1KDTA

Cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
223
structure length
223
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CYTIDYLATE KINASE
publication title Sugar specificity of bacterial CMP kinases as revealed by crystal structures and mutagenesis of Escherichia coli enzyme.
pubmed doi rcsb
source organism Escherichia coli
total genus 78
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2001-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kdtA00
2LKCA 1COWA 3K9GA 4TLAA 3GMTA 1YU9A 2B92A 1AS3A 2ZJYA 3PQCA 2EFDB 2PL3A 1DPFA 2F1IA 1KY2A 2CCJA 3CRW1 4TTPA 4UQOA 2H8KA 4HB4A 1RIFA 4R2HA 4WXPA 3EARA 4LBVA 4NZYA 2VH5R 4DT1A 1OIXA 3I1FA 3K0EA 1KI8A 2ZAOA 3X1WA 2FZ4A 3ICEA 4A6PA 1ZYUA 4HAUA 4KSBA 1Z5ZA 1W2GA 1IY1A 4II7A 1VECA 3W5JA 2CHGA 2QGZA 4IW3B 3UANA 3HPRA 3TSWA 4KSCA 2OO7A 2ZITA 2AX4A 2Z43A 4OBEA 2ZYUX 3J81k 3THYA 5KSPA 1S3SA 721PA 4I1SA 2ZS7A 1US8B 4PTLA 2HXSA 2YC4C 4P32A 3AP1A 1NSFA 1S0UA 3BERA 3TUZC 2ZI5A 1HYQA 1ZD8A 2O8CB 2I1QA 1R6BX 3OEED 1W46A 3AVPA 1MABA 2ZRFA 4D4LA 1W48A 5FOVA 3FDIA 2PT5A 1S1MA 2J7PA 4JS0A 1FUKA 1KNXA 1NRJB 3HU1A 1W1WA 4GMDA 5IRCD 4TYQA 2OAP1 3GLHE 4EIWA 2IWRA 4IDPA 1KJYA 1FPMA 3PIRA 1NKTA 4DLRA 2VF7A 4XJXA 1EXMA 2WMNB 1IY2A 1G5TA 1G3RA 3Q5DA 5H8WA 1UKEA 3EWSA 3DMNA 5EZ6B 4ILEA 1CXZA 4DBLC 3LY5A 3B1XA 4LCBA 2A5DA 4M1KA 1E32A 2ZRPA 1GKUB 3GLIA 4PR0A 2QTFA 3QPWA 1WP9A 4FCTA 2O52A 4M2LA 4LUCA 4Q1EA 1SVKA 3A4MA 2WTUA 1ODFA 2BBOA 3GJ4A 2D62A 4EJSB 4MKFA 2PZFA 2R6CA 4NDZA 5TMPA 2V6IA 2VP5A 1OPXA 1M2OB 2IYZA 3BRWD 3K0AA 2Q3MA 3Q85A 4RD0A 3K09C 4A0GA 4DEYA 1SVWA 3WRYC 1GNPA 1U9IA 4PXAA 4GBMA 4D0LB 3IUYA 1NLFA 1VCOA 3L0OA 3KFXA 3ICQB 2JCSA 1E2LA 2HDNB 4I4LA 4BLQA 1KJZA 1IY0A 1LS6A 3AKYA 3K0FA 4TZ6A 2KSQA 3UK6A 2ATXA 1Q12A 1E2JA 4Z1MD 5TXGA 3CONA 3EWAA 4BFSA 1HH4A 1NF3A 1Z29A 3T35A 1G7RA 2GEVA 4V0KA 1ZD9A 3DPUA 4JL8A 2VHUA 3OEHA 1WQ1R 1Z3IX 2QI9C 1GDDA 3B6EA 1VHTA 1QHIA 3BE4A 3D7MA 4DZZA 5B58C 2O8EB 3WYFA 3GLFA 3EIHA 1NBME 4K46A 2RGXA 2HV8A 5C4GB 4ACAA 6Q21A 4OHZA 1XPRA 4NH0A 5TDHA 4MGZR 3NBYC 3U6BA 4CEIA 3VR5A 3W8NA 4BLTA 1OHHD 1PLJA 2V9PA 1VKJA 1ZUIA 2HCJB 5KDDA 3SQXA 3LRPA 2OCBA 2CDNA 5FH9A 3C5CA 4XOIA 2ZRKA 4HB3A 3PUYA 3LXXA 4XTRA 3EPHA 4C0BA 3W5IA 2PJZA 1P61B 5JFGA 2FG5A 1E9FA 4LGMA 4QHSA 3K70C 3G0HA 4HAVA 3U60B 2IXFA 1YKSA 2DFLA 4JLPA 1DAIA 2TMKA 1ZVQA 4ITRC 3SI7A 2QE7D 2QSZA 3KB2A 4YDSA 4M22A 3IQXA 1QG2A 2EVWX 2NO9A 2FSGA 3OFNA 3KQHA 2ZS9A 2F1HA 3D31A 3OAAA 2ZEJA 1E2MA 5DI9A 3B1VA 1R10A 4EKDA 2BMFA 4MDEA 4RD3A 3MRSA 1FX0B 3BIFA 1U8YA 3HYRA 3WNCA 1KSJA 1N0UA 4L4UA 2OESA 2WOJA 4OYHA 1F2UA 5JEDA 1FFHA 2BWJA 2H18A 5A0FA 2QUZA 2WJJA 3PFIA 4OI4A 1K6MA 4R71A 4AYXA 2IS6A 3QIAA 4TZ0A 4M1SA 3CIOA 4GNKA 4RD2A 1ZAKA 4WXRA 5K8LA 1Z0FA 2FFAA 1E0KA 2F55A 3NEYA 2IBMA 2ZRIA 2ZAMA 4BEJA 1G7SA 1KK3A 2WWHA 5HKKA 1D9XA 1MH1A 2VEDA 5AUOB 1R5BA 3GP8A 4V0NA 4NMMA 3QG5A 1VPLA 1KZGB 4DWJA 3EZFA 3BH7A 4TL7A 4ARZA 2WVJA 3HR8A 4KFUA 1UFQA 2W2TA 3DZ8A 1DEKA 3MWYW 2QT0A 1BIFA 4KFSA 4URWR 1G7TA 4A4DA 4QNMA 1GSIA 1XX6A 4A8JC 2J3EA 4PSKA 1PUIA 2IHYA 1KIMA 5CITA 2OXRA 3CH4B 3QKRA 3RNLA 3SYKA 4Q9KA 4JLMA 3UMSA 5IHPA 2F1JA 2HLDD 2J0UA 621PA 1OH7A 3T12A 2MSDB 3BOSA 1YRBA 2ANCA 4JLAA 1ZM3A 1XEWY 5L3SB 1HT2E 1XPUA 3O8RA 4TLEA 3AUYA 4YDHB 3B60A 3SC3A 2VIIA 3REFA 1RJ9A 5AUPB 4HDOB 4B35A 4G01B 3U7HB 3AVWA 4RD6A 2GBLA 4OI0A 2ORVA 3EC2A 1W44A 2V3CC 1DG3A 1GUAA 3NHAA 3W6NA 4B73A 1G9XA 3CRMA 1KZ7B 2C03A 3AP2A 5TARA 5LD2B 4UNNA 1KYIA 4KFRA 4Q7MB 5E7MA 2AD5A 1OYWA 4L15A 3Q9LA 2P67A 1UKZA 5EP1A 2F7SA 3W3AA 1DOAA 4CEIB 2GXUA 1WRBA 5E7IA 4LHZA 521PA 1V5WA 4CEJA 1TUEA 3GLGB 2QTHA 1JXOA 2DCUA 2J7KA 1N0WA 1Z6GA 4HAWA 2IS2A 4L9SA 3GFTA 1P73A 2ZRCA 4RFSB 3MAAC 2UVQA 2ONJA 3VHXA 1E79A 2X77A 2VSOA 1I4LD 1Q1QA 1GKIA 1L7VC 3PUWA 5KPJA 1EFHA 2GZHA 4KAXA 4LHVA 2C95A 2WWXA 4NCNA 3QEJA 1TMKA 1IXSB 1S4QA 3BORA 5EQTA 4E22A 1QHHA 1XEFA 3LWNA 1DTSA 2LWIA 5CIQA 5FL3A 3A1VA 3RABA 4QHTA 1ZUNB 2OILA 4P4SB 1TQDA 2BKUA 3PUZA 4DLXA 2O0JA 1GL7A 2NPFA 2GJ8A 3JVVA 3TSZA 4TLCA 3T1OA 5DN6A 4JJKA 4MYTA 3ZYCA 1N3BA 1SZPA 1V43A 1VYVA 3HU3A 2YNMA 4YQFA 1A2BA 4P33A 3T1QA 4WBSA 3FMPB 2V7QD 2D2EA 3L43A 2FN4A 4HLUA 5HR5A 1E1QD 3CLVA 3HR7A 3PCRB 4TSFD 2V6JA 5DLQC 2WWGA 1KO1A 1XF9A 1Z28A 3ND9A 3LLUA 3X1DA 1E94E 1XJ0A 4HAXA 3DOEA 5JWRA 1P9NA 3D8BA 4KYIB 2AKYA 4GT1A 3ADBA 1E0SA 4GSYA 4Q4AB 5JSZB 2ZPTX 1E4YA 2WSSA 1J90A 1TADA 5KDOA 5C2JB 3BFXA 1T8TA 4A2WA 4O2LA 1GTVA 1H8HA 2WJGA 4C0KA 2CCKA 4LYFA 5SZHB 1W36D 2GAAA 2GEDA 5JMTA 1E2NA 4DHEA 1J2JA 1ETUA 5C46F 3DEFA 1YQTA 1YZKA 3WMFA 2V1XA 1D2MA 421PA 4O2RA 4EDHA 1P72A 5C4MA 3B8HA 1PLLA 3E5HA 3EZ9A 3SBEA 4DRZA 1KMHA 4C30A 1UKVY 4I1VA 3VR2A 1G8GA 4KU4A 2ZJZA 3R20A 5FPKA 3OZXA 2OAQ1 3KQKA 5JWOA 3L2OB 3ZIAA 1FW6A 1RC8A 2BHRA 1JJ7A 1FZQA 4F38A 3PVSA 4WW0A 1QVAA 1AQUA 4NHOA 1NKSA 1D8TA 4PQRA 4KI0A 1YE8A 2PT7A 3NHBA 4PC1A 1D2NA 4PZLA 4URXR 2C78A 3GD7A 1VIAA 1W7AA 2YOGA 1IM2A 2YVUA 1EK0A 2GJAA 2ECKA 3D6TB 2FFQA 4Z54A 1XPOA 1DBSA 1P62B 3B7GA 4NU0A 2OSBA 2B7CA 4ZI3A 1Z0IA 1S8FA 4BFVA 2RGEA 1RRFA 2QGNA 3AF2A 3CZPA 3TH5A 1HQCA 2G1JA 3BD9A 3QF4B 3VU9B 1QHHB 1R8QA 1XJCA 4IVRA 4OK5A 1J8YF 2PMDA 1HTWA 2GF0A 3LQRA 4M21A 1VG8A 4TQUS 1SXJA 3ETLA 1AN0A 2NZJA 3A58B 3RS0A 2QMHA 3TQFA 4MKGA 4QGHA 1RZ3A 1XD8A 4GL2A 5K8TA 2XB4A 2GJKA 5JCPA 2UZ3A 2LCFA 2ZE8A 3QI2A 4LV8B 2P3SA 3V00A 5HZKA 2WPDA 4H1VA 3ZQ6A 4FD2A 2W2VA 5GJVC 1C9KA 4A2QA 4TL6A 3KQUA 1ZINA 5HCNA 5CJ2A 4HSEA 1JR3D 2ZXUA 2XB2A 2XNDA 4GOXA 1VCIA 2EFHB 1M8PA 3X2SA 2BMEA 3CB4A 2JJ8A 1R2QA 2PCJA 3FWYA 3RS7A 4HUTA 4TYWA 4B3BA 3LLMA 4PX9A 4PSVA 1XRJA 1Z0DA 3ZJYA 5EP2A 1XFAA 3AP3A 2G9NA 1EFTA 4X8HA 3ZVMA 4QJ4A 5FTKA 3AVUA 1VYTA 1E9RA 2JJ2D 1IXRC 4MGIR 3C14C 3B1YA 4GZLA 5TVKA 4QM7A 2QPAA 5AR1A 1CULC 4ASUA 1Z63A 3LX8A 1SVLA 3PG5A 1JAHA 3VKWA 2AD1A 2QY9A 3BGWA 4FWIB 2X8AA 2PBRA 4GPTA 4YXWA 3EIEA 1NJGA 4CGZA 2D7DA 1G3IA 1OXXK 1O87A 3C15C 2A5JA 3TK1A 4CEHA 1N6HA 3QUSA 2GCOB 3RLFA 4Q1BA 4NYJQ 1W47A 3N5CA 1W0KD 3VX4A 2WWWA 4B48A 2VHQA 3SDZA 1OFTA 3MUFA 1W36C 3KTAB 3ZDQA 1BO6A 2G0TA 5BWMA 3KQLA 3U44A 1M7BA 5HE8A 4BFYA 2R2AA 5H70A 5GJWC 5P21A 4A0FA 4NPHA 1R5NA 5FBRB 3ZS8A 2GK7A 4YMUA 4H9GA 1TQ4A 4L8GA 1T3LA 3RWOA 2NIPA 4MA4A 1BMFA 4B6FA 1HV8A 4RZXA 4QXAA 1G291 3QBVA 4M8NE 3FYHA 3AGQA 2QAGA 1AZSC 1G3UA 4BGDA 3TW8B 4V0MA 4NYMR 1P2TA 3GEEA 3U7EB 3AVVA 2HCBA 4N3NA 3PXGA 4TTRA 4L16A 2AK3A 4LPSA 3SJCA 5EE1A 3TR5A 3KKOA 1JJVA 1NVXQ 1XTJA 2JLUA 3AVXA 2CHQA 1E9CA 2RCNA 5FI1B 4BFXA 2ZRLA 1S9HA 2AWOA 5ANRB 1YZLA 3BFVA 1QHGA 3AV0B 2FFHA 4JSTA 2KBEA 1DAHA 4EQ6B 3B85A 4CT4B 3U7FB 1QRAA 1G5RA 2WAXA 3M1IA 2A5YB 4Q7JB 1KOFA 1KJWA 2D06A 2RH5A 2CHVA 3G82C 3K9NA 5DGXA 1W0JA 3MFYA 2PZGA 1GNQA 4MUAA 5J40A 4KLNA 3CPEA 1W4CA 2V8OA 3S1AB 5AWFC 1WCV1 3FHTA 4IFEA 3X1XA 2G83A 5KSZA 2QNRA 4R98A 3ZVRA 4CT5A 1US8A 5JCZA 1A2KC 3NXSA 1N6IA 2JLXA 2P6RA 2VP4A 1YZGA 3FHCB 4Z8XA 3FPAA 2OLJA 2W6IA 1TAGA 2V4ZA 2ZR7A 2O8CA 1FNNA 1R7RA 4BASA 3NEJA 2KB0A 2GF9A 4TYPA 3L0IB 4QGFA 4Q01A 5D3MB 1YR8A 2Z6VA 2H1LA 1DO2A 2ZJBA 4FIDA 4M53A 5FI0B 1KDTA 2WSMA 1JQLB 3MSXA 1KI6B 4DXAA 5GVRA 5J4KA 1PLKA 1FNMA 2YWEA 2G0NA 4QBHA 4AK9A 4ZDWA 2J46A 4WIAA 2REOA 3QE0A 4BFWA 1IQPA 4PAMA 3CRQA 4PAQA 4ZPXA 5IK2D 1CJKC 2A3RA 3PV0A 1KSHA 4V03A 2O8DB 5DH9A 5FPHA 1AGPA 4ESHA 1ZNZA 2KWIA 2IX3A 3V9PA 2BM0A 4L9WA 5EP3A 1HEIA 2FE4A 3MJRA 2JIZA 3U3RA 1W36B 4LBWA 1UPTA 3R9XA 2RGNC 1Q3TA 2ZU6A 1XXHB 2G6BA 3QEOA 1NVUQ 4OK3A 4EJSA 1G8FA 1GWNA 3T15A 1OKKD 3BFKA 4QJ5A 2QSYA 4XVUA 2RGDA 2Q0HA 1CF4A 3C5HA 2XZPA 4D82A 1XEXB 5FBQB 1RPZA 1NJFA 2ODNA 4BFTA 4FMDF 2WBLC 2QG6A 5KPDA 2D3WA 2FPMA 1OXSC 1Q22A 3QVUA 1JR3E 2QEQA 4C9BA 1J99A 3QF7A 1E99A 3MG9A 5CIWA 2AL7A 3TQCA 2ZI7A 1E9SA 1VYUA 2CLCX 1J8MF 4QC2A 2IA5A 3T5DA 2VBCA 1TUIA 1UKYA 3K70D 3B1WA 4KHZA 5J4LA 2BBWA 2O8EA 2PMKA 2QAGB 4A82A 2MSEB 3LBNA 1NVVQ 1VTKA 5J5CA 3EAQA 3HYTA 1SVSA 3PEYA 4MUBA 1S1CA 3GJ7A 4HEJA 3VR1A 821PA 2RHMA 5FUXA 5C18A 3ZGXA 2JLYA 1NLYA 5BXQC 221PA 3GJXC 4PQYA 1T3SA 3UWKA 4D0NA 2JLZA 4D2IA 1MRNA 3WP1B 2AK2A 4FMDB 5HE9A 2VP2A 3AKDA 3QENA 4DCTA 1T8UA 4DLVA 2VL7A 4X8LA 1BS1A 4WZBE 2FA9A 2WJYA 5EXTA 3UPUA 2FOLA 4KVGA 4Q18A 4FMBB 5M04A 1GIAA 3DDCA 4Q00A 3EG5A 121PA 1XD2B 3REGA 2OXCA 1NN3A 1E2KA 3Q3JB 2Q6TA 5KHOC 1I2DA 1IN6A 4A2PA 2ODEA 3C4JA 2VPPA 5FTJA 2J41A 2IYSA 2OZEA 3O47A 4DUGA 2GETA 3U3OA 2ZRGA 1FX0A 2FSFA 3CRRA 4F4JA 4CRWB 1I4TD 2ZM5A 5KU1A 3KL4A 1OYYA 3SJZA 3BH6A 2CL0X 1JI0A 1NN0A 1UBGA 4HB2A 1JXMA 1AKEA 3IHLA 4YMVA 5FR1A 3IPYA 5FUVA 2QZ4A 1SULA 4US2R 1WBBA 4TTQA 2QORA 3A4LA 4IVPA 1X86B 2ZETA 2CL6X 3KKNA 1NBMA 1ESMA 3FMIA 4PO1A 2ZYWX 3T61A 1AZTA 1T0HB 2YYZA 4G5GA 2ZRJA 1Z22A 1MO6A 2W6JA 4EPTA 4J0QA 5CLQA 3TE6A 1T5LA 3TSOA 5FOWA 2ATVA 3SJAA 2HYDA 5E7JA 2GZDA 2YZ2A 4IJMA 3M4YA 4HYYA 1OW3B 3SJBA 3BB1A 4Q1FA 2YHSA 4XD7A 4OI2A 3IKJA 2KJQA 4XWOA 2CLSA 1UDXA 2J1LA 3V4FA 5JJKA 3A37A 1KTVA 2GKSA 4KO8A 4LYJA 4A6XA 2QROA 4KBFA 4RD1A 1A82A 3IIKA 2AKAB 1E2QA 1G4UR 3CWQA 4ZDIA 5FBLB 1VDZA 4BLRA 3F0TA 1HE1C 5L3SA 3AF3A 1G18A 3LH5A 2YOHA 4M0LA 3I5YA 4AY2A 5H1YA 4EAQA 2EYUA 1N6PA 3B13B 3HPQA 5DO9A 1UBCA 2KBFA 1T5IA 1LF0A 2V1UA 1RRPA 3WYAA 2JEOA 2R8RA 2Z4RA 4RD4A 1XEWX 1LTQA 3PEWA 4NCHA 3JZMA 4HUQB 4HZIA 4I1OA 4HLQB 4KLZA 4HAYA 4I1UA 5HTKA 4IHQA 1DG1G 1I4DD 3GLGA 2JDID 2ZJ8A 3K0SA 1A1VA 3KJIA 2ZRDA 3GLHB 5F2EA 4RFSA 2JA1A 4O0MA 4A0RA 3LQQA 1MO5A 2AFHE 2QT1A 4Q4LA 2ZR9A 2IYXA 4KCGA 4KXFB 1U9IC 3B9PA 4DEXA 3PEUA 5FR2A 4MKIA 1VG9B 2IF2A 4OJKA 5FUYA 1ESNA 2BJVA 1GITA 2CNWD 4G0NA 4DC9A 4Z51A 5F9FA 5DHAA 2WKPA 3CF0A 1YZTA 4U5XA 2QL6A 1A5TA 5JRJA 1II8B 3O8BA 3EZ7A 3FTQA 3IEUA 4LJAA 3R8CA 3TAUA 4DJTA 3ADDA 1G8YA 2EFEB 2G3YA 1F2TB 5J4HA 3NC1C 1GILA 3A1TA 1NY6A 3LD9A 4FI3C 1M7GA 2O0HA 4IFBA 4P4SA 4AKEA 1F3OA 4IXMA 5FOSA 2P6NA 1Q20A 1NL3A 2YINC 3KKPA 1RE0A 5JJLA 2FFBA 1ZMXA 1OFIA 5AK0A 1CJMA 3ADKA 5LPNA 1Z47A 3B9QA 4PO8A 1OH8A 2B6HA 2QQ0A 4WZ6A 3TW4A 4B75A 4RZ3A 2YOFA 2BMJA 2YV5A 1CEEA 3H4MA 4JLNA 1FQKA 2DWOA 2CE7A 2C99A 2OEPA 3OEEA 4Q9JA 4A15A 3IO3A 2WWIA 2YC2C 2WJHA 1VG1A 3R7WB 2FNAA 3UMRA 2FSHA 4NP6A 4A8JA 2XNSA 2NZ8A 2DB3A 3ECCA 1EESA 1MR3F 2OFWA 1M7HA 3KXLA 3A1WA 3MCAA 4Q4AA 4Z8YA 3GLFE 2YKGA 4G5OA 5JSZA 4NTZA 5AJVB 2X2EA 2BCJQ 4Q9HA 4RKFA 4PANA 1P2VA 4LJ7A 2B21A 2D4HA 1Q3HA 1YJ5A 1ZU5A 4D81A 3AM1A 1Z83A 4LY6A 4RKEA 5TY0A 1GG2A 1N0VC 1W4BA 4JSYA 1AS0A 1U2RA 1XTQA 2NPIA 3EC1A 1YVDA 1SVIA 1Z2AA 5IT5A 2XZOA 2Z5FA 4M9ZA 1AM4D 2AXNA 3A36A 5BQ5A 3SFZA 3U6KA 1UBFA 2WSSD 2A7QA 4HI0E 1S3GA 2H16A 3HP1A 3IHWA 3SOPA 3KJGA 1DO0A 3H1TA 1P6XA 2WIAA 2NO7A 3NIBA 3AF1A 4QKQA 1OV4A 2OHFA 2OCAA 4ZKDA 1FMJA 1U8AA 4M4SA 3NKVA 4ZIRB 1GM5A 1G3MA 3G5UA 1SVOA 4NCJA 3AUXA 4U00A 2OE2A 3DZDA 5J47A 3N70A 1YR6A 1LNZA 3BBPA 1H8ED 2PLRA 1XWIA 2XJ9A 4Z1MA 1ANKA 2YWHA 1EFRD 2XXAB 3BK7A 3K70B 2OCPA 4NL4H 3AQ4A 1FP7A 1P60A 2C2HA 1E96A 5G53C 1OB2A 2IC5A 4OHYA 4ZV4A 1CRPA 3RVBA 4Q66C 4MYCA 4PPQA 2ZR0A 3ZIAD 4LBZA 1PUJA 4BZXA 5A5GA 4AYTA 1DELA 4UJ3A 1CS4C 4LYAA 1OHHA 1JALA 3I92A 1QDEA 4I99A 2OG2A 1OXTA 2ZS8A 1IJEA 1G64A 2C04A 4JKIA 4C7OB 3GJ8A 3KDSE 1ZU4A 4RY2A 1Q0UA 5E4FA 3VX3A 2EQBA 4D0GA 2DBYA 2F6RA 3U2QA 3QOFA 1G3QA 1Z0JA 3QF4A 3VU9A 3FKSD 3KB1A 4FN5A 1KI2A 4TL9A 4BQSA 3VKGA 4US1R 3RANA 5KO2A 4WZAE 2BC9A 4IRUB 2HF8A 3ONWA 4JVMA 1YRAA 1RW4A 1S2MA 4DVGA 1E9DA 2ZJ5A 3O8CA 1JPNA 3RAPR 3U3JA 1N6RA 1AGRA 3FGNA 4BWYA 4X8MA 1K5GA 1XTIA 3JVUA 1YZNA 1ZIPA 5L3QB 3F5FA 2JASA 3PUXA 2ORIA 3RYTC 4C0JA 5EUQB 5BN4A 2WICA 1DADA 1VG0B 4OK6A 2F3RA 1N5LA 3P20A 3QKUA 4YONB 1WE2A 2HEIA 2ZQ5A 3CF6R 4EPWA 1DVRA 2PJRA 1DAFA 2P5TB 4K81B 1UEIA 4R7ZA 4LBYA 2O0KA 4W5WA 4GP7A 5DNYB 4TMKA 4A9AA 4A8JB 4EFMA 1U0JA 5EUMA 4NKRA 3NH9A 4G5SA 3VR3A 4JT4A 5ELXA 1CJTC 1ZP6A 1IN8A 2WV9A 2ERXA 1G6HA 3M0EA 1B0UA 3IQWA 4GZMA 3NBXX 3U7GA 2BOVA 5LBIA 3CNOA 4FMCF 1NY5A 3QKSA 4ZI2A 2REBA 4FCWA 1EFUA 5L8VA 2IYYA 4DIDA 4NE2A 1IOZA 1QF9A 1XMJA 2X1VA 4S2EA 2XEXA 1G4AE 5G41A 2GCOA 1KKMA 4OQFA 4KBGA 4W9MC 2YJTD 5GADl 4TT3D 1NLZA 2AXPA 3IPXA 2GJ9A 2HLDA 1LW7A 4UNQA 4CVNA 3H2YA 4NYMQ 2DPXA 4DCNA 2QAJA 1TU3A 2VHJA 3BJIC 2Q9AA 4LDJA 4V02A 2Z83A 5GVSA 2ZREA 3BWDD 2GHIA 3KTAA 2NO6A 1XMSA 3H86A 2H17A 4QG7A 3RWMB 3TBKA 3RSLA 1II0A 1G41A 2BMDA 1SKQA 4D4JA 5FFMA 4QL3A 3THOA 1E1RD 2WJIA 4P31A 4CYMA 4TN1A 1TEVA 1XMVA 4FMCB 2Q9BA 3QXJA 2Q3FA 3UG6A 1R4AA 5DYIA 3UATA 1L4YA 2XSZD 4HATA 2KI5A 2ZYVX 3NG1A 1HQYE 3TMKA 2QU8A 2V55B 4FCVA 5FPTA 4PO9A 3ZZTA 2I1VB 1KAOA 2R62A 2EFCB 2ZI4A 4IXNA 1N6KA 2WIBA 2Q9CA 3I5XA 4FXPA 3PR1A 1E2FA 1RVDA 3LDAA 3RRZA 1M6NA 5J4YA 5AJXA 2JLRA 2JJ1D 2PEZA 3BAFA 2XJ4A 4DB2A 1JAIA 1KSFX 2J0VA 1KGDA 4TYNA 4MYHA 1OXVA 3NTUA 3ZVLA 1BYIA 4EQ6A 1U90A 2J87A 2GA8A 5FBVB 1E4VA 2K5UA 4HLDA 1ZIOA 3I72A 1MV5A 3RSOA 1KO4A 3LO5A 5EXSA 1N5JA 3EW9A 1CR1A 3ZLJA 1TF5A 2BBTA 5FPSA 1AJEA 1D6JA 1MRSA 1KK1A 4KJZA 2CCGA 3S1AA 2IUSA 2L0XA 1XD9A 4CF7A 1M34E 2ZYTX 4QNRA 1S9DA 2FEOA 1KSGA 1W49A 5DISB 1XBTA 4F4CA 4TMXA 3SQWA 3AKCA 2ZTSA 4GP6A 4KV9A 5EXXA 5BN5A 3W6OA 2V7QA 5D3MA 1U0HC 3VQTA 2GK6A 2XZLA 3GEIA 1E1QA 5FBWB 3SYLA 4PAOA 5TV2A 1KI9A 2WHXA 4HDQB 4TSFA 1KI6A 2R44A 1G1MA 1E0JA 3CPJB 4NONA 4JKYA 2A2ZA 5EE5B 1CBUA 5JZVA 4BZQA 1U81A 5SZIA 2GRJA 3SFVA 2CMKA 4JYBA 4JL6A 1FTSA 3OE7D 3KFVA 1NN5A 2IXEA 2ZSAA 3UXMA 2O8DA 4ZDJA 2WOOA 4E03A 4W5JA 1SXJC 1LY1A 3QKSB 2XAUA 4NCIA 4XSGA 2IS4A 3DKVA 1DAKA 3IBGA 3P26A 5KDLA 1QHSA 1SQ5A 5B30A 3W6PA 1D9ZA 1EX6A 1IAQA 1ZM4A 2O8BB 2XX3A 2PLFA 4DB4A 2H92A 1II9A 5AUNB 1XXHA 1CLUA 1U8ZA 1D5CA 1Y3AA 1U94A 4XTCS 3WBJA 3FFAA 1N2CE 2IWHA 1W5SA 1ZC4A 2JLVA 2VP0A 1XEXA 1F48A 1P2UA 2WWFA 3LX5A 4Y0VA 3VNVA 3I3SR 1AQYA 1CP2A 5CDFE 4ABYA 5CK4A 4TLDA 5HCIA 2ZRBA 1SXJE 1NIJA 1ZUHA 3FHOA 4ZCMA 2X19A 3GJ6A 5FL7D 5CB8A 3NWJA 4P3YA 5F3WB 3HDTA 3OIUA 3L82B 2DFTA 2H5EA 2CBZA 3CX7A 3SE0A 2IHBA 1NSTA 2WKQA 3CNLA 4B47A 4C2UA 1RFLA 4D4KA 4JVNA 4IOMA 2P5SA 3K1JA 3EPLA 1DAEA 2GJSA 4M9QA 3LXRA 2ODWA 5DYGA 2D7CA 2DWQA 1DE0A 3A1UA 3AB3A 1CTQA 2WM9B 5JI3E 2GCPA 1GAJA 2WJVA 1NIPA 3VR4A 2A78A 5FOXA 4IOLA 3WP0A 3RC8A 2B8TA 1MO3A 2D2FA 2W58A 3N2IA 1Z08A 2JATA 3Q7PA 2IYWA 4UNPA 4B3CA 3P4XA 4Q4JB 1KI1A 5KSOA 2Z0MA 4BLOA 2NMVA 2HT6A 1WXQA 2MMGA 1Z2CA 1COWD 1FUUA 2CVHA 3CX8A 4MRSA 4C3ZA 3R8FA 3SS8A 4FW9A 4LJ6A 3C7KA 1W2HA 3Q5EA 4IKEA 3U61B 5CYPA 1XD2A 4NYIR 2B8WA 3U3KA 5KSYA 1X1SA 4PHGA 5CYOA 3NBZC 4P0TA 2R65A 4ZO4A 3B5JA 3THXB 1PV4A 1OFHA 2QTVB 5H68A 3K0CA 5B64A 2GZAA 2QN6A 5DI3B 2AR7A 1HA3A 3W34A 3BH0A 4NCKA 1Z6YA 4LC1A 2ZIAA 1IXZA 4KFTA 4BRUA 1OLOA 4LHXA 1OH6A 2BJWA 1Z6XA 2IUUA 3BC1A 4Y0AA 4Q21A 4C0LA 4A36A 1SHZA 3LNCA 4DLZA 4EUNA 3VMFA 2RGNA 2XOKA 2H7VA 4DLYA 2ZU0C 2ZRNA 4PQFA 3PJRA 1ZNYA 3LBIA 2BKEA 1E2EA 2JJ2A 3DM5A 4B6EA 1VHLA 3M6AA 1Y63A 5DIFA 5FOUA 2F3TA 2IYUA 1P3JA 5L3VA 3TJZA 1QBKC 4V0ME 1X8JA 4OQLA 1IN5A 2IUTA 4JLKA 2J7PD 4HAZA 4MKHA 4A92A 5A4JA 2PEYA 2OT3B 1NVWQ 4US0R 4DSOA 2XTMA 2PX3A 4WA7A 5KNBA 1R0ZA 3AVQA 1JNYA 4P4TA 4UXJA 5L3RA 4LWZA 3RC3A 3KJHA 1M74A 2FGJA 1GKYA 1XTKA 2ZSBA 1JEEA 1JEDA 1E9EA 2QP4A 3QQ5A 3IGFA 3P4YA 3CH5A 3GJ5A 1HURA 2R6FA 1W0KA 1KDRA 3DM9B 4ZDKA 1ZM9A 5GJCA 2IEYA 1UBEA 1CKEA 2GXSA 4L5BA 3SU8A 4BUJA 4HDCA 2ZUCA 3W8RA 2IYTA 4B76A 4C4PA 4EFLA 1RKBA 2NQ2C 4G5RA 3WBKA 2CE2X 4ERNA 1ZJ6A 2E9SA 4Q1AA 5EE3A 1TEXA 1GL6A 1RYFA 4D6PA 1ZNXA 5BN3A 1Z06A 4HUQA 1G17A 4B32A 1EWRA 4HZUA 4EPVA 4D80A 1TPZA 2EW1A 1KAGA 3A1SA 1QG4A 2R9VA 3ZZUA 2FF7A 5LDDC 1Q57A 1A4RA 1G20E 1KO8A 4GRAA 1T0JB 3OEHD 1MO4A 3GLHA 4EJSC 1XCMA 5KNCA 2VQSA 1DAGA 4NBSA 3IILA 5DHFA 2HYIC 1UF9A 1F5NA 2A30A 4LJ5A 3Q7QA 3KKMA 2FDCA 3LW8A 4TQ9A 1OIWA 2VO1A 3IEVA 3PUVA 1KHTA 1KK0A 1JQJC 3FKQA 4OL0A 3BB4A 4XWAA 3UWOA 2CXXA 1UAAA 4WOPA 3ZVNA 2P2LA 1II8A 1F2TA 2YWGA 4TMZA 3AH8A 1BOFA 5JRZA 3A6PC 2ZJAA 3R9WA 3TVDA 3T34A 2WAYA 3FB4A 4RCZA 3U5ZB 3WHKA 1AA9A 1L8QA 1T3HA 4URUR 5C1BA 1ZM2A 5TB5A 5D3QA 1E2DA 3LV8A 4U7DA 2V54A 2RAPA 1FL9A 3OFND 5CM9C 2CK3A 3RHFA 3X1ZA 1OSNA 5K8UA 1BH2A 1IN7A 1UDWA 2E87A 3RS3A 4OQMA 1GOTA 5FTMA 2REXB 3UG7A 3W90A 3OAAD 3IBYA 4HB0A 2BDTA 4MRPA 4B34A 2DFNA 2VHTA 4TLBA 4GDFA 3TLXA 3R7WA 1XJQA 1HUQA 3FFBA 1XZQA 2W83A 2ZROA 3LAWA 2QRNA 2R6GA 3SBDA 4XVQA 5IK2A 5DSZA 2OCYC 3K09A 1XTRA 2O5VA 4QM6A 4JBYA 3VFDA 5KNDA 4IDHA 2A5GA 3PEVA 3CX6A 4O25A 3H0KA 2OV2A 1VCMA 3GJ0A 1BKDR 5JJIA 1LVGA 3DL0A 1QHNA 4ZCLA 4QRHA 2QRZA 4XH9B 4DCSA 4YMSA 3GFPA 4IOKA 5HKKD 3VKHA 1Z07A 4B3FX 4D26A 4MRRA 5F98A 3CNNA 2FEMA 5E95A 1FQJA 1X3SA 4UXHA 1OKKA 3OIYA 4K8OA 4AG5A 2BCGY 4G3XA 4EPXA 3THWA 1UM8A 2ZSFA 2J5XA 3KJEA 1N5KA 4X8OA 3ZS9A 1G7CA 4IDOA 1VIYA 3H84A 1GVNB 2CJWB 2VHCA 4PPFA 4QGAA 1WA5A 2KE5A 4F93B 3ADCA 2C8VA 4B2LA 1LFDB 4ZIRA 1E2IA 1QHXA 2RKOA 5UKDA 3SZRA 3V4RA 3OHMA 3KQNA 4V0LA 2P6UA 2XXAA 4AD8A 4D25A 1R0XA 3LW7A 4OQXA 4JLOA 4OJQA 4S35A 5G3ZA 2J0SA 2ZE6A 4C0QC 1LS1A 3L0SA 4HZUB 3AGPA 5F9HA 3DOFA 1Q1EA 4LSGA 3RS5A 1IN4A 3SYNA 1GZSA 1Q44A 2C98A 3NH6A 3QJYA 4M1YA 3P27A 4IEIA 4LK2A 4B74A 1CIPA 4M1WA 4AURA 1R5OA 3K9LA 1FP6A 4XSHA 5JI2E 1B23P 3BB3A 4Q5IA 4C7OA 5E3HA 2HXYA 4EFNA 3ZD7A 2IYLD 4PC2A 4PZYA 1OFUX 2QMUA 3K8YA 4N0DA 5FTLA 2C9YA 4QJ3A 1CR4A 4IOJA 1E6CA 2LKDA 1HY3A 1OIVA 1XDBA 3WY9A 4PZZA 1A7JA 4DLUA 1H65A 1P9WA 1TL7C 2I3BA 5JLJA 3TRFA 3QPVA 4TL8A 1E79D 4MH0R 1E3MA 4LJYA 5LD2C 3W9YA 3GLIE 1FOEB 1XB2A 4A1FA 1F6BA 1IHUA 3EPJA 4Q9LA 4PHFA 3UKDA 4DLWA 2W00A 1N6OA 1Z0AA 2D74A 4G1UC 5L3QA 4DT1B 1NVVR 2OLKA 5BW8A 4B3XA 1N25A 4TMTA 3VR6A 4E09A 4LJ4A 1G8HA 2VF8A 4B2IA 2J0QA 2IXGA 4ACBA 1GRQA 2N46A 4MRVA 1YR9A 4RJLA 2PCLA 2AHOA 1ZNWA 4R9UC 2AFIE 5DN6D 1XZPA 3EA5A 3VTKA 3OESA 1TTTA 3THYB 4QBGB 4BLSA 4DIEA 4MYUA 1J7KA 2W2XA 1ZCBA 1AS2A 2OBNA 2QM7A 1IJFA 2UZIR 3EZ6A 2GWHA 2HF9A 2ZSDA 3HJNA 4ESVA 1F60A 2GCNA 1PZNA 3PITA 4JJZA 1G5PA 1MABB 2IYVA 2MMCA 1Q1ZA 4JZKA 5G40A 4ZKEA 3VHLB 4TYYA 2ERYA 2ZI9A 4V0OA 2SHKA 1Z6AA 2RB4A 5AJYA 4B43A 3GLGE 2OFXA 4B44A 4JMPA 1SVMA 1YHNA 2ZRHA 4XIGS 1NG1A 4B3DA 1DAMA 1K5DA 2QP9X 4AYWA 3I62A 1E9BA 4YC7A 2H57A 4N0EA 3CR8A 3KKQA 3THWB 1AIPA 2BIFA 2A5FA 3LFUA 4LX0A 3MWLA 4LYHA 1H8HD 4Q4HA 4GI7A 4RVCA 4OI1A 1P5ZB 5HPYB 1KY3A 1Z8FA 3GLIB 3MWKA 2OBMA 5KTYA 2EFGA 5KUTA 4DDUA 4IDQA 2R6DA 3MD0A 4AKGA 1DS6A 1OE0A 1NN1A 3KXKA 4JBXA 2BEKA 1OT3A 3HU2A 3K0AB 4CIDA 1QZXA 3L8ZA 3ZD6A 4Q02A 3CUEF 3SHWA 1GNRA 1ZW6A 1NMXA 3WMGA 2WZQA 3DVLA 3E1SA 3K0FB 1T4GA 1KI3A 1ZBDA 2OFOA 1G8PA 3TUIC 2CLDX 5IF9A 3RDPA 4EPRA 2JDIA 4PPNA 5AJZA 4C0SA 2UKDA 1EFCA 4ON9A 3WRXC 2F43A 4LI0A 1EWQA 4GMXA 1Z0KA 2JAQA 5LB2A 3GLFB 1E69A 1GL9B 5AJWA 3I8XA 3WXMA 4I81A 2FMXA 3AEZA 4P4UA 1KKLA 2QBYA 2CNWA 3LBHA 2GBLC 2ZUBA 1R0YA 3F3YA 4IVQA 2QE7A 3SN6A 1YZQA 4TMVA 4UXIA 4XWKA 4LPKA 1E9AA 1ELOA 4JLJA 3GFOA 1OB5A 3DHWC 2GNOA 4JT2A 5FPYA 4JYCA 4W7SA 3N2EA 3L8YA 2DR3A 1WF3A 2X2FA 3HWSA 1L4UA 3I73A 1T9HA 3NDPA 2BEJA 5LB4A 3GQBA 2ZJOA 4Q48A 4BZPA 2QA5A 5JS7A 5BYKA 4OHXA 4TWZA 2DY1A 2GDJA 4G5QA 1SXJD 1JPJA 2BBSA 1HE8B 1TQ6A 3RS2A 1TF2A 1KK2A 5EE0A 2J45A 2XTNA 1SKYE 3TNFA 1XU4A 1KDPA 2IW3A 2VSXA 2DFKB 3FE2A 1LF5A 4LV6A 2NTYC 2WPDD 1U0LA 4CZ2A 3MWJA 5EXPA 1BYUA 3B1ZA 1F2UB 3DO6A 5IDVA 4DLTA 4MITA 5B2ZA 1XP8A 5JEEA 2XNDD 3OIVA 3TAHA 2WWYA 4RSGA 4Q7LA 3CWZA 2WMOB 4Q1DA 2FV8A 3QVVA 2W0SA 2C9OA 1NMZA 1KO7A 2P0EA 2ZUDA 4PC6A 4BFUA 5JWHA 2FU5C 2O8BA 2AN9A 4JLVA 2FGKA 3B2EA 3Q72A 1WBDA 2EWWA 1PVOA 4FWTA 4ASUD 5JECA 1TQ2A 4MDFA 3A8TA 1JR6A 2ORWA 3OF5A 4QOSA 1QHYA 1ZCAA 2C77A 3T06B 2VLIA 4Q4HB 4RZ2A 3BXZA 1NI3A 4HLUC 4ARZB 5EP4A 3WYGA 4DDVA 4IDNA 2VSFA 2HJVA 4YXWD 2G88A 4YMWA 3LVQE 1AK2A 4LZZA 1C1YA 4WAUA 1JBKA 1EX7A 4EPYA 2QENA 1ZC3A 4PSAA 4R2IA 3X1YA 4FINA 2E1RA 3QKRB 1NMYA 3F8TA 4M9XA 3QXSA 2RMKA 3T1TA 1MKYA 4UNRA 1G6OA 1JB1A 4A0HA 1H8EA 1TU4A 5DE3A 1EFRA 5K8IA 2J0UB 2GXAA 4DDTA 2PH1A 3TVTA 3PENA 2PZEA 3KZ1E 2F9LA 4E5UA 1RJ9B 4KVAA 1SKYB 2P65A 4N1AA 4CDGA 3A4NA 4W5HA 2QMOA 5EE9A 4PHTA 2XITA 2ZJ2A 3FMOB 2FPKA 1DARA 4M1TA 2F43B 2ANBA 3RRYA 4NYIQ 4U02A 3D3QA 1BMFD 2QPTA 2R6AA 2VYFA 3T1VA 2YWFA 1OXUA 1ZM7A 2ZSEA 4POAA 5B57C 1VMAA 3RRNA 4Q4JA 2MSCB 4DCUA 4AI6A 4BLPA 4BEBA 2QBYB 3QXXA 4OKSA 1KNQA 2FWRA 3FMFA 4MGKR 4KITB 4CEJB 3Q8XB 4LHYA 4UJ5A 2IT1A 3BS4A 2BVNA 3FKSA 5CM8B 5EZ5A 2RGAA 4O3MA 2EYQA 3TIFA 1CRQA 1L2TA 1OJLA 3QKTA 3CW2A 2IYRA 2G1KA 2GEUA 2FZLA 2OUKA 2NGRA 2HT1A 1X1RA 2QM8A 2VTKA 3CR7A 1IBRA 3THXA 1WB9A 1P9RA 1P75A 3DMDA 3QXHA 1KI4A 3T5GA 5DI3A 1E2HA 3KUDA 3AVTA 5CDFA 1D2EA 2EU8A 3WNBA 4AG6A 1W0JD 2RGGA 1RRCA 1KMQA 1KDOA 4MQBA 1FTNA 2FPLA 2GAOA 2QQEA 5JHGB 1UADA 3AF0A 3QPUA 3I61A 1XTSA 3QNUA 3GPLA 1LB1B 5G3YA 2B7BA 2GESA 3NBFA 3TKLA 3UMFA 3EX7C 3MGCA 3CF2A 5SZKB 3GCGA 1UJ2A 4OHWA 4PPGA 2F1RA 1E0AA 1WDTA 1EG7A 2W0MA 1GP2A 4F7WA 4H1UA 1RRGA 3EXAA 3MLEA 2W6ID 3UIEA 3B82A 1Q21A 3ZQJA 1JECA 3ASZA 2GVDC 2FX3A 5HZHA 2ZE7A 3JZAA 1ZRHA 3FOZA 3NVAA 1CR0A 5AUQA 3I4LA 3WHLA 1MOZA 1U98A 4Q1CA 4ZCIA 4UKDA 2A9KA 2DYKA 2XOKD 3P1JA 1CU1A 4HLCA 1XCGB 4CW7A 1EGAA 2FH5B 1NP6A 2JLQA 1ZD1A 2ZRAA 2AWNA 4LJ9A 4JL5A 4LOAA 4RZUA 4URYR 1PJRA 4PFSA 5CB6A 1NNEA 1YZUA 2ZI6A 4TT3A 3QSYA 2JIZD 4GOKA 4PC7A 1IONA 2I4IA 3ND8A 4LJ8A 3TR0A 5CK5A 8OHMA 1RYHA 3E2IA 4LHWA 2JLWA 5EJEA 4UNSA 1TX4B 4PC3A 2BV3A 3IIMA 1CJVC 1U99A 2VA8A 4JLDA 1CJUC 3E70C 3AF4A 3I32A 1W4RA 1HT1E 3U4QA 1KMHB 3L0PA 3MMPA 1E1RA 3KUCA 4AC9A 5GJBA 3RRMA 4DSUA 2ZVQX 1P4SA 3I8SA 5CJPA 2RGBA 2Y8EA 1KO5A 4MGYR 2O8FA 4C0HA 2XSZA 4C2TA 4D4MA 4M9SA 3NDBB 4B3GA 4B71A 4WVFA 5KOYA 4URVR 4TQAA 1W5TA 4Q9IA 1X8LA 3WNDA 3SR0A 1J70A 1X8KA 4QBFA 4XVRA 5CLLA 1WMSA 2GILA 1Z6TA 2JJ1A 1Q1BA 1XNJA 2QPOA 3R9IA 3LVRE 1ONBA 2ZI3A 4DCVA 4F91B 3RS4A 2NG1A 3SNHA 3C41J 3EASA 1O3YA 2IS1A 2FSIA 3GJ3A 4LC0A 2JGNA 2HJGA 1C4OA 1OF1A 2ZRMA 4BPBA 2Z4SA 2ZVPX 5J4VA 2VRWA 4Q03A 2WKRA 4DSTA 2N1BA 3OIWA 1LV7A 5FOTA 5FUWA 4JBWA 4DSNA 1K8RA 4DLSA 1XXHE 2QAGC 3DKPA 5FTNA 3KX2A 2CL7X 1X6VA 3U3MA 1P2SA 4RFVA 2C9CA 3P32A 5JBQA 1JR3A 3MJHA 1KI7A 1SGWA 1SXJB 2ASEA 2Q3HA 3SHFA 2RHDA 2C5LA 2BM1A 3K9HA 1N6NA 2FJUA 4DUGD 2NOAA 4M1MA 5BYJA 4AKHA 2CVFA 4Q7KA 1N6LA 4BRWA 4B2PA 3C8UA 3QY0A 4JVSB 2IEZA 5JHHB 2VP9A 1TF7A 4KODA 2G77B 1I2MA 1S96A 4C0AC 3EIQA 4LRWA 3FVQA 2CK3D 1VCNA 4DDWA 3OE7A 3CRVA 3AKEA 1OH5A 1E2GA 2DWPA 2J9RA 1G19A 2GXQA 1G21E 3IIJA 4DKXA 5KYKA 4AWXA 2ODBA 2QP3A 1T91A 1R8SA 3EZ2A 4JLBA 3C16C 3TUJC 4QFMA 1GFIA 4E07A 1T6NA 4QHYA 2QMEA 1NBMD 2N42A 4F92B 1NG9A 1P7CA 1YR7A 2F9MA 3K0CC 4B33A 2ZE5A 4GOJA 3ASYA 1SHKA 4YMTA 2W6JD 4BE7B 3IO5A 1XMIA 4F4IA 1R0WA 3CPHA 2EWVA 2IYQA 1FMLA 1AKYA 2J59A 4TMWA 4AIIA 2IK8A 4RCYA 4YLGA 2JLSA 4Q47A 2CJWA 3NC0C 4IEEA 4Q19A 4JIMA 3QG1A 4XD7D 2ONKA 2OBLA 4PHHA 1GRRA 5JS8A 2NO1A 1GRNA 2CEAA 4CEHB 4AKIA 1E2PA 2HUPA 3CO5A 3EA0A 3U4QB 5FL7A 3QBTA 3CM0A 5SZJA 3QXCA 3O8DA 4QBIA 3SEAA 3VNUA 3VAAA 3CBQA 4OHVA 4BECA 3ZZ0A 4BFZA 3CZQA 3WMEA 1G16A 2GVZC 3AVOA 1E98A 3EPKA 3IDQA 2GTPA 2VP6A 3K53A 2O8FB 1M1YE 4GFDA 2PX0A 3ZH9B 1W4AA 4M1OA 2OM2A 3TGPA 3U44B 2NO0A 2ZANA 4JVLA 1UEJA 3LA6A 2XGJA 4OQNA 1XCPA 3B78A 2RGCA 1CR2A 1N5IA 3KXIA 1MT0A 4KYUA 4LV5B 4NYJR 4QGGA 4URZR 4MRNA 2IL1A 3GEHA 3CKLA 1TNDA 3AVYA 3W3ZB 2C96A 1QVRA 2IF0A 2DHRA 2Q21A 2XTZA
chains in the Genus database with same CATH superfamily
5GTDA 2LKCA 1O08A 2V8BA 3R0IA 1P2GA 1AC5A 2WFZA 3K9GA 5F21A 3EUEA 1LZLA 1ECLA 1MUUA 2B92A 3IBTA 3PQCA 3UTDA 3VPXA 3KBBA 3GCWA 1KVSA 4CQJA 2WR8A 4HK4A 2FUG1 1KY2A 4HQFA 4DEVA 4YUZA 4KR3A 3KPVA 1W96A 2H8KA 4EO7A 2AH5A 2ZP1A 5D3ZA 2I22A 1BOOA 2NSHA 3N6XA 1Z7GA 4KQ1A 2DBZA 1WDWB 1TA4A 4B83A 4DT1A 1U0GA 3I1FA 3ICEA 2GQ0A 4BS9A 4A6PA 1J07A 5KAMA 1ZYUA 3CUUA 5EOVA 4D9GA 5CTJA 4MUEA 3IXLA 4S04A 5FV4A 1JKJA 1BQ3A 1P0FA 1IB0A 1VECA 2ZK7A 3L1IA 2PUEA 2CHGA 1R4NA 2PQMA 3F5DA 4EI9A 1DQRA 2UYQA 3AINA 3TSWA 1W76A 2OO7A 2Y93A 3A04A 5KREA 3J81k 3PD1A 2P7HA 1YZYA 3SM9A 2VXOA 1UBKS 4I1SA 4H0FA 3A10A 4LSMA 5C52B 2I7VA 5IDWA 4OF4A 3QBJA 2OVBA 4JUDX 2OAGA 4R7GA 1ZFNA 4L85A 2I1QA 3DZFA 3WL5A 2HU5A 5CBPA 1TM7E 4Y0NA 3MHPA 1W46A 5J5VA 3MTAA 1FXWA 1Z34A 4S2UA 5FOVA 2VYQA 3V7UA 1LI5A 2PFGA 2J7PA 3WGIA 1W1WA 4DRZA 2GO1A 1R27A 3HVHA 3GLHE 3RV4A 4CIXA 2JB9A 5IUJC 1NAHA 2W6MA 4K1LA 4PZEA 3DXFA 1JEQB 2VF7A 3V1KA 4IG9A 1EXMA 4XJXA 1IY2A 3IAEA 1P6UA 4AMGA 4QXOA 3S99A 1EXWA 1A8HA 3KOZA 5CA0B 3EXHA 1CXZA 1RYMA 2QUKA 1E1YA 4IFIA 5A6VA 4R2LA 2UZ0A 4LCBA 4QBKA 1GKUB 5CFMA 3RV3A 1SXPA 2Z2YA 1U6IA 3WGNA 5LXTF 4BNGA 2P1ZA 3S1SA 1QO0A 4Z4QA 4Y1FA 2Q6VA 1V8OA 1SVKA 2VPQA 4GMHA 1IK6A 5A4MS 3V1UA 3DE0X 1M1XB 2GBGA 2PZFA 4QUDA 1NXQA 1CUYA 1MJGM 2F3PA 2Q3JA 2V6IA 3DBOB 3I2HA 3K0AA 4II2A 3BRWD 5HQJA 2Q3MA 1FF9A 4MR7B 1JE0A 1R6UA 4A27A 1SVWA 1Y8RB 3IUYA 3A4IA 3L0OA 1FSSA 2ENWA 5DBEX 3SIRA 4NPAA 1E2LA 1X9GA 1Q0TA 1MH9A 2VWPA 3RSCA 1PDVA 2DRIA 4K9QA 5IMSA 1NFQA 2MR5A 4TZ6A 3ETDA 3OTWA 1WU8A 3UK6A 1H4VB 3FUUA 4R2KA 2P8SA 3EWAA 5TXGA 1HH4A 2HSEA 3T35A 1G7RA 4Q3AA 1QDLB 2DUJA 3ER8A 3MWDB 4MV4A 3GA0A 3OEHA 3DMTC 1CJCA 1OX4A 4KWIA 4P6VF 2FW7A 1OWNA 4GYKA 3GLFA 1E18A 3UV7A 3EIHA 1NBME 4CMBA 2RGXA 4DV0B 6Q21A 1XPRA 2R86A 5TDHA 2HY7A 2E4ZA 3DLIA 3ESXA 3FPEA 5DYTA 3H0CA 5WRFA 3W8NA 5IG2A 5KKAA 3SQXA 3VJKA 5H9VA 1ZVKA 4JXZA 2V7WA 1EUZA 3MCTA 3ABSB 3O3NB 1CVIA 1WVGA 3JR7A 3E15A 1UXIA 4BY9E 2ZRKA 5KQSA 2IKQA 3I9KA 5JFGA 1PJZA 1M8GA 4RZHA 3ZDCA 3G0HA 1E7WA 3U60B 3QY9A 5AICA 2VNSA 3X43A 2CUZA 1R16A 2C61A 3UJNA 3L9XA 1Q1GA 4ZCTA 3F67A 2H4HA 3QPBA 2IPLA 3SI7A 3A3PA 4KRYA 2QSZA 3JSXA 2R4TA 4EB0A 1RXYA 3BVPA 1GAXA 2NO9A 2YYAA 3GAMA 4H2DA 4Y6OA 1PTKA 1JQAA 2ZS9A 3E9NA 5T6BA 4BHTA 1WXFA 2FEPA 2OV1A 3OAAA 1E2MA 2II6A 1YA4A 5ADHA 2G7ZA 2R6R1 4FYPA 1YDGA 3DE5X 3ZJ4A 4MDEA 4RD3A 1XA0A 3BIFA 4D4IA 1WCYA 1CUDA 3MINB 1N0UA 4WXHA 3ZWDA 2WOJA 1RCTE 1YQQA 5IANA 5JEDA 1IJKA 2ES4A 4UBMA 1EA5A 5A0FA 1AXRA 2AMLA 2IV7A 5KNCD 2H08A 3OQHA 1P7PA 5CMLA 5LA6A 2W7TA 5KQMA 1KMMA 4TZ0A 3I9V6 4ME6A 4AP9A 1NV8A 1ZO8A 1FPQA 2I0FA 3D3WA 3EW7A 3VSEA 1LZKA 1Z0FA 4J8PA 1DEHA 1A9RA 4B0PA 4N82A 4W4TA 3HP4A 4PO3X 2R4QA 2JD0A 3DB1A 3EAFA 5TF4A 4F72A 3VC1A 3L06A 3PFHA 1Z35A 1D9XA 1MH1A 1Z6ZA 1IOVA 3K5HA 5BSUA 5AUOB 3S8YA 4YT4A 4EYKA 1W94A 3W5CA 1S6YA 3WLRA 1IQ0A 3E03A 2X0IA 1B2LA 3EGDB 3IX7A 5BSWA 4B5KA 3EMKA 1KZGB 1WB6A 3EZFA 5K6AA 4CXMA 2Q0SA 2VHWA 2WVJA 4DWWA 1WIWA 4KFUA 2Q45A 3ENWA 1DEKA 1PQYA 1Z88A 2C9MA 2KPOA 4LDZA 4R9RA 1GSIA 1DKLA 3N86A 1P0IA 1WCWA 3EJ6A 4ZTBA 5TNXA 1N9KA 3AY7A 1MAVA 1G66A 1OAOC 3BZBA 3UMSA 2FMKA 5JADA 1K3TA 1ZGAA 1A95A 4Z0PA 5K4HA 3UW3A 1DWQA 4N5NA 3SQNA 3LVBA 621PA 1DIRA 1H2AS 3RARA 4F5ZA 1OWOA 3GEPA 3IUQA 3NGXA 3IR7A 2ANCA 2XBUA 1XEWY 4PIMA 5L3SB 4TLEA 3AUYA 3TZBA 4CPDA 4KQ2A 3U7HB 4ZYYA 1DKOA 3AVWA 1I3MA 4Z4HA 3P2IA 4OI0A 3HI6A 4QPNA 1QO9A 2V3CC 2OZVA 3V4PB 1E2UA 4HQKA 4GRIA 3NWBA 2HMUA 5TARA 4KFRA 4DA7A 2D59A 4PLWA 1KJIA 4EX7A 1THZA 3Q9LA 2B83A 4QU9A 3LQFA 3LYHA 3WZMA 1HG1A 2PPLA 5EFZA 3OIFA 2ZDQA 1WRBA 4MLZA 1BVHA 4V1CI 4RIEA 4RJJA 3TDKA 1JXOA 4YRMA 1ZMTA 4L9SA 3A2MA 2ONJA 1S2GA 3BJEA 3F6RA 3GOHA 1N57A 1WZCA 2X77A 2YUTA 1U2EA 1Q1QA 1GKIA 1TK3A 1I30A 1R0RE 4GLLA 1PR9A 2GZHA 2ZZKA 3HRKA 4B85A 4X3PA 1T5BA 1JFFB 2C95A 2HCFA 2ZAGA 4DWVA 1KP9A 2PAFA 3TL3A 1KYYA 4RDIA 4Y6GB 1QHHA 1ZD5A 3LCCA 1XEFA 3IKMB 3MMSA 4WOCA 3UPDA 3ZKAA 1EVJA 5FL3A 3RABA 3K15A 2C31A 1MEJA 1Y4DE 4QHTA 2OQVA 3GZTB 2LDXA 3EQ8A 4H6PA 4IG4A 1O57A 1N9ZA 2BKUA 4P4SB 3ZE6A 4DAOA 1KC3A 1LSUA 4CMGA 2G70A 1DBRA 4P81A 1BE8A 4Q05A 4DIMA 1GNVA 3K6RA 3T1OA 3FLAA 3EFOB 3UM9A 4MYTA 1HDIA 1O6FA 4KXWA 1N3BA 4M38A 4DJJA 1D4AA 1V8FA 3LBYA 1V43A 4M6WA 1EXNA 4MS4A 4PCVA 3ZJTA 2EJCA 3CC8A 4OKNA 4D9KA 1YZ3A 1IEXA 3AHIA 3DUFA 3OTOB 4P33A 3RODA 4C76A 1T9GS 5IT4A 1RM5A 1Y3BE 3IHKA 2NNLD 2V7QD 4KMMA 2DPMA 3H2IA 4EL0A 3L43A 4HLUA 1MIOA 4BKMA 1K6JA 1YC2A 3KPWA 4RZSA 3W78A 2J85A 1W0CA 2ODAA 3LIPA 3PCRB 5EUBA 3DEIA 5DLQC 8ATCA 3F4LA 1T1RA 1PR2A 3DOEA 4M8KA 2OKGA 4WNIA 1D1TA 4LF7B 1DPGA 5EVCA 1J5EB 2VQ6A 2AKYA 4JELA 3FAZA 4TTAA 1UK8A 1X7YB 4D3FA 3HCFA 3BXEA 2QV0A 3R3UA 1VM6A 1E4YA 2AMFA 3SZLA 5KDOA 1W88A 2Y68A 1C0EA 4X66B 3GOQA 4LWOA 4HRAA 4X3CA 4XUCA 5JARA 3OZEA 3BUSA 3BK2A 4ZMRA 3Q40A 3GI1A 1W36D 5EG5A 1M67A 4EDFA 3S4YA 3LCRA 3WSWA 3VVBA 3ZWOA 2OYSA 5IC4A 4DDKA 3LU1A 3IHTA 5IDXA 4H31A 1U28A 1P72A 2REQB 4WDRA 5F77A 3X0DA 5C4MA 2CNOA 1W9HA 1OWMA 3E5HA 1TCAA 2VJYA 3KKKA 2E5FA 5DBHX 5BW6B 3SBEA 4I1VA 4CKEB 3CUTA 1RLMA 4I2VA 4R81A 1L9KA 4BL5A 5B5SA 4KU4A 4O1HA 4P7KA 5JO0A 4YGXB 5CUQA 4ZANA 3R20A 5B1YA 5FPKA 1T8PA 3EIUA 3KQKA 1U8EA 3CNBA 4RVUA 4B84A 1FW6A 2MT9A 3DE6X 1YMUA 1JJ7A 1VE6A 1WUTA 2WV7A 4FOOA 5CURA 5AVVA 1SKUA 3GPBA 4ZEMA 1K7EB 1XWFA 4MLPA 3CTPA 1O77A 4P7FA 4BTEA 4ND1A 5EJ6A 4I0WB 4LRXA 4NHOA 1D8TA 2PWAA 4KI0A 4URXR 1OI3A 3C6MA 4CIBA 4QVGA 1I51A 3Q6NA 3OCWA 3INNA 4PN7A 2HFKA 1HT0A 3STHA 3T4UA 1H66A 1U5CA 4MDYA 2HD4A 2RIRA 2IPAB 2YVUA 2C7RA 1I0LA 3NW9A 1XR3A 2GJAA 2JI9A 4GKKB 1I5EA 3OC0A 1ZOSA 1ZIDA 3WSVA 1Q0LA 3ABIA 5ARCA 4U7WA 2P4UA 4O29A 3JQ8B 1W4LA 3OJCA 1VGVA 3PVCA 1AKRA 1Z0IA 1TJPB 1PHRA 1GSAA 1UODA 3O2NA 4OY3A 4RLFA 1VBFA 3HO1A 1FFWA 1ENOA 1HORA 1XP5A 5M7EA 4EY5A 1CCWA 1S8FA 1WEKA 2C2MA 1X1EA 2EFJA 5EHGA 3SF8A 4EEXA 5BMVA 1KQGA 2RGEA 1JEOA 2V6FA 4LCJA 2OSVA 1NW7A 2Z56A 2ZSIA 4DA4A 1WL8A 4JGIA 1XNRB 3OC6A 3OQNA 3HDGA 1L4BA 3TH5A 1HQCA 1POXA 3QF4B 3VU9B 4FS8A 1QHHB 2Q6LA 4ARSA 3LYLA 1TK9A 4GM4A 4W7HA 1GPLA 2XV1A 3N1UA 3VH4A 2IH5A 3ELYA 3ETLA 3D5TA 4TOIA 2R7AA 3RS0A 1RI3A 1GRCA 1A4UA 3MGGA 4QGHA 1G4HA 5A3RA 1XD8A 5J43A 5K8TA 3ROPA 1WTCA 4EECA 2GJKA 1EFVA 1M6VB 2UZ3A 3EYAA 4URFA 3V8EA 3V34A 3PHLA 1SEPA 1C9KA 2VAMA 4A2QA 1YFKA 3DXZA 4OYLA 5JH7B 5D3KA 1H93A 1E58A 5AW5A 3UMGA 4P54A 1VCIA 4MWEA 3C5WP 3PPVA 1TYZA 5ILQA 3FFTA 2RHGB 2H06A 2NXNA 3X2SA 1VRCA 1R2QA 2CUNA 4M0MA 5TPZD 3U48A 1N78A 1ZVMA 4K5QA 4B3BA 3G2JA 1C4XA 1GG5A 1Z0DA 1P7WA 1D1PA 3ZZMA 1EFTA 2ETVA 3UYKA 2CLIB 3R3YA 5G0VA 3K6SA 2R2GA 4E2YA 1E9RA 2DQZA 4DLAA 5KEIA 4BMPB 3GLQA 2AOXA 4L76A 5FHQA 3AESA 1FVFA 1V25A 3SIPA 3AHGA 4WOKA 4F96A 4B3RB 3PG5A 3I1YA 3QFCA 4Q3BA 5FPPA 2FPIA 4CKBB 5BW4A 4WT7A 1IZ7A 1MX1A 3KEOA 4TN5A 3FPKA 4W8OA 4D9BA 4CTOA 4X65B 1YJBA 1NJGA 3EIEA 3TZ6A 4AAYA 1MC1A 3C15C 4YTEA 3TS1A 5F52A 5KNBD 2W6CX 1YF3A 3A9WA 4DIKA 4ZVLA 1N6HA 2P4EA 3BSSA 3QUSA 2GCOB 4R9VA 4Q1BA 4NYJQ 2QTAA 3RLFA 1VE9A 4QODA 5AW3A 1B16A 3IV6A 4KX5A 3JYOA 5CLHA 1FSFA 4MWBA 2WYIA 1RYEA 4XGRA 4I50F 1B3BA 3IVCA 4IL5A 3VX4A 1X15A 3ZN2A 1FTYA 5C8XA 1M2NA 1Y98A 4ECEA 8GPBA 1LQTA 1C7EA 2E55A 2P9HA 2VHQA 2YHIA 5AK3A 4NG5A 1KYWA 1UC9A 4ZFNA 4EJ6A 1ISJA 3ZDQA 1BO6A 2YZGA 2HDOA 4G0PA 1M7BA 3U5TA 5JVDF 2R2AA 5H70A 4CMEC 1VDMA 3UCEA 3ZS8A 3WQBA 1TOAA 3OPQA 3EGEA 3WKEA 4AROA 1LDNA 3CZAA 2Q6KA 3R74A 1T3LA 4KWEA 4QXAA 1G291 2PXAA 2XCUA 3KXDA 2RH9B 1W4ZA 3O8QB 7YASA 1AZSC 1QE3A 2BMVA 5F51A 3ZCTA 3OCJA 4FHCA 1NQTA 1Y6RA 4N3NA 4DIUA 1MJNA 2OOSA 4L16A 2X1HA 5DN9A 5ALUA 1LBTA 5AKJA 4UTPA 7ABPA 2P75A 5EE1A 4ZEOA 3TR5A 1TTHA 1JJVA 2XHEA 3CCFA 3EY9A 5TX7A 4IQ0A 3PL1A 3R23A 1DT3A 4MWSA 5FI1B 3AVXA 2AC2A 2EKZA 2QB5A 3ZIUA 1KR5A 3QPDA 1C0PA 3BFVA 1GGNA 2A92A 5JYDA 4C6RA 1S2DA 2P3QA 2FFHA 1GKKA 4J9VA 1UL1X 2QTGA 1UP4A 1TVEA 1N36B 4KN9S 3B85A 1JX6A 4BNZA 3T3EA 3FCYA 3L8HA 4W82A 4C3VA 4WUTA 2WIJA 2CDBA 3FI9A 3A4VA 4F3TA 1BKSB 3IP5A 3KJXA 3K9NA 3PQ8A 4ZGBA 3GEMA 3MFYA 2PZGA 5B2EA 2IQ5A 1GNQA 1C8BA 3AY0A 4G85A 4MUAA 4NZMA 3CPEA 5D2CA 4RW0A 3VZSA 3A6ZA 1ODJA 1V5GA 3DWIA 4YQEA 3ZGZA 4B4UA 1W4CA 1RRCA 5HFJA 1AK9A 2VNHA 5AWFC 2PKEA 4MV9A 1WCV1 1G55A 3FHTA 4FZ3A 1QPBA 3AETA 1X9IA 3X1XA 3FBWA 5E6UB 5MN5A 4K3UA 3ZVRA 1MOQA 2PO5A 2DR0A 3NXSA 4BKPA 1DQYA 3VDQA 1UDCA 1QFZA 1YZGA 3IUNA 3PE6A 4YCAA 2ZR7A 1CDEA 3MS7A 5GV8A 3QEKA 1H2RS 5ELLA 1M3SA 4WNAB 5IVDA 1YBHA 1GD1O 2GF9A 3BXHA 4G1MB 4TYPA 3W9UA 4HS4A 2VWQA 4QXMA 1YR8A 2M9MA 4FIDA 5D1HA 2FZWA 2PX5A 1KH2A 3HXPA 5C1OA 2EKDA 3KWLA 3WNVA 5J4KA 2OL4A 2EJBA 3LTNC 3QVOA 2YWEA 4QBHA 2G0NA 1RYNA 2J46A 3OZAA 4U1RA 4WIAA 2GAFA 1I1OA 4BFWA 2PR7A 1QRUA 2AZMA 1BRMA 3L7OA 1UOEA 3OE1A 3E0XA 3PV0A 4BQFA 1BQEA 2P68A 4JLWA 1AGPA 1JLSA 4PYNA 3UXEA 4M0CA 1C4WA 2A57A 2KWIA 3IVGA 4ESHA 5IULC 2IX3A 3HLYA 1T29A 5EP3A 1HEIA 1ZUWA 4KB5A 2X0EA 1ZN9A 3CE6A 1M66A 3KYDB 2YFYA 1YVPA 5BR1A 5B12A 3U3RA 4LBWA 5C5CA 5M5BA 2RB5A 3TLYA 5CNMA 2A7XA 2G6BA 2JGAA 3HA2A 3LFHA 3PSHA 3E82A 3QKIA 3K5PA 3CH6A 4G24A 4B3TB 4WEQA 3JD4A 5DXAA 3HKCA 3P8ZA 3V8NA 2IPOA 5L7TA 3KG2A 4ND3A 2MCFA 1VL8A 5B1IA 1TT5B 3EVZA 1XEXB 1NJFA 4FMDF 1GN9A 4U7TB 4BU1A 1LWNA 2FPMA 3C6YA 2GBIA 1O95D 3T4PA 1Q22A 3C3XA 3QVUA 2BMWA 3DYVA 3ESDA 5HRUA 5CA1F 3D0OA 1JR3E 1YQGA 1LLFA 2GBPA 5ARBA 3SLGA 4WK0B 3JQRA 5FAXA 1YB5A 1RNLA 4MWZA 1YDFA 3OZBA 2PFKA 4UE2A 2P2NA 1A96A 3A9RA 1VYUA 2OV6A 1V35A 1J8MF 3ITEA 4ROTA 1B8PA 5AVOA 3TRKA 3RADC 3ZW8A 2C3OA 4JK3A 3Q41A 4GXRA 4KHZA 4F3RA 3OPYI 1B15A 3QX8A 1U2PA 1JWBB 3G5TA 4JB0A 3WK7A 5B7NA 3LBNA 4ZD6A 3M33A 5J5CA 4JBNA 1XQVA 1CUGA 2OOKA 2ZBDA 3HUUA 5LXTA 3WL8A 1XNHA 2C29D 3UBTA 2VNJA 2CFSA 1XMPA 3DG9A 3O8OA 1EGHA 4HEJA 3VR1A 5CAEA 5MN6A 4HWGA 3LKZA 2POCA 3VI3B 3VMMA 2KX7A 3T3DA 4I1PA 1DKNA 1MFZA 1T3SA 3MQFA 2WHYA 3RE1A 1I33A 4Y6LA 3WP1B 3DFKA 4IRMA 4WASA 5KVVA 1FDUA 2DHCA 2UXBB 1RBMA 5EJGA 1IXKA 4F46A 3SYRA 2AJBA 3VR5D 2FWMX 4DLVA 4G0WA 2VL7A 1L5OA 2FA9A 4I9UA 1L7AA 2KLHA 3IRVA 2PUCA 1R66A 4EG5A 1JSCA 4KVGA 1UXOA 4P0QB 4G5FA 3K9CA 4YHBA 3C85A 1SXHA 121PA 4JQCA 1USUA 3KDAA 3R7SA 1E2KA 2DHDA 3ZHBA 4JGBA 4UEKA 5LP1A 4KQ6A 4DM4A 2XBMA 1ENZA 1RHKA 1H69A 1XTUA 2H48A 2ODEA 3C4JA 3DD5A 5IH3A 3G2KA 4HEA6 4DLPA 3O47A 1WPGA 4FZRA 4R8SA 2ZRGA 1FX0A 3MC1A 4GR9A 4TVSA 3AQIA 1I4TD 4XYGA 1M8KA 3IP9A 5KU1A 2HZ7A 3OHSX 3KL4A 1TE2A 3W0LB 1ML3A 1U4OA 5JPCA 1JXMA 2VC2B 2Z1DA 2FMIA 4CLRA 3QA3E 4AO7A 4HPXB 4DC1A 3WOHA 3LWDA 3R0QA 1WCXA 1TCCA 4WWHA 1UJCA 1VJ5A 3LS2A 1SULA 4RIHA 2XT6A 3OKCA 2PYZA 3SC2A 5B3JC 4US2R 2QORA 4ISBA 5LYJA 1DUVG 3EBOA 1LBHA 3SF0A 5JC8A 3ZLVA 1VA5A 4PCAA 3FMIA 4L8YA 3T61A 1BXZA 2Q2WA 1ORTA 1T0HB 1F38A 3I2IA 2YYZA 4PN3A 4G5GA 2ZRJA 3AB8A 3RVRA 1X1QA 1MO6A 3R6GA 3TXYA 4CDMA 4J0QA 1Z8DA 1FFYA 1DDIA 3TE6A 4BZWA 1T5LA 3IODA 4MWTA 3TSOA 1RWPA 3O0TA 4QWMA 3I4FA 4HLNA 2HYDA 4TSKA 1IDOA 1AKMA 4QJBA 3C98A 1FVOA 3B1FA 4OSEA 2CZCA 2HMWA 4D79A 1C7FA 3BB1A 4FZJA 4XD7A 5F76A 3MELA 4DMCA 4OI2A 3QLUA 4C4XA 4E5YA 4XWOA 5ELMA 3VKVA 2HWWA 4L4SA 4PLHA 3UHFA 4XFKA 1QGUB 5AVRA 2H07A 2GKGA 3A37A 4N3CA 5IJWA 1G8SA 4MWCA 3NASA 2OC9A 3PFNA 1ZPDA 1NVEA 1HKUA 1G4UR 4MVYA 4OXNA 2GN4A 1X1AA 1VDZA 4BLRA 4ZDIA 3I5AA 2VQEB 4ETMA 5K2OA 3OM1A 3BQNB 1UINA 5B37A 1NTRA 5LZ2A 4J16A 2HCRA 3LH5A 5BNIA 4F1JA 2YV1A 4H7DA 3IPCA 1P29A 4PX5A 3KVVA 1UPXA 4AS2A 4BAUA 3N8NA 2A0XA 3BMXA 3HCDA 3TOVA 3IMFA 5LFAA 2Q07A 3JQBA 3AM1A 5D51S 1T5IA 1NASA 5SY9A 1JIXA 2FE1A 3VPAA 1GCGA 3NX4A 1LPMA 1AUOA 3PF9A 1BMDA 4ALLA 5BN3B 2BI7A 2XUJA 4N0PA 3RKUA 1Z6PA 4N40A 1OFGA 1WLYA 3C6XA 3WLSA 4B2YA 4D6XA 1HX7A 1RBYA 4HAYA 5DM4A 5HTKA 1HZZC 2E2WA 5HKAA 1CYEA 1PNQA 4OMUA 5CAEB 4EB6A 2QUHA 1GXSA 1YQXA 2YV2A 5FA8A 5IC5A 5J58A 1N92A 3ANSA 1J49A 2JA1A 3G17A 2Q4RA 2QPLA 3LQQA 3TTSA 4AJ1A 3D3EA 4ER0A 1PI3A 4RTNA 2ZR9A 1O9BA 4RF3A 1EPUA 4KXFB 3HN6A 3B9PA 4DEXA 1RAFA 3PEUA 4ZO9A 1VG9B 2NSYA 3OMXA 2AZ4A 2XQVA 5FUYA 1ESNA 4ZT5A 1GITA 5AP9A 1QH9A 3VM6A 2ICAA 2PWYA 4BMXA 2HA6A 3I3OA 5F9FA 5DHAA 5GZ1A 3UK1A 2VFAA 1JDBC 2QL6A 1NV9A 1I1HA 1II8B 1NWHA 3O8BA 3PTAA 4IZOA 1R0SA 2F67A 4BQQA 2G3YA 4EY3A 5J4HA 2NYVA 3LD9A 4IFBA 3Q4GA 3JQGB 4GXNA 2Z2XA 2EDCA 1F3OA 3ZOKA 1P0QA 2OP0A 2P9QA 2OK7A 4D99A 3QBDA 1IE3A 3C8DA 4LZOA 3CCBA 1RE0A 4OHUA 2NP6A 3UHOA 5CH8A 1OFIA 2N9UA 3BMOA 5AK0A 5EERA 1USGA 2G82A 2W2QA 5EPUA 2IU4A 2IZ5A 2VPWA 4YP1A 3ZWCA 3I6QA 2YXLA 1A1SA 1DC5A 5I45A 4OFWA 2IGBA 2WNHA 5IU6A 1RHMA 1VE7A 3H4MA 4MCHA 1THTA 2A35A 4X1KB 4A6EA 1OVMA 2DWOA 3O84A 3RBVA 1WXXA 2D2VA 2I4LA 4TKVA 1L7QA 1JBQA 2WWIA 1R8YA 2YC2C 3I45A 5DNDA 3UMRA 5LYJB 3KR2A 1LFAA 1PGOA 4N3GA 3BTOA 1S7GA 1Y89A 2NZ8A 4E30A 4BE9A 1TLFA 4QVKA 3IAM6 2AKEA 2O48X 1MR3F 3H1AA 1LU9A 5ED0A 2OFWA 4QSMA 1GUBA 5AOBA 3T7EA 2GD0A 5DCUA 4LWQA 1SK9A 2GR9A 4U6SA 1HG0A 1IIRA 4NS1A 4NTZA 2WI8A 3IQDB 3OOJA 4OD0A 3PC2A 4NY1A 4DM3A 4FX2A 4PGMA 4Y30A 3URKA 3W79A 3H5AA 2P2YA 5FUQA 1BKYA 1YJ5A 3A2KA 4YECA 4D81A 3S8EA 2DCMA 3MN1A 2VJDA 1W4BA 1N0VC 4PV7A 4XGQA 4ZEVA 3I23A 4X60A 1U2RA 4NIMA 4OJYA 2X0JA 1YVDA 1UBHS 4DABA 4R0NA 3P9NA 4M9ZA 3ZWYA 4TX1A 2JG3A 4BB5A 1AM4D 3H8SA 1Q7GA 1HLGA 5BQ5A 3TZCA 1DXQA 3JY6A 4DYVA 4ZJZA 4HI0E 4RV4A 1S3GA 4X1IB 3VJLA 3H3XA 2C57A 3IHWA 3K0KA 4U7GA 3SOPA 4DWOA 4ZHSA 3KJGA 5MGBA 4KR7A 2C0QA 4WESA 1XLTA 3NIBA 1TMOA 4MXDA 5DXFA 3ABZA 3R77A 2OCAA 1GM5A 1FMJA 3AIOA 4M4SA 4ZIRB 1SVOA 4NCJA 4U00A 1YR3A 4C08A 1PGPA 3V3TA 1H6AA 1W34A 2PRYA 3NTLA 3C3EA 1H8ED 2HNAA 2XXAB 4HDMA 5ALOA 4E12A 3VZQA 1H22A 2PXCA 3DE4X 3EGXB 3CMCO 3JD2A 2OCPA 3K4QA 1BVYF 1FP7A 1GGVA 2W2LD 5DWQA 1E96A 5C7OO 2IXDA 5EIAA 1JG6A 3I30X 4DA9A 4OTZA 2IGTA 2PKQO 4H0CA 4MYCA 4Q9NA 1OZGA 2IPNA 3HZOA 3HP7A 1OLXA 5DP2A 5FJJA 1PUJA 2YJZA 1U0OC 2AZDA 1RI4A 1DELA 1GXSB 2FTKE 1CS4C 3F46A 4NF2A 1OHHA 5BP7A 1UPAA 5C81A 1JSLA 3FY4A 3A0UA 3IAS1 2WF8A 1JHMA 1XZCA 4HFNA 1OR8A 3LKBA 5IWCA 3N0RA 1TIPA 1OPRA 3UWMA 5JANA 1GCOA 1Y9DA 4KXLA 1Q0UA 1XTPA 4RY2A 2CKDA 3F2IA 3S40A 2PFSA 3ZU3A 1ZONA 2QW0X 3LT1A 1ZXBA 4BQSA 1MF7A 4TL9A 2BUBA 4JJ8A 4US1R 1H2XA 4L22A 5KO2A 2BC9A 1UXKA 1Z8NA 2PH5A 3KPUA 4MW0A 5DASA 5DJ5A 5AKLA 4CV0A 3QLJA 4YA6A 2ID7A 1FDVA 1Z39A 2YDYA 5ALYA 3NFYA 1EEHA 2EBHX 2Y1XA 1OTXA 3L7JA 4ETWA 1AGRA 2ECQA 4UVDA 1LRKA 2IPMA 2VZLA 4U3JA 1V1RA 1XTIA 1O8CA 3JVUA 3CX3A 5EAIA 4CFSA 5FLEX 1N2ZA 1EM6A 3HXTA 1CS0A 3E9QA 3QVLA 4F9GA 1TAUA 2AJTA 3DEHA 4TXHA 1PX0A 3W8FA 4IDEA 1EFPA 3NM6B 1RMTA 4PXSA 1A7KA 4UREA 5LQNA 4D9NA 2PKQP 5CG2A 2A59A 2PJRA 1DAFA 1TA0A 3TZEA 2CNDA 4LF4B 4M9UA 2L82A 2O0KA 1QE0A 4U6NA 5HF6A 3W2FA 3WAKA 2F3QA 1ZH6A 1P7YA 3HWRA 3WQHA 4O02B 5EIOA 3VSBA 3ASVA 2OLEA 4FHEA 4I5EA 4L74A 5T57A 3Q3VA 1K8ZB 1RWWA 1Y3DE 3DZGA 4NKRA 3NH9A 4JT4A 1TK2A 1BAPA 4OXIA 3TDNA 3GT4A 4OB8A 1P45A 3ZLTA 2OHVA 3M0EA 3IQWA 2O7QA 3GZ4A 2G09A 2Y99A 3U7GA 3K20A 3E5RA 2CGEA 4OP3A 3ENQA 3ZHSA 4D9EA 1UMKA 3PYMA 3QKSA 1FFSA 4B4KA 4ZI2A 2REBA 4FXOA 3LMKA 4FCWA 4E88A 5IXYA 5L8VA 1NXWA 1I7SB 3L05A 3USCS 1RPNA 3G9XA 3BMNA 2BI4A 1Y7TA 5KX5A 1F1JA 2NSJA 1L7NA 2D2XA 1QF9A 3T7CA 1XMJA 3RU7A 3CVUA 4BJ1A 3Q9SA 4I14A 4I3FA 2EATA 4P34A 1TM3E 5G41A 2AIRA 2C2GA 2LV8A 3COYA 4MMYB 3FROA 1JGTA 3MWFA 3BGVA 5F4BA 5GADl 4TV8B 1X38A 4JKOA 5CH5A 1LW7A 4UNQA 5T64A 1N77A 2C84A 3T3IA 3SP1A 3TLEA 4C6TA 4DCNA 2VHJA 5TMDA 2YV4A 5ULLA 2NO6A 1SC6A 1JU9A 2XRZA 4E2WA 1E2BA 3L1JA 1SZJG 2H17A 1FW8A 2LPMA 3RWMB 3TBKA 1EJ0A 3ZUPA 1SKQA 4D4JA 3ESCA 4FCCA 4BJ5A 1T9AA 2XKKA 4P31A 4CYMA 1NI5A 4IYJA 4FMCB 3I6MA 3QXJA 2Q3FA 3UG6A 1R4AA 3RH0A 5K0JA 3FLBA 2FPRA 2MYUA 5AM0A 1L4YA 1YSCA 2M6LA 4RKQA 3OQBA 3W5AA 4KLAA 1HQYE 2WUWE 1C0KA 3ZZTA 2R62A 5LLTA 1P1CA 2ZAYA 3AK4A 2X0DA 2WIBA 2XDWA 2Q9CA 4UC0A 3GFFA 5AW1A 1ICIA 3NR2A 1PL6A 2HMTA 3LDAA 2RI0A 3RRZA 3BL6A 3TGWA 4ZJUA 5J4YA 1Q91A 2R0QC 5KC9A 5IVIA 4BP3A 4GSLA 3DR5A 3OY7A 2XJ4A 2YHAA 4OH1A 4D0RA 4I50A 4M8SA 2P41A 3AL0C 1V3TA 3WMRA 1MW9X 4IO0A 3QWFA 3OWOA 1OT5A 2G6TA 2GA8A 4QQKA 2XD9A 2K5UA 2VJOA 1ZIOA 2BFBB 1QV9A 3RSOA 5JVDA 3WWOA 4QQNA 4FDLA 1N5JA 2Q3EA 1EVYA 1LRJA 1YI0A 3BL5A 3HY6A 3UMVA 2HA4A 4HC4A 2O59A 5KNLA 1D6JA 4FX5A 4KJZA 3JV7A 3MRTA 2C3YA 2CCGA 2A9RA 1V1RB 3UGQA 2XWBF 1XD9A 3RUIA 3GQBB 4LJRA 1WLSA 3FOBA 2FQQA 4QNRA 5EPOA 1YIDA 1NDUA 3MJFA 1Y7LA 3Q11A 4RX1A 3KC2A 4YMIA 3HMQA 4EVSA 2G5TA 1DBIA 1AXEA 2EQAA 1W49A 2G8LA 5DISB 4F4CA 4YJ3A 2X5OA 1NU8A 3AKCA 1LDMA 2Q7XA 1NNLA 1T5TA 5I4KA 2V9CA 4NU8X 1MEOA 3V8QA 5KQGA 1N1DA 5AIBA 1CQZA 3F73A 1ORIA 2ZUTA 4I4TA 2XT9A 1TQHA 2CYBA 2WHXA 4RNCA 1JG2A 2GD2A 2VRBA 4TSFA 2DERA 1T24A 2A2ZA 1M2FA 1CBUA 3ND5A 2WKWA 4RE6A 5D5PA 1QYWA 3FNEA 1XLVA 2HPAA 3IRUA 2EHDA 2GRJA 4RDHA 1JT2A 4M99A 4JYBA 4JL6A 1FTSA 1NN5A 2ZSAA 1GQYA 4PCLA 3B6IA 3UXMA 2O5RA 5BUZA 2WOOA 1E6MA 3QLVC 4FTWA 2O8DA 3QKSB 2XAUA 3DKVA 1YDHA 3IBGA 3F90A 4MEJA 3NOVA 2B8NA 4YR7A 3FCOA 1V1MA 5LU8A 5KX5B 2J3IA 2PLFA 2P90A 3L1VA 1II9A 2FK8A 4FOSA 5AUNB 4XIYA 4KXQA 2C8LA 2P6MA 1IJBA 1D5CA 3E5MA 2GH1A 4L28A 4N39A 3SEFA 4RLQA 2PZAA 2FOIA 2HKIA 2DECA 3D4LA 3JD0A 1MIHA 4F2WA 1ZC4A 2Y67A 5JZBA 2JLVA 4F84A 3AM5A 1Y9ZA 4XX0B 2GYYA 2X23A 1NXPA 3LX5A 4Y9SA 4WJKB 3K9WA 1KZ1A 1CP2A 2JI6A 2B82A 3SZOA 5CDFE 3TRJA 5CK4A 2A1UA 4TLDA 2CVQA 3KLNA 5GOTA 3DDZX 3TL2A 4KO4S 2QRQA 2I4TA 1U63A 4OJNA 5LUAA 2X19A 2RC6A 1EWVA 3B51X 3G7NA 3GJ6A 4RXMA 5FL7D 4BIIA 5C51B 4K2HA 4MQFA 4L4ZA 4P3YA 2CXQA 5F3WB 4X6LA 2CMDA 3Q6MA 5AKZA 3NWPA 3IB3A 1BE1A 2QQ5A 1VCHA 2COEA 2H5EA 3L82B 3OIUA 3QVTA 3SE0A 1PP4A 2XB9A 3MT0A 4YMLA 3IS3A 2O5EA 3DVRX 2KYRA 5T8KC 3GVPA 7MHTA 2ACVA 4IOMA 1FYDA 1G21A 1NXOA 2VK4A 1X74A 3RJMA 2ZUSA 3L7LA 2V7EA 2ZB3A 4BUCA 1U5AA 4FDVA 1DG9A 3LI2A 1GTSA 3K92A 3KJFA 3ZV4A 4E6PA 1CTQA 1XAJA 5A9SA 2EZTA 1YZHA 1BN7A 3UFXB 2WJVA 2A78A 4CHTA 1Y7IA 4K86A 2FXIA 3WGMA 3MBOA 3IAHA 2EERA 3N2IA 3PQ4A 2WF9A 1WKVA 1Z08A 3OCUA 3Q7PA 1WD7A 4AJKA 3J80A 3P4XA 4CM8A 1KI1A 3KE9A 5IAOA 1SEVA 3M6XA 3T7SA 2NMVA 4Y7CA 1FUUA 4MRSA 2HHJA 4C3ZA 4CF6A 5CA1A 2HHHB 1O5OA 1FSGA 2AJ8A 2VPYA 1QKKA 4QSHA 2GBCA 5I7HA 3QPAA 3GFSA 5LJIA 1ZKDA 2V0NA 1XD2A 1RRMA 2VT2A 4J