1UDCA

Structure of udp-galactose-4-epimerase complexed with udp-mannose
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
338
structure length
338
Chain Sequence
MRVLVTGGSGYIGSHTCVQLLQNGHDVIILDNLCNSKRSVLPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVIHFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSSATVYGDQPKIPYVESFPTGTPQSPYGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDMGEDPQGIPNNLMPYIAQVAVGRRDSLAIFGNDYPTEDGTGVRDYIHVMDLADGHVVAMEKLANKPGVHIYNLGAGVGNSVLDVVNAFSKACGKPVNYHFAPRREGDLPAYWADASKADRELNWRVTRTLDEMAQDTWHWQSRHPQGYPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of UDP-sugar binding to UDP-galactose 4-epimerase from Escherichia coli.
pubmed doi rcsb
molecule tags Isomerase
molecule keywords UDP-GALACTOSE-4-EPIMERASE
total genus 132
structure length 338
sequence length 338
ec nomenclature ec 5.1.3.2: UDP-glucose 4-epimerase.
pdb deposition date 1997-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1udcA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1udcA01
1Z73A 3D3WA 4E2ZA 4ZGWA 4P22A 1YOVA 3LT2A 4WCDA 3H9JA 3ROKA 5FI3A 2Y1OA 3HWRA 1EFKA 4XIYA 2R00C 2NU8A 5A9TA 4EUEA 5HWSA 2EIHA 2HK8A 4MIYA 3JQAA 4PCVA 4WCFB 1WLYA 4J2HA 4OXKA 1HXHA 2VYNA 2Z1MA 4HKTA 4JP2A 1KEWA 3AK4A 5T8KC 1ZCJA 4L76A 3ZU2A 1YJ8A 1PJLA 4JXKA 1NAHA 3WQSB 2YV1A 1BVRA 3CZRA 3H6KA 2X22A 3UW3A 3INGA 3KOUA 4ZQEA 4OHUA 1QV7A 1GEGA 4Y9DA 3UVEA 1VL6A 3A1NA 5AOVA 1RPNA 3RWBA 1QR6A 4N54A 4NJMB 4KUEA 1C1XA 4RPHA 1DC6A 3ZWOA 4TMFA 4J1NA 3D4NA 3I9OA 4QTZA 5JCXA 5BNIA 1V0JA 2FSVA 5ADHA 3Q11A 1EK5A 4XGKA 2QRKA 3EY4A 3P19A 5L7YA 3VAZA 4GWKA 5TC4A 1ADGA 3BTOA 4BMSA 4JLWA 3WSVA 3WBBA 4BO2A 1XU9A 4L9RA 3VTFA 4CLRB 4CQMA 3AM3A 3BMQA 1NNUA 4WCFC 4CV1A 1PGOA 4BNXA 3TJRA 2W2KB 1SBYA 3HUDA 1NWHA 2Y0EA 3OA0A 2PZLA 3OETA 1N2SA 3E5MA 3IP3A 2CSUA 3PLNA 4TRMA 4XD2A 5DNAA 5U4QA 3TSCA 5B4TA 2VN8A 1I10A 4CLOB 4CM3A 1DIGA 3GRKA 3UOGA 4N5LA 4Y6PA 4LMRA 5KCZA 4FD3A 2DUUA 5FF9A 2NLOA 1B3RA 4L75A 4E4YA 2VHYA 3QJ5A 2O7QA 3GN1A 3ONEA 4BNUA 2BLLA 3GOHA 5KKCA 4Z0PA 2EP7A 2BRUA 3JQ8A 5JY1A 1O9BA 1ONOA 1K5HA 1F8FA 1ZJYA 4YJFA 4W6ZA 3RU7A 1KS9A 4RVFA 2PNFA 4B4UA 1QORA 3ZGYA 1DJNA 4ESOA 3C8MA 4UAGA 4CQMB 3AI3A 3DC2A 2WYVA 3JYQA 2JJYA 3MJCA 2VRCA 4QFCA 4BO6A 4A10A 4BO0A 1UUFA 5JYDA 1KVQA 1I0ZA 2I67A 3GUCA 4JROA 3S8MA 2I65A 1NVMB 2ZCUA 2VWHA 3S1LA 4HUJA 2X0JA 2ZK7A 4CODB 2C0CA 4XYBA 3KSZO 3CKYA 3R1IA 2IYPA 1K6XA 4QFDA 1GL3A 3X2EA 4UEJA 4R69A 3UCFA 3U5TA 4U6SA 1YBMA 1AUPA 1UZMA 2ZYGA 1EQ2A 3WSWA 2Y05A 2PH3A 4FPXA 2X5KO 4CLDA 2VUSA 3AUTA 3BMQB 3KEQA 2RHCA 4DTIA 3TOZA 5A9SA 4B7UA 4BMVA 5EJ2A 4W9NA 3I52A 2X5JO 4J4HA 1E1LA 1HL3A 1R4MB 3PI7A 4DPKA 5JBIA 2AXQA 2JAPA 5KJFA 3GNSA 3BTUA 3FBTA 1Q0LA 2W2LD 4M8SA 3ZDFA 3PYLA 1B7GO 3GNTA 1X15A 3H9EO 1NQ5A 2EHDA 3IJPA 1VKOA 4U0KA 5EN4A 2FHSA 3TNLA 3UAGA 4RLHA 1ID1A 3LF2A 1EDZA 4D3DA 1J49A 1EDOA 3OMLA 3RSHA 4F6LA 2VRCD 1E0DA 5KVCA 3DB2A 1Z6ZA 3DDNA 4K26A 3F1KA 4BNVA 3OECA 1MX3A 2Q4EA 1Y81A 2QYSA 5JC1A 3E48A 1A72A 1GTMA 3RVDA 3I9NA 2OHXA 3M6IA 2DBVO 1LSJA 2I76A 4D46A 4P4GA 1R12A 1UP6A 1X7GA 2O3TA 4LGVA 5G4KA 1NFRA 3F5QA 2BGLA 4BV8A 3JQAB 1I24A 1ISIA 4PG8A 2J3KA 4WEQA 3WWYA 2OFPA 2BGKA 1NHWA 2TMGA 2VZ9A 3TFQA 4FJ1A 4CM5A 4YDRA 4BS9A 1PJ2A 2P5UA 3I9MA 4IQ0A 2H5LA 3BMCA 2HJRA 5JPIA 5HM8A 1SZJG 3HN7A 2RIRA 3RUIA 3X2FA 1WXDA 3C24A 1JVBA 3ZNPA 1WWKA 3CH6A 1EBFA 1JKJA 3HN2A 3PPIA 3HDYA 4GWGA 4CUZA 5U1PA 2F00A 3O8QA 1KVSA 2IEBA 1HT0A 3BHJA 3FF4A 3O26A 2QQ5A 4ALIA 2PTGA 4O6VA 1LDYA 5EINA 5JMPA 5CEFA 4FSHA 4IUYA 3ZZNA 3TZ6A 3Q0EA 5TT1A 3GHHA 1DFHA 3BHIA 4D3SA 5GZ6A 2H9IA 1YBAA 4IDGA 1NHGA 1A27A 1LDEA 1F0YA 1V3UA 4EEZA 1DFGA 1GD1O 1PZGA 3PGXA 1H9AA 3WGIA 4ND5A 4Q3DA 4CMEC 3GZ4A 3QP9A 3VH1A 1SEVA 4AJLA 5K0ZA 4PG4A 1JWAB 3JTMA 1NXQA 4FGWA 2YHIA 3GNQA 5KNLA 1B8PA 1O94A 1MG5A 3TL3A 4CQLA 3GVCA 4BNTA 4ZHSA 5KWEA 1LLQA 4F45A 4D43A 2NM0A 4FQ8A 3JQGA 1U2GA 3RROA 1WMAA 5F1PA 4DXHA 4Z3DA 1M75A 4IZHA 4M54A 1YONA 1ZUD1 5JE8A 3HQ4O 1O6ZA 4NH4A 2WYWA 3H5NA 1JQBA 4IQGA 1E3EA 2B4RO 2RCYA 1DOHA 2X8LA 3JYPA 1M67A 2X86A 1Q7CA 4KQXA 3VDQA 1ZVMA 3DHYA 3E9NA 2EERA 4YEDA 1YDWA 3H3FA 3L77A 4H3VA 2HLPA 2FP4A 3QIVA 4FJ0A 4DIOA 3DZJA 1WDMA 3O4RA 3E18A 1EFLA 1U8XX 1HDGO 3DMTA 3GQVA 5TLSA 2D59A 3C7DB 4MVJA 4BVAA 2AEFA 3HDHA 2O3RA 1BSVA 5DULA 1ZEJA 5I9LA 4PZCA 4LRTB 2PGDA 1NR7A 1YH3A 4HWKA 4WUVA 1RYDA 1QSGA 3SXPA 1SAYA 2OOSA 2HUNA 1EQUA 4XJTA 4UVDA 5KJCA 3PZRA 1GU7A 1CIVA 3ENKA 1PL8A 2VZ8A 3A28A 3ZV3A 1P45A 3DTTA 4DWVA 1CQIA 2NVBA 3I3OA 4MP3A 2NV6A 4B8WA 3KZVA 4B8ZA 2BFOA 3ZI0A 4J49A 5KVSA 3TRIA 4GVXA 1Z7BA 1ENPA 2QYTA 1P3DA 5K6AC 1U4SA 3UH1A 1HE5A 1DJQA 1EUCA 3JV7A 4L73A 2GN8A 2FPPA 5IAAA 3FWZA 2CF5A 4R1UA 4BGVA 3GEGA 4NI5A 3AFMA 1YRLA 1H6BA 2X6TA 2XPCA 4DBZA 1G0OA 4ALKA 1PGNA 1WAMA 2V6GA 4BGUA 3ZWXA 3TPCA 1LX6A 4JX8A 3IKVA 3H5RA 2NU6A 1O5IA 4ALNA 5KVQA 3SLGA 2JKVA 1WW8A 1K3TA 4WLNA 1FDVA 1KY5A 3KXDA 3WWZA 5IDQA 4CM8A 1V3VA 3JQ6A 1ZK2A 1HF3A 3U0BA 4A2CA 3IUPA 3QHAA 4LCEA 1MXHA 3W4KA 2X9NA 4H16A 4J1QA 4W9NC 3S55A 3ZU3A 3EW7A 2IYOA 2NU7A 1N7HA 3O9ZA 1UJMA 1HYGA 1DXYA 2JD2A 2AE2A 3OQBA 4OH1A 4ZQFA 4Q3CA 1PJ4A 3LZ6A 5CDUA 2ZJ1A 3PGJA 1EUDA 4R9SA 1B16A 3QVTA 3I4FA 1QXSA 1RM4A 4HP8A 4OXYA 3BHMA 1XEAA 5CHEA 1Z75A 1N9GB 2B5VA 4LN1A 4RVHA 4CMJA 5CEJA 5ILOA 3DAFA 2CVZA 4GX2A 2B0JA 2AEMA 5T8KA 1Y5RA 2GNAA 1OZAA 1F17A 2V7PA 3HJAA 4ZRNA 2RAFA 4OGWA 9LDTA 3AU8A 1RJWA 4JIGA 3UHAA 4UVGA 1PJSA 4Q9NA 3DWFA 2TMDA 1P1IA 4WECA 3S2IA 3RCBA 3RUAA 2GZ3A 1NBOA 3P7MA 1YS4A 4GKVA 5IXSA 2O4CA 1HEUA 1CDOA 3NGLA 4BNWA 3NTOA 3VZRA 4IMPA 3PIDA 2EEZA 3PHLA 2Y99A 4BQRA 1L7EA 3WGZA 2YYYA 3PQFA 4JCOA 4KUHA 4PLHA 2HMWA 1IZ0A 1LRLA 4DQUA 4ILKA 2NVUA 2ILTA 2YQ5A 1BTOA 3GEDA 3QQPA 3SBOA 3WOHA 4BOYA 2FR1A 4JBIA 3PFFA 3GC6A 2AG8A 5AXCA 2A9FA 4R51A 1E7MA 3G3EA 4YBZA 3GN2A 4E12A 3EVNA 2BI8A 3RD5A 3HHPA 3IAHA 4WOJA 1NPTO 1XWFA 3DHNA 3R6DA 3V2GA 4FGSA 1P1JA 4RPLA 3IKTA 3GAFA 4RZHA 5FEUA 1MFPA 2HJSA 5DBIA 1A4UA 3T4EA 2B37A 5L4SA 3T4XA 3DOOA 4WLFA 4JN6B 3JYLA 3IL2A 4NNJA 2UYYA 3I83A 3ZWMA 4MIEA 3WB9A 3JQDA 4LMPA 4EJ6A 1IHYA 1GV1A 5HTOA 1ZKMA 2D1YA 4P8RA 3FNGA 4BO5A 2YHUA 2ZQZA 1NVTA 5I7FA 5ICSA 2DU8A 3H65A 3WGYA 2HDHA 1MFZA 2FR8A 4HXYA 3AM4A 1DSSG 1T4DA 1A9ZA 3C1AA 1E1KA 1I3KA 4CL3A 3K2BA 1TEHA 4O5OA 1EBUA 4ZVVA 3NDJA 3JQEA 5CDYA 3RUFA 3NAQA 1UR5A 1XKQA 5TNXA 4ZD6A 2PGJA 3K9QO 3PWKA 3QWBA 4JP3A 4LISA 2JCVA 3PWZA 4L4XA 4WGGA 4ZQGA 2GLXA 3RJ5A 4AJOA 3I5MA 5KVVA 5IN4A 3JD3A 3MZ0A 1EMDA 1TI7A 3WFIA 2EKPA 5KOIA 3UICA 5GMOA 4NBTA 1P31A 4B79A 4LRSB 1XCBA 3VZQA 4WLOA 1TLTA 3BMOA 2IZZA 1QMGA 5A05A 1T25A 3D3EA 4I8XA 4OXNA 3DZGA 4KQWA 2PV7A 4KUGA 2Y1FA 2NUAA 5DBGA 3ADOA 4GGOA 3GY0A 1YQXA 1VL8A 2G1UA 1FJHA 2OZPA 3E1KA 1GZ3A 3ZNOA 4WE3A 3G1TA 1ADBA 4RORA 1ZBQA 1J0XO 3RUEA 4NG5A 2NADA 1ISFA 3OHSX 1BXZA 1ZZEA 2J5QA 2UV8A 4I5FA 3AY7A 2JFHA 1UH5A 4YAIA 4GVLA 3PJEA 3DFUA 4QQRA 4HBGA 3ZWCA 5F3RA 3RC9A 3VPXA 1RM3A 5TIIA 1CERA 2CZCA 4GSKA 3JQGB 4JK3A 3JD1A 4UUPA 1I3NA 4YT5A 3Q9NA 2VOEA 1PS8A 2ZTUA 2PFGA 2NNLD 4P38A 4AJ1A 4CR7A 3CMMA 3E8XA 5IXYA 3SVTA 3CTMA 3DO5A 5KTKA 4TRNA 4EGFA 1R0SA 1K2WA 2IZ0A 4CMAA 2BFMA 3EK2A 1HYHA 3L6OO 4PRLA 1WDKA 4RLSA 5F1KA 3AI2A 3ZU4A 1ZSNA 3JYOA 3PHGA 4DVJA 4GAEA 1DIHA 4CMGA 1E3WA 3IMFA 3SC4A 4PVCA 1Z82A 2RH8A 2G0TA 3WTBA 4EI2A 2I5PO 4OOFA 4J16A 3KSUA 4CV3A 4WKGA 1OBFO 3GMDA 1SEPA 2BF7A 1GAEO 2CDAA 8ADHA 3C3XA 4XX0A 3ZU5A 2YW9A 2FWMX 3JYNA 1P33A 3KB6A 3GFBA 1LDGA 3LT0A 3V1YA 4E0BA 1HZJA 4BUCA 1MGOA 1KEPA 3OSUA 1I3MA 1HKUA 3LK7A 4G65A 3ZWAA 4AJPA 1VRWA 3BMOB 5JAQA 4AJNA 3NJ4A 2SCUA 3DR3A 3OBBA 4IXTA 3N7UA 2WDZA 3PJDA 2ZTVA 3FN4A 4INAA 4KWIA 2HAEA 3RBZA 2IEDA 3GVXA 2OORA 2BKAA 3LSYA 4OIMA 4TKMA 4HX5A 3I6QA 1Y1PA 1YL5A 2YDXA 4Z0TA 1PS9A 1LXCA 4RPKA 5F5LA 3TN7A 5BNTA 2QX7A 4U0JA 2ZATA 4NFSA 3PXXA 1YB5A 4IDDA 5AXDA 1GCOA 5G0TA 4IIVA 2CNBA 4F3YA 1F8GA 1T2DA 3ITDA 4RCVA 4RL6A 2CFCA 3V1UA 1UP7A 4I9NA 2O3SA 4J7CA 4BQPA 1T2CA 1XGKA 3ETGA 2E49A 1S7CA 1SCUA 1U1IA 2JFFA 4PZEA 3VKVA 3ONDA 5C7IO 1I32A 3WMWA 3A4VA 4IJWA 4D44A 1D7OA 2P4HX 4JJGA 2VT2A 3RUDA 1Y5MA 1PR3A 2PA3A 4YR9A 1KYQA 1UXGA 3WLEA 1ISMA 1BVUA 5HA5A 5FWNA 1BDBA 1YJQA 1ZSVA 4YCAA 2YV3A 2Y1CA 1KEVA 2HKIA 4AJKA 2D0IA 4E5YA 3C1TA 3LLSA 2CDBA 1Y6JA 3VH4A 2C2XA 4AJEA 3MWDB 3E03A 1NQTA 5BT9A 1T2AA 2B35A 1QV6A 5C5IA 3HDJA 4YQYA 4XYLA 1SO8A 1PZEA 1XU7A 1LBEA 4RF2A 1QG6A 1B8UA 3M1LA 2GASA 3AFNA 1C3VA 1T2EA 3INTA 3W8EA 4DLLA 3E9QA 1GFSA 4Q3EA 4XB1A 5H83A 5JAZA 4B7CA 4R3NA 1LC3A 1KERA 1YB4A 2AHRA 4FB5A 3IS3A 2PZJA 2W98A 4U5QA 2NTVA 2CMDA 1UZNA 3VPFA 2R6JA 4G81A 3PEFA 1YKFA 1EVZA 2O2SA 3ST7A 3DL2A 1K6JA 4MJLA 5ITWA 4D7AA 3WYBA 4XDYA 4D79A 1H2HA 1C0PA 5IJZA 1B0AA 1DLIA 3DZBA 1NWCA 2E4AA 2X9GA 4FC7A 4M87A 3DBHB 1ULUA 2IRWA 3BA1A 1B8VA 1P1KA 1WPQA 5A02A 1NPYA 3HE3A 4U7WA 5BNFA 1FF9A 1A7KA 2Y66A 4GX0A 4PZDA 1ZK0A 1VSVA 3S2GA 4CLXA 2X0IA 4NU5A 4ID9A 3A9WA 3EYWA 2G5CA 3FR8A 4R1TA 4EUFA 3NKLA 4UREA 3D0OA 1IY8A 2YFHA 4RV9A 1KVRA 4MKXA 2XF8A 4XA8A 3TZCA 4BL5A 5KJ6A 4Y98A 1LUAA 3KYCB 2PK3A 5JCJA 3IQDB 2ZB7A 4TZTA 1R6DA 1E1NA 4OOEA 4NFHA 2HRZA 4E31A 5LDGA 3FNEA 1ONNA 3L4BC 3OM9A 5TRTA 4JNKA 1E7QA 3EZLA 3UCXA 3COSA 1QYXA 2BH9A 4EDFA 5EQFA 3ZNQA 5B1YA 2G17A 4MVJG 2DFDA 3HFGA 4DC0A 4PLWA 1B3BA 4MVJD 4XKJA 5JAIA 3TFOA 5A4DA 4PG6A 4MVJP 4YJHB 3W4JA 1DAPA 3PHJA 3QW2A 4QECA 1ENYA 5G4KB 5AYVA 1NR1A 3D64A 4BB6A 4E13A 4NIMA 3WGOA 1RM5A 3ZHYA 5F5NA 2YY7A 3KV3O 3U4IA 1A7AA 3PJFA 4P4NA 4BKUA 4BNLA 4ONEA 1D1TA 3OICA 3IP1A 4PLPA 2A35A 2EJVA 5H81A 2WE8A 1J6UA 2PD3A 3H7AA 4Z9YA 4DMLA 3P2YA 4GMFA 3WR5A 1ZH8A 4XRGA 4CMEA 1G0NA 1XIVA 1GZ6A 4I9HA 1NYTA 4I9UA 2Q3EA 3D1LA 5JDCC 3UCEA 4YXFA 4WNIA 1BWSA 5G0VA 4PLGA 1T2FA 5JCJD 2OP1A 1P0FA 5DDIP 3D5QA 2YJZA 3G49A 4PLCA 3TDKA 2BFAA 4MPDA 1GZ4A 1UXKA 4WOKA 1EE2A 2JCYA 2J6IA 5L51A 3F1LA 2B4QA 4KP7A 2W2LA 5I9NA 2V6FA 4ND2A 3R3SA 2G76A 4CMKA 5EERA 1U5CA 4MO2A 4A5OA 2HU2A 3QWFA 3PRJA 4DRYA 5JC8A 1IOLA 2ZB3A 1GYQA 2B69A 1R16A 1AE1A 4Z3KA 3EMKA 3FWNA 5ENVA 2NVWA 2A4KA 3FTNA 3K73O 4NK4A 2JHFA 5EPOA 4XJSA 4C7KA 5BSFA 3AOGA 2W8ZA 3ROPA 3GVIA 3WIEA 5I8WA 1DRWA 4I08A 1YE3A 1IPFA 5CG2A 2YHIB 5IDYA 3GDOA 2DT5A 5IG2A 1YO6A 1T26A 4YRDA 4OQYA 4GKBA 2VHZA 3B6ZA 4QEDA 1IHXA 3JQ7A 4NPCA 3U62A 4TVOA 5DN9A 3O38A 1ZK4A 5C7LO 1U3TA 4J91A 3AW9A 3H9GA 3JQFC 1WMBA 1R0KA 2IZ1A 3C1OA 1KBZA 4TWRA 1PGQA 3AOEC 3PQDA 3MJEA 3RC2A 3SJ7A 4OKIA 3GT0A 4CR8A 3Q1LA 2P5YA 3TQHA 2EF1A 4CMIB 3QVSA 5U9CA 1E7YA 2EGHA 4FDAA 4C7JA 4A73A 1C0KA 5H82A 4OKNA 1HE4A 2Z1NA 1OMOA 2PZKA 4HV4A 2VTEA 3DAGA 4WLVA 4H15A 3L4SO 4YYZA 2C7VA 2Q50A 5A3VA 1LRJA 1EVJA 1SB8A 1S6YA 1T1SA 3MCVA 4EEXA 5IFLA 4JBHA 3OIGA 1UP4A 3OEWA 1SB9A 4PLFA 1CRWG 3ZHBA 1DRVA 2V65A 2BMAA 3NEPX 4ITUA 1UDAA 2IXBA 4AL4A 1H94A 1DIRA 3GRPA 4B4WA 1ISHA 1FDWA 3AUUA 3MEQA 4XB2A 1DLJA 2Q4BA 4MVJM 2C20A 5I8ZA 3JQBA 3IJRA 2GSDA 3WG9A 3GG2A 3C85A 1D4FA 3LQFA 1GYRA 4NBUA 3SC6A 2HSDA 3OQ6A 1CWUA 4B3HA 1T1RA 4TQGA 3OIDA 1KEUA 4NHEA 5L7TA 2AQHA 4CUKA 3CINA 4MKRA 5LDHA 3IDSA 3TOXA 4ZU3A 1UXJA 4PN3A 2Y93A 5JSFA 5IZCC 3MWEB 3GK3A 3RC1A 1JAYA 5A5EA 4GL4A 1B26A 4GH5A 3VC7A 4UULA 3TZKA 1LJ8A 5JW6A 1M2WA 1EZ4A 3ADPA 3RKUA 1XHLA 4YVFA 5L45A 1NX6A 5JY6A 4B7XA 1ZEMA 1QYWA 3JD2A 4CMIA 4M89A 4RVSA 4YB8A 1Q1NA 1XDWA 2XOXA 3NTRA 5LCXA 3K30A 4I5GA 4IJKA 5BR7A 4D42A 4HFMA 1EE9A 3DMTC 4R16A 3LC7O 5TGDA 4TVBA 3UFXA 4BNYA 4HNHA 3JQ7B 1MG0A 3QY9A 5TQVA 1PL6A 4GX5A 4FOSA 2ZJ0A 2VNAA 4K9DA 4CMCA 1G1AA 1JWBB 3HB4X 1OOEA 3JQAD 4XR9A 3VOSA 5L95A 2E82A 1YQGA 3WQQA 3GVPA 4GLOA 1F12A 2X0NA 3ZWBA 4ZN6A 2DTDA 4URFA 1Q2XA 2Y0CA 3RAJA 1JVSA 1R37A 2RH4A 3D4OA 1HDCA 4TROA 1XSEA 1JAXA 3HNPA 3OJEA 4YRBA 5IF3A 3NRCA 4WPGA 5DP1A 4NFYA 1MC5A 1W8DA 3F4BA 3ONFA 2IODA 4RPJA 4Z9FA 4BNMA 2JAHA 4FIZA 3U9LA 2ZB4A 2DTEA 3D4PA 3U09A 4FFPA 4BO1A 4OSOA 2GD1O 1UAGA 1VJ0A 1YL6A 3HDQA 4J1SA 4DYDA 5EMHA 2EGGA 3N58A 4IS2A 1L1FA 1UDCA 3PQEA 2QW8A 2Q2VA 3NX4A 2X4GA 3WS7A 4BNNA 4Q39A 4CQLB 2VQ3A 1GY8A 5LC1A 5L3ZA 1F06A 3WJAA 1T4BA 2I99A 3HADA 3DOJA 1N5DA 3K8ZA 5A06A 1WZEA 1E3IA 1C1DB 3ZWNA 1GQQA 2Q1TA 2FN7A 4CM4B 3H2ZA 3QLJA 4YJDA 1PJCA 3ZWYA 5CAEA 2DVMA 2B83A 3PZBA 4A27A 2E48A 4MDHA 9LDBA 1E3SA 1TB4A 2OP0A 3ICCA 2GDZA 1U7HA 2GZ2A 3STHA 1YQDA 3H9UA 3KTDA 4Q3NA 3EZYA 5JLAA 1U3VA 1H93A 3CEAA 4UUNA 3ZW9A 2VOJA 1CF2O 1IE3A 3F47A 4II3A 1XR3A 1XELA 1D8AA 2O7SA 4E6PA 2Q1WA 3VPSA 3DFZA 4IJVA 5L4LA 1H6CA 4ZQBA 2Q45A 4MVJI 2GCGA 3UUWA 4PLVA 1YGYA 1PGPA 4BNIA 4EYEA 1GV0A 4BKRA 3I6IA 4NJMA 1DAOA 2NSDA 1M66A 3VTZA 2R00A 3L6EA 2VWGA 5HBRA 2HK7A 4RVUA 5ICMA 2P9EA 1P1FA 2OMEA 1JU9A 4OJNA 3AU9A 2JD0A 5TJHA 4IY1A 4AJ2A 2VRBA 3CIFA 4L4SA 2C5AA 1AXGA 1RKXA 1AXEA 3KYCA 4NZ9A 5A5FA 4R4JA 3KEOA 3B70A 4KTVE 4UVIA 5JAMA 1Y8QA 1R4NB 3PYXA 3BMNA 3RUCA 1P77A 2YZ7A 2ZTMA 3G79A 5KJEA 1O95A 4E33A 1E7RA 4N18A 3V2UA 1PWZA 4J2OA 1I5RA 3EGOA 3KO8A 5A9RA 2ZIZA 3FNFA 1FK8A 3LLVA 2IXAA 4I5DA 3GUYA 4BGIA 3ZWPA 4D45A 1E92A 2YQ4A 3OJOA 2F1KA 3ZN2A 1X13A 4NU6A 3GGOA 3LF1A 4B3JA 3GDFA 4UUOA 1N1EA 5KKAA 1GQ2A 2A94A 3OEYA 2VWQA 4QUKA 4UEKA 1OFGA 2P9GA 4KMSA 4A26A 5G0UA 5ITVA 1QP8A 4YT8A 3OJFA 1NASA 2DPGA 3IUSA 2Y1GA 2BI7A 4DYVA 1PQUA 1EUZA 4AG3A 1ISJA 2NTNA 3PLRA 2B4TO 5DP2A 3KBOA 3G0OA 1NP3A 5BSHA 1PJQA 3E9MA 4PLTA 4DPMA 3HG7A 1UAYA 5G4LA 3OFSA 3M2PA 1H2BA 4W7IA 1YWGO 1IPEA 2VUUA 4YWJA 1GPJA 3F6YA 3RI3A 1N9GA 2I6TA 1U28A 3LC1O 5COQA 3ASVA 3BXXA 1MXFA 1HDYA 5DCWA 1HDRA 2DKNA 2J8ZA 4FFNA 5FYDA 5B37A 4BKPA 4N5NA 1NTOA 4A7PA 4IDEA 4ND3A 4IDFA 1K89A 2HMSA 3WGTA 2IDZA 3KLMX 1HLPA 3CZMA 5ILGA 3P5SA 2CVQA 1XQ6A 3AI1A 1KC1A 1GUYA 4XEHA 4NR0A 4DL9A 2WE7A 5GZ1A 3KM0A 3WXBA 1Z7EA 4OL9A 2PKRA 4BGEA 4B4OA 3K92A 1QYCA 3JQ8B 4CM1A 4MINA 3OQ1A 1DIAA 4DA9A 1Q7GA 1XQ1A 5BQFA 2QG4A 4S1VA 2EJWA 2PZMA 2O48X 3FNHA 4IS3A 2Q1UA 3SLKA 3W4IA 2C7GA 4TZKA 2G82A 4FFRA 3K5PA 3F5SA 4Z9XA 2ZCVA 3OF2A 4Z6KA 3OJ0A 4IM7A 2O2YA 3G1UA 5ER6A 1PR9A 2WMDA 4EZBA 1Y8RA 3OP4A 4CMHA 5T64A 2VTDA 3AUSA 2HRBA 1ZFNA 4CR6A 2PKQP 1ORRA 2Q49A 1I01A 1Z74A 5ES3A 3ABIA 3C7CB 2Z95A 2HQ1A 4L0QA 4E30A 1HWYA 4D3FA 4N5MA 3VH3A 3U4CA 1HLDA 2DBQA 3RKRA 3RUHA 5CDGA 3ETEA 1C0IA 5TF4A 5BSGA 2FZEA 1RYEA 3A14A 3W1VA 5JYEA 5AXAA 1W73A 3NUGA 5I7EA 4TSKA 4TRJA 4PG5A 1ISGA 3IOYA 2Y0DA 5A9SB 1ZXLA 4DMMA 1A9YA 2Y1DA 2P68A 4OSPA 1FMCA 5K6AA 3LC2O 1V8BA 5T5QA 4FR5A 3TWOA 3ENNA 1CJCA 1ARZA 2NWQA 1A4IA 3QA9A 1G6KA 1VC2A 4BNHA 3OJLA 3G17A 1XA0A 2AE1A 4QSMA 4B4VA 4RDHA 1ZIDA 4OQZA 1DBVO 1I8TA 2WYUA 2LDXA 3F9IA 3KVOA 2X7HA 3QWIA 5CDSA 3U3XA 1DC5A 2CUKA 4BB5A 2YUTA 3DZFA 4HY3A 2Y67A 3LVFO 3B1FA 1E1MA 4KOAA 1EEHA 4W4TA 4MP6A 2RHRA 2AMFA 3H3JA 1N92A 3H9QA 1BG6A 1N1GA 2Q99A 4FCCA 1JTVA 1GCUA 3IC5A 2W4QA 2QHXA 4M55A 3MJTA 2DAPA 1YDEA 1TXGA 2D3TA 4IPTA 1X1EA 1LSOA 3A06A 3NYWA 2FPGA 3W8DA 4J3FA 2UDPA 2P9CA 1E5LA 3L0DA 3SX2A 4J90A 4XR4A 4WLUA 3L6DA 4DBVO 4GGPA 1PJTA 5HS4A 4E5KA 4BO8A 4CLOA 1NVGA 3MJVA 1HE3A 3CE6A 1X7DA 4J6FA 5JDIC 1M6WA 4BNGA 1WNTA 2OXIA 2VZ0A 2AQKA 3DTYA 2PR2A 1YB1A 3Q3CA 4MVJH 1LI4A 2XXBA 5G2OA 4XZ3A 4RQTA 2VWPA 3ICPA 4XQEA 3GF4A 1CEQA 1IZ9A 1E77A 3NTQA 4OO3A 3AY3A 1GPDG 5MDHA 2ZTLA 3L9WA 1QYVA 2J3JA 2X9VA 3B1JA 1X14A 1MA0A 1C1XB 3H8VA 2O4UX 1AHIA 4FFOA 2DUWA 2AG5A 3I9KA 2WJPA 3GGPA 4J1TA 4M1QA 1VM6A 4WLEA 1ZJZA 4XYGA 1ZSYA 2X5OA 4WASA 3RFXA 1I3LA 2YV2A 2GN9A 3WGHA 5I9MA 1E7WA 4A0SA 1X7HA 1H5QA 4ZJUA 4R54A 3I9JA 5KJ1A 1ML3A 1PS0A 3DBRA 1P44A 4OYRA 2PH5A 1MP0A 4BKQA 3FHLA 1WDLA 3NT4A 3GA0A 3F3SA 4U6QA 4YT4A 2NQ8A 2XAAA 3ZV5A 5CPFA 3F46A 7MDHA 1DC3A 3HZZA 4E3ZA 2WSBA 1O0SA 4CM9A 3H5AA 3JQ9A 1LLDA 3F4LA 1GADO 1GUFA 1I2ZA 4DREA 3BZUA 4XIJA 5IN5A 5DF1A 3LT1A 2C59A 4UVHA 3B1KA 1I33A 1A71A 3BMNB 4HFNA 1UXHA 2BELA 3CXRA 1E3JA 5K9ZA 2BD0A 3TL2A 4CLHA 3GPDG 4R5HA 3WDSA 4BIIA 4IIUA 4O0LA 2CF6A 4A03A 5L9AA 1VJ1A 4Q3AA 5THQA 5EIOA 3CUKA 3TF5A 3D5TA 1J5PA 4BHTA 4YPOA 5B4UA 2DBZA 3KUXA 4YACA 1Q0HA 4AICA 4EJ0A 1GQYA 2D5AA 2GN6A 2I66A 3MOGA 4PGFA 4BKOA 5CG1A 4QO7A 5TSDA 1VE9A 3RBVA 1OC2A 2FSSA 3WJ7A 1LDMA 1NPDA 1WP4A 3GVHA 2Q2QA 1P74A 3AUAA 3RBXA 3WYEA 2EW8A 5GZ3A 2HMTA 5DCUA 3WX0A 4KTTE 1BHSA 1PX0A 1BRMA 2FRDA 3C7AA 4RZIA 2GR9A 1PQWA 2OUIA 4YT2A 5C37A 1IL0A 4MKZA 4ALJA 2X58A 3WIDA 1DHRA 2O3JA 1DB3A 3FR7A 3JSAA 5COBA 3L4BA 4AJ4A 1ADCA 4XCVA 2PWZA 3EVTA 3WNVA 4J43A 3ZV6A 1YXMA 4IXWA 4I1IA 3DONA 4GPD1 2P2SA 2WM3A 1E5QA 4MVJE 4RVGA 1IB6A 3UGKA 1ULSA 3PTZA 1LDBA 3QSGA 3DQPA 4H7PA 1DEHA 1XG5A 1H6DA 2NVUB 4Y6SA 4BO3A 4XGIA 1O8CA 2B36A 2VT3A 4C4OA 3EHEA 1CYDA 4BO7A 1TT5A 2BGMA 3R0IA 1MC4A 2OBNA 2GO1A 4ALMA 1SC6A 3CPSA 1FDSA 3DBVO 1LNQA 1FXSA 2EKQA 4R9RA 1C14A 1P0CA 3ZWWA 1BXGB 4MVJF 4BNZA 3TZQA 2W2KA 1HDOA 3VZSA 3WFJA 4Q3BA 2GYYA 2DBRA 2E6UX 3I1JA 2A92A 5CP8A 4XYEA 4BO4A 4PG7A 1A5ZA 2VCYA 3H2SA 1ZMOA 5I7SA 1T24A 2GN4A 4F46A 3NV9A 2VHWA 1R66A 4W99A 1YVEI 4XRRA 3DHEA 4IGEA 3VPHA 3PP8A 4BNFA 2JL1A 4FC6A 4NK5A 4JBGA 2C82A 3MJSA 1HE2A 4DIBA 4XQGA 4IZIA 4I5EA 3GHYA 1TVEA 1Z45A 5A3JA 1PJBA 3DEYX 4HADA 1GR0A 3QVWA 1WZIA 4W82A 4E2XA 1BW9B 4XQ9A 3GMSA 3PHIA 4PLYA 4UVEA 3S2EA 3DZKA 4BNKA 3W6UA 2EG9A 4WJZA 1H6AA 4O1MA 1XLTA 1VI2A 4ALLA 1P9LA 4DQXA 4CV2A 4ZQHA 2WEKA 3GAZA 4BNJA 4CM6A 1SOWA 2DLDA 4ZA2A 3TZHA 1W6UA 3LDHA 1I2CA 1TT7A 2QZ9A 1ADFA 2OO5A 3BYZA 4AJJA 3FSRA 4CM8B 2FZWA 5A03A 5JNLA 4NDNE 5A1TA 5DCYA 4N7RA 5HS6A 3OH8A 1HZZA 2P4QA 4FBGA 5COAA 3RQSA 3RFVA 1H0KA 2OGUA 1D1SA 1YBVA 2NACA 4DUPA 4RPGA 3INRA 4CV0A 3SEFA 1ZMTA 1R4MA 2ZB8A 2NU9A 5FFFA 4FW8A 3KYBA 1Y8RB 4XDZA 4QT0A 2J3IA 3V1TC 3VHRA 3ZHZA 1Q0QA 2P91A 2FMUA 4RF4A 4XWYA 1VKNA 1KY4A 5C3MA 5DOZA 4IDBA 2WTBA 3ASUA 3VH2A 1Y7TA 3HSKA 1OC4A 2RBEA 1SNYA 4CJXA 4QX6A 4QXMA 4CUJA 2H1SA 1O89A 1LA2A 5GY7A 5JXWA 2V6BA 5BSEA 1AGNA 4J4TA 2AW5A 4JGBA 3PDUA 2XXJA 4FJ2A 1U7TA 1B2LA 2DPHA 2NQTA 2HMVA 4YJGA 1LLUA 3NGXA 3RFTA 2BFPA 4RO0A 2ET6A 3PHHA 4HNGA 1E3LA 4FFLA 1KOLA 2ZYAA 4ZICA 1ONPA 2E37A 3ANNA 4K6CA 3B20A 3QVXA 2HCTA 4RQUA 4BO9A 4YJFB 4CM7A 5L40A 3JQBC 1QLJA 2B5WA 4KDEA 4OM8A 4R01A 4Z0HO 4AFNA 4MOWA 3FRJA 2C29D 2PD6A 1JA9A 4J4BA 4IDAA 4DIFA 5CDTA 2UUOA 2EXXA 2BHLA 2VHXA 3QV1A 3RIHA 1SOVA 4B3IA 1QLHA 1LQTA 1KC3A 4NBWA 4LK3A 4OAQA 4XYMA 3GPIA 1RWBA 1UZLA 4R1SA 5AXBA 4E5MA 4K6FA 4JJIA 3U4DA 3WBFA 5DT9A 5TT0A 3MOIA 1Q7BA 4JQCA 1XYGA 1U5AA 1E3WB 4HFRA 4E32A 5IZCA 1W4ZA 4J0FA 1JDJA 4YQZA 3VKUA 4D0RA 1LQUA 2Y1EA 4CPDA 1FDUA 4CLRA 3L07A 2VUTA 1LLCA 3AM5A 4L8VA 3Q6IA 3QE3A 1MUUA 1P1RA 3JCZA 3JD0A 2VYVA 1HRDA 4KWHA 1Y9EA 1HSZA 1ENOA 3K6JA 1DRUA 1QRRA 1X1TA 4DLAA 4DGSA 3WNQA 1TT5B 4GSLA 1MLDA 1H9BA 4EUHA 3P2OA 4KZPA 1DHTA 3K96A 5AVOA 2C5EA 1NQAO 3ULKA 2ZKLA 1V35A 1NFFA 1PTJA 3ROQA 3RASA 1RM0A 2EWMA 4LVUA 3DBLB 4IJUA 4IDCA 1BMDA 4AJIA 2EP5A 2I9PA 2UAGA 3KETA 1MV8A 1K0UA 3BTVA 5TX7A 1UDBA 3GFGA 4X54A 4J9VA 4R5MA 3PK0A 5KIAA 1LSUA 2HK9A 3DOCA 5C7OO 1JKFA 2HMUA 3EUWA 1B15A 3EDMA 4M49A 2AA3A 3UF0A 4Y6RA 2QRJA 2C2YA 2I3GA 4DPLA 1NAIA 3L9XA 2O23A 2Y68A 3IIEA 1JW9B 4GMGA 2ZQYA 2GZ1A 3U49A 5G0SA 4EITA 2O3QA 3E5RA 4YAGA 1OAAA 3KYDA 4YJGB 3ZCXA 4YA6A 2VHVA 3HFSA 1YL7A 3BTSA 3BIOA 1V6AA 3W8FA 1BXKA 5T57A 1X0XA 3KYDB 3PWSA 2WD7A 3GDGA 3W6ZA 1U2DA 4Y8VA 4E2WA 1R0LA 3V5NA 4LVCA 3Q2KA 1Y9AA 4R3WA 4PIVA 4ZRMA 4HFJA 1IULA 4J9UE 3WLFA 5ER9A 3DBRB 3M2TA 2UVDA 3ON5A 4NQZA 3D7LA 3FPLA 3M1AA 1Y8QB 3DZIA 1VJTA 3Q2IA 1LSSA 2JD1A 1KVUA 1NQOA 3KSDO 3NT5A 1PEDA 3DZHA 3LT4A 3AJRA 1C0LA 1HYEA 4MP8A 4XGNA 2O50A 1LC0A 3WYCA 3MJ4A 1W0CA 1FDTA 3DBHA 4TKLA 4CM4A 1HETA 2WWRA 5J23A 1VLLA 3GGGA 2FOIA 1V3TA 3GZNA 3MTJA 2H6EA 3RC7A 3VDRA 4EBFA 5I7VA 2POQX 2Z5LA 5MGBA 1LEHA 4GI2A 1ZXBA 3KLPX 4NBVA 3DMYA 3MTGA 5EESA 1PZFA 2FPIA 3KRTA 3OIFA 2VYND 4GQAA 1AHHA 2D5CA 1KVTA 2JCXA 4J0EA 5CFZA 5CPBA 4NMHA 2WD8A 1BW9A 2GUGA 3GR6A 4ND1A 3GEMA 4RJTA 3V8BA 3QVOA 4YAKA 1WVGA 2GPTA 3ZV4A 1N8KA 3HB5X 4M86A 4GLLA 4NBRA 1HTBA 2DTXA 5JFOA 1ZO8A 3FCOA 3PYMA 3NDIA 4O63O 1I2BA 2JHGA 4FFMA 2EV9A 5G0WA 3VZPA 2DM6A 1VSUA 1PU2A 2J5KA 3FI9A 1GDHA 5DZSA 3PIIA 2C07A 4WNCA 3ZH2A 3I9LA 4R68A 4FN4A 4YTEA 3NT2A 3ROMA 1E6EA 1ZNQO 3GLQA 2FR0A 3WGQA 3CMCO 2J3HA 5JO0A 5DOVA 4LSMA 5JDCA 2AEJA 3K2EA 4NJOA 3VVCA 3VVBA 4CQMD 4QO8A 5A04A 3KHUA 1LDNA 3EAGA 3ZHXA 4PLZA 3Q9UA 3GZNB 3QRWA 4K28A 1K6IA 5THKA 2CDCA 1D3AA 1U3WA 4IGFA 3OA2A 2V6MA 1NM5A 5DBFA 5IDWA 1ZK1A 3AY6A 4ND4A 4UEOA 1IYZA 2C54A 4S3MA 5T6BA 4RVDA 2D2IA 1LU9A 3LYLA 4D0SA 3V2HA 1LRKA 1I36A 2PY6A 4FS3A 3ANMA 1CETA 3R3JA 2PD4A 3RJ9A 1E7SA 1JKIA 2NTJA 2QZZA 5TJ9A 1U9JA 4BMNA 2HO5A 2X0RA 3FBGA 4WCFA 5L7WA 3E82A 1E6UA 2Q1SA 1PZHA 1PL7A 5FI5A 1JLLA 3LU1A 4J7UA 3T7CA 2FY8A 4LSWA 3ZNNA 2O3UA 3WGGA 2WD7B 3QWHA 1CQJA 2D8AA 4RF5A 1EVIA 1YOVB 2X1HA 2ZYDA 3JQCA 4PVDA 5EL0A 3D3WB 1KETA 3RU9A 5F1OA 1IUKA 3NDRA 3NJ8A 4ROSA 3GG9A 4O59O 3T7EA 4G5HA 5CEEA 2YDYA 1PGJA 1PQPA 2EKLA 3I4CA 5JS6A 4YAJA 2GF2A 1U3UA 5HRUA 2PLAA 1SPXA 3UKOA 4XQCA 3DXFA 4W7HA 2I3AA 2VNSA 2PGLA 3O03A 4DQVA 3S2FA 4II2A 3UN1A 3ZWVA 7ADHA 3WMXA 4EJMA 3PFWO 1HDXA 2JFGA 2IE0A 1X0VA 1E6WA 4L74A 6ADHA 5ENDA 1HSOA 1R15A 1GYPA 3ORFA 1VPDA 4RGBA 2PKQO 4IBOA 2R2GA 4BV9A 2DQ4A 1U8FO 4F6CA 1DDOA 4E21A 3GH3A 3PDJA 3ZW8A 4WEOA 2X23A 4IQ8A 2W90A 1PWXA 1V9LA 2UUPA 1PJ3A 5TS3A 4DLBA 4P4LA 4JJFA 1U4OA 1SMKA 2QRLA 1J4AA 3JQFA 1JN0A 1BXGA 3ETDA 2VYVD 1BGVA 4MIOA 5T67A 3AOEA 4CLEA 5JMWA 3WICA 1GUZA 2OBYA 3UXYA 1N7GA 2GERA 2CVOA 2AQIA 3WTCA 3DBLA 5JDIA 2QIOA 3AWDA 5IDXA 3N74A 4WK6A 5L4NA 4L4RA 1DC4A 3DAPA 1EVYA 4RDIA 1C1DA 4Y67A 1QYDA 2DC1A 1P1HA 1AN9A 1DIBA 4OMUA 3H4VA 2GGSA 3SJUA 1ENZA 4U8GA 2GRAA 4G2NA 4K1LA 4CMBA 1L7DA 1OI7A 4YRAA 4R41A 3CSDA 3PJGA 3O8QB 4J7XA 4KDFA 2D4AA 3E6AA 2DFVA 3JD4A 4PFJA 4R1NA 4CL8A 4E5PA 5IZ4A 1BDMA 5F21A 2CY0A 4EW6A 4IMRA 4E5NA 3PVZA 1GEEA 3I23A 1VL0A 1PIWA 3JQ9C 4AJHA 3FTPA 4DC1A 3QWAA 2J5RA 4RF3A 3BMCB 3FD8A 4CM9D 1TA4A 2H63A 1DPGA 2OL4A 1M76A 2YFQA 1HDZA 4FOOA 1QKIA 4GX1A 3BAZA 4LCJA 1EK6A 3WQRA 1UXIA 2CD9A 3U4HA 3ITKA 1LTHR 5AQ1A 2Q46A 1DO8A 1MB4A 1R4NA 1I30A 3ANLA 3FPCA 4YJHA 5B12A 5L53A 4TRRA 4AVYA 2LDBA 1PSDA 1ZW1A 1M6HA 4PRKA 5B4VA 4IINA 2Q2WA 4E2YA 8LDHA 3K31A 1F14A 1NFQA 4YAEA 1ZK3A 2EW2A 6LDHA 1B14A 2AQ8A 1KIFA 1DFIA 4LW8A 5EQDA 4UUMA 5JO9A 3VPGA 4GBJA 3EC7A 4D41A
chains in the Genus database with same CATH superfamily
2I6XA 4Q1VA 4FHDA 3D3WA 3SS8A 2DHDA 4E2ZA 1O96A 4UFNA 3ANSA 2IFTA 4M9QA 4OPMA 3DYIA 2GK7A 4NYJQ 5FI3A 4F2PA 2VKTA 4XIYA 2IEIA 5IUNC 3IT1A 2R00C 1NQVA 2W2QA 4H0NA 2NU8A 4D80A 4HS4A 5A9TA 3GEPA 3ZKAA 3RRBA 1JIJA 1U7ZA 4QJ3A 1GTZA 2XDQB 3EVFA 4D82A 2C31A 2HK8A 3AV3A 1MIOB 4M9UA 3GLGA 3KB2A 3V4FA 3NBQA 1Z36A 3IPCA 4TYPA 2UYOA 3OZBA 3PKIA 2VYNA 2Z1MA 4JP2A 1K63A 1LK7A 4K86A 3VUFA 1VXRA 4IDXA 1D4OA 1ZCJA 4YP7A 4KXFB 1NAHA 1QAOA 2E6KA 2OCYC 2YV1A 3AR5A 2FJPA 2W6ID 1CUVA 2H4WA 4KXYA 5K3FA 4L5BA 1GEGA 3F5FA 4Y9DA 3AY0A 1WQ1R 1CJKC 1U2GC 3UVEA 3RWBA 4RPHA 5D00A 2BGWA 4MULA 5JZMA 1IBCA 3GFFA 1GQSA 1AB6A 2PZBA 2XWPA 3O4IA 2GHTA 5BNIA 3AV0B 4RK0A 2FSVA 1PYOA 3NWPA 1XTZA 4BRUA 1M0TA 3EY4A 3CNQS 1D7AA 2QD4A 2OECA 3A2MA 3F7TA 5L7YA 2W37A 4GWKA 1SU4A 5TC4A 4JBLA 4DABA 4NZZA 2K7FA 4F92B 1QE3A 4BMSA 3VNBA 3GP3A 3WSVA 1UBLS 2FI1A 4L9RA 4CLRB 3HJUA 3U80A 2QNIA 4UE2A 4HVLA 2Y3IA 4JWKA 1G6Q1 5K8LA 5AI6A 4DB2A 3I5AA 3OA0A 3H13A 4D4KA 1C9YA 2CSUA 2FKNA 4Q7LA 3THYA 2RGGA 3BWXA 4MUMA 4CLOB 1TCUA 4CM3A 1XFDA 1O97C 2PZ8A 5F9FA 2DUUA 5HJ2A 4EB6B 1KDPA 1GG5A 1ODSA 3T4UA 4X24A 3ZCUA 2JCGA 3QY0A 3EB9A 1UBTS 1EVKA 4L75A 5EMJA 1SUBA 3P2IA 3ZBTA 2VHYA 4E4YA 3SQLA 4QUIA 4B3TB 2CCKA 1HO3A 2BLLA 5HIJA 4Z0PA 2EP7A 4RCZA 3KSAC 3IHWA 1DGQA 1Q1GA 3SDSA 3ZD8A 1O9BA 2V03A 1QHYA 3HUFA 3N0TA 1K5HA 3WXMA 4B44A 4C04A 3URKA 1RZRA 2HWYA 4W6ZA 2P1DA 3L4JA 1WDWB 2EQ5A 3JVEA 3DDHA 3KPVA 3QV2A 3IBTA 4TT3D 3ZK7A 2ONZA 3MJCA 2WYVA 3JYQA 2JJYA 3QNWA 4O2AB 4DMFA 4BO6A 4AULA 4F5EA 2QM8A 5EIXA 4GDFA 1I4TD 1MB2A 3DWGA 4MKHA 4BLWA 2I67A 4B4KA 2B4YA 3NHZA 4ZQIA 2OK7A 2P9QA 2YNMA 1R0BA 2ZCUA 2DFLA 3UK6A 2XTAA 1KK2A 2X0JA 2ZK7A 4CODB 2C0CA 1Z6TA 3OEHA 3ECAA 1XK7A 4LE0A 4AK9A 3CKYA 1EAMA 2MWMA 3DBIA 2IYPA 2QLBA 1H2AS 2VRNA 3V46A 2VQSA 1K6XA 1AO0A 5DM70 2FW1A 1SULA 3FOZA 3AEQA 3KU4A 3PRHA 4QQNA 1P8JA 3Q7SA 2M6LA 3U5TA 3OZTA 4U6SA 3EH1A 1W2GA 4J2TA 3M89A 1YDFA 3RM3A 1I13A 1AUPA 1UZMA 3OQPA 2ZYGA 4H2DA 1D8TA 4RZ3A 3LX8A 4CEHB 2B30A 4Q1BA 5TEVA 4DCTA 4EX7A 2A58A 2X5KO 3KEQA 1RWKA 2PTHA 1FW8A 4BMVA 4W9NA 3P1JA 1EX6A 3L8EA 4JASB 2JDID 5E7MA 1O9HA 2IUFA 1FP6A 2AXQA 4KE6A 1CY7A 3FBTA 2PKXA 3RSFA 3M1IA 4M8SA 3D7SA 4TLCA 1IOZA 2GM3A 2RGAA 3IJPA 621PA 3PFNA 5EN4A 3LQ2A 2HA3A 4FU0A 5A3RA 1VPLA 2Z08A 3RU3A 1NJ6A 1WOYA 1H5UA 5BP7A 5KHLB 1XEXB 1BAPA 5BOVA 3FOAA 1NVEA 1P73A 1MX1A 1RABA 3FVQA 1LPPA 1KYIA 5JG7A 2J4FA 3AHJA 4B84A 1GT6A 1E0DA 2WTMA 3L2OB 1Z6ZA 4PS1A 1S2DA 1L8XA 2K6GA 4K26A 3L4EA 3SEZA 1MX3A 3PNQA 3E48A 2A0YA 3MYRA 2PQMA 1HMPA 1UXOA 1DTEA 2OHXA 1G2OA 1I5OA 1RWXA 4GLBA 4D46A 4RH0A 3WLMA 5GIOE 1KOFA 4LJLA 5FNVF 3PXBA 4UBOA 3ZY6A 1T8UA 3F5QA 2BGLA 4JU8A 4BV8A 3JQAB 3WLRA 4N7JA 3PUYA 4YQEA 1QGAA 3C3AA 2OFPA 2PUDA 2BGKA 4JELA 4PSCA 5G3YA 1NHWA 2ZW9A 2VZ9A 3TFQA 2A78A 1KI1A 2WVAA 2RGBA 1SCQA 3CURA 3I9MA 3AJ8A 4JUDX 3K8OE 1SZJG 3U48A 4YCMA 4Y6LA 1AGXA 2II6A 3RUIA 3V33A 3X2FA 4BDTA 3UYKA 3C24A 5BO5A 1XAJA 4RSGA 2D54A 2H57A 1IM2A 3HN2A 1ZG3A 1FNSA 4OFZA 5HCIA 2IPXA 4NY1A 1JPNA 1K7XB 4NV1A 2Q5HA 4CUZA 2XIJA 2VSFA 1RCTE 2WINI 2MDTA 2WQZA 3A1FA 2ZZKA 4BGDA 3TE7A 5C8YB 4FEYA 1PN3A 2HFKA 4PR0A 4HDOB 2H7XA 2WA2A 3BHJA 3WK9A 1CUJA 2OO7A 2Y2UA 4OI2A 2PTGA 16PKA 1XEWX 1ZD8A 4NC9A 5EZ6B 4PYJA 4M53A 5AVZA 2CHFA 1TKRA 3FVWA 2G36A 3TOVA 2YV4A 3IR5A 5TT1A 4I8DA 3GHHA 4RPIA 4NTZA 3ICQB 1ORVA 5LLSA 4IDGA 5DISB 1CF9A 2X0EA 4HAYA 4X6UA 1QOPB 2NZXA 1ZDMA 3P97A 4EEZA 1QRSA 2HC9A 2IEYA 1QTQA 4R05A 3JALA 2IYWA 3T1OA 2C3OA 5EHNA 4Q3DA 2ZBPA 3WK8A 5LQRA 2YWHA 4DSTA 3IV7A 3LMKA 1SEVA 2WKSA 3CUSA 3QP9A 4WT7A 4AJLA 4PG4A 3I09A 3U1VA 4GL2A 3UB4A 5KNLA 3N6XA 4NOMA 2Z2YA 3RFFA 3EGEA 5KMGA 2WHPA 3C2QA 4EK9A 1FP7A 3GVCA 4ZHSA 1WV1A 4FS8A 5KWEA 1LLQA 4F45A 5FJIA 1LH0A 1W59A 2BGGA 4YQFA 1RCUA 3PFIA 1UK7A 3E0QA 1VMDA 3CV3A 2P2LA 3LFTA 1N8NA 3RROA 3LQKA 4Z3DA 3EPKA 4M54A 1YONA 4CKEA 2C2OA 4CKCB 2BCJQ 1EGQA 3K9HA 2IH5A 4URWR 1O6ZA 4NH4A 4EVSA 3K9LA 1GU1A 2C9CA 3WZ2A 5JUWA 5A4FS 3RIEA 4ZK6A 4IQGA 3NIBA 4CDNA 3TG2A 2OYRA 4OTZA 4YO8A 2R48A 1DOHA 3QMMA 1KDYA 1Q7CA 1KMQA 4XM2A 4JBYA 2XCRB 3DHYA 3MG9A 2V7VA 1H2ZA 2ZVJA 3N39C 1OIXA 1EWTA 1ZUWA 3QOFA 3F97A 4D8XA 1ORTA 1FYXA 4NXMB 1CY0A 1DUIA 5GONB 4FJ0A 1G6OA 2JJ1D 2VPTA 3FYCA 1KYYA 4WDRA 1FBTA 1GTG1 1UADA 3RG8A 5KPJA 3CKMA 2AFIA 1HDGO 2IXGA 3DMTA 3HCAA 4IXDA 5HUQA 1JHQA 3LUJA 5TLSA 2D59A 3ZIUA 2E1PA 2AEFA 3DB1A 3QOYA 3R2JA 4D4MA 5BSKA 1BSVA 5DULA 1M1XB 1YTLA 1IBKB 4DVGA 1JYSA 2D1SA 1BQ4A 2HTFA 2WG0A 2BISA 5FWXB 1SHTX 1WCIA 1QKKA 3ITEA 2ZXUA 4HWKA 1TJNA 1UKCA 3AEXA 1NMXA 4RVCA 2EZTA 4MCIA 4WUVA 1GA4A 3U4GA 3ZJ4A 1EQUA 2NYRA 2QA5A 2XVAA 2OV1A 1GU7A 4OQ4A 3TCXB 3WK6A 2IZ5A 2BM8A 1KZ9A 3F78A 1SCJA 2W4MA 4JT9A 4AWBA 1YQEA 1F0KA 4MUXA 2NVBA 5C46F 5ESRA 4WKBA 5H4HA 5SY4A 4F9EA 4OLBA 1CY6A 3MRVA 1NLFA 4IG4A 3KZVA 2ZUTA 4RE6A 4B8ZA 3W8RA 5KNCA 1P91A 2BFOA 2F1RA 4GECA 4J49A 1YBHA 4JZYA 1Z7BA 2EZ8A 1WF3A 2QYTA 1TQHA 2MYPA 4MAFA 4KDCA 5F77A 4A91A 4D8UA 1NBMD 2ETXA 4RXTA 4JVOA 3UH1A 3PDHA 5DNUA 1C3XA 4RH1A 2XGOA 3ZVLA 1JRLA 1XALA 3F2VA 5IAAA 5TVGA 4R1UA 4BGVA 3GEGA 5DX1A 1YRLA 4E7PA 4FWBA 4AZWA 4PW0A 1G0OA 3E5NA 5ICFA 4ALKA 5LQCA 4RX1A 1PGNA 3OQMA 2V6GA 5IVHA 3ZWXA 2H8KA 3S7TA 2PMEA 3G5TA 1XZKA 4ALNA 1CUCA 3SLGA 3BXOA 2JKVA 4OHVA 1K3TA 4WLNA 4EHAA 3SBDA 4CM8A 3IXLA 2QL6A 3QF7A 3O2SB 2ZREA 3I0NA 3U0BA 3QHAA 3HI6A 4LCEA 5EE1A 5FTLA 4X00A 2IIPA 4MIKA 1SU7A 1TF5A 4GOJA 2NU7A 2O07A 3K16A 3OZVA 4BX8A 3UT6A 4DA4A 1T8WA 1XO1A 3FETA 3X1MA 4GO1A 3A1CA 4HNVA 1CFJA 3EEFA 5AI5A 4OH1A 1SELA 1TUIA 1RXWA 5FB3A 3NEAA 2FGKA 2KE5A 5JD4A 3LZ6A 4R98A 3RDPA 1L8QA 1PUJA 1GVNB 1Q6YA 1QV9A 3EARA 3AEQB 4BJ5A 4DTCA 3VYVA 2PAFA 4GLJA 3NNNA 3CF0A 4R9SA 3QVTA 4FGKA 1AZTA 1ZN2A 1RM4A 4BNDA 4M46A 3BUSA 1XEAA 2ATIA 5CHEA 1Z75A 4RVHA 5DTMA 3IE2A 1J0EA 5CEJA 1EIWA 3OO0A 1REQA 2QTZA 5KTSA 3TVDA 2AEMA 1ETUA 5DJ5A 1KEKA 1Y5RA 4H6PA 4B3DA 1F17A 3M5WA 1RXEA 9LDTA 3NRJA 1IJFA 1RJWA 1T4GA 3ELDA 4J7AA 3RCBA 3VTKA 1A5TA 1NBOA 1QZ3A 3P7MA 5AK0A 4DV1B 1YS4A 5BMOA 5IXSA 5M29A 4MV6A 2XVMA 3MJHA 4B74A 3HEMA 3OQOA 2ZYUX 2WG2A 2ZJ4A 4G25A 3R9XB 1RLOA 3RT1A 2Q6IA 4ILEA 3CLSD 1OVGA 2MCFA 3E9CA 3LD9A 4RDXA 2IQ5A 1QTRA 1W5EA 1J1ZA 3GA5A 3PQFA 5SY6A 5L6MB 4JCOA 4EVIA 4S0ZA 1RC8A 2C3YA 4Y2XA 1E5DA 1UK8A 2CFSA 3E5HA 3H2JA 821PA 1TVKA 2NVUA 4MRMA 4N01A 1CF4A 2YQ5A 1SURA 2YWRA 1BTOA 1Q3HA 3QQPA 4BOYA 1ZH6A 1P5RA 5CR9A 1PVDA 4G1CA 5HJ5A 1CY2A 4F86A 4QASA 4G0PA 1ZGJA 2C8LA 4QHTA 3KYJB 4BMCA 3OPYI 1DCTA 1N5RA 1P8AA 2XUKA 4EY4A 1IEXA 2P30A 3L46A 1ONSA 5AKYA 1K8ZB 2QQ0A 4PANA 3IQIX 2AL7A 5JYBA 4ETNA 1WW3A 2WHXA 1JPUA 2FPIB 3HHPA 1J9ZA 1TZBA 1RADA 3DR5A 4JI0B 3RLIA 2ZIEA 3V2GA 4Z1OA 2ISSD 3JZDA 5HIKA 1TC2A 1XMPA 2E5FA 3IKTA 3CZAA 5TMDA 2HJSA 3CJQA 1A4UA 1JZQA 3DYVA 3IDQA 3T4EA 2B37A 3D2CA 1CQXA 1SVUA 4JNCA 5H59A 5LLTA 1G21B 4EO9A 3KJNA 4WLFA 3GZJA 1USVA 3GBVA 2P6OA 4JN6B 5HKLA 3SQOA 4DQKA 3I83A 3U7HB 1R2QA 1EWYA 3M70A 5KX5F 3BBPA 3C5WP 3JQDA 2ADMA 3W04A 5B30A 1ZKMA 3SX4A 4FMCB 2CLOB 3FNGA 3IHKA 4GGMX 1XLVA 3WFZA 4RNDB 2RKOA 4UPEA 4ZYLA 5IPFA 2ZZMA 2YHUA 3N75A 3IP8A 1H23A 1BA3A 4IDUB 1XK6A 5ICSA 1JXQA 4JC4A 5G1NA 4CT5A 2PH7A 2QB5A 3H11A 5B64A 4WKNA 3GLTA 5KYTA 2JIZD 2A1TS 4KQCA 3LI2A 3NYRA 3F5MA 2J3EA 1DBPA 3Q10A 3C1AA 4DCVA 2RARA 1L4YA 1X7ZA 1Q11A 2PSFA 4KKXB 4O5OA 4ZVVA 4DCOA 2IHJA 4EKIA 3G23A 3JQEA 3DMDA 3NDJA 4FT4A 2VLBA 5CDYA 3KTOA 4DHEA 4D8YA 3EYAA 4ZD6A 1XMQB 4HWGA 3QWBA 3RJ5A 2WMYA 1ZD3A 4WGGA 4IZ6A 3AGPA 5IULC 1H9CA 2FPKA 1X80B 3PE3A 3TMKA 3AX6A 4ZVSA 4J76A 4I1VA 2A5DA 3HC7A 5NULA 1T6BY 4LRSB 1TW3A 2IGBA 4LHVA 4D4IA 5B7QA 3VZQA 5E7IA 2BBTA 1W36B 1DBQA 3R5HA 3SHOA 2IZZA 2JGDA 2ZWIA 3D0KA 3D6FA 4AO8A 5A05A 5LQAA 1CZRA 3MT0A 3QH4A 4OXNA 1J1IA 4OA5A 2QTLA 1VJDA 3DZGA 2GJSA 5FNVA 1FFYA 2D5BA 3KVYA 2Y1FA 3WRXC 5LFAA 3ADOA 1IBRA 5EHIA 3X44A 2DWPA 2J67A 1K4YA 3LWNA 1N2CE 1YQXA 3NHBA 2CD7A 3WKEA 1WY7A 3UMJA 3UUEA 3D8HA 4DDHA 1AURA 4G0ZA 3G1TA 1ADBA 2NYAA 3HXKA 3HH8A 3H84A 1J0XO 1M1YA 4BX9A 1BX1A 1XJQA 4NG5A 2NADA 1W49A 1ZZEA 4L9SA 1U94A 4WY8A 4RULA 2G0NA 2JFHA 3GGDA 1BU5A 4A4DA 1QDUA 4CKWA 4LC1A 3U6BA 4GKKB 4HBGA 1QB8A 4K3UA 4OUDA 3IIMA 5F3RA 3RC9A 3VPXA 4DNPA 1PNQA 1RM3A 1U9ZA 4FE3A 1CERA 2PS1A 4IDNA 3IUQA 3JZFA 1A4RA 1I3NA 4YT5A 1G3QA 1SOMA 2ID8A 2JI7A 1ORDA 3EZXA 1PS8A 2ZTUA 2HBQA 2ASVA 3C0KA 4AJ1A 1CJBA 2J48A 2BTEA 4JI4B 3CG0A 3FKJA 3K20A 5LOVF 1R0SA 3HL4A 4EUSA 5DKFA 1JQ3A 4KN8A 3L6OO 2CEAA 1LVGA 1MO2A 3H1TA 3V42A 1V45E 1ZSNA 1I6LA 3PHGA 1K7YA 4DVJA 4F5WA 3IMFA 1EHIA 4Y0VA 3CUEF 2PUWA 3W34A 1OREA 1AQNA 1RI2A 1XPUA 2G0TA 1RACA 4EI2A 4OOFA 2F9LA 4J16A 3KSUA 4QQ8A 1P2SA 3LW7A 2JLUA 5UKDA 1OBFO 4E51A 3GMDA 3OFJA 4B1FA 4RGQA 2F64A 4E1VA 1DMSA 1P1BA 1T4MA 2FSFA 3ZU5A 3JYNA 1XQXA 3KB6A 4IWNA 4W1SA 1PHPA 1M74A 2A0FA 1MKYA 2OAGA 3R7WA 1HZJA 4JLSA 4BUCA 4EF6A 4I0WB 1MTOA 3A4LA 1Z83A 4J0QA 4RY9A 1U6KA 3GROA 2YRWA 5E4TA 4E07A 3AI7A 4YMHA 1OROA 2C3UA 4B71A 1DXOA 1M9NA 1Y1SA 1I9GA 4NJEB 1UK6A 3BMOB 1PCXA 2XGGA 3WIUA 2BJWA 3OBBA 4B6PA 4EAAA 3V1LA 4A9AA 4W1RA 4GP6A 3HP1A 1G55A 1BROA 1WCWA 2I6FA 4FFBA 4PN7A 1FFBA 1KA9H 4V0QA 1QJCA 3PUHA 3HCPA 2BMFA 3FM9A 1F4LA 3QXSA 1JQAA 2ZSKA 5E4JA 4A8PA 3CVVA 1L9XA 4ASUD 1FB5A 3TM5A 1U5BA 7ABPA 1YRQA 3NHFA 1Y1PA 4Z4FA 4P08A 5GVRA 4Z0TA 4KN5A 2GEKA 1V6CA 2I33A 4RPKA 3LCJA 3VSDA 1N2GA 2HGZA 1T0IA 5BNTA 4OL0A 4WN9B 1KP9A 1NUQA 1EXVA 4L3WA 3OX1A 2ZATA 1Z47A 2JH3A 1XTPA 3PXXA 1YB5A 1KJJA 4MW7A 4EYKA 1VB3A 5I01A 3OE7D 1TQ8A 2ISCA 2CNBA 1F8GA 4RL6A 4XSHA 4C0SA 2NV0A 2YWJA 4FSDA 1S01A 5K0EA 1ZKDA 1YDGA 4FMPA 1T2CA 2R8XA 3EC1A 1GA1A 3ETGA 3LHDA 1P2VA 2E49A 4AO6A 5J1SB 2WV7A 2HK6A 2YY5A 5CU7A 5BWMA 1QCCA 3AERB 3ABQB 2JFFA 4HZUB 4ATNA 5C7IO 2ZZNA 3EZFA 3WMWA 1UBGA 1VE6A 2P4HX 4JJGA 2B7BA 1W0JD 3MUEA 3BWCA 2HQRA 2IGTA 5FOXA 3COZA 4HB4A 5K8CA 2UU9B 2OFWA 4BTEA 2QGNA 1Y0BA 1EM8B 1V7PC 2W00A 4Q16A 4XTRA 5D5QA 1RIFA 4YCAA 2YV3A 5KSOA 1ZITA 4ZGGA 1T9BA 5DBOA 4CKEB 4HGYA 4H7JA 2O2GA 3VH4A 3OTIA 1DZ3A 3HVJA 5JTUA 3BGSA 2C2XA 4WK2B 2QV0A 4Y2SA 1BEUB 4P9NA 5HKBA 3FUTA 1VYHA 2FE1A 3WNBA 2MSLA 3W1WA 4OLAA 3NOQA 4G3XA 4XOUA 2B35A 4QUGA 2FP4B 5C5IA 3ED1A 2ZRHA 2FGJA 1NF2A 4TX1A 3S44A 2AI2A 1XYYA 1SA0B 1X9IA 5B1DA 3JS5A 5BSVA 1ZESA 2BCEA 2JGIA 4EKDA 4XYLA 1N5OX 1R18A 1CRPA 2CT8A 1F2VA 3IPXA 1Q44A 4K40A 5HUHA 4JNGA 1SUFA 3CRW1 3TRJA 3AFNA 1LPNA 2DYKA 4YIHA 1HE8B 1UM9A 2WSSD 5JFTA 3RAGA 3DDZX 4QYIA 5J9FA 2XNDA 1T1EA 4ZXFA 2IXFA 4DLLA 4ENVA 5MN6A 3GB9A 1ZJ6A 4XB1A 2H1OA 4GD3Q 2P9ZA 2E4VA 2R7LA 4B7CA 3UK0A 2IW3A 3VZBA 4E4TA 2QBYB 1X94A 2WT4A 1P2UA 4M60A 5KSYA 2HCRA 1K0FA 2JI9A 5LU8A 1P5ZB 3KBBA 3RRYA 2PZJA 2W98A 4MB6A 2NTVA 2XBUA 2Q41A 4U5QA 3R8XA 3VPFA 4HAIA 3WO1A 4Q02A 4Q6BA 4ZV7A 1F38A 3HEBA 1H3EA 1QP7A 2AMJA 3WNZA 4G01B 2O2SA 4ERNA 5IEBA 3ST7A 3JRXA 4MJLA 3H4IA 4ND6A 3DOHA 1IHDA 4HQNA 1IN5A 4F72A 5IK2D 1X42A 1Z8NA 2QDXA 2R9VA 2G28A 4Q1DA 5DEIA 5LL6P 1B0AA 1DLIA 4EPXA 1KO7A 1NWCA 4N6OA 5EFZA 1DE0A 4GPAA 3DMNA 1ULUA 3QLUA 1KYZA 4HN2A 1B8VA 1JF8A 3G68A 3I2JA 3PR1A 4Q82A 4XDGA 1PG5A 2Q27A 1FMTA 3SYRA 4IGIA 3P9PA 3I76A 3T9BA 2Y66A 1A7KA 2WZDA 1GITA 3KR9A 1P0IA 2QTGA 5J1TB 4K2AA 2HA6A 4P5DA 1ZK0A 1M2GA 1VSVA 5CVDA 3DDOA 1PFGA 1UBKS 3KT0A 1BWPA 4ID9A 2DT8A 5KSWB 2G5CA 3FR8A 2ZLBA 3BE8A 2PFKA 1OFVA 2BTQA 4X45A 3RYFA 4KRYA 4EUFA 3L0PA 3SK0A 2YFHA 4RV9A 4LVNA 2R8YA 3KYCB 3BZWA 5JCJA 5B36A 3IQDB 4XVCA 4UBKA 4TZTA 3KL4A 3Q5EA 4KN6A 2QAGC 1QOZA 1R6DA 2R8PA 2VKQA 4NFHA 4F4UA 4GXQA 2DY1A 1U7UA 2FZVA 3LHSA 5LDGA 4Q9AA 3OM0A 4M38A 3VOAA 5AVSA 1N77A 2WYIA 4Z9AA 1RYHA 5IT9A 1XXLA 3AILA 3BFJA 3BJRA 4JNKA 5BNWA 3UCXA 1RI3A 5JSKA 3A6HA 1YFJA 4M4SA 1B1CA 1J09A 2H16A 1R8JA 1Q84A 1SQGA 2DFDA 2VNHA 4N49A 2YBDA 4PNZA 4KPYA 4MVJD 5KQLA 3DXZA 3ESCA 5DFAA 5DNDA 1G8GA 2GEJA 3GA7A 5HEKA 4K9KA 1JAHA 2CXNA 2IEAA 2NZ8A 3ECCA 4TV8B 3TDNA 3TFOA 1KARA 4MVJP 5K2OA 2CBXA 3UHOA 5FR1A 4QOEA 3VR5A 1T5HX 4QECA 2BTQB 4MRRA 2FPOA 3RYFB 2ZDHA 3D64A 3B36A 2BP7A 1YS6A 3EQ8A 3LE8A 4H59A 2GTHA 2I8LA 4BB6A 1SVLA 1RM5A 1ORWA 3LDFA 1FFSA 3ZHYA 1R3DA 5GOZA 1ICEA 1BVYF 5BW8A 1OBVA 1A7AA 1FDIA 4NZNA 1T9HA 4Z8XA 1M2EA 3OICA 2GAFA 4UNPA 2B9EA 2A35A 2AOVA 2Q62A 1C2YA 1Q0ZA 1N5JA 1J07A 2C4NA 2PD3A 2WE8A 3P2YA 4OQLA 4S2UA 4DMLA 4ZI7A 1KJ9A 1GTRA 1UPXA 1NVKA 3IAEA 3T9FA 1W75A 1DQRA 4CMEA 2PJUA 1MABA 4I9HA 2PJRA 2Q3EA 2D2XA 3UAVA 1IN4A 1E2QA 5IAJA 2NP7A 5G0VA 2LRHA 1ZGCA 2M9MA 1FNNA 2REBA 4J0GA 5JBNA 2PZFA 2YS6A 4MV9A 2WYHA 2B1QA 3THXB 1RBQA 3GLRA 5E6SA 2XMZA 3A0RB 4PLCA 3G49A 3VYRB 5IKMA 2BBOA 4ESHA 4MPDA 1GXSB 5E2AA 4WOKA 1YVDA 3ZHOA 2FWRA 2JCYA 3ID6C 3TGLA 2WWGA 3B6KA 2IOFA 2WV9A 2GBCA 4RYDA 2W2LA 3CCBA 3ODGA 2V6FA 4HPJB 3QX3A 5LIRA 2JAUA 2NNWB 2P6MA 3EAQA 4RV5A 3L1IA 4CEHA 1OYYA 2HIHA 1JJ7A 3QPVA 5GJCA 1QQ7A 2JW5A 2ZI7A 3SQMA 1ACLA 2HU2A 4A5OA 3ILVA 2HNBA 4UAUA 1JHAA 2FFBA 5F9MA 1UKVY 2BGRA 2V7TA 3AR4A 4UAVA 2GM5A 4M7OA 4Z3KA 1EVQA 1L5VA 1W4BA 1NXSA 1QHNA 4FLMA 1Z7WA 3FWNA 3A7DA 5GAJA 5ENVA 4DJTA 4F3RA 2A4KA 2PSEA 3K73O 4NK4A 1O57A 2P1RA 2FX5A 1T91A 3CE9A 4L0MA 4KXXA 3AOGA 4MS1B 1K8RA 3UJBA 5JSHA 5I8WA 4KVFA 3EVAA 4Q4AA 1IQ0A 3QU5A 4I08A 1YE3A 1L7XA 3RSGA 4GXTA 5HQ3A 4WI1A 2GCOA 3U5ZB 3GDOA 4FYMA 3OLWA 3EPRA 1ZMRA 5IG2A 4OBEA 2VF7A 1ESDA 1SCDA 1PSZA 5C81A 5KQGA 1LBHA 4GKBA 5F7XA 1N6PA 1Z5PA 1GCIA 3FKQA 2YN4A 1IHXA 3WSTA 5KOHB 4DV7B 2PRJA 1A8UA 3ILXA 3P5BA 4L27A 4MS4A 3P8ZA 4NPCA 2A5FA 3B2NA 3ELBA 5DN9A 3O38A 4DZZA 1A9XA 3A4IA 4CETA 1NY6A 2QSYA 4FUQA 4TWRA 4F71A 4FGZA 1UWVA 2W22A 2YIDA 3K09C 3Q72A 3TNJA 3PQDA 1V47A 3SJ7A 4TVKA 1K08A 3OQIB 3NRBA 1XZAA 2P5YA 1IATA 4AZTA 3N0XA 4UARA 2EF1A 1BE0A 1KH3A 3QVSA 5SZHB 1BQ3A 2PMBA 3GRFA 4FDAA 3WO0A 1I7DA 4C6TB 4OGGA 3N8HA 4H1VA 3FOFC 4OKNA 3KE9A 1E64A 5JH7A 2VTEA 4G0UA 3L4SO 4FCVA 1J22A 4AMYA 3ZYZA 3MGBA 2W2OA 3F6SA 3G2NA 4FFVA 3P96A 3K0SA 2EDAA 5TQ2A 2WZQA 1O7JA 5KB3A 4N3BA 1SB8A 3CZ4A 1JB9A 1S6YA 1E1QA 4FZJA 1JHPA 3K53A 3MVEA 4JBHA 5MFPA 1QG0A 1AX9A 2ZAIA 2ZBVA 3DW3X 2ZCJA 2FG5A 2GK3A 4XTCS 1A95A 1DRVA 2KLHA 3NEPX 1MQSA 1UDAA 4AL4A 4O4JB 2I4NA 1DIRA 4MCAA 3RFUA 4XB2A 1C3LA 3UNXA 1S9HA 4MVJM 4MXDA 5GGXA 3FG9A 3FGPA 3GUVA 1C9NA 1RC0A 3IJRA 5CJ2A 1OFUX 2WWWA 3WG9A 2YC4C 5CYFA 1WZCA 3PA6A 3C85A 2OR3A 1KO5A 4HYEA 1V4NA 1IHUA 4NBUA 3WLJA 3SC6A 1T1RA 4HXGA 2ECPA 1KEUA 2RBGA 5IWCA 3A70A 3DE1X 4NBKA 4IX9A 3R7BA 5L7TA 3GEHA 2AQHA 3LUAA 1Z0JA 2FG6C 2R25B 3O7WA 3RT9A 4QDUA 4MKRA 3C39A 2PANA 4ZU3A 4DUZB 3KZCA 1DEKA 2UYGA 1DBRA 1TJ5A 2CE7A 3F67A 4TTIA 1YNOA 3STWA 5A5EA 1PEYA 4IVRA 3T5GA 1B26A 5FBZA 3VC7A 2I1LA 3TZKA 2H3HA 2XIQA 2Z98A 1GZDA 2XKBA 2C5BA 5KYWB 1X7YA 1ZGBA 3UC9A 3DD5A 5L45A 1VBFA 5JY6A 4B7XA 1KMIY 1ZEMA 2NPIA 3P2KA 1QYWA 3U61B 3NVKI 4CMIA 5LP6C 1KQ3A 1FXWF 2E9SA 2PSDA 4YB8A 3AKZA 1T36A 2HHJA 2XOXA 1NVUQ 5LCXA 2C5LA 1XKXA 4S2EA 2ZAYA 4PM4A 2DULA 4IJKA 2PCJA 4MUKA 1QF6A 1EE9A 2RCNA 3DMTC 5F4BA 2ZXFA 4GP9A 1XCLA 1Z37A 4XWTA 4DMHA 2R47A 1V5EA 2A59A 3UFXA 5HMLA 3QY9A 1MG0A 3G5MA 3O84A 3CR8A 4QDOA 4GX5A 3OCZA 4Y2UA 1MAVA 2QGZA 2XZDA 2PHZA 2VNAA 3SPXA 1JWBB 3HB4X 4M9SA 1GGFA 5FXMA 5CB6A 5IX8A 3IUNA 5E9WA 3K0AB 2DZDA 1TKAA 5IC4A 4ZN6A 5TQJA 2LWIA 2I22A 1MU0A 4URFA 3RAJA 4RTSA 1R37A 3MWFA 1OXTA 2FW8A 1V39A 1ZMXA 2XKAA 2V0CA 2GBFA 3OO1A 3BL5A 4EHKA 2VH5R 2WM9B 3NRCA 4WPGA 1JR3D 1UBNA 5C5EA 2QRVB 2PXCA 4CKWB 1NLUA 4XWGA 1I51A 4RMNA 4DJ5X 2HYIC 1K8XB 2JAHA 4RMJA 4C0JA 5BYKA 5JJ5A 2V45A 1WB9A 2ZB4A 2DUMA 3D4PA 1D2AA 3I92A 4FFPA 3VO2A 3LW8A 4IZOA 1PLLA 2YIMA 3O75A 5LLDA 1E59A 3V4RA 1UAGA 2ZWOA 3B48A 5JJBA 2VA9A 5SYNA 2EGGA 3W5SA 1UDCA 2ZRPA 3PQEA 4O2LA 4NS4A 4AZ0A 1CS0A 2HXGA 2QMQA 3HKEA 4GXRA 3IAUA 4HUQB 1X8KA 2VQ3A 3EISA 4P31A 1ZP6A 2BI4A 1F06A 2H7VA 5LC1A 3UAZA 3WJAA 4AP6A 3W1EA 4PC3A 5AT1A 4RIEA 4G23A 5J40A 3K8ZA 4O08A 3K6KA 3EFOA 4JKYA 1FA9A 2W9XA 1E3IA 1C1DB 2XUAA 2IYAA 3O7MA 4QTTB 5ERYA 5FUBA 5C1BA 4I2NA 1QNFA 4G36A 1M8JA 1TTPB 2FJ0A 3QLJA 3PGLA 1MMFB 4RKWA 3SICE 3WLQA 4DW8A 2B83A 4A0RA 1YS2X 5EHXA 3OZSA 2MSEB 4LYEA 2GDZA 4OLFA 1VLZA 1A1SA 1T5BA 1U7HA 3PS9A 1YQDA 5LQMA 1UT5A 3EXIA 3KTDA 5AM3A 3ZV7A 2FQYA 1H93A 4F1WA 3TDMA 4DLTA 1CF2O 2WUDA 3W05A 2GVDC 5AHRA 1Z0KA 2CNWD 3MTAA 5JARA 2OLEA 3ESQA 4E6PA 3T1VA 2Q1WA 2I6QA 3I2HA 5C53B 1XZCA 3ZHRA 1TK9A 4CHGA 1M1YE 3OTQA 5L4LA 1UBJS 2YIVX 1H6CA 2HOQA 3C6QA 3DLTA 4MQUA 4ZQBA 2FW6A 1N7IA 4LX8A 1KFJB 3VI3B 2IUEA 4JJ7A 3V8QA 3P20A 4HDMB 4QHSA 4QREA 2C99A 3PITA 3P26A 5LZ5A 4DNXA 3I6IA 4DSAA 4AWXA 3L8ZA 5EPUA 5I7HA 1UC9A 3F2IA 3JARA 2BYTA 1G3MA 3OLYA 4FZ5A 5DIFA 1WEKA 4MCJA 3RJMA 3DULA 5C18A 4DG9A 3KX2A 5DHSA 1V96A 3H0CA 4ZMRA 2NP6A 4KXMA 3EULA 2XDAA 1JU9A 1SD1A 4R8MA 3LGSA 5TJHA 1OTXA 2IX9A 3B51X 3QGMA 3PNBA 1JR3A 2B1GA 3IDFA 5CBKA 4MUFA 3HDVA 4R4JA 5JS7A 1KPIA 2QN3A 3CNNA 1Y8QA 2X14A 2M98A 4X8MA 3SMVA 3HCWA 3RUCA 1P72A 3VPCA 5FD8A 1OB5A 5HR5A 3CJRA 1E7RA 3FZEA 1PJZA 2ZUCA 1VJ5A 4N18A 4MRNA 3N53A 2HMYB 2JLAA 2HA5A 4J2OA 4NDZA 2OOKA 1KI3A 4RVOA 3KIPA 3EGDB 4UOEA 1SVIA 3EGOA 2WR8A 5DMHA 4Q7QA 2J0QA 1EK2A 2L19A 5LXTA 3FNFA 1F20A 1FK8A 2XLBA 3ILSA 4QXPA 4BGIA 5A4MS 3D5EA 2E5WA 1E4EA 3ZN2A 4MRMB 4RQUA 3CWCA 2A7XA 1V95A 1PV4A 5CDFE 1MX9A 1UMDB 1XCJA 1N1EA 1Z4PX 3FB1A 4FYKA 3N6VA 4J0HA 4JQSA 4PSVA 1GQ2A 4WFQA 5FOVA 2GLTA 3G0HA 1IONA 4QBTA 4DNFA 2Q1XA 1YOBA 4HVAA 4IVQA 1F4VA 1U11A 2JJ1A 2YMLA 2ZT6A 5G0UA 3PKZA 4KQEA 1L4LA 3Q40A 3PT9A 1OFIA 2ZWPA 3NC4A 3OZXA 1QP8A 3VGJA 1GM5A 1KGSA 3OJFA 4ZV9A 1C2TA 5HOEA 1NASA 1Z35A 1Z8DA 2WAYA 4IQFA 3WMGA 2XODA 2Z3ZA 1FDRA 3N87A 1KORA 4QUEA 1U9CA 1KP3A 3C5HA 2GHIA 2WOOA 3PLRA 2B4TO 3B9BA 5DP2A 3KBOA 4XUDA 1GTVA 2NQ2C 5EP2A 4IIJF 5HM6A 4OFXA 4NBSA 2OWDA 4XLZA 4B73A 1PJQA 3ZE2B 3KR0A 4IYJA 1UDWA 4CIYA 3LKZA 4QRDA 1KR5A 4W7IA 3JAWB 1O6CA 1YQTA 4QYSA 4H0FA 1CIPA 5ALDA 4MMZB 1BCRB 2ZJ6A 3MMPA 4LC9A 5COQA 2W70A 4BX2A 3COJA 3ASVA 3HLKA 4BFYA 5JS2A 1E0KA 2X2FA 2XMSA 1NKSA 3QU2A 3H18A 5DCWA 4N7BA 4BKPA 4UFPA 5T7BA 4G63A 3T12A 4ND3A 2MOKA 3WGTA 3SKXA 2FEMA 3SKYA 3CEJA 1HLPA 3N8NA 1D6SA 4LE2A 5DT2A 1IN6A 5CG2A 4Z4IA 3CZMA 3EA4A 5JRJA 4QT4A 2CVQA 4RDCA 4FHCA 4I55F 5JASA 2OHVA 2PSSA 4E15A 1K1EA 1ZIPA 1TRHA 3AI1A 3N2EA 1TPZA 1E79A 4LQCA 2WFMA 1U9YA 4PGHA 2P1ZA 5IS2A 1AJEA 4LBZA 1IU9A 3FLEA 1MVLA 4RK1A 4ZALA 4DL9A 1T9KA 4RTOA 4KFSA 1JMVA 1Z5GA 3GI1A 1SH7A 1X80A 3REOA 1P3JA 2ZBFA 4B4OA 3K6SB 4CM1A 4MINA 1L5WA 3A6KA 3DCJA 1ONBA 5KYYB 4B82A 5BMVB 2ICAA 1R0YA 2FQ1A 2ZRCA 2XYVA 1IQPA 2C4MA 1A5BB 2R62A 3U13A 1X2EA 2H9AA 3FNHA 4IS3A 2Q1UA 1T3HA 4YXWA 1Y63A 4IWXA 5I3CA 1KDVA 2G82A 2AX3A 2BC9A 3O1LA 1FTGA 1PG0A 5K2MA 4X7RA 3DTVD 3W5DA 4AJ9A 4DBLC 4Q4CA 3KCNA 3OF2A 5DWQA 4A0GA 3OJ0A 4KGDA 4IM7A 1X38A 2JIDA 2BFCA 3QLUC 1NVFA 1PR9A 1U3DA 4LJ8A 4HGPA 4NZMA 4KI0A 2HRDA 3C7TA 3STXA 1J20A 4GOKA 3ZTWA 1IN8A 3OIWA 1W29A 3NWOA 4H1UA 2AVDA 4YRKA 1FFDA 4LF9B 1KRWA 2RD2A 2F1IA 1A96A 4LJAA 5ES3A 1CTQA 2Z95A 4LXGA 1KS2A 2ZSHA 4FYVA 3FIUA 3B8HA 3AHHA 2IS2A 3QLVA 3U4CA 4LHYA 1HLDA 1QDLB 3COPA 1A8IA 2ZU6A 2D0OB 5CDGA 2BMVA 1RLIA 1T34A 3QFSA 4LZWA 5TF4A 1PFKA 4CF7A 4UQLA 2QRPA 3EVZA 4KBYA 3IGFA 2GD0A 4IKOA 5ALWA 5LMCA 1KPGA 2OCAA 4NAUA 5I7EA 3MIZA 4MMYB 3DP7A 2GZSA 2DR2A 2Z6UA 4HXFB 4TWAA 2ECKA 4MQ6A 4D97A 3K1ZA 1V8DA 2DFPA 1X1RA 4YMGA 1N6IA 2G88A 3AKYA 3OKFA 4JEUA 3DMFA 5HKKD 4GR4A 7YASA 4OSPA 2Z2XA 1AHNA 1J2TA 5K01A 3I2GA 4C6SA 1DX6A 5I7UA 5B58T 3L5KA 1E6KA 4KXUA 5FWDA 5L3SB 5A6SA 2QUHA 2NWQA 1ARZA 2A30A 2WJGA 3C5CA 1RBYA 1X9GA 3R5KA 5HFAA 4F1JA 1M72A 3IUBA 3A9UA 1GUBA 1LV7A 5AKEA 4B4VA 4U02A 3P2MA 3DWIA 3IHTA 1JR2A 1I8TA 2WYUA 4OQZA