4A 2L82A 2ZIXA 5JPDA 1DJQA 1X1SA 2CFSA 3QPDA 4MUNA 5JSYA 4IHJA 3E18A 4MWTA 4NCJA 1GPKA 3NDRA 3MUOA 2NTEA 4DA9A 3IDQA 3AWDA 1LLUA 3BHJA 2QVBA 5FORA 4H3SA 1MRZA 2M9MA 2ZI9A 2C58A 5LQDA 3IEMA 2PA0A 4QUEA 5BW6B 4J1TA 5G53C 4F1JA 4NAUA 1IN1A 2ORED 5IC5A 4RJKA 4NK4A 1F6WA 1JQAA 1TM7E 2FHSA 2Z8XA 3H11A 3LY5A 3FYHA 2OG1A 3NHFA 1IUPA 4HBZA 4J0QA 4FW8A 4KWIA 4H3KB 5IBPA 2P6OA 5IPFA 5JS6A 4IIXA 4QO8A 3CLRC 1R27A 5J4LA 1DMSA 1N2GA 3GEIA 2NM0A 2FK8A 2IYLD 2VHYA 2Y4NA 2ZJZA 3LQ1A 4O2LA 4UEQA 4CI9A 1VCMA 5FPHA 2O8NA 2GF2A 2ZJ8A 1WCYA 1G66A 1GXSA 2ATCA 4TV9B 3VR1A 5JY6A 4E70A 5CHYA 2PR7A 2XNJA 1I4DD 4R2XA 1Y33E 4B17A 2AH5A 1MDBA 3KL4A 3R0ZA 1YBHA 2Z2IA 1IJBA 4KPUA 3TBKA 3TBFA 4F4IA 2GD6A 2OFPA 3IUPA 4J94A 3NMUF 4BVBA 4F4DA 1F5SA 2EFDB 2OCIA 3L92A 3MMZA 4C2TA 3M8KA 2Q5LA 2EQAA 2J08A 3BCHA 4NENB 5AK4A 4QULA 4CWAA 3AINA 5B1IA 3EEFA 4RQAA 4Y9SA 2BFFA 1KYWA 1N1DA 2HRBA 1DXOA 2QAGC 4M8KA 2FX3A 4N18A 1NUPA 1CE8B 3DFUA 5T64A 3TLCA 5I7HA 4LCJA 1G64A 4BN4A 4D0SA 1KAEA 1PK9A 2H1IA 3L8FA 3OSZA 2W2QA 2HY7A 4PHTA 4RD2A 1K89A 3DL0A 2RJOA 4QOJA 3X1ZA 4A9AA 5H70A 5CGQB 5J40A 5KSYA 2NUPB 4D7AA 1HQDA 3C3EA 2PCLA 4P54A 2NG1A 3RF6A 1RJEA 2PPLA 1VECA 1J2RA 1PGJA 4WKPA 5LBTA 1BQEA 5DMHA 3T4XA 3TW4A 1ZNZA 3D7NA 3QRWA 1WXWA 2JJ1D 1GGEA 1LPAB 3ETLA 2VRCD 1X38A 3H9JA 4JH0A 2LCQA 4YRSA 1GGJA 4DQUA 1YO6A 4Q4HB 4ECEA 4PTLA 4DR7B 1BS2A 1CZLA 2V7BA 4I6GA 2WABA 4XVQA 4N3BA 2CXNA 3SVLA 4XWGA 4UTNA 1TX4B 1WAMA 3AG6A 4RVCA 4ILKA 3S1LA 3WYFA 1M8FA 2W93A 3NKLA 4L3OA 4CM1A 4DWJA 1X8LA 2R7MA 3L0SA 4A1FA 3DDOA 4R3WA 3A8TA 3VKFA 5CBPA 5JXGA 4DABA 3G0CA 4HWTA 3RV3A 1D4ZA 4PYJA 4JI0B 1ZIDA 3R7AA 4L15A 2FRDA 2HF8A 3JRNA 4Q7JB 3SZ3A 1NRXA 3AI7A 1O95D 2R7NA 2ILTA 4QU9A 1U9JA 4AYXA 2FYTA 2CVQA 4URZR 3I34X 9ABPA 1TTHA 2IHNA 3DFIA 2P5TB 2QUAA 1G1MA 3LQ4A 4Y9RA 4OK6A 1QGAA 1X0VA 4L57A 5D51S 3ENKA 1XG5A 1SXQA 4ZI2A 1OQAA 1C7FA 3I32A 4HWGA 3T15A 1HTTA 3JPWA 3UAZA 5TEWA 2HGZA 1LPSA 2J5KA 1R0XA 2QUZA 2ZETA 3JAWA 3NKVA 3OBBA 4M76B 4Q3NA 2F62A 5EMNA 4RGYA 4U7HA 3NVKI 1ZGZA 2WJ4A 3IVXA 2GPNA 4I50A 1OKKD 5FNVF 4EZBA 3GFOA 4QU0A 3W05A 1E94E 3ZY6A 4Q3CA 1VJDA 1V6SA 3JQAD 2I78A 1L4LA 3H5IA 1KY4A 3B1VA 1OX4A 3P9SA 3PHLA 4QEDA 4JX8A 5KB3A 1SAYA 4AUNA 2PX0A 5IN4A 4WN3A 4OUDA 2V1UA 1KVQA 1Q1AA 3ES9A 1P1KA 1BJTA 1WNFA 3D0OA 3FFAA 3A4IA 2ZAGA 5E4FA 4F6RB 4Z6KA 1G8GA 4FDTA 1Y7HA 4A6DA 4YIHA 4EA9A 2EHDA 3ELDA 3HUEA 4JITA 1D2AA 1EB8A 2RKBA 5DWQA 3P26A 3EWAA 4CLRB 1D2RA 2OCPA 5K0SA 4KK3A 3IS3A 3IKJA 3PNVA 1CUDA 4OFWA 2C3MA 2IDKA 2P9BA 3PNMA 3U48A 4EGJA 2B6HA 5TF0A 2C4TA 1GDDA 3IV9A 1VXOA 4MYSA 5D8DA 5A4KA 4WEOA 4QKQA 3OFND 4V0SA 3K70B 2PUWA 3BD6A 2DECA 2R4UA 3DG9A 2BBSA 3MPOA 1Q22A 4W5QA 4JJ4A 3O4HA 5A05A 2CNOA 3J7AC 3AR2A 3UOAB 4P4LA 2JJYA 3MBIA 2RH8A 4OATA 4O4HF 1CIJA 4NI5A 1Y82A 4YN3A 3TMKA 3ITKA 2CXTA 4NIMA 3T1HB 1XU7A 3PGXA 1C30B 1Q2XA 3KT6A 4BQQA 5AVSA 3LUDA 2G8NA 1PZFA 3E3OA 4KR2A 4B3XA 3PR1A 2YYYA 4K2AA 5AYVA 1LSUA 2DH6A 2I2XB 1P9RA 2BFBB 4OHCA 1FDOA 2G5CA 1IQPA 3AVVA 2DWUA 3E1GA 1EFVA 3E3NA 4EHNA 3A9CA 3D4PA 2XUOA 5AVRA 1UBCA 1QB8A 1OBCA 1J8VA 3LMKA 1ECCA 1C0EA 1ZD2P 2CMFA 4AZTA 3FGZA 1JEAA 1LD3A 1AKMA 1MVOA 4IRMA 1YOBA 3QVLA 1N6IA 3KSDO 5AHOA 5EVJA 1E62A 2D5CA 3USZA 5KVAA 3CT4A 2F43B 5BQ5A 1G17A 1KRHA 1XCOA 3GX1A 2AW5A 2HA4A 3EMBA 3GEDA 2YN0A 1QX4A 3OWOA 3STTA 2I80A 4JAVC 5AW9A 5TX7A 2WAAA 3B2NA 5JCXA 3T95A 2AD5A 2GJAA 2XA2A 1ORDA 2OCDA 3UFBA 4DGSA 2EFJA 3KB1A 5BN3A 5F7OA 1KEEB 3H5RA 4URFA 3TRHA 3HKDB 2PWZA 6REQA 4YRNA 1SUWA 2I54A 1L6IA 1WB6A 3E6AA 3KLPX 1OT5A 1RBYA 2GAAA 2MSLA 2ZAYA 4PIPA 5AJXA 1P1BA 3AVUA 3CWCA 1RZUA 2UAGA 4PLPA 1A76A 3KXDA 3ONVA 4WVFA 1DRUA 3S1AA 2WU3A 4AG6A 3KV1A 4QDOA 3HFGA 4E7OA 1YS4A 4B43A 3CT6A 4YWHA 2G4CA 2EG9A 1M0SA 1ZVKA 2Q45A 4BHTA 1ZA2A 5FBLB 1CEYA 3GQBA 1UP4A 4BFYA 1F12A 1Q14A 2V6JA 5J59A 1QWSA 5KYVA 3SM3A 1M1NA 4LMBA 5JYDA 3EULA 3RFTA 1NU6A 3GLQA 3B7WA 1YD7A 3OHSX 3R7SA 2REXB 4WBNF 5K3CA 2WSIA 3DZCA 5I01A 4TLCA 5ILOA 2WHRA 3I4FA 3HO8A 4QTZA 2QY9A 4CQNA 3N6RA 4FYJA 4DOMA 1ML4A 2VSOA 3L8EA 4P5DA 4ZIRB 2IZZA 4YGYA 3OHMA 1PJRA 2X9VA 4HX9A 1UPAA 1VJRA 3CKLA 4JI5B 2FH5B 3SNKA 2IY9A 3ZV6A 3DT8A 3HWSA 2YJTD 1M2VB 5CXXA 3WLEA 3UWPA 1ORRA 2FE1A 1DZ3A 1T1GA 2RGEA 2VP3A 3F0TA 3HJFA 3LQQA 4DXDA 3VMFA 4W1SA 4R8SA 2YJZA 4LZOA 3R3HA 5GY7A 4PX2A 1T10A 4D9BA 1SRQA 5AQ1A 3GLTA 2GEVA 2GJKA 4PXYA 4WLEA 2EF1A 3NJRA 4Q47A 1E9EA 2DHEA 5F77A 5WRFA 1RVDA 3D6HA 3LLSA 3LY9A 5C5CA 3LFTA 3VR2D 3N76A 3D4LA 5F1OA 4ETMA 1PEKE 3HFSA 3A1CA 3DEIA 3N39C 1N0UA 3T1NA 5KJ1A 1J1ZA 3FF4A 4C4OA 4R3NA 4IQ8A 4BUZA 5JD4A 3WV4A 2LRHA 1XVTA 1T8RA 3EG5A 3IBSA 4RD3A 4BO9A 4F9TA 3I53A 1SKYB 2EIXA 1H5UA 2NZXA 2VXYA 3LUKA 4NY1A 5T57A 2JLYA 3CMMA 3GCZA 3BFKA 4GQAA 2P4EA 2G0NA </