1UDCA

Structure of udp-galactose-4-epimerase complexed with udp-mannose
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-GALACTOSE-4-EPIMERASE
publication title Structural analysis of UDP-sugar binding to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
molecule tags Isomerase
total genus 132
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1udcA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1udcA01
4RLHA 1A9YA 3GVIA 4MVJM 2AEFA 1XDWA 2G76A 2JD1A 2F00A 4AJIA 3L4BC 3FPCA 5T8KC 2VZ8A 3IP3A 3ZHYA 4Y67A 5CAEA 3A1NA 3DOJA 3GZNA 1T1SA 5HS4A 5ICSA 4CM6A 5GZ3A 5IZCA 2ILTA 3UUWA 2VYVA 4CLDA 1AN9A 1ARZA 4HX5A 4RZIA 2HMTA 2B69A 4JP2A 4K6FA 3DZGA 1BHSA 1PSDA 3LZ6A 4N5NA 2X7HA 3WB9A 3FD8A 4GL4A 5F3RA 3VDQA 3ZV5A 2PGDA 3ADPA 3PFFA 4NHEA 4XCVA 4IIUA 1YL7A 2G1UA 4PGFA 1UH5A 4DTIA 4AJLA 4MDHA 2B5VA 4MIYA 1N1EA 1EUDA 1M76A 3MJTA 4BS9A 4XEHA 4MJLA 1GZ6A 4XR9A 4CM3A 1UDBA 4BNYA 3MJVA 1SB9A 4IDEA 3JQFC 5TSDA 1T24A 1LLDA 3AUUA 1LEHA 2WD8A 3FR7A 2ZQYA 1GFSA 4FBGA 4URFA 1DLIA 5B12A 3GDGA 3D4PA 4KTVE 3WNQA 4ZHSA 5KJ6A 3TL3A 1U8XX 3U62A 2EXXA 3CMCO 2DBZA 2Q50A 4UVHA 1ID1A 4LW8A 3DOCA 3KZVA 1XELA 3R6DA 4RVDA 4OGWA 2X5JO 4R4JA 3UXYA 3JQDA 3G17A 3Q2KA 1UP7A 1O8CA 3GQVA 3KVOA 3PIDA 5JAIA 3K2BA 1UR5A 3HWRA 5DDIP 3OJFA 5AXBA 2YQ5A 3TN7A 4OSPA 2P5UA 2HCTA 4W9NC 3OIGA 3RU9A 4II3A 5CPFA 4PLCA 3W6ZA 3ZU5A 3JQ8B 4TZKA 4CLRB 5F1KA 4E2ZA 4BO9A 2XXJA 3KSZO 3CUKA 4AJHA 2X4GA 5DOZA 4DA9A 3ZH2A 5GZ1A 1RKXA 2NQ8A 2NQTA 5L9AA 1GQQA 2G82A 3AFMA 1YBAA 5JYEA 3GG2A 1J0XO 3JQAA 2Y1OA 2AQIA 3KXDA 1LDYA 1SOVA 3PJGA 1ULSA 3FWNA 1NPYA 2C20A 1EE2A 3INRA 3LT4A 3IKVA 3RQSA 4FB5A 4R68A 2X6TA 4KZPA 2HMVA 3NRCA 5ITWA 4K28A 4DIOA 1F0YA 1NFFA 4B4UA 4R01A 1XYGA 3WDSA 1EFLA 1BXZA 3PWSA 1EQ2A 1PGOA 4PG5A 1KEPA 3GPDG 3H6KA 3MTGA 3P2YA 5JO9A 4INAA 1R66A 4LSWA 2OBNA 3Q1LA 1ZO8A 4OOFA 2PFGA 4BNIA 5CDSA 1IOLA 3GN1A 5KVQA 2OORA 2D5AA 3Q6IA 3C24A 4DPMA 4JN6B 4TRRA 4YRDA 3O4RA 4PLZA 1Q0HA 1I8TA 4CM1A 3WGTA 3NDJA 4Y6SA 1LJ8A 1GUZA 2CF6A 2IYOA 1ENZA 2C5AA 1HDOA 4QT0A 3PIIA 5COAA 3KTDA 5EL0A 4YJFA 3DMYA 2PZMA 1LLQA 5EJ2A 2AMFA 3PJDA 4YPOA 3FWZA 5C7LO 4QO7A 3Q9NA 1V3VA 4MVJH 5FEUA 4UUNA 4TSKA 1DIAA 4OXKA 2ZCVA 4MIEA 3UFXA 3U4DA 3HDQA 2ZTLA 5I9NA 3MEQA 1LBEA 1AHIA 1XEAA 2DPHA 1H9AA 2BFOA 4GH5A 1P1FA 2CDCA 3KOUA 3S2IA 1HE5A 4R9SA 5T67A 1CQJA 3K8ZA 2DAPA 5L4LA 2C29D 4KWIA 3D64A 3E03A 3E18A 4FS3A 4ZQGA 1BSVA 5IDXA 4IJKA 2GASA 4E5PA 2AQ8A 2Q49A 1VSVA 2Z95A 3G3EA 4P22A 1MA0A 3W4KA 4TMFA 1M66A 1XKQA 1CDOA 3DZHA 1NR7A 4CJXA 3VPHA 5HBRA 4L73A 2QYTA 1SBYA 4GGPA 4YT5A 3TJRA 2ZJ1A 2DPGA 1PR3A 2EERA 4GPD1 4QSMA 3ZV6A 4CM8B 4XJSA 4AJEA 3IC5A 1ZVMA 2PH5A 5FI5A 3TDKA 1Y81A 1Y8QA 1B8PA 2NU7A 1QP8A 1ZKMA 4WOKA 4A27A 1B15A 2D59A 3D1LA 1V35A 4CMEA 3F4LA 1EVZA 1TT5B 5IXSA 1K6XA 3HDYA 3K5PA 4YJGA 2C7VA 2D4AA 5F21A 3ROPA 3X2EA 3EC7A 3TWOA 4R54A 3RC1A 4UVGA 1OC4A 1PS9A 4PLHA 5ILGA 3DTYA 3LC7O 1MUUA 2VTEA 1JVSA 4NBRA 4CLOB 4X54A 4RCVA 1BW9B 1H2HA 4XKJA 4HUJA 3ZHZA 2BGKA 4IZIA 4EITA 3PLNA 4PZEA 2IZ1A 4G5HA 5KVVA 1H9BA 1MG0A 2OHXA 4ND5A 1LA2A 3ENNA 4E5KA 3C7CB 3F9IA 2UDPA 3JYLA 2HMUA 1Y8RA 4PLFA 1MGOA 4L8VA 2UYYA 3F6YA 3BMOB 4TRNA 2JAPA 3VZRA 2Y1GA 3H3FA 1IPFA 3MWEB 1DEHA 3UCEA 1PQPA 3ZWYA 2YQ4A 1UJMA 4FFLA 3LQFA 3PQDA 5JCJD 3GH3A 1R0KA 1GR0A 3AOEC 2JCYA 4R1UA 1V3TA 4BNMA 4DLAA 2P9GA 3PXXA 2DT5A 1KEUA 3GGPA 1UXGA 4J0EA 3VKUA 3WMXA 4KUGA 1TB4A 2DBVO 5ITVA 1Y5MA 3ITKA 2FZEA 3AU9A 3ICPA 5TC4A 4CMKA 1ZMTA 2FP4A 1RYEA 1GCUA 1P1HA 2PWZA 1P0FA 2WYUA 4TKMA 2EV9A 3M1AA 1YL5A 3S2EA 3C1OA 4IJUA 3DZJA 2HJSA 1WMBA 3PJEA 4FD3A 1M75A 1NQOA 3K2EA 4BO0A 4HWKA 3FBTA 3RASA 3DHNA 3QWFA 3WJAA 3DMTC 1A27A 1UP4A 3HJAA 3ZU2A 1P45A 4J9UE 4XRRA 4R5HA 2WDZA 2E82A 4NZ9A 3EDMA 2R6JA 4MO2A 5EQFA 3UICA 1U2GA 4OO3A 1QYWA 4WE3A 3IKTA 4KQWA 3VPXA 4YAEA 1FDVA 1HDCA 3FCOA 3WGHA 1RM4A 1ZIDA 4MIOA 2VUTA 1AUPA 2W2LD 4E33A 2D1YA 5A5FA 5TS3A 1F17A 1LNQA 2R00A 3ASVA 1B0AA 3AK4A 2A35A 9LDBA 3CIFA 4O1MA 2HLPA 1CETA 4M86A 1I3NA 2ZYAA 4TRMA 3PLRA 2DC1A 2X9VA 4IDGA 1PQWA 5A4DA 2RH8A 3JYNA 3H5RA 3SEFA 1B14A 4KDFA 3GGGA 1T4DA 4ZD6A 3OJOA 3RC2A 5CEEA 3O8QB 4F45A 1NXQA 4JXKA 2P4HX 4WPGA 4RVFA 1N1GA 1VPDA 4O59O 1CERA 5G4LA 4RLSA 2HK9A 5KOIA 2V6FA 2Z1NA 1ZFNA 3N58A 3ABIA 3Q3CA 5KWEA 5T5QA 4XR4A 1E77A 1CEQA 3D3WA 3EVNA 5BSHA 1Z7BA 1GADO 1E3IA 3HFSA 3JQAD 1F8FA 1E7QA 1HE4A 2P91A 1BDBA 3S2FA 1Y5RA 3EMKA 4MVJF 3WGOA 1C0KA 1WVGA 4HV4A 2YDXA 2V6GA 4K6CA 3NT5A 1Y6JA 2Y05A 4CV0A 3I9MA 1DIBA 4R5MA 1C1XB 4YJHB 2O3RA 4RPJA 2X8LA 5AXAA 2E4AA 2PA3A 3K30A 1QV6A 3PHGA 3KETA 4RPGA 1NNUA 4CM5A 5MDHA 1J5PA 5EMHA 2CNBA 3PGXA 1YQXA 1MFZA 4AJKA 3PHHA 5JDCC 4FR5A 3S8MA 4CMIA 1AHHA 5CDYA 2G0TA 3WMWA 1I32A 3UCFA 1LLCA 4YR9A 3JQEA 3TZHA 3DAFA 3DB2A 3HDJA 4IIVA 3SX2A 4BNNA 1E3WA 1EQUA 3VVBA 4UUMA 4BQRA 1AGNA 3TZQA 4FPXA 3WFIA 2YHIB 3EGOA 3JTMA 3GPIA 4D46A 1PS0A 1GEGA 1ZK3A 1VE9A 2VNAA 1RM5A 4DBVO 3AM5A 1T25A 3DAPA 7MDHA 1RWBA 1P77A 3D3EA 3GDOA 4BO8A 4RPLA 1SB8A 4E21A 2GR9A 2Q2QA 4E3ZA 3NX4A 3L6OO 2P4QA 1QLJA 4IQ0A 4JJGA 4UREA 2YV3A 1U5AA 4Z9YA 1DIRA 1YQDA 3GMSA 5T57A 1U2DA 4XYLA 3PYLA 3B1FA 1BVUA 3RUIA 4DLBA 4E30A 4PZCA 5TGDA 2VRCA 1NQAO 1XG5A 2V6MA 2ZB8A 5IDWA 1GYQA 1I10A 3NYWA 4WCFA 3NUGA 3PWKA 2EKPA 5G2OA 2YY7A 1DHRA 3PRJA 3GK3A 1XHLA 3QQPA 5A03A 2ET6A 4WEQA 2AE1A 6LDHA 2X0IA 4XA8A 2NTNA 4L4SA 4B7XA 1KVRA 1JKIA 1DXYA 2I6TA 3A28A 3GGOA 4W6ZA 1R4MB 1PJ2A 4B3JA 2B37A 3WGIA 3ZWVA 1LRKA 4MKXA 2A92A 3C1TA 2OO5A 4U0JA 4KUHA 2VTDA 2UAGA 4IS2A 5U9CA 3ANNA 5L3ZA 4R9RA 4PG6A 3VPFA 1QRRA 1LC3A 2G5CA 3LDHA 2I65A 4D42A 4FC6A 4ESOA 1D1TA 3H3JA 1E92A 1FF9A 4BVAA 3BMCA 3SVTA 2O48X 4CV1A 1DC4A 4GMGA 3AI2A 4L74A 4WASA 4C7JA 2E37A 2UV8A 4OL9A 1E1NA 5G0UA 4RZHA 4J7CA 4Z0HO 1EFKA 3WICA 2BLLA 1HLDA 2XXBA 3H9GA 5TJ9A 2BH9A 2LDXA 3AUAA 3LYLA 2JCVA 4KMSA 5EINA 4HY3A 4EUFA 5A5EA 2Q1UA 4R1TA 3GG9A 4U6SA 3ZWAA 4PG7A 4NK5A 5L7TA 3HDHA 2I66A 3WGGA 4E5NA 3U5TA 4WGGA 3ZNOA 1B16A 2YHUA 4XQGA 4B3IA 5ILOA 1NVMB 2FSSA 3F1KA 2JD0A 4OMUA 1HDYA 4BB6A 3ZWBA 1I24A 3Q0EA 4BO4A 4ILKA 4M1QA 5F5NA 3CMMA 4U6QA 1TT7A 3ZV3A 3DZFA 3V8BA 1MG5A 4CMHA 1FDWA 5LCXA 4CUKA 4H15A 1PEDA 1U28A 2QIOA 4RF4A 3TOZA 1A4UA 3E9QA 4BB5A 1A71A 1IYZA 3V2UA 5JMPA 4PVCA 3GNQA 2HRZA 3JQGB 3H2ZA 4AJ2A 7ADHA 3PZRA 1GZ3A 4IDFA 4YAKA 4CQMA 1V6AA 1C14A 1ZMOA 2EGHA 1HDXA 5JYDA 4RPKA 4J0FA 1QORA 1LDNA 3T7CA 4D3FA 1ZEMA 1ZSYA 1CWUA 3LT2A 4CLEA 4WKGA 5TQVA 2D5CA 4OOEA 1P1IA 2PZKA 3WFJA 4ZN6A 2PTGA 1A7AA 1BVRA 4EDFA 4NJMA 3RBZA 3TFQA 4E32A 1FDUA 3DC2A 1XA0A 4YBZA 3DHEA 4MVJD 4B3HA 4IY1A 4OXYA 1U3WA 2X58A 1DRVA 3AUTA 2B4QA 4NFYA 4BKQA 9LDTA 1LC0A 4PFJA 1KVUA 4W4TA 3D4OA 5C7IO 3FI9A 3OJEA 2GN8A 3NT4A 4I9UA 3ZWWA 1SNYA 3IMFA 3E8XA 1FJHA 4NBVA 4DUPA 1X1TA 2E49A 3DXFA 3E48A 3ASUA 4GLLA 1E0DA 4NU5A 4GKBA 4U5QA 1UXIA 3CE6A 3I5MA 3GRPA 4LVCA 5EN4A 3BMQB 4XQCA 3O26A 4N54A 4M55A 2O50A 1EVIA 4IINA 4BNVA 3QVTA 4J91A 2B35A 4I08A 4GWKA 1DPGA 5JS6A 1WDMA 4NU6A 5KJ1A 3L07A 2EW2A 1OMOA 2AE2A 5F5LA 3T7EA 4MP3A 3FHLA 3NTOA 4GBJA 4J1TA 4XGIA 1CRWG 1T2AA 1PIWA 2O7QA 3ANLA 4GMFA 3TZKA 2X22A 1X0XA 1EBFA 1K6JA 4ND4A 4XD2A 3EVTA 4HBGA 2IXAA 4HKTA 1FK8A 4BNKA 3SJUA 1VJ0A 3ZNQA 3IUSA 2CUKA 3O03A 3AY7A 5A9RA 3MCVA 8ADHA 2I5PO 1PQUA 1YO6A 5JAZA 4MP6A 2J3JA 3AM3A 1E1LA 3NGXA 3ONFA 2B0JA 1HLPA 2AG5A 1KC1A 3F5QA 3GMDA 4DIFA 3DBLB 4H16A 4NFSA 4QO8A 5CHEA 1LSUA 2ZYDA 4JJFA 1BTOA 2Y1EA 1H5QA 3UOGA 2B36A 3BTSA 4YXFA 3RU7A 2Q4EA 5FF9A 4M49A 1UUFA 4J3FA 3UGKA 1EK5A 5TT1A 2NM0A 5JE8A 3W8FA 4A5OA 2Q1SA 3UKOA 4KTTE 4NNJA 3OBBA 1LDBA 2QYSA 3PHLA 5JBIA 4DGSA 3JQ9A 5G4KA 3OA2A 1NQ5A 1R37A 4G81A 4EEZA 1V3UA 5EIOA 3JQ7A 3WGYA 4DYVA 1BXGB 1OBFO 2IDZA 4J49A 2WMDA 4E2XA 1LDMA 2BD0A 4IPTA 3QWAA 4XDZA 3RUCA 3ZU4A 2AG8A 2J8ZA 3JQCA 4CMAA 4OSOA 2FOIA 3EK2A 2ZB3A 3VVCA 1EBUA 4XYEA 3JYPA 2CVOA 4KWHA 5THKA 5GZ6A 3ZCXA 3RI3A 4NBWA 4WLFA 1HKUA 1ENYA 1O95A 3T4EA 4CLRA 5C3MA 2Q2VA 1LTHR 1FMCA 4JX8A 3ZWNA 4OYRA 2D0IA 3NAQA 3EZLA 1XQ1A 4I5GA 1C0LA 4AJOA 2C5EA 4BNWA 4NMHA 1LDEA 1D4FA 3UHAA 3LK7A 4W7HA 4HFRA 4XJTA 4WK6A 3RBVA 1NPTO 3F1LA 1WP4A 2OL4A 1V0JA 2PR2A 3RROA 4F46A 4FIZA 5ENVA 2VRCD 3ZDFA 2ZKLA 3DTTA 3OQ6A 4RDHA 2C07A 3KYDB 1C3VA 4TWRA 3PYXA 3MJSA 1PJBA 5B37A 4BNXA 5JAMA 1I36A 4FFOA 4I5DA 3KEOA 1VI2A 3HUDA 1GUYA 2X0RA 4EYEA 3WG9A 2WD7B 4LCEA 4BO5A 1B3BA 2EIHA 4Y8VA 3QRWA 1LXCA 2FY8A 2X0JA 3KSUA 1RJWA 4PVDA 3OJLA 1E3JA 4CR7A 3PDJA 2QW8A 3DQPA 3EY4A 5K9ZA 4ZA2A 4CLXA 2DLDA 2PK3A 1QYVA 2Y99A 4YJDA 5L4NA 1ZJZA 4G2NA 5DNAA 1E7YA 5FYDA 4J1NA 5TX7A 3I9NA 3RBXA 1MXFA 5HTOA 1A4IA 1XWFA 2BGMA 4QUKA 3JD2A 5A3JA 4YRBA 1F12A 3D0OA 4YQYA 3C85A 3JCZA 4U0KA 3L6DA 1EUZA 4L4RA 4LN1A 1IZ0A 4J43A 3IDSA 4Y6PA 5IXYA 2W8ZA 2VHXA 3WSVA 4CUJA 1DBVO 4I5EA 4XB2A 5L7YA 4D79A 1PU2A 3GY0A 5ICMA 4BHTA 5A9TA 4CUZA 3BMNA 1F8GA 4BOYA 4Z3KA 2DFVA 1MC5A 4DIBA 4B4OA 2VWPA 3DDNA 1GQYA 2XOXA 2ZK7A 4XQEA 2O3SA 1QYXA 4LISA 5ADHA 1I01A 4B4VA 4KP7A 4Z0PA 1TXGA 3WXBA 2OBYA 3JQ6A 2QRLA 1K89A 4ND2A 2Y1CA 4UVEA 4E5MA 1IHYA 2NSDA 3GVCA 1PJCA 4BGIA 1A72A 1UDAA 1YDEA 2VYND 1GY8A 4ZQHA 1J49A 3K73O 1R16A 3LF2A 2CMDA 4BV9A 2I9PA 2JJYA 5CFZA 1FDSA 4F3YA 5CP8A 3TRIA 1VL0A 3S2GA 3TL2A 2EJVA 3WLEA 1MLDA 3SJ7A 4YAJA 5CDTA 4ZVVA 4XYGA 3OFSA 3D5QA 4WLVA 3V1UA 1WNTA 5ENDA 4N5LA 1E6WA 3BAZA 3VC7A 3GLQA 4HADA 5HA5A 3H7AA 5JNLA 5DBGA 3JQAB 1JWBB 3RUDA 3LC2O 2W4QA 5BSEA 4CMGA 3G0OA 4HFMA 1YOVB 3QW2A 3D4NA 5G0SA 3W6UA 2FHSA 2UVDA 3GVHA 3ORFA 4ALMA 6ADHA 2WJPA 2C82A 3IUPA 1HETA 3V5NA 4IM7A 4CLOA 2YW9A 1YBMA 3G1TA 4JJIA 1BW9A 4JROA 2NU6A 5KVCA 5IDYA 3MTJA 5JXWA 4BQPA 3U09A 1P1KA 1KC3A 3E5RA 3AY3A 4CODB 1ZUD1 5KKAA 2BF7A 3NDRA 3P7MA 4BNFA 5K6AA 1Z7EA 2NU9A 3EZYA 3VKVA 1T1RA 2AXQA 3QVSA 4BNJA 1UP6A 4XQ9A 1ISIA 3PHIA 3E82A 5JDIA 2GZ1A 2ZB4A 4L4XA 3QY9A 2BHLA 1SMKA 1L1FA 1ZNQO 4LRSB 3NEPX 2FR0A 4P8RA 3VHRA 3D5TA 1GQ2A 4IXWA 4II2A 5A05A 3L9XA 4IDCA 3WIEA 1PGQA 3WOHA 4NG5A 5T6BA 4JGBA 3A14A 4RF3A 4EJ6A 1PTJA 1ZK1A 3BTOA 4JQCA 1VKNA 5HRUA 4CR6A 2O3JA 3GF4A 3RIHA 3X2FA 4BO6A 4PCVA 3H5NA 2Y67A 3NV9A 4IDDA 4GSKA 4OKNA 1NAHA 4RVSA 2BI8A 1HSZA 2F1KA 2VN8A 3UVEA 3FNFA 1ADGA 4I9NA 5GY7A 1K0UA 4KUEA 4CM7A 1B3RA 2I3AA 3JYOA 2O4CA 4UAGA 3T4XA 1PZGA 4FFMA 1NM5A 4EJMA 1Q2XA 3PP8A 1G0NA 1UZLA 3I6IA 3GR6A 4B79A 3ROKA 4JLWA 1JKJA 1X7DA 5DOVA 3TZCA 1HE2A 1KOLA 2OFPA 5JCXA 1W8DA 4CMBA 1F06A 4GX0A 1ISFA 5IZCC 5BT9A 3CKYA 4FJ2A 4S1VA 3QLJA 1SCUA 5DCUA 4CL3A 2J5RA 2YYYA 3FPLA 4HFJA 4UULA 4XYBA 1EDZA 1R12A 3WQQA 4U8GA 3ZHXA 1HWYA 2VYVD 2BGLA 5DCWA 1DRUA 2YV1A 4ALKA 3RFTA 4LGVA 3UN1A 2WTBA 2D8AA 1QXSA 2FSVA 2HUNA 1GD1O 1EVYA 2EEZA 3O8QA 4FFNA 3UW3A 3BIOA 3AI3A 4XDYA 2BRUA 3I9KA 3NJ8A 2ZB7A 1YB1A 2J5QA 5AOVA 3GNTA 3LF1A 1I3LA 3FN4A 2Q45A 3KLPX 4B8ZA 4BV8A 1SEVA 3DBHB 5A04A 2A4KA 3OJ0A 3ROMA 4CV2A 1OOEA 3HN7A 1B2LA 2O23A 1NR1A 2X0NA 5T64A 4B7CA 4BO2A 5L4SA 1DFHA 3IQDB 1YXMA 2RBEA 1ZH8A 1LRJA 3PHJA 1WDKA 2PZLA 1ISHA 4XZ3A 1ZXBA 2YFHA 4TRJA 1LQTA 1PL8A 2HQ1A 4R51A 3BYZA 3JQBA 2VHWA 2W90A 1LSOA 5TF4A 2A9FA 4ZJUA 4RGBA 1PX0A 2AEMA 4QECA 4W7IA 1X7HA 2NTJA 3GAFA 4PLYA 4CM9A 1NVTA 2J6IA 3DWFA 1G0OA 3GVXA 4AVYA 1YRLA 3ZN2A 3DZBA 3DFZA 1AXEA 2H1SA 2HDHA 4J7XA 4WECA 2HKIA 4XX0A 3VTFA 4FQ8A 2CVQA 2FRDA 3U0BA 4RJTA 4AL4A 2LDBA 4PZDA 2J5KA 2V65A 1VLLA 4PLWA 2YHIA 2AHRA 3WWZA 4Y9DA 1YQGA 2RH4A 5JC1A 1KETA 1KBZA 5L51A 1HYGA 4JBHA 4NBUA 4TQGA 4ND1A 4E6PA 2YZ7A 3PTZA 4BNUA 4ZICA 4Q3AA 1H93A 4RDIA 4DREA 2CVZA 2QZZA 5AVOA 2GN4A 3ROQA 1G6KA 4D0RA 1GPDG 1UXKA 2O3UA 4CR8A 3WR5A 3ZHBA 4FOOA 1G1AA 5ER9A 4DMLA 1R4NB 1ORRA 3EHEA 4DQXA 1U3VA 3LVFO 3MZ0A 3PEFA 3V1YA 3VZSA 3LT0A 1ZBQA 4HNHA 2BELA 3ZU3A 3QP9A 2WE8A 4MVJP 4ZQFA 5DF1A 4YCAA 1ENOA 1M67A 3VH3A 4A2CA 1U8FO 3RKRA 2GGSA 1W4ZA 1PZFA 3L77A 5TLSA 3E9NA 5TT0A 3TPCA 3ZWOA 3PGJA 1HDGO 4R1SA 4W82A 2VHVA 1R4MA 3AUSA 3GA0A 3RJ5A 3CSDA 4IGFA 4PLPA 1DIGA 1E1KA 4NH4A 1LDGA 3GN2A 4TZTA 4DXHA 4TVBA 4ND3A 3L4BA 4KQXA 5T8KA 1H0KA 5CPBA 3WX0A 3KHUA 1SPXA 1N9GB 4FJ1A 4TKLA 4NDNE 4I9HA 1HRDA 4N5MA 3KYCA 2YDYA 4MPDA 1L7EA 1Q7GA 2VUSA 4BO7A 4F6CA 5CG1A 1YH3A 3HN2A 1IPEA 3ITDA 5KJCA 2NVUB 2JHGA 2W2KB 2IZZA 3H4VA 3PYMA 4FC7A 3FBGA 1ZK2A 1PJSA 4IDBA 4GX1A 3BHIA 2HAEA 1EK6A 4NFHA 4CM4A 2H9IA 4B7UA 3BTUA 3OEWA 5CEFA 1NX6A 1PL6A 3WGZA 3DZKA 2WYVA 1PWZA 1WZIA 3NGLA 4K26A 4BNZA 3PQFA 1YKFA 3E9MA 5TNXA 1WXDA 4GWGA 1D8AA 4TROA 4DPKA 3L9WA 3OHSX 4BKPA 3JQFA 4B8WA 4RPHA 3AWDA 2Y1FA 4I5FA 1GTMA 2C0CA 5K0ZA 4AJ4A 3JD1A 3TZ6A 5A9SB 1X0VA 1HE3A 2ZCUA 1BWSA 2JFHA 3RC7A 2CD9A 3JD3A 1HEUA 4ZU3A 1K5HA 3R0IA 3I9LA 5G0VA 5KVSA 3ZI0A 1C0IA 3RUEA 5KCZA 2NVBA 3FR8A 1PWXA 1E7WA 3JQGA 5H83A 3VZPA 1DSSG 1E3SA 1P33A 1BG6A 2IYPA 3K96A 5HWSA 3W8DA 4CMEC 3U3XA 1E6EA 2NNLD 3PI7A 3GFBA 1R15A 1X1EA 4CPDA 1D3AA 5B4TA 5HM8A 2PKQP 4W9NA 4A0SA 3KRTA 5F1PA 4A10A 1NBOA 1R6DA 4AICA 1P9LA 3GHHA 5BR7A 4RF5A 2ZTUA 4YQZA 1OC2A 4CQLB 3HADA 2B5WA 3N74A 1WZEA 2Q1TA 3C8MA 3DEYX 1Q1NA 3A4VA 3CZMA 3HB5X 4IS3A 3CZRA 4D45A 4L9RA 1LUAA 2H5LA 4IDAA 4AG3A 2C2XA 4OIMA 1VSUA 4ALIA 2EP7A 1DFGA 3PPIA 1AXGA 2WWRA 5G0WA 5JLAA 2ZTMA 2EKQA 3QIVA 1NQTA 1Y9AA 4BIIA 3BMQA 3MJCA 2VNSA 3P2OA 2FR1A 4XYMA 1IHXA 3I83A 2DM6A 1R0LA 5JC8A 1EDOA 4EUHA 1HL3A 5COQA 4U7WA 1KYQA 1E7SA 3DFUA 1RM0A 1KS9A 1JAYA 4RO0A 3U4CA 3E5MA 3S55A 4D0SA 1WAMA 4GVLA 1P44A 4UEJA 3MJEA 3ADOA 4LCJA 2NADA 3F5SA 3IS3A 4R3NA 3G79A 4RVHA 5IDQA 5EPOA 3O38A 1VJ1A 1XU9A 4LRTB 5DP2A 4J2HA 1JU9A 3VOSA 4ZGWA 1GEEA 2VQ3A 1YONA 1X7GA 4CL8A 2NTVA 3KEQA 5DBIA 4XIYA 5FWNA 4C7KA 3RSHA 3W4IA 1B7GO 5L95A 1UZNA 1H6CA 4PLGA 2DTEA 1H6BA 4LK3A 3MJ4A 2PGJA 1OZAA 2Q99A 2XAAA 3U4IA 4YEDA 3RKUA 3LC1O 3UH1A 5IN5A 2AA3A 5AXCA 2R00C 3OQBA 4FFRA 1IZ9A 1QLHA 3OEYA 5KIAA 3V2HA 3I6QA 1A9ZA 4IBOA 4JIGA 1I2BA 3NDIA 2O2YA 3RUHA 3OM9A 2VWHA 4WLUA 3VH4A 2PV7A 3DOOA 5CEJA 1SO8A 3LLVA 4R69A 1XCBA 1EZ4A 4FSHA 4BMVA 1NASA 5I8WA 5ER6A 1F14A 1H6DA 2RIRA 5IFLA 1DOHA 4CM9D 1NFRA 1JA9A 1GCOA 1U3UA 1BXGA 4OH1A 4GGOA 2GRAA 1XSEA 2VWGA 1B8VA 2UUPA 4YAGA 2SCUA 5JW6A 4BGVA 3NT2A 1DC3A 1P1JA 2B83A 2NVWA 1KY4A 2FMUA 2C2YA 1VRWA 2D2IA 2GZ3A 3GEGA 2POQX 3ZW8A 4N7RA 4O0LA 4YACA 4EEXA 3U49A 1NWCA 1UAGA 2TMDA 3M2PA 1GDHA 1TEHA 2DQ4A 3ZWPA 4J7UA 4YT8A 2ZYGA 1PJTA 1KEVA 3GC6A 3JV7A 3N7UA 1JDJA 2JHFA 3IAHA 5J23A 2JFFA 2X5KO 4D7AA 2X9GA 1C1DB 3QWBA 1YVEI 4BO1A 3F47A 4M89A 4RVGA 4JNKA 4W99A 3KYDA 4WNCA 3PJFA 3FNGA 2IEDA 3AM4A 3W1VA 2HMSA 4NIMA 4PG4A 5H81A 4PLTA 2X5OA 2E48A 2GZ2A 3U9LA 5TRTA 5C7OO 2WD7A 5KJFA 1O9BA 1ZW1A 2IXBA 1X13A 3INGA 2CFCA 2DU8A 2EWMA 1DJNA 4GX5A 1I5RA 4XIJA 4J4HA 3KB6A 3P5SA 3QV1A 4J2OA 4PLVA 1ULUA 5AYVA 2NV6A 3ULKA 3P19A 5JCJA 3DBRB 1N92A 3C7DB 1DRWA 5C5IA 2P9CA 3D7LA 4IQGA 4M54A 4GX2A 3JQ8A 1I3MA 4UVDA 2Y0CA 3STHA 3A9WA 1U7HA 3NKLA 1O6ZA 2DUUA 4Z9FA 3AOEA 3HFGA 1DO8A 4XGKA 1VKOA 3ZV4A 4NK4A 5CDGA 1A5ZA 4RV9A 5EERA 4YYZA 3C7AA 1O94A 3B70A 2VT2A 5I8ZA 4WCFC 2O7SA 4MVJE 1WPQA 3I23A 3RFXA 4DLLA 2J3HA 5I9LA 2PD3A 2OMEA 1KIFA 3C1AA 4ALNA 2QQ5A 4O5OA 1IUKA 2EJWA 5EQDA 4CV3A 2IODA 2UUOA 4D41A 4FCCA 5DP1A 3FF4A 1XLTA 2J3KA 2TMGA 3FRJA 3R3JA 2GO1A 2Y66A 3RUFA 4A73A 1NVGA 1KVTA 3DMTA 1T2EA 4CLHA 1FXSA 1VL6A 3L4SO 4YT2A 1I3KA 1MP0A 3OH8A 4ALJA 2W2LA 4OHUA 4Z0TA 5G4KB 2G17A 3GZNB 3RD5A 1J6UA 1SC6A 4IJVA 3ICCA 4ZRNA 4BKOA 1O0SA 1Y7TA 4P38A 3VZQA 2O3TA 3MOGA 3JQ7B 4ROSA 4K9DA 2JKVA 3I9JA 2PNFA 1ONPA 2ZTVA 4IMRA 2IRWA 3ZZNA 1YDWA 5BNIA 3QVWA 1PL7A 1QR6A 4XWYA 4S3MA 2GSDA 2PZJA 2GERA 3DZIA 3C3XA 3PDUA 3RFVA 1HDZA 4GKVA 5U4QA 1Z6ZA 2WYWA 5TJHA 4BMNA 4DYDA 1VC2A 4A7PA 2RCYA 2I76A 3ZW9A 3CH6A 3GRKA 2OZPA 1XIVA 4J9VA 4DPLA 3H65A 4OJNA 1W73A 3WSWA 3GHYA 3EYWA 2FPPA 1MX3A 5GMOA 2R2GA 1BDMA 2IE0A 2O3QA 4EUEA 4MINA 2OXIA 1O5IA 2J3IA 5L40A 2EP5A 2O2SA 2CZCA 2GPTA 1PJQA 1ZSNA 4EJ0A 3AW9A 1DFIA 1ZK0A 1YOVA 4QQRA 5HS6A 3DBVO 4P4LA 1QYCA 3VH1A 1IE3A 4FGSA 2Q2WA 4R41A 3QA9A 1SEPA 1U4SA 2P5YA 3AY6A 3BHJA 1LI4A 3LLSA 1ZXLA 3EUWA 1W6UA 3F4BA 3GVPA 5JMWA 1I2ZA 4YB8A 2DVMA 1DAOA 2JCXA 4DL9A 4O63O 1NPDA 1NAIA 2GN6A 4UEKA 4TVOA 1P0CA 1P3DA 1DC5A 1T2DA 2OOSA 4FFPA 4N18A 1ISMA 4WLOA 3WYEA 3M1LA 4CQMD 4E0BA 5F1OA 5JDCA 4FJ0A 3A06A 2X86A 3IOYA 4CM8A 4CMCA 3KSDO 3RC9A 1Z45A 4WLEA 4JK3A 4BKUA 1KY5A 1N7GA 1ONOA 3OECA 2X9NA 3I1JA 4D3DA 4WOJA 3HB4X 4RL6A 4EZBA 1JTVA 1VL8A 2Y1DA 3K92A 1TT5A 2EW8A 4PRKA 1LSSA 3EAGA 1LSJA 3ANMA 3O9ZA 1YWGO 1K2WA 2QX7A 3VPGA 3NTQA 2OP1A 3OQ1A 4QFCA 3MOIA 3ZGYA 2WSBA 1I2CA 3QHAA 1YBVA 4BGEA 1TI7A 3ENKA 4EW6A 3OMLA 1T2FA 1E5QA 1JVBA 1QYDA 1UXJA 3WBFA 4WUVA 1BXKA 2YUTA 3BMNB 4O6VA 2HRBA 3KUXA 5G0TA 4OAQA 3K6JA 5A02A 4XB1A 3BZUA 5B1YA 1DAPA 2OP0A 1R0SA 5DBFA 3IJPA 3WJ7A 1GU7A 3L0DA 5BQFA 3ON5A 2QZ9A 3ZNPA 3UCXA 3DHYA 1ISJA 3BMOA 1AE1A 1ZSVA 1J4AA 4J1QA 2O4UX 1JLLA 1YJ8A 2NWQA 3B20A 3K9QO 5JO0A 3PFWO 3B6ZA 4NPCA 2VZ0A 4I8XA 1N8KA 2ZATA 1I33A 2HJRA 2ZJ0A 5ES3A 5B4UA 1BMDA 4D3SA 3BA1A 4BUCA 2VT3A 4Q39A 2EG9A 2VUUA 1NTOA 3KYBA 4M8SA 4OKIA 1ADBA 2GUGA 4YJFB 4GLOA 3RAJA 2GLXA 3HQ4O 3F46A 1EE9A 1Q7CA 1I30A 1LX6A 2C54A 4IJWA 5DN9A 4UVIA 5L45A 4NR0A 4OQYA 1WLYA 4L75A 1BGVA 1B8UA 1RM3A 1DJQA 5AXDA 3GDFA 5JFOA 5JAQA 1Z73A 3H2SA 3FNHA 2QRJA 1RYDA 1E7RA 3B1KA 1MC4A 1Z74A 1ZEJA 1P1RA 4M87A 3H5AA 4WEOA 3VTZA 3DBHA 4LSMA 1W0CA 3COSA 2PGLA 3GEMA 3I3OA 2P9EA 1LRLA 8LDHA 3JQ9C 4E4YA 2ZQZA 1GYPA 4JP3A 2ZIZA 2I67A 1EEHA 3U4HA 2EGGA 3AOGA 4L76A 3TF5A 3DONA 3PVZA 4AJJA 3QJ5A 5DULA 3ONDA 1EVJA 2VHYA 3M6IA 4R1NA 3QWHA 4H3VA 3V1TC 3GUCA 2BFAA 3I9OA 3WGQA 5C37A 1ZCJA 4FGWA 3JD0A 2RHCA 1TVEA 3WTCA 1HF3A 1N7HA 1T4BA 3F3SA 1DHTA 2DFDA 4BL5A 3B1JA 1IULA 4HP8A 3PWZA 2EKLA 3WNVA 3PQEA 3G49A 2BFMA 4J90A 4AJ1A 1Y8QB 3L6EA 4G65A 4BMSA 2CSUA 1SZJG 1U4OA 2DTDA 1ML3A 4HFNA 1YE3A 1JKFA 5JSFA 4YJGB 5BSGA 1PGJA 2A94A 4JCOA 5THQA 4IMPA 3CPSA 1I0ZA 5EESA 1ADFA 2C59A 3INTA 4MVJA 2VZ9A 4YVFA 4ZQBA 1M6WA 5L7WA 4ITUA 1S7CA 4AJPA 1OAAA 2HMWA 3R1IA 1C0PA 4OQZA 5A06A 5I7VA 1R4NA 5TIIA 1C1XA 1NP3A 4YJHA 4BO3A 2DTXA 1P31A 2P68A 1OI7A 4PN3A 5IF3A 1Y8RB 4MKZA 3IIEA 5BNFA 4QX6A 5KJEA 1OFGA 4P4NA 1N5DA 1ONNA 4RVUA 1XQ6A 1UAYA 5A1TA 3LSYA 4K1LA 2Z1MA 4R16A 3HHPA 5LDHA 4QFDA 1LU9A 5JPIA 1H94A 1GL3A 4HXYA 1IL0A 5BSFA 4WNIA 1E1MA 4FOSA 5IZ4A 3DR3A 4Q3NA 3CXRA 1IB6A 4E13A 3CEAA 2FN7A 2PKQO 1N9GA 1VM6A 2H6EA 4KDEA 2OGUA 4UUPA 1EUCA 4Y6RA 2VCYA 2FPGA 4GAEA 1JAXA 1Q7BA 2HK7A 4YAIA 5FFFA 2NVUA 5IJZA 2W2KA 4RQTA 1PGPA 2JAHA 4BNLA 1DIHA 3OICA 3SC4A 4BNGA 4DBZA 4P4GA 4IQ8A 4Q3EA 3WS7A 5IN4A 1PJ3A 2DBQA 5IAAA 2Y68A 3IL2A 4MP8A 1HYEA 2I3GA 1TLTA 1EMDA 3E1KA 5B4VA 1PJ4A 4EGFA 1MXHA 1Q0QA 3TNLA 1MB4A 3ONEA 3I4FA 4BKRA 3GT0A 1YB5A 4D43A 3M2TA 1YL6A 1N2SA 2HK8A 1WWKA 1D1SA 3DL2A 1DB3A 3QVOA 2FR8A 1KVSA 5LC1A 2PH3A 4XGNA 4Y98A 4L0QA 5A9SA 1MV8A 3GOHA 1YGYA 2AQHA 3HE3A 2CY0A 3GFGA 1SOWA 1NWHA 5H82A 1H6AA 1E5LA 4PIVA 1XR3A 4J6FA 1X14A 4JBGA 3SXPA 1WW8A 3BTVA 1K3TA 1T26A 3AU8A 3IJRA 3D3WB 1ADCA 2YJZA 3H8VA 2FZWA 2QRKA 3QVXA 1HZJA 3ZWXA 3WQSB 2FPIA 3OF2A 1LLUA 1RPNA 1JQBA 1YS4A 3ZNNA 1HSOA 1HZZA 1GUFA 1UZMA 4GVXA 3TOXA 4WLNA 1DLJA 4R3WA 4Z9XA 2NUAA 5CDUA 4MVJG 4CQLA 4NQZA 3H9QA 2FWMX 2B4TO 4OXNA 1M6HA 1HYHA 2AW5A 4C4OA 4MVJI 3FTNA 3GZ4A 5COBA 1T2CA 2PKRA 2B4RO 4IUYA 3CTMA 5CG2A 1MFPA 1QMGA 3WLFA 2Y0EA 2GYYA 2HSDA 3AI1A 3ETEA 1DC6A 2JFGA 3WTBA 1M2WA 3RJ9A 1TA4A 4CMIB 5K6AC 1LQUA 3KV3O 3UF0A 4A03A 4DWVA 4FN4A 4GSLA 5JDIC 5I7SA 1E3WB 3AFNA 3PK0A 1FDTA 1ZK4A 4D44A 5JY1A 4LVUA 1HXHA 1X15A 3Q2IA 1O89A 3H9EO 2IEBA 2X1HA 1YJQA 2IZ0A 3FNEA 2VOJA 4J16A 1QKIA 1V9LA 1PZEA 4E2WA 1GV0A 2YV2A 3QSGA 4DC1A 5U1PA 3BHMA 2OUIA 1P74A 2PLAA 2Z5LA 2YFQA 3KYCB 4KOAA 4QEDA 1GPJA 3E6AA 2X23A 4ONEA 4WJZA 1E3EA 1KVQA 2BFPA 1HTBA 4YWJA 1KEWA 1U5CA 1H2BA 1L7DA 1JN0A 3NTRA 3OETA 2JD2A 1ENPA 4FW8A 4WCFB 2DUWA 3SC6A 4CM4B 4DC0A 4XRGA 5DCYA 5I7EA 3SLGA 2Y0DA 1GYRA 1XGKA 1S6YA 4LMPA 3TSCA 5JY6A 4I1IA 1D7OA 1CQIA 3V2GA 4E12A 1PS8A 1CIVA 1NHWA 4RORA 2Y93A 3HNPA 3LU1A 4B4WA 4YT4A 5I9MA 5KNLA 4DRYA 1Y1PA 3IP1A 4Q9NA 3KLMX 1WMAA 4YDRA 3HZZA 3K31A 4WCDA 1U1IA 3TFOA 3OIDA 2VRBA 2NU8A 1IY8A 4E2YA 4F6LA 1V8BA 2GN9A 4JBIA 4MOWA 1GV1A 3SLKA 1NYTA 3GEDA 3GAZA 1U9JA 3RWBA 4DMMA 2H63A 3GNSA 3I4CA 1E3LA 2RHRA 4NJOA 3H9JA 5IG2A 3BMCB 5DZSA 3JSAA 3KO8A 1UXHA 2GNAA 3KM0A 2VYNA 2V7PA 3VAZA 4YRAA 3WQRA 1HDRA 1UDCA 2CDAA 3OP4A 2GCGA 3ST7A 2HO5A 3DAGA 4Z6KA 4NBTA 1GZ4A 4LMRA 2Q46A 3W4JA 2W98A 2EHDA 4YA6A 1Z75A 3MWDB 3BXXA 2DKNA 3EW7A 3Q11A 1NHGA 1WDLA 2NLOA 1SAYA 4DQUA 2V6BA 3DO5A 4IXTA 3QWIA 1CF2O 2VWQA 4ZQEA 2QHXA 3I52A 5L53A 5MGBA 3VH2A 3DBLA 1PR9A 1E7MA 3FSRA 4OM8A 1KERA 3KBOA 4E5YA 1ZZEA 1GAEO 2P2SA 1B26A 4Q3DA 2DBRA 4RF2A 4J4BA 1K6IA 5DT9A 3JQBC 4GQAA 5FI3A 4NI5A 4Q3BA 2JL1A 1Q0LA 2CF5A 3ZWCA 2Q1WA 1Y9EA 1YB4A 3W8EA 4E31A 1C1DA 2XPCA 3H9UA 2RAFA 2D3TA 3NJ4A 3HG7A 3RUAA 4Z3DA 3WYCA 1QV7A 3FTPA 4J4TA 3JYQA 4BNHA 1JW9B 4FDAA 5KTKA 2NACA 4PRLA 3Q9UA 2GF2A 2BKAA 2C7GA 3RCBA 4CQMB 3WWYA 4YTEA 4MKRA 3R3SA 4UUOA 4CMJA 3ETGA 4AJNA 3OA0A 1BRMA 4H7PA 1PGNA 1CJCA 1HT0A 4IZHA 1ZJYA 3HSKA 4IGEA 3TQHA 2Q4BA 3G1UA 3GUYA 3ZWMA 2WEKA 3WBBA 4ZRMA 2GDZA 2HU2A 2Q3EA 4ID9A 5I7FA 3VDRA 5LDGA 2WM3A 2WE7A 4NJMB 1QG6A 3DBRA 2PD6A 1Z82A 2CDBA 2QG4A 2AEJA 1CYDA 1DDOA 4Q3CA 4QXMA 3JD4A 2GD1O 2E6UX 2BI7A 4HNGA 5AQ1A 3WIDA 4EBFA 4RQUA 4J1SA 2VHZA 2PY6A 1ISGA 3OSUA 1VJTA 5KKCA 1XU7A 4GI2A 3AJRA 4UEOA 3OIFA 5BNTA 3LT1A 4A26A 1QSGA 3QE3A 1PZHA 2I99A 3UAGA 3ETDA 2VOEA 4EI2A 1JWAB 2XF8A 2AQKA 2EF1A 3S1LA 4AFNA 4BGUA 1A7KA 1U3TA 3PZBA 3RVDA 4DQVA 1NFQA 1U7TA 2BMAA 3SBOA 1E6UA 2PD4A 4BNTA 4PG8A 5A3VA 3CINA 1PJLA 3VPSA 4QTZA 4ALLA 3WYBA 4DVJA
chains in the Genus database with same CATH superfamily
4RLHA 2PKWA 5AVXA 5ED4A 4BXOA 2BJVA 1O57A 4MVJM 4ER0A 3KPVA 2BGJA 4K9NA 2AEFA 2Z6UA 3A9UA 1IK6A 2F9MA 2OLJA 1ZD9A 2F00A 2GEBA 1NLMA 3E7XA 4N6OA 3FPCA 3INNA 4NYJR 3OFKA 4Y9UA 5T8KC 4REQA 2W4MA 1J9ZA 3A1NA 1YHYA 5BYAA 4DS3A 2WQZA 4PPGA 3R40A 5E6SB 4EYOA 1ZZGA 4ETIA 2NMVA 2W2PA 3T9DA 5M5BA 3ZVRA 1PJ8A 1TRKA 3HCBA 2P6NA 2G07A 3O1IC 3FNIA 4C14A 4CLDA 1ARZA 4AY3A 1Z68A 4ACAA 1N0UA 2KWIA 4C4AA 3JR3A 1PSDA 4KFRA 2UKDA 2P77A 4PICA 3ZV5A 4Y2SA 3EZ6A 3VDQA 3AVVA 4DJAA 3TLCA 2PGDA 3ADPA 2V9ZA 3OT1A 1QFYA 5K4HA 1YL7A 4D6PA 4H4DA 4AJLA 3IIKA 4MDHA 2B5VA 1KWGA 1ACJA 4MIYA 2AMVA 1FQKA 1N1EA 3S2UA 2FDCA 1EUDA 3TG2A 3MJTA 4BBAA 3BWVA 4XEHA 3DW3X 1MEEA 3HCDA 4G4SO 4XR9A 3LHFA 2YJ5A 4EMUA 4HVLA 2XRMA 3MJVA 5F5XA 4BNYA 1NG9A 1G8KA 1WXWA 3JQFC 1Q0UA 2B6HA 3FJOA 4RENA 5A62A 1QFMA 3AUUA 4ZIRB 4CXMA 2WD8A 2YBEA 5EJIA 4X3OA 1LW7A 3FR7A 1W19A 1GRQA 1LB1B 3CJQA 3ILYA 3NEYA 1FQJA 1YT5A 4P82A 4RD2A 4URFA 3RS8A 3THRA 1ZD2P 3IRVA 4ZXFA 4JLBA 4AY2A 4ZHSA 1YJ5A 4AWXA 2I4MA 1U8XX 2XCOA 4X8HA 2EXXA 3CMCO 1WMEA 3CIOA 3W5DA 4KO1S 4UVHA 1AQUA 1M2OB 1XELA 2HCJB 2VEOA 4E14A 1TAGA 3NC4A 3D5EA 3T06B 1Z8DA 1QQTA 2WSSD 3UXYA 3TRHA 2P3OA 3G17A 4JU8A 2UZ1A 2VJYA 2ZJ7A 3Q2KA 3L4KA 4N7JA 3AMVA 2JGIA 3QFRA 5E0OA 4D8XA 4EJSB 3J81A 3I5XA 1JH9A 3BIFA 5JAIA 3KKQA 2UZ3A 4UQOA 3U39A 3T3OA 2PX0A 3HWRA 5CW1A 3RYCB 1A8QA 4HNQA 4LZJA 2YQ5A 1IEQA 2QTBA 4TTRA 3IDOA 4HN9A 2WJVA 2FSGA 5E7QA 4D26A 3A3OA 5KOJA 1N6NA 4PLCA 5CPFA 3W6ZA 1OGJA 2NGRA 2WDPA 5IJ9A 2DXIA 3JQ8B 1HRKA 2WJJA 3LZCA 4TZKA 3WBJA 4CLRB 4KBGA 2XXJA 1ZJ5A 1WHTB 3CUKA 4BO9A 5DOZA 3A2MA 3ZH2A 1I1HA 3GEIA 1JU4A 2NQ8A 3JAKB 4HNAB 2Q28A 4K8OA 2C57A 1D9XA 1W88B 2G82A 2E0IA 4HWSA 4ZV9A 1WNFA 1EI9A 2VPIA 1AUXA 1J0XO 2X2PA 2XADA 3D59A 1RPTA 2XBLA 2I6GA 1CRZA 3QA3E 3TRFA 1SOVA 1Z6AA 2GSWA 1E8MA 2DFNA 3TJZA 4OV6B 4IVRA 3FWNA 3KAQA 5ESRA 4RY9A 3PGKA 4RAQA 1EE2A 1XUOA 3IKVA 4Q02A 4X7MA 1M7BA 3THYB 2BISA 2R7KA 5IXJA 3PDHA 3IH5A 3NC1C 4QQKA 1FLNA 4W8HA 1J8DA 5A6SB 3O6VA 3K6SB 1E2KA 3WISA 1PI3A 1NFFA 1U2PA 3LC0A 1NXVA 2Y27A 3WDSA 4EHJA 4GRAA 1QDEA 5TEWA 4BJ6A 5JHGB 1SWVA 3KHSA 1EQ2A 4K0KB 1KJJA 3RT7A 4RKEA 5EQTA 2H18A 1SOUA 1WCIA 4L5JA 1N6OA 1R66A 3SSNA 3TMKA 5I7HA 3A6PC 2OBNA 2VSXA 3MAJA 2O5CA 1IXKA 4OOFA 2V7QA 5CDSA 1IOLA 1OQAA 3KOYA 4MHSA 1E64A 3O47A 3FDXA 4JN6B 5AJTA 2AUTA 2IXDA 4KPUB 1JDPA 4Y2QA 3B8HA 4IX9A 2WF8A 1HURA 4XJVA 5I9BA 4YRDA 1ZL0A 2MOKA 4OB7A 5I5GA 1MB0A 3KELA 5GVRA 3WGTA 4CM1A 3X1ZA 4AUEA 1MOPA 1ZISA 5FTNA 4B45A 3O95A 1Y3HA 2NO1A 3PNBA 3ME5A 2IYOA 2FB9A 3BN3A 5LMZA 1HDOA 1ZY2A 2GBPA 3PIIA 5E4FA 1IUNA 1JG2A 4NU8X 3UQZA 2H16A 2P2GA 4IW3B 4GD3Q 2PZEA 4PE5B 5ECDA 4MS4A 1YQWA 1S2OA 3B8EA 3L8EA 4KNYA 2XCUA 4W8GA 5DIFA 4RGQA 1XK6A 4YPOA 5JPDA 3FWZA 8AT1A 3T7SA 3Q9NA 5EQJB 2VDKB 2FPOA 1Z17A 3AH8A 1I80A 4X1IB 2YWDA 2WM9B 3S7TA 2PCLA 4XOIA 4UUNA 3UG6A 4AKEA 2BCJQ 4D5GA 1M6EX 2VJNA 5FEUA 3D2CA 2OXEA 1AV6A 4OXKA 1GTSA 4MWEA 5SY6A 2ZTLA 4YCCA 1XRNA 2OCDA 2ZAMA 4S35A 3Q8KA 3FLMA 2D1SA 5CTJA 2I2BA 2YWRA 2C92A 2QVGA 5SZJA 2PUFA 1PAUA 3HXMA 1TZCA 4EGSA 4QM7A 2JLAA 1GJRA 3ACCA 3SOPA 4O02B 1PZMA 1BMTA 2HLDD 5I7OA 3N70A 2JIMA 5IDXA 1QH9A 2JJMA 5HF8A 2OGTA 4IJKA 3K0SA 1GRVA 3FDFA 2AQ8A 4F9GA 3G3EA 2Z95A 3TXYA 3DLPX 1MA0A 2RIPA 1QIGA 2YY6A 1TE2A 1OJ7A 3OUUA 4TLCA 4TMFA 3B36A 2XXAA 1NVVR 4MR8B 1E3DA 3PDIA 4PTYA 1T1JA 3I2YX 1LV7A 4TUYA 2M9MA 2B30A 3M4XA 2H0RA 1T8UA 2ZREA 4L73A 4W1RA 4ZOBA 2ZJ1A 1QYIA 2F6RA 3F6PA 1CU1A 5TQ0A 4GPD1 1G5TA 3ZV6A 5C8YA 3QPWA 4Y2GA 4ENRA 2I6QA 5DGIA 4GL2A 1Y81A 1J5XA 4JL5A 2NU7A 8MHTA 2YWJA 4FGLA 3TLGB 3NBFA 4A27A 1TTHA 3DWGA 1DX4A 2W7TA 4BB0A 1VMDA 5IXSA 3HXKA 2BFBB 3ROPA 2PT6A 2V1XA 2YVUA 1NNSA 1V45E 3F4KA 2XVYA 5JVDF 1UBOS 1OC4A 3UJNA 4ABTA 4AKGA 2X8JA 2N42A 2I3DA 3DTYA 3EWIA 3LC7O 1OWNA 1YNSA 1ZCAA 1GPLA 2VTEA 1E79D 1RZRD 1YCGA 2ZBVA 1XTQA 4CLOB 1AS0A 2G0NA 1US8B 4X54A 4XKJA 3BWCA 3GAAA 4HNRA 2JGDB 4F5WA 3PLNA 5DGTA 4PZEA 3W7BA 2ZFUA 3FDIA 3LFTA 2K87A 1LQ2A 4DY6A 1CUHA 1MG0A 2R6HA 4KPYA 3MLAA 3L8FA 2GPJA 2H2AA 2X0FA 4EQZA 2QP3A 1L7QA 4CCYA 1W6RA 3JYLA 2NU9B 1A1VA 1WLSA 2XE4A 4LBVA 4DA0A 4ZAZA 3VZRA 4I36A 3SLRA 1JLLB 3K05A 3CBQA 4QUDA 1KFKB 3TTWA 3N86A 4YMIA 4HEA6 1H66A 5LJLA 2C83A 1C2YA 2I8LA 5IUNC 3A1WA 1HQYE 4R1UA 3TI9A 4MKGA 4G8DA 4XIFA 2P9GA 5JWOA 4U7DA 4Y7DA 1TO1E 3CT6A 3FAZA 1GGKA 4EHNA 3MJDA 1NZJA 2FK7A 2NNWB 3PXEA 1C4OA 4N4AA 3Q7EA 1Y5MA 1WUYA 3AU9A 5KWSA 4J76A 4RZQA 2OFFA 3AUYA 4X1OA 4Q4JB 5TC4A 6REQB 4IEIA 4HQ0A 1S8OA 3ZHQA 2XD4A 2HQBA 5DN6A 2L2QA 4WJLA 1Z36A 2QMHA 2XUGA 2W42A 4EVIA 2NV0A 1F4VA 4M0PA 1YL5A 3R9WA 5DHQA 1XZLA 3DZJA 2HJSA 1GNPA 1L4KA 1NQOA 721PA 4BO0A 2HPVA 2HQOA 2QQ0A 2G6BA 4X24A 3FOEC 2AN9A 1IVYA 3HJAA 4PO3X 1IN4A 4J9UE 1N6IA 2ZUSA 1DO2A 2KYRA 3LQRA 4R5HA 1XCOA 1C9MA 3QPUA 3EDMA 4MO2A 5DGXA 3D3JA 3L0SA 3W77A 3WGHA 1BJKA 1M2FA 1MB2A 3V4ZA 4IGAA 3RGWS 1AUPA 3LUBA 2GEKA 3FGNA 2W2LD 1G2PA 2D1YA 2DHDA 5TS3A 3V7NA 1XPUA 4GECA 3AF6A 2LRHA 1ORIA 1YB2A 2VFAA 3ASVA 2CDNA 4D4LA 3NEJA 2A35A 3EPLA 2FW8A 3H1EA 2HLPA 4W9RA 2DUMA 1MAHA 2IF2A 2NXCA 4M86A 5BN4A 4QXOA 5CCBA 4MCJA 1F4LA 2DC1A 3IEIA 4YAWA 1TJNA 1U9YA 4QXAA 5D8DA 1YQUA 3H18A 3JYNA 2DJIA 3PEWA 2WG0A 1KJIA 1B14A 1CR4A 4GBGA 1Y3CE 1PWHA 4R98A 1BKDR 1WB6A 2PGNA 3TR5A 2INGX 1FFHA 1FUUA 3ZBUA 1D6MA 1NXQA 2P4HX 4WPGA 5KX5A 3F74A 5CDHA 1TYBE 3K20A 1MAAA 3SEZA 4HF7A 5KOIA 2BMJA 3ZCVA 4HN2A 3QMVA 4I9GA 4D4GA 2XCLA 2QRZA 2JHCA 3ABIA 5H02A 3H3XA 3E23A 4XR4A 3TE7A 1E77A 3PC8C 1CEQA 1Y4SA 5DX0A 5HZMA 1Z7BA 2IUEA 2LCIA 4WZBA 4ANFA 1JYSA 2FEWB 1E7QA 2GJ4A 2J5BA 1W2GA 4RETA 2QLJA 5TMDA 4KREA 2AOTB 3G2NA 2CJWB 3KVYA 1FL9A 4RNCA 3WGOA 1K8ZB 1C0KA 1RKQA 1CXZA 3D7SA 1V4VA 2FN9A 2V6GA 3QU5A 1Y6JA 2Y05A 3EGXA 4R83A 1DIBA 1K7YA 1LVUA 5CA0A 3UWOA 3II6X 2XUDA 3G89A 2ZE8A 2FPSA 4JUFA 5F12A 4JYZA 3GCXA 4IJ6A 3KETA 4GT1A 4CM5A 4ZMSA 5H70A 3GAMA 1N2CA 4WBNB 1YQXA 5JDCC 1RLUA 3D0RA 1AHHA 4M4SA 3RRJA 1N2EA 2Z9BA 4MZDA 2R68A 5JSYA 3UCFA 1ODSA 2CLHB 1QHYA 5EVCA 5TPZA 4O2LA 3TZHA 4IIVA 4WBNF 3UXMA 1X39A 1EQUA 2ERXA 3BXPA 4L5AA 5FL7D 5H80A 2GJ8A 3VVBA 4BQRA 1EG2A 3C6KA 2JIRA 1CV2A 3K09C 4MCAA 1ZPDA 3IIIA 7REQA 3CUVA 4M1SA 1UFKA 2PVPA 5ALGA 3FUWA 2CL0X 2WUEA 1I3OA 3H75A 3GPIA 4IV8A 1ZOSA 2F9LA 2FFBA 4H6PA 3PVSA 2QRPA 2C95A 4MRRA 1C3XA 4KI0A 3AM5A 3DAPA 3ZXIA 3D3EA 1MT3A 3VC3A 1N5KA 4PZUA 3ADDA 5GTDA 1JR3A 2R1TA 1P8AA 4P92A 3IERA 3KE8A 4RPLA 4BO8A 1OZ0A 2E89A 2Q2QA 3NI2A 4NICA 3L6OO 1KTIA 1A9OA 2YV3A 1HOXA 2OWEA 4ETMA 4FGKA 3GMSA 4O2BB 1B1CA 2VRCA 1XG5A 2V6MA 3G8YA 5KKNB 3C4QA 5JBQA 3NYWA 3A9RA 4ZT7A 3NVKI 4O2BF 3PWKA 4YRTA 3RTAA 1NKSA 2GX6A 6LDHA 2OGZA 4JELA 3BERA 4F86A 4JXJA 3FPJA 1FFSA 1PK7A 5DIZA 2J33A 1MMFB 1SD5A 1RE1A 5AW5A 1W2WB 2B1JA 2O0JA 4Y18A 3FVQA 3RVJA 3ZWVA 4QJ3A 4HLUA 5JXJA 3WGIA 1WZUA 1M0EA 4H31A 4U0JA 3K0AB 3JATB 3BDAA 5BV8A 4IS2A 3TTUA 3S81A 1CUYA 4OGFA 4B6GA 5K05A 5U9CA 1E2MA 3KBBA 5L3RA 4P6VF 4PG6A 2VVTA 2G5CA 1LC3A 3KKLA 1X42A 1SXQA 4HGYA 2QAGB 1MCZA 4D42A 4FC6A 2I6FA 3RVRA 1GQSA 4HAYA 4NTZA 2D5LA 1PUIA 2RGGA 4Q9AA 4XX1A 1BCSA 1EG7A 4UHBA 4UNNA 5CX4A 2R44A 3SVTA 4RIFA 3GELA 8ABPA 1IH8A 4GMGA 2REQA 4F2PA 1NN3A 1W1UA 2QTRA 1T15A 5FBRB 1OHHA 1VOTA 3M9LA 1TPYA 2PKXA 4GKJB 4LE2A 1G41A 4MHTA 2UU9B 3ZLAA 2QK4A 4U9HS 4LZPA 1UFVA 3EDYA 3NV7A 1HLDA 2PLWA 5BV2P 1E9FA 2FEAA 2BH9A 3H9GA 4A36A 5A5EA 4KN8A 5EINA 4EUFA 4R1TA 4IO0A 3ZDQA 2IP1A 4OQPA 3ACDA 2C7QA 4PG7A 1XA3A 4NK5A 2J46A 4E5NA 3X1YA 2EZ9A 4KRYA 1U0NA 1YI8A 5LBIA 3BICA 2OGSA 3ZNOA 2EQAA 3UQYS 1H2XA 3TIVA 3DSRA 3F1KA 1VIVA 3K1AB 4RDCA 2FN4A 1CZOA 2Q1XA 3ZWBA 1II0A 3I6ZA 3SS8A 3ETHA 3ACBA 4C7VA 3HP7A 1Q95A 1FFDA 1TT7A 5D3ZA 3DZFA 2L17A 3ZV3A 3V8BA 4MI9A 1DUIA 2W4IA 5DK6A 4JI6B 4BLVA 1U1GA 1U7OA 2BJWA 2HWWA 3BAFA 4QBIA 1FDWA 3RSLA 4ATNA 3GXOA 1OWLA 1RXYA 1PEDA 1QB8A 2MJLA 4PZZA 1A69A 1AQIA 3F3KA 3ISJA 2DKFA 2ODWA 1VE1A 3W2EA 2SNIE 3B13B 4BB5A 5L6LB 1A71A 1DPFA 3RS4A 3EOBI 1KRXA 4WX2B 3SZLA 1IN7A 2A57A 2HMYB 4HPJB 3RO7A 1PO7A 3GNQA 2V96A 2KBEA 1LJLA 3H2ZA 4HD8A 4RQBA 4YAKA 4CQMA 2RJNA 2HQSA 2V7XA 3B12A 1ZMOA 4H08A 3VYVA 4YQFA 1AHPA 1A9RA 4NKRA 2WI8A 3IMGA 3H1PA 2CNWA 4IXMA 4RPKA 1AQNA 3T7CA 1IY1A 1MQAA 1QIFA 1ZEMA 2LW7A 4EG3A 2OV8A 1VJDA 3B9RA 2D5CA 2JF0A 1C4KA 1DBWA 1A7AA 1OROA 1ZU4A 3ZIAA 3RBZA 1TF7A 2CN1A 2YV4A 3AJDA 4GG1A 4IIGA 1ZD3A 4MARA 3JVDA 1XA0A 4QNNA 5FIUA 2M6LA 1RXCA 3DHEA 4MVJD 1JHMA 1TOAA 1U3WA 3EVGA 4H7IA 2X58A 4OXYA 5D5QA 1R5JA 1J2YA 1NP7A 3AUTA 4YIKA 4DR3B 4BKQA 3ED5A 4NFYA 4NWIA 1JHDA 5FCDA 9LDTA 2DQYA 4CFSA 2VDPB 5IK2D 4TKVA 3UA3A 2RGXA 1IQRA 4HAXA 4JBLA 4UMVA 3ZY2A 5ITSA 2DX7A 4EAAA 1PNOA 4AS1A 1F60A 1TK9A 1TM3E 1RXSA 3KQSA 1L3BA 1E62A 1OT5A 1U31A 2A0WA 4I4TB 4NBVA 4EIWA 3ASUA 2VSQA 5CUQA 1PR1A 2PRZA 2FQWA 2YCBA 1P7YA 3N2IA 4IGKA 4Q9IA 1P81A 1YS1X 3OMXA 4Y2PA 1IN5A 1IM5A 3O26A 3ZQ6A 5LJIA 3AETB 3BX1A 3DMHA 1VXOA 2O50A 4OB6A 3CLTC 4WY2A 2EHJA 3QVTA 4J91A 1W29A 2XGGA 1E9SA 4GWKA 4I08A 3EXHC 5FQOA 4AP6A 4TKUB 4NU6A 2R85A 5JS1A 1YBFA 3UUFA 2ZSIA 4NOLA 2AE2A 2PRSA 3T7EA 3T7TA 3WLRA 4ASUD 2GJKA 2C78A 2H2IA 3IA2A 3KQYA 1ZKDA 1HG1A 4XGIA 3B51X 4OFWA 4EFMA 3IELA 3RS2A 4GMFA 3TZKA 1N1MA 3MSCA 4Y2YA 3QFCA 1OFUA 2EG5A 4IIFA 4ND4A 2V7WA 3ZXXA 5KI6A 4BZXA 2GETA 4OGKA 2D3WA 3SSOA 3SJUA 2AJCA 3CUSA 3O03A 3C48A 2EP8A 5EKSA 2BEUB 1Z2DA 3DTVB 3WKAA 1WB4A 3MCVA 4NE2A 1FP4A 1O5OA 2QR3A 4NARA 8ADHA 1BS9A 1YO6A 1IY9A 1R9JA 2XZTA 3A6GA 4MHOA 5PGMA 3SFTA 3ZCQA 2RK6A 1KBOA 4DRXB 3VRHA 1NI3A 4BQQA 2B0JA 1HLPA 2CEKA 1KC1A 1Q7EA 5DBEX 4E22A 4XFDA 2PIDA 2W8BA 5CHEA 1J2UA 4HC4A 4LDAA 2ZYDA 4HEQA 2BKLA 4IIJA 4JJFA 2AVDA 2H4ZA 1WP9A 2JLCA 2VPXA 5F76A 4EPTA 4YXFA 2VT6A 1Q22A 3T3MB 2I62A 5EIEA 3SVLA 1V8PA 3OG9A 5EE5B 4JC0A 5E38A 4J3FA 2RHLA 4M8LA 2GD2A 4NSNA 4NBSA 3GCDA 1E9VA 3FSEA 3ZCRA 9MHTA 1H05A 1NVAA 2C04A 2WZDA 2HRCA 4JJZA 1TUEA 4KTTE 3UKOA 4NNJA 3LKZA 4INJA 3TUZC 1L5FA 4L0MA 1LDBA 3IOEA 2ZJ8A 3A4MA 4B1FA 5K6RA 1BDHA 1OTYA 3NTUA 4DGSA 4XD7D 1EGVB 2GILA 3OA2A 4EI7A 1NQ5A 4RLQA 1AB6A 1Y1LA 4G81A 5DTJA 4KXYA 4DEXA 2V7EA 2NZVG 2Z98A 3F5FA 1QANA 1V3UA 4KQ1A 3VU1A 1C81A 5FJJA 2WM8A 2ENWA 2R8XA 4MS1B 4WH0A 5K3AA 4L8LA 1HTTA 1M7GA 1XZ8A 3DJYA 5ES4B 5LP1A 3EF3A 1BX0A 3HBLA 4QYWA 4V2UA 4XDZA 3RUCA 4DY4A 4AURA 4YR7A 2AG8A 2J8ZA 1ESCA 4G0NA 4CMAA 2X77A 2FOIA 3F7TA 3VVCA 3JYPA 2WA1A 4KWHA 5JJIA 4AMUA 2JBAA 3AILA 5ECWA 1Q0PA 1ENYA 1O95A 4LZWA 3NM5A 4TX1A 1YK0A 3H05A 4JX8A 4IHQA 1NJ2A 3B82A 3ZWNA 3PD7A 4IDHA 4BPRA 2WQ6A 3TL6A 1EKXA 3O2SB 5CBPB 4GEGA 3UUEA 3RAFC 3V1NA 1XQ1A 3EEBA 5BXQC 3W8NA 1WHSB 4G97A 4OPMA 1LDEA 2H9AA 5DLDA 3RK4A 3LBFA 5DWVA 1NJ6A 2A58A 2J3QA 4HFRA 2W2MA 1COWD 1B6SA 1NBIA 3F1LA 1Q44A 3OURA 1BU8A 2PR2A 3IX7A 5ENVA 1N78A 4MQBA 2BFDB 2ZS9A 2FW0A 3ROZA 5LQNA 3MINB 3DTTA 4HQRA 1RC0A 3PF9A 4IKEA 4JUDX 4N39A 4Q3KA 3UIEA 4N6GA 3WLLA 5ALVA 2PQ0A 3D7KA 4NOMA 3K35A 4AXBA 2ZULA 4TWRA 3ECSA 1TX4B 1W85A 3GGJA 3LP5A 4F3RA 2CMHA 2IITA 4YHHB 2ZRJA 3KEOA 2P40A 4DJJA 5EJ9A 5HXAA 2FZVA 2PIAA 1GUYA 3SXUA 5BQOA 1ZUNB 5IC4A 3RIYA 5DTRA 4Y8VA 4U2EA 4YJ2B 4YP7A 2FUCA 4JKOA 2SKDA 3TW8A 5C8XA 4ZJZA 2X15A 4PVDA 4CR7A 5KINB 2C5SA 2FWJA 1YJCA 2MWMA 2ZSAA 4MZXA 1YJBA 1AM4D 3TSZA 4BFWA 5JD5A 1T1IA 4P1ZA 1FRZA 1VBMA 1E7YA 1XCLA 4J1NA 5TX7A 1PKEA 1K3FA 3Q7TA 1FNNA 3PPXA 2G06A 4RYLA 2ZSJA 2J07A 3RBXA 4TT8A 3AL3A 1PV1A 1PN3A 2X4IA 4BVHA 1H4QA 1C9NA 2BGMA 1NUTA 4C43A 4YQYA 4CL2A 2RGRA 4U0KA 3L6DA 1BGWA 4L4RA 1YZVA 4LN1A 3BJIC 3UJ8A 1AOXA 4ZPJA 5AM2A 1W5BA 1HGXA 1K7SN 1U0GA 2VHXA 2XJ4A 3B85A 4NVRA 4Q16A 4WVLA 4I5EA 5L7YA 3Q3VA 2OO7A 3GIDA 4R81A 3WSVA 4LQ4A 2DRIA 3H86A 4X91A 3TNJA 5DGCA 3MRTA 3GA5A 3L2OB 2E87A 2LR0A 1TMGE 4IIBA 2OCBA 2WSIA 3NBMA 3KR9A 1GQYA 3O8BA 3IHLA 2O3SA 3D8TA 4GEKA 1JFVA 1QYXA 1I01A 4B4VA 3MGBA 1X7ZB 2DY0A 4UDOA 5A0TA 1TXGA 1WXFA 2GAIA 2J7PD 5JH7A 4LF7B 4YRZA 3FMIA 5CVCA 1S2MA 3KVNA 2OBYA 1V1MB 1Z13A 1K89A 1FTQA 2ZUWA 3I0ZA 1GVNB 1PEYA 2IYYA 4UPVA 3Q88A 1GKUB 2Y1CA 4ND2A 2ZAYA 3KL2A 5ESXA 1JNYA 1DMSA 4ZHQF 2JW5A 1XMIA 2AWNA 2JJ1D 2GXSA 4JZKA 1N8SA 1PJCA 3G6WA 1TYZA 4NABA 1H85A 1XRRA 2OO3A 4R2HA 3WYGA 5CFQA 4BJ1A 3TTSA 4LZZA 1YDEA 2RJ3A 4TYYA 1AKUA 3QE9Y 4L8WB 2NP7A 1HYQA 3B78A 1ID8A 2VXOA 1D6SA 2GCOA 1V6SA 4R7ZA 4IFBA 1V25A 3A6EA 3K73O 4ZVSA 5A5VA 2I9PA 4G23A 4Q01A 1D2CA 4I1SA 1CRLA 2J87A 4HGQA 1OKKD 2EJVA 4OHCA 1JEYA 1SBCA 4REMA 5CIQA 1TM4E 1V9CA 3KJGA 1EAYA 2BHSA 4WLVA 1WNTA 2W00A 5ENDA 4N5LA 1TYDE 1M2VA 5E1DA 1E4YA 1GTVA 1V6CA 3GLQA 3LPDA 3LT5A 5HA5A 4URZR 2QS9A 2F62A 2R9VA 4G2TA 3JQAB 1W87A 4O4JA 1JWBB 3A7EA 4RC9A 5CFOA 2W4QA 2QU7A 1KQPA 3W34A 1I7QB 3TRKA 4AO8A 1SQSA 4QHTA 2E85A 2Y2VA 3K5IA 3FYUC 1NJ5A 4TMXA 4PQYA 3GDHA 1YMQA 3KYJB 1M34A 4H18A 1C7FA 1U2RA 3HJBA 4HAUA 5FXMA 2IEIA 3O1JC 1XKLA 6ADHA 2C82A 1ZM9A 3WO0A 4FNAA 5ALMA 3V5NA 4JJ8A 1VL5A 4YREA 3DZ8A 1J00A 3G1TA 3HJHA 4JROA 4PSAA 3LQKA 2IHTA 5IDYA 3OPXA 1CE8B 3HHEA 4WNAA 1H1LA 1MRNA 4DR2B 1XCPA 1KHTA 3QNMA 4P93A 4UNPA 3U09A 3L4EA 3E5RA 1FNCA 1CUEA 5FR2A 3P7MA 3MWFA 4MAFA 4CWAA 4GW3A 2GM5A 2M6SA 3ELUA 5IC6A 3VKVA 1AA9A 2R6GA 2IOFK 2QL6A 3MQFA 1ZRNA 1N2JA 2BKXA 3PHIA 4YCMA 2ZUVA 1GFZA 2JATA 2DFTA 2OCGA 4L4XA 3SDZA 1L5RA 4YGXB 2BHLA 3PFKA 2VA9A 1D1QA 4M2LA 1DQZA 4JLPA 3GFQA 1UXOA 3G8DA 3IP7A 5LB2A 3VHRA 3KZXA 4P8RA 3D5TA 2IOYA 3HYTA 3RGGA 5HRAA 1Y6GA 4B17A 5AJVB 5LN1A 4A23A 2WPDA 4QC2A 4GKAA 3UAYA 5HX7A 4XSGA 1V9SA 5D1HA 4NG5A 1FRFS 2QTLA 2HWYA 3GJTA 1KI8A 4G01B 4Y6GB 3U5ZB 3ABZA 1SHLA 3UMVA 5G02A 4FE4A 3QF4B 3UJ9A 2YHAA 1VKNA 4G5OA 1XU4A 4K81B 3HPQA 3C41J 2RAPA 4NULA 3GU3A 5HFJA 1E9CA 5F4BA 1QHSA 5LQRA 1UMBA 1WF3A 5FBKA 2Y67A 3NV9A 3Q0IA 3QKSB 4OKNA 5C0OE 1NAHA 3OLVA 3HXLA 3FTFA 1IXYA 4PPQA 3UVEA 1E66A 1CQZA 5FBQB 1I4WA 3KZCA 4OI1A 5GJCA 2JANA 4KUEA 5AM0A 2XCIA 4W1SA 1PZGA 4LTDA 1U98A 4ZQCB 1G4HA 2XQJA 3A1CA 1VE7A 3I6IA 1IZZA 3I42A 1XTVA 1U6KA 2OA0A 3ZHVA 1JKJA 1E2FA 2R4QA 4DNXA 1F2TB 1X7DA 1T5TA 4BQNA 2EZTA 1M5RA 1KOLA 3EGEA 2OFPA 1TZKA 4ZO7A 2V1UA 1EM8B 4P33A 4KVGA 2GN1A 1D2HA 4F06A 5IZCC 3FOZA 4DNOA 2BZGA 1T5LA 3WWDA 4QD3A 2A0YA 3B3JA 4FJ2A 3KE9A 1Q14A 2YS7A 4CL3A 2CLDX 5DT2A 4HZUA 4V0NA 3O3NB 1VGVA 4S0XA 2ZT6A 4U8GA 3ZHXA 1CJUC 1P2UA 5DM60 5L6MB 4ISCA 2BGLA 4P7GA 2YV1A 4QAJA 1XKTA 2A86A 2GTHA 3K1TA 4LGVA 4OHVA 2EL9A 1WXIA 1LZLA 3CKMA 2GZSA 3PC6A 4RJJA 2HUNA 1KK3A 3CO0S 4QYTA 4MIKA 1LPMA 4W5OA 1F38A 4PO1A 5EXDA 2B92A 3BRWA 3EMBA 3REGA 3UV3A 3PFNA 3OTWA 3LBIA 2JCGA 1GTJ1 1UK9A 2AXNA 4FFWA 1P80A 3CWZA 4ZYTA 5A4JA 2B1RA 2BRUA 1WPXA 2Y77A 5EZYB 4CG0A 1JFRA 1UMCA 2HHAA 3H84A 3UAWA 4BHHB 1PFGA 3P96A 5IARA 6ABPA 1YR3A 1F51E 2Q45A 2BF4A 1GOTA 4B8ZA 5BYKA 1AGYA 1JSRA 1QRTA 1L0BA 3DBHB 2CBGA 3TEJA 1GU1A 2AOUA 1B2LA 1HFKA 2O23A 3V33A 1WKVA 4B7CA 3E2PA 5L4SA 1UWVA 1JJ7A 2UZAA 4X84A 3HS3A 3RSCA 5JJBA 2KLBA 1ISHA 2VBFA 4LDJA 1EXVA 4PPFA 4AG5A 4U7HA 1PT8A 3F0TA 5A4FS 1LQTA 1NBMA 1ZJ6A 2VEDA 2HLNA 4HQFA 1CRQA 2REOA 3RRZA 4D02A 4G3XA 3D8RA 4RIIA 1KFJB 2W90A 1LSOA 3WRYA 1OA1A 4NV0A 4WN9A 4RGBA 3ZLTA 1NKVA 3PDCA 3VOBA 3PGVA 3SC2B 1PX0A 3DFMA 2CC2A 2CXSA 2G1AA 3M4NA 4BC1A 4C0LA 4ETNA 7GPBA 1R8YA 4FZJA 3S4YA 1G38A 3QTLA 4FKBA 4CM9A 4OUDB 2RHHA 4V0QA 2XTJA 2C5HA 2J6IA 3DWFA 3W9SA 2WYIA 3GVXA 3ILVA 3LX5A 1F8XA 1QG4A 2HR1A 1AXEA 2AN5A 2H1SA 2QROA 1ECBA 4WECA 5C52B 3WLPA 2FRDA 1TEZA 1JMKC 1D4OA 2DUJA 3EXHA 3GEBA 2C9YA 4AF6A 2V65A 1NVFA 2ONKA 4PLWA 1QHXA 3UJCA 3ZW7A 2YHIA 2JKZA 4QDJA 5EY5B 4Y9DA 3B5EA 3IOCA 4C7OB 1EFHA 4RFVA 1KBZA 3HABA 3FY4A 1P5JA 1DQSA 4HH4A 4JBHA 2UUAB 1TD9A 10MHA 1DAFA 4ND1A 2L82A 2DGDA 2NYUA 2QN1A 5D01A 4DZRA 1XN4A 3P0EA 1BKSB 2P9HA 2XDQA 3PUIA 4AMVA 1H93A 4BX2A 4DREA 3R76A 1H2WA 521PA 4HN4B 3L05A 3G6KA 4IOLA 1P9RA 1GPDG 3AVPA 1KY2A 3OLYA 4V3CA 2B3DA 3EZXA 4IDPA 3AP3A 1OV6A 3MTEA 4K87A 5T4BA 2AG1A 3W9BA 3EHEA 2Z2JA 4Z4EA 2R6DA 3WB0A 1C3LA 1U3VA 4HAOA 4BQOA 1UAAA 3VZSA 3MZ0A 1P1BA 4P5EA 2HCBA 5CFRA 3AVYA 2AI3A 3KD2A 4JUIA 3ZU3A 3GJZA 4QDTA 2JFUA 4YCAA 4OQNA 1ENOA 5C1DA 1TKAA 2YVLA 4FHCA 4A2CA 1KO5A 3RKRA 2VHTA 1W4ZA 1OLXB 1CUUA 2ETVA 3FMGA 4D57A 3WB2A 4FHDA 2OORC 3H04A 1RYMA 2VHVA 3ZGNA 2WBLC 3B1YA 4R8LA 2P6PA 5E3IA 4BFCA 3ZXUB 1BHJA 1TQDA 2V7QD 4L7VA 4MRMA 4J0QA 4MEJA 1F3OA 1DIGA 4JL6A 3SZ3A 3GN2A 4TZTA 2R8ZA 5F7OA 4TVBA 3NHFA 1ZOPA 4L16A 3L4BA 2CXHA 1UJ5A 4W63A 4AK9A 4FWBA 3EGVA 3GBVA 4KYTA 5A4AA 5KPJA 5JLJA 3E9ZA 4JWKA 2H07A 1SU8A 3KUUA 1H0HA 2BBTA 2BMDA 3NANA 4I14A 3LOUA 4MPDA 5EVJA 2MSDB 4BO7A 4Y3UA 1I94B 3T3PB 5EKDA 2J30A 2GKGA 5KJCA 3GB9A 3ITDA 2RAVA 3PYMA 2W2KB 2IZZA 2PZ8A 3C5CA 4FC7A 3TQOA 2C9BA 2BUBA 3F6SA 4BKMA 1ZK2A 4PHTA 3GLUA 1CTQA 1YVDA 1BVYF 3BHIA 3RB8A 4B0PA 2H5EA 2X2EA 2O07A 2FTKE 2VDMB 3BTUA 3C6XA 3BD7A 3DYIA 2PMKA 5IBRA 4RULA 1OD6A 2GK7A 4ILEA 2WWWA 4FBLA 3DZKA 3WGZA 1Z63A 1R2QA 4K26A 4QDKA 4DM4A 2X8WA 4GIBA 3ZIDA 1P7PA 3PQFA 3UMSA 2Y4OA 5TNXA 9ATCA 2UXCB 5LLTA 3ADKA 3GOQA 3A25A 4MR9B 4XE5A 2LE0A 3L9WA 2HQRA 3HJGA 3OHSX 1T9ZA 4R1PA 3HO1A 2FWPA 3AWDA 1EFDN 1FUIA 3DT8A 3CEMA 5K0LA 2EARA 3BGSA 2Y0BA 2OCKA 1TGVA 3RVOA 1ND5A 1GTMA 1YRWA 4LNUA 2I22A 3LA8A 4P7KA 5C53B 2EF0A 4Y1RB 2ECPA 3KFVA 3ZVKA 1DS6A 2FEKA 2JFHA 2CD9A 3AJ9A 1HEUA 5G0VA 1WRBA 3R0IA 3I9LA 2PMBA 3T5DA 2AFHA 1C0IA 3BVPA 3TSWA 3ZI0A 1LX7A 1OBOA 4JR1A 4AQDA 2O2CA 2XY4A 3ET5A 3ZJ5A 1UZUA 4H1HA 1A9PA 1QKKA 1U9ZA 3W5JA 4IWXA 4U2DA 5KCZA 1LPAB 1Y7IA 2NVBA 3FR8A 4PFQA 3ZC3A 1E69A 1WBJB 3VZPA 2PGXA 1P33A 2H2DA 2OGWA 4FFVA 4IF6A 3VNQA 6AT1A 1GAXA 1PFWA 1LS6A 3U3XA 3E84A 1E6EA 4PO9A 2RB4A 4UHJA 5EE9A 1WZCA 4LZLA 3PI7A 4DV3B 1X1EA 3N6XA 4XIIA 5C1IA 5HVNA 5HM8A 1FU8A 4EYQA 1LPBB 2IOQA 3D54D 2HPHA 2C03A 2FW9A 1RRMA 2JFWA 2F4VB 4EHLA 5C5CA 1GFWA 3EVBA 4LOJA 5E95A 5KSWB 1BYUA 2NUAB 1TC1A 1CDZA 1QCZA 1Z33A 4YQZA 3PT5A 4MUAA 3DDZX 1AMOA 1WZEA 3LXRA 1NY5A 4UM8B 5JCOC 1T2UA 2R5FA 3W3ZB 3A4VA 1H1DA 2ZI6A 2AR9A 2PKYX 4FDLA 1V16A 2BM0A 5FOQA 4KHPB 2VL7A 2X6RA 3HB5X 3KLOA 5GPBA 3WKEA 5AVUA 3CZRA 3DDHA 3GJXC 1NVBA 1LUAA 2GCNA 3J80A 1H22A 1M0SA 1IBKB 3NTVA 2XQVA 2C4MA 1XVAA 2E5FA 2EP7A 2QL9A 3TB6A 1DFGA 2G36A 2GYUA 3PPIA 1AXGA 4L72A 2WWRA 4WVFA 3FHTA 5F3WB 5BMVB 4BEBA 1FJ2A 4BE9A 4A2QA 1H2FA 1QHHA 2PPVA 3D81A 4MV8A 2PEZA 2PLNA 4M0EA 2JI4A 3I83A 3EGDB 3HLKA 3OZAA 4AC9A 3T5MA 4PHFA 3GFSA 5D7NA 3PPWA 5DM2A 4FDMA 2GBCA 2H29A 3QLVA 4N01A 4RIGA 2QNRA 1YHNA 1DT3A 2OK8A 4RLFA 4G5FA 5BRNA 3ZHTA 4EZEA 5JC8A 5KQPA 1JG3A 3LUKA 3NAGA 1KXZA 5AI5A 3KDPA 4BQFA 1AXRA 2R5WA 3DFUA 2ZRDA 1OU4A 3DMFA 1V47A 4QGBA 3SX0A 3ELDA 2WNIA 3H8WA 3E5MA 2D6FA 4D0SA 3LGXA 3S2ZA 3TZEA 2AJ8A 2OWDA 4HEA1 3VR4H 3NHZA 4C0BA 4DCUA 4ERXA 4DCPA 2IZOA 3RYFA 3MBKA 1VHWA 4Q34A 4EPXA 1DKNA 3KS9A 3SZOA 2J9FA 3VR6A 3O38A 4GMDA 1KU0A 1VJ1A 4Q1EA 3TQRA 1P0PA 4C5AA 5DN6D 1NBWB 2C5FA 4HXEB 4J2HA 1JU9A 2H1IA 3VOSA 1JI3A 2CNLA 1YA8A 1H0RA 3TJMA 5AJHA 3NBUA 5B7GA 1XXLA 5ALWA 4TL7A 3RVLA 4HCJA 3JWPA 1G8PA 1QCYA 1RRCA 3KTAA 2VP3A 2FJ0A 1U2GC 4GZ3A 5D2CA 1KMQA 2ZYHA 4RTQA 3MWKA 5L95A 2DTEA 2FPLA 3BXZA 1USVA 5H9VA 2ORWA 1AO3A 2ZIXB 4QICA 4YEDA 2WPNA 3UH1A 4NAVA 1A7UA 4OYYA 3MRVA 2OK7A 5HW0A 2REXB 2LIVA 1EFPB 5LQCA 2QZPA 2R00C 4FFRA 3L46A 3EE6A 4GPIB 3V2HA 2WJ4A 4RE5A 3ADCA 2EX0A 2FETA 2RHWA 3OZ7A 4E1BA 2Q4DA 1VYUA 3G2MA 2NYVA 4JIGA 1LBSA 3LHDA 1I2BA 2FX3A 3GLGA 5ULLA 1ZGBA 2AR7A 3ABOB 1PYOA 3DM5A 4ZJPA 4WLUA 3VH4A 3DOOA 4CIVA 4FOLA 5AICA 4DR4B 2ZRLA 3BGIA 2EVWX 3TLEA 1DT5A 3E3AA 1EZ4A 4MWTA 5ER6A 1F14A 3HRIA 4B6JA 5IFLA 3D9QX 2PJUA 3SQMA 3SSMA 2ZU6A 1BXGA 4OH1A 5K1ZA 4EHDA 2GRAA 1N8NA 1XSEA 1T1GA 2AYXA 3RYIA 3MELA 1G1MA 1FS5A 2SCUA 4LXHA 4WESA