1UDCA

Structure of udp-galactose-4-epimerase complexed with udp-mannose
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords UDP-GALACTOSE-4-EPIMERASE
publication title Structural analysis of UDP-sugar binding to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
total genus 132
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1udcA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1udcA01
2NQ8A 1HDCA 3KVOA 5JDCC 3U9LA 3GH3A 3ZI0A 1U2GA 4HBGA 4I5GA 3H2ZA 3PZRA 1HZZA 3TNLA 2LDBA 3RBVA 2UDPA 4OM8A 4F6LA 5CG2A 2J3HA 1R37A 3LZ6A 4DQUA 3WNQA 1ISFA 1F12A 4OSPA 1E6WA 4IGEA 3WSVA 4HFRA 3V8BA 5FEUA 3I9JA 4G81A 3TZKA 3A14A 3QE3A 1HDGO 1XG5A 4CQMB 4ND3A 1U4OA 3BXXA 3PXXA 5F3RA 5KCZA 1LRJA 3LSYA 3RC2A 4HFJA 4IDAA 3A9WA 1HEUA 4NI5A 3RFXA 4KMSA 4U7WA 5L95A 1LLQA 3KO8A 2IYPA 4OH1A 1KVQA 2I3AA 4ALKA 1F8GA 4YJDA 5A03A 4BO3A 3DZKA 4N5LA 3PTZA 4RPGA 1WAMA 1U28A 3D64A 3UF0A 1WWKA 2P5YA 4WCFC 4DIFA 5I9NA 1O8CA 4HNHA 2O3SA 4TRNA 4J3FA 1E1LA 1TT5A 3WOHA 2VWGA 1NP3A 3GPDG 1ZEMA 3PQFA 1HTBA 4PVDA 3WWYA 4R41A 1YB1A 2GNAA 3C1AA 3F4LA 4KUGA 2JAHA 2UVDA 3PFFA 4HADA 3U3XA 1DIAA 3U4IA 4WKGA 3CUKA 1FK8A 1ZXLA 2OUIA 3Q0EA 5DCUA 5HWSA 4BVAA 1NR1A 1U4SA 3LU1A 2HDHA 3L0DA 1PQPA 2NQTA 1ZMOA 3VHRA 4IS3A 3MWDB 4CMJA 5IF3A 1NPYA 1SEPA 1W8DA 5C7IO 3HSKA 4E12A 2I76A 5FYDA 3DBRB 1K2WA 2RH8A 3QWAA 3Q1LA 1R0KA 3ZV5A 4EEZA 1EE9A 1HDYA 4R68A 1VJ0A 5LC1A 4JQCA 5G2OA 5KVQA 2O4UX 3GHHA 2RIRA 2J8ZA 3NJ8A 3OEWA 4N7RA 4TRRA 3ADPA 1CJCA 4NQZA 4IUYA 2AMFA 3DOOA 3NEPX 2EW2A 1IHYA 2CF6A 3AM4A 3LYLA 2EKPA 2DQ4A 3AUSA 4L74A 1K3TA 1XQ6A 5AVOA 5JYEA 2PZLA 5JLAA 1BHSA 2YV3A 1QR6A 1PSDA 4Z9XA 5H83A 1RPNA 4IDBA 1S6YA 4P8RA 2E37A 4DUPA 3GEGA 4GKVA 4UAGA 4AJJA 1YE3A 5JO9A 3S1LA 3TL3A 4M54A 3FPCA 3WMXA 5AYVA 4BNLA 2YQ4A 1UDCA 3D4PA 3PP8A 5JSFA 3I4FA 4GX2A 1PWXA 3OM9A 3CH6A 5TX7A 1EUDA 4JJFA 5A4DA 1EQUA 4CM7A 4JP2A 3IKTA 2NU6A 2PK3A 4PLVA 1W73A 1XEAA 3KXDA 3LT0A 2R00A 2OBNA 2OOSA 4J1TA 4H3VA 3VAZA 4KOAA 1UH5A 3DR3A 2HU2A 3BA1A 2J3IA 4XCVA 4J1NA 5BQFA 1SEVA 1JN0A 4IPTA 3RUFA 4WPGA 2EKQA 4YJGB 2P2SA 2PGJA 5TLSA 1T25A 3GVXA 2ZYGA 3GVPA 4UREA 1YQGA 4AJOA 1KVTA 1B8PA 3GNQA 2VOEA 2QRKA 1HSOA 1XLTA 3BIOA 3RU7A 4D44A 4OIMA 3PQDA 4C7JA 1Z7EA 3EZLA 3MJCA 2RBEA 1EUZA 4WLUA 3HN2A 5L51A 1CDOA 1E7WA 1E92A 1NQOA 4NZ9A 4ITUA 4XGKA 3ZWCA 3ZDFA 5FWNA 4YB8A 3JQ7B 2NV6A 3DQPA 4L8VA 4BNZA 3ANMA 1LDMA 4E31A 3D5QA 2NNLD 4CM1A 4RDHA 2ZTMA 4C7KA 1I2CA 3SX2A 4B7UA 1V3TA 4PG8A 3OIDA 4CLOB 3ROMA 1X7GA 4UUOA 1NYTA 4GVXA 1EVIA 4IJVA 1GDHA 3JQEA 1ONNA 1HLPA 5ER6A 4CLEA 5EIOA 1AHHA 2D1YA 2X86A 1QLHA 2AXQA 2G1UA 2DKNA 3ANLA 3JQGA 1LSOA 4CMKA 5CDGA 1WDLA 2NU9A 4GAEA 2BMAA 5DN9A 4A10A 4FOSA 1QYCA 4FGSA 5B4VA 3PYMA 4MIYA 3WBFA 3NTQA 1HE2A 2OXIA 5CHEA 5JDIA 3DHEA 1B0AA 2D59A 4TZKA 4J7UA 2JD1A 4E33A 1KOLA 5K6AC 2HSDA 4O1MA 1V35A 2C2XA 2NADA 1MC5A 3ZGYA 2D8AA 4F3YA 1T24A 1RM3A 4BNYA 5EJ2A 2UUOA 3JQFA 3JD4A 3JQBA 1U8FO 1JKJA 1Q0HA 4GH5A 3RQSA 3TL2A 3WGYA 3GN2A 3OQ1A 4L4RA 1E3SA 2J6IA 2DBZA 3G49A 5MDHA 5TT1A 3NT5A 3L4BC 1J6UA 3NDRA 1T2EA 3FTPA 1NPDA 1LQTA 2WJPA 5T5QA 1P33A 2QW8A 3VPHA 2HAEA 3CINA 2EV9A 1RKXA 3H3JA 4ONEA 3WYBA 3IDSA 4NJMA 4BNTA 2CZCA 4D43A 4AJ1A 4PG6A 3H9GA 5ITVA 2JCYA 4HP8A 4I5FA 1X7HA 4XGIA 3WGGA 4GQAA 1GTMA 4QO8A 4EUFA 5A04A 5JS6A 5BSFA 4AJIA 1PJCA 1T2DA 2BGLA 2EEZA 2GZ2A 4WOJA 1E5QA 4BB6A 3DHYA 5U1PA 3JQ8A 1RYDA 2Z95A 1V3UA 5B12A 4Y6RA 1BTOA 4RVUA 1N5DA 3OJEA 3ON5A 4II3A 1ARZA 3F3SA 2H6EA 1GQ2A 5JO0A 4E5KA 4QFDA 1CQJA 1XDWA 5AXCA 1FMCA 1I01A 3U09A 1E3IA 2NTVA 3ITKA 4AJEA 1HT0A 1UXHA 1V8BA 4ID9A 4UVGA 2DPHA 4ALMA 4YT8A 2ZCUA 4J6FA 5JXWA 3R6DA 3GHYA 5F5NA 5I8ZA 3TJRA 3FR7A 3ORFA 1HYGA 3PYLA 4RVSA 3RJ9A 3GK3A 4QFCA 1K6JA 4IQ8A 1Y7TA 3ZWNA 3AY3A 4XB2A 3UICA 3TQHA 5TNXA 2X0RA 3BMQA 3ZWWA 3K6JA 2VYVA 3WWZA 2HMWA 1VSVA 2CUKA 1WVGA 2AQHA 4YTEA 2ZKLA 4YVFA 5C37A 4WECA 4Q3AA 4XWYA 1AGNA 1SC6A 3DBVO 4FQ8A 4PIVA 1R4MB 5BSGA 4A27A 1NR7A 3UFXA 1VC2A 1WDMA 4L75A 4TVBA 3ETEA 3DOCA 1OFGA 1T4BA 4CV2A 4Z3KA 4O5OA 2UAGA 5KVCA 1JU9A 5L53A 1EUCA 1JW9B 2B0JA 1VPDA 3K9QO 2OL4A 8LDHA 4IZHA 2JHGA 1EFLA 2YZ7A 3HN7A 4HFMA 2H5LA 2NSDA 1DOHA 4Q3CA 1NVMB 2X0JA 4YRDA 4CV0A 1ENPA 2EXXA 1WLYA 1Y81A 2GRAA 3BMNB 3FHLA 5DBFA 3WX0A 4W99A 2WD7B 3NGLA 4FFPA 3RUCA 1BW9B 2D0IA 1VSUA 3GRPA 3ROPA 4YAGA 5AQ1A 9LDTA 3TOZA 1LLCA 3ZHZA 3JYQA 1ADCA 2Q46A 3F46A 2ZYAA 4BKPA 1QORA 1R4NB 3A1NA 5DOZA 4JBHA 3U5TA 1QLJA 4WLVA 3RKRA 1T26A 4RPLA 3LLVA 4FCCA 2ZK7A 1DB3A 1DEHA 3W1VA 2YHUA 4R3NA 3SJUA 4KWIA 3FSRA 4BNXA 1C1DA 5U9CA 3B6ZA 4DRYA 5GY7A 4FFRA 1H94A 5JCJD 2CDCA 2IXBA 4RF2A 5DULA 1R16A 4ZHSA 1PGNA 2HMVA 1ISMA 3S2IA 1YJQA 4PVCA 1A27A 2GR9A 4EDFA 1ZZEA 1SB9A 4R1NA 1P44A 3DC2A 2WD8A 1ID1A 3KTDA 2C5AA 1BRMA 2PD4A 3H7AA 2EP7A 1PS0A 2GN4A 4E32A 1O5IA 4I5EA 2I67A 1OMOA 2GO1A 2CVOA 1TVEA 1E0DA 1QYXA 4BQPA 1IB6A 2VHYA 5EN4A 3DMTA 1T1SA 4GGPA 4TVOA 1C0IA 4CQLA 3OECA 1OBFO 2A94A 3JQAD 1GZ6A 1XCBA 2V6MA 3ZNOA 4AJPA 1GZ4A 2A92A 3D3WB 4XYEA 3DTYA 1T1RA 1Z74A 5L7TA 4U5QA 4WASA 5JMPA 4EJ6A 3KYCA 2VHXA 4ZRMA 1TT5B 5EMHA 2G76A 4HFNA 4DLAA 1E3LA 1L1FA 2H1SA 4Y8VA 1I36A 2IEBA 3DOJA 3Q9UA 1D3AA 3FNHA 3UOGA 1P9LA 4J4HA 4U8GA 3W8FA 1EVJA 4MKRA 3IQDB 1Y8QB 4HWKA 2FR0A 1E1NA 3GUYA 1AXEA 2HMUA 2IZ0A 3IUSA 2O3UA 1LX6A 4DGSA 3AY7A 4G2NA 2CY0A 3QWFA 1DFIA 4L4SA 3WQSB 2PLAA 4R16A 5B4TA 1Y5RA 4ZQGA 4ZQHA 1AHIA 1H9BA 4U6SA 3GMSA 2BFOA 1IZ0A 4BGVA 3FWZA 2D2IA 3H9EO 4PLFA 1YL6A 4TSKA 2GF2A 4CM5A 3H2SA 4TZTA 1I10A 4MIEA 1AN9A 1RM4A 4BNNA 4QT0A 4BO0A 4FPXA 4PLHA 1KEVA 4R54A 4DIOA 1P74A 5A9RA 4DPLA 3NV9A 2QHXA 3JQAB 4KQXA 3JD3A 3QY9A 1GEGA 4ND2A 1AUPA 1Y5MA 2EF1A 3DL2A 4PZDA 2AE2A 3HG7A 3GEMA 3UH1A 3I6QA 5A9SA 3ZWPA 1GR0A 4LVUA 2GD1O 3PGJA 4PLPA 5KJFA 3LLSA 4GSKA 4DBZA 1BWSA 3I9MA 2GCGA 4IXTA 3RFVA 4Y9DA 3VPSA 4HXYA 1I3NA 4HY3A 1U5CA 4BIIA 4E5NA 5JDIC 1Y8RB 3INTA 1U1IA 4MINA 4NU5A 3E5MA 2QZ9A 1E3EA 4DPMA 1I0ZA 2Z1MA 3U62A 4JN6B 3B1KA 1EK5A 3PJDA 1R15A 2DT5A 4NFHA 1M67A 4AJLA 3RUEA 3W4KA 1BDMA 1HL3A 1XIVA 3O9ZA 1E7YA 2YHIB 3JQFC 5BNIA 3JQBC 4IJWA 3ZNNA 3ZWBA 3CZMA 3PI7A 4R9RA 5JE8A 1PWZA 3HNPA 3RCBA 4CL8A 2Q2WA 1HE4A 4E5MA 2EWMA 3WMWA 2V6GA 5TC4A 1FXSA 1QMGA 1MC4A 4WEQA 1C1XB 4D3DA 4I9NA 4RCVA 1NX6A 5FI5A 3GMDA 2ET6A 2AQKA 1VL6A 8ADHA 2P9EA 4Z0PA 1R66A 2C07A 1F17A 2FSSA 1K0UA 1PQUA 1UDBA 2UUPA 1IHXA 4RLHA 4WLFA 5F1PA 4BKOA 3C1TA 4EEXA 4BHTA 1I2ZA 3QJ5A 1RYEA 2NVUA 4IGFA 1ULSA 3NDJA 1Q7CA 3RC1A 1NQTA 1A4IA 4IMPA 1PZFA 2WYUA 3DAPA 3E8XA 3BHJA 3DHNA 2PD6A 3LDHA 1JA9A 5A5EA 5IXYA 1I32A 2UV8A 3GGGA 1L7EA 1EZ4A 5I7VA 1GUFA 1SOVA 1KVSA 2OFPA 3FR8A 3KV3O 4CM8B 4Q3BA 5K6AA 1VLLA 5KWEA 2P4QA 1WXDA 2CD9A 2W98A 1V9LA 1J0XO 2X7HA 4ZQEA 3QWHA 2E82A 4ALNA 2YW9A 4NFSA 4DYDA 1KY5A 2X8LA 1QYVA 3S2FA 2C5EA 1UDAA 5KJ6A 2Q99A 4EJ0A 1B26A 1ZXBA 1LJ8A 2WMDA 4QUKA 4OKIA 4EJMA 4XZ3A 3MJ4A 5C5IA 2RH4A 1ISIA 3JD2A 2X0NA 1CWUA 4PRLA 4E2WA 3TZQA 1UAGA 4OXYA 4CLDA 4DQXA 1LSUA 3QW2A 4RPKA 3AM3A 1KVRA 5H81A 5CDTA 1PJQA 2OP1A 4KUEA 4OSOA 4CMIA 4OXNA 5T8KA 1GUYA 1S7CA 3V2UA 2W2KB 2PZKA 3VKVA 3VPFA 3DAFA 1MXHA 2J5KA 3U4CA 1B3RA 1HSZA 4UUMA 2DM6A 4QO7A 5KVSA 3DZHA 4TRMA 5ENVA 1P0FA 3E82A 5LDGA 1LC3A 4BNJA 3JQCA 2W2LA 1Q7BA 4URFA 3GAFA 1PS8A 2ZB3A 3EVTA 1B16A 4EUEA 4RO0A 1GUZA 3AY6A 4NFYA 4BNMA 2C29D 4ZQBA 2X22A 3PZBA 4JBGA 1NVTA 4LISA 2ZTUA 1N9GB 2BGMA 4DREA 3OQBA 1C0KA 4QECA 3KEOA 3PHLA 1QV7A 2Y1FA 3K5PA 1C0PA 4B4VA 4B3HA 1DHRA 2QIOA 3CXRA 4G65A 4O0LA 4R01A 1HDRA 4Q3NA 4CR7A 5IFLA 5IZCA 4LW8A 2ZTLA 3INGA 3A06A 3O38A 5BNFA 3ZH2A 4NBUA 3WG9A 2RAFA 1PL7A 2VZ8A 3I9NA 1I3MA 4IDCA 4NMHA 4MJLA 4XJSA 3VDQA 2J5RA 1NXQA 3HDJA 3RVDA 3EHEA 3EK2A 4CMCA 3B1JA 2PH3A 3AUUA 3D0OA 4TKMA 2X9VA 2ZYDA 2AG8A 2FPGA 2PV7A 3V1TC 4GWGA 5TJHA 5A06A 5I7FA 4GPD1 4J9UE 2WM3A 4R1SA 1N1GA 4XQCA 2YV2A 1U3UA 3WTBA 2AQIA 1HKUA 5CFZA 1VL0A 5FF9A 3G79A 4CLRA 3UGKA 1EMDA 1HF3A 3ZNPA 1BXKA 3DBHB 3WYCA 4J4TA 4YJFB 2IDZA 4CM4B 4AFNA 2JD2A 1P1HA 1GY8A 3CMMA 5A02A 7ADHA 3E9MA 4EW6A 2FSVA 4JBIA 1ZO8A 1K89A 3G1UA 1DLIA 3BHMA 3DMTC 1GYPA 3D5TA 4DC1A 3RUDA 2C54A 1U7TA 2CVQA 3N58A 4OMUA 1R6DA 1TB4A 3Q2IA 4CM6A 1Z6ZA 4LRSB 3KYDA 1NFFA 1DC4A 3HDHA 4IY1A 4NBVA 4CUKA 4RV9A 3M1AA 1BXGB 5L3ZA 1V0JA 2Y1CA 3ONFA 4CV1A 5I7SA 2NTJA 3IIEA 2Y0EA 1WMAA 3PK0A 1J49A 4NIMA 2HRZA 3KRTA 4TWRA 3NTOA 2NVBA 5C7OO 3E5RA 4BB5A 4N5MA 1DFHA 2FZWA 1DC5A 2B69A 4R5HA 4XYBA 4AJNA 3CEAA 3V1UA 1PJBA 3C7DB 3I9LA 5KNLA 1O89A 5T64A 4GMGA 3W8DA 5CEJA 1U3WA 3OJOA 4FB5A 1I5RA 1NAIA 3ZWAA 3M6IA 3AU9A 3UVEA 1EFKA 2WEKA 4JNKA 4BS9A 3VH2A 4S3MA 2BI8A 3C8MA 3DZJA 2D5AA 3FCOA 5C3MA 2VCYA 3AW9A 2J3KA 9LDBA 4BNHA 3W4JA 3ADOA 4CM9D 1ZVMA 2AA3A 4YQYA 4GSLA 1UXJA 2BD0A 1UP6A 4PZEA 2QYSA 3PLNA 3DBLA 3GEDA 3WGIA 1GYQA 1O94A 1ZK1A 5JBIA 3EUWA 3RKUA 3WYEA 1LEHA 2Q49A 3PWKA 1JAYA 4Y6SA 2JFHA 4R1TA 1D8AA 4LGVA 4M89A 4DVJA 1YB4A 1QP8A 3AUAA 3RC9A 3RUHA 4YQZA 2C59A 4B7XA 3U49A 3K31A 3NT2A 3RASA 1K5HA 5F21A 1QYWA 4D3FA 5L7WA 3QIVA 1HYHA 4PN3A 4E5YA 1YGYA 3CMCO 4YRBA 2VHVA 2DU8A 3CSDA 4M8SA 1XWFA 4WCFB 1ISJA 1YOVB 4UEKA 3ZV6A 3GZNB 3BYZA 3UCFA 2VHWA 3I23A 3K92A 5GZ1A 1CF2O 1VM6A 4CMEA 5G0TA 4PLYA 4NBRA 1M76A 1PJ4A 1HDZA 3GDFA 5I8WA 3TSCA 1X7DA 2VOJA 4RZIA 3T4EA 2BFPA 3E9NA 3H9QA 1VKOA 1NPTO 1Q7GA 3H8VA 1KIFA 2XAAA 4A2CA 4FW8A 3BTVA 4P22A 3X2EA 1VKNA 1P77A 3FNFA 4XR9A 1A4UA 1GPDG 4U0KA 2VRCA 4NBTA 1P0CA 1H6DA 1MP0A 2H63A 3PGXA 4MVJF 4YT5A 2OO5A 1QSGA 1IYZA 3CPSA 4A03A 1Q1NA 4OOFA 1DJQA 3Q9NA 1ULUA 4IDGA 3E1KA 2Q1SA 4D41A 3MJSA 1YS4A 4BO2A 4MVJE 1W4ZA 1KC3A 4D3SA 1RJWA 4J2HA 2HK7A 1YWGO 1U7HA 3D1LA 4M1QA 5TJ9A 3GQVA 3GUCA 1LA2A 1O0SA 1BDBA 1E3WA 4K26A 5K0ZA 1F14A 4L9RA 4U6QA 1PJ3A 1B14A 4EUHA 4YJHB 5G0SA 3H9JA 4RVDA 4AG3A 4Q39A 5CEEA 4NR0A 1N1EA 2X9NA 5A3VA 4XX0A 2OMEA 2PY6A 2V65A 4LCJA 4RJTA 3QWBA 3OJFA 2NU8A 5JNLA 3QVOA 1LDYA 3I3OA 1VJTA 2VRBA 4XB1A 1GFSA 5A1TA 3DXFA 1DO8A 4R1UA 3ETGA 3L77A 3ZU3A 2Q1TA 4ZU3A 4W4TA 2ZCVA 3BTOA 1H93A 5IN4A 2ILTA 5BSEA 6LDHA 2DBRA 3FD8A 3LF2A 4LCEA 1HXHA 2IEDA 2HK8A 3NAQA 3K96A 2Q4EA 5JCXA 1ZSYA 4RF4A 5TRTA 2FHSA 1VI2A 4QQRA 1E6UA 4PLGA 4W6ZA 5ITWA 3SLGA 1YBAA 1H6AA 2CMDA 1M75A 4M49A 5T8KC 2Y0DA 4RQUA 2D5CA 3BZUA 2HJRA 1XU9A 3H5RA 2IRWA 3HQ4O 4CMBA 3EYWA 1LSJA 2BHLA 3C7AA 1HETA 3OHSX 1WW8A 1GL3A 3AK4A 3GDGA 3OSUA 5G4KB 1EEHA 1TXGA 3EDMA 2R6JA 3IJPA 5JC1A 4J43A 1JAXA 3VVCA 4CMGA 3HE3A 2EERA 1EDZA 3RC7A 4CQMA 1B3BA 1YDEA 4FN4A 4CV3A 4E2YA 5COQA 2DUWA 3PIIA 4NK5A 3F1KA 3GFBA 4WEOA 2JL1A 5EQDA 3VH4A 2TMDA 4B7CA 1NASA 3I52A 2O3QA 1OC2A 2E4AA 3A4VA 3FWNA 5JFOA 2IE0A 4Q3DA 4CLHA 3JYOA 3GC6A 3BMOB 5IZCC 2YFQA 2AEMA 3TPCA 2VZ0A 1DFGA 2AEJA 3OFSA 5DDIP 4ZRNA 3P2OA 2OGUA 3S55A 2VYNA 1LDNA 1T4DA 3ULKA 3GGPA 4DC0A 3HWRA 4FIZA 4IS2A 3GVIA 3P2YA 4XD2A 4F6CA 4W7HA 1SAYA 3KEQA 4MVJG 4Z3DA 3BMCB 1NQ5A 4XYLA 4BNKA 1SCUA 1VJ1A 5EPOA 1PEDA 5GZ6A 2YJZA 3PWZA 3V2HA 1H2HA 2QRLA 5CPFA 1OZAA 1PL8A 4L73A 5JPIA 1ZIDA 3PDJA 1LSSA 4NU6A 3TWOA 3F9IA 1BMDA 4OXKA 4J1QA 4D79A 1I2BA 3ZNQA 1P31A 1LDBA 3PJEA 4O59O 2YYYA 1IE3A 4I9UA 1DIHA 3DBRA 2FRDA 3ROQA 3DEYX 1CYDA 3AFMA 4AJKA 5B4UA 3JQDA 1LLDA 5G4LA 3VZRA 1U3VA 3GVCA 3KLMX 1HYEA 3NRCA 4GX1A 4IDEA 3WFIA 2X6TA 3UCEA 4DLLA 3JTMA 2CDBA 2P68A 4II2A 1A9ZA 3HDYA 3ZWXA 4A0SA 3L9WA 4R69A 1F8FA 2I6TA 5HS6A 5A05A 1FF9A 2B5WA 4Q9NA 1U3TA 2P4HX 3WGQA 3TF5A 1U8XX 4IINA 2C7VA 4MVJI 4AICA 2RCYA 3OJLA 4MDHA 3ABIA 4NPCA 4CMIB 4JP3A 3VPXA 2B4RO 3TZ6A 4YT2A 3O8QB 4R4JA 3WDSA 1PZGA 1H0KA 4JK3A 2QRJA 2ZB4A 2DLDA 2ZB7A 2XXBA 1OOEA 1ISHA 3EGOA 4H7PA 5I9MA 4W82A 2BLLA 4Z6KA 1LU9A 3FBTA 3ZU2A 1QG6A 3KOUA 4GL4A 4M55A 1PR3A 5IAAA 1K6IA 1ORRA 4PRKA 2IODA 2X23A 5BR7A 2EW8A 5JW6A 2GLXA 1C3VA 1Z73A 3ICPA 3QP9A 4Y6PA 5JMWA 3C3XA 3RFTA 3ENNA 2YDXA 3ASUA 1N2SA 3T7CA 3NJ4A 1N7GA 1MV8A 5IJZA 5IDWA 1JKFA 3KB6A 3ASVA 3ZCXA 1EQ2A 1PQWA 1ZCJA 4RPHA 2GZ1A 4XKJA 4NBWA 4ND1A 1PX0A 4ND5A 1ZK0A 4FR5A 3EAGA 4XEHA 3IKVA 4IM7A 4RVHA 4YJGA 5IN5A 4PFJA 4N18A 2FOIA 2Q45A 1UZLA 1NHWA 1LBEA 3JD1A 5A9TA 4D0RA 5JY6A 4WLEA 3CTMA 5C7LO 4OHUA 1RWBA 2WE7A 4YDRA 4FC6A 4TROA 3PQEA 3RSHA 4CL3A 5HM8A 1SPXA 4CMEC 1Q2XA 2Q4BA 3O26A 3KSUA 1FJHA 1UR5A 1KETA 4EBFA 2C82A 1UUFA 2X5KO 2AG5A 1CRWG 3VTZA 2VUSA 2YQ5A 3ST7A 2V6FA 4KUHA 3MWEB 3JQ7A 1I3KA 3VZQA 1YKFA 5HRUA 1H9AA 1DPGA 1HLDA 4IJKA 1Q0QA 1T2CA 3RWBA 4LSMA 1Y1PA 5CDYA 3EVNA 4IDFA 1ZSVA 3O03A 4CLOA 1A5ZA 1CIVA 3M1LA 2Y99A 3JYNA 3INRA 4RF5A 5FI3A 4LRTB 2CF5A 4BOYA 3MTJA 4BMSA 1YL7A 4O6VA 5DBIA 4RDIA 3OMLA 1ZSNA 3GOHA 4KTVE 4E0BA 2DAPA 3FBGA 3DMYA 2HO5A 1FDUA 4A73A 4GX0A 2FY8A 2DFVA 3IP3A 3OA2A 3WSWA 4ALIA 3C85A 1E77A 1DHTA 4DYVA 1ZK4A 2W8ZA 1BVRA 1PIWA 5GMOA 1GADO 2HQ1A 1WPQA 3RBZA 2BH9A 2VZ9A 1PZHA 5ICMA 4MVJH 1ZBQA 3OJ0A 5DP1A 1EBFA 1Y6JA 3S2GA 1MGOA 3PYXA 4PGFA 3M2PA 5H82A 4ROSA 3ZHXA 1OAAA 4BNVA 5HA5A 5DOVA 1UJMA 2WYVA 1LDEA 3Q2KA 4ZJUA 4XGNA 1UP7A 3GFGA 4XDZA 3A28A 1ZK2A 2B4TO 5JYDA 3MTGA 4FFMA 3F1LA 4PLZA 1MUUA 1SO8A 5T6BA 2JKVA 1Y9AA 5T57A 1NFRA 4BNWA 1I30A 4FC7A 4I5DA 4XRRA 4BGUA 1PJLA 1EDOA 2W90A 4BMVA 2UYYA 1YONA 1HE5A 4FFOA 3I4CA 3OIGA 5FFFA 3WGOA 1M6HA 4WOKA 2Y1EA 4ZICA 1YJ8A 2HMTA 4HKTA 2PGLA 3QV1A 2Q50A 4YEDA 1Z45A 3WFJA 5KKAA 4OGWA 4ZGWA 3D4OA 4HUJA 4BO4A 4ZA2A 3QVWA 1YO6A 4K9DA 3SBOA 2ZJ1A 5CP8A 3TOXA 1B2LA 2IZ1A 5COAA 2POQX 2PFGA 3CZRA 3PHGA 4I1IA 4WCDA 4CODB 5AXBA 1D4FA 1H5QA 2DC1A 2NWQA 4J0EA 4CM3A 4DLBA 2WWRA 3DZFA 2GUGA 1V6AA 1DC6A 1M66A 2GERA 4DQVA 1QRRA 2D4AA 3WIEA 1IPFA 4YR9A 4WGGA 3AOEA 5AXDA 3MZ0A 4JJIA 3TDKA 4D46A 2EG9A 4BV9A 2Q1WA 5ES3A 4CLXA 4ALLA 3WGTA 4W9NA 2OP0A 2X58A 4LMRA 3IOYA 3TZHA 4F46A 3V1YA 4AJ4A 2J3JA 1YQXA 2DPGA 4J16A 5GZ3A 3Q6IA 2WYWA 2SCUA 3BHIA 4BV8A 1DAOA 5CEFA 4INAA 2PH5A 4Y98A 1HWYA 2B83A 3DO5A 3TZCA 4J49A 4MKXA 1KYQA 3H4VA 4R51A 1R4MA 3RBXA 4BGEA 3UKOA 1R12A 3WLFA 1W6UA 2IYOA 1NAHA 1CERA 2J5QA 1P1FA 4NH4A 4PLTA 5DT9A 4FJ0A 1A9YA 1XKQA 3JQ9A 4YAKA 3JQGB 1YBMA 2PA3A 3IMFA 2PKRA 3JV7A 4BNIA 2TMGA 2Y05A 1C0LA 3PVZA 2BF7A 3ENKA 1VE9A 3KM0A 4WE3A 3I5MA 4UUNA 4B8ZA 1P1IA 4CJXA 4E2ZA 5KTKA 3ZU4A 3JQ6A 3BMNA 2Y1OA 2HMSA 2VT2A 3O4RA 2C7GA 3DZGA 4H16A 3NTRA 1BW9A 1TI7A 4XR4A 5KIAA 5JY1A 4B8WA 3FF4A 4JROA 4YRAA 2EGHA 2EKLA 3ONEA 1GAEO 5JAMA 1T2FA 3KYBA 1E1MA 4BO1A 4QSMA 3T7EA 2I99A 4MVJD 4K6CA 4XIYA 1X1EA 2AHRA 3SEFA 2EIHA 3IL2A 2Y0CA 4GWKA 4FSHA 1TLTA 5EL0A 3HZZA 3B20A 1NTOA 3SJ7A 5TT0A 1U5AA 3G1TA 3DAGA 3JSAA 5L45A 2VYVD 1WP4A 1BVUA 1ENOA 2A4KA 4PLWA 4NJMB 2BRUA 3OICA 3GRKA 4EITA 2XXJA 3PJGA 3I83A 1ZW1A 3GAZA 3LC7O 4FFLA 5L4SA 3N74A 1Z7BA 1BSVA 1IZ9A 1ZUD1 3HFSA 1E5LA 5LDHA 5T67A 2NLOA 2PNFA 4KWHA 3VOSA 3FTNA 1GYRA 2D3TA 4P4NA 1G0NA 1ZEJA 3LT1A 5L4LA 3JQ8B 3IC5A 1XHLA 2ZIZA 4O63O 1R0SA 1LXCA 1D7OA 1E7RA 2A9FA 5MGBA 5TIIA 1PGJA 1T2AA 1X14A 4AJ2A 3CKYA 3DZIA 5IXSA 1A72A 4B4WA 1E7SA 2JAPA 3IP1A 2YDYA 2O2YA 4NK4A 4OYRA 1SOWA 2EJVA 3EZYA 3U0BA 3GN1A 4D7AA 1QKIA 2P91A 3WNVA 1IOLA 4XRGA 1NWCA 3PJFA 5F1KA 3LC2O 1PGOA 3ZV3A 4G5HA 3OA0A 1ENYA 1J4AA 1YDWA 1YBVA 4N54A 2PZMA 4RL6A 3NX4A 1IULA 1KEUA 3ZW9A 1EBUA 1XR3A 1NM5A 3D3WA 2LDXA 2HKIA 3G17A 4XDYA 5CPBA 1N92A 1HRDA 1CEQA 3NDIA 4IDDA 3BMQB 4P4LA 2GN9A 5EESA 4MOWA 3U4HA 4F45A 2BKAA 3L6DA 3MJEA 4MVJM 4RQTA 3S8MA 5G0UA 3S2EA 5L9AA 1Y8QA 4FS3A 3RU9A 4B4OA 4FFNA 5JCJA 1YB5A 1ZJYA 2IZZA 1KY4A 1ONPA 3E18A 4B3JA 1GQQA 2PTGA 3RUIA 4I8XA 3RROA 2HUNA 2JCVA 4BKUA 1YQDA 2PKQP 1I3LA 4P38A 2CVZA 3SXPA 2ZTVA 2VTEA 3AJRA 4RPJA 3PWSA 2O2SA 2VT3A 4CMAA 3NT4A 1QXSA 3F47A 3P19A 2YV1A 1X13A 1NNUA 4RORA 3WQRA 2F00A 2B5VA 3C7CB 1WMBA 2DTDA 5LCXA 1GCOA 1X0XA 1DJNA 1H6BA 2F1KA 5B37A 2GN6A 3JQAA 4YPOA 4IQGA 3QQPA 5K9ZA 4J9VA 1YRLA 3MJVA 4OJNA 2BFMA 2GDZA 4PLCA 1MA0A 4YWJA 1EVZA 1VL8A 3UN1A 3DB2A 4UVIA 1ZMTA 3AFNA 3SC6A 4B79A 3W6UA 1Y8RA 5I7EA 3KHUA 3I9OA 1Y9EA 1W0CA 2V6BA 1H6CA 3UHAA 4CR6A 1ONOA 2JHFA 3E6AA 2QX7A 4MVJP 1C1DB 1MG0A 1NFQA 5DCYA 4DPKA 1PZEA 1XSEA 2XOXA 1KC1A 4MP8A 3QRWA 3I1JA 1ADBA 2YHIA 2I65A 3ZWOA 1EVYA 2VTDA 2WE8A 1JKIA 2ZATA 5KKCA 1X15A 3L4SO 4EZBA 3Q3CA 2DTEA 3DFZA 2XF8A 5EQFA 2O3JA 1WZEA 3F5SA 3F5QA 1C1XA 1GZ3A 1DC3A 2C20A 1O6ZA 1X0VA 4UVHA 4JGBA 4KQWA 4CR8A 4NG5A 2Y1GA 1XU7A 4GBJA 2FWMX 1WNTA 3QVSA 2C0CA 2A35A 2EGGA 4CQLB 3GR6A 1Z75A 4KDFA 4EGFA 2ZB8A 1G1AA 4E21A 1MX3A 2OZPA 5CAEA 4E13A 4S1VA 2E6UX 4WK6A 3OF2A 3NGXA 3ZWVA 3QVXA 1HE3A 3D7LA 3KYCB 3EY4A 4OL9A 4ESOA 1A7KA 3OP4A 1MFPA 4DIBA 4CUZA 3FRJA 3H9UA 3OIFA 1B15A 4BO7A 4YACA 1A7AA 3WR5A 4CM8A 1P1KA 3WGZA 1GCUA 2XPCA 3AM5A 4NHEA 5JC8A 2G82A 3AOEC 3JYLA 3WXBA 2NVWA 4DMLA 5L7YA 1UXKA 3WB9A 2VN8A 1V3VA 4J7CA 2JFGA 2I9PA 4W9NC 2Q2QA 1IUKA 3OH8A 2EJWA 3B1FA 3LT2A 4DWVA 4R5MA 3GA0A 4J91A 1KERA 1D1TA 1A71A 3D4NA 3TFQA 1LQUA 3H5AA 4XQGA 4XA8A 4JX8A 3NYWA 1DBVO 2AEFA 2W4QA 3OEYA 2H9IA 3VDRA 2X5JO 4DMMA 4AVYA 1GPJA 1LRLA 1DXYA 2X5OA 4D45A 2W2KA 1GQYA 1G0OA 4TMFA 5CG1A 2E48A 4Y67A 4B3IA 2GZ3A 1JWBB 3QWIA 2QG4A 2X0IA 3JQ9C 1ADGA 5AOVA 2HK9A 1PJSA 4L4XA 4UVEA 5A9SB 1EK6A 4XJTA 3IAHA 4K28A 3HUDA 4BMNA 4Z0HO 5BSHA 3WTCA 1DDOA 1Z82A 2P9CA 4XYMA 2FMUA 1HZJA 1P3DA 4BQRA 3KSDO 1FDTA 1LRKA 3QA9A 5DP2A 4TKLA 4CUJA 3ZWYA 2BGKA 5JAIA 1TT7A 3H65A 3DONA 1I8TA 1N9GA 2GPTA 1QYDA 5DNAA 1ADFA 2JJYA 1PGPA 3R3JA 1F0YA 1ZH8A 2O23A 3QSGA 4XYGA 1ENZA 2EP5A 4E3ZA 2O7QA 2O50A 2EHDA 2O4CA 4L0QA 4OQYA 5TGDA 4BNGA 2B4QA 2CSUA 4P4GA 2RHRA 4ZN6A 3VC7A 1FDWA 3RJ5A 4UUPA 3P7MA 3JD0A 3UUWA 3RAJA 4UEJA 1YH3A 4YAEA 1P1RA 4J1SA 3I9KA 4KTTE 4LK3A 4IIUA 2VHZA 4GX5A 4A5OA 4J7XA 4TRJA 3FN4A 4ZQFA 1UZNA 3ANNA 3L6OO 1LI4A 1XGKA 2FZEA 2NVUB 4N5NA 3SLKA 3JYPA 1E1KA 2I66A 3R1IA 4Z9YA 1LLUA 3PEFA 3ZN2A 2BI7A 2QQ5A 1UAYA 3DBHA 3WLEA 3GDOA 2W2LD 3ICCA 3TRIA 4AL4A 5U4QA 2AW5A 5ENDA 4YJFA 4CM4A 4KP7A 4HV4A 2QZZA 3VKUA 3OETA 6ADHA 1PJ2A 4DXHA 3Q11A 4BGIA 1JVSA 4MVJA 2FN7A 4IBOA 3QVTA 5COBA 1GV0A 4DA9A 1B8UA 4LSWA 3IJRA 4I9HA 3F4BA 1U2DA 1LTHR 1MLDA 4GLOA 1RM5A 3KLPX 3V5NA 3OBBA 4MO2A 3GVHA 3SVTA 2R2GA 4PG4A 3FI9A 3DDNA 4FJ2A 4FOOA 2VNAA 3LQFA 4E30A 4OO3A 1BXGA 4WUVA 1BG6A 3PDUA 2QYTA 5DZSA 4CMHA 2Z1NA 4E4YA 2NTNA 3VH3A 4FD3A 5JAZA 2VWHA 4WLNA 1PTJA 1K6XA 1JWAB 3ZWMA 3PHJA 4D42A 5KOIA 1PR9A 4Z9FA 4BO9A 3HDQA 4MKZA 4RVGA 4LVCA 3LF1A 5L4NA 4BL5A 2B35A 2O48X 4PCVA 5THQA 1ZJZA 2YUTA 2OBYA 4M87A 3FNEA 5TQVA 3V2GA 3MOIA 3JCZA 3L9XA 4IQ0A 2PKQO 3KSZO 3KBOA 3DTTA 2ZJ0A 5JDCA 3HHPA 1IY8A 1X1TA 1KBZA 1E3JA 1JVBA 3ZV4A 4JLWA 3VPGA 3HADA 4YYZA 3W4IA 1G6KA 3LVFO 2Y1DA 3EC7A 3C24A 3R0IA 4QXMA 2DBVO 4QX6A 2DUUA 1DAPA 2PR2A 1QV6A 5JAQA 4R3WA 3ITDA 1Q0LA 1PS9A 1N8KA 5F1OA 2JFFA 5IZ4A 2G17A 4RF3A 5TS3A 7MDHA 5KVVA 1ZNQO 2Y93A 1UXGA 2HCTA 1ZK3A 3RUAA 4D0SA 4FJ1A 1DRVA 4DL9A 3GY0A 4IIVA 2WTBA 1XQ1A 4AJHA 1DLJA 1YVEI 3UW3A 2FPPA 3LC1O 1J5PA 4ZVVA 1DIRA 3FNGA 1OI7A 5BNTA 3E03A 4XQ9A 3K30A 2DVMA 1KEPA 1LUAA 4W7IA 3H3FA 1GU7A 3T4XA 1JDJA 5HBRA 2CDAA 4WCFA 5KJCA 1YOVA 4OKNA 3GZNA 3WGHA 2CFCA 3ZHYA 1AXGA 3HFGA 2BELA 3G3EA 4OOEA 3QHAA 5G0VA 4K1LA 4NDNE 4JIGA 2NACA 3CIFA 4HX5A 4KDEA 1EE2A 3I6IA 1VRWA 1YXMA 3MJTA 4KZPA 3AI1A 5A5FA 3KZVA 3MCVA 4U0JA 4UVDA 4YBZA 1KEWA 4FGWA 1DIBA 4UULA 2VNSA 5ER9A 1GD1O 1GEEA 4CLRB 1SNYA 4YXFA 2HRBA 4LN1A 1XA0A 1TEHA 1C14A 4CM9A 4I08A 4ZD6A 5ILOA 3EW7A 2R00C 4ILKA 3VZPA 4H15A 4YAJA 5HTOA 4K6FA 2X4GA 4IJUA 3X2FA 4EYEA 2Z5LA 1PU2A 2I3GA 5J23A 2WSBA 5DBGA 1M2WA 1RM0A 2VQ3A 1FDSA 5B1YA 5DF1A 3HB4X 1E7MA 3KYDB 4E6PA 3MOGA 3AU8A 4NNJA 4PG7A 1IPEA 2GSDA 4J0FA 2DBQA 4J2OA 2HJSA 4TQGA 3WS7A 3GG2A 1FDVA 3H6KA 3IS3A 4GKBA 4YCAA 2ZQYA 2GYYA 2O3RA 3BTSA 4MIOA 4YJHA 2X1HA 4DBVO 4X54A 2Q3EA 4BO8A 3GT0A 2P5UA 3ZW8A 3E9QA 4HNGA 4BKQA 2YFHA 3R3SA 2O3TA 1DIGA 4J4BA 2NM0A 3PRJA 2BFAA 3C1OA 4GMFA 4BKRA 1SZJG 1UP4A 4JJGA 5IG2A 4M86A 4XIJA 5EINA 2CNBA 1YL5A 2E49A 2V7PA 4DTIA 4IZIA 2JCXA 3EMKA 3OQ6A 3VH1A 3K2EA 4GGOA 4J90A 4WNCA 4MPDA 4E2XA 2VRCD 3WBBA 5IDYA 4QTZA 1ZKMA 3WICA 4ALJA 5I9LA 1M6WA 3NUGA 1DRUA 1NWHA 2PWZA 3VZSA 1O9BA 3ROKA 4GLLA 1PL6A 3AI3A 5IDXA 2AE1A 5DCWA 4WJZA 3UXYA 3DBLB 1P1JA 2P9GA 5G0WA 1PJTA 3PIDA 3QLJA 4B4UA 5CDSA 1KS9A 2Y66A 2VUTA 4GVLA 5TF4A 4IMRA 1IL0A 4RLSA 5IDQA 3BTUA 4OAQA 2I5PO 3VVBA 3TN7A 1JQBA 1NVGA 5G4KA 3WQQA 3RI3A 1BXZA 1LNQA 2PGDA 3CE6A 2FR8A 2NU7A 3WJ7A 3STHA 2AQ8A 3TFOA 1I33A 1JLLA 4GI2A 3E48A 1TA4A 4MP3A 4PG5A 2NUAA 1O95A 1MB4A 1SB8A 2IXAA 3GG9A 4YAIA 2Q1UA 5AXAA 4LMPA 2X9GA 5BT9A 2B36A 5EERA 3VTFA 4FDAA 3GF4A 2RHCA 5ICSA 4ND4A 3DZBA 5L40A 4C4OA 4EI2A 2PD3A 3WJAA 4BO5A 3BMOA 3PLRA 3NKLA 1LC0A 4WNIA 4JCOA 4BNFA 2VUUA 1DRWA 2DFDA 3DWFA 4MP6A 1JTVA 3PFWO 1E6EA 1SBYA 4FBGA 1OC4A 5ILGA 5A3JA 1WDKA 1L7DA 3K8ZA 1XELA 3K73O 1MG5A 2PZJA 1UZMA 5F5LA 2FP4A 1LDGA 3MEQA 3ONDA 3UCXA 5HS4A 1HDXA 2HLPA 3GNTA 1CQIA 3D3EA 4BO6A 3BMCA 1WZIA 5CDUA 2G5CA 2OHXA 2Q2VA 2GN8A 3H5NA 2FR1A 1AE1A 1I24A 4UEOA 3SC4A 1MFZA 1NHGA 1U9JA 3RD5A 3W8EA 1B7GO 3AOGA 1F06A 3B70A 4OQZA 5TSDA 4YT4A 4E5PA 1D1SA 1ISGA 3GPIA 3PPIA 4YA6A 3ZU5A 2WDZA 1E3WB 2B37A 3AI2A 3GLQA 4WLOA 4NJOA 3IUPA 2FPIA 4RGBA 1HDOA 4CQMD 3M2TA 2VWPA 5THKA 3PHIA 1PGQA 3GNSA 1B8VA 5ADHA 3UAGA 4A26A 2WD7A 4R9SA 3N7UA 3L4BA 1MXFA 1BGVA 3LK7A 3LT4A 2DTXA 3BAZA 4RZHA 4PZCA 3HJAA 3ZHBA 4CPDA 3FPLA 1UXIA 2YY7A 2C2YA 1E7QA 4A7PA 3WIDA 4BNUA 1R0LA 4JXKA 1SMKA 3P5SA 3RIHA 1NBOA 4Q3EA 2VWQA 3GGOA 1NQAO 3K2BA 1KVUA 3F6YA 4RVFA 2Y68A 3ETDA 3L6EA 1CETA 1R4NA 5KJ1A 1N7HA 1ZFNA 1ML3A 3O8QA 3COSA 3W6ZA 3KETA 3HB5X 4QEDA 3U4DA 1XYGA 2GASA 2VYND 4BUCA 2ZQZA 1GV1A 1P45A 1DSSG 3AWDA 2O7SA 3ZZNA 3DFUA 3PHHA 4IXWA 2GGSA 2G0TA 1H2BA 2OORA 3GZ4A 3G0OA 4XQEA 4L76A 3L07A 3AUTA 2JD0A 2Y67A 3KUXA 5KJEA 4Z0TA
chains in the Genus database with same CATH superfamily
1HDCA 5KTSA 2IHNA 3GH3A 4RHTA 1U2GA 3TNLA 1T8WA 1M73E 2VPTA 3NHYA 4F6LA 4LJ8A 1GVNB 1Z22A 1FUIA 3OZDA 4HYYA 5INTA 4MW2A 3GO4A 3L8EA 4DQUA 4JI6B 4FSDA 5FEUA 3V8BA 3HY4A 1AC5A 2I91A 4NEQA 1AS2A 1HDGO 1ML4A 2G9VA 4CQMB 1RRKA 2HOQA 3BKWA 3VBEA 1U4OA 3BXXA 5JECA 3TLZA 1LRJA 2H18A 4ER7A 3SJZA 2GEUA 4QRDA 1YIOA 4HFJA 3A9WA 2CWDA 1G41A 1HEUA 3GRCA 1LBSA 3BGIA 3RFXA 3L79A 4KMSA 1LLQA 4HVLA 1AQUA 1Z35A 2BMJA 1NULA 2GBFA 2I62A 4ALKA 5E4YA 1OV4A 4BO3A 1K68A 1UC8A 3DZKA 2ZYUX 3KG2A 4QBTA 4PANA 3PTZA 2PUEA 3ZYZA 3MGAA 1F8XA 4UBKA 3UV7A 2ATEA 4Q19A 4G0QA 4C4SA 2JLBA 2P5YA 1DS6A 1PJZA 3HXLA 4G0XA 4QTXA 4WCFC 5GJCA 3U3KA 4ZMRA 4HNHA 1R18A 2D6FA 1RLOA 2O19A 1ZLXA 2QZ4A 1G5RA 4H7EA 5E8RA 3TLAA 1JP7A 3DCIA 4AUNA 5C46F 3M6LA 1USUA 3A7EA 4RQAA 1JFFA 4PYMA 3MWEA 4R41A 4W7SA 2WSSD 1RVV1 5BYJA 3VVMA 3QHQA 4KUGA 2UVDA 3FETA 5B64A 3SYTA 1Q1EA 3AT1A 2A9OA 3D59A 4WKGA 4Y9SA 4Y2HA 4IIGA 1ZXLA 1UK7A 2DSNA 1A9PA 4LXIA 3MCTA 1W44A 1NR1A 4PNHA 4RPCA 1KAOA 1OVMA 3N6RA 1BE6A 1J0CA 2H3HA 3JARB 4US1R 3L0DA 2VH5R 1P9WA 4U7FA 2IHTA 1YZKA 1RYYA 3H75A 5E9WA 5BMVF 2ILVA 1ELOA 3VHRA 3U44B 4CMJA 2I33A 3FBWA 1DEAA 3NAGA 4LQDA 3HSKA 4E12A 1MT0A 3DBRB 3JSXA 4D0NA 4EFKA 4HWSA 4ZCIA 1R0KA 4HLNA 4RFSB 1GQOA 3U39A 1NKVA 1VJ0A 3MRXA 2DPMA 2FN8A 3I64A 4KQJA 4XTRA 2O4UX 1OZGA 2CYCA 2F9MA 3DPIA 2NO5A 3HGTA 2I1QA 4LBVA 1N5JA 5DNUA 1IWOA 2Q0SA 2X15A 5BW6B 1BU5A 1EJBA 5IT4A 1U9IC 3VISA 3E9EA 1ESDA 1P9NA 3FG9A 3P5BA 4IUYA 4PC2A 4PO8A 4A6DA 3DVRX 4MI9A 1Z08A 4IXDA 2EW2A 1IHYA 1DBSA 3LYLA 4CEIB 1BHO1 1PT9A 2DQ4A 2RC6A 3O31A 3AVTA 4R2JA 1AH2A 1H2YA 2HYDA 5K0LA 5JYEA 1ZM7A 4QQFA 2PZLA 3OEHA 1EIZA 1JJIA 2BMDA 2YV3A 1QR6A 3WJ1A 4QT4A 1QGOA 2GZRA 1RPNA 4IDBA 4QU5A 5A7GA 4DEVA 4CIBA 5LLTA 4P8RA 1NKSA 1AK9A 2OWDA 4H3KB 1F0KA 3ABRB 3GEGA 1TD9A 3GQBA 4JYMA 2QTLA 3S1LA 1SUCA 5E0KB 5TQJA 3WMXA 1XZDA 5C8YB 5F98A 2YQ4A 2W2PA 5JSFA 3S4YA 3OOHA 4DCPA 1ZD2P 2H9YA 3R9IA 5B6PA 4GX2A 4IIEA 1II8A 1TIKA 3OM9A 4U39A 1G5QA 2YVQA 3F4KA 4ILEA 2O0KA 4I55F 4JJFA 2DECA 1VA4A 3N8DA 4KXUA 3B9QA 4PRYA 1JH8A 3DVAA 4KIWA 1W73A 1X94A 2BZ1A 4PLVA 4EABA 1IK4A 5CFQA 2PQMA 4EY3A 3H5LA 2VJQA 3IBTA 1TYCA 2HTFA 2LIPA 2BEKA 1NSFA 3IHWA 1E96A 2H59A 2AFHE 2WF9A 4H3VA 1HC7A 4KQFA 3ZCUA 4KOAA 3IVRA 2A9JA 3Q6MA 2AOUB 3FPBA 3W5CA 3BA1A 4BDSA 3NBUA 1A04A 3EW9A 4YP1A 4J1NA 3JTEA 5LLSA 2AT1A 2K2WA 4KIGA 3P0IA 4WPGA 5ERYA 2UYQA 4C7MA 5TMPA 5BV8A 2R60A 3GVXA 3PCTA 3GVPA 1WXHA 4KQGA 3U3DA 3ZBPA 5C8XA 1V25A 2OVFA 1T8UA 2I4RA 2LKCA 2SHKA 2BFEB 5DTEA 2FR8C 1LF0A 2VOEA 4D44A 4OIMA 1XZHA 4TL7A 5KWVA 2AV6A 4GFDA 1RI3A 3EZLA 3G2KA 4WLUA 4XJVA 1NGSA 4P92A 2DPLA 2YWEA 5ED0A 1WNFA 2VAMA 1BQ4A 4ZAYA 1FXWA 2QT1A 4NZ9A 3GWGA 1R64A 4ITUA 3R7SA 3ZGXA 4AJ9A 4EGAA 4N82A 4DBLC 1J2RA 1A2BA 3JQ7B 4L8VA 5I51A 4X92A 3KWLA 1D7AA 5LMNB 3P9PA 4P5EA 4E31A 4DKXA 4EG4A 1CUEA 3PFGA 2FPKA 4HAVA 4O25A 3ISVA 4OBWA 5DKFA 4C7KA 1UQUA 4AZTA 1OJ7A 3OIDA 4CLOB 4EJFA 4AKTA 2BBTA 1NIJA 5CLJA 3UHJA 1ONNA 1HLPA 4R0VA 3EVCA 3LPNA 1M6YA 2D1YA 2C97A 4BMPB 1F2TA 3QVGA 2EQAA 3JASB 1IG0A 1RAEA 4Y1RB 2F55A 2OSBA 1KZ1A 3RE1A 4A0QA 1ODJA 4RY0A 1LSOA 1J22A 4OREX 1WDLA 2NU9A 1HT1E 3DDUA 3OPQA 4RS3A 1G4UR 5DN9A 1WHTB 1RQNA 4JOSA 3REGA 1XXHA 3E53A 4P3YA 5EA2A 1FNBA 5SY4A 2M6KA 4BXOA 1EFAA 3FSGA 1CLUA 1XMJA 1E98A 3NALA 4KXYA 4A0GA 3EH2A 1HE2A 5JDIA 3WLNA 3DHEA 3CX4A 1B0AA 2D59A 2B1GA 4KAAA 2E7ZA 4MDYA 1FNNA 1XAIA 4J7UA 2ZIAA 4NHOA 4TZKA 4UTXA 4ZPXA 3CA8A 4E33A 1LK5A 2H1OA 3LXRA 5ALUA 2Z4SA 3PF9A 3B3FA 2VP9A 1R8XA 3IEUA 3CLRD 4TYMA 2B9VA 1RM3A 4BNYA 4Q03A 3OFJA 4GSYA 4BE7B 3JQFA 3JD4A 2R1VA 3JQBA 1JHZA 1JKJA 5CT6A 3TLYA 2A86A 5B3AA 1DP4A 1Y3HA 4IDHA 2ZQ5A 4NAUA 5IULC 3RRZA 3L4BC 1J6UA 2MSEB 1QS0B 4KPUA 2ZZNA 4ML3A 2OAP1 3H9BA 4WFJA 2HIGA 5JCOA 4N0MA 4ONEA 4X24A 4EGSA 1BAPA 2BOVA 3IDSA 4X97A 4BNTA 2H0QA 3QVJA 2KQUA 2CZCA 5K0NA 1JR3E 4YGYA 3QTLA 1Z0FA 5FNVA 2ADFA 2PUHA 2V9CA 5AI5A 5FT9A 3ZJ4A 4HP8A 3I6YA 4I5FA 4RY8A 3VRHA 5ITVA 4V2UA 3GI1A 1GTMA 4JBNA 1UT6A 2WHQA 4EUFA 5JROA 4NG4A 5DHQA 3HYLA 3MT8A 5F78A 1PJCA 1T2DA 2BGLA 1E4EB 1JVNA 2GZ2A 3C98A 4LXHA 2JFZA 4FIDA 1KDTA 5FHRA 1U3GA 3DHYA 4KCGA 1A2QA 2CUNA 2QQEA 4V0OA 3KU1A 2Z95A 5B12A 4Y6RA 4DA4A 4RVUA 1PHRA 4FN5A 4II3A 1DIOB 3F3SA 5C32A 4ZGGA 5JO0A 1TEZA 2AG6A 2PT9A 4MRMA 2NZJA 4UU7A 3TW6A 2YZGA 3K94A 3ODGA 1O6BA 3BS4A 1I01A 1XMPA 3B1WA 4J29A 3U09A 3ELDA 3HR8A 1QHIA 2DX7A 5A1JA 2GAAA 4V02A 1E59A 4G1CA 4QPDA 4AJEA 4DAEA 3DSRA 2J9FB 3VR2D 2QTZA 2HC9A 4WIAA 1BH6A 2V7BA 3L0CA 4AUKA 4ID9A 1FUKA 2DPHA 3RWMB 3EOBI 2ZCUA 4HWPA 5JXWA 3OU6A 4IF4A 3OMWA 4AUMA 3GHYA 4I4TB 5F5NA 4DSTA 2XV1A 1TTQB 2RKWA 4H08A 2WJWA 1N2CA 4RVSA 3GK3A 3ROXA 2NTEA 3R9XB 2R6HA 4QC2A 4W63A 5AO9A 1Y7TA 3VKFA 2BM0A 1D4AA 1K7CA 5MF6A 2VHTA 5AHXA 1CFJA 3TQHA 1NMSA 1UC5B 3ZBQA 2X0RA 2YNMA 1OWPA 1ZCZA 3SVLA 2WRZA 4DIMA 3OZEA 1AA9A 3WWZA 1VSVA 1WVGA 4MJ7A 4YVFA 3GNLA 3SKXA 4F4IA 2IP1A 1GZHB 1MCZA 3LECA 4Q3AA 1SC6A 3DLPX 3K0BA 1GAXA 1SU8A 1G19A 4YO8A 4Q3OA 2RH9B 2REQA 5K2OA 3F3KA 3LE8A 3KJXA 1UMDA 1XRLA 4L75A 2F90A 4NCNA 3DOCA 3Q1KA 4Z3KA 4X62B 1R3DA 1WF6A 3T3HA 1IMOA 3VPDA 5KVCA 1WKBA 1YAJA 3LWZA 1ZI9A 2B3TA 5E6UB 2XVZA 2I6UA 1DTWB 2C00A 1L4KA 1JYEA 1TZJA 2XCQA 3CEPB 3K9QO 3NEAA 4FE4A 4LOHA 1EFLA 4W8HA 3TEMA 3B1XA 4AWBA 4E22A 5I3CA 1K88A 2NSDA 4TV9A 3QXSA 1XMXA 1BS1A 3DA8A 1DOHA 1JI0A 2ID9A 3T35A 2CXHA 3OLXA 3H04A 1GTJ1 4ND8B 2NV2B 3WX0A 2CCJA 2VLIA 3S3TA 4OLAA 4RMNA 4C08A 2JLVA 2JZNA 2YVKA 1YRHA 4W99A 3O0DA 3G6KA 2D0IA 1P4RA 1R8QA 3ROPA 2RB4A 3PDIA 4Z9AA 1MNAA 5AQ1A 4UHDA 2XKAA 3A3YA 4F8EA 4ZAXA 2ZT5A 5FL7D 3UXEA 3R5HA 4KW7A 3ZHZA 1AO0A 3U7HB 3JZFA 2B1IA 3OSZA 2G04A 2Q46A 4LV5B 3A1NA 4IXMA 4PHGA 4MAMA 2JA1A 3EVBA 1QLJA 4X6LA 3LYUA 1BDIA 3RKRA 5AIBA 1UK8A 1OBHA 2FEWB 4N9QA 4QXOA 3NHZA 1R00A 2JA2A 3C7KA 3D3NA 3L8ZA 3LLVA 1QVRA 3FYUB 4G0YA 1DEHA 1I2AA 4DM7A 4F84A 2HYIC 1K7YA 4EHKA 5CJJA 1RHUA 4R3NA 2XW6A 3FZQA 3ZC3A 4QWWA 5TB5A 3FSRA 4EVSA 3IOCA 1R10A 1KHTA 2C5GA 3OTOB 3D9QX 4RYLA 5GY7A 3ZEAA 5BPFA 2CDCA 4X66B 3UK0A 4BAUA 2NUBA 1PGNA 2HMVA 1ISMA 4L9WA 2ZJ2A 4LSGA 1NV8A 3WLLA 3OCYA 4DLPA 1W0JA 1ZZEA 4TT3A 3DC2A 3PR2B 1L5VA 4JIMA 3LBNA 3ZKWA 1A9SA 5DIZA 1RYZA 2C5AA 1ACJA 4BVHA 2BHSA 3D7MA 3BICA 3OG9A 5E3IA 2H2WA 4TV8F 9GPBA 4W9MC 3H0CA 1V4BA 3SYKA 1QYXA 3UAZA 4FHZA 4BQPA 3P2MA 3VR4D 5EN4A 3ME5A 4HL6A 4NH0A 3A0UA 2PX0A 2CVHA 1XVTA 3EXIB 1JQJC 3FPKA 4LC1A 4V1CA 3P4UA 4JHLA 2FMXA 1JNXX 1XCBA 1JHQA 2Q5FA 2V6MA 4E1VA 1IWBB 3NHAA 3ZNOA 5CFLA 2BSAA 5CMLA 4AJPA 4AG5A 1CNEA 2IOFK 5AM4A 4A36A 2IA5A 1M10A 3TSZA 2QUHA 3DTYA 1IHDA 2CHFA 3A4NA 2QRMA 1QHXA 1TF2A 3F9RA 3FOAA 1IVSA 3L8FA 4X63A 5JMPA 1VJ5A 1KS2A 2I7XA 1P3Y1 4O4HA 1MF7A 2VHXA 5K7SA 1ZR4A 4LJAA 3NNNA 4WH0A 3TDNA 3BQ9A 5EMHA 2DWUA 5ALQA 5FBRB 5CLHA 4G8DA 4MR7B 3WRVA 1CHNA 1E3LA 1NP7A 5B3JA 4DLAA 1I36A 3DOJA 3UGTA 2NSLA 2C4WA 3BRWA 1FTNA 4EA9A 5BOVA 4U8GA 3H17A 3MINB 4MUAA 3T3MB 4AT1A 4RIFA 3N2GB 3PL5A 4X8LA 3MS7A 1M1XB 4XDGA 4BCBA 1AXEA 1T10A 3EA5A 4WD3A 3LNCA 1DC7A 2AVDA 3GJ4A 1RJGA 4G2NA 3G1WA 2I7DA 4COKA 2PLAA 4FXOA 4URHA 1NXPA 5CYFA 1Z9BA 5B4TA 2P4EA 3PSAA 1B6RA 3DE3X 2ZRCA 2QLLA 4C0BA 2D2FA 1GQSA 1FX0B 1DWQA 1E2UA 3H9EO 3NCHA 1DMRA 4QEZA 2ATIA 5IYZA 3EFEA 4QGHA 4CM5A 1JAIA 1ADYA 1FP7A 2AOVA 3BL5A 4ES6A 3EF1A 4B2YA 1P75A 1RM4A 3ZK8A 4EYGA 3HV0A 3LWDA 1NRJB 3VMFA 2FB9A 4XIGS 4R54A 4HTFB 3T5DA 1D2RA 4KQXA 4LDNA 4M21A 4JI5B 2FPWA 1Q19A 4MQ4A 4YUXA 1P4AA 2EF1A 4EPVA 3HG7A 3A1CA 4HRAA 3GEMA 4LFCB 3R8CA 2J09A 3I6QA 1CXZA 3ADBA 2BCJQ 3KQKA 1GR0A 4YMWA 2GD1O 3WLKX 2FG7C 4PLPA 4BZXA 3U16A 3LLSA 1SVIA 1ZONA 3K1YA 3LXMA 3I9MA 4DBZA 1W8IA 3K6SA 3VYVA 1WXXA 1TPZA 5JDIC 2HDNB 1SUPA 1DKUA 2VJOA 1EFVB 4NU5A 4KKXB 4AXBA 4O2AA 2QZ9A 2CXSA 2GXSA 2CB9A 3K53A 3NXSA 4DA8A 3NV7A 4QYXA 4RD4A 2G72A 1CY4A 2WMYA 3RIYA 2VDQB 2VI5A 4YRMA 1EK2A 2FZVA 1Y1RA 5K0GA 5IS2A 4AJLA 4BLVA 2IYSA 1BDMA 1K7EB 2XMPA 3O9ZA 3Q7EA 1E7YA 3L18A 2XHZA 3JQFC 3JQBC 4IJWA 4ZTZB 1RFLA 1QG2A 1XK6A 1XP5A 3G8BA 2WNHA 2BDTA 2GPSA 2EC5A 2ST1A 4JAVC 4EJSC 5BP7A 4ZTUB 3R7AA 3ZTWA 4A23A 5JD6A 4Z2YA 1C1XB 2Y2UA 4RTKA 3OZBA 1F60A 4I9NA 4QRHA 4D3DA 1Y3IA 1M8GA 5BWBA 5G02A 1Q5PA 1FU7A 3IAM6 3E9ZA 2Q3BA 3EODA 8ADHA 5JCOC 3LDAA 1EHYA 2C07A 1RIFA 1VYTA 4EJSA 4UM9D 5F1PA 3V4SA 4N0PA 1PW7A 3ZY5A 1MMFB 4INOA 1OBOA 3ND8A 4AK9A 3DEHA 5EWJA 3SAJA 2CWWA 2H5IA 4TKUA 2IYEA 3KZOA 1G3MA 1T5IA 3QJ5A 3V9PA 3WV5A 4OHKA 3QKSA 2IPXA 4L2IA 5LWHA 4IGFA 3DFIA 4W5TA 4B34A 3B2QA 4PXSA 1D0IA 1T9DA 4QXQA 5BN3B 1LPMA 3VHQA 1VKZA 3OHPA 4GGMX 3SOZA 1Z68A 2HA5A 5AVJA 1Z07A 3OQVA 4KMOA 5LA6A 1NSYA 2ZRMA 3PQ4A 4LY6A 2HF2A 5IXYA 3FDJA 3M34A 1IC6A 2SICE 5KOHB 4MZXA 4WDQA 1YCGA 1XMOB 3EQ6A 2AX4A 3P94A 2OFPA 3FR8A 1G7SA 3IRUA 1E32A 4Q3BA 4F2GA 4MGZR 1VLLA 1JXQA 4E03A 1A5SB 3DBIA 3NAZA 1WXDA 2CD9A 2XZPA 5CVCA 3CVWA 1J0XO 4H7FA 3TZLA 1T1EA 2FUKA 5F23A 2OCLA 3A4YA 1R5JA 2XB9A 4C07A 5IF9A 2RCNA 1KY5A 3B5JA 3N86A 3S2FA 2C5EA 1DQYA 2R7LA 4BV2A 5KJ6A 2C95A 2VJCA 4EJ0A 1AJEA 1MOZA 3WL8A 4AYWA 3HO1A 4ARCA 3U1TA 2WMDA 5TR9A 4OKIA 5C5IA 2HCFA 2RH4A 3KXPA 1ISSA 4IMIB 4UM9B 2WWHA 4OXYA 4DV5B 4QDTA 1LSUA 1M8KA 1MIOB 2MSDB 3AM3A 4IDOA 1A8HA 1W1UA 5KB3A 2Z6QA 1IVNA 2GJ4A 3N3AC 4OSOA 2O7NA 3V2UA 1W36B 2W2KB 5JANA 1F51E 2J5KA 5G1OA 4EKEA 1SG0A 3N0XA 1ZUIA 3GRVA 1Q17A 3WK7A 4QO7A 3HKDB 1UJ6A 3ZK7A 1N0UA 1GFWA 2WUEA 4MV5A 1I94B 3MRSA 3CTPA 1KAHA 1LVGA 3QEMB 4IKOA 1V71A 1RIIA 4URFA 1D5WA 3OQOA 3TNFA 3GAFA 5ISMA 3MD9A 4LOAA 2Q0XA 4KIUA 5EP3A 5H3CA 2ZBRA 2JJ8A 4PF1A 5CT5A 4AUEA 4RO0A 5BW5A 2CBZA 5KYXB 1QDUA 3YASA 1RI1A 1X3LA 2JVIA 4XWKA 4MHTA 4BNMA 3FAZA 2C29D 2VAXA 4ZQBA 2P62A 4FDMA 1UK9A 5I3ZA 1JALA 5LR6A 4GPTA 5H5JA 3PZBA 4JBGA 5BXQC 3U7FB 1NVTA 1L7OA 2KWIA 1ZITA 1Y98A 2MSCB 4IGKA 1KDYA 5FORA 4DCCA 1XMVA 3GFVA 4LISA 2IYNA 1N9GB 2BGMA 2ZTUA 3K0EA 1GGEA 1WCYA 4LHYA 3OQBA 4DREA 4PTZA 4QECA 4BJ3A 1MAVA 1QQBA 1QV7A 2W22A 4O4JF 1C0PA 3HP1A 4Y2SA 3CXRA 4G65A 5HKBA 1J7KA 5KYVA 3ETJA 1V95A 1XAGA 1Z28A 4HQNA 3O38A 4KXLA 4FGJA 4LW8A 4QUGA 4ZO7A 1UFVA 4HDQB 5K3OA 1QQ5A 4P31A 1N4AA 2Z9CA 3U19A 3A0RB 4TMWA 2EFHB 1J8YF 3D1VA 3E7XA 4KK3A 4NMHA 4MUFA 4B47A 5HR5A 4BX9A 5KSYA 2FWAA 1QFMA 3VDQA 2B25A 3ZGVA 2C7RA 2FTKE 3HDJA 5EMNA 3EK2A 1E2HA 2X7JA 2YOFA 1A0OA 4U5XA 1UPBA 3BDAA 3B1JA 3SEZA 4ZVTA 4AXXA 2ZYDA 4D4MA 5TMEA 3HKCB 3UW1A 4BQOA 3QEJA 3SYRA 1E3TA 1N1GA 2AJBA 2W0SA 1FFDA 4FYMA 4K9OA 4KHZA 4XQCA 3JWGA 1N6PA 4H6XA 2PAAA 4ZV9A 1RW4A 4UFPA 5CFZA 1ORVA 3TKLA 5D84A 4YCMA 5KC9A 5EKTA 4H0CA 3JAKB 3ROTA 3G79A 1XPUA 3A6GA 1SD1A 3OKPA 1BXKA 2WJ6A 3BK2A 3GZJA 3IT3A 4H27A 3ZUGA 2Q4DA 1RKQA 2RGNA 2Z2IA 4YJFB 3ZE6A 2AFIE 1XOIA 2PVPA 2PWBA 1P1HA 1N0WA 2QQGA 2X3UA 1GY8A 3D8RA 3HPRA 3M6UA 1X8JA 2FMKA 4C0QC 3PXCX 1QIJA 7ADHA 1G60A 4EW6A 1LNSA 1ZO8A 5K09A 1OXVA 3CNLA 1K89A 1ZNZA 5AHWA 5GOZA 1DLIA 3BHMA 1GYPA 2HRDA 2ZXEA 3C39A 3KHKA 1V4VA 2IQ5A 4GI5A 5JWHA 4RTQA 2JI7A 2WUVA 3GEIA 5DO9A 4PYJA 1K7SN 4IQFA 4CM6A 3I37X 1KPGA 1I5EA 5HRCA 2X42A 4IY1A 4NBVA 1HNXB 4CUKA 4ARIA 5BNWA 2RC5A 3O4GA 3FXAA 2O2GA 1A69A 4IICA 1EFHA 2ZJ6A 1HT3A 5GADl 4EPWA 1SD2A 3BXHA 4NOKA 1WMAA 2NUTB 3PK0A 4NIMA 4MYTA 3RYFA 1M34A 3MGGA 3EBLA 4JB2A 2PCJA 4QNMA 1ZOIA 3F8TA 2YKGA 5C7OO 5B3JC 3H5TA 4KGDA 3L84A 3MWGA 4OHWA 2WBLC 2FZWA 3G2OA 2K7FA 1MIHA 3W34A 4AN1A 5EHXA 3C7DB 3I9LA 4BN0A 3VO2A 1O89A 3L06A 1PJ8A 5HEKA 2PBRA 3KZNA 1NAIA 4B6RA 3KWJA 4DRXA 4ENUA 2MINA 1X70A 2VHCA 1JILA 4HNAA 4M7RA 4ZC1A 4BS9A 2IPNA 1IQRA 5DCLA 5AOAA 3DZJA 5FOUA 4G0OA 5K8UA 3NRBA 3W4JA 4CEJB 5F2NA 2CMHA 4BB0A 2Y27A 2ZSFA 1FYEA 3ZDDA 5E7MA 3VNUA 2CMGA 2ZTSA 2QYSA 1J2UA 2NUPA 3DBLA 4KLZA 4F85A 3WGIA 5JWRA 3EUWA 3OLVA 4LUCA 3RKUA 3KQLA 2BGWA 2GA8A 4HG2A 3QMMA 4Y6SA 3AFGA 1HEYA 2O2IA 1QP8A 4AWAA 2IDJA 4DIUA 3RIGA 2CW5A 3CEJA 4B7XA 5HGJA 1PZXA 1L5LA 1K5HA 2K6GA 4XD7D 1QFSA 1QYWA 5F21A 3FYDA 1NTRA 4X5OA 2ZSHA 4CI9A 5L7WA 3GLIA 4Y9RA 4HK4A 4PN3A 4Q1AA 4Y0VA 2I71A 2C9ZA 2W6OA 4M8SA 5KEIA 4DIEA 2ZDHA 3JY6A 4WCFB 4UEKA 3ZV6A 3GZNB 1DJLA 3HVJA 4YRGA 1QBGA 3I23A 1F3LA 3K92A 1VM6A 1NOJA 1YQ9A 2WV7A 3IXQA 4Q34A 4AYTA 4DA7A 1H69A 3MQ4A 4AMBA 1XKLA 2PGIA 1OI2A 3CM0A 1I80A 1UJ5A 2PX8A 3HZHA 1TVKA 2ZUEA 4OYLA 1SXPA 1XNQB 1NLFA 4RZIA 3RGWS 2PU5A 1NQUA 2BFPA 1NPTO 2YWJA 1KQ3A 1R5OA 1F8YA 4CEHB 2XBLA 2MMCA 5AKGA 5A0TA 1P77A 4TN5A 4YJ2A 1GPDG 4UKDA 2QAIA 2VRCA 3BFKA 1DE0A 1AN0A 1P0CA 2BTQB 3BWBA 1PR6A 3KU4A 4O0MA 1NW4A 4TUYB 4V0MA 3Q8XB 3KOMA 4N8SA 2A4MA 3T12A 1N2ZA 1T5OA 3QEOA 1IYZA 4A03A 2JGDA 2QG6A 4OOFA 2XNHA 4LDZA 4HSGA 4MB6A 3T99A 2VXBA 3DNFA 4GOOD 5DN6D 5E7JA 3FPAA 1XEWX 2VK1A 1ULUA 1R1DA 3E1KA 5J4VA 4R0NA 4I14A 3DE7X 3UJPA 1OFTA 4D41A 2LTAA 3QBDA 4BO2A 4N3BA 2PGOA 1L5MA 1KC3A 4YALA 1WSDA 3KTAA 1JZSA 1CQPA 2PMEA 1E2DA 2HBZA 4DANA 2HK7A 4RJIA 4BFTA 1EGAA 1YWGO 2F43B 2M98A 3VQTA 2A5YB 2WIJA 3H2HA 2FDXA 1NZDA 3UJDA 2JLUA 3TSOA 2AOTB 3GOQA 4MJ3A 3GQVA 3W9SA 2ZZKA 2ZBDA 5AI4A 2ZRBA 2XUDA 4CKEB 1UEJA 5FTJA 3NP7A 1F14A 4L9RA 5I7OA 4IX9A 4EUHA 2NYRA 3C14C 1O57A 4QATA 1JXMA 4YJHB 3ZE8A 2OY0A 4RVDA 2FVYA 5CEEA 2OZVA 5A3VA 5JALA 3CF4A 3T61A 4RJTA 3IKLA 3Q3HA 1H4VB 2JHCA 3AC0A 5JNLA 2QSJA 4BX0A 4Z53A 2L69A 2JJ1A 3BB1A 3H4IA 2GFIA 1E6CA 2A0YA 5KNCH 3MJHA 5AJTA 1P4SA 4XB1A 2PL1A 1QKJA 2IF0A 5A6SB 3T0IA 5HE9A 4CVNA 4QBHA 5P8WA 4FMCB 4Y3UA 3ZU3A 2GJKA 3PWTA 4W4TA 4C76A 1HOTA 5CVUA 1M2FA 3BTOA 5IH3A 2ILTA 2H2AA 1BD3A 1KOFA 2NZ8A 1JBQA 3PFNA 2XR1A 4F93B 1M1NA 2CL7X 2Q8PA 3L05A 3ACCA 2HK8A 1GFZA 2OV1A 3K96A 3MTQA 3VFDA 4C4PA 5KYYA 1GXSA 1O9HA 2HWWA 4R2LA 2OAGA 4LJRA 3K15A 3UB4A 3M4YA 4PBTA 1CS4C 1T4CA 5ITWA 3N1UA 3HC7A 5LFAA 2BEWA 4X1IA 1TKAA 4OGLA 3T5AA 4UAUA 3ER8A 4D9CA 3OY2A 3KJHA 3H5RA 3TX6A 1SXQA 5ALNA 1OH5A 2BR5A 4B74A 3EYWA 1J8QA 2JHPA 3UUGA 5L3SB 1UKZA 4ZEWA 4GRAA 3ZVLA 1WW8A 2QX9A 3GDGA 4TM8A 5B7GA 1EEHA 3LQ4A 3USES 4ZVLA 2WHYA 4JUBA 1S5PA 2WUFA 3QLTA 2RI0A 3AR9A 3VVCA 2FE1A 1XTJA 2EERA 3SU8A 1EDZA 4LC9A 3RC7A 2CEKA 5CR9A 1YDEA 1KI2A 1Z5WA 4HH0A 5COQA 4HLCA 3S70A 1UJCA 5B7QA 4NK5A 1HPLA 2L82A 3GFBA 4O8CA 1SUBA 4JB8A 1RQXA 2DQKA 4BMDA 2V7EA 3L7BA 2J9XB 3VH4A 3LDFA 1K4KA 3I52A 1S8AA 1QGZA 5JFOA 1J1UA 2IE0A 4TM7A 5J47A 1NMQA 1NZJA 2P5TB 3KT6A 3N0VA 4GNKA 4XPIB 3OPVA 3QVVA 4M8IA 5I4CA 5IZCC 2BEVB 4LGCA 3NHWA 3ZHTA 1K92A 4U9IS 4ZOBA 4H7DA 4K9NA 4BRWA 3C3DA 3MHTA 3W1WA 2BAGA 2B8WA 5FFMA 2HCRA 4BVFA 3PQ8A 2LW7A 3OFSA 4C0SA 1B73A 4HDMA 1JSLA 4EG7A 4QEKA 1N5RA 3A6KA 3QOWA 2CDRA 2PA0A 4ZRNA 4ZANA 3ADCA 3BRSA 3FROA 3OPXA 1LDNA 4RW0A 2AI2A 2J0QA 3GGPA 1D6JA 2AN4A 1CUCA 1M7BA 1N6HA 3KJGA 1XFDA 3OO0A 3KHSA 2P8JA 4OHBA 4FIZA 4IS2A 5DWDA 2FP4B 1U1GA 2HT6A 1O96A 1WTCA 1ONSA 2O6LA 3GVIA 3IOMA 3P2YA 3BEOA 4K3VA 4W7HA 3VPAA 4F6CA 4H1WA 3A2KA 4B3RB 4M0KA 4MVJG 4JSYA 4IJSA 3EJWA 1DQRA 2FV8A 3HR7A 2EKDA 2WFLB 3R3UA 5CNKA 3RARA 4EPRA 4XYLA 4C3VA 2R8BA 4BNKA 2PM8A 3VJKA 5C1PA 1ZNXA 4M1MA 3PWZA 1IOWA 1YULA 4FINA 2OQVA 2H4ZA 4F9EA 4P5PA 2Q0HA 4CIAA 4L73A 4RU1A 1J70A 2P67A 5JPIA 1SPBS 1ZIDA 4HX2A 3CNEA 1N75A 4ZYXA 2NP6A 1DBQA 4D79A 1BMDA 4R2IA 1I2BA 2JGKA 1TDJA 2RGNC 3D2AA 4PINA 1DIHA 3H1AA 3MRVA 3PUKA 5TARA 1U65A 1TYBE 1QBKC 3JQDA 4LWOA 5G4LA 3V6MA 2J3QA 3KKZA 5JSKA 5EYPA 3UMRA 3VZRA 4A1OA 3DKPA 1HYEA 2YZ2A 3NRCA 4YJ3A 2X6TA 2XQIA 2CDBA 5B36A 3EBPA 1DMSA 2P68A 3CGWA 3HDYA 5LXTF 4IEIA 3L9WA 5EEHA 4BBZA 5CDFE 4B3SB 2PWPA 5A05A 3A05A 3TTWA 4FMCF 1BS9A 4IIFA 3D3QA 3WKEA 5KYTA 1T1IA 2OO3A 3PFBA 4FD2A 3EWAA 1XF9A 1MQ9A 1C9KA 1U8XX 2IZ5A 4IINA 2WB4A 4MVJI 4WZBA 5C1DA 3OJLA 2VDMB 3ABIA 4NPCA 3VSAA 3VPXA 4AZ3B 3JR7A 4LMAA 4ZCMA 4DQLA 4DV3B 1FOEB 1U8YA 3UHOA 4F3CA 2PJDA 3AB3A 3VZDA 4AS2A 4HQLA 2QRJA 1RMTA 2R66A 4J0JA 2Z43A 5CVVA 3ZCSA 2A0UA 4QGAA 4IEFB 4REMA 4H7PA 2JRLA 1P5ZB 2PYDA 3I1FA 3K05A 3ZUPA 5JAPA 2OV4A 4Z6KA 4GRDA 2AH5A 3O4IA 1DXQA 2DWCA 3B85A 3EGEA 4MPTA 1ZR2A 4LZLA 3L8DA 1MO5A 4KBGA 4INPA 1PR3A 1TF5A 1K6IA 2Q21A 2WLTA 2XECA 3NTLA 4AO8A 2CNWA 2XNDD 4XTCS 2X23A 1COZA 2HQBA 4PGGA 3PX2A 4A0RA 1IK6A 4Y6PA 2QMZA 3ENNA 2JNWA 2EWVA 3O0TA 4KE6A 4ZU1X 3MFQA 1N2SA 3A2MA 1EK1A 2C61A 3UWMA 1JS1X 1ULAA 2ZUCA 4DR2B 5IJZA 3S7TA 1F6WA 3K8YA 5IDWA 3R76A 4UBMA 3K35A 1LJLA 1T1GA 4MS3A 3HCDA 4MS4A 4LF8B 4RPHA 1UBGA 2GZ1A 3PUIA 1XD8A 4HEA6 4MQEA 5CD9A 3SBDA 4DR5B 3IBCA 4NBWA 4XKJA 1QRTA 4ND1A 2DWQA 4R2HA 5J9FA 2I2DA 2ZIXB 1XVVA 2V97A 3BCSA 4LRYA 2NNWB 1CEEA 3EEOA 1SUWA 1C9JA 2BEJA 1QGAA 4JZYA 4OFZA 4D0RA 5HXAA 4YASA 3IB6A 1YR8A 3ZHUA 4NTZA 5ECYA 5K0EA 1RWBA 2CXNA 5LIPA 1P7YA 4OHPA 3VPBA 3W5VA 2PRSA 1RMQA 4QDOA 3GLFE 2DHDA 1N2XA 1CW2B 3RPEA 2WT9A 4I66A 2Q4BA 4FGZA 2D62A 2CC2A 4LGMA 1UUFA 5JBNA 3W5HA 1H2XA 3O83A 4R1PA 1JFFB 3K3PA 3MWEB 2JAUA 1R4AA 3D4BA 5FTNA 1PNOA 3ZD7A 3K0AA 4F4HA 2GXQA 1B93A 3FDZA 1YZNA 4C3ZA 4MKGA 2Q9UA 2GJ9A 3HL4A 5D7BA 3W3AA 3TTUA 3V97A 3RWBA 4X44A 1G21E 1ZSVA 3IVMA 3O03A 1A5ZA 4FYVA 3V80A 5F7JA 3WYNA 1SQ6A 2Y99A 1CVRA 1XQXA 2CLSA 2GI4A 2CF5A 4BOYA 4B6SA 4B3GA 3E61A 4LWZA 1W2GA 3OMLA 1ZSNA 4KTVE 3LUPA 4E0BA 2QI9F 1T6YA 4KFUA 2DAPA 3M6MD 3NORA 1UDXA 4Q5IA 3VNRA 4AO7A 3R3ZA 1FDUA 1PZMA 3CUUA 4F5DA 4A73A 4KPEC 2UZ0A 2JCSA 3C6KA 3DLTA 3HJCA 4IJ5A 1S1MA 1SN7A 4Y2RA 4UD2A 3ZU2A 2WTUA 4PAOA 3WLQA 3SHTA 3TS1A 2AK3A 3HEBA 4ZFNA 1O0CA 1MX5A 4V1CI 2C5SA 1N5OX 2W37A 1BVRA 3U3JA 1GADO 1AK2A 2HQ1A 2WU0A 4MGHA 2J6BA 2BH9A 2VZ9A 1WU7A 4HEQA 3I01M 4HAYA 3SICE 5ICMA 3NZEA 4H4CA 3QUSA 1W59A 4P3PA 4M8NE 1YZQA 3S2GA 2Z2XA 2G6TA 1PD1A 2V1XA 1BFKA 1MGOA 1P3JA 2W2NA 3PYXA 4ROSA 4V0RA 1V1JA 1ZUHA 2PSJA 3DV0A 4NMXB 3Q2KA 4Q9AA 4M36A 5FWYA 1KOGA 1B6SA 3M9LA 4FCVA 2WJAA 5HFNA 3AUYA 4EY8A 4WXEA 4XDZA 1VFPA 1M2KA 5JYDA 5LJIA 4DLZA 4OLHA 4MWGA 3MTGA 3MS2A 1K9VF 2VHUA 5LJLA 4PLZA 1H2FA 1MUUA 1Y9AA 1N0VC 1NFRA 5CYOA 1JFLA 3G7UA 3IP8A 4IG4A 4MQ6A 2VIIA 3QYAA 4RLQA 2AXEA 4BGUA 4CF6A 3QVLA 5L6LB 1II8B 1Y5NA 4D98A 3OQIA 5CVDA 2L0XA 3LBIA 2P9BA 2AKAB 1K9SA 4DNXA 1FJXA 2RE8A 1G55A 3NM4A 3DVAB 5AVWA 5GV7A 4YEDA 3SDZA 3A6LA 1A7UA 2OHFA 2OKGA 2Z30A 2IYQA 4LHVA 3VO1A 3JAMA 1P7WA 1L0BA 1M33A 3QITA 4ZQCB 3UAYA 4ZGWA 4HUJA 1Z34A 3SE7A 1IBCA 2ZAGA 1IJFA 1I6KA 4BO4A 4ZA2A 3SI7A 1T0UA 3UGJA 1UKCA 3ORRA 1EAMA 3QA3E 4RH1A 2CXOA 2H1CA 2RSLA 5F12A 1B2LA 2ZSDA 2H07A 3PHGA 4ZTBA 4YP9A 2YW2A 5JEEA 2I4OA 2QPLA 3FSGD 3UWKA 2XAUA 3S1SA 1D4FA 1H5QA 2DC1A 4J0EA 1L7AA 2C57A 4DLBA 4H3SA 4OIFA 1E1YA 1VHJA 1QUFA 4FDLA 2GUGA 4TS1A 1KA9H 1ZESA 1IONA 4HEJA 2XA2A 4F04A 1EFPA 3C3YA 2NXNA 1GDTA 3OCCA 3WIEA 1A82A 4BLQA 5EZSA 2GAOA 5E9QA 3AOEA 1NUHA 4D5GA 1UKYA 2MIIA 3ZLTA 1E2FA 3GLRA 4BEJA 4BV9A 1U0NA 1NBIA 2I3ZA 2Q1WA 3HJFA 4ALLA 2GVNA 3AIMA 2IEGA 2X58A 4LMRA 3UY4A 3V3KA 4PEVA 4F46A 1Y1QA 3KX2A 3V1YA 2A88A 5JV5A 4TWBA 1G5PA 4M9RA 1VP9A 1PQYA 2H48A 2GETA 2YC2C 2C5LA 1E6KA 2EZUA 4UAVA 4C20A 1XA4A 5KYKA 2B1QA 1WB9A 821PA 1P80A 3FPFA 3KYIB 5E4JA 1N5MA 3DWGA 3MTDA 2VQEB 3RBAA 2C4MA 3KLNA 3MLBA 2PH5A 2GBPA 2QYOA 1HWYA 1RZ3A 4V39A 3RK0A 4OB7A 3ZVRA 3RF6A 2PFSA 3TZCA 3ZJVA 1YCHA 2VL7A 3UKOA 5EJ9A 4W8OA 4TS3A 2VJAA 4LF7B 1P1FA 4WRRA 1F2TB 4M0LA 3AESA 3QVGB 4KQ6A 3A26A 4FJ0A 4Z7JA 2JFNA 1QVWA 1G16A 5CURA 3EFHA 5B2ZA 2NU9B 2XUFA 2ZS7A 4BNIA 4UDXX 1M72A 1CQWA 2AFVA 1XXHB 3PVZA 2BF7A 4TVSA 2R11A 1T1JA 2ENWA 3KM0A 5UKDA 2QRPA 2G08A 3NONA 3DOFA 2FSUA 2NZVG 3OO1A 4B8ZA 1P1IA 2X1MA 3ZXXA 4BZZA 1NJFA 3WLRA 4CJXA 4R5MA 3BMNA 4E2ZA 2V5AA 1VYHA 4NCAA 4B35A 3EVGA 2VJBA 2ZYSA 3TLBA 4FLMA 3DZGA 4B09A 1BW9A 1IJEA 4RUKA 4XR4A 3WL6A 5B1DA 5JY1A 3RSZA 4IFIA 4B8WA 2JGMA 3KPWA 4JI2B 4NBSA 2HR1A 2PZEA 4L6IA 1QUEA 2R8OA 3ONEA 1GAEO 1T0HB 4RTLA 5JZSA 1U6JA 1NMYA