1KDTA

Cytidine monophosphate kinase from e.coli in complex with 2',3'-dideoxy-cytidine monophosphate
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
223
structure length
223
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTIDYLATE KINASE
publication title Sugar specificity of bacterial CMP kinases as revealed by crystal structures and mutagenesis of Escherichia coli enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 78
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2001-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kdtA00
2VP4A 3A4MA 3WP0A 5K8UA 1QBKC 3PXGA 2WKRA 1JAHA 3I8SA 1N6RA 1Z06A 3KDSE 4XWAA 1KI6B 3KQNA 2XNDA 3ND8A 1NLYA 2WIBA 3PUYA 1AJEA 1W4BA 3VKWA 1CU1A 4KBFA 1M8PA 4F7WA 5L3RA 1HA3A 1UDXA 1CXZA 4C0AC 1VG8A 2WPDA 4JLNA 4Q4HA 3KUDA 4ZI3A 3VR3A 1NBMA 2CE2X 1S9DA 2G88A 4C7OA 1Q57A 3PEYA 3RSLA 1W4CA 2H17A 4A4DA 4OK5A 3VU9B 4DCTA 2V54A 1YQTA 1XXHE 5FOTA 4BFVA 1FZQA 4IXMA 1NF3A 1DOAA 4Q00A 3RS4A 1HQYE 3AKYA 2WJJA 4B3DA 1YR9A 1PLJA 4OK3A 4S2EA 2IF2A 2VIIA 1ZD1A 1KI1A 4FCWA 1Z6GA 3VR2A 2V6JA 2FEMA 1IBRA 1G64A 3GJ5A 1NMYA 2ZSDA 3DEFA 2O8CA 4M1OA 3A1WA 3E2IA 1RW4A 2FZLA 5JLJA 5CLLA 2ZAOA 3AF0A 3U3MA 4TT3A 5JJKA 4YDHB 2WJYA 2IS1A 4KSBA 4RJLA 4I99A 4MRSA 2QP3A 3GCGA 3SQXA 1Z6XA 1HT2E 2O0HA 1G6OA 3CR7A 4OI1A 5F9HA 3IDQA 4NL4H 2DB3A 3FB4A 2IXFA 1G7TA 3CPJB 3LW7A 1ZNXA 2IW3A 1K5GA 3FMIA 1MO6A 4KJZA 4B2LA 5KDOA 2H5EA 4OJKA 4G5OA 4XVQA 4XOIA 1IQPA 5GVRA 5JEEA 2ZRLA 4PPNA 1R8SA 3ZIAA 4HATA 4MYCA 1G4AE 2ODEA 2ZVQX 1SVOA 5KNCA 1GNQA 1E9RA 2ZU0C 2WTUA 1OHHD 4ILEA 3DO6A 3T1TA 2C9YA 3K70C 4HLCA 3CRMA 3K9NA 1GKUB 1VCIA 4LHYA 3K0CC 1OKKA 1E9CA 2Y8EA 4FW9A 2BM0A 2XTNA 1NSTA 3OIVA 2QPAA 2ZE7A 1AA9A 4OHVA 5EUMA 3RRYA 2JJ2A 2QE7D 1FNNA 3ICEA 4ZIRA 1RZ3A 3KJEA 2V7QD 3SJCA 1Q1BA 1Z0DA 2CJWB 2FPKA 3VX3A 5HCNA 2O8BA 3KB2A 5GJCA 2IX3A 1CRPA 4R9UC 2X2FA 2AK3A 4BZXA 5KSOA 1Z6AA 3QKTA 4ESHA 5AJZA 2JLUA 2NO6A 3ZD7A 1TQDA 3KKNA 4HDOB 2ZRCA 4US1R 1V5WA 4LYFA 1KAOA 4DCSA 4GMDA 3AB3A 4NHOA 5AWFC 4CDGA 1L8QA 1IN7A 1LS1A 3AVYA 4RKFA 3J81k 2GCOA 2BJVA 2VHCA 5FBQB 1G3MA 1GOTA 2Z43A 3DMNA 1PLKA 4LX0A 1GUAA 4JLPA 4BGDA 4NYJR 2HCJB 1EFTA 2NO9A 1DEKA 2VH5R 3CUEF 3GQBA 2IS2A 1T5LA 2KI5A 3SBDA 2OZEA 3B8HA 2IUTA 3PUZA 3D7MA 1TQ6A 1KDRA 4XD7D 1WF3A 4Q18A 3LQQA 4AKGA 2ZJOA 4CEJA 4TLAA 4RD3A 4DEYA 3FKSD 2C9OA 4PPQA 5FI0B 2QMOA 5AUOB 3JZMA 5E7MA 1HV8A 5UKDA 3T5DA 3VMFA 1SKQA 4KFSA 3E1SA 2QM8A 2IUUA 1RJ9A 3QVVA 4W5HA 1OFIA 5AUNB 3B78A 1VYTA 5LB2A 5JRZA 3LXRA 2P6UA 1LV7A 1FX0A 2CHVA 2GF9A 4HB4A 4PHTA 2ZM5A 2QBYA 2QU8A 2BMFA 1P5ZB 2J0UA 2CXXA 5AJVB 1D9XA 3P1JA 2DFTA 4B34A 3QI2A 2AN9A 1IN5A 1XCPA 3KJIA 2IS4A 2OBLA 2OEPA 2VF7A 4A0GA 4DBLC 2ZTSA 2CLDX 3AF4A 4KV9A 2OFXA 5L3SB 1R10A 5FL7A 2EFGA 1BS1A 4IHQA 4TQAA 3IQWA 4JVNA 1G16A 4CZ2A 2JLSA 2X1VA 5DYIA 3MGCA 4IFEA 3ADDA 3MCAA 1KI2A 4M8NE 4DDUA 2YKGA 3GJ3A 3BBPA 4IEIA 1E9EA 3CWZA 4FMDB 1VYUA 3TLXA 4D0LB 4YMTA 1AZTA 4D80A 2QT1A 3AVPA 3U3JA 3UWOA 4B48A 2ZE5A 4CRWB 2V6IA 3LDAA 1G8FA 5KO2A 1N6LA 2FEOA 1P9NA 3WRYC 3ZJYA 1NN5A 4LC1A 4P31A 5DI3A 4A0FA 2ECKA 5EP2A 1PJRA 3EA0A 4LI0A 4DB2A 2OM2A 2R6FA 4N1AA 2QAGC 4UNSA 1TMKA 2ODWA 4HLDA 4DWJA 2EYQA 4BZPA 2HYDA 4Q7MB 5DIFA 4QKQA 4URVR 3Q72A 1RIFA 1IY1A 4M9QA 4E22A 1CR4A 3H4MA 2WVJA 3SOPA 4F91B 5F3WB 3ADBA 4AIIA 1Z22A 1U8YA 2FF7A 3WY9A 4C0KA 4TYNA 1AQUA 3AUYA 5B64A 4XVUA 4RD2A 1IXSB 1L4YA 4M53A 4DT1A 3ZLJA 2RHDA 2KBFA 3AKDA 3RRNA 1T5IA 3AUXA 3Q8XB 4PAMA 1P73A 2PX3A 3DZDA 2PLFA 2H8KA 1SVLA 1ZUIA 3LXXA 3AQ4A 3N2IA 5K8LA 4P4TA 4IW3B 4EPYA 2CDNA 2VP9A 5BW8A 1SXJD 4Q47A 3K8YA 1LB1B 2QROA 2RGXA 1SGWA 4NCIA 1OHHA 2GEUA 1QHXA 5IF9A 1G5RA 2I1QA 5G53C 2JLRA 2FG5A 5TY0A 1XPRA 4D82A 3IBYA 5CM9C 2WKQA 2HYIC 5B2ZA 4Z8YA 4GOJA 3Q3JB 2QE7A 2V7QA 2DFKB 2QNRA 4MH0R 4JLJA 1X8JA 5FPHA 3X1ZA 1W5TA 3ONWA 2FPLA 4AY2A 3TK1A 5J4HA 4E07A 2BEKA 1FOEB 1NLZA 3DPUA 3LBNA 4P4SB 4D81A 1RYFA 3NKVA 4LHXA 1MV5A 1ZIOA 1IM2A 1F60A 2Q21A 2GJAA 3CF0A 2GVDC 2IBMA 2RGBA 2WMNB 2ZS9A 3GJ8A 1CS4C 4LRWA 5JJLA 2QTHA 1Z2CA 1CP2A 2JLYA 1VIAA 1T9HA 2KBEA 4TMWA 2A5GA 3W6PA 4V02A 1P7CA 1Z0KA 1Z6TA 4TTRA 4IOKA 1ETUA 3BXZA 5HCIA 3AM1A 2YC4C 1N6IA 4XD7A 1Z0FA 4ZCMA 4BLPA 3IO5A 3NDPA 4TYQA 4ABYA 1M7BA 3WYFA 1BYIA 3FKSA 3U4QA 1NSFA 2J5XA 1XJ0A 5LD2B 3ZS8A 1XZQA 2XB4A 3N5CA 3THOA 4C3ZA 3KZ1E 4KXFB 5FUXA 1QHIA 2J59A 721PA 1XD8A 2XXAA 3W3ZB 1VIYA 2FFBA 2CLCX 3THWB 2FA9A 4FWIB 4CT5A 2IYUA 4UXIA 4O25A 4AKHA 3K9LA 2YWEA 2C99A 4LJYA 2V8OA 3GFPA 4HLUA 1ZU4A 1S0UA 1T3SA 2L0XA 1DVRA 2BMDA 2PZEA 3CRVA 5J40A 5KSYA 2BKUA 4NP6A 2AD1A 4H1UA 4M1TA 3TKLA 1KI9A 4HUQA 2ZRDA 5P21A 2H92A 1NN0A 2ODBA 3AKEA 2EFCB 8OHMA 5TV2A 1KHTA 2O8EA 2ZR7A 2PJZA 2FX3A 2XGJA 2ZJ5A 4JMPA 1KSGA 4B74A 2ZUDA 4JBXA 4E03A 4B47A 2J41A 1GITA 1VPLA 2FSFA 3S1AA 2WMOB 3W34A 2JLZA 4DLWA 5FPTA 1NG1A 5FBWB 2JDID 4M21A 4N3NA 1OIVA 4W9MC 4LZZA 3P20A 3GFOA 3K70D 3IO3A 4YXWD 2OT3B 3EIEA 3AH8A 1I4DD 4OQXA 4Q4LA 5AJXA 2VSXA 5FTKA 1WE2A 1E2EA 1NP6A 2O8FA 5EE9A 1T3LA 1W49A 2P3SA 2VQSA 2W2VA 5E7JA 5J5CA 2DFLA 2LKCA 4CT4B 1E2IA 4URUR 1KZ7B 2HXYA 4BZQA 4Y0VA 3GP8A 1T8UA 1U2RA 3CWQA 4KI0A 1NBME 2NOAA 2XX3A 1QRAA 2GILA 1JJVA 1VTKA 3AF2A 2Z6VA 4HDCA 1B0UA 2O0JA 4TYPA 1S3SA 3SEAA 3K0AA 5B30A 2W6ID 4GZLA 3A8TA 2C96A 4Z54A 1MRSA 3EPKA 4M1MA 1XCGB 4WBSA 4NYMR 2FOLA 1J8YF 2FSGA 4RZ3A 1KKLA 1C1YA 2RGGA 2B92A 1DAIA 1SXJA 4RFSB 1ZYUA 4LHWA 1UKVY 1D2EA 1FNMA 1UBCA 2AFIE 1Y3AA 1E98A 1JQJC 1K6MA 3QPVA 3T34A 2X8AA 1Q1QA 1XEXB 4A8JA 2REOA 2ZJAA 3I4LA 3WNBA 2W6JD 2V4ZA 2JIZD 4TLBA 5FOVA 3PCRB 1EFHA 4XJXA 4QM7A 3W6OA 3K53A 2J0VA 3VHXA 4DC9A 2N42A 1DBSA 1XJQA 2CNWD 2IEZA 3LY5A 5E95A 5L3QA 3D6TB 1NVUQ 1KDPA 5C2JB 2PX0A 3DKPA 1VG0B 1CLUA 1KSFX 1GL7A 2VP0A 1GZSA 4PAOA 3LV8A 4KYUA 1YZTA 3MMPA 5FOSA 2I1VB 2NTYC 4K8OA 2XEXA 4MKFA 121PA 1E2JA 2J45A 5JRJA 3G82C 4A0HA 4L9WA 3VX4A 1G3IA 3KTAB 2YOFA 2QRNA 2FMXA 1KMQA 1MO4A 4UXJA 3OIYA 3VQTA 1U0JA 5DNYB 2BVNA 4KITB 2PJRA 4BLTA 5B58C 1QHHB 1Y63A 4ZDWA 1NKTA 1RFLA 1F2TB 1E2KA 1HYQA 2VP6A 4Q19A 1XZPA 3GLHB 3Q7PA 4D4KA 1JXOA 3A4LA 2R8RA 2ZR0A 4JLKA 3C16C 2EWVA 3T1OA 4NONA 1QHYA 2VA8A 3V4FA 1KNQA 4DXAA 1ESNA 4IVQA 4QNMA 2QMUA 4JIMA 4R71A 4KU4A 4POAA 5CB8A 1F2UA 2VL7A 1ZCBA 1LF5A 1KJZA 5JHGB 4URWR 3B60A 2RGAA 1NIJA 3FMPB 3QQ5A 5EE0A 4ZDKA 3AVUA 3LBHA 4UJ3A 1ZP6A 5EXPA 3ZVLA 4D26A 4U02A 3U3RA 1EG7A 1HT1E 1W47A 3T15A 3MWLA 4G3XA 1U9IC 2AK2A 4M4SA 5HR5A 1SVKA 2XZOA 1GM5A 1ESMA 2VHTA 3TUIC 3U44A 1NY6A 3VKHA 1LS6A 1Q3HA 5TVKA 2JJ8A 2F1IA 2G3YA 4GL2A 5SZIA 3MRSA 1W36B 1KO1A 3B9PA 2PT7A 1G5PA 2H16A 4WXRA 1N5IA 4LY6A 3BS4A 1GL9B 1KKMA 1JR3D 5J4LA 1OXUA 2PT5A 2P2LA 3I5XA 2W2TA 3THYB 3M4YA 1V43A 1R0WA 3SJZA 3LBIA 3UWKA 3TGPA 1YVDA 5FTNA 2YOGA 2QGNA 2ZREA 1QVAA 1EWRA 3QY0A 2ZXUA 3PITA 2JDIA 2XJ4A 1G291 2IYXA 3ETLA 1VCMA 2BOVA 4BFSA 3UG7A 5AJYA 2AD5A 5K8TA 4QOSA 4RD4A 4RD6A 4LYAA 3K0CA 4YXWA 3EWSA 3SHWA 4Q4HB 4V0LA 2ZS8A 5FOXA 2ZAMA 2FSHA 3QOFA 4C7OB 3ZVNA 2BJWA 3R8CA 1P62B 1XEWX 2KJQA 3EG5A 4Y0AA 2WJHA 4UNPA 1IY2A 1YR7A 4Q48A 3CF2A 3TAUA 1Q1ZA 1W2GA 3AVXA 5FBLB 2VSFA 3T5GA 4PZZA 1WBDA 4BFUA 4B2PA 3OESA 3VNUA 1UM8A 4RCYA 4G5QA 2OCBA 1VHLA 2GRJA 2W6IA 1GKIA 2C78A 2QRZA 2FJUA 2GF0A 3N2EA 3WHKA 3GLGA 4HSEA 1BOFA 5JFGA 2Q3FA 3OHMA 4E5UA 4Z1MD 4QXAA 4URZR 4FMCF 2O8CB 4RSGA 1US8A 5KSZA 4QBGB 2J3EA 1EESA 2G83A 1R0YA 3NEYA 3PEWA 1QG4A 4QGHA 4JT4A 1Q1EA 4OQMA 2CCKA 2W58A 4BFZA 2BWJA 3KKOA 5C1BA 1SZPA 2KE5A 3M1IA 2W6JA 1GILA 2JIZA 1J2JA 2WWXA 4TWZA 4FIDA 1ZC4A 3KL4A 1E3MA 1P75A 2F1HA 3GJ4A 2A3RA 1G20E 4TQUS 1WMSA 4DEXA 3QKSA 3QNUA 1GKYA 2GKSA 2AFHE 1KAGA 2GETA 1N3BA 1BMFD 1II8A 1YRAA 3QXCA 4LV8B 4O0MA 4QRHA 3T12A 4EPXA 3TUJC 1ZM7A 2UZ3A 2HLDD 3P26A 3LH5A 5AR1A 1CJVC 1SXJC 4N0EA 1T0HB 3TW4A 4QC2A 2CLSA 2QP4A 3QEOA 3DDCA 1GRQA 4I1OA 3ZGXA 1FW6A 1M1YE 2IYRA 2GAAA 3PENA 3F3YA 1MO3A 3P4XA 4HZIA 2IUSA 4C0LA 4NTZA 3UMSA 4P33A 1HY3A 1XX6A 1YZNA 1NVVR 2ZJ8A 1E79D 2OXCA 2Q3HA 2GXQA 4FCTA 4JLVA 4JYCA 4OHWA 4AWXA 1XEFA 1IY0A 2D7DA 2BIFA 2O8BB 3AF1A 3QPWA 1F48A 4WAUA 3B82A 4OL0A 3CNNA 4HAWA 2R6GA 3B1ZA 5BN5A 4B2IA 2KSQA 4DSTA 2C2HA 3A1SA 4IFBA 2CL7X 4XWKA 5G3YA 3KUCA 4GZMA 4JVMA 3WXMA 1Z63A 1E1RD 3IUYA 4EQ6A 2GCOB 3KX2A 3RC3A 1KSJA 1N5KA 5FOUA 1E6CA 4GP6A 4QJ4A 4EFMA 2NO0A 1A1VA 3PUWA 1KMHA 1CJUC 2BCJQ 4IDHA 4EJSC 1KGDA 1Z08A 2C9CA 2QAGA 3IPYA 1OJLA 4Q4JB 5H8WA 3ECCA 2O8DA 4M1WA 2WV9A 2RGNA 3AF3A 4CEJB 4ZKDA 2J0SA 4L9SA 2F6RA 4NKRA 4X8LA 2O52A 4TMKA 4PFSA 1E2HA 2DYKA 4TMTA 1RJ9B 5CJPA 2JA1A 2ZRPA 1CULC 3MSXA 3NBFA 4HAYA 1JR3A 4B71A 1OLOA 4D6PA 2J7PD 1G8YA 1FX0B 3GLIA 1E9FA 3BD9A 1YZLA 1ANKA 2J0UB 3F8TA 1CTQA 3CX7A 4Q7JB 3K9GA 4RCZA 3KQKA 1H8ED 1UKEA 2MSDB 3M6AA 3RLFA 2EU8A 3BERA 3K1JA 1OIWA 2IHYA 3HP1A 1G21E 5DGXA 3CPEA 1XD2A 2AXPA 4OKSA 3W9YA 3GPLA 3EPJA 4M1SA 2GA8A 3A58B 4GPTA 2ZANA 4MDEA 1G8PA 1LVGA 2QPOA 4LBZA 4NCJA 2A7QA 1QHGA 4K46A 2Z83A 5DISB 4BEBA 1OXVA 4Q1AA 1G1MA 5KPJA 1KO8A 4AG6A 4D4JA 2VSOA 2IXGA 2P67A 4O2LA 3R9WA 1IHUA 1VCNA 1S8FA 2PCJA 4LV6A 3C5CA 1COWD 1H65A 2QT0A 4QBFA 5DI3B 4Z1MA 3TR0A 3V4RA 1AGRA 4AKEA 4BE7B 4OI0A 2OCYC 3RS7A 4I1UA 1A2BA 1ZVQA 2GXAA 4AI6A 5IT5A 2DWQA 3ZH9B 4KODA 1X8LA 4DZZA 1G5TA 3TVTA 2XB2A 4TZ6A 4YMVA 4Q21A 1KO4A 1XDBA 4LBYA 2WWYA 1RC8A 1F6BA 1AN0A 3OIUA 1ZD9A 4B32A 1E0AA 4G1UC 2REBA 3IKJA 1HURA 1NJFA 2WAXA 2HJVA 4DT1B 1J70A 1P61B 1MO5A 3OEEA 2AX4A 3R7WA 3AP2A 1BMFA 3LFUA 2HT1A 4PHFA 1J90A 2NG1A 5G41A 4F38A 3FDIA 1KZGB 2ZR9A 4A2PA 2HLDA 1Z83A 1A4RA 5EE1A 3SFVA 1J7KA 5ELXA 3SNHA 2DHRA 1OE0A 4DLUA 3CF6R 4H9GA 1EXMA 4BQSA 1A82A 1SXJE 1ZNZA 2QAJA 3EZ9A 3MUFA 4AG5A 3NDBB 2BMJA 2BBWA 3BWDD 4HB0A 4JL6A 2WSSD 1LW7A 4ASUA 1P72A 4A15A 1TTTA 3SYKA 1DAGA 1OFUX 2OFWA 1MKYA 3RS3A 4B33A 1ZUNB 2GXUA 4YMWA 3RRMA 2G1KA 5JEDA 2AL7A 1U8ZA 2EFEB 5EP1A 1TF7A 3BC1A 1NL3A 1L7VC 1FUKA 1TNDA 3MAAC 2BKEA 3NEJA 3HU2A 3GMTA 1WQ1R 3JVUA 4B44A 3IHLA 5BN3A 1DADA 1W2HA 3SJBA 2A5FA 4JS0A 3ZQ6A 3QUSA 4V0MA 1TEVA 2QM7A 2CVHA 1XXHB 4CF7A 4D4MA 4L15A 1UAAA 2D7CA 5EUQB 2FH5B 3EC1A 2MSCB 2G6BA 5EZ5A 4B3FX 1ZJ6A 3AP1A 3VR4A 2EYUA 3EA5A 1B23P 3CZPA 3KXKA 2YVUA 4GRAA 5FPSA 3OEHD 3RWOA 4EPRA 3B1YA 5CYPA 5JSZA 3U4QB 1G7RA 1I4TD 5FBRB 5EE5B 3LWNA 3QENA 1Q20A 2VP2A 1SKYE 2ZQ5A 4XWOA 2PZGA 3PV0A 3EPLA 3U7FB 2GZAA 2WWGA 1HQCA 4FMDF 2IYWA 2GK6A 3PQCA 4DKXA 2F3RA 5DN6D 1N0VC 2IT1A 2QPTA 1OFHA 2J7PA 3PUXA 3KB1A 2XXAB 4PZYA 2OCAA 4IEEA 3ZZ0A 5F2EA 4IKEA 1OSNA 1ZNWA 3L0IB 1TQ4A 2HV8A 1H8EA 2ORVA 2OLKA 4OHZA 4ZDJA 4GDFA 4KSCA 1KDOA 2ZI5A 3G0HA 2G1JA 2LCFA 1KK1A 2VF8A 3CPHA 2WZQA 3QKRB 1DE0A 1O87A 2RGNC 4A2QA 4HUQB 1CJKC 2C98A 2P6NA 2GVZC 3CZQA 4U5XA 3IIKA 4BRUA 3W5JA 5HKKD 4FXPA 2ZPTX 4A36A 5BYJA 1O3YA 2O8EB 3IBGA 1G7CA 4D0NA 4A6XA 3FFAA 3I32A 4MKGA 1U0HC 1G4UR 2Q6TA 3D31A 5FUVA 4CYMA 2PCLA 4LK2A 1U81A 3S1AB 2YWGA 4MRRA 2QGZA 4RD0A 1KI7A 1T0JB 3SC3A 4L4UA 2OHFA 2ZSFA 2ZIAA 4KBGA 4LOAA 1COWA 3RDPA 2ZJ2A 4DCNA 3NG1A 1NIPA 2IC5A 1KK2A 5HE8A 2ZRNA 1GRRA 5M04A 2IK8A 4MKIA 4Q1BA 5H70A 2O8FB 4MYUA 3O47A 1ZNYA 2WWWA 5C4MA 5LPNA 1N5LA 5KU1A 2EQBA 2HF9A 4M9ZA 2HUPA 4EDHA 2PL3A 1VCOA 3OF5A 4B3CA 4BWYA 3NTUA 2H18A 1ONBA 1G3UA 3WNDA 1W4AA 1TEXA 4QL3A 1S3GA 4Q1EA 1ODFA 1W0KD 2ZRIA 1GL6A 4Q4AA 3EX7C 1IONA 3R9XA 1AS0A 4CEHA 3U61B 3P32A 3FE2A 2CEAA 1SXJB 3QF4A 3W90A 1U98A 4DSOA 4HB3A 3GLGE 1P2TA 2Z5FA 2ZRKA 3I61A 1U9IA 3C15C 4TMVA 2O0KA 4A8JB 3UATA 1VHTA 2BM1A 2XJ9A 4DHEA 2IYVA 2CCGA 1Q3TA 5EP3A 2Z4RA 3B6EA 4C0HA 1Z0IA 3LX8A 2A30A 1W44A 1MH1A 2NZJA 3REFA 4PANA 2WKPA 2WSSA 1XPUA 2GEDA 3H84A 1OB2A 3U7GA 4EKDA 4Q9IA 3C7KA 1HEIA 4WIAA 2ZYTX 2AR7A 3QSYA 4Z51A 2GZHA 3GJXC 3KJHA 4PC2A 5BXQC 1G8GA 1RRPA 2IYYA 1XMIA 2HDNB 2ZUCA 2R62A 1IOZA 2DPXA 2WIAA 4H1VA 1CBUA 2IXEA 1PZNA 3IEVA 4IDOA 3ZDQA 1JPNA 1U99A 1UKZA 5FL3A 3M0EA 3HYTA 4FWTA 2AWNA 2R6DA 1E2LA 4G0NA 4MGKR 4ON9A 4QHYA 2IA5A 4NU0A 3C41J 4QHSA 4PHGA 1DAFA 2WBLC 2ZRAA 4JKYA 4PPFA 4BASA 5CITA 5J4VA 2VP5A 4M1YA 3EPHA 2XTMA 3V9PA 1VG1A 3EIHA 4HAXA 2B7BA 2F43A 2QMHA 3TMKA 3FMFA 2GNOA 3QXSA 3OEHA 3QBTA 1VG9B 2ORWA 5E7IA 3TE6A 5JCZA 3EZFA 3E70C 2HCBA 3X1WA 3IGFA 2GXSA 4EPTA 2YC2C 4RZXA 1F2UB 2RKOA 1KIMA 4JBYA 4DDVA 5EZ6B 5DN6A 1D8TA 3IIMA 4D2IA 5B57C 2LWIA 3PG5A 1TF5A 3VNVA 1R2QA 3N70A 1ZM9A 4FINA 2O5VA 4IXNA 1T4GA 3TRFA 1KO7A 3CNLA 4GMXA 4RKEA 5DO9A 2YOHA 5FTMA 4B6EA 2F9MA 3W8RA 2D2EA 3EZ2A 3FTQA 1KJYA 2B7CA 3QXXA 5KNDA 1ZIPA 3U44B 4F4IA 1YU9A 2AKAB 4TLEA 1UEIA 1SQ5A 2OO7A 4NZYA 1NLFA 3KKMA 1AGPA 2GDJA 1E2MA 3AVQA 2ZETA 2ZI6A 4JLBA 1TADA 2VBCA 3RS5A 2FV8A 5BQ5A 1Z8FA 3BIFA 1YZKA 5HKKA 2QSZA 5JWHA 4L5BA 2GCNA 4NMMA 4UNRA 5FPKA 2QTVB 2WOOA 4LJ8A 1AZSC 2ZRHA 1XMSA 2G0NA 5FPYA 4DLZA 4BECA 2HXSA 2ATVA 5KYKA 1D6JA 1TU4A 1JR3E 1SVWA 2RB4A 1IN4A 3TSOA 3LX5A 1SVSA 1AK2A 3OAAD 2QY9A 3GLIE 3MLEA 2CBZA 4Q1CA 4Q1DA 5DLQC 3K70B 1KDTA 5SZKB 3OZXA 2Z0MA 3U60B 4HEJA 1KI3A 4DLRA 1XTRA 4LCBA 4TL6A 4DCUA 1T3HA 2I4IA 2GEVA 3AVWA 4BFXA 2IHBA 3WBKA 3A1UA 1W46A 4ZPXA 1NN1A 2W00A 1BO6A 1E2NA 5GJVC 1TX4B 1MT0A 1SVMA 1UBFA 2WJIA 4JT2A 4DUGD 1NN3A 1GSIA 4LDJA 4MUBA 3W8NA 2ZYVX 1N5JA 3THXA 3DZ8A 5C18A 1VECA 2Q9CA 1QVRA 5IRCD 4DIDA 3I92A 1GIAA 1W0KA 2QZ4A 3NBXX 4KVAA 3GLGB 5IDVA 3U3OA 4IOMA 4NYIQ 4A9AA 4IOJA 4II7A 3WMGA 4XTRA 2JAQA 1DG1G 3BH0A 4RY2A 1US8B 3T61A 1JEDA 1KY3A 1XTJA 4EJSA 3LD9A 3SI7A 3DM9B 1Z5ZA 4LPSA 1E0SA 1R4AA 4CVNA 4ITRC 4TSFD 3WNCA 2OFOA 3THWA 4C0BA 4P4UA 4Q1FA 1OIXA 1MABA 3AVTA 3DKVA 4HZUB 3NHAA 1S1CA 3U5ZB 1XTSA 2RAPA 4F92B 1Z47A 2BC9A 2E87A 3QKSB 1D2NA 3QPUA 2QN6A 5CLQA 1Q0UA 3EASA 1DELA 1II8B 2AXNA 3BOSA 3SZRA 1GFIA 3AGQA 1J8MF 1ZD8A 4KLZA 4A2WA 4DDWA 1W36D 4OYHA 2VHQA 2HF8A 2ZRGA 5IHPA 4NCKA 1NKSA 2PZFA 2ZSEA 5JS8A 4BUJA 2GCPA 2ZJYA 5L3VA 4Q9KA 3UPUA 3IHWA 4J0QA 4LJ6A 1YRBA 4CEIA 421PA 1SULA 3QG1A 2R44A 4FCVA 4ZV4A 3EWAA 2XAUA 1RRFA 3RABA 3FFBA 2XNDD 2WHXA 2WSMA 2XZLA 3C4JA 2OG2A 2EVWX 2PEYA 2V3CC 1XBTA 3SYLA 4C4PA 1RYHA 2CL6X 1UEJA 4PQRA 5F9FA 5CDFA 4DCVA 3ADCA 3NC0C 2FWRA 4HAVA 2D3WA 2Q3MA 1XMJA 4PSAA 1ZMXA 1FL9A 4LYHA 3QG5A 2GWHA 3CRW1 4QJ5A 4I81A 2IYLD 1W1WA 1XU4A 4W5JA 4EQ6B 5KPDA 2NQ2C 2Q9BA 4P3YA 5CIQA 2UKDA 1IXZA 4EAQA 1X86B 2H1LA 2BBTA 4EIWA 1FQKA 1HE1C 1W5SA 1RE0A 2QAGB 4GFDA 4EPWA 3A4NA 4TYYA 3MD0A 3SN6A 2ERXA 4A0RA 4FMBB 4GBMA 3A1VA 1FTNA 5SZHB 1TUEA 4BFTA 2O8DB 1N6NA 4WOPA 5FFMA 3FWYA 4V0ME 1F3OA 4DB4A 1ZM2A 3CX8A 4KLNA 1CR2A 3KFXA 4G01B 2V1UA 3SE0A 1R5NA 4HUTA 4Q9LA 2XTZA 2NIPA 5KDDA 5SZJA 3Q5EA 3ICQB 5CIWA 1XEXA 5DHAA 4UQOA 1XB2A 4ZCIA 3BGWA 2QORA 1D5CA 3HJNA 3W5IA 1S9HA 3GLIB 4MGZR 4ESVA 2EFDB 2FU5C 4IDPA 5CJ2A 2FSIA 1E9DA 1E32A 4BFWA 3BH7A 2XZPA 1CJTC 3BRWD 2VYFA 1Z28A 1M2OB 3VR5A 4MKHA 1XP8A 2JATA 1XD2B 1I4LD 3QXJA 3ADKA 3VAAA 5J4KA 3RS0A 3DVLA 2JLXA 4JSTA 5EP4A 1ZC3A 2HJGA 5FUYA 4A82A 4ARZA 3I3SR 2GBLC 4XVRA 5TARA 1U90A 2VO1A 3FVQA 3PFIA 3CH5A 1SHZA 1RPZA 3ZVRA 1EX7A 1S96A 5TMPA 4TLCA 2JLVA 5KNBA 1XTIA 2D06A 1Z2AA 1OKKD 2CNWA 4PSVA 4YONB 4BEJA 1WBBA 1YZQA 1G3RA 1BH2A 3GEEA 3NBZC 5TDHA 3R8FA 2W2XA 2REXB 4V0KA 4ZCLA 3B13B 3JZAA 2ZRFA 4PO9A 3WMFA 3UMRA 2BBOA 2F1JA 4IVRA 4QGAA 3RSOA 4PAQA 4G5SA 221PA 4JL8A 3FOZA 3BH6A 3QE0A 2CK3D 3IIJA 4C0JA 1RRCA 2W0SA 4WXPA 1H8HD 2IWRA 5K8IA 2IYSA 4LHVA 5BWMA 4DSNA 3ASZA 5AJWA 4WW0A 1OPXA 4ZIRB 5HTKA 4LC0A 1JB1A 4TSFA 3H1TA 3BJIC 2OBMA 3P4YA 4NE2A 4X8HA 2ZJBA 3VR6A 4LJ7A 1UBGA 1ZM4A 3REGA 3EC2A 1CR1A 2QL6A 1N6OA 2A5JA 4N0DA 1CEEA 1JNYA 5EXTA 2JLWA 3R7WB 4Q7KA 1NMZA 3CONA 1A5TA 1N6KA 1JBKA 1FMLA 3CKLA 4Q03A 1R0XA 3DHWC 2B21A 3PR1A 3MWYW 5DYGA 4MRVA 4LBWA 2QMEA 4OQFA 3GLFA 3KQUA 3ASYA 4UKDA 4HYYA 2IS6A 3TIFA 3NH9A 4MGYR 1L2TA 2DY1A 3UANA 3RRZA 1UFQA 1P4SA 3ZZUA 4MA4A 3B5JA 1Z07A 1OW3B 1ZINA 4RZUA 4W7SA 5FI1B 3WP1B 3LLUA 4U00A 5LB4A 1RKBA 3FPAA 4JYBA 4KCGA 3TJZA 1E9SA 5FTLA 2XNSA 2J46A 1M7HA 2OLJA 2RGDA 4PC3A 1U8AA 2CE7A 1XTKA 4QBIA 1R0ZA 2MSEB 2ZROA 3BAFA 2C5LA 4I1SA 4P32A 1ZBDA 2RGCA 4R2HA 5FL7D 1VYVA 5E4FA 2QP9X 3I8XA 1FP6A 3OE7D 4PZLA 5HZHA 1E2PA 2QBYB 3EZ6A 4R7ZA 1ZCAA 3TUZC 4Q5IA 1G17A 4QM6A 1NG9A 1HE8B 2YHSA 1RVDA 4EFNA 3QEJA 4DRZA 2BMEA 2I3BA 1JQLB 3AVOA 2MMGA 3EIQA 1GAJA 1K8RA 5J4YA 1G7SA 3CB4A 4Q7LA 4ACAA 3NWJA 4TN1A 3KKPA 2B8TA 2FFAA 2OBNA 1OXXK 3CBQA 4EPVA 2GJ8A 1QHSA 3K0FA 4O2RA 1E9BA 4OHXA 5JSZB 3KXIA 1I2MA 4PPGA 4QHTA 1CR0A 2C03A 3CR8A 1M6NA 5AK0A 3FHOA 1CRQA 2YZ2A 2YNMA 6Q21A 4LUCA 2IEYA 1AIPA 1QG2A 3NXSA 1DAHA 5D3MA 1W7AA 1KI8A 5C46F 5FBVB 1KNXA 4TLDA 1Z0AA 5L8VA 1Q22A 3VR1A 3U6BA 1JR6A 4OJQA 1EX6A 2KB0A 4AKIA 821PA 5KHOC 4WZ6A 4XSHA 2GHIA 3CM0A 4JZKA 1WB9A 2BEJA 4URXR 1K5DA 3MJHA 1NVWQ 2X77A 3PUVA 1KK3A 1X1RA 1ZAKA 5A4JA 4AURA 1KY2A 2ZI9A 1TL7C 2OUKA 1M34E 4LJ4A 4XIGS 3VHLB 2P65A 4HLQB 2TMKA 2ZRJA 3MWKA 4I1VA 4KVGA 1VDZA 5JI2E 4KHZA 2P5TB 4C0SA 5DI9A 3C5HA 1SHKA 5FH9A 4NDZA 4PC6A 5EQTA 1GVNB 2ZRMA 1Q21A 2NPIA 1A7JA 3ZQJA 1N6HA 3SQWA 3QVUA 1R7RA 5KDLA 1Z0JA 3WHLA 1Z29A 1WP9A 1NVVQ 2QQ0A 4LBVA 4MYTA 3B7GA 1G3QA 4YMSA 2ZSBA 4QGGA 4DJTA 2CHGA 2ANCA 1UADA 4UNQA 1G8HA 3LLMA 1QF9A 1TUIA 2N46A 3NH6A 4HB2A 4JVLA 1FUUA 2KWIA 4C0QC 1E2GA 2YYZA 5G40A 2Q9AA 3WMEA 2Q0HA 3R20A 1NY5A 3Q85A 1PVOA 2CK3A 2G0TA 3G5UA 5JS7A 2YJTD 5EJEA 1H8HA 2YWHA 1LNZA 521PA 1KSHA 2R6AA 4YLGA 2WM9B 1E79A 1KI6A 2DWOA 4BRWA 3H0KA 1BIFA 4PR0A 1W48A 3LVRE 4BLSA 1DAEA 3NHBA 4V0OA 4YMUA 4MYHA 2VEDA 3NBYC 5EE3A 4IRUB 2C8VA 4Q4JA 2G77B 2ATXA 2F3TA 4M9SA 4AYTA 2VPPA 1E1RA 4Q4AB 4JLMA 1NJGA 3VU9A 3X1XA 1E4YA 4B35A 4CEHB 4AD8A 1E2FA 1X3SA 1MRNA 4OQNA 2GTPA 3QF4B 1QZXA 1KTVA 3JVVA 1Z3IX 3K09C 5JJIA 1IAQA 2OE2A 4MGIR 3HU1A 3HWSA 3IEUA 4URYR 2HEIA 3QKUA 5TXGA 4LHZA 3RYTC 1ZW6A 1P3JA 3BK7A 4DVGA 3T1QA 1D9ZA 5FR1A 3B85A 3SYNA 3L2OB 1L4UA 1TPZA 4D4LA 2JASA 3TVDA 3CH4B 4W5WA 1OV4A 1Z6YA 3L8YA 2K5UA 4WA7A 1ZRHA 1BYUA 2CVFA 1P2SA 1P60A 1E2DA 3T06B 1OH8A 2NO1A 2QG6A 3BFXA 3HR8A 1C4OA 1U94A 2JJ1D 3CIOA 3OE7A 4KYIB 3WYGA 1WDTA 1OB5A 1FP7A 1W36C 2BV3A 4PSKA 1OH6A 4PC7A 2N1BA 4GT1A 3TAHA 1JECA 4Q02A 4YQFA 5CB6A 2FZ4A 3L43A 2IYZA 2ZJZA 3U6KA 621PA 2PMKA 1PUJA 5FTJA 2ODNA 5JZVA 3FHTA 1YHNA 1XWIA 1E9AA 4JVSB 4A92A 5JWOA 2F43B 4HI0E 2GJSA 5JWRA 3FHCB 5LBIA 2JLQA 5GADl 1MOZA 2C95A 1GTVA 3SBEA 3NC1C 3K0SA 1R8QA 1T91A 3A36A 3FKQA 5KSPA 1OYYA 1PUIA 4C9BA 5HE9A 4DLTA 2X2EA 3B9QA 1M74A 3AP3A 2F9LA 5CDFE 1Q44A 1DPFA 1EGAA 4CW7A 4KFRA 3PJRA 2CJWA 2E1RA 4RFVA 3W3AA 3V00A 2V1XA 4OI2A 3GD7A 4F4JA 4IVPA 1E99A 1YZGA 1OH5A 3PVSA 2P5SA 3KKQA 5DH9A 2ZITA 4QFMA 4BLRA 3EAQA 1IN8A 2ZSAA 1AS3A 3PEUA 3QBVA 3RWMB 2GJ9A 1E94E 4ACBA 1OXTA 1CIPA 1N25A 1I2DA 1KYIA 5IK2D 4PO1A 4RVCA 4RD1A 4NYJQ 4B6FA 2OXRA 4GI7A 1P2UA 4R98A 2D62A 3X1DA 4DLYA 3K0AB 2DFNA 3TNFA 4B76A 2IYTA 2AKYA 5D3QA 3K0EA 3Q5DA 1XD9A 4GNKA 5CYOA 5DSZA 4CIDA 4DIEA 1GWNA 1T8TA 1OH7A 1RRGA 2B6HA 3IPXA 2A5DA 1S1MA 2VHJA 4US0R 2RGEA 1DARA 2QTFA 1JI0A 3FGNA 3X2SA 3SFZA 2C77A 2D74A 3A1TA 3GEHA 1E69A 1HUQA 3HYRA 4G5RA 1EFCA 2WWFA 4M0LA 3VFDA 5BN4A 2G9NA 4IOLA 5FOWA 4C2TA 2ZE6A 3BB3A 3B1VA 4CGZA 2EW1A 3CRRA 4KFTA 4XSGA 4TL8A 3LW8A 1S4QA 1LFDB 4UJ5A 1E4VA 4PQFA 4C2UA 1UJ2A 2CMKA 5L3QB 3BB1A 4AK9A 4JKIA 4K81B 1X1SA 1HTWA 4B43A 3THXB 5L3SA 1XXHA 1FTSA 4PHHA 1TF2A 4LYJA 2LKDA 3UKDA 1UDWA 2ZYWX 2DCUA 1OFTA 5AUQA 1MR3F 4B3GA 3DL0A 4NYIR 3CW2A 4MQBA 3AV0B 3L0SA 3LAWA 3RVBA 5HPYB 4AYXA 1FPMA 2J1LA 4B3XA 1DO0A 4EJSB 2OESA 4DLVA 3HPRA 3GLHE 1AQYA 3QIAA 3AVVA 3FMOB 4TTPA 5AUPB 1SKYB 1XJCA 3BORA 4QNRA 2YWFA 2J0QA 2QA5A 2ZI3A 2FNAA 1YR8A 2FGJA 2YINC 3SDZA 1E2QA 1KJWA 5E3HA 1MABB 4DSUA 2ZRBA 2A9KA 2X19A 1EK0A 2DWPA 3I72A 1PV4A 5JHHB 2WJVA 5C4GB 1DAMA 1DS6A 4Q01A 2D2FA 5JECA 4EFLA 2OAP1 1JPJA 3QKRA 1XMVA 2JJ1A 4LJ9A 1JEEA 4TTQA 3NVAA 1J99A 4DLSA 3UIEA 2HT6A 1EFUA 4ZI2A 2PMDA 2W0MA 2EWWA 4OBEA 3VKGA 3L8ZA 5GVSA 4A1FA 5JI3E 3HPQA 2NMVA 2GK7A 5FR2A 3SJAA 2JCSA 2RHMA 2OSBA 4IJMA 4CEIB 3H86A 2GJKA 3IQXA 3RAPR 3GLFE 3WRXC 2WWHA 3MWJA 1PLLA 1WXQA 2V55B 4BFYA 4JJKA 4ZDIA 3SS8A 1D2MA 5KTYA 5EXSA 2GBLA 1OYWA 3ZVMA 2QSYA 4DDTA 5DE3A 4A6PA 2OILA 3L0OA 3Q9LA 4O3MA 2FPMA 1GRNA 1TQ2A 4Q9HA 2PEZA 3QXHA 3D3QA 4LGMA 2AHOA 4WZBE 4PXAA 1QHNA 4QG7A 1YE8A 1IJFA 1FQJA 3DOFA 1XPOA 1GP2A 4F4CA 2NO7A 3BE4A 3AGPA 4KFUA 1JALA 3L82B 4TL7A 2VRWA 2OV2A 3RHFA 1DTSA 1UF9A 1N0UA 4M2LA 1NMXA 4GP7A 3O8BA 3LA6A 4ERNA 2XSZD 4RZ2A 4TQ9A 1P2VA 1YZUA 4P4SA 2DBYA 3TR5A 2VHUA 2P0EA 4B73A 1WCV1 2WAYA 3HDTA 1R5BA 3HU3A 2R9VA 4MRNA 1N0WA 2J9RA 1C9KA 2EFHB 1XFAA 1YJ5A 5KUTA 4I4LA 5IK2A 2R65A 2JEOA 1HH4A 1P6XA 2NZ8A 2RH5A 1S2MA 4V03A 2ERYA 1X8KA 3GJ6A 3ND9A 1M7GA 2GESA 2XOKD 2CL0X 2QEQA 1IJEA 3KFVA 3LQRA 4G5GA 3KJGA 4M22A 4OK6A 5HZKA 3WYAA 4L8GA 1QDEA 1II0A 1G19A 2A78A 2RCNA 2JGNA 2VTKA 4NPHA 5GJWC 1KOFA 3O8RA 3I5YA 1NNEA 4F93B 3OFND 1KI4A 4KO8A 3F5FA 1W0JD 3CRQA 3LO5A 3F0TA 2H7VA 3GJ0A 2BCGY 3C8UA 3ZS9A 1UPTA 2ASEA 4B3BA 1TAGA 4MITA 3RS2A 3OIWA 3CLVA 4MDFA 4ARZB 4FI3C 2Z4SA 5CM8B 1G41A 2WJGA 4LPKA 3I73A 3L0PA 4JSYA 1XTQA 4V0NA 1GNRA 4PQYA 1A2KC 2PBRA 3FYHA 1U0LA 1E1QD 4NCNA 5FUWA 3VTKA 3T1VA 4X8MA 5ANRB 2WICA 4JBWA 1FFHA 5A5GA 3ZD6A 2UZIR 5JBQA 2GZDA 1OT3A 4NH0A 2VLIA 4M9XA 4PC1A 3UK6A 4OI4A 1NI3A 2C04A 3TSZA 1IN6A 4QBHA 1XF9A 1UKYA 1GDDA 4HAZA 1TU3A 4IDQA 3U2QA 3KXLA 4AC9A 1EFRD 1UBEA 1G6HA 2FE4A 3TQFA 4XTCS 3EW9A 3DOEA 1XNJA 3RC8A 3O8CA 2J7KA 2A2ZA 3SR0A 4JLDA 3U7HB 3TBKA 4ZKEA 2ZU6A 3CO5A 2CHQA 3GFTA 4JJZA 1II9A 2ZVPX 1NVXQ 4YC7A 3W6NA 2ANBA 1KO5A 2V9PA 4Q9JA 4NBSA 4PO8A 4NCHA 4Z8XA 1ZM3A 4TMZA 4WZAE 1OXSC 3A37A 2A5YB 1JAIA 2WPDD 2ORIA 2FGKA 2BBSA 1NBMD 1G9XA 3TH5A 3GEIA 4ZO4A 2ZI7A 3DM5A 3KQLA 3WBJA 1R5OA 1XRJA 4LV5B 5EXXA 1EWQA 4X8OA 1ELOA 1GNPA 4Q66C 3PIRA 1KMHB 3GLFB 2FFQA 3B1WA 3O8DA 3SHFA 2WWIA 2QUZA 1G18A 3CX6A 4XH9B 3C14C 4US2R 2IL1A 1OF1A 4OQLA 4NYMQ 4S35A 2IF0A 4D25A 1JJ7A 3QJYA 4TMXA 2B8WA 2IWHA 4PX9A 3X1YA 2FFHA 4LSGA 4QGFA 4UNNA 1N2CE 3I62A 1YKSA 4RFSA 3TW8B 2R6CA 4GOXA 4HLUC 4TT3D 2MMCA 3BFVA 4LWZA 5A0FA 1YR6A 2XITA 1T6NA 2CCJA 2FDCA 5CK4A 4BLQA 1AKEA 2W83A 1LTQA 5JCPA 2ZEJA 3AEZA 3D8BA 4GOKA 3MFYA 4DLXA 4OHYA 3MG9A 3CNOA 4LJAA 4IDNA 3R9IA 2SHKA 1CKEA 1VMAA 3GJ7A 1AM4D 1DG3A 1ZUHA 1WRBA 3OAAA 2ONKA 1BKDR 2BDTA 2IYQA 2WOJA 2OCPA 4HDQB 5LDDC 3TQCA 2XSZA 3LRPA 3ZIAD 1DO2A 2E9SA 2ZYUX 4FMCB 4YDSA 4UXHA 4KAXA 1WA5A 3LNCA 3T35A 4JL5A 2ZS7A 3H2YA 1LF0A 2BHRA 4GSYA 2GAOA 2ZUBA 3EARA 4WVFA 4JLAA 4FD2A 2PH1A 3K0FB 3U3KA 4HAUA 4JLOA 2AWOA 4DUGA 1XEWY 3KTAA 3EXAA 3AKCA 3UXMA 4PTLA 3BFKA 3I1FA 1E0JA 2XOKA 2R2AA 2RMKA 4TYWA 2P6RA 1CJMA 3A6PC 1QHHA 3PEVA 3MJRA 2JJ2D 5J47A 5G3ZA 5D3MB 2F7SA 2ZI4A 3K9HA 1F2TA 1P9WA 4FN5A 4BPBA 3UMFA 1E96A 1SVIA 2OAQ1 4P0TA 3GLHA 3TSWA 3OFNA 3Q7QA 3RNLA 5H1YA 3ZZTA 3LVQE 2QI9C 1W0JA 4HZUA 4R2IA 3UG6A 1W4RA 4U7DA 3OEED 2F55A 5KOYA 1R6BX 2YV5A 3K09A 5DHFA 4B75A 1E0KA 1KK0A 1DAKA 2ZE8A 3QF7A 3NIBA 5JMTA 2J87A 1Q12A 1ZU5A 2QQEA 4E09A 4MUAA 4AYWA 4EUNA 1FMJA 4L16A 4MRPA 1X6VA 2QENA 3BB4A 4LJ5A 2FN4A 2ONJA 1F5NA 3RANA 1VKJA 3B2EA 5BYKA 2H57A 3B1XA 1E1QA 4A8JC 1IXRC 1P9RA 2DR3A 2NPFA 4C30A 1LY1A 3U7EB 1NRJB 1XCMA 3IILA 4BLOA 1JXMA 1GG2A 4QJ3A 3DMDA 2F1RA 2NGRA 3EZ7A 4D0GA 3SU8A 4TZ0A 4TL9A 1CF4A 2UVQA 4ASUD 3E5HA 5CK5A 3ZYCA 5H68A 3KQHA 5LD2C 5F98A 1AKYA 5GJBA 1EFRA 1N6PA 2PLRA 3P27A 1AS2A 2D4HA 5TB5A 3THYA 4M1KA 3HR7A
chains in the Genus database with same CATH superfamily
2FQ1A 3IVAA 4BXOB 3A4MA 3WP0A 1JFFB 1JWAB 2BN4A 5JISA 2NNWB 1DPGA 1LPOA 3B1JA 2ZTUA 3PXGA 4O4LA 1JAHA 3DZFA 1YVRA 1Z06A 4DADA 1JE1A 1KI6B 4LQCA 4N39A 3ND8A 2HUNA 2VXOA 3IAUA 1IHOA 3CCBA 3VKWA 4TV9A 3GT4A 4R2MA 1NT4A 1XRMA 4WOCA 5FYQA 3RU2A 1JSCA 3WKBA 5L3RA 1V8OA 3SK0A 2A7XA 3E35A 1VG8A 1SBHA 1YA8A 1OZGA 4Q4HA 1I6KA 3KUDA 4EF6A 2ODQA 3VR3A 4CHGA 1NBMA 1C3EA 1RWQA 4ZI3A 1PV1A 2W11A 3PEYA 1Q57A 3LYAA 2VPQA 1K7YA 1SD1A 2APJA 1GLGA 1VMEA 4OK5A 3M9WA 2V54A 2BEWB 5M7EA 3RAGA 1CUXA 3TJRA 2Y67A 5LBUA 4Q00A 2G8LA 2QUAA 3QV2A 3KSMA 4C89A 3VYWA 5JAIA 4M83A 5BN3B 2AVNA 4XLZA 2A35A 1FS6A 3DMTC 1U2GC 2R8YA 1Z34A 3U17A 1ZD1A 1N2CB 2YJNA 2E4ZA 3QVGB 3LPCA 1ZIDA 4QOEA 4Z4CA 1QC5A 5E9QA 3AL2A 4ROSA 5CA1A 3LIIA 1Z6GA 2DETA 1A9OA 4BO0A 1YDEA 2WYVA 2I1WA 2FZLA 5JLJA 1J42A 3PF8A 2J9ZB 3EEOA 2AUTA 1KZYC 1YC5A 5T5QA 4I5IA 2P2CA 1JKJB 4B9AA 1A71A 4DCGA 1DXHA 4KSBA 4I99A 3ZWQA 2IS1A 3F7NA 2H2DA 3UT6A 1XUOA 3OTOB 1Z6XA 2YTZA 3NTQA 3GVXA 2HEGA 3IR6A 1B2LA 3I04A 4K6GA 4REOA 4KQXA 5IWCA 3IDQA 4NL4H 3GV0A 1A04A 4BNVA 1JFVA 1LRLA 2H5JA 3ESZA 3FJYA 4HBZA 4G89A 5ARCA 4D97A 4PCLA 3BD6A 3C97A 3LW7A 1ZNXA 1KJNA 2IW3A 3LKZA 4AROA 1R00A 1OTHA 1JJAA 2VATA 2UYCA 4XVQA 4XOIA 1AZWA 5GVRA 3ROXA 4GZ5A 2ZRLA 3UJNA 3EH2A 2JLVA 3U4DA 1JZQA 1H1TA 4HATA 2R1TA 4MYCA 2ZVQX 1SVOA 2FX2A 1GNQA 1E9RA 2ZU0C 2ON6A 2H9IA 1FUYB 4RDHA 2C9YA 3K70C 4CLEA 1A4XA 3I28A 1W76A 4QTZA 1VCIA 2NU8A 5LMCA 3FNFA 1NR1A 1PS9A 1TW3A 4BNFA 5FA8A 4ETNA 4KN5A 4WL0A 2BGRA 4IDAA 1IHDA 1AA9A 4OHVA 4YS6A 1RBQA 3ZKWA 4BO3A 3HB4X 5BYAA 4F2DA 2QE7D 4GQIA 4ZIRA 1QK3A 2V7QD 3SJCA 5GJCA 4O6VA 2IX3A 2GYVA 4H7IA 1AX9A 1H2ZA 2DUWA 1KEZA 2AK3A 2X2FA 3L0YA 1GLNA 2G06A 2PH5A 4Y9DA 3NNDA 4A5SA 1KWGA 2JLUA 4M87A 1YE3A 3PXEA 4QEKA 3ZD7A 2GEFA 2HRCA 4US1R 1KAOA 3QKWA 3IB3A 3COPA 4NHOA 5AWFC 2FG6C 3FCXA 3W8DA 1E59A 1L8QA 5K0NA 1GEEA 3BJRA 1N5MA 2HQOA 2ZT5A 1N7HA 3QFRA 1GOTA 1ZCFA 2ODPA 1PLKA 2B4YA 4CFSA 4JY7A 2GEKA 2HCJB 4DS3A 3G7NA 1Z56C 4UPEA 2KI5A 3HRHA 3SBDA 1EUCA 2J9GA 3MJ4A 1ES9A 3PUZA 3D7MA 3GUVA 4FIZA 4GPIB 4AKGA 2FCRA 1K5HA 2PL5A 2ZJOA 4LXHA 3WOHA 5AVQA 1PBTA 3HLKA 4DEYA 3C39A 2NYAA 3GYBA 5FFNA 1K9VF 3MQ4A 5K0BA 4WKBA 3JZMA 1O89A 5AIAA 1UMBB 3WLRA 1HV8A 1ADGA 1CZUA 3NJ4A 3GEMA 1D2GA 1H2AS 1DEAA 4W5HA 2HFKA 1OFIA 3RVKA 5AUNB 3GG9A 1I24A 3EXG1 4JUCA 1QP0A 4HDMA 3I9JA 1FX0A 2VHEA 3G1WA 4YP1A 3TM5A 5LUAA 2GF9A 4PHTA 2GF2A 2QBYA 2JIQA 1ACMA 1QQ6A 3FSRA 2CXXA 4B34A 4IO1A 3WGMA 1BWQA 4UUNA 1IN5A 3L8CA 5BR4A 1BJTA 4AT1A 1XCPA 3RGGA 5ALUA 2FP4B 3G8CA 1FSFA 3TQTA 4CGYA 1UMDA 2XD9A 3C3EA 2PYDA 1RP1A 1QO0A 5ALQA 2ZBPA 4RV4A 2ZT6A 1FP4B 2EARA 3EXHC 4RC9A 5BVHB 4YYZA 5LMUB 1CUCA 2C4NA 1MQ9A 3NNSA 4A10A 1U3WA 3FOCA 2CJXA 3NMUF 3GELA 4MWBA 3GEPA 3F4BA 1KAEA 4YH1A 3GEBA 2OZPA 4IEIA 4Y1RA 2JKZA 1E9EA 2HK6A 1JQ3A 1TYCA 1VYUA 4TSRA 4PIPA 3HB9A 4AMBA 4PN7A 2WLSA 3D6NB 3F5DA 4D80A 2QT1A 4R83A 3WSTA 4OMFG 3UT0A 2V6IA 3OFSA 3PJGA 1PR0A 3TD9A 1IK6A 3O5AA 5IARA 2QN3A 3HCAA 1SC1A 2H3EA 1NN5A 1QWOA 3OTWA 3P8ZA 2EJBA 3H8SA 4G84A 2J30A 4CFYA 1PJRA 2RGUA 1GXSB 2BI8A 3EA0A 4L7VA 1AK9A 4LI0A 4PNZA 5AYVA 4DB2A 2GO1A 4DZRA 1K3TA 3FUTA 4KXUA 1R8JA 1BNCA 4ND6A 4YTEA 3V2IA 4BZPA 2XNJA 5EL0A 3OJEA 1P5FA 4U9HS 4ZC1A 3IVCA 3JQ9A 4YDRA 5HMMA 2G80A 2H5IA 1VKOA 3BGDA 3QE2A 4HLNA 1CR4A 4GZ3A 3SOPA 3HVUA 3E7XA 1U4SA 5CVEA 3VC7A 4F91B 1JSXA 2P68A 1U8YA 2QL5A 4QXQA 4D6XA 2YXLA 3UGJA 2W8ZA 2VT2A 2H85A 1GKKA 3LBYA 5KINB 3G5AA 3ONVA 4RD2A 4BX9A 3ZXYA 4DT1A 4HSGA 3AKDA 4LZLA 3RRNA 1T5IA 3RS8A 2BGIA 3JD0A 4PAMA 4DWWA 1RXWA 1KXZA 2PX3A 4ZAZA 4AZ0B 1INLA 1Y3DE 3DCNA 1V6CA 3NHMA 4AN4A 3N2IA 5K8LA 4P4TA 2VP9A 5T8KA 1QOZA 3QELA 5BW8A 1USIA 2QROA 2RGXA 4LE1A 1QHXA 3WFIA 4ZRMA 4QLAA 3KLOA 4MQ4A 2FG5A 5TY0A 4JBIA 5DFAA 1XPRA 1EA5A 3IBYA 4OO3A 2IUEA 4I66A 4IJQA 4ENVA 5BV1A 2E85A 2WKQA 2B98A 4Z4FA 4OCZA 2I2AA 4EO7A 2PU7A 2I78A 1I0ZA 4G0ZA 1N2GA 4GOJA 4DUPA 5JJCA 1NBWB 4Z9BA 4WNYA 3GG2A 3GO4A 3WLFA 2PH7A 3WGUA 2DFKB 4MH0R 4JLJA 1X8JA 4X6UA 4YP6A 3ZZ1A 3DWEX 1W5TA 2JI4A 4DJ5X 5C4IA 1N77A 4V3BA 2UZ0A 1M54A 5ITZB 4WX2B 4JIGA 4HNVA 1TGYA 5JRJA 1DC8A 4XKJA 3IXMA 1FRVA 2C5AA 2YVKA 3NKVA 2G5TA 5COQA 5GV7A 2IDZA 3TTYA 4CLRB 4EUKA 2GVDC 3GJ8A 3UAVA 3TBHA 1CS4C 4GE3A 4LRWA 4P7BA 4MWZA 3PXBA 3E18A 1M0TA 2KBEA 1T9HA 2XAAA 2P4HX 3FH0A 4QU8A 4ED9A 1KDVA 3K2EA 3VOTA 1Y89A 4MIOA 2P62A 2HSDA 1S89A 4TTRA 4IOKA 1EVLA 1OLXA 3TIGA 5A02A 2XUZA 1TTQB 5HCIA 5KOJA 2XKAA 5M2QA 4JENA 2HA6A 3U4IA 4S1VA 2CHFA 3L7JA 3Q2IA 4R1QA 4TYQA 3HVRA 3P0HA 2GEJA 2IU4A 2QXYA 4UDNA 5T4HA 1BYIA 2O4CA 2QRKA 4AG3A 2VRCA 1NSFA 2LCIA 2AMJA 3RC7A 1RVV1 2QTNA 2AOWA 2QG9A 1E3LA 2A33A 1JG6A 3CLTD 3V7YA 3ZHOA 5LD2B 1Q7EA 2XB4A 3PGMA 3OWXA 4X1KA 4DIKA 3RNOA 4GECA 4HC4A 5LQSA 1VLLA 3HWRA 3ZQUA 4AAYA 4CQMA 1BMDA 2N47A 1JU9A 1G66A 1YBHA 3L7LA 3OKPA 4QYMA 2XXAA 3ER9A 1L1FA 1UBNA 1VIYA 2FFBA 1QX4A 2BZGA 2CLCX 2FA9A 3BHJA 3NFYA 4NU8X 3KPVA 4O1MA 1G21A 4AKHA 4ZVLA 2Q8QA 3RT7A 5TPWB 2C99A 1CG6A 1XIVA 3PWTA 4LJYA 4CF6A 3GFPA 4HLUA 4FDAA 1RAFA 4IF4A 2C2KA 1QVVA 2BF7A 5KTRA 2YJ4A 1H5UA 4M1TA 3DV0B 3TKLA 5CW2A 3TW6A 4CKXA 5KJEA 2X8JA 4HUQA 2VK8A 2YZGA 3PLRA 4WRRA 1JIKA 2H92A 5DYNA 3M2PA 2B82A 2ODBA 4AJ1A 1FVOA 4JVOA 1ULTA 2FVXA 5H7XA 5IZ4A 4DV1B 2GTHA 5I9NA 4NENA 1Q77A 2ZXUA 1REQA 1Z68A 2BZ0A 1BGVA 2ZR7A 2XCIA 3JYOA 4OYYA 3ZC3A 3BE6A 4LJRA 2FX3A 3V4VB 4BIIA 5LP6F 2ZJ5A 3IL2A 2VNIA 5ALSA 4B79A 2ZT8A 1YZYA 3TXAA 2P77A 2I7TA 3KWMA 2JLZA 1JA1A 2FMIA 3R40A 3DYBA 5FBWB 2BD0A 1M2VA 3HJUA 3P20A 3R0IA 3E9DA 3G1UA 1QR2A 5FTKA 3AH8A 3NLLA 4MB2A 4OQXA 1DQYA 3G9XA 1AQLA 2JG3A 4O63O 3WGYA 2CXHA 2WTXA 2P78A 1T3LA 5HP4A 1W49A 2P3SA 4JKOA 2QM0A 3OQHA 4C20A 4URUR 1FDUA 1KZ7B 2GH1A 2HXYA 3LA8A 4Y0VA 1H1LA 4DC1A 4O4HF 4A7PA 3CWQA 2CFSA 2NOAA 5HBRA 1PR3A 1JJVA 1Z5GA 9LDTA 2Z6VA 1E8NA 2PXAA 3JX9A 3OE4A 3A9RA 1D8AA 4B3IA 1EUQA 1OV6A 1O9GA 1PG5A 2B1GA 4HXFB 3K0AA 2OOSA 3SKXA 3WKAA 2W6ID 2AG5A 3L4BA 2FDRA 4ZYYA 2IGTA 5B30A 2C96A 4LXGA 3E3LA 3A25A 4HRAA 4ZU3A 4WBSA 1GGNA 1VHWA 4MP8A 4OP1A 3EOBI 2VUUA 2YXEA 4NYMR 2JL1A 2FSGA 5ARDA 1A27A 1YFKA 1EVKA 1C1YA 1MJGA 1GQQA 1QGUB 2CWWA 2E5FA 3BCRA 4XYEA 1SXJA 1ZYUA 1HE3A 1W6UA 3T94A 4N48A 3ABZA 1UKVY 1KOLA 4M1ZA 1FNMA 5LC1A 3AESA 5LA6F 4C4YA 1AUOA 4TOIA 1YKGA 2XVZA 4IMIB 2REOA 2WSYB 4DJEC 4LYYA 2W70A 3EEFA 1TVMA 4XPZA 2JIZD 4R16A 4QM7A 2RE8A 2OBFA 2QZPA 3K53A 1HL3A 3N7UA 5E1BA 5DNVA 2J6HA 4BAZA 2J0VA 5HKOA 2FPSA 2O0LA 2Y1LA 3HY4A 1ZISA 3PE3A 4DC9A 1NXVA 1V4NA 2X9LA 1ZJ5A 1DBSA 2IEZA 3BULA 3CVOA 3KE9A 4G1BA 4P4GA 2GM3A 4CM4B 1NVUQ 1IWPB 3TIVA 1DWUA 2Z5VA 1VG0B 4H27A 1CLUA 3ZWYA 1HDEA 2DR0A 1P0PA 3Q9NA 3O7WA 4KYUA 5DHUA 3OUZA 1OJ7A 2XGGA 1A7KA 1NUAA 5KCMA 3FCAA 4OOEA 4WBNB 4EGSA 4L1KA 1ZKMA 5H59A 2NTYC 1T9BA 4RJJA 4F3KA 4REQB 4MKFA 2AT1A 2J45A 3DTVD 3EYWA 3NC4A 4FDVA 5ALHA 5K3SA 3MINA 4CPDA 4IV5A 1BW9B 1RQ2A 1QIJA 4ZT3A 4RVOA 1KZ4A 1M2WA 3RYIA 3NM5A 1MB4A 4L4XA 5KEIA 5LQMA 2QRNA 1EUZA 3RFUA 1KMQA 1QIGA 1C3VA 1NONA 4KITB 1XF1A 2HJHA 3RTGA 2PJRA 3BM5A 3KOUA 1Y63A 5IAKA 4ZDWA 2I3ZA 1NKTA 1HNNA 1E2KA 3LI2A 1VKRA 3TCKA 4EG4A 4JI1B 1XZPA 2JGFA 3K9CA 4GWLA 3GLHB 3NBQA 3ICCA 2R47A 4XFKA 1RJDA 5MN6A 3T1OA 3BCSA 1EHIA 1QHYA 5TQVA 1FFAA 2X5OA 4DXAA 1RLTA 1D6NA 1M2FA 2QMUA 5AIBA 4KU4A 1U2GA 3TW0A 1HM5A 1F2UA 2R00C 1A69A 3TTWA 2LRHA 5CB8A 1SKMA 2G1PA 1SIUA 3AR9A 1ZCZA 2F3PA 3V2UA 1FNCA 4ER7A 2X0KA 1M0WA 2AVDA 2ALJA 3ASUA 4TTIA 3IA7A 4GRIA 3C3KA 4JP5A 2ZZKA 1R0LA 1HT1E 1NNUA 3HJHA 1O5TA 1U9IC 1E6KA 3MWLA 1H85A 3P9QA 2VHTA 2Y0EA 3U44A 2BFBB 3ZCSA 1Z6PA 1IRXA 3F49S 2FJPA 4G1MB 1YAHA 3TL3A 2IP4A 3FFWA 1LQUA 1MNAA 4PG8A 4B8YA 5SZIA 2MIIA 3MRSA 1SM4A 2EW2A 5KIAA 3HCDA 2O3TA 1EJ6A 2V65A 3WYEA 1RWVA 1G5PA 2H16A 4BRZA 5KNLA 5BV0A 3R0ZA 1GPLA 2D13A 2IV7A 1GA1A 3F5MA 3W78A 5J4LA 5MN5A 2WUEA 2ZT7A 3HGQA 1KEEB 1OXUA 3DNMA 4NDAA 2W2TA 5A7GA 3T3GA 4E5KA 3R23A 5LZ7A 3M4YA 5DBEX 2O59A 3OVMA 4H6PA 4BO5A 4CR6A 3AHIA 4GM4A 4HDNB 3HDVA 1Y1RA 3UWKA 4WFJA 3TGPA 1J0BA 1XMXA 1WUYA 1O6BA 5FTNA 3FX2A 4E1BA 2BELA 5EKDA 3QY0A 2XJ4A 4OIFA 4TV8B 4E5PA 1EP3B 3ETLA 2UUBB 3UG7A 5AJYA 3RT1A 5EJ9A 1MZPA 4YXWA 3L7BA 1AO3A 4I6GA 1ODJA 1NW9B 1PZXA 3EWSA 4EGCB 4M49A 5L40A 2JD0A 2P9ZA 2W93A 2ZS8A 2C3OA 2GAIA 1XVVA 2XQJA 2P4EA 1EAYA 3EJ6A 3FAZA 3NB0A 4YJKA 4RYDA 5D87A 5LLSA 4LNHA 3E53A 3OOSA 4Y0AA 5KHAA 4ENUA 4R2XA 5AOVA 3FVVA 1GG9A 2FPOA 4YCJA 1YR7A 3IMKA 1JLKA 1PHRA 4FFOA 2CZGA 5FBLB 5IH3A 4UHDA 5IBPA 2BHLA 3AR4A 3ZTYA 3VNUA 3OOHA 1DDGA 5IZCC 2J6IA 1GL3A 1J8VA 2OCBA 4I0WB 1XE3A 3M5CA 2GRJA 5JYCA 1GKIA 1QP8A 5DCLA 1SPBS 4NE7A 1OXMA 2FJUA 3N2EA 3LL7A 4HSEA 5JFGA 1YI1A 3OHMA 3T5CA 1OU4A 3V8QA 4E5UA 4QXAA 1NXTA 5ER9A 3FRHA 4G1VA 1O97D 3G0BA 4ZCQA 3EQ7A 4FYJA 4HF7A 3NBMA 4O02B 4OFBA 1EWVA 2XHEA 4IIXA 3IAS6 3RBXA 1WL8A 4HXEB 4F71A 3SX4A 5A2GA 3NEYA 4RXMA 3SVTA 2PUEA 1ZBQA 3A4YA 3IUMA 1L7MA 1U6JA 3D4PA 1L5LA 4DMKA 4LHEA 5LXTA 5AVOA 2CCKA 1D7OA 3BWVA 3SQLA 4JU9A 4RPIA 3S5JA 5C1BA 4EYSA 4LF5B 1UJ5A 3D0OA 1A9TA 1GILA 2FMKA 2W6JA 3L6EA 5C0OE 4KO2S 5IS2A 1H66A 2BP7B 1YUNA 4FIDA 4BLWA 4L3WA 4MQEB 1ZC4A 2RGWA 3KL4A 2PUCA 2F1HA 1G20E 2WG1A 2CLHB 3MM4A 5DLYA 2WFZA 2FOIA 2BF4A 2GO7A 4FDUA 2A6PA 1N3BA 2GETA 2Z5LA 4FFVA 3QXCA 1F0KA 3P0IA 1D04A 2J4CA 4QRHA 4YT5A 3T8YA 3UY4A 3TUJC 1VIDA 1WHTA 4EW3A 1N2ZA 1NXXA 1G2PA 2YV1A 3GVHA 2FZGA 4F6CA 1XP5A 1SMKA 2M9MA 2P9GA 3ZV3A 1AXRA 2QUKA 2E55A 3NHUA 3NONA 1I3NA 1JVBA 3B70A 3QEOA 4ZYWA 1M1YE 2H48A 1GDHA 3IV9A 3R6GA 4YV0A 2GAAA 3NUQA 4DMHA 3F3YA 3FG9A 3CQ9A 1L9KA 1NP3A 2ZWIA 4P33A 4D4HA 5KYXB 1XX6A 4YP7A 3H5OA 3NAGA 2GNAA 2PSEA 3FI0A 4HG2A 2BAGA 1WUJS 3H9CA 4JLVA 2GXQA 1UR5A 2PMFA 4JQOA 3VYTB 4AWXA 1LV8A 2D7DA 4Y2GA 3IOBA 2BIFA 2Q5QA 1CUZA 4UMFA 1F48A 2WFLB 4WQMA 1XA4A 2LXNA 4OL0A 5G3ZA 2FR1A 2P4UA 5BN5A 3QE4A 2PGAA 2RJNA 3DD5A 4IFBA 1N2OA 2QSJA 2DHCA 2VC2B 1T1GA 4RVDA 3I2HA 5AQEA 4UTPA 4KXYA 4JDPA 3M6FA 3KUCA 4GZMA 1ECCA 1OWNA 3WGHA 1E1RD 3JWEA 2LIVA 3IUYA 4EQ6A 2H06A 2GCOB 3AR6A 4GL4A 2CVOA 3SSNA 2F1KA 3HGTA 3WGQA 1G8MA 1N5KA 1SIBE 4OH1A 4EFMA 1H94A 2NO0A 2X8BA 1ECBA 3AZQA 1TJNA 3QW4B 4GUAA 3UXYA 2MSKA 3AL0C 1AVTA 1SC6A 1U3UA 2ID8A 4GU5A 5IEBA 4UARA 2Q4RA 4AZSA 3AHJA 4PFQA 3HL4A 1YVUA 2PFSA 4BYMA 3U9SA 1E2UA 5HF8A 1H5QA 4MW6A 3ZU4A 4Q3DA 3ZCXA 2C84A 1JDTA 2RGNA 4TXNA 3LUDA 4XB6B 4CEJB 4WN9A 2JZOA 2GUWA 3DLIA 2GFHA 3HN6A 3SYRA 4RTQA 4TMKA 1K88A 2CUNA 4PFSA 1KRHA 4R1NA 1WZUA 3CW8X 2NLOA 5CJPA 5LM3A 3IDAA 4AW9A 4D4IA 2JA1A 2ZRPA 3FYCA 3GGJA 3MSXA 4HAYA 3CG4A 2AR0A 1V9LA 3LHIA 1S4MA 4JA2A 5KAMA 5IEJA 2NSLA 1PDOA 2P75A 3RSGA 2E4UA 3AJDA 3SXUB 2VNJA 4K9SA 1XU9A 2F4NA 3F8TA 5E9AA 3CX7A 3MWDA 4RCZA 1EU1A 2XVYA 2C1ZA 1POWA 2XE8A 1NW4A 2MSDB 4B3TB 2FQQA 4EENA 3R41A 4NVRA 5AXCA 1NUUA 1Q50A 1DV2A 4MPDA 3CPEA 3NM4A 4OKSA 1R0RE 2E18A 1OZ0A 3MC1A 4JUDX 5TLSA 4K88A 1SPXA 3AFIA 4GPTA 2ZANA 3KT3A 1IXKA 1LVGA 2QPOA 2V7TA 4G9EA 2DAPA 1I4EB 4DIBA 1GNSA 1SVUA 4AJ4A 1XMPA 4LYDA 3ZU6A 1G1MA 1Y37A 1HGXA 1IFXA 1KO8A 1D4FA 3KPYA 4DV7B 1HNWB 2QGFA 2Z9CA 2CLEB 2H1OA 1F38A 2VSOA 3AI1A 3SZMA 1IEWA 1GCAA 2BZ1A 1NVTA 1RKXA 3MCZA 3UJ7A 3FYUB 4NMLA 3ETNA 1K27A 4BVBA 3QBEA 3O9MA 5B58T 3F98A 2XGOA 3C5CA 4AM8A 4W7HA 5DI3B 1D0IA 2OZVA 5J58A 4WT7A 4EITA 3FPKA 3OCVA 4BE7B 4OI0A 3NP7A 4FB4A 1A2BA 4LY0A 5M5BA 3EVCA 4M37A 5LU8A 3PEFA 5H0IA 1U8TA 3QGMA 3ZH9B 1X8LA 1QGOA 1G5TA 3LFTA 3ZGNA 4N5NA 4ZI5A 2I6XA 4YMVA 2Y1WA 1J09A 4Q21A 3QVSA 2Y66A 2P7IA 1N1DA 4D99A 3PDIA 2JFNA 4RMJA 4CUKA 3V4SA 5LMNB 1KPGA 1WOYA 2N9UA 3BSFA 3EOAI 3L93A 4LBYA 5KU7A 1J07A 1MQ8B 3U4GA 2TMGA 5LOVA 1E0AA 1F1JA 1WZNA 3B52X 1M2KA 1E7QA 4MWTA 1P61B 4TKMA 3HBFA 4XIIA 4DMMA 1VL0A 5EMLA 3R7WA 1UINA 3VDQA 2W2OA 1TO2E 4MVYA 1YIDA 5U9CA 1Y5LA 4PHFA 1J90A 5LWHA 5JBIA 5K09A 1KZGB 3PXUA 2QL9A 4A2PA 2FPPB 1Z83A 4IRMA 3SFVA 4B3SB 1TK2A 3HCPA 7ADHA 4MV8A 3P9YA 3I2IA 5A4FS 5LR6A 1E77A 4H9GA 1U6KA 1EXMA 5K3CA 2AR9A 1A7UA 4LDPA 1DXOA 3ETHA 2I4RA 2Z2ZA 1BHO1 5FQOA 2Q9UA 1QRUA 4HX9A 4IIUA 1FNSA 1PUXA 5LYJA 2BMJA 4X90A 1E4EA 6YASA 1UKCA 2X3FA 1NXWA 1V2GA 4JL6A 4MVWA 3RO7A 5DGCA 1CYEA 1P72A 1FSSA 3O4FA 3PZBA 4PLWA 5JXWA 5EQDA 4A15A 1OCEA 1DAGA 2VPYA 3T95A 3D43A 4XIJA 1KVQA 1P44A 4WK4B 4YJHB 1IU9A 4YMWA 5JNUA 1SKBA 3GCXA 4PGHA 1U8ZA 2DBZA 1TF7A 3RVJA 2CYBA 3QI7A 3ORQA 1TNDA 3DGFC 3GGCA 4WJLA 1ZOLA 3O8QA 3GMTA 4KUHA 1QUFA 1FJGB 3VZRA 4ZFNA 4BC1A 2UZ4A 3CZ9A 1T8SA 2XA9A 4R68A 4JS0A 2C31A 3F4KA 4JJ8A 4OXIA 5JMPA 3B36A 3ZGOA 3O3CA 3AU8A 2QM7A 1BFUA 2CVHA 1LPBB 1NQUA 1W1IA 2ZSHA 3O38A 3RH0A 3DTYA 4DA9A 1UAAA 1R5JA 1RU3A 1OLUA 3LVBA 2B8NA 3EC1A 3SZGA 2MSCB 2R1ZA 4H3VA 4AJNA 1DBVO 1OPRA 3ENWA 3UZUA 4B3FX 4CG2A 2EYUA 2OHJA 1S8AA 3LT2A 3M6VA 4MV1A 1DINA 3CZPA 4GRAA 1DCKA 3FRJA 2KW5A 2BJHA 4PX3A 5DX1A 1LPAB 3VPDA 1IY9A 5FEMA 1G7RA 3MBOA 4BWVA 5JSZA 3Q15C 1B0AA 4XWOA 2OCGA 2VP2A 1SKYE 2ZQ5A 1WV0A 4IV0A 1LLQA 4OL9A 4YHHB 3EPLA 1WXWA 2A9JA 2GZAA 3R3UA 3TS1A 4A5OA 2HR1A 4XDYA 4D9EA 1HQCA 1YDHA 4OGGA 1FXWF 3TKAA 4N40A 5DN6D 2IT1A 3FM9A 1VKZA 3IE0A 5FUMA 4PZYA 4J1NA 3RBAA 1LGYA 2N0SA 4IEEA 4Q4DA 3ZZ0A 1A2OA 2WFAA 1M33A 2WYOA 1XL0A 3E1GA 5JLAA 4OQZA 3JALB 2ORVA 2OLKA 4LMBA 2NSHA 5A9TA 4ZDJA 1LDBA 4S2UA 3EGIA 5KNDD 1PAUA 1K7FB 1KS2A 2ZI5A 4J03A 1KC3A 2IEAA 3DDOA 4JFAA 4JHLA 4PYJA 2LCFA 1KQNA 3DDHA 4YMHA 4LAFA 5LDHA 1IPEA 3ULKA 3TGWA 2QN9A 5CW1A 4XM1A 5L7YA 1O87A 4R81A 2CZQA 2PXCA 5CG1A 2ZB4A 4C7KA 3CZQA 3EODA 5ALYA 1T8YA 4B31A 2AFHA 3IIKA 4BRUA 4C76A 4NFSA 5PGMA 3PXAA 4KUGA 2C4HA 3IVXA 5HKKD 2I34A 4AO7A 2HPHA 7GPBA 2X8LA 4GYYA 4ER0A 4MKGA 2PIAA 1G4UR 2COKA 4LOLA 4CMAA 5BVGA 1U81A 5JQGB 2CSUA 2DH5A 2YWGA 3AEKB 3L79A 4MRRA 1KI7A 4ZA2A 4DGQA 4EECA 4UTZA 1KU6A 3FJ1A 2Q5LA 3RDPA 4LOAA 1KYZA 3WLTA 2ZJ2A 1U2TA 3QWAA 4LWQA 4G0QA 4DCNA 4E51A 5EIEA 5EMJA 1NIPA 3HCBA 3ZNOA 3E9RA 1KK2A 4PZEA 2ZRNA 3U56A 2M6SA 4E5SA 3I3OA 4WE3A 4B17A 1DB3A 4Q1BA 5M04A 4I4TB 3VGJA 2BEUB 3NZEA 4UQLA 2NTNA 5C4MA 1I33A 3GARA 3OOEA 4ZYZA 5LPNA 1ESEA 5KU1A 5IT4A 2EQBA 4DBZA 3NIDB 3CX3A 1RRKA 3FZQA 4P38A 3UK0A 5I7VA 2O0MA 2PUTA 5B4VA 3F9IA 1LBTA 2JRCA 4ZMRA 4V2IA 3G9QA 5C5EA 1QQAA 2BTQB 3EVAA 4OJMX 4RZSA 1TEXA 2EHJA 1HDYA 2YNMC 3FUWA 1A98A 3AWIA 3N6XA 1MB3A 4ND8A 4HBGA 1S3GA 4Q1EA 4EG6A 4Y67A 4IIEA 2R00A 2WKSA 1W0KD 3MGAA 1GL6A 1Y3CE 2AYYA 2QD3A 2X0RA 3B6MA 3M81A 4Q4AA 4W82A 4BTEA 3EWIA 1VPTA 3T7RA 4E31A 3M5PA 3FE2A 4YUVA 1UMBA 1U98A 1XZHA 4P34A 4BDTA 5KOHB 2YV4A 1PR6A 3PD1A 1G4HA 4GI1A 4M0CA 2ZRKA 3A7DA 3U81A 1U9IA 4A8JB 4R05A 1SUAA 1ZGZA 3C8DA 3MJDA 2PRIA 3OZDA 4EW2A 3EFHA 3LDUA 5DDIP 2JFPA 1MAHA 1N4DA 1JTEA 4U8GA 4YWHA 2NZJA 4PZUA 1BKSB 4MA0A 4R2KA 1JR2A 1LQTA 1QKJA 2WSSA 3JARA 3M5WA 4E4TA 2GEDA 4QPDA 1J2EA 3U7GA 3N2LA 3VHXB 1YJ8A 2QDKA 1HEIA 2OLEA 3H8JA 5CT8A 2ZYTX 4DBVO 4EY8A 2X1HA 1QF6A 2EIHA 3FPSA 1CQIA 2GZHA 1Y48E 1YL5A 1IYZA 1QTRA 1BS2A 1DC7A 3KM0A 5BXQC 3P2IA 5KC8A 4TRMA 2HDNB 3LCVB 1S2LA 4TXLA 2DPXA 1FP4A 1MOQA 5HJEA 3Q8KA 3KALA 2AC4A 3ZDQA 1JPNA 4MQ5A 4G6ZA 1BE0A 1FP2A 1RI4A 1Q7GA 2FSUA 5HS4A 1U99A 1UKZA 3PC3A 2IZ5A 4EG1A 1RACA 3PFGA 4ON9A 1E2LA 1IZZA 4BE4A 3CZMA 5IFKA 1V37A 5JZOA 4BB0A 4QHSA 3RRBA 3T38A 2WUGA 1W25A 1V1RA 4BASA 1NAHA 5CITA 2VP5A 2BGMA 3CTMA 3NDRA 1DDIA 4K0KB 2C5EA 1FTGA 1OXBB 2RH4A 4L22A 4BQQA 1TC2A 1ONPA 1QONA 2B7BA 2F43A 3W7VA 1YS4A 1Q7CA 4FFSA 4DBLE 4F8JA 4QU9A 4LQDA 3ANLA 3FMFA 4Y6PA 3A3OA 4YNBA 3TMKA 4F2PA 2R751 5MHTA 1DKPA 2GNOA 4G5FA 1T2FA 4H35A 4CG1A 1BRTA 4IGEA 3SE7A 1GG8A 2XUDA 1VG9B 3QBTA 4UZFA 5DGDA 2HCFA 4FOLA 3OFVA 5DLPA 5CCEA 3KKZA 1PZFA 3IGFA 1AQIA 1L7EA 1L5GB 2GXSA 3RW9A 4WLOA 3DKIA 4EPTA 2FUNB 5IZCA 4S1OA 2HU7A 4JBYA 4RPHA 4DDVA 1D8TA 3IIMA 3IQDB 4D2IA 2HD4A 5HF9A 3ZCQA 5B57C 3C7TA 4QUJA 4YRDA 3VNVA 1EK1A 2HKIA 3HXPA 1S02A 4HWKA 1DIOB 4FINA 3AINA 3IPLA 4AZVA 3WJ7A 4LGCA 4RKEA 4NOJA 2YIVX 1W0CA 3QOYA 1UC5B 5ALJA 1N1EA 2YOHA 2VT7A 2KMLA 2D2EA 4GVLA 1DV1A 2B7CA 1KJYA 1M34A 1VSUA 3N28A 3QXXA 1Q0ZA 1GCOA 4PLHA 4F4IA 2AKAB 5B53A 4BAGA 1UEIA 2OO7A 5HIIA 3KYCB 4AZ0A 3DE4X 1ACJA 1EBUA 1L7AA 1NLFA 2VWHA 3KKMA 1KQGA 3COVA 5K4HA 4MKZA 2BH2A 4OGLA 4CKBB 1SHUX 3FFXA 2V4MA 2FV8A 3F1LA 5BQ5A 5IN5A 4LE2A 1D0VA 3L6RA 5JWHA 4DR3B 1Y42X 2ESRA 3MQFA 4UNRA 5KMGB 2PAAA 2OVFA 2WOOA 5LBTA 4LFCB 1BCRA 1AZSC 3N2GB 1XMSA 2PT9A 2PV7A 4BECA 1QNFA 4ALNA 2OORC 1JR3E 1B76A 3TSOA 3LX5A 1J25A 2GPJA 3OJLA 4KQKA 4CLDA 2FY8A 2FZCA 5JAHA 5KQPA 2OGUA 4XEUA 5C53B 3MLEA 5JU6A 1OD6A 2CBZA 4Q1CA 1YDMA 2IHKA 3DD1A 3DLPX 3LYHA 4Q1DA 5CNJA 3VR5D 2X0NA 3U60B 4EABA 5JCJD 2EL9A 2QVLA 3EAGA 3NOVA 4O4IF 3Q8MA 3RKSA 2RG7A 3S70A 2I4IA 4QE3A 5L4LA 2NV6A 4BFXA 2IHBA 5E6RB 5EYPB 3A1UA 3UEOA 4ZPXA 4FJ2A 2IOYA 1BO6A 2Q3BA 2CFRA 2XUOA 3PFWO 3GPBA 4LC9A 3PNSA 3U9TA 1PGJA 4KTVE 4FYPA 1BVUA 1V95A 1VIVA 1NN3A 2VNSA 3LY8A 4FSHA 4LDJA 3W8NA 2ZYVX 3DQPA 4NFYA 5CURA 3DA8A 5BYBA 1K1EA 1MTZA 1V5EA 5C18A 4KQMA 5DNEA 2Q9CA 3MS2A 4HVTA 4BMPB 1SUSA 2QLMA 1UEXC 4DIDA 1HNZB 1IATA 3M4JA 1X1EA 3KZVA 1MHPA 4LZWA 2LP4Y 4IFIA 2C7PA 5I7OA 5IDVA 4KIWA 2ACEA 4P0QB 4A9AA 3OPVA 4PG6A 1USKA 3N2KB 4M99A 3BH0A 2IE8A 3KXPA 2MHCA 1KY3A 2ZLBA 2KLBA 2B0CA 3GUCA 2PMEA 4PLFA 5K99A 3I2YX 4EB0A 1JG4A 3LD9A 4PWZA 3SI7A 3ZXIA 1E6UA 3GUUA 1DJPA 3PX2A 4BGUA 2IYEA 2X5KO 1RWPA 1F17A 2GX6A 4K2AA 4DMLA 1SXQA 4EHFA 2IH4A 1ETHA 3MJFA 4ETWA 3ON5A 2V7BA 4ITRC 1XLTC 2VKTA 5KTNA 5AI5A 5JCOC 4TKVB 3DFKA 4P4UA 2ZBGA 1A0OA 1ZZGA 3BBLA 1WABA 4ZGBA 4HZUB 1RHRA 4LZNA 4M54A 2RAPA 3O4JA 3U3XA 3QKSB 1ORVA 2NP7A 2QN6A 1XDZA 3KQWA 1II8B 2AXNA 4G1EB 2JI8A 5A6SB 5TR9A 1SC3A 3SZRA 3AGQA 4LRTB 1ZD8A 2W8BA 2WD9A 3WLSA 4D4GA 3A26A 4OYHA 4I55F 1JU3A 4YJGB 2QF7A 5CA0F 2PWBA 5B1HA 1RJGA 1A72A 2IHUA 1OILA 2PZFA 2W22A 2ZSEA 3DTVB 4P6VF 2JRLA 4UEOA 3ZE0B 4F6LA 3WJAA 2O5RA 4A6DA 2XZTA 3IBTA 2YIJA 3CE9A 2VT3A 1MF7A 5I47A 1BKYA 1K86A 3WMRA 1GPYA 1SULA 2YVLA 4N49A 1T25A 3QG1A 1HDGO 2NYRA 1YASA 2HK7A 2SNIE 3K1AB 4DE5A 2VJPA 2WJ6A 3EVEA 5AW9A 5CXUA 4E5MA 5C9ZA 2P30A 2XCUA 2I4TA 3SGLA 5ADVA 2B0JA 4YBZA 2IHNA 1Y1LA 1EGHA 1TA9A 3ZPXA 1TZMA 3TWOA 4CR7A 1E1CB 3GEDA 1UEJA 1UXHA 4PQRA