1KDTA

Cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
223
structure length
223
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sugar specificity of bacterial CMP kinases as revealed by crystal structures and mutagenesis of Escherichia coli enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords CYTIDYLATE KINASE
total genus 78
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2001-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kdtA00
2QEQA 4CDGA 5J4KA 2VHTA 4A9AA 1GDDA 1IAQA 4TL9A 2RMKA 1ZD8A 4XWAA 2F43B 2ODBA 4A36A 3I61A 2OFOA 5HZKA 3MWKA 3GLIA 1QRAA 5F2EA 1DADA 4M53A 4PR0A 1P3JA 5KTYA 4HLQB 1BS1A 1AGPA 5H68A 3CPEA 3GMTA 3BK7A 4NZYA 5C4GB 2OE2A 1OXTA 3NH9A 4TYPA 1E79D 1CKEA 2V6IA 2WWGA 4PZYA 2IXGA 2F55A 3L8YA 3JVVA 3ZQ6A 2HDNB 3B1WA 3BD9A 1WE2A 4RZXA 4BECA 4HLUC 3NEYA 1GTVA 2NPIA 1CP2A 1BKDR 3FB4A 3OEEA 2ZSBA 1SXJC 2HCBA 4BUJA 1JPJA 5FL7A 2QAGB 2ZRMA 1F2UB 3DMDA 4HEJA 1GL6A 1YZNA 1SKYB 3F3YA 2O8CB 3PXGA 2VSFA 4XOIA 2ZAOA 4OQXA 2VHCA 4DSTA 3ASYA 3TR0A 2IYUA 2QGZA 1ZU5A 3BH0A 3HP1A 4UNRA 5IT5A 4BPBA 1Z06A 2BMEA 4F38A 1SKQA 2B7CA 1NBMA 3V00A 1S0UA 2F43A 1G6OA 3B6EA 2R65A 1LB1B 1ZC3A 1X8LA 4LBWA 2IS2A 2ORVA 2PL3A 4NPHA 4TTRA 2O52A 4Q18A 4KSCA 3L2OB 2ZRHA 3THWA 2XXAA 3SFZA 1MO5A 2ZI6A 2EW1A 1U90A 1COWD 1W5TA 4NH0A 5HTKA 4LV5B 2KJQA 3AV0B 1Q20A 2HT1A 1F2TA 3KB1A 1LVGA 3CF2A 4GDFA 1KI6B 4OHXA 3W8RA 3O8CA 1FW6A 4TLBA 4RY2A 3HJNA 1A2BA 2FSIA 2ZPTX 3GLHA 4ZIRA 4WXRA 2ZYUX 3CH4B 1Y63A 1AS2A 3M4YA 5BN5A 2J59A 4LRWA 2EWVA 1HQYE 1XCMA 2CDNA 3TUJC 5EJEA 2GEVA 3QKUA 4IFBA 4H1VA 1SQ5A 1D2EA 4O2RA 4LSGA 5BN3A 2RGBA 4Q03A 3SZRA 2QE7D 3DVLA 1A1VA 3AVOA 3RC3A 1QVAA 4PAMA 2CLCX 5SZJA 3RSOA 3BC1A 4ZDJA 3LO5A 2HXSA 4Q1AA 4TL6A 1PLKA 5FH9A 4AY2A 4F4JA 1HQCA 5DLQC 1R6BX 4YQFA 1OXSC 3X2SA 4FI3C 3FKQA 2HF8A 3VKHA 2F1RA 3BWDD 1E0JA 3ZS8A 4Q9IA 4W9MC 3GFPA 3LY5A 3EZ6A 3B9QA 4JBWA 4DCNA 4ACAA 5FBLB 1P2VA 1ZNZA 3K0EA 1MT0A 2NMVA 4LOAA 2LWIA 4Z54A 2UVQA 4CW7A 3A37A 2IEYA 1ZUNB 2FEOA 2OEPA 4OHVA 2OXRA 2J45A 1IM2A 5BXQC 2A7QA 5EP3A 5FOTA 1NLZA 3SJCA 3SQWA 1Z0DA 1E96A 2ZYTX 1OH5A 4PC1A 1HTWA 2RGCA 2WOOA 2JCSA 1Z29A 3DM5A 3T5GA 4CVNA 2FU5C 1CU1A 1XD9A 2D06A 2ZIAA 3LA6A 2JJ1A 1G7TA 2D2FA 3H1TA 4B2IA 5L3QA 2ZE8A 5L3RA 1E2NA 2W2XA 2QRNA 4C3ZA 5ELXA 4B47A 1RYFA 4Y0AA 1RC8A 4PQFA 1OFHA 1ZNXA 3TAUA 1ETUA 4R2HA 1J8YF 2VIIA 1KNXA 5DNYB 1WB9A 2W6JA 1BO6A 4JT2A 1FX0B 2IYWA 3PJRA 2HXYA 2JJ8A 4D6PA 4JKIA 1EFTA 5B64A 2N46A 1E9DA 4WA7A 3FMIA 4TQAA 5KHOC 3EPKA 4EDHA 2WWXA 3A8TA 2DPXA 5A0FA 4EPYA 2W58A 3W6OA 4RZ3A 2ZRFA 2H17A 4XTRA 2I1VB 2PLFA 3GLGA 1G18A 1P2TA 4BLPA 1GKUB 3KTAA 1AIPA 2MSDB 1KI1A 4TMKA 3BIFA 3MFYA 4V0LA 4Q4AA 3QKRB 3CBQA 4ZCLA 1H8HD 3K09C 2FMXA 4M9QA 4LUCA 4AKIA 2CHVA 1XWIA 3DOFA 2AHOA 4OQNA 5EUQB 3FKSD 2R44A 3C41J 1W4BA 3ADBA 5JFGA 4B76A 4WBSA 3X1YA 2F9LA 2Q3MA 4URVR 3QPWA 4RD0A 4OYHA 3BRWD 3F8TA 3EG5A 4A2QA 2RGGA 1A5TA 2DWPA 3MWJA 2H16A 4OK3A 5C2JB 821PA 3ECCA 2Q6TA 3K0FA 2OCPA 3D7MA 3RS4A 1S1MA 1NMZA 1CR1A 4DLTA 3PQCA 2JLXA 4LJYA 1G16A 3CIOA 4II7A 2ZITA 1XMJA 1Z6AA 4P4UA 2JJ2D 4XSHA 1F48A 1XZQA 2Y8EA 4B43A 3G82C 5J47A 2OCYC 4EFLA 1KDPA 1ZNYA 3CRQA 2BEJA 3AF3A 1SHZA 4HATA 4Z8YA 4Q7JB 1SVSA 1XEFA 2H57A 2ZETA 1GAJA 3AVWA 1IY2A 1E2FA 3PEWA 3KQNA 1KI8A 4KFUA 4BFUA 2A5YB 5JEEA 4UKDA 2G88A 4KCGA 2CCJA 5TVKA 1UM8A 4CT4B 2GCOA 4Q9KA 3KFXA 3QVUA 3KL4A 4BLOA 3CZPA 1RRGA 2QPOA 3U4QB 2R6AA 2YVUA 5CDFA 1CULC 5AJYA 1W0JD 3EC1A 4D4JA 2W00A 2ZEJA 2PT7A 3AVPA 1W4CA 5FBWB 3TUZC 4D81A 2PJRA 4QXAA 1GRRA 4HUQA 3RYTC 2W6IA 2VP6A 2ZYWX 4R98A 1ZU4A 3P20A 4DDUA 2QE7A 3DL0A 1W0KA 4HB2A 4DDWA 1JQJC 2XOKA 4MKHA 3QXCA 1M74A 1OFIA 2H7VA 4AIIA 4JLJA 1K8RA 4G5RA 2WOJA 1A82A 4P4SB 4F4IA 4OI4A 1TADA 4GOXA 1XTRA 4RJLA 1E98A 2WJIA 1UEJA 2DYKA 1U94A 3OEED 4OBEA 2Q3HA 4TZ0A 1FFHA 5J4YA 4NBSA 1Z5ZA 1ZM3A 5JHGB 4NYJQ 2HYDA 1IY1A 1VCIA 4TMWA 1W47A 3W90A 4BLRA 3GLIE 4MRRA 1QG2A 1KYIA 3I5XA 1FMJA 4QG7A 1XRJA 5BN4A 1FNMA 2CLSA 1NF3A 1RRFA 4Q4JB 1L2TA 3QF7A 3V4FA 1L7VC 1KO1A 5FR2A 2ZREA 3EA0A 3RLFA 3W34A 2CL6X 2QAGC 3UANA 1QHGA 4MGKR 3MGCA 3NG1A 5IRCD 2LKDA 1FUKA 2QMEA 1U99A 2EFGA 2X1VA 3BB1A 2H92A 4TQUS 3R9XA 1KHTA 2CJWA 1Z83A 1UEIA 4F91B 1LV7A 4DC9A 4PANA 1Q21A 5F98A 3OE7A 3UG6A 4BFSA 3U6KA 4WZBE 4LV8B 3ZVRA 3CPHA 3VX3A 1XJ0A 3E5HA 1M1YE 2XX3A 3EZ9A 5CM8B 1QZXA 1KJZA 2DFTA 5LPNA 3SBDA 4PHGA 5AUPB 4PFSA 2GCNA 1OT3A 2XITA 4FCVA 4JL8A 1JJVA 4MGZR 1W36B 1MRSA 4B73A 4M0LA 3CWZA 1X8JA 2GJ9A 3FVQA 3M1IA 1GL7A 1Z6XA 3WYAA 2ZSDA 4GP6A 2XZOA 4HZUB 4DT1A 5CDFE 2JDID 2KSQA 4RD4A 2C2HA 4MGYR 4MRSA 3K0CC 4QBGB 2DWQA 1GNQA 1D6JA 4L9SA 3FWYA 5BYKA 1YR8A 2FOLA 4CF7A 2FGJA 1CRQA 5JRZA 1Q22A 2IYQA 5J4LA 1N6NA 3MWLA 3HYRA 2JEOA 1KSJA 1QHHA 4BGDA 5DI9A 5FOXA 1OFUX 1CS4C 4ESVA 3VHLB 1M7BA 2IC5A 1ESNA 2JAQA 5D3MB 4O3MA 4AKEA 2OILA 4TL8A 2Z0MA 4PZLA 5EXXA 3RSLA 1XFAA 4QRHA 1XDBA 1NN1A 4BZQA 1Z3IX 2WWHA 3GLGE 1G3MA 5FUYA 5FTMA 3CX8A 1E9RA 2ZS7A 4I1UA 3R20A 4OHZA 3O47A 2NG1A 4D4MA 1PLJA 4XD7A 2BKUA 1D8TA 4NCHA 5GJCA 1ZW6A 1DE0A 4JYCA 5J4VA 2WAYA 2IW3A 2ZRPA 5FL7D 1P4SA 4QOSA 4GI7A 2A5FA 5TB5A 4NYMQ 4MRNA 1TF5A 4TTPA 5FUWA 3UMRA 5CLLA 1XF9A 4LBZA 2F6RA 1ONBA 1XZPA 2V54A 2XXAB 1H8HA 2A9KA 3X1DA 4A2PA 3RABA 3AF2A 3LVQE 4A8JC 2LKCA 4PPGA 4Q02A 2A5GA 1G5RA 4QHTA 5CIQA 2V3CC 2FSHA 3QOFA 2V1UA 5EP4A 5DI3B 5C1BA 2GTPA 1CLUA 1US8A 3KQUA 1E4YA 1ZC4A 1WCV1 4EPXA 1W1WA 2WWWA 5EUMA 4PPFA 1XEWY 1V43A 4P33A 1DELA 5KNBA 4LJAA 1FQKA 3ZD7A 3W5JA 4B3CA 1U8ZA 2EVWX 4GP7A 1OIWA 2DCUA 4LDJA 1T3SA 3I92A 4LX0A 3TW8B 2GDJA 5B58C 4V0KA 5HKKD 2D3WA 3IHWA 3DHWC 1KMHA 3IHLA 3LXXA 1Q57A 2J7PD 2SHKA 3PFIA 3SNHA 3U3MA 1ZUIA 2OBMA 4A15A 2ZRGA 3EZFA 3FMFA 4MITA 4JVNA 1RW4A 2O0HA 1KDTA 4YXWA 4OJKA 3U61B 4IVQA 3OAAA 5FL3A 2RGNC 5DHFA 2P6NA 1W0KD 1TQ4A 5HE8A 1G5TA 4QJ3A 1OXVA 3K0CA 4V0OA 3SHFA 2QU8A 5E95A 4B75A 1GRQA 1FX0A 4K8OA 2D7CA 4C0JA 2VHJA 1LS1A 4HSEA 4LJ8A 4V0ME 5D3MA 3B13B 4E07A 1XPOA 4QM7A 2QMUA 4FMDF 3T12A 1F5NA 5FPYA 1SXJE 4I1OA 1QHNA 1BH2A 4C30A 4QBHA 2CVHA 3WRXC 4EPRA 3TGPA 4OI0A 2REBA 4KFSA 1N5JA 2GESA 5BW8A 1PUIA 5FOSA 5DHAA 1MOZA 4PC6A 1G7CA 1XD2A 4R7ZA 5AK0A 5BYJA 4JJZA 1G21E 3LWNA 1UF9A 1FTSA 2R6CA 5DYIA 3EXAA 1KZ7B 3KXIA 4WAUA 5DN6D 1W46A 3VKGA 2RHMA 3VAAA 3K70D 1A2KC 3UPUA 4DCSA 5UKDA 3PR1A 1AZTA 1NJFA 4AYWA 1TQDA 4M8NE 1Z47A 2VF7A 1KGDA 3GEHA 4QGAA 2JIZD 3EZ2A 1Q1ZA 4EPWA 3KKPA 4PQRA 3QG1A 2AFHE 4PPNA 3ND9A 3OE7D 1VHTA 3CR7A 4Z8XA 3QUSA 5AJVB 3ZD6A 3ICEA 4LYAA 5AUQA 2RCNA 3DKVA 2BCGY 121PA 2GCPA 2BBOA 1M34E 3B1YA 4OK5A 621PA 2QP4A 4Q01A 2XB4A 2CCGA 4KLZA 1Z28A 4IHQA 3K9LA 1GP2A 2VP2A 2ZJ2A 3GLHB 4NONA 5L3VA 1DAMA 2V4ZA 5J40A 4ACBA 3KB2A 3WP0A 1NBME 2WVJA 3R7WB 2BC9A 1SXJD 3I72A 2MSCB 2IL1A 2ZRJA 4URUR 2NZJA 5JZVA 1CJMA 4Q21A 2ZJOA 3I8XA 1XCPA 4M4SA 1VG1A 2PT5A 1EGAA 4RD3A 4TMVA 4ESHA 2AN9A 3PEYA 2XNDA 3W3ZB 3QQ5A 3U60B 1UFQA 2PEYA 3UMSA 4K46A 1KI9A 2F1HA 2F3TA 1GKYA 3AF0A 3Q7QA 3RRYA 1AS3A 1IOZA 1BYIA 2ZI3A 4WXPA 1E2MA 1EXMA 2J0VA 2G83A 4K81B 2V8OA 3GJXC 1EK0A 3P27A 1QVRA 4ZI3A 5SZIA 2ECKA 2FFBA 4C0AC 4DT1B 1XD8A 5IK2D 2PZEA 2RGDA 4AURA 1JR6A 4UQOA 4M1SA 1G3IA 1S9DA 2ZJ5A 2CNWD 2E9SA 4TSFD 4ZCIA 1X6VA 2GILA 3T06B 3PEUA 4KVAA 1E9CA 4RZ2A 4D4KA 3VU9B 2CLDX 1O87A 1DTSA 3PIRA 2WWYA 1E2JA 1UPTA 3EPLA 1XB2A 2BV3A 1E94E 1R0WA 4GZLA 4URZR 3ZH9B 2VP9A 4GZMA 5LDDC 1WF3A 2JDIA 2OHFA 4ZKDA 2GF9A 5FUXA 1G5PA 4DIEA 1E9FA 4WVFA 3B85A 2KB0A 1XPUA 1JNYA 3P4XA 3VR4A 2PMKA 3QBTA 3NDPA 1OIXA 1KKLA 3CR8A 4PAOA 1P7CA 1G8HA 2HEIA 3LW8A 4A0GA 2RGAA 2CL0X 1E2EA 2QTFA 3G5UA 3AEZA 1G3RA 5KNCA 2WM9B 3T61A 1L4UA 3SBEA 3UXMA 2BJWA 3KZ1E 3OZXA 4XD7D 1NLYA 3TVDA 3QY0A 4TZ6A 1C9KA 1UBCA 3THXB 1YHNA 4JL6A 3GFTA 3UWKA 5CM9C 4ZO4A 4IRUB 4TT3A 3PUYA 1VYVA 5FFMA 1ZAKA 1WBBA 1DO2A 2R6DA 3BAFA 5A5GA 3ICQB 1FPMA 2O8EB 1G19A 1NN3A 5H8WA 1N5LA 2R9VA 1SHKA 1S4QA 4GNKA 5JRJA 1OB2A 3WMEA 3I8SA 3THOA 3AUYA 1MO4A 4R71A 4I1VA 2GBLA 4NKRA 4TYQA 4EUNA 1OXXK 3IUYA 3EPJA 1D9ZA 1LW7A 3K9HA 5FPKA 5AJWA 1MV5A 1YZUA 2CE2X 2ZSEA 1GVNB 3IO5A 3UKDA 3GJ7A 1Q1EA 5JCZA 1NLFA 1E2QA 2BMDA 4C0BA 4CZ2A 1WQ1R 4DSUA 2ZXUA 2XB2A 4JSTA 2FWRA 2ZJAA 2NPFA 1W5SA 4J0QA 5AWFC 2OXCA 1KIMA 3MAAC 3QXJA 2OAQ1 1KJYA 2V55B 2FZ4A 2XNDD 3DM9B 3GLGB 2RGXA 3O8BA 4TLEA 3NC0C 4BFYA 2EYQA 2W0MA 4TLDA 4F92B 4BFWA 4D0NA 1JXMA 2HJVA 2YJTD 4JSYA 3LRPA 4C4PA 2O8BB 1VYTA 2AD5A 2FFHA 4JLNA 2AKAB 5HE9A 2QMHA 1K5DA 1EX6A 1DEKA 4PHTA 4RFVA 4Q1CA 3EPHA 4NE2A 3I73A 3GD7A 3SN6A 2QMOA 2UKDA 3EIHA 2VLIA 3MRSA 1R7RA 4G5SA 4O0MA 8OHMA 4DZZA 4WZAE 1U0JA 1N0VC 3LBHA 5HZHA 2GBLC 4TN1A 2Z4RA 2WIAA 3TSZA 1YZTA 1ZM4A 4X8LA 2P5TB 4FIDA 1SVMA 5E7MA 3KKOA 1KO5A 4ASUD 5J4HA 2VA8A 5DYGA 1YR6A 2GAOA 2UZ3A 5JECA 5K8UA 3GFOA 3THYA 1LF5A 2QTVB 2ZRBA 3QEJA 4KSBA 3QVVA 1GZSA 2OSBA 3Q85A 2C9YA 1HUQA 1ZIPA 4N0EA 3PCRB 4A6PA 4WZ6A 3DPUA 3VR6A 4AWXA 5HPYB 4YMVA 2NZ8A 1XMIA 2WPDD 4N1AA 3ETLA 4Q4HB 5JS8A 3U7FB 3B78A 3P26A 1H8EA 1NMYA 2VBCA 3WY9A 2ZJBA 4C0LA 5HKKA 1E79A 1P62B 1JPNA 3L43A 3IQWA 3SJZA 2IBMA 2O8EA 2IWHA 2VEDA 3ADDA 4MDFA 3VNVA 2A3RA 2Q21A 4BASA 3RS7A 3EX7C 5EE1A 3FHOA 4TSFA 2QAGA 4ZV4A 3KKMA 5EXPA 1KTVA 3BH7A 4MGIR 1NVVQ 3OAAD 1RRPA 3AP2A 4NTZA 3NC1C 4R2IA 4MKIA 3HPQA 4IOMA 4P4TA 4PO1A 5EP1A 4N0DA 5KYKA 2VL7A 3AGPA 3U3RA 1FNNA 1QG4A 1Z08A 4Q1EA 4E03A 1JALA 4TYWA 2CHQA 4RCZA 1KDRA 4KITB 4CEJA 3ZIAA 3IGFA 5JWOA 3CM0A 1SVOA 3NKVA 4Q7LA 4LPKA 4BFXA 5K8LA 1CR4A 1L4YA 4DUGA 2BIFA 3L0PA 5CLQA 3K8YA 2D4HA 2ZI5A 4CYMA 1OF1A 4RVCA 2QT0A 4GMDA 3CNOA 3C15C 3ASZA 3I1FA 2ZRCA 2D7DA 2GHIA 2P5SA 3T1QA 3JZAA 1T4GA 2WMOB 3B82A 4G5GA 4OI2A 3GJ0A 4XSGA 3GEEA 4FWTA 1T0HB 2XEXA 3NBZC 4QKQA 3WMGA 2A78A 2WHXA 3VQTA 3ZZ0A 2ERXA 5FOVA 1IY0A 3SI7A 5AJZA 1TEXA 4DDTA 5FUVA 3TLXA 1G1MA 1OHHA 1OJLA 3LX8A 4O2LA 3W9YA 1Z63A 1QHYA 2O0JA 3KQLA 3IBGA 4DKXA 1NRJB 1US8B 1Z07A 4B34A 1U98A 3A1WA 4M9ZA 3OIYA 1XX6A 3RVBA 1HH4A 5EE9A 3FOZA 1W2HA 4L15A 5JWHA 3D6TB 3U3OA 1XTQA 1HT1E 2FFQA 2PCLA 1HY3A 4URYR 3SYLA 2CK3A 1W49A 4UNSA 2K5UA 3B1XA 3D3QA 1JI0A 2WTUA 3PUVA 2YINC 3BXZA 3I5YA 4CEIA 3NDBB 5KUTA 4BEJA 4TYYA 3K09A 4ZI2A 5TARA 4BRUA 4B2LA 3E1SA 1XBTA 2OT3B 1J2JA 2HLDA 2D62A 1H65A 2IYZA 4Q4AB 5DN6A 5E3HA 3K1JA 3RS2A 2YWGA 3BB3A 1TF2A 2N1BA 4CEHB 3TNFA 1DAFA 2FA9A 1ZVQA 5JMTA 3AKCA 4ERNA 5GADl 4PC2A 3EC2A 3B7GA 3NEJA 4E5UA 1AJEA 1H8ED 3U7GA 2AWNA 4NCIA 3RS5A 2GJ8A 3WNDA 4RFSA 5TDHA 2GXAA 2KWIA 1NI3A 3B2EA 1T5IA 5L3QB 1VCNA 4XVUA 1UKZA 2PBRA 3BFXA 3TH5A 3QENA 4US0R 3VR2A 3RANA 3DO6A 2QPAA 1E1RD 1CJUC 1WBDA 1N6OA 1IQPA 3KXKA 4HDOB 3SOPA 5JJKA 4AYXA 3OEHD 1GM5A 2ZVQX 3B60A 4C7OA 1FP7A 2FG5A 2CHGA 2R62A 3UIEA 2FDCA 4PC3A 4BWYA 3CNNA 2J46A 1T9HA 1DAKA 3LBIA 5L3SB 1TNDA 2ZQ5A 3B1ZA 2JJ1D 3RHFA 4PQYA 4C9BA 4QM6A 4IDOA 2Z6VA 3LQQA 1N5KA 2ERYA 5EE5B 1J7KA 3NHAA 1S8FA 4IDPA 1N6LA 1PVOA 3OFND 3VKWA 2XZPA 3RNLA 4W5HA 1Y3AA 4M1KA 1OFTA 1X3SA 2YWHA 1IN7A 3WNBA 3SR0A 4EFMA 1DO0A 5JHHB 2QP9X 2B8TA 3W6NA 3SHWA 3LH5A 1YR7A 5FOWA 1JQLB 1II8B 1GILA 3X1WA 1LNZA 2BM1A 4P31A 2L0XA 4H1UA 4MYHA 2IYRA 3MUFA 2WSSD 2IS6A 5IHPA 4OHWA 5JEDA 4F93B 4M1OA 1Z2AA 3U7HB 4CEHA 4X8OA 1JECA 1S9HA 1T91A 2G0TA 1UADA 2WJYA 4BEBA 3QBVA 3KUDA 4D25A 4M21A 2QQEA 3TMKA 1W7AA 1COWA 4AK9A 1TU4A 1VPLA 4YMWA 2CVFA 1KSFX 4DUGD 4GRAA 4A8JB 2XJ4A 1ZYUA 2WWIA 5EZ5A 3ADKA 2G1JA 3NWJA 1N5IA 3RRMA 3W5IA 4DDVA 2FH5B 3AVYA 4ZKEA 1W4RA 4W5WA 4B71A 2DB3A 4JS0A 2EU8A 4PO8A 1YZLA 3QKTA 2G3YA 1NVWQ 1T5LA 3SEAA 2XGJA 5KDLA 4A1FA 3VNUA 5DH9A 1DBSA 4PHHA 2RHDA 4OQFA 4YDSA 3KJEA 3ND8A 1Z2CA 5FPHA 4B3XA 4BFTA 4Z1MA 5K8TA 2CCKA 4U00A 4NYMR 4EIWA 2VH5R 1UBFA 2NO0A 4NCKA 4XVRA 2DR3A 3QJYA 4W5JA 1X1RA 1I2MA 4FCWA 1EG7A 2OLKA 3RS0A 3CWQA 3ZS9A 3PITA 1TU3A 3CKLA 4QL3A 4HAXA 5JSZA 4Z51A 2FF7A 1Z0FA 4YDHB 2ATXA 3CONA 2GZDA 5FTNA 1JXOA 3BH6A 5JLJA 4NU0A 2JLZA 3A4LA 1NKTA 5DSZA 4E09A 5DE3A 4UJ5A 2D2EA 5LBIA 1RIFA 1WDTA 4LJ7A 2ONKA 2F1IA 4IOLA 1Q1QA 2QTHA 1IXSB 4DWJA 1DG3A 4MKGA 1MO3A 3QNUA 3RWOA 4ASUA 2Z4SA 1NN0A 2DWOA 2QM7A 1B0UA 1DAIA 4AG6A 3ONWA 1FZQA 3TR5A 4MDEA 1I4DD 1HURA 3E2IA 3GPLA 1QHHB 1NKSA 1M2OB 3TSOA 1NP6A 1GFIA 2NGRA 1VECA 2WMNB 4TMZA 4B32A 1N6IA 1OE0A 2OFWA 2W83A 1UKVY 3PUZA 4JVSB 1YR9A 4AD8A 3A1TA 2X77A 4A0HA 4A82A 1OYYA 2GXSA 1Z0AA 4IXNA 3LX5A 3ZGXA 1ZNWA 4M2LA 1DAHA 1D9XA 3CRVA 2BMJA 4HLUA 1ESMA 1T3LA 4G1UC 4DXAA 5KSZA 1IXRC 1E2KA 1VKJA 4GOKA 2Q9CA 1M8PA 1HT2E 1VG0B 1T3HA 2VYFA 3VHXA 4DIDA 4DB4A 2XSZA 4JLMA 3K0FB 2P3SA 4IEEA 2ZI4A 2JASA 4EFNA 1MH1A 1OLOA 4LC1A 1RVDA 2RGEA 1R5BA 3D31A 4EKDA 4AI6A 4PAQA 1ZM2A 2A30A 2B8WA 2O8CA 3RC8A 1N0UA 2AKYA 2TMKA 3U3KA 3MSXA 3AVTA 3QPVA 1E1QA 1CTQA 4BZPA 3CF0A 3RS3A 3SDZA 1KK0A 1RZ3A 2OCAA 2WICA 4RZUA 4I99A 1II0A 3W6PA 1E4VA 2CK3D 1A7JA 5G40A 2HYIC 2QM8A 4Q47A 3KFVA 1W0JA 1GIAA 3CB4A 2RH5A 1G3QA 3IIKA 1AS0A 4JBYA 1KY2A 4PXAA 2B6HA 4LHWA 1XJCA 2ASEA 1NIPA 1KI7A 1Q0UA 5HR5A 1NSTA 4O25A 1P9RA 4OJQA 1OYWA 5DISB 2JJ2A 4ZIRB 4GL2A 4LYJA 4XIGS 5H1YA 2EFCB 3LFUA 4LWZA 2JLQA 4ARZA 1NMXA 3B8HA 3EWAA 1TTTA 1NVUQ 2J0UB 3AUXA 1E9EA 1N0WA 2JGNA 4Q4JA 4Q7MB 5EQTA 4A0RA 3MCAA 2ZR0A 3GJ4A 5KPJA 2C95A 4Q00A 3UATA 4M1TA 4LHXA 2IUTA 3IPYA 2CMKA 3N2EA 4YC7A 1F3OA 1RJ9A 3TSWA 1WXQA 4ON9A 4QBIA 1VCMA 2PX3A 4NYIQ 3IQXA 2CEAA 4EJSA 2ZUCA 3OF5A 5J5CA 2ODEA 3TKLA 1O3YA 2P65A 2ZS9A 1CRPA 3A1VA 3PUWA 1GKIA 3KQKA 4B6EA 4BLTA 4P4SA 2OAP1 4DJTA 2GK7A 2QN6A 2J3EA 4JT4A 1M7HA 4X8HA 4Z1MD 2X2FA 4QNRA 4Q66C 3KDSE 4RD1A 3IEUA 4FMDB 2NOAA 1J99A 5JI2E 4OI1A 3VFDA 2A5JA 1DPFA 2J9RA 1GG2A 1Z0IA 2B7BA 2OUKA 2XNSA 3OIVA 4NYIR 3RRNA 1F6BA 1R0XA 3EARA 4MRPA 3RDPA 2P0EA 2REXB 1P9WA 5G53C 3CUEF 5FTJA 3U4QA 2GJAA 3ZVMA 4CEJB 3CH5A 1P72A 5B57C 1CJVC 4UXJA 4CEIB 3FTQA 2BWJA 2VRWA 3K0AB 1Q3TA 2JLVA 2VTKA 4LV6A 3P1JA 4DSNA 1P60A 2AXPA 3OHMA 4Q7KA 5KNDA 1AKEA 2Q3FA 1FL9A 1NNEA 2Q0HA 1XXHE 4TYNA 2PX0A 5TY0A 1P75A 4MH0R 1KJWA 4BFVA 4B3FX 3U5ZB 1MRNA 2GRJA 4BLQA 2MSEB 1UAAA 3MJHA 4IOJA 1XEWX 4QFMA 3L82B 4Q4LA 3WBJA 3AKDA 3REFA 4OQLA 2QA5A 2CXXA 2IYVA 1HV8A 3OFNA 4B35A 5KU1A 1IN5A 3SJAA 2ANCA 2J5XA 2DHRA 4R9UC 4PSVA 1XU4A 4LHZA 3I62A 4TTQA 1E0AA 1KSHA 4MYCA 2KBFA 1CBUA 4JLVA 1CJKC 3A1SA 5FI1B 3QKRA 1ZM9A 4YXWD 4IVPA 2QI9C 1CXZA 4JBXA 4DLXA 1FQJA 2GK6A 4HLCA 5H70A 4B44A 1OH8A 3A4MA 4QBFA 5FTKA 2IYYA 4FCTA 4HAUA 4MA4A 2X2EA 2OO7A 1SXJA 2JLWA 3LVRE 1UKEA 2XTZA 1PV4A 4C2TA 2QBYA 1G17A 2JA1A 2BOVA 5ANRB 3R7WA 1OV4A 4M1WA 4QHSA 4BRWA 3T5DA 3NBYC 5SZHB 4NP6A 4D0GA 3SYNA 2I4IA 1AA9A 2AR7A 1E2IA 3B9PA 1EWQA 1TUIA 1S96A 3LNCA 2QENA 1KI6A 4HAYA 3GLFB 1C1YA 1HYQA 1JAIA 3DZ8A 1ZIOA 1KSGA 5IDVA 1U2RA 2VO1A 2QY9A 1W48A 3FFAA 2HF9A 1BOFA 1FMLA 4U5XA 4L16A 4Q1FA 3K53A 4OKSA 1NL3A 2GVZC 2G77B 3Q5EA 5KDDA 2F1JA 3BFKA 4FW9A 1QHXA 2OFXA 1SVLA 2YWFA 3ZLJA 2O8FB 1LY1A 4KXFB 1ZBDA 2HV8A 4US1R 2OLJA 5LD2C 1D2MA 3UWOA 4CT5A 3AVUA 1R10A 4AG5A 2BJVA 2C5LA 2Z83A 2C03A 4TWZA 4C7OB 3IILA 2ZRDA 2F7SA 3QIAA 5DI3A 3SYKA 2IXFA 2J87A 3MJRA 4ITRC 3VR1A 3TE6A 3WMFA 2YYZA 2R6GA 5FBQB 3TVTA 1NG1A 1R0YA 4LI0A 1CR2A 3K70C 3H0KA 4KO8A 4W7SA 3W8NA 4HUQB 4HUTA 1M7GA 3AF4A 3HR7A 2KI5A 2ZRAA 2ZR7A 4KVGA 1Q1BA 4YLGA 2IWRA 521PA 3AP3A 2QL6A 1D2NA 1XTSA 1E2PA 3MD0A 1QBKC 1HE8B 1CR0A 4HZIA 3C14C 3CF6R 3K0SA 2ZAMA 2RKOA 2O8DB 4FMBB 4BE7B 3V9PA 5KSYA 1UDXA 5EZ6B 5B2ZA 1K5GA 1Z8FA 1E9SA 1U9IC 5TV2A 3VMFA 1PZNA 2DFLA 5EP2A 1W36D 5G41A 1II8A 4URWR 4HAWA 1T6NA 1BMFD 2CJWB 2IF0A 3N70A 3IIJA 3EWSA 3ZQJA 1RRCA 3HR8A 3GEIA 1YZGA 4CRWB 1AQYA 5D3QA 1E1QD 1TX4B 2ORWA 3U2QA 5IK2A 5F9HA 1TPZA 3NBFA 1GWNA 4LK2A 4KAXA 1SXJB 2ZRNA 2CNWA 3NBXX 3GJ5A 3LLMA 2WKPA 4D82A 2IS1A 2FE4A 2IYXA 3Q8XB 4FWIB 2W0SA 4YMUA 3PUXA 4GMXA 2EWWA 3NVAA 4DEXA 2ZS8A 2Q9BA 2QQ0A 1OH6A 4U7DA 2G1KA 3L8ZA 2IK8A 5GJBA 3AP1A 5IF9A 4DB2A 2YZ2A 3QEOA 4DLZA 5LB4A 2IS4A 4EJSB 4OQMA 3SC3A 2WPDA 4S2EA 1YRAA 2F3RA 2OM2A 1HA3A 2JIZA 2VP5A 4IW3B 2YWEA 5E7IA 5K8IA 3U44A 3R9WA 1BYUA 2VQSA 3T1OA 4OHYA 2GWHA 4LYHA 4A0FA 2ZSFA 5CB8A 2Q9AA 3THXA 1PLLA 2JLSA 3PVSA 2C04A 1FOEB 4IDNA 3IO3A 1NY6A 2FPMA 2DFNA 1XTJA 3BFVA 2IYSA 4KLNA 2C98A 3U3JA 1YU9A 4JMPA 4KJZA 3Q9LA 3ADCA 3UG7A 4IOKA 3QPUA 1CJTC 3AKEA 1E0KA 2FNAA 2IF2A 2YOGA 4JVMA 3WHLA 2QNRA 3DEFA 4QHYA 3KJGA 3SS8A 4CGZA 4UNNA 3I32A 2BVNA 4HB0A 5F9FA 5E4FA 2OG2A 1N2CE 1PJRA 2WIBA 2NO6A 2BDTA 2X8AA 4Q9JA 2O5VA 5B30A 2W2TA 2BBTA 3FMPB 4H9GA 4CIDA 4QGGA 1N3BA 1U8YA 2R8RA 2ZI7A 4GSYA 2AK2A 3S1AA 1U8AA 2FV8A 2WBLC 5AUNB 3T35A 1GNPA 4C0QC 5CK4A 4TLAA 2QSZA 1ZCAA 4E22A 1XTIA 3GP8A 1ANKA 1XP8A 2WV9A 5E7JA 3DDCA 1OKKD 3Q5DA 1XTKA 5LB2A 5KDOA 4QNMA 2MMCA 4NCNA 3A6PC 2GA8A 4AYTA 4P0TA 1BMFA 3LAWA 1G64A 4G5QA 3AF1A 1UJ2A 1OSNA 1UKYA 1ZD1A 3PV0A 3QXSA 1XEXA 4URXR 1VG9B 3X1XA 2EFEB 4LJ6A 2ORIA 2DFKB 2GF0A 2H1LA 2E87A 2OZEA 4KFRA 5L8VA 4BLSA 3F0TA 4TMXA 2Z43A 1W36C 3TRFA 4EQ6B 2DY1A 4LC0A 4NL4H 5HCIA 1IONA 3CRMA 1TL7C 2VHUA 1KY3A 3FGNA 1VCOA 3WXMA 4MUAA 4AKHA 1J8MF 1KAOA 2MMGA 2ZJ8A 3HU2A 1G6HA 1KO7A 1DS6A 1NJGA 3FFBA 3H2YA 4NMMA 3R8FA 4U02A 2WJJA 4B2PA 1Z22A 3HDTA 4L4UA 3BOSA 1AM4D 2GKSA 2WJVA 2RAPA 1A4RA 3Q3JB 5EXSA 3TK1A 4JLBA 3THWB 1RYHA 1TUEA 4HI0E 1IN4A 1R5NA 3L0OA 1N6PA 2EQBA 3JZMA 4AC9A 5DGXA 4DSOA 5GVSA 1G4AE 3AM1A 4HAVA 4QJ4A 4XWOA 1FUUA 1E9BA 1TF7A 3R9IA 1XJQA 2XZLA 2P67A 1WA5A 1G8GA 1ZP6A 1F2TB 2WJHA 3LDAA 4A92A 3EIQA 4JL5A 3B5JA 2GEDA 5CJ2A 1EFUA 3CLVA 4JYBA 1XEXB 3QE0A 4KBFA 3HPRA 1IXZA 4HAZA 1YQTA 2ZSAA 3F5FA 4PSAA 2YOFA 2IHBA 2R2AA 1DOAA 1EFRD 2AK3A 4HZUA 1DARA 4LHYA 4P32A 4DHEA 2V7QA 2YV5A 1F60A 5TXGA 2P6UA 4PC7A 3BORA 2IT1A 1W2GA 1U0LA 1XMVA 4TLCA 2ODWA 1K6MA 2H5EA 4LJ9A 3T1TA 2VHQA 2VP0A 3ZIAD 4V0NA 1I4TD 1EWRA 4RFSB 1XD2B 4KFTA 4UJ3A 5GJWC 2IHYA 3GLFE 4JZKA 3GJ3A 3FHCB 3WHKA 2EFHB 2J0UA 5EXTA 2CBZA 1LS6A 1X86B 4IFEA 3L0IB 3KKNA 1EX7A 2ZROA 2XTMA 3OIWA 4D2IA 1E2DA 2ZJYA 3LD9A 2ZTSA 2XJ9A 4C0HA 1G8FA 1MO6A 1CF4A 3U6BA 4ZCMA 4NHOA 4JKYA 3EAQA 3O8RA 4X8MA 3NXSA 4FN5A 4XTCS 3DOEA 4I4LA 2GCOB 4HB4A 4LGMA 4MQBA 4RSGA 3ZVLA 1P5ZB 3TAHA 2OBNA 4Q1DA 2LCFA 1G3UA 1UBGA 4A2WA 2B21A 5JJLA 3C7KA 3SQXA 3L0SA 1VMAA 2OCBA 1VIAA 1SULA 1ZJ6A 3IKJA 3N5CA 2ZE7A 2QBYB 3FE2A 5FBRB 3REGA 1J90A 1XNJA 3A4NA 3H86A 1G9XA 2C9OA 1RE0A 4FINA 4DLSA 5HCNA 4WOPA 3VU9A 4D26A 4HDQB 4RD6A 1VDZA 3KJHA 3NIBA 5JSZB 1QHSA 1CEEA 2QAJA 3GLIB 3HWSA 4OL0A 1OHHD 4D80A 4LCBA 2H18A 1P61B 4LZZA 2PJZA 4RKEA 5EE3A 1N6HA 1R5OA 1HEIA 2ZYVX 3AVQA 3H4MA 2ZJZA 2CL7X 4NCJA 3O8DA 3BE4A 4M1YA 3QSYA 2GNOA 5FPTA 3OESA 4IJMA 1G4UR 3DZDA 4M22A 1RJ9B 4UNQA 2CE7A 4F4CA 4M9SA 1NN5A 1E1RA 1DAGA 1OXUA 2VF8A 3RAPR 3BERA 2O8FA 1G20E 3NH6A 3CRRA 1RFLA 3LLUA 2QUZA 2HCJB 2FEMA 2V1XA 4B33A 1VHLA 3EA5A 1E32A 1NY5A 2NQ2C 4MYUA 4MRVA 2QP3A 2ZRIA 4MKFA 4JLKA 3WNCA 2GETA 2XAUA 5FI0B 3SFVA 1UDWA 3MMPA 3BJIC 4JIMA 2GVDC 5KSPA 2KE5A 5JS7A 3FYHA 2ZANA 1VIYA 3ZDQA 3EASA 4BQSA 4JLDA 2WKQA 2PMDA 4QC2A 2ONJA 1R0ZA 1E0SA 2PH1A 3M6AA 3K9NA 4YMSA 5AR1A 4HLDA 2FPKA 1E69A 3BBPA 5KSOA 1P6XA 2KBEA 1VYUA 5AJXA 2O8DA 5JCPA 1XMSA 1ZCBA 2ZM5A 4P3YA 1OKKA 4Q9LA 1FP6A 1BIFA 1M6NA 1E6CA 3WRYC 1GOTA 1YVDA 2BBWA 3OEHA 3C16C 3AGQA 5LD2B 4KV9A 4L8GA 2XOKD 4YONB 1GSIA 2Z5FA 3E70C 4DCVA 4UXIA 5C18A 2ZR9A 1JJ7A 1G41A 2NIPA 3PENA 4BZXA 4ZPXA 2YC2C 2EFDB 3QKSB 1ZD9A 1ZINA 1S3GA 3Q72A 5GJVC 2JLYA 1EESA 4B74A 1WMSA 1V5WA 4S35A 2P2LA 4DLVA 4B3GA 2ZI9A 3AQ4A 1S3SA 2JLRA 3I3SR 4V03A 3ZZTA 1G7RA 4HDCA 1E2LA 2YKGA 2OBLA 4DCTA 2RB4A 2V7QD 3QF4A 4JLOA 2FSGA 1CIPA 1E99A 1TQ2A 3T1VA 2RGNA 3AVXA 2FGKA 2D74A 1Z6TA 5JBQA 2VSXA 5DO9A 2ATVA 1KNQA 1SVWA 4NDZA 3HYTA 1VG8A 4I1SA 3IEVA 3GJ6A 1IBRA 1NSFA 2FJUA 3B1VA 3G0HA 1S1CA 3HU1A 5JI3E 1OH7A 2O8BA 2HT6A 2ZE6A 4US2R 1JEEA 3KXLA 1ZRHA 1L8QA 4XH9B 5CK5A 4IEIA 4GFDA 5A4JA 3T34A 4XWKA 3VR3A 1OPXA 2IYTA 5CITA 4LHVA 3HU3A 2FSFA 4DBLC 3GJ8A 2AD1A 1GRNA 4WW0A 2F9MA 2P6RA 1KO8A 2UZIR 4JJKA 3VX4A 4YMTA 4EQ6A 3BB4A 221PA 4MUBA 3MWYW 3TQFA 4Q19A 4TL7A 2ZUDA 4RKFA 1XPRA 1OIVA 2AL7A 4PZZA 3V4RA 1ZMXA 1WP9A 3A1UA 5EE0A 4B3DA 3QXXA 4LPSA 4IDHA 1P73A 2QPTA 2BM0A 4TMTA 3U44B 2GJKA 4JVLA 1MABB 5FOUA 4TQ9A 2NO1A 2PLRA 1IHUA 2GXQA 2NO9A 2GXUA 2PZGA 1N6KA 2BKEA 1JR3D 3DKPA 3JVUA 5P21A 2AWOA 1J70A 2BMFA 2YC4C 2J0SA 4FD2A 3KKQA 4LBYA 1YJ5A 4DLUA 4LYFA 1AKYA 1MR3F 4Q4HA 3S1AB 2IUSA 4QGFA 1I4LD 4Q48A 4HB3A 2PCJA 2J7KA 1YRBA 2ZVPX 4DRZA 2JATA 4LBVA 2NTYC 2FZLA 1GUAA 1VTKA 4FMCB 1C4OA 4ARZB 2YOHA 2G9NA 4F7WA 1N25A 2ZUBA 3THYB 2AXNA 1JAHA 4A8JA 4BFZA 5TMPA 3AH8A 2WSSA 1Z6GA 1KDOA 4HYYA 4DLRA 4DCUA 3KQHA 1AZSC 1NVXQ 1WRBA 1AQUA 1KK2A 1HE1C 4N3NA 1EFHA 3A58B 1SZPA 3MG9A 1NG9A 3IIMA 2C77A 2IEZA 3GCGA 4PHFA 2WJGA 3MLEA 1YZKA 1TEVA 5BWMA 4AKGA 1ODFA 1II9A 4KYIB 1Q3HA 2G6BA 5CYOA 3SU8A 3NHBA 3CPJB 4C0SA 4G01B 4GBMA 4IXMA 5CJPA 1ZM7A 1P2UA 1Q44A 4LJ4A 1DVRA 2ZRKA 3T15A 2J7PA 3BS4A 4G0NA 1DG1G 1Z0KA 3LXRA 3J81k 2XTNA 1T8TA 1U9IA 4Q1BA 2WKRA 3FKSA 1W4AA 3X1ZA 1JR3E 3EIEA 4DVGA 2IYLD 3OIUA 2VP4A 3KUCA 1DAEA 1NIJA 5G3ZA 3C5HA 1KMQA 3CO5A 2YNMA 1GL9B 3QI2A 2G0NA 4KHZA 4KU4A 4B6FA 1YKSA 1X1SA 1LFDB 1YE8A 3K9GA 2GJSA 2V9PA 4ABYA 5FTLA 1GNRA 4DEYA 2J0QA 2J1LA 3M0EA 1X8KA 3IPXA 1E2GA 3NTUA 4G3XA 4XVQA 2PZFA 4DLYA 1OW3B 2ODNA 3H84A 1W44A 1QHIA 2WWFA 5AUOB 1P2SA 4XJXA 5CYPA 3LW7A 1R8SA 5DIFA 2A5DA 5FBVB 1IN8A 2IX3A 2BCJQ 3IBYA 3LQRA 3QKSA 421PA 4DLWA 1IJEA 5C4MA 1AGRA 1G8PA 1TQ6A 3D8BA 4FXPA 3PG5A 2JLUA 2XSZD 5C46F 1PUJA 2VPPA 3CW2A 3KTAB 5KOYA 3K0AA 3C4JA 3N2IA 5FR1A 3VR5A 2YHSA 5JJIA 2FN4A 2QSYA 3UK6A 3EW9A 4LY6A 3KX2A 1E9AA 3Q7PA 4KYUA 4ILEA 4V02A 4A6XA 1T0JB 4G5OA 2C96A 4NYJR 2ANBA 3KJIA 3K70B 1YZQA 4IKEA 4KODA 3R8CA 3SE0A 1TAGA 2OESA 3LBNA 1UBEA 2OV2A 2C8VA 2QGNA 2QORA 4TT3D 5BQ5A 4EPTA 4GPTA 1R4AA 4EAQA 3BGWA 1R2QA 4Q9HA 1MKYA 2DBYA 1R8QA 3C8UA 1SVKA 2C9CA 3ZVNA 1IN6A 4QJ5A 2QT1A 4M9XA 2FPLA 1FTNA 2HUPA 1SKYE 2QZ4A 4IDQA 4OK6A 4L5BA 4JLPA 1LTQA 3QXHA 3CX7A 1Z0JA 3PEVA 1NBMD 2HJGA 4RCYA 5GVRA 2EYUA 5JWRA 2O0KA 4V0MA 2GZAA 3ZZUA 2GAAA 3FHTA 4JLAA 1LF0A 2VSOA 4EJSC 2X19A 3AB3A 2ZU6A 3TIFA 3RWMB 1EFRA 3QF4B 3FDIA 5L3SA 4M1MA 2E1RA 1KOFA 1KI2A 3GLHE 4GT1A 4PSKA 2R6FA 4D0LB 1JEDA 2BHRA 2C99A 1KK3A 1Q12A 2PEZA 1KK1A 4EPVA 1XXHB 5F3WB 1G7SA 1JR3A 4MYTA 1AN0A 3C5CA 4ZDWA 4I81A 1MABA 5KPDA 2QG6A 1SVIA 1TMKA 3WP1B 1KZGB 1SGWA 1E2HA 3AVVA 1IJFA 4C0KA 3TJZA 4Q5IA 1XCGB 4Y0VA 1ELOA 2A2ZA 5FPSA 1GITA 3EZ7A 1KKMA 2NO7A 4KBGA 3WBKA 5CB6A 3P32A 4D4LA 3TBKA 3I4LA 1U81A 3CNLA 1KAGA 1QDEA 3DMNA 1F2UA 721PA 3RRZA 4PX9A 3TQCA 4C2UA 2BBSA 5M04A 1E3MA 1JB1A 3GLFA 3LV8A 3ZJYA 1OB5A 3W3AA 1AK2A 2N42A 2FX3A 2I1QA 2IA5A 3FPAA 3U7EB 4RD2A 3TUIC 2J41A 2QRZA 1U0HC 2V6JA 3CRW1 1KI3A 1KO4A 3SJBA 4B3BA 1D5CA 1ZUHA 2H8KA 3GQBA 3FMOB 1RPZA 3CX6A 2WZQA 6Q21A 2ZU0C 2GZHA 3WYGA 1T8UA 1G291 3A36A 4KI0A 3VTKA 2W6JD 4UXHA 2C78A 2IXEA 1RKBA 3AKYA 4ZDIA 1EFCA 1KMHB 4B48A 2ZE5A 2FFAA 2REOA 2GEUA 5KO2A 2I3BA 4QGHA 2QROA 1G8YA 1B23P 1S2MA 2AX4A 3ZYCA 3QG5A 3IDQA 3P4YA 4GOJA 5CIWA 2IUUA 2B92A 4FMCF 1NVVR 4ZDKA 4WIAA 2W2VA 5G3YA 1Z6YA 1XXHA 1JBKA 1P9NA 2AFIE 1I2DA 2WAXA 2BEKA 4PTLA 3TW4A 4PPQA 3UMFA 3WYFA 3CZQA 4PO9A 4POAA 5SZKB 1N6RA 4L9WA 2W6ID 2HLDD 4A4DA 4LJ5A 2WSMA 1KI4A 4UNPA 1QF9A 2ZRLA 4IVRA
chains in the Genus database with same CATH superfamily
4LSZA 1E5DA 3C98A 5TLSA 2VHTA 5DNWA 4A9AA 3M83A 3LI2A 2RMKA 2AOWA 1N2XA 2JIMA 3DDOA 3KOYA 2GM5A 2VDVE 4XWAA 1IK6A 2NU9A 1HZJA 1JSXA 2ODBA 2WWRA 1MRZA 4QDOA 4U5QA 4YRDA 5C53B 3I61A 4TKMA 4MR7A 4FB4A 3D8NA 4OSOA 3O4GA 1AUVA 1C9NA 2HZ7A 4R68A 5ALGA 3NHRA 5MDHA 1WY5A 4O4LF 5LYYA 3UMGA 1SC9A 3K2BA 4DQVA 4M53A 4PR0A 5KTYA 1BS1A 1FSPA 1YIAA 1GFSA 4NZYA 4F6CA 5F2NA 1X7XA 5C4GB 2OE2A 3B5EA 1RRKA 2I54A 5AHXA 1VJRA 2HRRA 3WMWA 2V6IA 4H16A 3T94A 3AF6A 4EI9A 4JYPA 4NE7A 5AKHA 3MPUA 3UHAA 2Z98A 1MTOA 1GTVA 1XVIA 2HMSA 4ZWNA 3FB4A 3R3ZA 1OROA 4UZFA 3JAKA 5TF0A 5ECDA 1E6KA 1PGOA 1A9TA 3BRQA 1NQXA 2W2KB 1ZJZA 3NJ8A 3PTZA 4MI6A 3RV3A 4D9MA 3WYNA 2ZPAA 5K0CA 3O31A 4HEJA 1SELA 3LKZA 4QXRA 1Q0LA 2P2SA 3BD7A 5BOVA 1WKCA 2VHCA 4DSTA 4RH1A 3L4EA 2IYUA 2QSJA 1ZG3A 1N0IA 3DNPA 4IHJF 4UNRA 4I6JA 1Z06A 5FB3A 3RQIA 1SKQA 4M89A 1G5HA 3HXQA 2P68A 3E4CA 1W34A 2ZJ7A 4QPZA 1PVVA 1BHQ1 3HSSA 1JYSA 1A50B 2A9PA 3HRKA 1RYBA 1ZHFA 3GDWA 3E7PA 2ALJA 2J09A 3NPMA 2IS2A 3HCOA 4BNWA 1JEJA 4AZVA 2ORVA 1GZVA 1MV8A 3AHCA 3ZHRA 3AU9A 4C08A 1UBUS 1X9GA 4Q18A 2R7NA 4OG2A 4YUXA 2PAAA 1GT91 4YBRA 4MO2A 3MMXA 3KL2A 5I7VA 3IVMA 4NV3A 5EMHA 3T5BA 1RACA 3T41A 1OWPA 1XJWA 1FVXA 3KBOA 1CQZA 4H4DA 2RH9B 1Q20A 4AZTA 3C3PA 2EOAA 3IAS6 3EY9A 4GDFA 4OHXA 3DOOA 3TLEA 1XDZA 3MNFA 4OREX 2QJFA 1JHUA 1QO0A 2FSIA 3SWWA 5JIBA 4BJ6A 3PTLA 2R751 5CH5A 4EFKA 4WXRA 1KP3A 4EYGA 2VK1A 4ZIRA 1PBNA 1HRDA 3CH4B 4LZAA 3F4KA 2H2DA 5TF4A 2AFVA 3VDRA 4UHJA 2J59A 1MCZA 3SEQA 4BGIA 4DR4B 3ZUGA 1HQYE 5DBHX 1TAHA 3MXTA 1NR7A 4S1VA 4EJMA 1JDBB 4H1VA 1SQ5A 5IU6A 4O2RA 4LSGA 2NSHA 4Q03A 4QUDA 4BB9A 1A1VA 2Q2QA 5TMBA 4CTNA 4BCDA 5AHWA 2BMAA 3O7WA 3RSOA 3WJ2A 2J5RA 1GCUA 3BC1A 3LO5A 1MJNA 2PDAA 4TL6A 3OFSA 3OA0A 1U7ZA 4YQFA 5FO0A 1OXSC 3JWHA 3RC1A 4HQNA 2C5HA 2YWXA 3FKQA 3OFKA 2PGDA 3VXKA 2NADA 1TJ4A 3L1VA 3OICA 4KQXA 3GFPA 4BKRA 5ALOA 1E18A 5BSHA 3B9QA 1KY4A 4JBWA 4CF3A 5FBLB 1MT0A 4TSRA 2RKWA 1NP3A 2HIAA 1KQPA 2LWIA 2P2GA 4M0KA 3TQOA 1HEYA 4EECA 5KNDH 2A0WA 2GGSA 3VI4B 1ZBQA 1ZUNB 5E2BA 3O21A 4GYJA 4OHVA 5IFLA 1QLJA 2FPIA 5EP3A 5AW0A 1NLZA 2WTBA 1SUBA 1H22A 3SQWA 1I24A 1T0IA 1J8DA 1E96A 2PL9A 1OH5A 3IP8A 3NBUA 2C5SA 4TQGA 4CVNA 1T6ZA 1MP0A 3ROEA 1BCSA 4UARA 1MIHA 1XD9A 4ZAXA 1Q0ZA 4FFSA 1M5TA 2JJ1A 3H1TA 4R01A 4YWHA 1PIWA 1JPVA 3VKVA 1Q15A 1TT5A 2W2XA 2QX4A 3OWXA 4CM5A 4K40A 4EMTA 2QUIA 3AFOA 1DX6A 1LSOA 2YHBA 5HF6A 4DNOA 3HVJA 2X3YA 4LVCA 5GV7A 2DUWA 4O4HF 2E4VA 1UQRA 2G6TA 1WDLA 1UBSB 3BSYA 3FPGA 4JGBA 4GS5A 4Q39A 1KBQA 3ML1A 3ODGA 8LDHA 1FX0B 4KVZA 3K0BA 4UVDA 4YYEA 2HXYA 5ICMA 1ZK3A 2QUKA 3FTDA 3RUCA 3H65A 5I5EA 5B64A 1EFTA 3TG8A 2OD2A 4HAIA 2Z9DA 3ER9A 4ZC8A 2XBLA 1EI9A 2M6KA 3BGSA 2W58A 3D7NA 2CJXA 3L8FA 4RZ3A 1GQQA 2ZRFA 1I3MA 4MW2A 1M6EX 1LUAA 1P4HA 2I1VB 1JFVA 2NV6A 4QJIA 3AL3A 3UKOA 1Y3HA 1AIPA 2Q1YA 1O0CA 4TMKA 3VVMA 3I76A 4V0LA 4ZCLA 1H8HD 5ADHA 3K09C 4JU8A 1OGIA 1OBCA 1B16A 1EP9A 1HNNA 1LPOA 3DMGA 4G65A 4FW8A 2RBKA 2Y1KA 3H9UA 4LUCA 4M9QA 2FUG6 3DOFA 4GX2A 4HRAA 1NW8A 4CCYA 3PR3A 3UT5A 2A59A 4OYRA 1QH8B 1SVNA 3IDFA 3MEQA 4MR9B 2R3SA 4W82A 3L5OA 3VHXB 3W5VA 4ARVA 3A10A 2GSWA 1MHTA 3U3DA 4I5EA 5EJ7A 1QB8A 3R0XA 3T4XA 2V7BA 3CN7A 4P38A 4A2QA 1CC1S 3ROXA 4XIYA 4F3NA 2DWPA 3JY6A 3HFRA 4E11A 5MN5A 1RM0A 3QLJA 5I01A 5DTRA 2VJOA 3WXBA 1UINA 2QR5A 2Q2VA 3D7MA 3NJRA 4PW0A 1ZHOA 4FZJA 4IIVA 4NU5A 2HRCA 1REQA 2HBQA 3E9YA 4C3UA 4LJYA 1GTZA 4IV0A 4IGIA 4RNCA 1W59A 2X5JO 4S1PA 1NYLA 2JJ2D 4QO8A 1TKRA 4B45A 2YBDA 3C39A 4B43A 3O8NA 4NE9A 3LDGA 4GPEA 3WGLA 5J47A 4U39A 4DY6A 3JARA 3RBXA 3JTEA 3L0DA 3MUOA 1HM5A 5HW0A 1OC4A 2H57A 2E6KA 1GUDA 3H42B 4MMZB 3C6MA 1IY2A 1SJ9A 2L42A 2PMCA 1KI8A 4P81A 4FTWA 4ND8B 4HNHA 5IAJA 3RVRA 1U0NA 4BFUA 4DR5B 2XH8A 2H59A 4TYMA 2BI7A 1TCUA 4R9SA 2G71A 1UM8A 3H04A 1ADFA 3E2MA 3EGDA 3TS1A 3B48A 3BDIA 1D03A 3FPJA 1KYWA 4QUGA 1KFEB 5JBNA 3DKIA 4X3CA 2R6AA 2YVUA 3IQIX 5CDFA 3AFNA 5CDTA 5IM4F 3LBFA 4DLLA 1IYZA 4RTOA 3FRHA 3JYHA 2BL4A 4OTZA 2W00A 1FRNA 2PT7A 2GPTA 3OOWA 2LIVA 3I53A 3CMMA 3ZVKA 3RYTC 2Q99A 3ETHA 1LRKA 3H1EA 3M4ZA 2WJ3A 4TKVA 2WIJA 3FG9A 4R98A 4TVOA 1YCGA 4DDUA 4QTUB 2VCEA 3BCHA 2O2YA 4LC9A 4XGRA 2M6SA 1W0KA 5K3OA 1L3IA 2XOKA 3CKMA 4MKHA 3QXCA 4B8YA 4O0LA 3TNLA 4RL6A 1K8RA 4YUWA 4HGRA 3RFUA 2PUHA 3GGOA 4OI4A 1TADA 3VJLA 1ISMA 2Q4EA 1XTRA 4IINA 4JODA 4Q9NA 1LPNA 1NKVA 2YJNA 3OLXA 4WZBA 3ZOZA 1JDZA 2E21A 4GOMD 1NQ5A 4FK8A 4HYEA 1X3LA 3U4HA 4BJHB 3NT4A 1QGUB 3PP8A 3NWEA 1R0CA 3O84A 4HDNB 2Y1CA 4LY0A 1ZM3A 3MT8A 1V3VA 3I8OA 2YJGA 1OZAA 1P0MA 2A4KA 4NYJQ 3U39A 1W47A 5B7NA 1ORTA 2DE0X 1E4EA 1Y9JA 1PTJA 5CA0F 2G9VA 3ITKA 3Q9UA 4QG7A 3KPVA 1RLOA 3E5MA 4UBOA 3J7AC 3W5DA 2XWSA 4KXNA 3D64A 2WSBA 1S7CA 4E33A 3V4FA 5FR2A 4FNMA 5E1MA 3I83A 1R64A 2C2ZA 1YAJA 3BCSA 3QEMA 5DHUA 2H52A 4MGKR 3AESB 1THGA 1W75A 4KWHA 4AJIA 3NG1A 3VPDA 5A4KA 2VTVA 1FUKA 4N5DA 2F00A 1R66A 4W6QA 4MVYA 1XQXA 2H92A 2RHTA 3ZU3A 4ZRMA 2CJWA 4F91B 4N5IX 4DC9A 3CT6A 3SS9X 1Q21A 3NP9A 5K03A 2UVPA 4BFSA 4OMFG 3JR3A 5F64A 1W93A 3E5HA 3BDAA 5DK6A 1M6HA 4XE5A 3L1IA 2SKCA 5KYKA 5LPNA 1BGWA 4K3VA 3RC7A 4P5EA 1YFZA 1G0OA 2JFWA 2XITA 3AHFA 3IMEA 2H6EA 2Y1XA 3I9JA 3QLUA 4IRMA 4DA6A 5C8YF 1W36B 1ML4A 3FYDA 4ZYZA 5CFZA 3CLUD 3NS7A 4M0LA 1QIFA 2PKQO 1X8JA 4TVSA 2X0IA 3NNSA 3R5XA 1U80A 3BK1A 3SVZA 4ZARA 1S01A 4FSDA 3LF1A 4YRCA 2NP7A 4UHKA 3LYLA 4GP6A 4UC0A 2XZOA 4HZUB 2JDID 1YSCA 2Y1DA 4RD4A 2C2HA 3I6BA 4QBGB 3DMYA 3NI2A 5HS6A 1PEDA 1YR8A 5BYKA 1RQ7A 2MSWA 3D1VA 3KD2A 2XD4A 1AO3A 1N6NA 1TKBA 3Q88A 2C1ZA 2UZAA 3MWLA 3PTAA 2YVQA 3MYYA 1EUDA 1KSJA 4OXRA 1UZAA 5DNUA 1V96A 5DI9A 1MQ8B 4O1HA 1P81A 3ZWVA 1NOKA 2GOYA 6GPBA 1ZXXA 1I30A 1Q7BA 2VCHA 2ZXFA 1CS4C 3D6VA 1UT8A 3IVXA 3VHLB 1CP3A 1ESNA 1E1YA 2YX1A 3M81A 2P69A 4J90A 4RXTA 1JDPA 4TL8A 4N6NA 1U8XX 2QM0A 2WDPA 4YN3A 4OHKA 4XM2A 2CDCA 2XQJA 4HGNA 4MUGA 4S3MA 4U2GA 1IUNA 3D7LA 1XDBA 4CI0B 1NN1A 1DP4A 1EP1B 1M0SA 1QGZA 5KQPA 1XZHA 1Z3IX 3EEYA 1E1CB 4LTMA 3FPKA 5BT9A 4AUEA 4UATA 1FSSA 3H2JA 4I1UA 4D4MA 1NUHA 1YS7A 2O2HA 1PLJA 2PKRA 3UOWA 2HWWA 4F56A 2FZEA 3ACBA 3R6WA 1ZI8A 4RVHA 2WJ4A 4CV2A 4DQXA 1YR1A 3BKXA 4NCHA 3UAXA 1O5TA 3QE9Y 1J25A 2II6A 5MF6A 2CLLB 3MJTA 4R31A 3V5NA 4WFQA 4JYCA 1CUAA 2W6OA 2I71A 4H31A 2H5IA 4DS3A 2JGDB 4B7XA 1IPFA 3MRVA 2Y92A 3UY4A 2MHCA 1PJ3A 3F9RA 1IZYA 2J48A 4MRNA 2R86A 1EZ4A 2IYOA 1SBQA 1XF9A 1JHYA 1AUQA 1RHQA 4OH1A 1YVEI 2V54A 1XRRA 5KVSA 1D4FA 4FE3A 1MPTA 4I4TF 1I14A 3T52A 4A2PA 3RABA 2P9BA 4L50A 3LUCA 3GY0A 1JKFA 2A5GA 5CIQA 2H4WA 2FN8A 3IOBA 4HDKB 4RAQA 5AMXA 2FSHA 2V9ZA 1Z62A 5DI3B 2VYCA 3ODPA 1L5GB 1US8A 1XCBA 1E4YA 3O8OB 4KPFC 2JGFA 4XB2A 1PJ4A 1GPUA 1Y1KE 3O38A 4PPFA 3GIDA 4E7PA 1WXDA 1HL3A 4YR7A 1V43A 3IL2A 2JIBA 1P7PA 3LS2A 1KR5A 1J2YA 2D5BA 1OLXB 2WYUA 3B1KA 5CP8A 3C87A 1Y0BA 3A0UA 1DX9A 4H7PA 4JUAA 5BSMA 2PPVA 2P5YA 4EVSA 3QWAA 5AVTA 2N47A 1PR4A 2CHUA 4V38A 1VBKA 4LDJA 3KG2A 1IAVA 1PFVA 4LX0A 3I92A 1GZ4A 5TRTA 1GXSB 2FW6A 5KWIA 2PH5A 2GDJA 3GXOA 1EXWA 1GCOA 2KYRA 1QWOA 3FROA 3PZRA 4V0KA 1K8YB 1P1CA 2D3WA 2H0AA 4ZEXA 4D9CA 2VUIB 1BXZA 3QKWA 4YMIA 5FWAA 3D2LA 4RA6B 4YIHA 2OBMA 3GZNA 2HRQA 1V37A 3DKKA 1E1CA 3EZFA 3FMFA 4II3A 4MITA 4EG8A 4MTCA 2E4ZA 1L7NA 3K2QA 2DR0A 4O8ZA 3COJA 4OJKA 1JPUA 1SOAA 1YB1A 3G2LA 3OAAA 2VZLA 2M32A 3ORQA 3CGWA 1FJ2A 1FVFA 1NW7A 1U2EA 3E9DA 4IWNA 4KIGA 4YQYA 3MWGA 3CX4A 5EHZA 5IBCA 4KNYA 4L8VA 1EFPA 2HJRA 1B00A 1OXVA 4K1XA 4PZEA 3K0CA 4V0OA 3SHFA 4CLOB 3JWPA 3OZGA 2ZWPA 1A27A 4C0JA 5IYZA 4OLHA 3LT2A 1YCFA 1KYZA 2PO7A 2VOEA 4UZSA 2X8LA 5ES4B 1PK9A 2H5LA 5DXFA 4ABTA 1CW2B 2QMUA 3PGA1 3QIVA 4XDHA 2ZIVB 5FPYA 2NZYA 4I1OA 3NEAA 3T7KA 3M6WA 4IL5A 3O6VA 2GYUA 4OI0A 3HO1A 1R4NB 1Y6JA 1OBFO 1DOHA 4CFZA 3U7RA 4NBNA 3TZBA 1N2SA 1JP7A 2O50A 4EYOA 2MSKA 5U1PA 3OCJA 2PH7A 4IGFA 5JMPA 4BNMA 5AK0A 1M2FA 3TKAA 4BP3A 1OZGA 4ALKA 5CVVA 1JA9A 4EVQA 4HL6A 3S81A 1U28C 3LWNA 4QEDA 1FK8A 4YV0A 3FD8A 2R6CA 4TM8A 3EXAA 2X4DA 1Q7RA 3HKBB 4HOYA 4E15A 2P0AA 2PE5A 1EB9A 3DVRX 3G7UA 2DH6A 3MTQA 3JCZA 1RQPA 5DDIP 5TS2A 3VAAA 3RGWS 4B7AA 4COOA 5MN6A 1Y4AE 4DCSA 1JG6A 3DBRA 2XCSB 5UKDA 2XUPA 3PFFA 3KUXA 3LIPA 3S0JA 2P3LA 3TF5A 1OPRA 4M8NE 1Z47A 4R1OA 1RWKA 3KHKA 2JIZD 2QG9A 3EZ2A 1KZ9A 1Q1ZA 4QDTA 1XDGA 2G09A 2WIFA 2AEEA 3OE7D 4B0OA 4Z8XA 3BEDA 4KAJA 1X19A 4R84A 5AUQA 4J4BA 4Q7EA 4N8DA 1ZQ9A 5DGCA 4C2AA 5J2TA 2P9GA 621PA 5JAZA 4Q01A 2BR4A 2VTBA 1XZIA 4A7PA 2R1UA 1GP2A 2CB9A 2IE0A 3GLHB 3EGXA 1U5AA 1DAMA 3CRZA 5HQ3A 1C2YA 2BE7A 4ACBA 1MOSA 5FLEX 5I8ZA 5A0TA 3KB2A 1T4BA 4GKJB 4Z4CA 2WG1A 1TKCA 1NBME 5A7GA 1GN8A 4R6WA 3ICOA 1SCJA 1DQYA 3BUSA 3JWIA 3IELA 4MQ4A 2AVDA 3CQ9A 4GEKA 2ZJOA 4NSNA 3I8XA 4M4SA 2FWNA 2PT5A 2R5FA 4WSOA 4FGWA 1AA6A 2HRZA 1E6MA 2EKLA 4ZI7F 3AHJA 1LQTA 1X80A 2BUAA 1KQOA 2JIOA 3GFBA 4IF4A 2CWWA 1E1LA 3E0XA 3ISJA 3T4UA 3RG8A 1KI9A 3IXQA 2WM8A 4RHYA 1GJRA 3DE5X 4B31A 2NU8A 1GUBA 3CSDA 3PJFA 3B7WA 3ZHTA 1VPEA 4LSWA 1QVRA 3FNIA 4WLEA 3WIOA 3WGKA 4EH1A 1WNFA 1JWAB 3AIKA 3C3XA 5FFFA 4DT1B 1XMXA 2H4ZA 4HT3B 3FPLA 5IK2D 4C7JA 3N05A 4AURA 1JR6A 2C5FA 4M1SA 3PX2A 3HY6A 4ZJZA 4ZT3A 3I0NA 1NQAO 2CNWD 5DN9A 2EKQA 2NO4A 2OXTA 4ZCIA 1YA6A 1FLDA 3QU2A 2GILA 2CL5A 2IHZA 3A6JA 2XWPA 3T06B 1BU5A 1E9CA 1SU6A 4C6TA 4RZ2A 4D4KA 2VHXA 4H1WA 1O87A 4FE4A 4YY3B 3B52X 1E2JA 1UPTA 1E59A 2BV3A 2HU2A 1VM6A 2AR9A 3BTOA 1E94E 4YV7A 4RV5A 1T1JA 1GPDG 1QXSA 3AZPA 3IT3A 4KMMA 1NUTA 4PYMA 1B73A 3IAS1 4Q3BA 4ENPA 2YHIA 1PUXA 4PEVA 5CX4A 3C3AA 3P8ZA 1G5QA 2GF9A 3RO7A 1NU8A 4Y1FA 1G5PA 4DIEA 5LBTA 2V59A 1EGQA 1SCNE 4LRTB 4I9GA 3ORSA 3ZZ1A 1XPUA 1GCAA 2AQIA 4MQFB 2NP6A 1ID1A 3Q3CA 4M76B 2PMKA 4N4AA 4C4SA 3Q6MA 1O95D 4C7XA 1OI2A 4PAOA 4RVNA 3LX6A 1JWLA 3AR7A 3LW8A 2I80A 1DIOB 5L6MB 5GWXA 4KV7A 4ER0A 1GQSA 4GHWA 4QOJA 3CURA 1E2EA 3VH3A 3G5UA 2P1DA 1MGPA 3CCBA 3SX0A 4CG2A 4RTLA 1C1XB 1JA1A 2EF0A 1EKXA 3MTIA 4RK7A 2AYZA 2QRKA 2IP2A 2B1JA 4FYPA 3ZGOA 4H7DA 3BQMB 1UBCA 1WXEA 3VR5H 1AT1A 2IZZA 4P0QB 1JQ3A 3V1NA 5JNSA 3VOTA 3GFTA 1JXAA 1VFNA 4CCWA 4RESA 2QNIA 5CHYA 1SC3A 1ZAKA 2FFRA 4A27A 4I14A 1K8XB 1DIBA 3IV9A 3BAFA 4MTLA 2FKAA 3BMNB 3JWEA 5T4HA 2C7BA 2EJUA 5D00A 6REQB 3N39C 4QXOA 3I1JA 5H8WA 4X1IB 4W5TA 2R9VA 3JXEA 4QXPA 2MYUA 4KQFA 3O2JA 2YN4A 2O7QA 4P0PB 3RKUA 4R71A 3L7CA 4RHEA 3ZHQA 4OXQA 4ETIA 2VWPA 3EZYA 4HNSA 4JBHA 4Y2PA 2CE2X 2ZSEA 2QY6A 3ZV4A 4D9HA 3PFHA 3PDJA 3K4PA 5F35A 1ZMOA 1BQEA 2D6FA 5K0LA 4CZ2A 3OLZA 3K73O 2NPFA 2WUVA 2XBUA 1UBMS 4MVJM 4C3VA 3U7IA 1KIMA 4AJ9A 2OAQ1 1KJYA 3KAJA 2FZ4A 2E1PA 3GLGB 5LLTA 3B12A 1CZUA 3W6UA 3B6ZA 5BSWA 4ZYYA 4H6XA 2EYQA 4WKGA 2ZUEA 3JAKB 1V9LA 1GKKA 1PJLA 4BFWA 2C92A 3KO8A 1Z68A 4COKA 4D56A 4GUDA 2C2WA 1C3EA 3LRPA 3JQGA 1KDZA 1VYTA 3PD7A 2JAHA 4BC1A 1RCFA 2FFHA 3OY2A 4IQ8A 4OFXA 1QP0A 2QN2A 1SZDA 2PUWA 3H4IA 3N3AC 1RFGE 4MQEB 3O5AA 2D5IA 3EPHA 4GWLA 4YRMA 2QMOA 2UKDA 3MRSA 1T2NA 2VLIA 1R7RA 1UPUA 4MEAA 4GRIA 3TX2A 1L6RA 4DZZA 1DZIA 4G1BA 1KFCB 4M36A 4D41A 1N0VC 2R96A 3VYRB 1C1DA 3ZDXB 2FR0A 1J0DA 4TN1A 3GARA 2PR7A 3C45A 4MQFA 5IULC 1N1DA 1YZTA 5HA5A 1ODCA 3KR9A 3WLQA 1TCBA 3LQFA 4FIDA 2AB0A 3T9FA 1BEZA 2QTZA 5E7MA 5JAHA 2VA8A 4CMIB 4E5KA 4LF9B 2UZ3A 3THYA 4D42A 3H7IA 1U0OC 3T3PB 3K9BA 4NMHA 1G2PA 2DF8A 3AM4A 3HCNA 1XUOA 2PMBA 2OSBA 1C30A 5ES3A 4NIMA 3DMPA 3UPDA 1Z2OX 1ZGGA 2CLHB 1DDIA 1HUQA 3NBMA 3GWZA 4OHBA 4WZ6A 1AHIA 3HBLA 4WUVA 3DFMA 5EN4A 1K8ZB 1GEEA 1O1YA 2NZ8A 3G2HA 3I2IA 4HYTA 2Y77A 4JC0A 5JDCC 1WB5A 3F5DA 2ZJBA 1F0PA 3DT8A 1P62B 4TWBA 5JANA 1W4LA 3IQWA 5DSTA 3PHGA 4UBIA 3TLGB 4D9JA 4QYMA 3T1HB 2XUZA 4KJXA 1FS4A 3RSZA 3FAKA 5EE1A 2CWDA 2GCGA 4O4LB 1T1SA 5EXPA 1WZUA 1RXSA 3PHJA 4KMOA 1NVVQ 3OAAD 3FWKA 4PNZA 3NC1C 4UEOA 5T3UA 4P4TA 3KQYA 4C5BA 3UPTA 3D8HA 1XZEA 3HACA 3A1DA 3U3RA 1D04A 4OUKX 1FNNA 4FD3A 2VHZA 4PG5A 3SHOA 4IXTA 3ZY3A 4KHPB 4EMSA 1QG4A 1UL1X 3GJRA 3BIOA 4E03A 5I6DA 2G7ZA 4YP9A 4O2AB 4AJ4A 4TYWA 1E61A 1KDRA 3CX3A 4LOLA 1NW9B 4UU0A 4A0QA 4QKQA 4JOCA 4R1NA 5DF1A 3Q12A 5JWOA 4MOWA 1SUFA 4TTJA 3OQOA 1POXA 3NKVA 4U2CA 4Q7LA 1DAOA 4K05A 1L4YA 2QTRA 3N8KA 3DUFA 1Z8NA 4GWGA 4OUDB 2BIFA 1EVIA 2NZUG 3L0PA 2BHNA 3FMVA 1O0SA 3KTOA 5TPWA 2D4HA 2W70A 3MRXA 5A02A 4N3CA 2AC7A 3ASZA 4GKKB 3EDRA 4WXMA 4ZVMA 3T1QA 3GRRA 3JZAA 2XHEA 1VKNA 2WMOB 3GGCA 2ZSHA 2VUHB 4G5GA 4ND6A 4OI2A 4F84A 4FWTA 1T0HB 1V8OA 2GYVA 2Y1LA 2HY7A 3C7CB 2WTEA 3NBZC 4EGJA 2OZKA 3WMGA 2P4HX 2A78A 3TEFA 4IEFB 4D5EA 1TRHA 4M87A 3ZZ0A 1IY0A 3TI7A 1TEXA 1GGEA 4ZAFA 1ABBA 3BZUA 3IHTA 3MTBA 3O90A 3OHPA 3HO6A 1OZFA 3QWFA 3DEZA 1OJLA 3LX8A 2QLJA 2QK4A 4M1EA 1TZKA 2PUEA 2P2CA 1QHYA 1EWTA 2Q3EA 3IBGA 3AB8A 1US8B 2PLWA 4B34A 4XJVA 4M9ZA 3ZZMA 3D7RA 3DO8A 4QTTB 1HH4A 1QLWA 5JD4A 3T3OA 1EVJA 1SXHA 3D4BA 3D6TB 5KREA 1FU8A 5BXYA 1DFIA 1HT1E 3PHIA 2PCLA 4KNVA 4YQZA 1MA0A 1NT4A 3DMHA 3LLSA 5DULA 2WFLB 3OKCA 4UNSA 3D3QA 3RUHA 3EWNA 1JI0A 4LYYA 3ZBPA 3ZBQA 2B4YA 2YINC 4BQPA 4CEIA 1NXXA 3UT5B 3NDBB 2G08A 2YFHA 4H35A 4UM9D 4Y2JA 3L01A 4S2UA 3BMXA 4ZI2A 1PP4A 5JHGB 1ND5A 3SEFA 2IBTA 4IIJA 1NC3A 3JWGA 3ZEIA 2HLDA 3NHSA 4YECA 5E3HA 3RJMA 3C4QA 3HWWA 4YJKA 3RS2A 2YWGA 2ZT7A 1TF2A 4PWZA 3OOJA 1TFRA 2N1BA 1AQ6A 1DAFA 1RADA 4ZANA 1LBTA 1YJQA 3H13A 1DQPA 2PX5A 3AY0A 1GTG1 3V97A 2XMDA 2CDAA 3NEJA 3LPNA 3UMVA 1LI4A 1RPTA 1Y33E 3GPIA 3E3AA 5BQ3A 2P40A 3KLPX 2AWNA 4YAGA 3PX7A 4YAWA 3KUUA 4ZHQF 4WZAB 3RS5A 4GR4A 3HUTA 5TDHA 2FSVA 2GXAA 1I0ZA 1UJ6A 3B2EA 2YW2A 1VCNA 1C0KA 3G2QA 1EZZA 3KT6A 3AQIA 3HCBA 1OZHA 4MXDA 4QU0A 2QPAA 5CLFA 3ZDCA 5D5QA 5GIPE 1SWVA 1N2HA 1C0LA 4FFWA 4HDOB 1O54A 2FP4B 3DCNA 4OQZA 4AYXA 3BE8A 4TKZA 3B60A 4EF4A 4ZK6A 3TL2A 4LF8B 1PL6A 2FG5A 1UPXA 1BFDA 4OHRA 3O3OB 2X0EA 2GBIA 3A32A 4C7BA 1PDOA 3EB9A 3LBIA 1XOIA 2ZQ5A 1XDDA 1V45E 2C54A 3GJQA 5FWDA 2IV7A 5FV4A 4PQYA 4DR1B 5AKXA 4F2HA 2SCUB 4HWSA 3QEKA 4GC5A 4C9BA 4QT4A 4QM6A 1GADO 4IDOA 4U7GA 1DLIA 5FHQA 3WHIA 2LPMA 4HHEA 2XMZA 2QT9A 4LG1A 1PVOA 3K9WA 4BEWA 1PBTA 3RNLA 3HJRA 1Y3AA 4JT9A 1OFTA 1X3SA 2YWHA 3IR5A 5ESRA 3K0HA 2BTEA 2VAPA 4OHCA 3WAJA 3P2EA 3IMKA 1U7PA 2WMDA 4NHEA 4WFIA 1C3LA 2WJ6A 3I9OA 1TW2A 2VS1A 4ER3A 1XQ9A 2HX1A 3FUXA 3UUGA 1JQLB 2DPLA 1CLEA 4ICIA 1BWSA 1LNZA 2BM1A 2LDBA 4MB2A 3DXXA 3RTGA 1RPAA 3UB4A 4MYHA 2Y6VA 5IANA 1OC2A 2IS6A 2B98A 3ED5A 4OHWA 2O0MA 5A5FA 2XT6A 1QYDA 1Z2AA 1QORA 3VJMA 4FZ5A 1JECA 5F9MA 1DKMA 1T91A 4DYDA 1JDSA 1KZ1A 3KLOA 3O75A 4GYKA 4BEBA 1DI0A 2B30A 2YV4A 1Q2UA 1SXIA 3FDXA 2HI0A 1VIDA 4AJOA 3SBOA 2QQEA 2QL7A 3TMKA 1RKQA 3UJAA 4FN4A 4JJFA 2PMWB 1ZPDA 3KCNA 1COWA 3IJ5A 1NPYA 3OBBA 1K4YA 2BELA 3G68A 1F6WA 4DUGD 3VJKA 1DXQA 4J75A 5BQOA 4F11A 5K6AC 4A8JB 1X7DA 2XJ4A 3KDAA 2WWIA 1A8QA 2G1JA 3HB7A 4PBRA 3DLHA 2LZ0A 2WJPA 4KIFA 4W5WA 4NMXB 2GH1A 1LX7A 4OATA 1RYDA 1SPXA 4KACA 2E4YA 3ANYB 3SEAA 2B7LA 1X15A 5KDLA 5JH7F 3QLVA 2Q29A 1UP4A 1FPQA 3UTDA 4PHHA 4OOFA 4YDSA 1EGHA 4QIHA 2K2QB 4JSRA 3ZHYA 3KJEA 1NF9A 5FPHA 4B3XA 4E1BA 1A76A 3AR3A 1D0SA 1RLJA 4FX2A 4NCKA 3E7DA 1Y89A 2C0QA 3LHKA 1H6DA 2G07A 4XVRA 5L45A 3G2KA 3KHSA 1X1RA 1C80A 4I4IA 1JH8A 4BBAA 2EKZA 2H1CA 5CT9A 3RS0A 4PGGA 1NOIA 1TU3A 2YYAA 3SS7X 4HAXA 5IBPA 1TTQB 1IB0A 2ATXA 2UZ0A 5ALWA 2GZDA 1I6LA 1I2ZA 5FTNA 1JXOA 3TQSA 2JLZA 1B0AA 3MB5A 2BZGA 1L0BA 1K98A 4DWOA 3TFQA 4YDQA 4P22A 4BO6A 1LSUA 3AY7A 1WZEA 4GPD1 2HMAA 3UUEA 4BUZA 4A03A 5KWSA 3ZQKA 3CG0A 2QTHA 4EZBA 3B3AA 5KVAA 4E5DA 4YJ3B 1PQPA 4YUVA 4HFRA 4KAAA 3RWOA 4V0QA 3CVXA 2FUKA 5CPBA 2XMQA 1ZKDA 2BEWA 4ZZ1A 1B0UA 2JI6A 1CRZA 1OOEA 2QLNA 4DIBA 4MDEA 3E2IA 3AUFA 3VV2A 3HGMA 3GPLA 2DHEA 3W6ZA 4BPRA 5DM60 4EUKA 3TSOA 2FMHA 3BXOA 2W93A 1G66A 1ZVMA 4OF4A 2NGRA 3ZY5A 4OQDA 5K09A 4TMZA 3KQVA 5G4KA 1NZJA 1VKRA 4K9KA 5T7BA 3MWEB 2VQ6A 1BOOA 3KWFA 4LJSA 2J3DA 3V42A 1JE1A 3I0ZA 5AI6A 3A1TA 2X77A 3D3WB 4PYQA 2O3RA 1IHYA 4ZQHA 1OYYA 5JYEA 1FDIA 1F4PA 1R6XA 2WB4A 3O9MA 4IXNA 4WY2A 3ZGXA 3F74A 3D54D 3RNOA 4M2LA 1D9XA 3CRVA 3AI1A 3F9CA 1Z9BA 4HLUA 4JJIA 5CCDA 5KSZA 5TC4A 4Z7JA 1E2KA 5LQSA 1VCHA 1QG6A 1VG0B 3L1JA 4DIDA 4PYIA 2XSZA 1MOQA 4ZCRA 5I4CA 1CZLA 1BDBA 2P3SA 2JASA 1MH1A 3RC2A 3H9BA 3K15A 3UKJA 4AY6A 1XI2A 3QYJA 5FAXA 3S3TA 1R5BA 2VYND 1X38A 1YVUA 2G17A 4E4TA 4AMZA 4BO3A 2PSEA 5AT1A 1YOVA 2EZ4A 2VPXA 2P9JA 2AFHB 1RHUA 2IUFA 1KQGA 1N0UA 2TMKA 1SZCA 1YL6A 4RLQA 3MSXA 4KQ6A 3QPVA 2IIBA 1V7PC 2CNOA 2ZIGA 4BJ5A 3PQ8A 1OTHA 4FX5A 4RQUA 2VDWA 3M5PA 3SKVA 1TM4E 4JXXA 3SDZA 2FW8A 3A04A 5JZSA 1M5RA 3VPBA 1KK0A 2RH4A 4MI9A 5DW3A 5B7PA 1W88A 1E4VA 4TZTA 3W6PA 1SQGA 2CK3D 5AOCA 5K7SA 5KQLA 1XEAA 3C1UA 4DNFA 4Q47A 3CB4A 1GIAA 5J59A 3AFHA 3TPFA 3WKCA 5IUJC 2JIPA 2WU3A 3GB9A 3IP9A 3WWCA 3FJYA 3HR4A 3W9BA 4LHWA 1XJCA 4Y2YA 2C20A 1WPGA 3R3UA 3YASA 4FYVA 5HYVA 3SCZA 5E3IA 2JHGA 4QICA 1KOJA 4O25A 4WNAA 4GU5A 3RFCA 5DISB 4CR6A 2IEBA 2JJ2A 4OYLA 4YVFA 5I9MA 4BB5A 6ADHA 4LYJA 2GK3A 1BCSB 4FDUA 4XIGS 3WWEA 2EFCB 3A6FA 3LFUA 2E4WA 3PS9A 1SWWA 4LWZA 4OU4A 4PCAA 2AYYA 3CUWA 4WASA 3H6KA 1KAEA 3I2YX 1USKA 1W4ZA 4WTOA 3WIVA 5ALUA 7MDHA 1I8TA 4Q7MB 5F73A 3MCAA 2ZR0A 2ZUUA 1RLIA 3GJ4A 2C95A 3MGGA 2W6PA 3ECAA 4BNLA 4BO2A 2QMZA 1F6DA 3R9XA 2I2XB 4M1TA 4LHXA 4DAEA 3PT5A 2J3HA 3L7BA 4OO3A 1ZN7A 2W6CX 1F3OA 2LR0A 3ZE9A 4LF6B 4AL4A 3TSWA 5A3VA 4ON9A 4CMJA 3ZCXA 1WPRA 3IQXA 2CEAA 1K89A 3I42A 9LDTA 2AW3A 5AVUA 5LQUA 4L4YA 5J5CA 3U26A 1VDMA 1Y8ZA 3L8CA 5HF9A 3FPEA 1CRPA 1NDUA 1QQAA 3ZNQA 3MJ4A 3PUWA 1X77A 4CN9A 2GEBA 4P4SA 1BWQA 4UUNA 3E4DA 4MWSA 2HKIA 4WD3A 3ROZA 3BGDA 4M0FA 1EVEA 5A3RA 2J3EA 1O97D 3JSAA 3KTFA 3EBOA 1R4MA 4UOEA 2IPMA 4Z1MD 1TM5E 4TUYB 3CEJA 2JH9A 3WISA 1BCRB 1L4LA 1UPCA 3VSDA 2NOAA 1UM9A 1TYAE 1Y4DE 5KX5A 4URHA 1SUAA 3A9CA 4KR0A 5TPWB 2FVXA 4DJFC 2A5JA 5KQSA 3ZV3A 4CR8A 5FLKA 3AI2A 5LZ8A 3VSBA 3OIVA 5K4AA 1OREA 3D02A 1ACMA 2EHDA 3QHAA 3SXPA 3HTXA 2OPHA 1ATIA 1IB6A 1YQGA 3EARA 3I6QA 4MRPA 3RDPA 5G53C 4YP1A 3TXYA 4QPNA 3O3NB 2FQQA 4QEKA 4BVBA 3JRNA 4EL0A 3K6JA 1UR5A 2WF9A 4C4ZA 1P72A 1GGJA 3FSJX 3S44A 3NX4A 1NJ8A 5IVHA 3FTQA 3K0AB 4LHSA 2F59A 1Q3TA 2JLVA 4E6PA 4XFKA 5CD1A 1TM7E 1ZSNA 3GHYA 4LV6A 5KNDA 1EHIA 1S2NA 3EXFA 4AM8A 4PZCA