1KDTA

Cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
223
structure length
223
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTIDYLATE KINASE
publication title Sugar specificity of bacterial CMP kinases as revealed by crystal structures and mutagenesis of Escherichia coli enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 78
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2001-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kdtA00
4QBIA 2IXGA 4MGZR 4MGKR 4CYMA 2CK3D 2QM7A 4TL8A 2ZRGA 4POAA 4TSFA 1DAKA 1E0SA 2D4HA 4B35A 4R71A 1OHHD 3NKVA 5KOYA 5FPHA 3MAAC 1KSGA 3MWJA 2G1JA 4DDUA 2CHVA 3VKWA 3AF1A 5L8VA 1VG0B 3RANA 2RGXA 2C78A 2XTZA 4TTPA 4IVPA 1XRJA 2DR3A 4QHYA 1K8RA 1YR8A 3AM1A 3C14C 1WQ1R 2WJHA 3ZZTA 5DYIA 2AKAB 3RYTC 5IK2D 2V1XA 4D4MA 5DHFA 4BEBA 5HPYB 1EK0A 1X8JA 2CCKA 1WE2A 4DSOA 4CT4B 4QOSA 1D9ZA 4JVNA 2VRWA 4LYHA 1G5PA 4Q4AA 3UK6A 5J4VA 2ZI9A 2HXYA 3TR0A 2KBEA 5JI2E 5FBQB 4L8GA 3BK7A 2I3BA 3GFPA 1G5RA 1II8B 3NHBA 3NWJA 1SVOA 1KDTA 1KI8A 2DFLA 1IY2A 3BJIC 3X1DA 3ZYCA 5UKDA 2P2LA 5KNDA 3W6OA 3WBKA 1Z3IX 1KK0A 2KE5A 4LBVA 1KKLA 4LYAA 2J9RA 2WSSA 3CWZA 3OIWA 1OKKD 3PEWA 2GXUA 1R0XA 3WXMA 3ICEA 2KJQA 4LC0A 3UWOA 4QJ4A 4G5RA 1VG8A 5FL7A 3IUYA 2EFDB 2QPAA 1DEKA 4IKEA 4E09A 1Q44A 2GK7A 1NBMD 1ZD1A 1N6RA 4QXAA 4LHVA 4BZXA 3GFOA 3AVXA 4GI7A 1HEIA 3K70B 3NC0C 4JSYA 5IF9A 1WMSA 4PTLA 3Q5DA 5HZHA 5K8LA 1F6BA 2FFQA 1II8A 2GEVA 1K6MA 4WAUA 2QQEA 3THYB 3I5XA 1Z08A 1X86B 3FFAA 1IY0A 2OZEA 5CM9C 2C98A 3SYKA 4B6EA 1JEDA 5JWOA 4QGHA 4LJ4A 2XZOA 3NH9A 4EFMA 4HDQB 2GJKA 4LJAA 1IN6A 3L2OB 1ZIPA 4B44A 5BYKA 2DFNA 5AJZA 3KJGA 2HV8A 2WPDD 1ZRHA 4PSAA 2N46A 5JJIA 3VU9B 3AVOA 5L3RA 4D82A 2IYUA 1MO4A 3TH5A 2IS6A 1GNPA 1G18A 4M4SA 1G6HA 4P4TA 2O8FB 1RRFA 4B73A 4PFSA 4XVRA 4KLZA 4OI0A 4G5OA 3GCGA 2R6FA 1NIJA 1KTVA 3LO5A 3DDCA 4MYTA 4DIEA 1OT3A 2J87A 1IHUA 1UEJA 2WKQA 3CR8A 2WAXA 3QEJA 1DAHA 1KK2A 1KY2A 3TGPA 1ZC3A 1FQKA 4IHQA 1W49A 2WKRA 3THYA 3CH4B 4GMXA 4DUGA 3KQKA 1YR6A 2VIIA 1G8YA 1GUAA 1N6PA 4DSTA 4Q9IA 2DCUA 4IEEA 4LPSA 5CYOA 1U81A 5FUYA 4B32A 1UAAA 3IPXA 2XGJA 3PUVA 2QM8A 1GM5A 3VU9A 1KO8A 2CE7A 4PZLA 1R0ZA 2BBSA 3Q85A 3WMGA 4AG6A 5CYPA 5FI1B 1XEWY 1OXSC 1Q1ZA 3OEEA 2OCPA 5TDHA 1S0UA 1E1QA 3VR4A 1GNRA 1I2DA 4CF7A 4X8HA 5KSYA 2GJ9A 1R8QA 1GRQA 1G16A 1H8HA 2ZYVX 3CF0A 4IOKA 3V4FA 2ODBA 4FWIB 3IO5A 2OG2A 2L0XA 1D5CA 1G3RA 4ARZA 3ZH9B 2JIZA 2OBLA 5GJBA 1LS1A 3S1AB 4N3NA 3VR5A 2C77A 4HB3A 1FW6A 3U3MA 1CR4A 2BMJA 1SKYE 2IWRA 1W2HA 4KFRA 3B9QA 1MO3A 1XD8A 4EPWA 2NIPA 3TVDA 4UKDA 3KUDA 3L0PA 3MFYA 4RZXA 5E95A 4URVR 4B48A 1L8QA 4QJ3A 1T3SA 3PEYA 2X2FA 3K0AB 3KJEA 5HKKA 2BBOA 4LBZA 1Q3HA 4B3GA 4XSHA 2VBCA 2MMGA 3BORA 4V03A 3K9LA 4W7SA 2G88A 2TMKA 4DDTA 1T0HB 3GP8A 4TTQA 4PQYA 1ZM9A 1NMZA 1NMYA 4M53A 1TAGA 4MKIA 1NI3A 2Q3FA 4XD7A 2GWHA 3VTKA 4EPXA 3U5ZB 4XJXA 1AJEA 4TQ9A 1M1YE 5KO2A 1N6IA 3A4NA 3ZZUA 3OIVA 1IOZA 2FPKA 2O5VA 3UPUA 2PCJA 4YXWD 3A36A 5FOUA 1ZW6A 4GFDA 5BWMA 3S1AA 5FH9A 1W1WA 3I4LA 5CIWA 1T3LA 4P32A 4Q7KA 4F7WA 3LDAA 2OESA 3DZDA 2BCJQ 3FTQA 2ZRKA 4JLVA 2HYDA 4PHFA 1UPTA 3D7MA 4DEYA 1S3SA 1DE0A 2PLRA 3KFVA 4M1SA 3RHFA 3TSOA 3ADBA 4UNNA 1G7TA 3H0KA 4E03A 1JPJA 2BEJA 2O8DB 2B8WA 2REOA 2ZRHA 2P0EA 2WJIA 4HEJA 2IUUA 1X1RA 3A37A 3U7EB 4YMUA 3KL4A 3VHLB 5FPKA 1ANKA 2GAOA 1BMFA 2YV5A 4RFVA 2QPTA 4NYMR 2OLJA 3BWDD 3W6PA 2CL6X 3WRYC 5KNBA 3QVVA 4C7OB 4ZDKA 3UG7A 1CJUC 4H9GA 4DDVA 4PC2A 5FOTA 3RABA 3AGPA 1GITA 1FPMA 4NL4H 5HE8A 2H5EA 2QSZA 2R6AA 4WA7A 1ZNZA 3W34A 1W4RA 4OI2A 3LBIA 4IVRA 1OE0A 2EFEB 4TL9A 2VP0A 3AQ4A 4GRAA 4M0LA 3I3SR 4C0AC 4GMDA 1EWQA 4HAZA 3AVWA 2PL3A 4LI0A 1NVVQ 3KX2A 3LX8A 4H1VA 5JMTA 1ZINA 3I5YA 2WSMA 4GT1A 2XB2A 1NKSA 2IHYA 4B2PA 4GL2A 1ZJ6A 2OFXA 2IYWA 3T12A 5JS8A 4V0ME 1ZD9A 2QAGC 4A0FA 1SHKA 1E2GA 2HJVA 2KB0A 1E9EA 2JASA 2O8DA 4LBYA 2ZUDA 4B3XA 4DLXA 4QGGA 4WZ6A 2X1VA 5B57C 4A15A 4FMCF 5EP2A 5ELXA 1TL7C 1LNZA 1LW7A 2IEYA 1NY6A 1LF0A 4TSFD 2PJRA 5FPSA 3CPHA 4QBGB 3CF6R 1DOAA 1WCV1 4C7OA 1CR1A 4N1AA 4BEJA 3F0TA 2Q9CA 5GJCA 3FWYA 2GXQA 1CEEA 2V7QA 3RNLA 3VR3A 4P33A 3ZIAA 3VQTA 4HLCA 4HB4A 4Q9LA 4LZZA 1U99A 3BH0A 2CNWA 2A30A 3O8CA 4TWZA 3B1XA 1P75A 1RRCA 4PO8A 5G53C 2D2FA 3NIBA 2ZUCA 3PQCA 3IILA 1RZ3A 3NTUA 3LVQE 3MWYW 5BN3A 3TUZC 1CJKC 3WNDA 3RS3A 4GZLA 2IT1A 1H65A 1R0WA 3RWOA 4DLUA 4KYIB 4KV9A 3IQWA 1OYWA 3U3RA 5TVKA 1CULC 5H1YA 2VF8A 1GRNA 1E2KA 3LAWA 1HT1E 3LXXA 5E4FA 3PUXA 2JLXA 2ONKA 2OCAA 1NJFA 4A8JB 1KI1A 2O0HA 2WSSD 2GESA 2C2HA 4TN1A 2C99A 4O25A 3O8BA 1M7BA 4FN5A 3EPLA 2AXNA 2Q3MA 2B6HA 2N1BA 5AJWA 5E7IA 1IN5A 4NU0A 5FL7D 3L82B 4P3YA 4BFXA 2OSBA 1M2OB 3EW9A 2IUTA 4F38A 1HQYE 3IIKA 4FMCB 4AC9A 1VPLA 5G41A 3GLHE 1QHXA 4TMXA 4IDPA 3SFZA 1SVLA 5DLQC 1E9CA 4C0SA 3VHXA 1AM4D 2VP9A 3I72A 4BPBA 1Q3TA 5DN6A 4B3CA 4Q00A 1OFHA 5F9FA 3MCAA 1UBEA 2XJ9A 3EXAA 1PLKA 3IHLA 2WWHA 5DH9A 3RS4A 3UMSA 1ESNA 4A8JA 2GJSA 1YE8A 3ZGXA 2BBTA 2ORIA 2REXB 2GBLA 2REBA 1E0AA 3KJHA 1PLLA 1WBDA 3FMFA 3ND8A 4Q19A 2CK3A 2OV2A 4GOJA 1EX7A 2A5YB 5EXSA 1Z28A 2QGZA 4D4JA 2F55A 4NH0A 3CH5A 2AL7A 2PT5A 4GOXA 221PA 1E98A 1II0A 2A9KA 4L5BA 4KJZA 4U00A 5LB4A 3SYNA 1AA9A 1MRSA 3K70D 2CHGA 3GJ8A 2C8VA 4OYHA 4LHXA 3AUXA 3QG1A 2H16A 2J7KA 4X8MA 1OB5A 4PAQA 1P5ZB 2GAAA 2RKOA 1F2UB 1G5TA 4JJKA 2B92A 4MUAA 2WWGA 2ZJOA 1G7SA 1RVDA 3LNCA 4KVAA 4OHVA 1R6BX 4DCTA 4EJSC 2VHCA 3U2QA 3SQXA 2V6IA 1JJ7A 4O3MA 1KNXA 3NBFA 1U98A 1O3YA 2GVDC 5JS7A 1KO4A 4DLYA 4EIWA 4DLTA 1BIFA 4IOMA 3GLIB 3ZVMA 3ONWA 4AG5A 1D9XA 1S1MA 4IEIA 3OEED 1JXOA 3HR7A 4AI6A 1E1QD 2IL1A 4ESVA 2ODWA 2ASEA 1C1YA 3BOSA 1T5IA 4PPFA 3NXSA 4Q1EA 1AZTA 4MKFA 4PC1A 3WNCA 2P3SA 1P73A 4IRUB 4ZI3A 5BXQC 3ZS8A 1FZQA 3H4MA 3AVUA 2JIZD 2QA5A 4Q5IA 4MGYR 2R9VA 3LY5A 5AK0A 2G0TA 3IBYA 1F2UA 5LBIA 1G21E 4TL7A 3CPEA 1T4GA 2XEXA 3IDQA 1SZPA 1TQ6A 2VLIA 4B2IA 5CB8A 1E2QA 3FDIA 3TRFA 4V02A 1KGDA 3RDPA 5F3WB 3C8UA 3ND9A 3K9GA 5SZHB 2ZE7A 2IUSA 1OXUA 3HDTA 2JJ8A 4GPTA 1DS6A 3RS5A 1UFQA 4US0R 1WA5A 4Q18A 1QZXA 5HKKD 2O52A 3K0CC 3PV0A 5J4KA 3G82C 4HAVA 1FQJA 2OCYC 4M2LA 3WP1B 2I1VB 4JSTA 5DISB 5J5CA 2ODNA 1UKEA 4XD7D 5FR2A 4NP6A 3SDZA 4IDNA 4UXHA 2GRJA 4HB0A 4JT4A 5SZIA 2IYQA 4JBXA 3C4JA 5EXXA 1XTJA 4D4LA 3P27A 1G20E 3VNVA 5DSZA 3SHWA 1GL9B 2QMEA 1AS3A 2FJUA 2YOFA 2AWNA 1NJGA 4RY2A 4DDWA 3BH7A 3CNOA 1E2JA 2A2ZA 2R6GA 3ZVRA 4Q47A 4PANA 4LDJA 1RC8A 4Q1CA 3MJRA 1S96A 3R9IA 1N6HA 2UZ3A 2ZR7A 3U6BA 3B5JA 5AJXA 3FB4A 4JYBA 4M1MA 4YMWA 3SI7A 1Z06A 4DB2A 1BMFD 3H2YA 3EASA 2A78A 2BHRA 1KMHB 4HYYA 2MMCA 2GZDA 3REFA 2YVUA 5HZKA 2QAGA 3TQFA 2BCGY 3Q3JB 4A2WA 3WP0A 2E1RA 1UEIA 2BV3A 2FMXA 1GP2A 2P5TB 1AKEA 4RD6A 1VG9B 4URWR 3RRYA 2VHTA 4MUBA 5FL3A 1YRBA 4E07A 1MABB 4A1FA 1II9A 1X3SA 1CRQA 5EZ6B 3CM0A 3ZD7A 1G4AE 5EE9A 1ZCAA 4IXNA 3NBXX 4UJ5A 3AP2A 2FEMA 2FGJA 3CLVA 1KI6B 3DHWC 3UXMA 3FHTA 3N70A 4M9ZA 2ZIAA 3SFVA 3A1UA 1OH6A 1KSFX 1ZUNB 621PA 4L15A 2H8KA 4RD3A 5ANRB 5FUVA 1KMHA 2GF0A 4LV8B 3DPUA 2F7SA 2ZJAA 3GEHA 3AF2A 5KYKA 1XD2A 2V7QD 1FOEB 3Q72A 1ZIOA 4KI0A 3ZIAD 5A4JA 4OHWA 1NBME 1LV7A 2RGNC 3TAHA 3VR1A 4XOIA 2XXAB 2OAQ1 2CNWD 2NZJA 4A82A 1BYIA 1RFLA 1RKBA 3B8HA 1P7CA 3PIRA 1JI0A 1MABA 2JLWA 3E1SA 4Z8YA 3MG9A 2BEKA 5JEDA 4TQAA 4JL8A 4D6PA 2HF9A 2ZTSA 1G17A 1CR2A 2RGEA 1KI6A 1JQJC 4M1WA 3RVBA 2FX3A 2BJVA 2IEZA 5TV2A 1OW3B 4G0NA 2C95A 1M74A 2YWFA 3P32A 1KI9A 1PJRA 3QPUA 1KJZA 1E2DA 1SKQA 4CGZA 3LW7A 4NKRA 4DCUA 1XJQA 2ZUBA 5DI9A 2BVNA 4OK5A 1VTKA 4D25A 1ZP6A 4MRPA 3O8RA 2QPOA 4NBSA 4KLNA 3AF0A 5DI3B 1NLFA 2ONJA 4I1SA 2JCSA 2AN9A 5L3SB 3RS7A 3WYFA 2XXAA 3CX7A 5DIFA 3TIFA 2IF0A 2XSZA 5JWRA 1XMIA 3R7WB 2PX3A 2C9OA 4C0LA 2DBYA 1MKYA 4EJSB 1E2NA 4G1UC 1KO5A 1N6LA 3WHKA 5J40A 4Q48A 2H7VA 3WRXC 5AUOB 1OPXA 3EZFA 3I62A 3X2SA 3LBHA 1EG7A 4C0HA 2DWQA 4JBYA 4NPHA 1YR9A 1DO2A 4WXPA 3I73A 3W3ZB 3ZD6A 4RCYA 5DN6D 1E4YA 4ZDIA 5DNYB 2DPXA 1GKYA 3OFND 1KNQA 4V0LA 3NC1C 3TW4A 3V00A 3B13B 2Q9AA 1XB2A 5DI3A 2P67A 3I8XA 5CJPA 4A0HA 5L3SA 3EAQA 1KJWA 3BB1A 4DC9A 2OUKA 3CO5A 1YZQA 1XZPA 1E4VA 2KI5A 1D6JA 1L4YA 2PZEA 2ZRNA 4ZV4A 3R7WA 1XFAA 5EZ5A 2V4ZA 4EJSA 4GP6A 4Q4LA 4D0LB 1VDZA 3U60B 3V4RA 1JNYA 4D2IA 3EIEA 2LKDA 3BS4A 3SJBA 2ZU0C 4CEIB 4TT3D 2O0JA 1W5SA 3AV0B 1T0JB 4DIDA 3NDPA 1KI4A 2DFKB 1IQPA 1I4DD 1DARA 3IEUA 5KHOC 4KBFA 4LUCA 4CEHB 1XEFA 1DAMA 1VCOA 2IYXA 1E9DA 3GJ7A 2VSFA 3T06B 3VX3A 4CIDA 2IC5A 3LA6A 3VNUA 3KQNA 2QT0A 3QPVA 2E9SA 4PR0A 2YYZA 5K8TA 3PEUA 1XCMA 1P2TA 3QEOA 4DSNA 1GL7A 2G6BA 1NN1A 3NDBB 1IN4A 4BZPA 2CVHA 4TYWA 1IXRC 4AY2A 2XOKA 4ZCIA 3K0CA 4CEIA 2RH5A 4TMWA 121PA 3HYTA 3M6AA 3QIAA 1HYQA 2C96A 3A58B 2JGNA 3TSZA 3HWSA 2PT7A 2WOJA 1GKUB 2VQSA 2WKPA 1VYTA 2ZI4A 4MRNA 1QVAA 3FPAA 4DCVA 2NO7A 1ZYUA 3WBJA 3ZVNA 3IIMA 4DT1B 4CEHA 1UBFA 5CM8B 2J1LA 4NONA 2PLFA 4TMVA 3TK1A 1E9SA 4F93B 1ZNWA 2FSFA 1SXJC 2XAUA 4DHEA 1NNEA 2NOAA 2W2TA 2WZQA 4PAOA 2J0VA 3T5DA 5IHPA 3Q5EA 1Z2AA 4W5WA 2EYUA 2C9YA 2I4IA 1KI2A 1XMJA 4FIDA 1YHNA 1KK3A 3BAFA 1TF5A 1GAJA 2H17A 1G1MA 2I1QA 2QY9A 1E2LA 3JVUA 3U3JA 1AQUA 2HT6A 4LBWA 4RD1A 3LW8A 3RRMA 3WYAA 4URZR 1NLYA 1TPZA 1VIAA 2QRNA 5BW8A 2AWOA 4K8OA 1JXMA 2YOHA 5J4YA 4A36A 3GMTA 2JATA 4KITB 4XTCS 1HTWA 5LPNA 4R98A 1FUKA 5KNCA 3LBNA 4A8JC 1OFUX 1Z22A 2IF2A 2LWIA 3UMRA 5AWFC 1CRPA 1CTQA 4DT1A 1J99A 2JLVA 1O87A 2F9LA 3T5GA 4HZUB 2GBLC 2NPIA 2OE2A 3B82A 1RIFA 2GCNA 4P31A 3UIEA 5TMPA 2IK8A 2DWPA 1U90A 1G41A 1XP8A 4C2UA 1MV5A 1V43A 5JCPA 4LWZA 3CX8A 4HZIA 3X1ZA 5CK5A 2CJWB 4OQMA 3L0IB 3FKSA 4XVUA 2OXRA 1IXSB 5E3HA 4RD2A 5E7MA 4OQLA 3QKRB 4BRUA 5JCZA 5KU1A 5FFMA 2O8FA 1W4BA 3QXJA 2OO7A 4Q1BA 1DELA 4HAXA 4TTRA 4PPQA 1NL3A 3RLFA 2Z43A 3QE0A 1XZQA 2H92A 1OFTA 3BXZA 3QXSA 2XZLA 1CXZA 2RGNA 3VR6A 1FFHA 4HZUA 4U02A 3P26A 4K81B 2WWYA 3QNUA 4ZKEA 1E9FA 4FW9A 2P5SA 4AURA 4ZIRB 4B6FA 1F5NA 4BFTA 1VIYA 2ZE5A 1WDTA 3MMPA 4BFWA 1R7RA 5C2JB 1XPRA 1YZNA 2B21A 2JAQA 2CJWA 2FSIA 3EC1A 2RGGA 2D3WA 2XTMA 1SQ5A 3EZ7A 3BH6A 1MOZA 2IYSA 4DJTA 2LCFA 3QF7A 4PZYA 1GWNA 3QKRA 5LDDC 5B2ZA 1TTTA 2P6RA 1R5BA 5FR1A 1M8PA 5A5GA 3DMNA 1HUQA 4TLDA 2IS2A 3WMEA 3HYRA 3MSXA 3BFVA 5FTLA 1EFHA 4EPRA 3CR7A 1UKZA 4S2EA 4W5JA 1NVWQ 1M7HA 2ZRCA 4QM6A 2GVZC 4PO9A 1LTQA 4AKGA 4ON9A 1EFRA 3TMKA 4IFEA 1FP7A 2FU5C 3OAAA 4EQ6B 3QVUA 1WBBA 1R10A 3F8TA 2XJ4A 4RZUA 4MH0R 4MYUA 1N6KA 1Z29A 2D62A 2DFTA 1ZUIA 4B47A 4Q03A 4ZIRA 1MH1A 1T5LA 3DZ8A 1E69A 1KHTA 2RGAA 2OCBA 4PSKA 1VG1A 2NO6A 2FA9A 2QGNA 3HPQA 1GVNB 2GF9A 4PQFA 2ZYWX 1US8B 3R9XA 4P4UA 1QHGA 3Q8XB 2BBWA 3K0AA 1Z6YA 3KQLA 4C0BA 3OEHA 1E2FA 4XH9B 2Y8EA 4UNQA 4D26A 5TB5A 4Z8XA 4JVLA 3BIFA 4QFMA 8OHMA 821PA 2XSZD 4OKSA 3SBEA 2J0QA 1PLJA 2FSGA 3GLGB 3CF2A 2HCJB 4ZDWA 4AWXA 1DAFA 3W8NA 5KPJA 1NN5A 2CVFA 4YLGA 4YMSA 3QBVA 4P0TA 1A7JA 3K0SA 1G3IA 1OB2A 4EQ6A 2FEOA 1D8TA 1ZM4A 1E3MA 1YR7A 2BJWA 2XTNA 4OK6A 1NSTA 5CLQA 1GNQA 3DOFA 1J2JA 1WP9A 1I4LD 5P21A 3FMPB 5KDOA 4PX9A 1KKMA 1CJMA 3K0EA 4LRWA 5HE9A 5KUTA 4I1OA 3TBKA 4C0JA 3NG1A 2IYRA 1S2MA 1EFCA 1GZSA 1LB1B 1XCPA 1Z0IA 2Q21A 3PCRB 4URUR 1US8A 4HLQB 4FCWA 5IT5A 1W7AA 1G291 1G4UR 4M9SA 4EAQA 3B1YA 1VCMA 4QNRA 2FFAA 2VPPA 1QBKC 4KO8A 4MDFA 3CW2A 1HV8A 1ODFA 1TUEA 3H84A 3TAUA 1N5LA 3RS0A 3VAAA 2W6IA 4IOLA 4JL5A 1JPNA 2ZANA 3THXB 3F5FA 2V6JA 1I2MA 4EDHA 2AR7A 3AKEA 5AUPB 2ECKA 2JLSA 1SXJB 2Q9BA 1JR3A 5JECA 2PZFA 2W00A 4KU4A 1VKJA 4L9WA 3D6TB 3T34A 4CEJB 4TMKA 4B34A 4TZ0A 1HE8B 4HLUA 2CCGA 1AS0A 4NDZA 4MRRA 4PAMA 1U8ZA 1ZCBA 3T1QA 4WVFA 2OT3B 5EP3A 3CRW1 5FTKA 5FBWB 1FL9A 4XIGS 3Q7QA 5FPYA 1P60A 3HPRA 2HT1A 1ZNXA 5EJEA 5A0FA 4OI4A 2NO9A 4RKEA 5EE1A 3EZ9A 4ILEA 2C5LA 4D4KA 1QF9A 1E79A 1Z2CA 3E2IA 1ZUHA 2FZLA 4LJ8A 5CDFA 2QG6A 1N5KA 1W36B 2R65A 2V54A 4DSUA 1AIPA 3DM5A 4B75A 5FBRB 2JJ1D 4O2LA 4KSCA 2JA1A 2JLUA 1SXJA 4FMBB 2XOKD 3PUYA 2QTHA 2NPFA 2NO0A 4BLRA 3EA5A 4Q02A 2QNRA 4CEJA 1XTIA 2XITA 4NYJR 2OFWA 4DEXA 2F1RA 3ZS9A 1F2TB 4NCKA 1JEEA 4PZZA 1LVGA 4BQSA 1P4SA 1TX4B 3IEVA 4KXFB 1D2NA 4O0MA 3UATA 3HU2A 2J59A 2ZAOA 1QG2A 4NCJA 3TSWA 3CRQA 1GL6A 3T35A 4ZDJA 2FG5A 1Z0FA 2ZR9A 1UBCA 1IJEA 3RS2A 1FP6A 2QEQA 2RGDA 2ZJBA 3LVRE 3RSOA 2IYTA 3OFNA 1Z0JA 4AYTA 2F1HA 4B33A 2QRZA 3H86A 4NYIR 3C16C 1CIPA 1EFTA 5DYGA 2FPMA 3GLFB 2NMVA 1JR6A 1J8YF 2EYQA 1IXZA 4A6PA 1AS2A 4OBEA 2H57A 1F2TA 2YNMA 3CKLA 3QKUA 2JLQA 1P72A 4IJMA 1Y3AA 2A3RA 2IYVA 3SR0A 4KFUA 1NSFA 1A82A 4LJ7A 4RVCA 2NG1A 4BRWA 5F98A 5DE3A 3QSYA 2QSYA 4TT3A 4TYYA 4RZ3A 2IS4A 4G3XA 1N0VC 2BMDA 3CBQA 1XTKA 1V5WA 1FNNA 1XWIA 3QJYA 2W6JA 1DBSA 2PCLA 2QMUA 1KY3A 3PVSA 2R62A 1JR3E 4DBLC 2IA5A 3C5HA 3FOZA 1XXHB 1G8HA 4E5UA 1X8KA 4HLDA 1UJ2A 3MLEA 3FKSD 4AD8A 3GLFA 4RD4A 3L8YA 4WBSA 4JS0A 3KXLA 2GCPA 3CNNA 1JALA 3QKSB 4TLCA 3KB1A 3CRRA 1TEXA 4MDEA 3IQXA 2GZHA 4FINA 4DKXA 3AVPA 4HUTA 4BLOA 3JVVA 3SJCA 4JL6A 1U0JA 2K5UA 4QHTA 2ZE8A 1HT2E 3PITA 4NTZA 2R2AA 2QTVB 3L8ZA 2FFBA 4C0QC 3I1FA 1XCGB 4CDGA 4ZCLA 3EC2A 4R7ZA 2OBMA 4A0GA 1NIPA 1AGPA 5FTNA 4IDQA 4JLMA 2BWJA 3HR8A 2BMFA 4URYR 1NVVR 3RSLA 2ZRAA 4JLAA 1SXJE 3CPJB 4AIIA 2BOVA 4TQUS 1Z6XA 4G5SA 4OL0A 2W0SA 4JKYA 4M22A 1XXHA 1MR3F 4QM7A 1G8GA 1E9AA 2QT1A 2NZ8A 3H1TA 3QKSA 1X8LA 4QJ5A 1E6CA 3TUIC 4F4CA 1NP6A 3GLIA 4RKFA 4JLOA 1EGAA 5FTMA 3KKMA 5EXPA 1G64A 2R44A 2OEPA 1BO6A 3DKPA 4OQNA 1EWRA 2GDJA 4X8LA 3DEFA 2WJYA 1CU1A 1JECA 3W90A 1XTRA 4K46A 3ETLA 3SE0A 1EFRD 3WY9A 1J7KA 3OAAD 4UNRA 3R8CA 5GJVC 3QPWA 1OH7A 3J81k 2P6UA 2AK2A 4Q9JA 1RPZA 1ETUA 3BFXA 2EFCB 5KDLA 1KAGA 5M04A 1QHYA 3B60A 2NO1A 2RHMA 4NE2A 1R0YA 2IHBA 5BYJA 2OFOA 3U7GA 3B2EA 3VR2A 4Z51A 1GTVA 1OXXK 1KSHA 4CRWB 2YKGA 4QNMA 1IAQA 1KZ7B 1XU4A 1G3QA 2O8CB 1LS6A 2H18A 2VTKA 2J5XA 3OEHD 3W8RA 4TYPA 4FCTA 2OLKA 1FTNA 1T91A 4PPNA 1KI7A 4DWJA 1P2VA 3E5HA 2LKCA 2J0UB 1G3UA 5EP4A 3DVLA 2V8OA 4OHYA 4OJQA 1ELOA 2GHIA 5L3VA 1TUIA 4I1UA 5AJVB 5B30A 1S1CA 2J45A 2ORVA 3CRMA 4EPTA 2ZSAA 3QY0A 5F2EA 3RWMB 4HAYA 2FN4A 1W48A 3PXGA 1NN3A 4TLAA 2VEDA 3CUEF 4HDOB 1NVXQ 1Z0DA 1U0LA 1Z0KA 4MGIR 3W5JA 2ZSBA 5TY0A 3IGFA 1VHTA 4DLVA 2Q0HA 3KKNA 5DHAA 1XPUA 3N2IA 1J70A 2O8CA 4IOJA 1OH8A 3P4YA 1VCNA 4BUJA 1PUIA 3SEAA 2KBFA 5H68A 2NGRA 2GTPA 2GILA 1KSJA 2IW3A 5HR5A 4AKHA 2W6ID 3LD9A 4D80A 2J0UA 1G19A 1SHZA 1OV4A 1VCIA 3KKQA 1CR0A 1U9IC 4G5QA 5EP1A 1CBUA 1OIWA 3U7HB 1F48A 2RB4A 1JR3D 2HUPA 2QMHA 4M9XA 4MYHA 5JEEA 1XJ0A 1NN0A 3M0EA 2ZJZA 1E1RD 5D3QA 1QHNA 3ECCA 1L4UA 2ZVPX 3C15C 4EPYA 2DB3A 2CEAA 5E7JA 2CL0X 3CIOA 2EW1A 2ZSEA 1JB1A 1W2GA 4MRSA 3A6PC 2J0SA 2YWEA 3GLIE 4PC7A 3FVQA 1TU3A 1Q12A 1ZVQA 4IDHA 3B7GA 3KB2A 3MGCA 1W4CA 1TF7A 2YWGA 1SVSA 2FNAA 2QI9C 1E79D 1OSNA 1KDPA 1Q21A 1QG4A 1ONBA 1Y63A 3I8SA 3L0SA 3WYGA 5KPDA 1F3OA 5K8UA 2JLYA 2HLDD 1OH5A 1IY1A 2GCOB 1DAGA 4TMTA 2ZXUA 4JLDA 1ZU4A 4GDFA 1SXJD 1J8MF 3U44B 2ZJ2A 4KBGA 2VHUA 3AP3A 4OK3A 5LD2C 1DAIA 5EUQB 4OQXA 2ZS8A 1S9HA 2G1KA 4EFNA 4JBWA 4LV6A 1ZNYA 2AD5A 1SVIA 1KI3A 2GK6A 2WJJA 2WMOB 2X77A 4A4DA 2WIAA 5JHHB 1Q0UA 2IXEA 3KXKA 3LWNA 4PC3A 3WNBA 2ATVA 4Z1MA 5JRJA 2DYKA 1DG3A 1YVDA 2EWVA 4Q21A 4P4SB 2AX4A 2HEIA 2WMNB 4EKDA 4LHWA 2ZRDA 4Q1DA 1KJYA 2OAP1 3T1OA 5G3ZA 4DVGA 1NVUQ 4C0KA 3DOEA 5JWHA 2Q3HA 3MWKA 4FD2A 2BDTA 1N3BA 1R2QA 3KUCA 4A0RA 1TQ4A 4N0EA 3O47A 5FBLB 1YZTA 2IX3A 2GCOA 2BC9A 1VHLA 1W36D 1IJFA 1PVOA 3A1WA 3FE2A 3PUZA 4MITA 1N6OA 3A1SA 2JLRA 3AF4A 4KFSA 4KSBA 4DLRA 2JDID 4NCIA 3U44A 2FF7A 1E2MA 3ZZ0A 4DLZA 1G7RA 5AJYA 4GOKA 4CVNA 3BFKA 1COWA 3REGA 1Z07A 2CMKA 1TQDA 4IVQA 1R8SA 3IIJA 4ZPXA 2VH5R 5C18A 2QL6A 4YQFA 1E2EA 4LGMA 4P4SA 4LJYA 5GJWC 3BC1A 1Z6GA 1CJTC 3NBZC 4YDSA 1Z83A 3AKDA 3AVQA 2JLZA 3GEEA 4I4LA 2A5DA 4QBHA 1JAHA 4KVGA 3DO6A 3AVVA 4D0GA 2WWWA 1GOTA 2W6JD 1P62B 4Q1AA 4R2IA 3W6NA 5JBQA 3PFIA 1KDOA 4ITRC 2CL7X 2D7CA 4TL6A 3BB4A 1NG9A 1JAIA 1SKYB 3GJXC 3ADCA 2FDCA 1PV4A 2QP4A 3CZQA 4V0KA 3AP1A 1MO6A 3M4YA 1FTSA 1P61B 3QF4B 3QXCA 2ZETA 4PHGA 5DGXA 5AUQA 1IONA 5J47A 2ZS9A 4KHZA 4HLUC 3K8YA 2PMKA 3G0HA 2IYLD 3VKHA 4KAXA 1YZGA 2XX3A 5TXGA 4JT2A 2ZYUX 1Z63A 2JJ1A 2QU8A 2WWXA 3SU8A 2RHDA 4HAWA 2WHXA 721PA 1P9RA 3K1JA 1I4TD 4I1VA 4G5GA 1P9NA 3V9PA 4GZMA 2HXSA 2HDNB 2PEYA 1PZNA 5BN5A 4A2QA 4NYMQ 1XMVA 4C30A 1XTQA 3SHFA 2BM1A 521PA 2GXAA 1E2PA 4X8OA 2WVJA 1W0JA 4N0DA 4MYCA 3EZ2A 2EFGA 3QF4A 2XNDA 3FKQA 4NCNA 1N6NA 1GKIA 2CDNA 2VSXA 3CNLA 4M8NE 3SS8A 3CRVA 2ZJYA 1LY1A 1H8EA 2ZREA 3PR1A 5CIQA 3GJ5A 1HQCA 2ZSDA 1WF3A 1QHIA 4A2PA 3U6KA 3NVAA 1QVRA 2VF7A 4DLWA 1A1VA 3EPHA 1PUJA 4Q4JB 4XWAA 1RW4A 4JLPA 4BFZA 3TE6A 1TNDA 4DCNA 2GEDA 3FMOB 1MT0A 2J7PA 4RFSB 3BBPA 2BKUA 1WRBA 4A92A 4ERNA 2FWRA 3EIHA 4JJZA 3RRNA 3CX6A 4LSGA 3B6EA 1FNMA 4CZ2A 4R2HA 3GJ0A 4GNKA 1E2IA 3K9HA 3P1JA 3A8TA 5CK4A 3KKPA 1W36C 4XSGA 4PSVA 1YU9A 2DHRA 4WZAE 2SHKA 2P65A 3TR5A 4KCGA 5AUNB 5B58C 4URXR 2DY1A 4AKIA 4QBFA 3EX7C 3GFTA 1P2UA 3JZAA 2X19A 4IFBA 1EFUA 5HTKA 2IYYA 2AHOA 2VA8A 4HUQB 4Q9HA 5FUWA 1ZU5A 2QQ0A 2O8EB 1N5JA 2ZI7A 1X6VA 2ZJ8A 5D3MB 2GETA 3W9YA 4Q4JA 3VKGA 5H70A 2NTYC 3U7FB 2G9NA 2ZRJA 5FI0B 2C9CA 3PEVA 4RFSA 4C4PA 4YC7A 4AYXA 2QE7A 4ARZB 2Z6VA 2PJZA 2F6RA 2ZSFA 4GBMA 2Z4RA 2B7BA 4BLPA 2C03A 3Q7PA 2HF8A 2Z83A 1GILA 4MRVA 1JQLB 4M21A 1U9IA 4DRZA 3P4XA 3FYHA 1P3JA 3NEYA 2IWHA 4BLQA 5LD2B 4L4UA 5GVSA 3ASZA 4ZO4A 4JLBA 4LC1A 4DZZA 1KOFA 4I99A 2V1UA 3C5CA 1ZM3A 4M1KA 1D2MA 3AF3A 4IDOA 4YMTA 4V0MA 1YKSA 3RRZA 2F9MA 2ZAMA 4V0NA 1E32A 4HUQA 4NYJQ 3D3QA 2O8EA 4MA4A 3HU1A 1W47A 4TLEA 1SVKA 2FSHA 3CZPA 5D3MA 2FFHA 2WBLC 3ICQB 2P6NA 4HDCA 1T8UA 1ZAKA 3P20A 5K8IA 1KO1A 2H1LA 1G8FA 2F3TA 2ZM5A 1F60A 2A5FA 5TARA 3KTAB 2AKYA 3T61A 4KFTA 4Z54A 3WHLA 2MSEB 1XEWX 1NF3A 4B3BA 4QC2A 2RCNA 2ORWA 3C41J 1ZC4A 4NYIQ 3QENA 2RMKA 4ESHA 5C4GB 1AGRA 2A5GA 4M1TA 3UMFA 1IN7A 1XD9A 1CKEA 3LLMA 4NMMA 2Z0MA 2UVQA 3GLHB 1ZMXA 1VMAA 1XEXB 4F92B 5BN4A 1ZBDA 3AKCA 3VFDA 4JVMA 2ZI3A 1C9KA 2WTUA 1OYYA 3K0FB 3W3AA 1FMJA 3GQBA 5C4MA 2NQ2C 4NCHA 1HY3A 1OIXA 1SULA 3EZ6A 1OLOA 1NKTA 2JJ2A 3GEIA 3W5IA 3B85A 4F4IA 2Z4SA 5C1BA 3AVTA 1TF2A 3UANA 2QUZA 3MJHA 3GPLA 1U8YA 3SZRA 2CE2X 4Q9KA 3Q9LA 4YONB 5H8WA 4U5XA 4US1R 1U2RA 1UBGA 3LXRA 3VX4A 3BE4A 2A5JA 3QXHA 3KTAA 4KODA 4G01B 2JEOA 3DL0A 1S9DA 1XNJA 4Z1MD 4CT5A 5B64A 1KMQA 5F9HA 4ACBA 4PQRA 3LRPA 2GXSA 1P9WA 2F1JA 3ZQJA 4JLNA 1YZKA 3U3KA 4BECA 2AD1A 2YOGA 3BD9A 2HCBA 1TEVA 2QTFA 2ZRFA 2MSDB 3TNFA 2ZVQX 3EARA 3GLHA 1YRAA 3SJAA 4II7A 1MRNA 3LH5A 1XEXA 4W5HA 2QORA 5J4LA 2PBRA 2J46A 2R8RA 2XNSA 3TKLA 1L7VC 4RCZA 4EPVA 3MRSA 3K0FA 1B0UA 3K09A 4QHSA 421PA 2FZ4A 2IYZA 5EXTA 2R6CA 4UJ3A 4B71A 4PHHA 3R8FA 3OIUA 3TVTA 2KSQA 3ZDQA 2ZJ5A 1LF5A 1KO7A 2WM9B 3EA0A 3MUFA 4FCVA 1W0KA 1COWD 4TMZA 5KTYA 1N25A 3IHWA 1XTSA 1QRAA 4I81A 3EWAA 5KDDA 3L43A 5AR1A 3GLGA 2ZR0A 1X1SA 4Q4HB 1Z8FA 2EFHB 4Y0VA 3RC8A 5BQ5A 1UKYA 2EQBA 3PJRA 4LK2A 2VP4A 2WJVA 1DADA 5JJKA 1E1RA 4HATA 2ZS7A 5KSPA 4B3DA 1UDXA 5EUMA 5CITA 2FPLA 3FHOA 5JFGA 1VYVA 3L0OA 1AQYA 4FMDF 2C04A 4BZQA 4W9MC 4D0NA 2VP6A 1CS4C 4DCSA 1AN0A 5FTJA 2G0NA 4QGFA 2ANBA 2RGCA 4QL3A 4FI3C 1ZM2A 4QKQA 4PPGA 2HLDA 1XF9A 3F3YA 2ZI6A 3N5CA 3SC3A 4ZI2A 4Y0AA 4BASA 4JIMA 3THXA 3KQUA 4Q4HA 1M7GA 1WB9A 1UF9A 3AB3A 4A6XA 3QBTA 2CHQA 2O8BB 5GADl 2WICA 1GSIA 4ACAA 1GFIA 1NG1A 1R5OA 2QBYB 4BE7B 3QQ5A 1G3MA 4LJ5A 2FV8A 2ZRPA 1SVMA 4FXPA 3R20A 2UZIR 1M34E 1YJ5A 2G83A 3QG5A 3AUYA 1OXTA 1KAOA 1VYUA 3FMIA 3KKOA 2QZ4A 1TMKA 3SQWA 3FHCB 2GEUA 4HSEA 5G3YA 1OF1A 1Q20A 1W0JD 5DO9A 3T1VA 1AZSC 4CW7A 4BGDA 1S3GA 4UNSA 4M1OA 1U8AA 2A7QA 4U7DA 2XNDD 1JJVA 1FX0B 1E0JA 2YWHA 2Q6TA 3ASYA 1H8ED 2ZE6A 4UQOA 2YC4C 3NBYC 2OXCA 2R6DA 5FOXA 2CLDX 2G77B 1A5TA 1AK2A 3T1TA 4ASUA 4Q01A 5JJLA 1NLZA 2O8BA 1P6XA 2EVWX 5FOWA 1E9RA 2JDIA 5JI3E 2QN6A 5J4HA 2QBYA 2J7PD 1JBKA 3A4MA 4B43A 4FMDB 4C9BA 3A1TA 2F43B 5KSZA 3EPKA 3X1XA 1S8FA 4AYWA 1BYUA 1ESMA 1AKYA 5JHGB 5LB2A 3IKJA 3TLXA 1HURA 3QKTA 3OE7A 3LQQA 1L2TA 4ABYA 4XTRA 1DO0A 5JLJA 4JMPA 2ZEJA 3RAPR 2VP5A 3KDSE 2WIBA 2QENA 1QDEA 2DWOA 3U61B 2RAPA 3NH6A 2YJTD 3TUJC 1UADA 3HU3A 2HYIC 1FX0A 3GLGE 2CLCX 2N42A 4HAUA 3ZVLA 1B23P 3GJ6A 3U3OA 1DG1G 1BH2A 1OHHA 4KYUA 1FUUA 2ANCA 2F3RA 4QRHA 4B76A 3KXIA 3PG5A 4HB2A 5CJ2A 1E0KA 1K5DA 5FUXA 5SZKB 1IM2A 1YZLA 3GJ4A 3CB4A 3CONA 4QGAA 1A2KC 2QE7D 1GG2A 2F43A 1S4QA 4DUGD 4Q66C 5IK2A 2IXFA 1T6NA 3DMDA 3ADDA 4Q1FA 4JKIA 2ZPTX 4JYCA 4E22A 4LJ6A 5CB6A 2CXXA 2W2XA 1E9BA 2BKEA 1YZUA 3ADKA 1M6NA 1Z0AA 5EE5B 1MO5A 4BFSA 1G8PA 5CDFE 2PH1A 2WOOA 2HJGA 4GSYA 3OZXA 2W0MA 4ZCMA 1W4AA 4L9SA 3PENA 4Q7LA 4XVQA 3B78A 4MQBA 3FFBA 1TU4A 4MKHA 1E2HA 1DVRA 2GA8A 1DTSA 4AK9A 1TADA 1OKKA 2Z5FA 1GDDA 1EXMA 3THOA 2J3EA 1H8HD 2WJGA 3LQRA 3OIYA 4JLJA 2AFIE 1OXVA 3I32A 1Z6AA 3BGWA 2WWIA 2V55B 5GVRA 3D8BA 2RGBA 4OHZA 1ZD8A 1BOFA 1RYHA 4O2RA 2YINC 2MSCB 4OJKA 1NBMA 3DM9B 4YDHB 3B9PA 4C3ZA 3X1YA 3N2EA 3QI2A 4BFUA 3SN6A 4B74A 4TLBA 3I61A 1G7CA 3GJ3A 1CF4A 5JSZB 3U4QB 2D74A 1XMSA 5EE0A 2XB4A 2GZAA 4OQFA 3WMFA 3IO3A 1HH4A 2ERXA 4Q7MB 4PO1A 1Q1EA 3HJNA 3O8DA 3NEJA 4H1UA 3SBDA 3E70C 5JRZA 4ZKDA 2ZRLA 4IW3B 3SOPA 1SVWA 2PMDA 3LFUA 3OHMA 4M9QA 4PC6A 1UKVY 4C2TA 2QROA 1XPOA 1KK1A 4XWOA 3B1ZA 3M1IA 4LV5B 2QAGB 2WPDA 2PEZA 4EUNA 3GD7A 2JJ2D 3BRWD 3PUWA 4RJLA 4M1YA 3DKVA 4J0QA 2OILA 3UWKA 4EFLA 4BLTA 3UG6A 3KJIA 2ZRIA 1ZM7A 4LOAA 3HP1A 4DB4A 1GRRA 2B7CA 4WIAA 1FMLA 1BS1A 2CLSA 2BIFA 1EX6A 2VHJA 2VL7A 1A4RA 4JVSB 1E96A 3EWSA 3LLUA 4A9AA 3SNHA 1LFDB 3THWB 1UM8A 5JSZA 2WWFA 3U4QA 1N2CE 3ZQ6A 1D2EA 2B8TA 3EG5A 1XJCA 1Z5ZA 2ZRBA 1OJLA 2PZGA 3AH8A 3TW8B 3OESA 1W46A 1E94E 2GJAA 2UKDA 5FOVA 1RJ9B 1QHSA 4BFYA 2YHSA 3GLFE 1R5NA 2QAJA 1W5TA 1U0HC 3R9WA 2BM0A 2EWWA 4WZBE 2W83A 2FOLA 3K70C 1Q57A 3EPJA 1XD2B 2ZITA 3NHAA 3B1VA 3CWQA 1N5IA 1Q22A 5KSOA 2CCJA 1W0KD 2ERYA 1Q1BA 6Q21A 1T9HA 4LYFA 1XDBA 2AFHE 4RD0A 1QHHB 2F1IA 5IRCD 1KZGB 4D81A 4OHXA 2E87A 2VHQA 2J41A 3VMFA 4LJ9A 5FOSA 3THWA 4XWKA 4Q7JB 3TQCA 1KDRA 1T8TA 5HCNA 2WAYA 1HA3A 3IPYA 2W2VA 5JZVA 2OM2A 2AK3A 2ZYTX 2GNOA 1G6OA 2W58A 3I92A 2VYFA 4JLKA 2IBMA 1RJ9A 4RSGA 1XXHE 3QXXA 4UXIA 4DLSA 2GJ8A 1CJVC 3OF5A 4WW0A 3ZLJA 2O0KA 2V9PA 2OBNA 3LV8A 1NY5A 4B2LA 4PHTA 4UNPA 1N0WA 4IXMA 1W44A 1OIVA 5IDVA 2X2EA 4US2R 5EQTA 1EESA 3C7KA 1XX6A 3IBGA 2FH5B 3G5UA 2V3CC 2D7DA 3B1WA 2QP9X 4GP7A 3BERA 1QHHA 4QG7A 1RYFA 2VSOA 4YMVA 2G3YA 2ZI5A 1DPFA 5L3QB 2ZU6A 1Z6TA 1CLUA 5CLLA 3KQHA 2BMEA 3BB3A 3A1VA 5EE3A 1RRGA 3KFXA 1WXQA 4WOPA 3SYLA 4PXAA 1C4OA 1XBTA 5G40A 3X1WA 2D06A 4YXWA 5SZJA 1A2BA 3AKYA 3RC3A 3AEZA 3EIQA 2IS1A 1HE1C 5C46F 2FE4A 3QUSA 4F91B 4F4JA 3K53A 3MD0A 4LYJA 1CP2A 4V0OA 2AXPA 4NHOA 3SJZA 1NRJB 2GKSA 4TYQA 2YC2C 2ODEA 5FPTA 4RZ2A 2XZPA 3K9NA 1IBRA 3AGQA 4LX0A 4B3FX 4TZ6A 4LY6A 4R9UC 2QMOA 2D2EA 4LCBA 1J90A 2KWIA 3AVYA 1KYIA 2X8AA 1N0UA 3JZMA 1Q1QA 2ZQ5A 3T15A 1YQTA 2VP2A 3QOFA 4OI1A 1T3HA 3LX5A 4AKEA 1E99A 1K5GA 3D31A 2YZ2A 5L3QA 2ATXA 4ASUD 3FGNA 4HI0E 4L16A 4TYNA 3KZ1E 1P2SA 2ZROA 4DXAA 2ZRMA 2VO1A 4MKGA 1RRPA 1KIMA 1NMXA 1VECA 1G9XA 2EU8A 1GIAA 2OHFA 4LPKA 3ZJYA 4BWYA 3TJZA 4LHYA 2CBZA 4FWTA 1BKDR 3A4LA 3UKDA 3OE7D 2PX0A 3MWLA 1OFIA 1IN8A 1R4AA 1UDWA 1TQ2A 4NZYA 4UXJA 1DAEA 4JZKA 3K09C 4WXRA 4LHZA 1SGWA 4Q4AB 2FGKA 2WV9A 4S35A 5HCIA 5FBVB 1RE0A 4BLSA 1Z47A 1U94A 2QP3A 4BFVA
chains in the Genus database with same CATH superfamily
3W4IA 5J2UA 4Z4QA 4CTMA 3WDSA 3DAHA 4MGZR 4QDUA 3IJRA 4MGKR 4RHCA 4WNAB 2NLOA 1WXXA 1G60A 3K1YA 4KDFA 1J42A 2D4HA 1ACJA 1CX9B 2HD4A 3IIIA 1OHHD 3HDHA 3DE3X 4UBNA 5AVSA 2OENG 2XUIA 1YZFA 3MAAC 1KSGA 1FVFA 3HA2A 2ZB2A 3PPVA 3ZNNA 1VP3A 5J58A 4Y2PA 5KTPA 1EUCB 2FUG1 1Y37A 4CLDA 5LLTA 2XTZA 1Z5OA 3Q5GA 4CMEC 2UZAA 4YYEA 4BMSA 4IVPA 1Y4AE 4C4AA 2ALJA 3H5IA 4M54A 3OO0A 4CDRA 1PE0A 3AM1A 1HG0A 3CNBA 2WJHA 4PYRA 2Q3CA 3ZZTA 1ZOIA 3FNEA 4TZTA 1SMKA 1DINA 1A8PA 2GEKA 5FI3A 4YYZA 2V1XA 3O92A 4QDXA 5GZ6A 3V8PA 3L4KA 5LOVA 1PNQA 2E4AA 1EK0A 2XYQA 2CCKA 3LWDA 3CVJA 4UAVA 3TG2A 1DBWA 4QOSA 3RTBA 3T5AA 1B41A 2VRWA 4LYHA 5D5QA 3RFTA 2YCLA 4Q4AA 3UK6A 5BMVA 2HXYA 2KBEA 3SIPA 4JI4B 4TROA 2PUGA 1FRVA 1II8B 3NHBA 2PKRA 3ZW9A 1OREA 3ONDA 4HXGA 3BJIC 4LRTB 1L5GB 3X1DA 4Q3NA 4YWHA 4KZPA 1PWYE 4QYWA 1EVEA 2KE5A 1KK0A 1WXEA 3ST7A 1NV8A 3F6YA 3W6OA 4JXZA 4GLLA 4J75A 2J9RA 3DE7X 5U4QA 4B80A 3OIWA 1WMEA 4NPAA 4WFJA 4DV6B 1MB3A 2K4MA 3WXMA 3COWA 1HPLA 3PA6A 3S8EA 5DYNA 4M3NA 4TS1A 7MDHA 1VG8A 2INGX 5ALDA 4F8JA 1LBHA 4LFBB 1MW9X 5G0VA 2GSWA 2QU7A 4WA8A 5FL7A 1Z5GA 4R9RA 3ML1A 2V8BA 2B83A 1J8FA 1DEKA 3CLSD 4M99A 1BD4A 1HLPA 2NZ2A 1NBMD 3PX3A 3GYBA 1ZD1A 4E09A 2TRSB 2V7XA 3J7TA 4QXAA 2HJWA 4DNQA 4RUKA 3AI2A 4B84A 1Y5LA 3CPSA 4OSOA 3CE6A 5ESWA 3W5BA 4JSYA 2B0JA 2W42A 2HNBA 4N7JA 5FAXA 3HBLA 1R74A 3CUUA 1JLLB 4PTLA 5HZHA 5K8LA 4CG1A 3CVXA 3CZCA 2GEVA 5JYEA 3FDFA 2VDUE 2QQEA 4RQBA 5CUQA 2V58A 1Z08A 5BV8A 3UENA 3MT7A 1WG8A 1AUXA 3HA7A 4LVCA 3THRA 3GRCA 1IY0A 3WRVA 4A6DA 1YR1A 3ZHRA 4BU0A 4C3VA 2VZ0A 3S2UA 3AERA 1U9CA 5EY5B 4N5IX 4EFMA 1YZVA 1Z36A 1IN6A 3EXFB 4PM4A 4B44A 4FT4A 2Y93A 4RE5A 1SUWA 3KJGA 4L85A 5AJZA 4H3SA 1ZRHA 1JG2A 4YRLA 1VRVA 1SBCA 4F56A 2BEWA 3P45A 1H2FA 5L3RA 3WB1A 4D82A 2WD7B 3QOWA 1XLVA 3IEPA 3SSMA 2ZUTA 4XGNA 3TJMA 2C1EA 2IEGA 1AKNA 4YIKA 5KOHA 4CI0B 3AFGA 4CR8A 1OGYA 3U56A 4IIFA 4OI0A 1U0NA 4G5OA 5K20A 2RC5A 4UUOA 3GWZA 2YHBA 4IM7A 1KTVA 1Y81A 3WGUA 3D1VA 2IYNA 3HK2A 1IHUA 2WKQA 1U4SA 4TTSA 3RRXA 5AW3A 2WAXA 1GRCA 1BCSB 1DAHA 1KY2A 4P5PA 1G8AA 4II3A 1FQKA 3A3OA 3IAFA 1A8UA 4ZAWA 2WKRA 3CH4B 5FULA 5JO9A 4IIHA 3WTCA 3KQKA 4C6HA 2VIIA 3DTNA 4UAUA 3DMPA 2X4DA 1N6PA 4JDPA 1GZ3A 4S2UA 2DCUA 4J2HA 1MEOA 3MMNA 3PD0A 3MF4A 4K5QA 2KX7A 2J6BA 3BF8A 4ZYTA 5DKFA 4B32A 1Q7CA 1CT9A 3IPXA 2XGJA 1NJ6A 1GM5A 3RRBA 4BBJA 5KVCA 3WISA 1QANA 2CE7A 4KIWA 3V8BA 1FNSA 1C30B 1R0ZA 3LX6A 5BWLA 1EEXB 1AV6A 3ACCA 1XMOB 4KOAA 1OXSC 3DUFA 3MERA 3MQ2A 1SNYA 5TDHA 1E1QA 1NJ8A 3UJBA 3F71A 1PGNA 1YAJA 2H9IA 2GJ9A 5CMLA 2PPVA 1GRQA 2BISA 3GT7A 3KE9A 4GO1A 4OHCA 3WZLA 5A1JA 1NJ5A 1U3TA 2BMAA 5LCXA 4DV5B 2ZIUB 4JC0A 4MIOA 4ZQFA 3G2PA 3ESQA 4U2CA 2YY6A 2L0XA 3CISA 1D5CA 3FIJA 3H17A 3E0XA 3LY8A 3OM9A 4ARZA 4DPLA 4EELA 3PLNA 2OBLA 5GJBA 3IMGA 3MC1A 2ZYAA 1JU9A 3VR5A 2UYOA 4HB3A 4HDNA 4PIPA 1FW6A 1QIJA 2HLHA 4MUFA 2BMJA 5DYYA 1IXYA 2ZK7A 3KCNA 1MO3A 2MR5A 3LCRA 3OM1A 2BUBA 1Y6JA 4RZXA 4ZT2A 1OX4B 3ENQA 1FDTA 2ZIZA 1TD9A 2BP7B 3E03A 4IYJA 2X5OA 4A5OA 1GQ2A 3ROEA 2PL1A 2IHKA 3ZNPA 5BR8B 3K0AB 4JQCA 4NARA 4YJHA 5AOAA 1P5FA 4E3ZA 3AK4A 3HWX1 2BBOA 2PXCA 3M70A 4RAQA 2BFBB 4RVDA 3STHA 4L4XA 4E0BA 2UZ0A 4FOLA 5FUQA 2MMGA 4V03A 1PCXA 3K9LA 4G97A 1WM1A 1PQ4A 2OC9A 2TMKA 4NU6A 1GJRA 4W7SA 3TRJA 4PQYA 1YBAA 5L9AA 1NMZA 3PK0A 3N58A 4XD7A 1NI3A 1Y3BE 4ALJA 2GWHA 3U5ZB 4MWSA 4GGPA 9ATCA 2JIOA 2DE0X 4PXSA 4G37A 1N3YA 3ZZUA 1O95A 1IOZA 1DXOA 1R88A 1OAOC 2VXOA 2XMQA 2O5VA 4GPD1 1JKJB 3RIHA 3UPUA 1NVAA 2YIDA 4G0XA 1NXWA 2GMWA 1AH2A 5FH9A 4HVAA 3VOAA 1BHSA 4RGYA 2R47A 3KOXA 4YMHA 3Q8MA 3R3VA 1QWSA 4MPJA 2ZULA 3HKDA 5HJ7A 5DT2A 4F6LA 2DFVA 2EBFX 2O4UX 1SELA 3FTQA 3EEYA 3PGMA 4G2TA 3O2JA 4QDOA 2O8NA 4Q1VA 1XQYA 3D7MA 4PHFA 5DEOA 4NXNB 3BXHA 3KO8A 3KFVA 4M1SA 1HDYA 4UNNA 3E7FA 1G7TA 2WD8A 3H0KA 5ALOA 1BFUA 2VDWA 4E03A 2D6FA 2P0EA 4HEJA 3W7BA 3N0TA 4HWKA 4XYGA 2IUUA 1X1RA 2ACKA 3NIWA 3U7EB 3GLRA 4BOYA 2RAVA 3ISVA 5KNBA 4AY2A 3TZ6A 4INZA 1P17A 3QVVA 3LK7A 2K7ZA 2Q8QA 2XCQA 4MQLA 1XZAA 1N3LA 4WOCA 4V0QA 2HW8A 3MVEA 3RABA 5EGSA 2PUBA 3U1TA 1LPBB 1VBNA 1DP4A 3TS1A 5IVHA 1A9RA 1Y0BA 5ITSA 2V4UA 2XB9A 1DCFA 1E7YA 2B69A 3DCJA 4MS4A 3W5UA 4UTPA 3CXRA 1ZVVA 3LBIA 5KHAA 9LDTA 1EWQA 2VP0A 4M0LA 4GRAA 3I3SR 3K1AA 3QEAZ 4OU4A 1Q3KA 3A6EA 4EMUA 2W71A 4YRGA 4H1VA 4QU9A 5TMDA 1ZINA 1AKVA 3I5YA 4QXMA 1QYCA 1PL8A 1G4HA 1NR1A 4FR0A 4R0VA 4B2PA 1ZJ6A 2Z3VA 4D9KA 5JS8A 1XFDA 3H9CA 1UXGA 3KKZA 2W5UA 1A9PA 3NOOA 2QW0X 3K96A 1E2GA 4TWJA 2KB0A 2XMPA 3KFLA 4LHSA 2I65A 2YXPX 3H42B 5E9WA 4D57A 1ECGA 3ZGLA 1IVYA 1SZDA 2BE7A 2NACA 2W2LD 4FMCF 2QE6A 3J80A 1TL7C 2VT2A 1LNZA 4ZVQA 3ZBUA 5L3ZA 3AY3A 2HK9A 4QBGB 3NOQA 5BWCA 1WCV1 1JFSA 2XYRA 4Z9XA 5BP7A 1JLRA 4KHPB 4BEJA 2GYWA 2OSVA 1V8FA 3LQ1A 4WMLA 1LEHA 2R8OA 3FWYA 1CUJA 4TV8B 3VOTA 3B1FA 3ZIAA 2NT3A 3O73A 3FOWA 4HB4A 4P3NA 1DWUA 1IBSA 1ZXXA 1R9JA 2G6TA 3HYSA 4LZZA 5TVGA 3VKVA 3JD2A 3O8CA 1BJKA 3IH5A 1RR6A 2PWYA 1JDBC 5SYAA 3UOAB 1JEYB 5AMXA 2ZDGA 4JEUA 4YRSA 1VMEA 4BY9E 3FDZB 3IDZA 2OV3A 1N9GA 3IUEA 1RRCA 3VYWA 1R8YA 1U6KA 3R3UA 4BU1A 3MOIA 2XF8A 1G55A 5CJJA 5G53C 3NMUF 3DMTC 3NTUA 5HRAA 3JASA 5G0SA 3RT1A 1CJKC 2RBEA 3RS3A 4OGKA 1M6YA 4UOEA 2G25A 1CUZA 5BYBA 2Y68A 1OYWA 3H2JA 4G26A 2H63A 3B70A 1GRNA 2CLEB 3J81A 1JGTA 2GPTA 5LZ2A 1U63A 1MPTA 1T6ZA 2AOTB 2BZ1A 4ETIA 1KI1A 2WSSD 5HMLA 4KDRA 1F4LA 1L6RA 1OXKB 1Y3HA 2C2HA 4UD2A 2V9CA 3EXEA 1GZ7A 4RENA 5AXDA 3EPLA 3QEMB 4YT8A 4UEOA 1NQOA 3W8EA 1EMDA 5JADA 1SXGA 3REQA 4CG3A 1TJ4A 2V7TA 4B5KA 4M0MA 1HQYE 5CXQA 2D4AA 2RH9B 1RXCA 1BDJA 3MRVA 2WUFA 2PFGA 4HNHA 3EDQA 4AC9A 3KZCA 3SFZA 3ZD7A 4V2UA 4ID3A 4C0SA 3GNQA 2GM3A 2R7NA 3VHXA 1QAQA 3TD6A 4G67A 2FRDA 1XVLA 5HWSA 1ABFA 1A97A 2WJ6A 3I72A 3PXEA 4LS3A 4F71A 4Z2AA 3PKIA 4U63A 5IC4A 1RXVA 2R66A 1PNTA 2B4KA 1FVHA 4K2AA 4GL4A 1OFHA 1R6TA 4Q00A 4UTNA 3FZNA 3MCAA 3ABQB 3TOCA 3TX2A 2OMKA 5IUKC 1PD0A 1FIUA 1GNTA 4TN5A 4DARA 4U9UA 2R8BA 1ESNA 2JH3A 2WF9A 3QFFA 4PO3X 4E1AA 1GUFA 1VI5A 3ZGXA 4G4SP 4WJLA 2VA9A 1NX9A 3HXOA 3K2BA 1VB3A 5CA0A 1YQDA 1HF3A 1PLLA 1WBDA 4L8VA 5JQWA 5CNMA 5D87A 3RADC 1YI0A 2CK3A 4MS1B 3V4LA 2AB0A 3P71T 1NNLA 5LXTF 4TXMA 1L5KA 2A5YB 4D4JA 3FN4A 1JLMA 4WZZA 1ENZA 1WUYA 2CNDA 2OWEA 2PSDA 4K26A 5FA6A 3T52A 3FSGA 2FX5A 1E98A 2ZVDA 3SYNA 1Z6QA 4C87A 2EBWA 1P44A 2FG7C 3DWFA 4MP3A 3DL4A 3WWYA 2PK3A 1MRSA 3B51X 3H83A 3RV3A 3MMZA 4MQMA 5GV8A 1PFVA 1NYRA 4ND4A 2R79A 4IJ5A 2O8FA 4LHXA 3AUXA 3ONNA 5TEVA 1JEQA 1RC0A 1L8LA 1HMYA 1LK5A 1OX6A 2ZOSA 4X8MA 1WU7A 1P2FA 1QAOA 2RKOA 3OZUA 4GC9A 3RJ9A 5H7XA 4B7ZA 4RU1A 4JJKA 4KRGA 3WGLA 3A6JA 1E6EA 2NVUA 3CN7A 1BDHA 1WPQA 3GJTA 1P91A 2PD3A 2ZM6B 2MHCA 2EXXA 1CJCA 3U2QA 3N7UA 1L3IA 3FWHA 1JLSA 3NASA 2DXIA 3F3SA 1U0TA 3OHPA 1KNXA 3NBFA 4RBNA 3VR5H 4YJ2F 5AD1A 4BX3A 1QPZA 1V2HE 5FYQA 5MHTA 4H7EA 4EA9A 4G0PA 2IV7A 3RFCA 4DLTA 1BIFA 3I83A 4IOMA 4QWMA 2O57A 4UUAA 3ZVMA 1M2NA 1UIRA 4KO3S 1JNXX 4KRXA 1NUAA 3OEED 1KEKA 1L4BA 2PLAA 3S3TA 1Q92A 4AI6A 2IL1A 4NY1A 4FB4A 2GT1A 5JTUA 3M4JA 3M9XA 3LDUA 4E6PA 4MKFA 4PC1A 4QPJC 5BXQC 2K2QB 4OP3A 3H4MA 5DTEA 4L08A 1XCBA 2QA5A 3HVUA 3LECA 4L6IA 3W8FA 3Q9UA 4Q5IA 2R9VA 2G0TA 1OYOA 1XZGA 2WYUA 4MWCA 5LBIA 4MINA 2IPOA 3C6MA 4C76A 3JAWB 3MHTA 3VJLA 1Z15A 2XEXA 3IP5A 2YJ5A 3IDQA 3UH1A 1TQ6A 2Q6VA 1PHRA 1I1QB 1QH1A 1Y1QA 1G8KA 4O8ZA 3ND9A 3K9GA 3WGVA 3MXTA 1UEXC 3V6MA 3W0LB 4EMBA 4RK6A 2I7DA 3RS5A 3WZMA 3ABRB 1WA5A 1WY5A 2AE1A 4KW7A 4Q18A 3GRUA 5HUQA 5JY6A 3GRAA 2VYNA 3BWVA 3KTOA 4FBGA 4QDTA 3WBFA 3JW8A 2FKNA 3FPSA 3WP1B 2I1VB 3B6MA 4J43A 3L7CA 4R68A 2WG0A 3GCWA 2Q3JA 5EYPB 2ODNA 1B8NA 3CT6A 2NQ8A 4P1ZA 3SDZA 4HNUA 3KJZA 2BTQB 4IDNA 3U7JA 4O4LF 1QVZA 2VAVA 2XI4A 2WIDA 3TLMA 3C4JA 3C3JA 5EXXA 1YIAA 4GDMA 2ZWMA 5JNTA 5A03A 2A0YA 5C34B 3SHWA 5ILGA 4BP3A 3FB1A 5F35A 4DYHA 3WXBA 3FNBA 1Z25A 2C1ZA 2FJUA 4IIYA 2F8LA 2H51A 3MILA 5HIMA 3GEDA 1ZK3A 4Y6SA 3ZVRA 4C14A 2Q27A 1VJ0A 3EN0A 3TL2A 4BYGA 2EZ8A 4I1RA 3ESBA 1AUQA 1S96A 1P77A 3LYUA 4KEAA 3V48A 1N6HA 2XVMA 2FPIB 3U6BA 1CE8B 3LJKA 2CUKA 2H4ZA 3B5JA 3Q12A 1U0FA 1DQRA 4ND8B 3SI7A 1NOJA 4WSOA 1DCMA 1Z06A 4D9HA 4DB2A 1BMFD 1QGOA 3EASA 4QT4A 2ZTLA 3UWPA 1N8TA 1QIEA 2GSDA 3KYBA 2GZDA 3REFA 1TOAA 4H6WA 2QAGA 2JI7A 1I24A 5ALJA 3I58A 2W37A 4P7JA 1LLQA 3PL1A 4P0QB 4K6HA 3SCZA 3AHHA 3UW3A 3WLOA 1KQNA 4DTCA 3B3FA 1EUZA 2E1RA 3BD7A 2PUTA 4INAA 3F96A 1UEIA 4FFLA 2P5TB 4AUNA 3PS9A 2NU8B 1X87A 4WCFB 5LP6C 4EB8A 3K6SB 1SR8A 4AJ9A 1EDZA 2C2BA 2PH7A 4A1FA 1SUIA 4R8MA 4YJ2A 3JAKA 5CB4F 2Q2OA 1QUEA 1TI7A 2HLPA 1NU8A 1N9KA 1YI8A 4RTMA 3NWBA 3AP2A 2DKOA 3O8LA 2GBIA 4MI1A 3R75A 5HOQA 4ER6A 3UXMA 5AKKA 1L7PA 4JI0B 4CM7A 3FHTA 4KUHA 1CY0A 4M9ZA 4DDVA 4CLOB 3NLLA 2DFDA 3NDIA 2H2DA 4ISBA 1JFTA 4L15A 5F7XA 5CTJA 4RD3A 4B45A 3TLGA 6AT1A 4MIYA 3IKVA 3ZW7A 4EB6B 3G5AA 4QAQA 5JV5A 3DPUA 8MHTA 3NIFB 4H0NA 2C8JA 4AULA 4EGAA 3GEHA 4LF7B 2DR2A 2V7QD 4RFLA 3RFUA 5A4JA 1LV7A 2KPOA 2J5BA 2RGNC 1NVFA 4HP8A 4ARAA 4ZHQF 2I6SA 2ENWA 3VUEA 2NZJA 4BNXA 1KTIA 1EVKA 1TIKA 3SVZA 1EVQA 1YE5A 1OWOA 1QCZA 1RKBA 1RJDA 2E4UA 1P7CA 3B8HA 4Q3OA 1RLOA 2R1TB 3B1KA 4IF4A 3HDJA 4E14A 4Z8YA 3MG9A 3UCXA 1K89A 5JEDA 4MPPA 2I6FA 4D6PA 2JAPA 2ZTSA 5EJ4A 5ICGA 1YUMA 1IY8A 2RGEA 3HCEA 3OLWA 3OJXA 4GXQA 3BK2A 3S2ZA 1YDFA 1UBTS 4QBKA 3MXOA 4N12A 2WFMA 4FK8A 4CM9D 4YUYA 4RHXA 2YWFA 1YR2A 3HU5A 3V33A 5EERA 5K0FA 1LX6A 1E2DA 3BREA 5GQSA 2GCIA 2ZATA 5GIPE 3CIFA 3H11A 1MLDA 5JXWA 1PR9A 1UPBA 3GNTA 3OLVA 3MT0A 4OK5A 1XHEA 4U6NA 4D1YA 4RJKA 1ULAA 4MRPA 5LQNA 1XMQB 4DM4A 4JITA 1HE4A 4NBSA 4B40A 2WQ6A 2Q50A 4MRMB 3EGXA 4KP7A 2H4XA 1V4BA 5EI5A 2BGIA 2PS3A 4I1SA 2JCSA 1VGRA 2JZOA 1D07A 2I33A 1Z26A 2I6XA 2IPAB 1LI4A 1QVVA 2VNIA 3O4GA 3CX7A 3TIFA 2VYCA 4CN9A 4IX1A 6ADHA 2IF0A 2XSZA 3LUKA 4AMZA 1CUEA 2PX3A 2C9OA 4GI5A 4L78A 2DBYA 3UICA 5EN4A 1G1AA 4G1UC 3NDRA 1C1XA 1IAVA 4G65A 3IA2A 4P7BA 1YRWA 4I14A 4DRXB 5KS2A 5J40A 4BHTA 3WRXC 1Z5PA 4NICA 4KDCA 4KYTA 2C5EA 4Q7EA 1YR9A 3U7IA 4WXPA 4NOJA 4B7XA 5A4DA 2R7LA 1CS0A 4OATA 5KB3A 1Z73A 1MC1A 3W2EA 3ZD6A 4QEKA 1C0IA 1TMYA 1GKYA 2FEPA 2XKBA 2P35A 1KNQA 4V0LA 3V00A 1RLMA 1FE8A 1XB2A 5F77A 2RBGA 5D2CA 1UT8A 3C39A 3PTLA 5CB4A 1GUDA 4PICA 4N41A 4DC9A 2OUKA 3UJ6A 3CO5A 4QULA 1M8FA 1MT3A 1XZPA 3KSBC 1D6JA 2RHCA 1W5BA 3NAMA 3EGWA 4GOND 1N2EA 4E4YA 1QK5A 2EG5A 4FKZA 4FMPA 4NDNE 1Q7BA 1X7YA 2A8YA 3E3NA 3RRFA 2HHHB 4D0LB 1OU4A 4XRGA 3GN2A 4GRIA 3RVDA 1PJSA 5CCBA 3AT1A 1BD3A 1IVNA 2LKDA 1W6UA 4F1JA 4YAEA 2L69A 1EHIA 1MD9A 1QZUA 1T1RA 1ZLYA 3ELUA 1KY5A 1X7ZA 3AEKA 3CMCO 4XFDA 4CEIB 3NGXA 4DCJA 1CV2A 1SQFA 2WMYA 4QAJA 4QNNA 4E32A 2UXCB 1JIXA 2OGWA 3AJDA 3IAHA 3OUZA 1NP3A 4FDMA 1B15A 2OOKA 2XADA 2XCIA 4JP8A 2BFDB 4MWOA 4DIUA 3C97A 4PG6A 2D3TA 4UU0A 4Z49A 1P7VA 5COBA 4YV1A 3C1AA 4ZAYA 3GCXA 3IUJA 3E9YA 1KEZA 4L3VA 3BYZA 3COJA 4EW6A 4OQZA 4WX2B 4YQEA 4IWXA 4KXXA 2IYXA 4OFXA 3GJ7A 1SBQA 5E6SA 4CIDA 1ISJA 5AJTA 1EX9A 3KQNA 3VNUA 2Y9PB 3RVPA 2JPDA 3JYHA 3VMMA 3QVKA 1K8QA 1QX3A 3QH4A 3D02A 2XDQA 4PR0A 5K8TA 2CDBA 3PEUA 1XCMA 3FF4A 5JDIC 1ZXBA 1XA3A 4QPDA 3NGMA 4DSNA 2CSUA 2ZQZA 1TIPA 3ZD9A 3UGJA 1KOGA 3IURA 1JHRA 1EUQA 1ZMBA 2CVHA 4TYWA 4YTEA 1Q2XA 5IM4A 4LXXA 2O4CA 4ENSA 5KYYB 1PVVA 2P79A 2AG6A 1L4NA 1RI2A 4EF4A 2C5BA 4I55F 2C96A 3OWXA 4QYMA 4ENWA 4ICIA 2PT7A 1KEVA 1GKUB 1VM6A 3CUSA 3Q3CA 4LF8B 4BAUA 1PP4A 4PCAA 5LWQA 2O3SA 1PFGA 3WBJA 2CZCA 4JV5B 4Q0MA 3WKEA 2KYRA 5ENZA 4IP0A 1U7XA 2HMSA 3T9DA 1E9SA 3G68A 3TK1A 3W9BA 5LP6B 3JQEA 5DTIA 1U5AA 5IUNC 1NNEA 2GBFA 2NOAA 1ZL0A 1JX6A 4QFBA 5I8ZA 1NXQA 4LIPD 4LDNA 5LWHA 4FNGA 4P5EA 3M6UA 3T5DA 3A1EA 5BSEA 3LOQA 1JWLA 3JQCA 4E13A 1TRHA 1WUKS 4FIDA 1SCDA 4J94A 5JYBA 3W2HA 3OFJA 4JP1A 1W4ZA 1L7EA 3R3JA 4PN3A 1QPGA 1L4FA 2XVYA 3D0QA 4UZFA 2YCBA 5HKOA 1LZKA 2HT6A 1LLCA 3MJEA 2CMGA 4RD1A 3RRMA 5CIYA 4URZR 3W5SA 5IJXA 2WJWA 2AXEA 2QRNA 4X0EA 5T3UA 3KQTA 2YHIB 4EHHA 3R3YA 3E1GA 3O03A 4C7BA 4K8OA 5ECDA 3GDGA 4A36A 2IBTA 4KITB 1XNQB 1XZCA 4XTCS 3L46A 5IASA 2XCOA 1NE7A 1RRMA 2VQDA 1HEUA 3QIVA 1X92A 3EXG2 2LWIA 4YRCA 5KNCA 5EEHA 1B0ZA 1CRPA 3M2TA 4AY4A 1J99A 2JLVA 1TZCA 4RSRA 5FNVB 3T5GA 3F8SA 3VZCA 2QYSA 1OASA 1RIFA 4P31A 2GUWA 1H2ZA 1A9QA 4I66A 5KCZA 1EBUA 1O2DA 2K2WA 3EXHA 1EJ0A 3IQFA 3LT1A 1P7YA 4EVSA 5C5EA 4C2UA 1PBNA 3ONFA 5E4JA 4RDXA 1K4KA 2HGSA 1W5EA 3RSFA 3RVLA 3EXFA 3JCZA 2NTJA 5ECGC 1OOEA 1C3OB 2BMWA 1Y33E 2YNMC 3CUYA 4R9SA 3UAVA 1SXPA 5FOQA 1CZKA 3UH0A 4D4GA 1LPAB 3FKSA 4L5AA 2C7BA 3A0UA 6LDHA 1WQ4A 1T1JA 3AEQA 4LN1A 4RD2A 5E7MA 1PNOA 3WWDA 3QKRB 5JUWA 2XB8A 4EX7A 2O6LA 4EI8A 1BG6A 2PLNA 4DQ0A 3C1OA 3LQYA 4Q1BA 1DC8A 4HAXA 3QI7A 4L1KA 1VMIA 3GUHA 3L05A 4PPQA 4L6CA 2Z43A 4WDRA 1XZQA 2CXQA 4ZN6A 3F74A 3CUTA 3V32A 1LU9A 1OBOA 4M36A 2XNKA 3L1HA 1R4MA 3KJNA 2OP1A 1ECJA 1PG2A 4HZUA 4ED9A 1KP2A 4K81B 1LQUA 3ES9A 3K4PA 5EMHA 4ZKEA 1R9MA 2FZEA 1QE0A 1Q84A 1M2WA 1XA0A 3BE6A 3EDRA 3EHEA 1C9YA 4UDNA 3WS7A 3MMPA 5TEWA 2IP2A 3A4IA 1R7RA 2A0UA 4OUDB 2HMVA 2CL5A 1W19A 4P6VF 1DBRA 3QLJA 1NVTA 1XPRA 4I55A 3U49A 2C2WA 2B21A 1SU7A 2JAQA 1P5RA 1RBZA 2XMGA 4LE0A 1DJNA 2N75A 4R2XA 3FPHA 4CMGA 1CB7A 1L7RA 3LSTA 4U2EA 4UEQA 4DJTA 4FZVA 5AI6A 3ILXA 2LCFA 4PZYA 4TSKA 4E4TA 4N3GA 1NC3A 3E22B 1M8PA 1TT5A 3DMNA 3KVVA 2O50A 3AG6A 3WMEA 3W1WA 2QTMA 4AMBA 1EFHA 4GYYA 4FHDA 1FUIA 1KS2A 3BDIA 3GEPA 5AW6A 1MB2A 4BO2A 5KOJB 2YBEA 4QM6A 2GVZC 1T9KA 4AKGA 1IBCA 3L1JA 4K9OA 4LZLA 5L4SA 3P2MA 3UMGA 5F1YA 3D6FA 4EZEA 1K7EB 2VR1A 1R10A 3F8TA 1BCRA 2XJ4A 4GM1A 4RZUA 1FVXA 4JJIA 3KBBA 4MYUA 1N6KA 1Z29A 2G17A 2JLBA 5BUSA 1BROA 2D62A 3D43A 4I4CA 1F14A 2VDPB 3ENNA 3GPDG 1NVGA 3DZ8A 4HNGA 4H59A 1E69A 3KETA 4NEQA 4ZO8A 4TT8A 2OCBA 3O1HB 3NEAA 3O82A 1GVNB 2BP7A 2GF9A 1IIRA 1EFVA 2FK7A 4P4UA 3Q8XB 1ESCA 2YV1A 3DNMA 2QRVA 3K0AA 4UPDA 1O96B 1F5SA 4D5EA 1LZLA 2P2YA 4Z6KA 5JNLA 4XH9B 2Y8EA 1FRQA 4QOIA 1L3BA 3E15A 3BIFA 2FP4B 2CLIB 1E7WA 3TRKA 1XZFA 2Z9BA 821PA 8OHMA 3MW8A 2J6CA 4GPEA 4LK3A 3NJ4A 4YFVA 2PFSA 5CDGA 2SKEA 1IUKA 3GLGB 3CF2A 4JI5B 2I67A 3QE4A 1AKUA 3BE5A 5F12A 3W8NA 2P27A 1NN5A 2GAJA 3E23A 3SC4A 7ADHA 1C9NA 2CVFA 4YLGA 3QBVA 1X80B 4YMSA 4A5SA 2P9BA 4KNYA 1JDTA 1YJQA 2NNWB 3OMLA 4ADSG 3ZTTA 3GZJA 2ZJ1A 3WOVA 4BVBA 1AO0A 1UOOA 3UUFA 1ZM4A 3Q88A 1T13A 2BJWA 2HBRA 2IYAA 4OK6A 1WABA 4KB5A 1GNQA 1J2JA 1C8KA 1PEKE 1B8PA 4PX9A 1GXSB 1CJMA 2CYCA 4GH5A 4IDGA 4MP8A 1CQJB 3RK1A 2IYRA 1S2MA 2C4UA 1Z0IA 5BRAA 3WKDA 4L8FA 2Q4DA 1P4RA 1W7AA 1RJGA 2JFZA 5JDCA 4MVWA 4X3CA 1RSZA 1BMQA 3BFPA 2FFAA 2VPPA 2WZDA 3LUBA 4JUAA 4HN2A 3AR4A 3SZMA 2ONZA 4AS1A 1HDCA 3TAUA 4NNOA 3I5XA 4R2JA 3OKCA 3VAAA 2OK7A 2W6IA 1OWPA 2FW6A 1DMSA 1L5WA 2ZANA 2B99A 5LQAA 3AY7A 1WSAA 2QOEA 5AKLA 1JN0A 1OWNA 2Q9BA 4GBGA 5CNJA 3G8CA 4KR7A 4U4AA 2VUIB 1XDSA 4KN6A 2PZFA 1V6SA 2W00A 3ITKA 5IWCA 1VKJA 2FRVA 3B6ZA 2DH6A 5K1ZA 1LH0A 2COKA 2AFIB 4AICA 3ODPA 1K63A 3TNYA 2IXDA 1Y5NA 1RHMA 1U7TA 2JZCA 5TNXA 3WE7A 1TMGE 5JAOA 3EOBI 3ROXA 4PAMA 5KKNB 2VHEA 4K6FA 3T1QA 4D9IA 2FSSA 4K1XA 3G0BA 1VIVA 2JIQA 3K2QA 1JZSA 2OT3B 2VQ6A 3GFQA 4RSHA 3H4IA 5EP3A 3ADPA 4BB9A 2NTNA 3HKCA 4JFAA 4IO1A 4N7RA 5FPYA 2OM6A 2GNAA 1TAHA 5LMNB 5LU9A 4B6QA 4RKEA 5EE1A 3EZ9A 2VWGA 4D4KA 3F9RA 4KOEC 1VA5A 1FNBA 3C3KA 3QVGA 5KTMA 3MWEB 3JD3A 1ZUHA 3LG2A 3LTNC 3GI1A 4CLRA 3NHMA 4PZEA 2H48A 1KZHA 4RK4A 2QG6A 2WM3A 3Q9SA 3QRWA 1LKZA 2P40A 3FLMA 4GQAA 4PX2A 3GVIA 1JKMA 1AIPA 4GOLD 2AG1A 2D8AA 4MNTA 4O4IF 5FBRB 1OBHA 3WWEA 1TPYA 3FCYA 2JA1A 4ZQEA 1AHNA 3RVJA 1NU6A 2BJHA 2XOKD 1WHSA 3N8HA 3DF7A 5FKJA 13PKA 1JS1X 1YHZA 2XWBF 4PZ9A 3ZXUB 2M32A 2AQKA 5I51A 1R6AA 2MYNA 2QNRA 4CEJA 2AN3A 1Z16A 4EGCB 4NYJR 4DMMA 3AESB 3I2JA 1OBVA 1N78A 4UQPA 2CFSA 4NCKA 4UM8B 4COOA 1BEEA 4PZZA 1NRWA 1LVGA 4G4SO 4BQSA 3L01A 2V6GA 4J1QA 3A9CA 3N0RA 4IINA 5F1PA 3CRQA 1GL6A 2RHJA 4OQ4A 4UZSA 4BNFA 3OFKA 1Z0FA 1HZJA 1UBCA 4K6OA 5DGCA 1IJEA 3PGXA 2O7RA 1RLUA 2VS1A 1AZWA 2RGDA 1NX6A 4BGIA 1JIKA 2HA6A 3LT2A 4FJ1A 3LVRE 3RSOA 2R5NA 5KNCH 3P97A 3PC7A 1LJLA 2IYTA 3NM5A 5CRIA 5F2OA 4YO7A 1HGXA 3BDVA 4MS3B 1AF7A 2QRZA 2OP0A 3RSSA 3W5AA 1UCFA 1SPBS 3C16C 3T9EA 4X1OA 2WSIA 2RJOA 2B34A 4RA6B 1JR6A 1J8YF 2EYQA 1CG6A 2P2DA 2BW0A 1P4HA 1KIAA 2Z1NA 4NOLA 3FPJA 3WK8A 5AVRA 2DBRA 4HWRA 4GGMX 1QO0A 3OZBA 3BSSA 3BMOB 4A6PA 5KYTA 1DJMA 1DNPA 2RHHA 2F3SA 2HJRA 1GFWA 1J9GA 1TCAA 3G9QA 3HCRA 4O6VA 1C7EA 5CX1A 5ALEA 4LDPA 5AO9A 4F5WA 2H57A 3IPAA 3LX4A 5IJ0A 2X7JA 5JNWA 1UOPA 2AFHB 5CNIA 2J9YB 2NZYA 4FX5A 2GEBA 3DE1X 4HL6A 2GZ2A 3RH0A 1VFPA 3E7DA 4IDAA 4RVCA 1TCUA 4XB1A 5ALHA 5F98A 3QSYA 4TT3A 5IEBA 5AICA 1FYWA 3VU8A 2J5KA 1ULBA 5EKUA 1N0VC 4KR0A 4FLFA 3WRWA 3H16A 3EG9B 3HYCA 1DKPA 1GDHA 3MIZA 1XWIA 1GUBA 1P0FA 1T5HX 1JDVA 3TLCA 3GXBA 1GA6A 3P0JA 1R00A 2HSJA 2R62A 3EVCA 1U3FA 3QWFA 3LZ6A 1LV8A 1XA4A 2O2DA 5HF6A 4DBLC 5C5IA 4IH9A 1XXHB 4E5UA 1Q15A 1UJ2A 4AD8A 4MCAA 1POXA 1SCBA 3CNNA 4TLCA 3QKSB 3U9LA 1Y9DA 4FR2A 4L7VA 1NF2A 1IPFA 4MW5A 1PJ8A 4DKXA 4RADA 4G24A 4EHFA 3DE4X 4EUSA 1ZBQA 1C80A 4HUTA 2GOYA 5B7NA 1K06A 3JVVA 2QLJA 4KLRA 4GQBA 5DSXA 1A9XA 4ARCA 4ZCSA 2K5UA 1DDGA 1KMMA 2EARA 4K05A 5IF3A 2QTVB 4JNKA 2FFBA 1BWQA 2J9ZB 4MCHA 4CDGA 4KREA 3WVNA 1GARA 2VTDA 3VR6D 2GASA 3ZDBA 1B8UA 3I0ZA 8ABPA 4YCCA 4O4IA 4PRKA 4IDQA 3PLRA 4L95C 1CZHA 4RLSA 2HRZA 2ZDHA 1OTHA 2OHIA 1U2QA 1NVVR 2GARA 4KE8A 5CVCA 3RSLA 3N3BC 2ZRAA 1Y7PA 4O2BF 3LNTA 3CPJB 4R5MA 4FI3F 3CTMA 1BVRA 4KYVA 1Z6XA 2B8NA 4TQUS 3DDOA 3D3WB 3N2ZB 4MQ4A 2W0SA 2BR5A 4OL0A 5LXTB 2HK6A 1MR3F 2OO5A 4B9EA 1QE5A 2P91A 1VL0A 4DMRA 2XIJA 3H1TA 4N82A 4QJ5A 4QYSA 1E6CA 4FNAA 3BQNB 1TJ5A 3MJDA 5EWJB 4B3JA 4B2YA 4V1CA 4JLOA 3PD7A 4DBZA 3PQ8A 5EXPA 1G64A 2WM8A 2ZIGA 3DKPA 1PZGA 4BX0A 3LQFA 2C2KA 3VOSA 1CU1A 3I6YA 4HX2A 4QPNA 1PF7E 1C8LA 2RCYA 4BN5A 5IKXA 2ZZMA 3ETLA 4TVOA 3SE0A 5ITVA 2R8XA 1OVGA 2HHJA 1IWPB 2YFYA 3OC0A 1SKBA 2MINB 1EP3B 1J49A 3V1YA 5BSWA 1M6EX 3G0IA 2P6UA 3KB8A 3TINA 3HZZA 3PC4A 4J49A 4Q9JA 1RPZA 3BFXA 2Q7OE 3JAWA 1YVEI 2GDZA 1XI2A 4MICA 5C8XA 1SBYA 3OCCA 4NE2A 2W6QA 2IHBA 4G1MB 2OFOA 4MV5A 5BYJA 4AVYA 5I7WA 3B2EA