4MX8A

Crystal structure of troa-like periplasmic binding protein peripla_bp_2 from xylanimonas cellulosilytica
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
302
structure length
302
Chain Sequence
PATASYTWDRNTATEEGADPVYEETTVEVPVDPQRIVVFDMAALDTIGALGGEIAGAPLDSVPDYLEEYLADDAFNAGTLFEADLIAIEAQQPDLIVVGGRSSGLWADLNEIAPTIDLSLRGSYLDTLEQNTTFLGKVLGAEAEAESVLAELEAGIAEAKAAVTEASGTGLGIMVSGGQLSALSPNTGNDPRGARGGLIYDVFGVQPVLEDIKAATHGEPISFEFLLEHDPQWLWVVDRDAATGAEGAQAAKVVLDNEIVNRTTAATEDHVLYLNPTAWYIVFGGVETTRIMIDDVLQVAAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein
publication title Crystal Structure of TroA-like Periplasmic Binding Protein Peripla_BP_2 from Xylanimonas cellulosilytica
rcsb
source organism Xylanimonas cellulosilytica
molecule tags Solute-binding protein
total genus 90
structure length 302
sequence length 302
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4mx8A01
3.40.50.12260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mx8A02
3AERA 2AFHA 5A1JA 3G9QA 4UDNA 1G20A 5KOJA 5KOHB 2OV1A 3BE5A 1M34B 4TKVA 2Q8QA 2QI9F 4BBPA 2XY4A 3U7QA 2XQVA 2RG7A 2YNMC 3AESB 4WESB 4N01A 1H1LA 3AEUA 5M29A 3ZK9A 4INPA 5AFSA 3HH8A 2R7AA 4HMPA 3GI1A 1N4DA 4HMQA 2WHYA 3ZKAA 3ZTTA 1QGUA 2WI8A 3K1AB 2PS3A 2AFHB 1N2CB 3AEKA 4CL2A 4K3VA 4TKVB 4WZBA 3TEFA 5BVGA 3BE6A 3R5TA 4OVKA 3U7QB 1L5HB 4MX8A 4NNOA 4PAGA 5GGYA 1M1YA 5HDQA 3AEQA 4OXRA 1XVLA 4FILA 1K2VN 3MWGA 5JG7A 4WZAA 1H1LB 3AEUB 3MFQA 4XPIA 5A5VA 4G09A 1PSZA 2X4LA 4OXQA 3TNYA 5FLYA 4MLZA 2O1EA 5A5DA 3HXPA 4MDYA 4UTPA 4UDOA 5CR9A 2CHUA 3PSAA 1QGUB 1QH8B 1G21B 2PHZA 4WZBB 3NU1A 4HN9A 2OSVA 4LJSA 5JPDA 5BVGB 2XDQA 1N2ZA 1FP4A 3AERB 5I4KA 2PS9A 2PS0A 5KOJB 1G20B 1K7SN 3AEQB 5JJ5A 1QH1A 3PSHA 4WNAA 2PRSA 4WZAB 2XV1A 4XPIB 4PM4A 1K75A 5LWQA 4WN9A 3LI2A 3PDIA 1M34A 5LWHA 3HJTA 4ND8A 1PQ4A 3LHSA 4NNPA 3TLKA 3R5SA 4TKUA 1MIOA 2MINA 1EFDN 5BVHA 3ZKWA 3AEKB 3CX3A 2AFIA 2XUZA 4MO9A 4IRMA 1QH1B 5ADVA 4B8YA 1N4AA 5CX1A 2OGWA 4LS3A 3EIWA 1N2CA 1M1YB 4DBLE 4WN9B 3ZK8A 3PDIB 1M1NA 3UJPA 2R79A 3MINA 4GICA 4HMOA 3AETA 4M7OA 4ND8B 1L5HA 2M6KA 1TOAA 1KARA 5KOHA 5M34A 5AD1A 2OV3A 3EIXA 5HX7A 4H59A 4TKUB 2ETVA 3MD9A 4H0FA 1MIOB 2MINB 5BVHB 5KHLB 3ZKWB 3GFVA 4FI3F 2AFIB 3AESA 4WESA 2M6LA 3ZK7A 4FNAA 1K0FA 5GGXA 5B58T 2YNMD 5ADWA 4FKMA 1KAHA 4INOA 2XDQB 2Q8PA 1FP4B 5CX1B 1QH8A 1G21A 5M3BA 1ESZA 5JOQA 1M1NB 5M2QA 4JCCA 1KAEA 2XH8A 3MINB 3MWFA 4UTOA 4WNAB 3K1AA 4G07A 3AETB
chains in the Genus database with same CATH superfamily
4B45A 3OD5A 1NURA 1NVEA 4HNSA 1A5TA 4YC7A 2YVQA 1EEHA 3U61B 1Z2AA 2ZJFA 4FFLA 1SU6A 1Y34E 3ZZNA 1G3QA 5CVTA 2WSLA 2JI8A 3H3FA 1U1FA 2RI1A 5CVJA 4IFBA 2OP0A 2IFTA 1P18A 1K08A 2J07A 4WDQA 4EWLA 4MB6A 3AINA 2HSDA 3COSA 4S3MA 1DTWB 2X9QA 3DULA 2O8DB 3OZTA 4X7MA 2O8EA 2F43A 2MSWA 3CF4G 3C3JA 3ESXA 1E89A 4BASA 3FHOA 3TE7A 1Y4AE 3GGOA 4ZQFA 2IYNA 2AOWA 3HDJA 1N3LA 4Z9AA 1N33B 4OGWA 1VKRA 2IXEA 1NYQA 4BNYA 1P4HA 2GEJA 4AICA 5IWCA 1QPZA 1SUEA 3A6PC 3T06B 2AJCA 3EFEA 2WMNB 4RW0A 3TI7A 4RLFA 3UZUA 3S8EA 2EX1A 2GM3A 4M9ZA 1G42A 4C05A 1MHPA 2YZGA 1OJLA 3DDOA 4GT1A 2N1BA 2ZYUX 2H17A 2P9FA 4FOSA 3U3RA 4YHHB 3B1KA 1MZPA 1DQYA 2UZIR 1ZK1A 3FR7A 1A4UA 1T9BA 5C1BA 4IIFA 3DFFA 1X1BA 2O0LA 6NULA 3MTIA 2O07A 5EKDA 3VAZA 1V8DA 5AW4A 3K71B 4LYEA 4QLOA 1I1OA 2JARA 3EXHC 4H3HB 4CFSA 5C8YF 1D4AA 5B64A 1TLLA 3JAKA 2IUTA 1KGDA 4ZAWA 4HB2A 4JUBA 1VJDA 4ZI7A 4H31A 1EKXA 2I4MA 2GN0A 3MTJA 3NWOA 4NYIQ 4A16A 2HF9A 3BDAA 4H7FA 5LM3A 2J9XB 3N2KA 1GNRA 1FP6A 2NQ8A 4JOCA 3AUXA 5LUAA 3ICEA 1I2DA 1EHCA 3F78A 4RZQA 1RACA 3BK1A 3I9OA 3PNYA 4HGRA 4V0MA 3R7WA 2CNDA 1ACMA 3AY7A 4N6GA 5GVSA 2XPCA 1U8CB 2O0MA 3U4HA 5HOEA 4U8GA 1F2TB 1ORDA 2ZYRA 5EP3A 4RKWA 4YO8A 4QT0A 2PUTA 4GKBA 3ANYB 1E3JA 1UKVY 2O57A 3O9MA 4BLQA 4CQNA 4JT4A 4Q9IA 3VPGA 4GMHA 1N8NA 3EFBA 5AI4A 1P77A 1DBWA 1XZJA 2G08A 2QSJA 3G2NA 5LP6F 2PMBA 1VFPA 3C6XA 1OH7A 5LBIA 3GGSA 4LE1A 5JSKA 5C5DA 2ZB7A 1PT6A 1O7JA 1JYEA 4MUYA 1E1NA 5HIKA 1SQGA 1F7UA 3FCEA 1S1CA 2BFBA 2ZEJA 1FVFA 4CKBB 1R0RE 1GYPA 1XTJA 2P75A 5LD2C 4BFCA 4PZLA 4QL3A 4H77A 3UJDA 3KYIB 3GX1A 4WEQA 3NBFA 2XRYA 4F3NA 3OKFA 1WBJB 1Z16A 3EIXA 5LB2A 1V4VA 1KEZA 3EUAA 2DSNA 3C2QA 2GRAA 3N07A 3DC7A 5L7TA 2P2LA 2CWDA 1NVVR 2HA7A 5TPWB 5KX5A 3EIEA 1D3AA 5TJHA 3BWMA 3EMDA 4FT4A 2FUCA 1FBTA 5K0CA 3RVNA 1F9AA 1ZI8A 2IEZA 3BJZA 2EWMA 1ZUWA 4UASA 5KHAA 5A9SB 4R1UA 1ZW1A 1KKLA 1RWBA 1X7YB 2XH8A 5CGQB 3FSGA 5HTKA 5IW8A 3VXKA 5MHTA 3WIOA 4L74A 1T5OA 1Q0RA 3UUEA 1KY5A 4OYYA 1NUQA 1SXJE 2REXB 4DYVA 1RLIA 2R2GA 4QGAA 3ZHSA 1I36A 1SCUB 1V71A 3R0JA 1CUHA 2QYTA 5FULA 1XL0A 1RT9A 1Q19A 1L6RA 4XPZA 3CH4B 3ZVLA 5KEIA 4R4JA 4Z7QB 3AUTA 5I5EA 1PJ4A 1A5BB 1NFFA 2HYDA 2GB4A 1TLFA 2GAOA 1XTQA 2PKQO 1R8XA 4DJDC 2VL7A 3E9MA 4FCCA 3RU3A 4R7ZA 2B1RA 2FPGB 3WG9A 2YRFA 1K8XB 2YQZA 4X97A 4C0SA 3FWHA 4M22A 4LZAA 3B12A 4Z7OB 1PT7A 1UQTA 4OSPA 4A23A 5IBQA 1UBHS 3VSAA 1PWZA 4KVAA 4KPEC 2IW3A 3WYCA 4AG6A 2QMQA 4MS4A 4ANFA 4PYMA 2VLBA 1NVGA 1QIGA 2A4KA 2YWHA 3DTTA 1WMDA 2W2LD 3PGLA 3T1NA 3TS1A 3UC9A 4B32A 4LXIA 4AZ0B 2JVKA 4OA8A 1CJMA 2VP4A 1XK7A 3DE7X 4DG5A 3W9YA 4S05A 1HDIA 5CDYA 4XEHA 1BROA 3R3XA 4RTSA 1IUOA 1QYXA 4HQNA 4RPLA 5G02A 2BW0A 3VO1A 3VSDA 4WCFA 1YBAA 1QWOA 4YP0A 1Z0JA 2OHFA 4NKRA 1PLLA 1R5JA 3PUIA 2VQDA 3UTCA 2YL2A 3CM0A 1VHJA 2X5KO 2AXQA 3BRCA 2Q6OA 5E0OA 1KOLA 3C3WA 3DLIA 4BO4A 1W87A 4HWOA 1NGSA 4UVGA 2CYAA 1XLWA 3THYA 3CRQA 4YA6A 3RK4A 3QTLA 3ZEAA 1JIIA 4EFLA 4N3CA 1XDDA 5I8ZA 3WL7A 1Y82A 4BJ1A 3CCFA 4IVNA 1UDAA 5HK9A 3NJ4A 4BO0A 2I0FA 2VATA 1H5QA 1AUOA 1FTYA 1N2SA 4YAFA 2C8VA 2IEDA 2WM2A 3OE1A 2WP8J 3QVTA 4LX8A 2E6KA 1HTWA 2VDOB 1JL3A 1H9BA 3KZMA 4JWTA 5HILA 3ER8A 3UPDA 2GRUA 2GS9A 2GYVA 5BWOA 3O4JA 1S2MA 1QH1B 3OTOB 2IH4A 4ZDIA 3K0KA 3IUEA 1A8QA 4EJSA 5I8PA 4PXYA 4YACA 1JT9A 1D2CA 1MT3A 3ZWDA 3SZMA 2OB2A 4MAAA 2OBFA 4FFBA 4HQRA 4KODA 1F14A 1FXWA 3LUDA 4KXXA 4JJAA 2Z2YA 4GS5A 5DU2A 3ZH2A 3OZBA 1EXVA 2Z6VA 3F6SA 3NW9A 3JRNA 3O94A 2GHIA 5EWMB 3HEMA 4ZZ3A 1Q0TA 4H7JA 2BGRA 3NT5A 1L7NA 3SS8A 4WN3A 5KTRA 1HYGA 2AFIB 3X2EA 1QGZA 1VL8A 4C29A 3LW8A 3T3OA 4WPGA 4U39A 2OKGA 1KH3A 2QE7A 2VHJA 1C3XA 1DTWA 5DZSA 4Q7QA 1N0WA 4CKCB 1Q0ZA 5M2QA 2O8DA 4K8OA 2WHRA 1GY8A 4G2TA 3PTLA 3TQOA 4C3UA 2C61A 3ROPA 1QK5A 3IAEA 2ZVQX 1Q44A 4DJAA 1ISHA 3TOCA 3W7BA 5IKXA 2ORIA 1R4NA 5CIWA 2XY4A 2HDOA 3H0EA 1W36C 1P9NA 3W5CA 1FXSA 3RODA 3EW9A 2YWBA 3NBYC 1C7JA 2H2IA 2HOQA 1W94A 4ZHQF 4ZO7A 1DAHA 1FQKA 3TLGB 4LCBA 1X1AA 3JATB 4Y2QA 4JC5A 1N2BA 1ZSYA 3F6CA 4E15A 5K4HA 2XCLA 5AW8A 1Y3AA 4OQFA 4WINA 1OVGA 2Q6KA 3IL2A 2IU0A 4UATA 1IQ0A 3UGTA 1ZU5A 4YRCA 3PI6A 2I9PA 2DLNA 5DWVA 4TKVB 2QU8A 4NY1A 2XCOA 4MGKR 1Y1SA 1I01A 4ZI5A 1TYAE 1HGXA 4OXNA 2MSEB 3KSDO 1HYEA 1ONBA 4MRRA 4DLNA 2WRZA 4GVXA 1OXKB 2DHRA 3QLUA 3HK2A 3U49A 1XVLA 4ND5A 3IP3A 4OAQA 1VCIA 1Y7IA 3PZRA 4QXQA 1YT5A 4AM8A 4FKZA 3G1TA 4O2AB 4K8RB 3S0JA 3FMGA 2C4WA 1XTZA 4I1PA 3R3HA 3OQBA 1XAHA 1FF9A 1L4BA 4ZVQA 1F2TA 2G63A 4BMVA 2QRVA 4BN5A 4M21A 1IH8A 3I2KA 3AIMA 3LFUA 3KJHA 4UTRA 3TTVA 1AQLA 4F2HA 3S44A 1TU0A 3DEHA 3GOHA 4UU7A 2H59A 2WBLC 4DCPA 5IF3A 3DJYA 4EA8A 1G4HA 2IP4A 3EEQA 2NZUG 1YTLA 4FSDA 1H2XA 1Z7EA 1NAIA 1LWOA 2KSQA 1KHTA 3QY9A 4I4IA 4BQQA 4X1OA 3WK9A 1T2UA 2OTCA 4DRXB 3C6YA 4AN1A 5EUQB 1CY7A 2Z6UA 1Z8FA 4R2MA 4ZYUA 3BWCA 2A9OA 5AK0A 5CFOA 1LF5A 2YIDA 3DPSA 5JRJA 4X64B 3C48A 4M3NA 4OHFA 3QLUC 4EHBA 4JLAA 3GEMA 4Q02A 4TQ9A 3AEKB 3AUJB 1ODSA 2Q1TA 5TPWA 1XALA 1KMHB 1VJ1A 3WGGA 421PA 4BKQA 3U9LA 2B1GA 1IM2A 4TV8F 2ZYHA 2P9ZA 1R6XA 5F21A 3UWKA 1W4CA 3O4VA 1TMKA 1U2PA 1HUQA 2E3JA 2VWPA 1H9CA 4CQJA 1UANA 3DKKA 2QGFA 1E18A 1VG0B 1RE0A 1ZL2A 1DCKA 3KZXA 3BGIA 5BN3A 1SCUA 2WUGA 3RGGA 4KX3A 2D0OB 3UW3A 5BSTA 1NAHA 2OFFA 3HSKA 5DVZA 2FQWA 5CT5A 4IS3A 3N58A 2ZRNA 1P1IA 3QBEA 3WDSA 4W8OA 1UBSB 3PE3A 1Q2XA 3DEIA 4QYIB 5KOIA 1QFZA 2PKWA 1CJUC 4XVQA 1R9GA 5LBUA 1PJBA 4NOLA 4PFKA 4RELA 4BU1A 2FPGA 2R86A 4R5MA 3OQHA 1KQGA 4MVYA 3WC4A 5SZIA 1P44A 3GEPA 4LYHA 5NLLA 1NRXA 3OEHA 4PG7A 3VNVA 2V9CA 2Z4SA 1E0JA 2ZRGA 2HGSA 2JK0A 3IPYA 3P2EA 4WFJA 3O1JC 1KJQA 1V3QE 2HAEA 3KR1A 1E2NA 2NAFA 4Q7MB 3W77A 3X43A 1BMFD 2QLFA 2WTAA 1U3WA 1C3OB 3KEQA 4UNSA 4UM9D 3RO7A 5JD6A 5LLDA 2QQGA 2J9GA 2WIAA 3VZBA 2I6SA 4AUNA 2ISSD 1OC2A 3EASA 4UBKA 4IEEA 3Q1LA 3AFIA 1NMYA 2ANBA 2Y27A 2Z0MA 3OZRA 4IDHA 3D6MA 4WI1A 3LL7A 4FD2A 5DNVA 4QM6A 1RQRA 4ODIA 5BW6B 4C76A 3CPEA 2GLXA 4YNBA 2J3JA 3EG9A 4LG1A 3ENKA 3A0RB 4DPKA 4C0HA 1Z6XA 3D7KA 3IQIX 3TD6A 4XYGA 1TI7A 1V0JA 3MWGA 3OEWA 3GA7A 1QHEA 1ZPDA 3GRVA 4KYVA 2FQYA 2R8YA 4N9WA 4U2BA 1FX0B 1MC8A 2CB9A 4PRKA 2QOEA 1A72A 3TNYA 1NONA 1HSOA 1KA9H 2OILA 3LRXA 4MJ3A 4RD4A 5K3EA 1TE2A 1KI1A 1VG8A 1X7GA 2CXXA 1Z6AA 3H7IA 2XVZA 3OE7D 4I1YA 5K3FB 1EWTA 3QUTA 5DLDA 1RIIA 4UVHA 2FR8C 2OV8A 3P5BA 3D6TB 1SD2A 1MN6A 1J2UA 2V65A 4TM7A 3WDMA 1QHSA 3HL0A 4Z3OA 1YAJA 2XDQA 5FOUA 2PS9A 3DAFA 3ZHYA 2BHRA 1KMCA 1TF5A 4D3YA 4BZZA 1QH1A 2YN4A 1YS1X 3EE6A 3K2BA 1XQ1A 1QOPB 1U2DA 3COPA 3KU1A 3P52A 1J0AA 4LY3A 4QQRA 4CEIB 4H7KA 1XZQA 2F55A 5FJIA 2JI6A 4L15A 3FX2A 1GIAA 1YUBA 1OI3A 1QG2A 1D1SA 3USZA 4IGIA 1TECE 1MRSA 2PH1A 3QPWA 2QN2A 4WLVA 3KOXA 2FSGA 2FZWA 1J1UA 2PUVA 3HCPA 4FB5A 3ZNQA 4E1BA 2FN7A 1C5KA 2DH6A 1XF1A 2AFIA 2AMYA 1TQDA 2R65A 4NE7A 2OBMA 1B26A 4B6SA 4U8HA 5HQ3B 3AJRA 3K09C 3HZRA 2E5FA 4ARUA 2P2ZA 4TMKA 3UHFA 1WWKA 3GLUA 3N8GA 1DOZA 3BUSA 1M1YB 3GP3A 2YMPA 5C3UA 5LKRA 1X7ZB 1YQEA 3AIIA 4Q1AA 3WWDA 1E5XA 2K4MA 4WRRA 3E82A 2JKVA 1VDZA 2B3DA 4YYEA 3DBRB 1YZHA 4QUGA 2GD6A 2JFYA 2VYQA 3FGOA 2IHYA 4KNVA 5H81A 3L0IB 1ZH4A 2Q7OE 1SPBS 2PKQP 3K15A 4RENA 4KQFA 1EPUA 3M6MD 5DNAA 3SCZA 1E63A 4MUGA 3H04A 1HNXB 4F12A 2XYGA 4AC9A 1BFDA 4IHJA 4QULA 5L8VA 3JATA 2DC1A 1OWLA 3EEYA 1N0IA 4II2A 1M2WA 3ASUA 5E1OA 2A33A 1OT5A 2HY7A 1QZXA 5JCJA 3VC3A 3L7BA 1OQAA 2ATIA 2JZNA 2MOKA 3DT6A 2YHUA 4I2NA 4MITA 9MHTA 4PRLA 5AKJA 3V2GA 4TKVA 1KF0A 3MAJA 3VR0A 1Z5UA 4YQEA 3ZGLA 4UULA 1TT5B 3A1FA 3V5NA 1Z0AA 3AR8A 4AROA 2HO5A 4TZKA 1SR8A 2C0CA 3EB9A 3IS3A 4NF2A 2QLMA 2W0MA 5B30A 1WF6A 3O8RA 1WZEA 1A8PA 1OZHA 2W6QA 3RSFA 1WXGA 1EM6A 2RHDA 2DPHA 4O2AA 1B42A 3A1DA 3WGNA 1Q3HA 4QXOA 3H2ZA 3ZVRA 3L0PA 1UKZA 3STUA 1N7JA 2OXRA 4GOLD 2OCAA 3MWEA 3RS7A 4RA6B 1L1QA 2E6UX 1JALA 4BVHA 4UXIA 2QTBA 3TTSA 1GD1O 2FKNA 1BNCA 3W6OA 3K0SA 5DHQA 3KJFA 3Q7IA 2JH8A 2OGZA 1SXJB 3TINA 3URKA 2OZKA 3AF3A 1Y8ZA 2C88A 4EB6A 2YJTD 2D13A 3O5AA 2IELA 2XGJA 4TKMA 2R5FA 2YW9A 1CZHA 1Y3FE 4UMDA 3AEUB 4GLLA 1A9TA 2C2BA 3HU2A 2OQVA 3ZDZB 1QRRA 1GJRA 1JR3A 2OOSA 3C16C 3BWXA 3ZWMA 4DA7A 3BH6A 4DRXA 1GPAA 4YR7A 3PXGA 3OLXA 3ONDA 2FRXA 3BGWA 4QOEA 3R4VA 1RC1A 4R3WA 2VHEA 4LJSA 4JJFA 3SQLA 4X6LA 3V9PA 1LA2A 3DE1X 3EDOA 4HOYA 3Q2IA 2PWYA 2FUG1 1GPJA 2X1VA 2RKBA 4GXRA 1KMHA 3JQGA 3BMCB 4FGWA 4IV5A 3GLRA 5G1NA 2OUKA 3GHHA 3T95A 4ZU6X 2CJXA 2GEKA 3GXBA 1V3VA 2OCXA 4LGYA 5FBKA 1C0PA 3INNA 3RU7A 1XZGA 3L2OB 4RU1A 1Z75A 1XQXA 2IRWA 3H84A 5FI5A 1E79A 2FU5C 4YEDA 1TAUA 1FNBA 4F86A 4OQLA 3CZ4A 4HXYA 1RBMA 3WRVA 3D54D 4PLVA 2W6JA 1E96A 3KHUA 1KO1A 1T29A 4YV7A 1VG9B 3R9XB 3KEGA 3VYUB 3SBXA 1FOEB 1TAQA 2ZVPX 4ZHSA 3MA0A 2GT1A 2R68A 2BKUA 3GD5A 4MI1A 2J31A 4B8YA 1NKSA 4B7ZA 4D8TA 4QX6A 1WD5A 2C9OA 3BXHA 1QV6A 1OVMA 4UCWA 3VJKA 2CLOB 5IBRA 2L17A 1VDMA 2IXBA 1FFEA 3ECSA 4D41A 1VQ1A 1EDEA 4MV8A 5IT4A 1N9GB 3ITKA 5DBHX 1IB6A 4S0ZA 4BKUA 2OZLB 1TL7C 4F8YA 5IUJC 2PA0A 3ZWKA 1FFGA 1P5RA 3O3MB 4M54A 1WCXA 1K4MA 1E58A 4R9NA 5CFNA 5F3RA 4P54A 2F9MA 4KOAA 5K03A 1YB5A 5KIAA 1N5MA 4LRTB 4BFSA 5GGXA 5KC8A 5ICEA 1I7DA 4J75A 2FMXA 2N47A 1C3OA 3IODA 3GBVA 2PU5A 5CCBA 1GKIA 2QT0A 3CMMA 4C9BA 4LC0A 4QUIA 4MR8A 5EE3A 4CKYA 3T7EA 3WICA 5B36A 1BWRA 1PK8A 4REQB 3R8CA 3G13A 2R60A 4YRGA 2FMTA 2H2HA 1OASA 5AHXA 4B4VA 3QFCA 4I6GA 1ODCA 5I7UA 4Q3DA 2EU8A 1P7CA 4G0XA 5CPFA 4B4UA 1T5IA 4KQGA 1B16A 2JAWA 2ZIGA 1YZTA 3V1TC 4IQGA 1XJ5A 4JJZA 2DEUA 4ZD6A 4QZVA 1T91A 4LJ9A 1Y6QA 2I7VA 4OQ4A 4DDMA 1W8IA 3HGQA 1EK2A 1J25A 1XTTA 2PX2A 1A8SA 3GFOA 5KOYA 1ZI9A 3ZBUA 2RMKA 1NJ2A 2PDAA 1FX0A 4I4CA 4E2YA 1NJ6A 3AV3A 1RPTA 2A94A 2C9BA 2PWZA 4LJ8A 4CGZA 3OSZA 5I9BA 1GA1A 4JB3A 2O06A 5K3FA 4WKGA 4HZUB 5K3BA 5K0GA 2D0DA 1T36B 2ORWA 4QDXA 1EVKA 5LXTB 1WPRA 2AVNA 3COYA 1R74A 3CUSA 4C5BA 3TUIC 1KSJA 1GGNA 1N1MA 4KGDA 3ICWA 4DEXA 1E7YA 3VKGA 3U1BA 3ZU3A 3RS5A 5A03A 1N6OA 1XLTA 4FIZA 2CZGA 4YUWA 3V2HA 1H22A 1QGUB 4YCCA 1PGJA 1QH8B 2WPDA 4BO3A 2OYRA 4U0KA 3S1AB 5EHQA 4IDGA 3L9XA 5K8TA 3CT6A 3NRBA 1GKUB 2XDWA 4D9KA 5KTOA 1N6RA 4Q3KA 1OY1A 2PGJA 1KKMA 5ALWA 1N7GA 1EWKA 2OCBA 3HCWA 4CF3A 1TM4E 1XELA 2P30A 4IXNA 2VBGA 1OWNA 5GM2A 1UMBA 4RHUA 2HV8A 1H2WA 2FPIB 3ELWA 4LXYA 5TGTA 3WGVA 4F1JA 3AXSA 5JECA 1P1JA 2OHJA 3IQZA 3HBLA 3OLYA 3SYRA 5ALYA 2WVAA 4ZK2A 2A0KA 3O4HA 2V54A 3DBRA 3FLMA 3ZUPA 3M6VA 1L5WA 3NBMA 2BM1A 2I76A 3FGZA 3EVDA 3F5MA 4EHHA 4JLPA 4H17A 3WV4A 1U2ZA 2CVOA 2OBNA 1AZSC 1SBNE 3O82A 3O83A 4DM4A 1C7EA 1K8QA 4FMDB 1ABBA 4PFJA 2NUBA 3H5NA 3W8NA 1JMYA 2XMDA 3EQZA 3LCCA 4QASA 3PT5A 4I99A 2ZZKA 2VHVA 4NPCA 4WHMA 5E9JA 1J0CA 1PJZA 4DMMA 2VP5A 4ND6A 2XX3A 3FUXA 5BT8A 1FFWA 1KNXA 3N28A 4Z7JA 4PN7A 1GEGA 1CDDA 1U0RA 4J90A 1IZ0A 1B8OA 1YRLA 2B98A 1LW7A 2XDYA 4PNHA 4OTZA 5HFAA 1WZCA 1ACLA 3UWSA 3COJA 1DEOA 2OXCA 2PGAA 3AUSA 2RD2A 4UMFA 4CKWA 2E1RA 2FZLA 1X1QA 2G4LA 4JT8A 5EMNA 1VCHA 3K0FB 4NDNE 1KTIA 2ZUFA 3QFTA 4PINA 1LXCA 3HRHA 3T1OA 4ZGBA 3ME5A 1N92A 1VIDA 3YASA 3E9NA 2AXEA 1WKBA 2Z5VA 3DEKA 4ZDWA 1S4MA 4E5VA 3LGSA 2PQMA 4FHCA 3AF0A 5HRUA 5FBQB 1UJ5A 3LUJA 5HMMA 3GFQA 2QR2A 1YBMA 3PEYA 4RA6A 2YWEA 1GLGA 3LWDA 1R4ZA 4RQBA 3HEAA 1N2HA 2D2IA 3AEZA 1PWYE 1SXJA 4AJHA 2B30A 3DBIA 4RH3A 2W93A 5DW0A 1BEZA 2OY0A 3ZH9B 1KH2A 2XE6A 2LKCA 2XGSA 3C8ZA 1JDZA 3E1KA 3OH8A 3TQIA 3DDWA 3ZW7A 3ELBA 5JNTA 3WNZA 5C8YB 5F7ZA 3AEUA 3E7FA 4RMNA 4DCCA 4RULA 4INPA 4CKZA 1RPAA 2OD9A 3N86A 3FNRA 2OAGA 4Z4IA 1ZD9A 4CR8A 2PJRA 2OFWA 4Z54A 5K8LA 5DSZA 1F8FA 1SBQA 3A4IA 3UMFA 1EDBA 2GFHA 4KKXB 3W1VA 3I4FA 4RWEA 4Z4HA 4OM8A 1SOUA 5AKZA 2VN8A 1ISPA 1YA4A 4WD3A 2OL4A 1IZ9A 2QIOA 5P8WA 3IE1A 2W6ZA 4E5DA 1GFSA 2CUZA 2WJ4A 4HLDA 5CJ2A 1JHOA 3BMCA 1OI4A 5L7WA 3P9CA 4OGLA 3KXLA 1RI2A 2FI1A 4GMXA 5DTJA 3T3DA 3VNAA 2HA6A 2LZ0A 1TUGA 2DULA 3JRWA 4KIWA 3D59A 1WULS 2ZTUA 1TDJA 4KFTA 1Z5NA 2ZAIA 3ZU6A 4AS3A 5LP6B 5DBEX 4X5OA 1EA5A 2V3CC 2XMSA 4FOTA 2AX4A 4EYQA 3NU1A 3HUFA 1Q11A 2HT6A 1L4FA 3DMHA 5CDHA 5FB3A 2XCUA 1N2ZA 2BZGA 1Z4PX 5H7XA 3RSOA 3AW8A 3GBSA 1XCBA 5E9WA 1VHQA 1XTPA 4MV6A 4P5EA 1RZRD 4B75A 3O26A 2QBYB 3DQQA 1WCYA 3EAQA 1JVBA 3GZ4A 3I5UA 4XPIB 5TSDA 1R3UA 1T1SA 5LIPA 1C1YA 1RABA 3JQDA 4URFA 2O7QA 5E2IA 5ALRA 2NVUA 4KGZA 1N9GA 1EZZA 2OZLA 4FS8A 4EUEA 1OH6A 2BFMA 1R8QA 3AR9A 2W0SA 1ZSNA 2J6IA 4KPGA 3HFJA 1TO1E 1V9CA 2XKJE 1RXIA 2RHHA 3KQYA 2YMQA 4OG2A 4B7UA 4YRIA 1DEAA 1CEQA 5DX1A 3KZNA 3H1GA 3N2EA 4HRAA 1HFEL 1XL1A 4REQA 4WN9B 1SK8A 3N2NA 4JY7A 4I4TF 5ALUA 1YZFA 3ORQA 3D8RA 3R6LA 4CCYB 1IN5A 2Z2KA 5DXFA 1EGMB 4ZU3A 3T9BA 1E32A 3KL4A 2JJQA 4LQCA 5CA0F 4GSKA 4V1CB 1XKXA 2ETVA 3MGKA 4F4HA 5FTLA 3M49A 1YFKA 4L75A 3FWKA 4MW4A 1A7AA 1YXMA 4LVCA 3RRXA 2CVFA 2K7ZA 3K6SA 4B83A 2EGGA 1J9EA 3PQCA 4C08A 5TRTA 1D6JA 4KNYA 3BSWA 4C4SA 2P9QA 4K9KA 1KIFA 4BZQA 4K26A 1K88A 1DJMA 2H65A 3SNKA 3H5IA 4Q7EA 1JGTA 4BO6A 2YOGA 5A4KA 3O93A 1YB6A 2PJUA 4NV0A 4WJKB 2R9VA 2GNAA 5EEGA 3WKBA 5A3JA 3QQPA 2V96A 1T36A 2H9IA 2GAIA 3S2EA 2X22A 3UJ8A 2Z5LA 1FLAA 3A25A 1K92A 4XRRA 3UM9A 1OBCA 3K5IA 5FBZA 4E2XA 3EBOA 5D3ZA 3AW9A 1H65A 4HLCA 3FPJA 5DFAA 3HB0A 3UUGA 2HHJA 4H3VA 2XXAB 1JQLB 2GOYA 5FPQA 1QDUA 2ZM5A 4R8KA 2VPIA 3L0DA 3G5UA 2BY4A 3QU9A 4DSOA 1B2RA 1TJYA 2HF2A 4LHEA 4RM3A 2RHGB 5AOAA 1QGUA 5FBWB 4K6HA 3ET4A 1EAMA 3GLQA 2OXIA 2J5KA 3UENA 4CHTA 1UBGA 1VMAA 2QW1A 5JYCA 3S1AA 3S27A 1GUZA 2XYVA 4JI7B 2ZQYA 1M33A 4TMWA 1NR5A 2FH5B 1P5ZB 1F60A 1SB9A 3BE6A 3KQPA 3P9NA 3PKZA 2CEAA 3HTXA 2ETXA 1G7CA 2WM3A 3OZAA 4IJVA 4PSDA 3IPCA 1K2VN 1ZEJA 5FWYB 2K2WA 1U2SA 1HRKA 1A9QA 1XJ0A 1G6OA 2Y3IA 2FPIA 2Y1EA 4CV2A 5K0ZA 1DLJA 2X0RA 1MG0A 4UDOA 5ED4A 1P60A 2JIPA 5UKDA 4CF5A 2FOIA 5DM4A 4YB8A 4BKMA 4MQUA 4O8ZA 2IU3A 3ETEA 2QZ4A 3I04A 1SBIA 4FZ3A 4P38A 2WJAA 2C1EA 2FAXA 1RWXA 1YBHA 3MELA 2LP4Y 4NJEA 2GVZC 3RYTC 3PCRB 3L0BA 5B3AA 3DCIA 5EIBC 3ZHVA 3RPEA 4RJTA 1HE3A 4IQ8A 4L4RA 3NPAA 3SOZA 1DO8A 4ED9A 1Y7TA 4MPPA 2CMFA 3HV0A 4NIMA 4AMVA 5KB3A 3QBDA 3PFNA 2VJDA 1Z0UA 4ZCQA 3FYTA 4O33A 2Y1KA 3WTBA 2W71A 3PIIA 4Q4AB 5KC9A 1SIOA 5E95A 1JW9B 1P7YA 4WLOA 4CMHA 3OQIB 3HWWA 3CUTA 1Q21A 3EBLA 1GXSB 3SDSA 5BR1A 2PV0A 2QN8A 3KCQA 1JDBB 1OLUB 2I6TA 1EE2A 3LT4A 4IY1A 4H7DA 3KTAB 3JWEA 4PQFA 3UUWA 2C4KA 3WWPA 1AHPA 4BB6A 4G1FA 2DBRA 3VR6H 3TGPA 1N9ZA 5HKAA 4RNCA 1ZIXA 5IULC 4XJXA 1Q7EA 1W0JD 2WF7A 4BKRA 1UC4B 3K0FA 4RTLA 1FRNA 1HDOA 1SUPA 4HK4A 4MQLA 5MN5A 2W48A 2YWFA 2AB0A 5CLLA 3UBMA 4IIBA 4QDKA 2QRUA 3BIFA 3KB2A 2WNHA 5FL7D 4AULA 3RHFA 1P2BA 4A9AA 1NUAA 5MDHA 1V48A 1A1VA 3O8LA 1EMDA 4MO2A 1C8LA 1EBUA 3R76A 1W19A 3SYTA 1DG3A 4CDMA 4DLXA 1W35A 1WBBA 2VRBA 1XTBA 5F9HA 1C2YA 1GUBA 1F38A 1FDIA 2H18A 3CVWA 2TMKA 4EL5A 1SVIA 3ITNA 3I8SA 2O2DA 5DX8A 4GLBA 2PZAA 1P73A 3OUZA 2R11A 4FKMA 4PO1A 5C8YA 1BVRA 3MOSA 4HF7A 5DX0A 4YUZA 1XMPA 4HUJA 1U1GA 1O03A 2NP6A 3DO5A 2AWOA 3FKSA 2IZ0A 3FWYA 4NPAA 2JLAA 3VPHA 3VV3A 1F0PA 2XW6A 4P22A 3NAMA 4FUQA 4MWTA 2AZMA 4ALNA 3NDIA 1G8FA 1RWVA 3GC6A 4HAXA 4O1MA 4EARA 1XD8A 2IBTA 2WK1A 3I58A 2WTEA 3BE8A 3CTPA 3VPXA 2AEFA 5JBNA 3QLVA 5BQ5A 3TLZA 2GN9A 2GASA 1AN0A 3AHDA 3OQMA 3GJTA 1Q1NA 3PFGA 3RC2A 3C3CA 2X58A 3UCXA 3UF0A 2R5WA 1CR2A 1E7MA 3V8QA 2WT8A 3QU5A 5LP6A 2HLPA 2PMWB 4TKZA 4KFUA 4N5MA 1WBDA 1DIHA 1U0JA 3UK1A 2VRCA 2RHBA 4JLJA 2R6HA 1NMXA 4NDAA 5DCUA 1NVFA 4XD7D 3SBOA 3ET5A 3HB9A 3MEQA 4KO1S 2NWQA 1NVTA 2RIPA 3FMOB 4FC6A 4QU8A 4U1RA 1QGAA 3VTAA 2QBYA 2PSHA 1YOVB 4X44A 4XPIA 3OU6A 4JI0B 3COVA 3P19A 4E13A 3MUNA 4EG3A 3DYBA 3LT1A 4YUAA 4C78A 1Z7YA 4ZU1X 1Z2DA 4ZDJA 4BHTA 2QUBA 4ZI2A 1DIAA 3L1UA 3HHPA 3TBFA 3TW6A 2X8AA 1T1IA 4DIOA 4TV8B 2FZGA 1IBMB 2R84A 1YZUA 2Y71A 1LKZA 4YRZA 3LV8A 5FPKA 4YTEA 4GM1A 1LW6E 4DWJA 4EBBA 3KKKA 4AF7A 4BPRA 1C9JA 2RGUA 1ZR2A 4XJTA 4I5GA 1Q77A 1UADA 1PK7A 4AUEA 1HYHA 5I9SA 1WJGA 1YD7A 3PPIA 3D6UA 5LP6C 1ILEA 3D6NB 1I0ZA 4WN9A 4M1KA 3PFCA 4N0PA 1H2FA 4M8LA 1G5QA 4LSGA 2VXOA 3K94A 2V6MA 4PO3X 1ODKA 4TT3D 2XA2A 2SNIE 3PDJA 3WLFA 3QEMB 5EJ9A 3CGGA 5AVYA 1T2VA 1ZM7A 2OCPA 3HKEA 2OXFA 1U4NA 2IK8A 3CH6A 2H2FA 4C04A 3TUZC 4UW9A 2C9DA 4Y18A 1HDRA 3IUMA 5AYVA 5MFPA 3ZXYA 4DUPA 1SQ6A 3GEDA 1F6DA 3L1VA 1T1GA 5CVEA 2ROQA 2IW1A 1P81A 5IUKC 4CM7A 4UEWA 4XUGB 4ZV4A 3QNUA 1R0SA 3RB8A 5JXJA 3C3EA 1QO9A 3T5MA 2XIQA 2DB3A 1P45A 1HT3A 4BLVA 5LPNA 3S70A 3RUEA 3USES 2FW1A 3ZDRA 1IVYA 3DE0X 3D9QX 2BE7A 1PR0A 1RPJA 1N0UA 2AMFA 3LY5A 2A8YA 2W6CX 3OEED 4RKQA 3RV3A 3F6RA 1Q1BA 2AQKA 4KNWA 1T0JB 4G0NA 4W1SA 3PYMA 3E7WA 3LQYA 1ES9A 4IR7A 1QCYA 1TQ2A 2ZJOA 2GVDC 3D3JA 4KYUA 2QX6A 2YWCA 3NEJA 1BSVA 1QKJA 1VRWA 5DYTA 3BORA 2OVFA 3DZDA 2Y92A 5TF0A 2A9KA 1Q57A 1IY8A 3H5OA 2JK1A 3RSHA 5JAHA 1QBGA 3AR7A 1CUBA 3E5RA 2E4XA 3AOEA 3LQ2A 1YBVA 4IDEA 2QB5A 5DNWA 5J9FA 3H75A 5F23A 4PAWA 3WL5A 4KL8S 5BUZA 3BK7A 1PQWA 4B1FA 4AI6A 5JDIC 2R6ZA 5DYWA 1WSDA 1H3EA 3V1NA 4EG0A 4AJ2A 5AVSA 2JFHA 1JAYA 4UHEA 2QENA 5GPBA 3G0IA 3IP6A 3PUZA 3DEFA 4R31A 1KYYA 2HCFA 3GAAA 4TLCA 3VYRB 1VE1A 4INZA 3OZWA 1F8XA 1IHPA 1V11A 2BUBA 2J33A 3PEVA 3GJRA 4YCMA 4FHDA 1C3JA 3PC8A 5CYOA 5BSMA 1RFLA 4YRDA 4AJ9A 3ND7A 1IUNA 3FI0A 2FE1A 5AHKA 3RIEA 1EESA 4HMQA 1DQZA 2PGXA 5BWBA 3UATA 1VM6A 5KDLA 4C07A 5L51A 2MYPA 5IEJA 1YA6A 4TZ0A 1W4BA 1GSIA 3I09A 3Q7PA 3RVBA 4PLZA 1JU3A 3I76A 3WLHA 4C6HA 2JFWA 1UDWA 5L7YA 4M88A 1LEHA 5FTMA 1PS9A 4YDSA 2VF8A 4GR5A 4HKTA 4ONEA 1E3EA 4AKTA 5H3CA 2WHQA 2HQSA 3UMBA 1NQ5A 1VLHA 3O7WA 2Q21A 4E88A 3KDSE 1E7SA 4A7PA 5CEEA 3KPVA 5AVRA 2ZI9A 2GZ1A 4OATA 4P0TA 2NUTA 1IE3A 2QM3A 3BRWD 5A3RA 2ZIWB 3F7MA 4PHGA 5IC5A 4Q4AA 2Y0EA 3L40A 1TMGE 3PEEA 1JKIA 4RS3A 5EJ5A 1LLQA 5DYYA 1WW8A 3ELYA 1OLUA 4ZVRA 1V2GA 1L5GB 3SBDA 4KDCA 3DJFA 3KTAA 3B6JA 5F2EA 4CTOA 3PFBA 3ITEA 1UP6A 3OM0A 1Y6GA 1L5KA 3TMYA 2A58A 3U0BA 1AF4A 1E9EA 4RHYA 2QYHA 4S0XA 3ROQA 3WY9A 3ZR4B 3EWIA 2DHDA 3VDXA 3PJGA 3CLKA 2VS1A 2CK3A 2RH5A 3BILA 5EJ7A 3U6KA 3PNBA 3H9CA 1G8PA 2JB9A 4ZHQA 5K9ZA 2CBGA 5E6RA 1I3KA 1L5RA 1MA3A 1UWLA 2JBAA 1VGQA 1JR4A 1T2DA 2CVPA 2Q3FA 4MW5A 2FLKA 3EYAA 1L5MA 3OEYA 4NZMA 3PNSA 4L2IB 3BJRA 3PC3A 3SMQA 4ZAZA 2NYUA 5SZHB 4DWVA 3HR4A 3VPCA 1RDFA 1WLSA 3TFQA 2Q6TA 4MQFA 5B1SA 1ST3A 4L5JA 2P41A 1SXIA 3RR2A 4KP7A 3RKRA 3A4MA 3KAKA 3NORA 1VPVA 4GYKA 5IZ4A 1OIXA 1XMSA 1M0TA 2E4ZA 1G8SA 2QUKA 2WUWE 3PNLA 4FYIA 1JIJA 2GD1O 4X8MA 3VDNB 2FFRA 4PANA 4DCNA 5GIOE 5KYNA 4HJRA 5F3DA 4YJFA 4P3KA 2JIRA 4BUZA 2O3SA 2VJNA 1P80A 2BDTA 4C4ZA 4CLHA 1MB2A 3MWJA 3B6EA 4X1KB 1CTQA 4QKQA 3S4YA 1Z2PX 1OPXA 2VJAA 1AKWA 4UE6A 1D1PA 1OJ7A 1EK1A 1B6SA 1KEVA 3RKSA 1G21E 4PYLA 4INOA 5BURA 1RJDA 4DSUA 5BQ3A 2PX8A 3ENWA 1J24A 3GRYA 1ESZA 4NBTA 2J3DA 3RJZA 5HK8A 4BP3A 1E3MA 4BLRA 4N39A 4WW0A 2INGX 2WU4A 3L82B 5A1JA 4ZCRA 2ZXUA 1F6WA 2AZTA 3X44A 4C20A 2O54A 2Y1XA 2J08A 4BNJA 3ZTWA 2ISQA 4KQWA 3RASA 3SLKA 4EGQA 1CV2A 2HXGA 2DFLA 4FPXA 5C51B 4L50A 5JADA 4UU1A 1EIWA 1NZFA 5K01A 2HJSA 3TTYA 4ZCPA 2GN1A 4DYDA 3HWSA 5JBIA 5LN1A 4ZAXA 3JSAA 2ZJ3A 3OZVA 4FNMA 4Y9TA 4I9FA 3DNPA 2G70A 4PHFA 1V37A 4YPFA 1MQ8B 4ZYTA 4W5RA 1II8B 2ZE8A 4IQ0A 4TV8A 3S28A 1VCNA 1BTOA 3DBVO 1NI5A 3C74A 4LI0A 3OLVA 4NWIA 2GK6A 2B8WA 5KNDA 1XZLA 1JAZA 2B0JA 2C77A 3A3NA 3HN7A 3I2HA 3L1JA 1Z0IA 4G5FA 3LZDA 4MUKA 4F9EA 5I9LA 3MFQA 3M4JA 4UCXA 2C42A 1E1YA 3T3HA 1M7HA 4M83A 4D2IA 4U00A 4IUBS 4BMYA 4MIEA 4FHGA 3DHEA 2R00C 1DIGA 1HSZA 1DIRA 2PGOA 1Q91A 1IHUA 3H2GA 4GKJB 2IXDA 3RHZA 4MJLA 1TF2A 2O3QA 5IMBA 1Y6ZA 5I8WA 2XGGA 3CH7A 1W5EA 3U1VA 2HM7A 3GGDA 4GDMA 5L3QB 2ZWMA 5KYUB 5JAUA 2FJUA 2I65A 3LECA 2PMDA 2CSXA 3LX8A 4AY2A 1PFUA 2QTMA 3L8EA 2HUPA 4MTCA 2PRSA 3MJVA 2B8NA 1NBAA 1H3NA 2XNKA 1I8TA 3AG6A 2ODTX 3ZZTA 1PV2A 1MEJA 2AK3A 4LWOA 2C5AA 1H0HA 3K53A 2GF0A 3WQRA 2CXHA 1Z4IA 1XTVA 3AGPA 5BSGA 3H1FA 4HS9A 3RIGA 2KWIA 1SIUA 4NMLA 1PG5A 3B6MA 4Q37A 4FJ0A 3ZJYA 3VRHA 3QEOA 5AJZA 4YLEA 1EVLA 4Q19A 4ER7A 3H8JA 3KPYA 2YXNA 4AX8A 4BV8A 4YXFA 1O0SA 4LDJA 2V7VA 4HNGA 1W5BA 1CBUA 2RBGA 5EHGA 4A36A 2C2KA 1CIPA 4KN9S 4RPIA 4A15A 2I3BA 5IVPA 3BIJA 1DAFA 5LQRA 2HGZA 4RCZA 5EE5B 2Z6QA 2R79A 4MINA 2XE8A 4Z0PA 4ZV7A 3FZYA 3R6GA 2GZ2A 5G0UA 2ZE5A 2BGTA 5HJ5A 1BQ4A 1L5HA 4BGVA 5CG1A 5IHXA 3BMXA 3E58A 3GJQA 2RFLA 1EH5A 4OGFA 4XLLA 4CDRA 2OYSA 4EF4A 5AKGA 1LPSA 4BBZA 3D7RA 2BFNA 1JBKA 5D00A 4XYMA 4HAWA 3T4EA 3DOCA 1YUMA 4XWGA 4B76A 4F7WA 5AJVB 3Q9NA 3UMYA 1WTCA 4UCQA 1K6EA 2AKAB 4K9RA 2AR0A 3V9AA 1E5QA 3BFPA 1YMQA 4XWTA 3BCUA 5DM60 1FDSA 4OP2A 1IUKA 3CZ5A 3NOVA 1QFXA 4GKVA 3ONWA 4Q00A 5DK4A 4DMKA 2VTKA 3OUTA 4NLLA 3PUYA 3BQMB 3HLTA 1A7UA 2ID9A 3PGVA 5KWSA 1ESCA 4G0VA 1UM8A 2E82A 3O31A 5ITVA 2PT9A 5CLJA 1CUJA 2H7VA 2ZYGA 5IBPA 4RF5A 3SE7A 2CYBA 4H7HA 1SU4A 2NO9A 4ZQEA 2C4UA 2QZSA 3WYDA 4F97A 4TTQA 1A2BA 3E5NA 1RXUA 3OT5A 1CLEA 1TTQB 2MSKA 3EZGA 4KQ9A 3IERA 3VNQA 5J2TF 2YHSA 1BXGA 1J0DA 1HEIA 3PTZA 3ODPA 2R6FA 2VAPA 4UE2A 2I54A 4KPYA 3L9WA 2ABWA 4R1NA 1JSCA 4Z1MD 3AOGA 1CPYA 3HDVA 2IYYA 4E11A 1IQRA 1C4WA 3NFYA 1YUNA 4L5AA 4LDRA 4RMJA 5K6AA 4NZOA 2I33A 1UKEA 3ZG6A 1QK4A 5CYGA 2PWBA 3OOYA 1HZZC 1J06A 1E6CA 1T0UA 1H2BA 4I1UA 5FLYA 1T6BY 4AO8A 4J29A 3NGXA 5ENZA 3BWDD 4AY4A 3L18A 1FTNA 1VZ2A 2IHKA 2IU4A 2WJ3A 4DVGA 2AEMA 4A5OA 1FBNA 1TGYA 1GPNA 2P77A 2VDMB 1U31A 2YR0A 4MYTA 3CF0A 4QDJA 1OKKA 4RV5A 3KPJA 2KBEA 2J1LA 1E9CA 1U3FA 1Z82A 3AK4A 2NO1A 4L2IA 4L7VA 4BQEA 3B6ZA 5A71A 5KNCD 1RCTE 1B14A 4RVFA 2VF7A 1U6JA 4G85A 3ZDBA 2EKZA 4M0UA 4TTPA 1D1QA 3ILYA 4LSWA 3RRYA 4DBVO 2YICA 3DDUA 1Y3CE 1WUHS 3X2SA 3JS5A 2PA3A 2XVMA 3MS7A 3AYXB 3AVQA 3KIPA 4R54A 5FQNA 4F38A 5KAPA 4QUBA 1C7ZA 2B5VA 2JG3A 4ZRMA 4PLFA 1CDZA 4QJ3A 2HT1A 5AVWA 4X1KA 2UXBB 5K3SA 4XM1A 3D3NA 4Z51A 4NZPA 1GN8A 3HSSA 3Q2KA 4EI2A 1N2CE 3D8SA 4JOBA 3K4QA 4R16A 1RHMA 1P33A 2Q5OA 1R0YA 2I4TA 3W7VA 4DCVA 1FUYB 1R2QA 1LS6A 2V6JA 4XDGA 4M2LA 2AJDA 4FYKA 1TOAA 2FEMA 3ONVA 1QONA 2WNSA 2VNSA 4FXPA 4JYPA 3UYKA 1WA5A 5EAIA 1ZX1A 3B6KA 4GF5A 2L69A 4PRYA 4RIEA 3BXOA 3G9TA 2GH1A 5HFJA 1R5OA 4NOMA 5KYWB 5KQGA 3O03A 3EMKA 2AQHA 3EEBA 4BQFA 2V4MA 3ZS8A 1FFYA 2HWWA 1X9HA 2J9FA 3H6KA 3I0MA 4MTLA 3LKVA 4QYXA 3R7DA 3L8CA 1DC7A 1FTSA 4R69A 3LWNA 2C2WA 1ZOLA 1COWD 4WNAB 5IXJA 5CCXA 4U7GA 2W2OA 3IA7A 2QNIA 4V03A 1GM5A 3EDMA 1WEHA 4Y2TA 3G9QA 3F3KA 2PD4A 1IAVA 1II8A 4TWZA 3RCBA 3IEIA 4HT3B 2QXTA 3EQ8A 1V16B 2R48A 4MSUA 3ROZA 2B8JA 3X3HA 1CY0A 4PYJA 2P5TB 1XMIA 1CJSA 4RKRA 2A1IA 3HCCA 3SQMA 4LNAA 5KAMA 2EERA 1N2XA 3LP8A 2QM7A 4L3OA 2RAUA 1OXSC 4PVCA 2YVLA 2ZS9A 4HYQA 1OE0A 2PRJA 3F8TA 4KRXA 4QNRA 3DE3X 3Q9LA 1NDHA 2X23A 3OQPA 5JH7F 4LNHA 1GPMA 1OXTA 3L1KA 4FEGA 1ZOIA 4HDSB 2BFOA 4CZ2A 3FPEA 3V4ZA 5JI2E 1ZCJA 1IK4A 1DHRA 1T8PA 1JVNA 2QPOA 2WTXA 4OI4A 4RCYA 5KYUA 4X8HA 3DMTC 5L3QA 4CXMA 3THXB 1GDTA 4XQGA 1OILA 4FINA 4M86A 3JALB 4MW2A 3JZAA 4GMFA 4PLTA 5HDQA 1ODTC 3LHKA 1KC3A 3KKOA 1R0BA 3VUEA 3MBKA 1HL7A 4MS3A 4V0NA 4EEKA 1VCOA 4B6QA 2ONJA 1K97A 1U9YA 1BW9A 1AN9A 1B8PA 4D9CA 3IP8A 4HEHA 1FVXA 3IHWA 4DDWA 1X77A 2WIBA 1FW6A 3JQ7B 1UMDB 3EUEA 3NKFA 1TEZA 3D7SA 2VF2A 4G37A 4E94A 4F2GA 1E6WA 1YZLA 1DJOA 4U7PB 4JIMA 1IYZA 4Y2UA 2X8JA 3HPRA 4XVHA 4JEIA 1DELA 2JLSA 2OSBA 4XQEA 4I4TB 1PTJC 2PVPA 3Q12A 5FOVA 5I9TA 3M6XA 3LRPA 4ZQIA 2XQIA 4POOA 3QF4B 2ZAYA 1HKHA 3QTBA 3T7DA 4BNFA 4YJGB 1PWEA 2ZRHA 4UNQA 3TW8B 4W1QA 4FYMA 5AK4A 5DYGA 4ZMSA 5JMPA 1OX6A 3QA9A 4LBZA 1CW2B 4P7GA 2PRKA 1T35A 2EJUA 2OCKA 2YXBA 1HT1E 1LJUA 1EDDA 2JH3A 4QM7A 3PFIA 1NTRA 2DU8A 4Q16A 5HP4A 3AQIA 1I32A 5WRFA 2WQZA 3GCDA 5D7NA 5IMSA 1Q7RA 3I3OA 3FUUA 3A6ZA 3BXGA 4JLNA 1NI4A 3SC2B 3MGGA 4RIHA 4ZMRA 3PHJA 5C32A 2C1XA 2ZAOA 4GE0A 3KQHA 2WOOA 2WJWA 1GU1A 4YWJA 2QORA 2PR2A 5L3SA 1GAXA 1RRCA 2BFDA 2QZJA 2RGGA 4X9XA 5GWXA 4Z4GA 1Q3KA 4NR0A 1ZRNA 3CUWA 1EFKA 2B7BA 4FYYA 4GYWA 4HNUA 4L9AA 1Z47A 1GDHA 1T2AA 1T10A 3H2KA 3IPLA 4RPKA 4WBSA 1DKUA 1VE9A 4WXPA 2HQ1A 3HNOA 1BJKA 4PFQA 4RGVA 3IBFA 1N6KA 2EGHA 2P65A 5AW3A 4DV1B 1P0IA 2R87A 2XJ4A 3AONB 4MQ6A 4QECA 1SUWA 3D8HA 4XQ9A 1KAHA 5GINE 4IOJA 4W5QA 2G0NA 3LBYA 4MS1B 2Q5IA 4Y0NA 4LSMA 4E2ZA 4WAUA 1SXPA 4EQZA 5LQUA 2ZYSA 2GCPA 3RTAA 3DKVA 5BR8B 4AMZA 2BVNA 1ZINA 2JGIA 5H16A 1JR2A 3RRFA 2QK4A 4CTNA 2WWTA 3G1UA 3M1IA 3VNBA 3JQBC 4FFSA 4L57A 1E77A 1I5RA 2ZUBA 4GU5A 4HLNA 1CFJA 3COZA 2FA9A 3FZQA 5D3KA 5ALJA 4LMPA 3NC0C 3AHHA 1OZAA 4U9IS 1VYUA 4MROA 1UBOS 2HLDA 2M2IA 3LDAA 4C1BA 5C7OO 2YN2A 2D1SA 4GPD1 1CVIA 1RR6A 3E1GA 3QOWA 1ZP6A 3DXXA 4G86A 5JATA 3DUWA 3LDGA 1Y89A 3P2MA 5ESRA 3UV3A 1O77A 2LTAA 1DIOB 2QTTA 3ND6A 4HYEA 5LOVF 1E6EA 5LVAA 4N5NA 4GE3A 4BEJA 4BX0A 2BFPA 2ZUVA 3H11A 4K3VA 2C8JA 3S2ZA 3ZV5A 1D2EA 1MW8X 1CJCA 2CLEB 4GNRA 1EJ6A 5BORA 1ENYA 2BTEA 1J39A 2EKPA 4E51A 4RACA 4NYJQ 5FPHA 5LDHA 1H1LB 5EL0A 2D06A 1T43A 2ODPA 5AVQA 2I3ZA 3VDMA 2HV9A 3IJEB 3PGA1 2C54A 4P0QB 2IEGA 3OIDA 5D6NA 5KMGB 4ZC1A 2IDKA 3KXDA 2VJLA 3QRWA 3ENVA 2FFBA 1TKAA 4G65A 1AA6A 3K70D 1VP9A 1F51E 1HYQA 4KIGA 1T4CA 2C2XA 4BU0A 3RYFA 3HDHA 2X42A 5A7HA 3WMGA 3ORRA 1QF7A 3QJ5A 2QVGA 2CDBA 1ZN7A 1YV9A 1FTQA 3OZFA 4XQCA 2O8BA 1J6UA 3NM5A 4KQCA 4LZPA 3T12A 4B2YA 4F1WA 5JV5A 2IUUA 4AY6A 4GOJA 1IY1A 5B2EA 4LCEA 5IDYA 2VUHB 4QBIA 3K35A 3BQ9A 4PS0A 1BEEA 4LI3X 1PJQA 2DQYA 4S1VA 2HJVA 2RONA 4U6QA 1NPTO 3QU2A 3NG1A 2YHAA 4O1HA 5AM4A 5TARA 3Q9UA 4C2AA 1MNAA 4CM1A 4DR3B 1AGRA 1Y9DA 4M99A 3EZ6A 2ZUSA 3PDWA 4MHOA 2Z8ZA 1P17A 3QKSB 4C5CA 1YIOA 3E22B 4IRMA 5JI3E 4AYWA 2DGDA 1UK7A 4LY9A 4YDHB 4ARIA 4IRXA 5JVDA 3L0ZA 3QWAA 4HZIA 1QP7A 1FEZA 4LF6B 3HE3A 4Q6WA 4CNQA 4R1TA 4ZOQI 3TQQA 4OSOA 2E5LB 2XEXA 4NK4A 4Q9JA 2JLUA 1D8AA 3HJCA 3BBLA 4M1OA 4F56A 4XVCA 5JXIA 1EVJA 3NYQA 4MVCA 1KJ9A 3VGPA 1PL7A 3AY0A 3C5CA 4WBXC 4DLSA 1J7KA 2RC5A 4OHCA 1GRQA 2ZIFA 5DHAA 2JEYA 3HFRA 1H94A 3ON5A 4H1UA 2OV4A 4ZKDA 4R2WA 3BWYA 4OOFA 4MDEA 3ZHOA 2W2LA 2GTIA 3AUUA 5SZKB 4AZ3B 4CLRB 2QX4A 1O6GA 3DL2A 3KQKA 2XODA 1M10A 2IX3A 3KWLA 3ZHZA 4NCNA 1Q2UA 3HKDA 1VE7A 2VO1A 5BWNA 3RC8A 1QP8A 4CR7A 1JILA 2IYRA 3W6PA 1P2UA 3RVQA 1J9GA 2J32A 2Q6IA 3MINB 1UEXC 2G8LA 3WZMA 1G20E 3MSXA 4F11A 1NQVA 2O7NA 3AP2A 2VH1A 4TV9F 1J70A 3NYRA 4RVDA 4CPDA 3VI4B 1GCAA 3NHZA 3MUEA 2BM0A 2OCIA 2QMHA 1F2DA 4H27A 4LF9B 1SELA 4F5EA 1X8XA 2WWFA 4ZTZB 1YI8A 4J94A 1LDEA 3JALA 4HH1A 4RJIA 1O8CA 1M2VB 1QHYA 3ANLA 3RSZA 2ZVDA 4LZNA 3JASB 3REQB 2FX5A 4JDUA 3ZE2B 3LBAA 3QVJA 2HA3A 1DRWA 4AG3A 3AY3A 4P98A 3RVSA 4F96A 4BYGA 1ORWA 3JQ7A 2I80A 4OA5A 4UC0A 1N57A 3A0UA 5HCNA 2FEWB 5KQSA 3PJEA 4ZQGA 1I7NA 1H8HA 3OCJA 5GMOA 4G01B 1FMTA 2D1QA 3DE5X 4IZ6A 4DW8A 3VOAA 4DFDA 4QHSA 1QU2A 3ZYZA 4NE2A 4I4TA 4U2FA 3PUKA 3NHJA 4MGHA 1Y4SA 2PCLA 1QNFA 4M55A 4GKKB 1P3DA 1Q0PA 4N0DA 3R3UA 2XZDA 4UZSA 4DMRA 3REOA 1SQ5A 3SVLA 4OQNA 1JE0A 4W4TA 5CA0A 4YJGA 3WBJA 2H1WA 2VCHA 4GEGA 2O5VA 5KYTA 1KOJA 3EGOA 1BWQA 3MJHA 3TW8A 5F12A 2WAMA 1SUCA 2EZ4A 3R0QA 3OLZA 3QE3A 3C3YA 1L3CA 1NPYA 2GF2A 4FW8A 4RY8A 5ALZA 2QYOA 3DB2A 4Z8YA 5IKOA 4BVJA 3TPZA 5CEFA 4IV8A 4UUAA 1JDNA 3L4EA 1UZMA 4MDFA 1T6ZA 3DOHA 3VVBA 3IR6A 1DNPA 3FLBA 4A6EA 4UCFA 1H4QA 3JCZA 1WPXA 3T54A 1K4YA 4YLGA 3RHSA 2W2XA 4XYLA 4JBYA 4TLLB 1IC6A 4E5MA 3HVJA 3HBFA 4FCTA 4NBLA 5BWCA 4N8DA 1L7EA 4RJKA 1HNWB 4FR0A 2IA5A 5DCLA 1PR3A 1QZTA 4TS3A 4HLUA 1EUZA 2C8LA 4UPVA 4AN0A 5KWIA 2R8EA 3MW8A 5HS4A 2V9ZA 1GA4A 2BGWA 3PRKE 4DLZA 4N3BA 1WPGA 1OV4A 2DOKA 2YUIA 3H0CA 1NMQA 2BEVA 4LWPA 4RFLA 4ZT2A 3OY7A 2IEAA 4B79A 2J5QA 4BLWA 2HHCA 2J4FA 2RAPA 1TYEB 3GF4A 4GI7A 5GQSA 2R1TB 2IT1A 4CMIA 1SO8A 4IINA 4N5IX 3C1TA 3W5SA 2ERCA 4OBWA 5THXA 4FHEA 1SIBE 4UJ3A 4D8XA 1K6MA 4M7RA 3ZLTA 4ZT4A 1X2BA 2W6NA 1UXKA 4KQXA 3DV0A 2VBIA 1NW4A 3U5ZB 3NOQA 4PWZA 3B1XA 2NTVA 1XGKA 3AYZB 4MW7A 3IUPA 3AF1A 4YP7A 5HX7A 3MCWA 4J07A 3P2JA 3T7TA 5C9ZA 1M5TA 4X71A 5JSHA 8GPBA 2QVCA 3GLFE 3UNXA 1Z4MA 4S1OA 5FI3A 1JEJA 4TVBA 4HQKA 1XCMA 2GZHA 4JC0A 4DPMA 1SH7A 2FCAA 4DHEA 3OTHA 2X2FA 1JJIA 5TGZA 1G21A 1NYTA 3ZWYA 1L9XA 3DO8A 3HCDA 3ELUA 2I3DA 3HYSA 1ZA1A 4HLUC 2HK6A 4EP1A 2JJ2D 3FOEC 5H0IA 3BJIC 1FXUA 1JHZA 1MVLA 1MTOA 2C03A 1YC2A 2GCGA 3C6ZA 3K0CA 4IH1A 4M9SA 3TQCA 3I34X 5HQTA 5JNVA 3EOBI 3Q7EA 4MH0R 4KDEA 5E3HA 1GPYA 2O3TA 2BTQB 1UPFA 2W6ID 3GLIB 3P94A 4BS9A 5BYAA 1T9ZA 3AR3A 4OYHA 1UIMA 1FS5A 1RWQA 4LA4A 4RVHA 4M8SA 4DARA 2CZCA 4RC9A 1L7RA 4YO7A 3LZ6A 1H1LA 1L7DA 3ZCXA 4I19A 1ICEA 4CQMD 1SBHA 2GETA 3U7GA 3BL8A 3RT1A 4LXTA 2ET6A 1AX9A 1E99A 5KMGA 2ADMA 2OV2A 1B1AA 1IQUA 1L5SA 2NSYA 4HWTA 4PZCA 3FNGA 1R8YA 3AVPA 3NVAA 2BM9A 1W1WA 2FEKA 2IY9A 2CJFA 3DVRX 2GR9A 4NYJR 3CF2A 4CMCA 2P0AA 4WOCA 1M7GA 5A4JA 2QWXA 3LUCA 4BNXA 3EVCA 4DZZA 1USKA 3DDHA 3QOFA 1SC3A 4D5EA 1L5VA 4EYOA 1KXZA 5G1OA 2IF0A 2TSYB 3FUTA 1UK9A 1SKUA 1RWOA 3UAVA 1S0UA 2QG9A 1V1MB 2IKSA 3QXGA 1R0WA 4LXXA 1QR2A 2FFQA 1M6HA 9LDTA 3JWJA 1DB3A 5AKYA 5CR9A 3HRIA 5JWRA 1NFRA 1Y9ZA 1BRMA 1X42A 2GPWA 1RJEA 3HZOA 4K6OA 1Z0DA 3SVZA 1JG7A 4BVLA 3SFVA 1EK0A 3EIOA 4LHZA 3PS9A 4UBJA 3RFFA 1XMOB 4PGHA 5I6DA 3AFMA 2B78A 1L5QA 3AERB 3UWMA 3VV2A 4JUAA 2JVJA 3LC2O 3QKSA 3E22A 1R3DA 5DWQA 3ROGA 5EJIA 4GC5A 4EB0A 2P6NA 4DR2B 3CXRA 2AJ8A 2VTDA 2ZSHA 5HIIA 4TS4A 2XZOA 5CB4F 1JYSA 1E2QA 1PQ4A 2LDBA 3FETA 3LHSA 2VPWA 1DEXA 1TU3A 3RWMB 3T3EA 4F60A 2GBLC 3LBFA 4K86A 2YASA 4RX1A 1BMFA 5FFNA 2IXTA 4BIIA 1EFLA 1L3IA 1PL6A 4AZ3A 6LDHA 2SICE 3AF6A 3K0BA 2R8ZA 2X3UA 2GUGA 3D2LA 1TQHA 1TKRA 2QTLA 3L46A 4QUDA 4DLRA 3JQAD 2VDVE 4HGYA 3RAGA 4JL6A 2QT9A 4OU5A 5IVIA 1CG6A 2A5GA 3A7DA 1ZJZA 2V45A 4P7KA 2VYND 4EZBA 1TVKB 1YR7A 3MINA 1LNZA 1RTKA 3A6KA 4GZMA 2Z95A 1AKUA 2JGKA 4F3RA 5EXEA 3TFWA 1GARA 5BYBA 4LPKA 1NC3A 5BVHB 1OYOA 1Z33A 4JN6B 2CE7A 1PD0A 1OROA 2JIZD 3LBHA 3MTAA 2HJGA 3CIOA 2P1DA 3DVQX 1IWOA 4IF4A 1PR2A 3REQA 1J20A 3CJTA 1A27A 4RVOA 1F48A 5B7QA 1A8HA 4F92B 3U40A 4DCMA 1SD5A 1TF7A 3W8DA 1K7CA 5H82A 1Y37A 2JZOA 3P9KA 5ENDA 1ADFA 1JAIA 2Z2ZA 1M5RA 1VHWA 4UDYX 2BH2A 2C2OA 1EVIA 2RI0A 2HA4A 2IEIA 3VOSA 2PMFA 1SG9A 1U5BB 1P1CA 3HSYA 1SM4A 5FBVB 1UQRA 1WW3A 1ZMBA 1BDBA 4GMGA 4J0QA 1CVRA 1UUFA 1ZN2A 2WIFA 5H5JA 1AQ6A 4RL6A 4XR4A 5JCXA 2BMJA 2BUCA 1NM5C 4DC1A 2XLBA 2Z2XA 1XI2A 3AUFA 3NC1C 4CEHB 4ZOLF 1MX9A 3PHLA 4NAHA 4RL4A 2JKZA 2O4CA 4J0KA 4UJ5A 3T4XA 5I51A 4XYEA 3KLMX 4Q4HA 1EWYA 1TA9A 5K0FA 5REQB 1JEQB 2NXJA 3I9V1 1G19A 4XUDA 1ZD1A 5EE1A 4PC6A 2I55A 2YIVX 5AM1A 5C1OA 4J4BA 5HKBA 5AM2A 5LMCA 4WVFA 5TPZD 3ZV3A 4H6XA 2ZT5A 4KXWA 4U7JA 1UPXA 3MBOA 2DX7A 3BRQA 3PPWA 1LZLA 3CB2A 1Y5LA 3NX4A 3PUXA 3TD2A 3N2ZB 4KVZA 4V2IA 4DM7A 3ZDCA 4KWIA 1UH5A 1C1XA 3MNFA 4CDGA 3WHLA 4ER5A 4AKHA 5EMLA 2W37A 1ZESA 3H5WA 3MUOA 3QYPA 5DGIA 1XD2B 2JGDB 2P2CA 3IIKA 4EZIA 2H16A 3NC4A 1FPQA 2O2GA 2IWRA 3ZQ6A 3ZCQA 2JAHA 2QRKA 4IV0A 4UTXA 2XTJA 1CYDA 3D3WB 3KAQA 4Q9AA 4AO6A 4X94A 4D0RA 5KSYA 3LH5A 2RJ3A 1WZNA 9ABPA 2ZKLA 4ZOAA 4DXAA 1NI3A 1FNSA 4B82A 3X0DA 3FCXA 3AVUA 3D81A 2IYZA 2DPGA 3M4ZA 4DWOA 2W83A 2IYLD 3PNQA 4MMYB 4P83A 4PX9A 2XB6A 4ZCSA 4URWR 5J59A 2CCKA 3K05A 4LRQA 3M4NA 4R1LA 1YR3A 3I6ZA 3VH4A 3CTMA 5BN1A 5HHTA 3FYCA 2PFSA 3KQWA 5K8UA 1ZH2A 3OKPA 1Z88A 2VRNA 4UHDA 3BOSA 5C7YA 2CFCA 1NVDA 4M0DA 3MTBA 3RT7A 3M6FA 3T7AA 1FP7A 5TVGA 3OZCA 1Y8CA 1RBYA 4FW9A 3FKQA 2RHRA 1JEAA 1E5LA 5CCEA 3KEMA 2D4HA 3Q8XB 1XUOA 5CYPA 4RTOA 2W58A 2HJRA 4MYHA 4LJLA 3QF7A 5BYJA 1KEEA 3TLCA 1XU7A 2OGWA 3LP6A 2HHAA 2BP7B 1N2CA 4WE3A 4EX7A 3HB1A 2EX0A 4IIXA 3FHJA 2FR1A 4M36A 5IJZA 2C58A 4TTTS 4NFSA 2P3OA 5KVCA 4GICA 4LXUA 5IN5A 2QS9A 3UMJA 1VYHA 3F5SA 3DMPA 4PZ9A 4CR6A 2H3EA 1FFBA 3FOZA 3NUQA 5HNKA 2XTMA 2CV0A 4MAFA 2IZ5A 2HFJA 2ILTA 3TQHA 3EGEA 2BTQA 3WIEA 4BMOB 5CBKA 4I36A 4OJQA 3Q8MA 1M1UA 4B0OA 4D8YA 4HQ0A 1BX1A 4M60A 5J4KA 1U2QA 3I53A 1J0XO 1MF7A 3FOAA 1KYZA 1QWSA 1YE8A 3H65A 3OT4A 1AOXA 2OE2A 1LPPA 4OSEA 4OV6B 4OK6A 1PYOA 3JQFA 3OM1A 1KYWA 2Q5FA 1LRJA 1LRLA 3ZZUA 1AKRA 1WNFA 3JYOA 3PXXA 4UDXX 1UXIA 4H18A 4TL8A 3C14C 5EUMA 1F17A 3TZQA 2PUFA 4NMMA 4GKAA 3HO1A 2Z83A 2R8OA 1NBHA 1J23A 2DUWA 4INJA 1HFJA 2F3QA 2JD1A 3EGVA 4OM7A 4Q47A 2XUQA 2C82A 1SUAA 3FTPA 2FPPB 3RTGA 1Z18A 3JPYA 1PJCA 4L3VA 3CX4A 5F9FA 4GP6A 3OAAA 3SPXA 1JFLA 4MK4A 1IN1A 4DF3A 5JIBA 1F8YA 2AOTB 5TEWA 3EEOA 4Q4DA 1C9YA 1V1MA 3CY6A 2DETA 2W98A 5DNCA 4F4JA 1T0IA 1EK6A 4GUAA 3RUCA 1F0NA 1ISSA 1XRPA 1XYVA 2VNAA 4FE4A 1MO6A 1ANKA 3HQ4O 4QU0A 3AB7A 5HXAA 1TTTA 2EZUA 2Z98A 4G97A 2QTCA 1NC1A 2A1UA 4HEA6 4LY6A 4MV0A 3W6UA 1BO6A 2RH9B 5HCIA 2JIQA 4DUGD 2DY1A 1IEXA 1HQDA 4ZARA 5TNXA 3MM4A 1QKKA 2X86A 2KQUA 1DJQA 4RK4A 3GT3A 4EFKA 1I3OA 2HC9A 4M1QA 3RYCA 1WE2A 3KT6A 3MQ2A 1AKVA 1RM0A 4ZYZA 5A5DA 2BYTA 4QPJC 2PPVA 1CQPA 1XTUA 1JLSA 4ND7A 2EJWA 3BWEA 2XMPA 2OWEA 1FFXA 3EZYA 1EFUA 3TIFA 1XLUA 3H16A 4GWGA 4P8RA 2FZKA 2YXDA 3GRAA 5IM5A 3U1TA 1H1TA 1KTVA 1ULUA 1YS2X 3FG9A 3ROXA 3AB3A 2JCSA 2YWJA 4BVKA 4OO3A 3WS7A 1OBHA 2YHBA 3A9RA 1E1MA 3N7TA 4PSAA 5LQDA 4HFRA 5A4AA 2PY6A 2Q8NA 3IP7A 3U44B 1XDZA 1Z4OA 3N70A 1OGYA 3CRNA 4QTZA 1A2KC 1PKXA 3LI2A 5CYFA 3SWWA 2IUEA 2QHXA 1TVKA 3PKJA 4YMWA 1QLWA 2C3UA 1CB0A 3NM4A 2GEBA 3UK2A 1NVAA 1OHHD 1OA0A 2J3MA 3RBXA 3NIGB 4ENPA 3GUHA 4IL5A 4X6YA 4GIBA 2BKVA 4HDNB 2Z08A 4MI6A 4UNPA 2FRDA 1RHUA 4Q1CA 3SZ3A 4HPJB 2R8XA 1IG3A 4XB2A 2VAXA 5CFPA 4KXFB 3ER9A 5BVHA 1PQPA 1RXEA 2HREA 4J1SA 2FSHA 3C5HA 4JK3A 4XA8A 4PZUA 2WJPA 4DBZA 3GUCA 1SOMA 3M6UA 4E6PA 3LW7A 2XBUA 4HGZA 5T8KA 1BQ3A 4KC0A 4ALLA 3G2PA 4MA4A 1KK2A 3KKQA 4LBWA 5DE3A 2BOVA 3GZTB 1AK9A 3HZHA 3R3JA 1MOSA 4HZGA 3WZ2A 4LTDA 4N7RA 4D99A 2NO0A 2B2CA 1K3UB 1Q12A 3DEZA 3BCSA 3OZIA 4Q9LA 3HXOA 3DPUA 3HLYA 4NHOA 2HU8A 4HRVA 5G0WA 1SJ9A 4MPJA 3TTTA 2P5YA 2DUMA 2WABA 1QM5A 1EFRA 4LYFA 2CMKA 4H4EA 3V3TA 3QLJA 1FP4B 2CF6A 5IAEA 4F4IA 1FPMA 5CA1B 4N03A 3WLLA 4CEHA 5FUXA 3BXFA 1X3LA 1N8KA 2BZ1A 2F9FA 4RK1A 1M1NB 4JZKA 5EIFA 2BEUB 2NT4A 1FYXA 5JWOA 2ZI7A 3K0AA 1BS9A 5JCPA 1GL9B 2FRDC 3CZQA 3P20A 1JEQA 2QXUA 5REQA 1DXHA 3WGTA 2QRQA 4B3XA 2V9PA 3STHA 5DEOA 4X7BA 3DL0A 3F74A 2NUAB 4KYIB 1TMOA 2WSYB 3NP9A 4OHWA 5IYZF 4C7BA 4F8JA 1V4NA 1J0BA 4E2FA 3RSSA 3R6TA 3ZBQA 4B80A 1G5PA 1GT6A 3UW1A 2CB0A 2JGEA 3NNNA 4DIBA 4PZYA 2RC6A 4FE3A 1U2GA 3HU3A 3FTEA 4XLTA 3PGMA 2A9JA 1T25A 4LV8B 1E0DA 3LDFA 3A1TA 1XD2A 2EOAA 4C2BA 2VG8A 1XZMA 3RSGA 4DCTA 2VJCA 5FUMA 3TR5A 6ADHA 2PFKA 1PHPA 4EKNB 3AFOA 4YASA 5JD4A 1Z4JA 4MIOA 2FMHA 2XEDA 3GVCA 4IJ6A 2NOAA 5CB6A 3H8VA 4NCIA 3S55A 1OYWA 1TU4A 3TEFA 1ZJWA 2O20A 4NNOA 1FU4A 1P6XA 1SOAA 2IUYA 2V0CA 5ECDA 4J9UE 1E2PA 4ZOCA 3UMSA 1L5YA 1W6RA 2YVKA 5E4YA 3RG8A 2MCFA 1XZIA 5HWSA 2P6OA 2QLBA 2NIPA 5HKKD 3TQTA 2Q3DA 4BJHB 3KJNA 4N7BA 4ROTA 2EDAA 4UTPA 4RMGA 2CL5A 3K2IA 1UPCA 1DRKA 2WT4A 3DTVD 2QTVB 3JD2A 2GARA 2GJ8A 3L8YA 4OUKX 5LA6B 4BMPB 4BUJA 2VDQB 3E9ZA 1SN7A 1DU4A 2HJ9A 3F9RA 4PLPA 3VDRA 2EDCA 1Z4QA 2Y0BA 3HXLA 1FE8A 3EPPA 1CLUA 3C8HA 1HA3A 1KJIA 4MV5A 3VJMA 4LYYA 2PMEA 6Q21A 4KJXA 1U2GC 1XCGB 5A2QA 1I2MA 1TJPB 2JAQA 3EVGA 1KO5A 1L4YA 5LQCA 3VNSA 1U0NA 2AXPA 5K4AA 4K9PA 2FP3A 3IDAA 5JZVA 3AF5A 1SAYA 3EGDA 4PIVA 2C7PA 5A0VA 5CB8A 2KLBA 5AK3A 4OREX 3UJBA 3ZD9A 4RJ2A 1I4WA 1VJGA 4IVRA 1CVLA 3OJFA 3H1TA 2DXIA 3D4IA 1RFGE 5J2TA 1PZFA 1QFMA 5H4HA 2AN5A 4YT2A 5DK6A 2C59A 2EHDA 5CLIA 2Q5QA 5H3HA 3TIGA 1IZZA 1RXVA 1KYXA 4BWVA 5EJ8A 1TO2E 1XAJA 2Y2VA 4RD3A 4R71A 3HPQA 4YREA 4KQ2A 1XBTA 2IGTA 5JHGB 2OGTA 2VR1A 4E5KA 1W75A 1RPNA 1NA5A 3EEIA 5KQMA 3PHIA 1H1DA 4ZXPA 4ECEA 5HUHA 4MV7A 5JISA 4F21A 3I23A 3QEJA 5KQRA 2RIRA 3WYEA 4BX9A 3GUVA 4DOMA 1Z8NA 2FPPA 3CLSC 1IDN1 1ZO8A 1W5AA 2ZRPA 3FR8A 1CUSA 4Q4LA 3ZZ1A 1FCJA 1ZVMA 2NX2A 4ZAFA 4B8ZA 1QHFA 1KO8A 1MDFA 2AOTA 2RH8A 3RFTA 2GF9A 2AJTA 4G0OA 4L8LA 3V8VA 2ZM6B 5TQ0A 4BCDA 1GCGA 1U3GA 3FBTA 4DGQA 1KPHA 1KU0A 1NUHA 3F90A 2WWYA 2NZXA 1YQQA 4L76A 3BK2A 3GVXA 1D07A 2N42A 2Q46A 5LWQA 1JQ3A 3R5JA 3V4PB 2WINI 1BH2A 1G20A 2CXUA 2F9LA 2WA2A 2NZVG 4RA9B 1YZVA 1TRKA 4IOMA 4WV3A 4XVUA 5AW1A 5K8VA 1RZRA 1GRCA 2F3RA 1ZUNB 4L4YA 5BV2P 5DBIA 4EPTA 3BKWA 1J8VA 2ZYVX 2KHZA 3SSOA 3TGLA 2QLTA 3DT9A 2CNLA 1MENA 5JTTA 2Q4BA 3EISA 1I2ZA 4CLOB 1H85A 4IO0A 5D5PA 4KZPA 5F5NA 2B2XA 2C92A 1NXVA 3LXUX 1MO2A 1O6BA 1GO2A 1MQ9A 1ZAKA 2ZIZA 1X14A 1T2NA 2GN6A 2C1ZA 2G04A 5HG0A 3QFHA 4WMLA 3PVSA 2QG4A 4HDRA 1R64A 1B8VA 1UZAA 5KSPA 4CHGA 4CU2A 1YHZA 2XCTB 2H6EA 4CCWA 4DIKA 4WASA 5C3MA 2QEQA 3NBZC 1G0OA 3EPRA 3BGVA 2ACEA 3C6BA 1LU9A 2FSUA 2WZQA 4NBWA 3BDVA 3PIDA 1TPZA 1FDTA 4ISCA 4E4RA 3TMAA 3EBPA 1D9ZA 1GCOA 3KUUA 4MVJD 5DHUA 3ZBTA 4OXYA 4E4YA 1P4GA 5FKJA 1O96B 3W8EA 3WAKA 2G4VA 4B2PA 4F9TA 3TNLA 3SKVA 4J16A 4GNKA 1NLMA 1ZMRA 1W48A 3PG5A 2NO7A 5FI1B 2B4QA 1PNOA 3GUYA 3SHOA 2YV2A 4K9QA 4COKA 3B2NA 2H4JA 1J8QA 3AHEA 2Q41A 3OJ0A 5YASA 3IGFA 4Q34A 1S01A 3GVPA 1R6VA 2B20A 2ZRJA 3TEJA 2WPNA 1U5CA 1PDVA 2G0AA 3M3PA 1QCCA 2V74B 3HB4X 3ZCVA 1NE2A 4N5HX 3U3DA 4FMBB 4CM6A 4J7CA 1J9ZA 4G1EB 2H5JA 1DXYA 2GTHA 3BRSA 5A9RA 3N8HA 2Q9CA 3EULA 3JU3A 1B6TA 1XQ6A 4O2RA 5FNVA 1E6UA 3RS4A 3G6KA 4A8JB 3W4KA 1JLMA 1E64A 5HIMA 4DJEC 3KOZA 1RJ9B 5KO2A 1EFCA 2D5IA 1D4OA 3BD6A 4PC2A 1TM7E 5ITSA 2B34A 3CEPB 3I72A 1YONA 5HF5A 4EPYA 1HNNA 1L5OA 2QA5A 1V8BA 3VPSA 3EXFB 2GO7A 3ZI7A 4BZXA 3KWMA 1N6IA 1VJTA 2XE4A 4NS1A 1BN7A 2OR3A 4BO1A 3QPCA 3QUSA 4Z9YA 2CLMB 5JH7A 4TV9B 2W2VA 1EXDA 1O6FA 1G2OA 1SZPA 3QVGB 3FN4A 4HWPA 4TYNA 5DSTA 4Z7NB 5JYEA 3SFTA 1DJLA 5CA1A 1A9SA 1GG2A 2C07A 4DDHA 1V41E 4YECA 5CDFE 1GQ2A 4KLCA 1M1NA 2NYVA 2BEUA 4OGKA 4A10A 4ABYA 3JVDA 1TW2A 3FWZA 4D9MA 3HJFA 3REGA 3S2GA 5FOXA 1K7FB 3I2GA 2KJQA 3ACBA 4FFPA 4DA0A 4X66B 2V7EA 2NUAA 2Y1OA 3UOGA 1BXRA 3PPVA 3GMTA 5B12A 3IA2A 4G23A 1EXWA 3AIOA 2H57A 2RBKA 4FR5A 3HVHA 2FVXA 4MQMA 4O2LA 5EKUA 5BSUA 1MKYA 4D4MA 3L5KA 1FU8A 3C3AA 1L1FA 3UAXA 1F7VA 2V59A 3O1HB 4IWNA 4WWHA 4HLQB 1SQSA 1B0UA 5IJ0A 5K0SA 4HHEA 1X0XA 4F91B 6AT1A 2QJFA 4WXMA 5IAOA 3GPIA 2OGUA 2Z8XA 2DERA 2ONCA 2VFAA 1G5IA 3R7BA 4J43A 1TB4A 1LBQA 5TLSA 4V0KA 1FTGA 4GPBA 4LRUA 5FFFA 1RWKA 4YV2A 5I48A 8LDHA 3FTNA 2WQ6A 1U11A 1U4SA 2FN4A 2NGRA 3AXTA 4QDOA 2G6TA 1RXWA 5CDSA 1CJVC 3E27A 1NDUA 2CFRA 3HZZA 2GCNA 2H1LA 3IOYA 4P86A 2X5OA 3EC2A 1E7RA 2V7QD 2IZZA 4XOUA 4HMPA 5DGCA 4XB6B 4ZC8A 5AFSA 1T4MA 2P79A 1AUVA 2WM8A 5JFOA 2HF7A 2DPYA 4KEAA 2AEEA 3I30X 3U60B 1VLJA 1ZN8A 3GRCA 1J8DA 1SBZA 2QTVA 3WRWA 5I9NA 3ORFA 1E9AA 1ZCZA 2XWQA 4BQSA 2F8SA 1LI7A 5CIYA 1W0JA 5JHHB 2EJBA 2DKFA 5CNKA 3OTGA 5E4JA 5TE9A 1QUEA 2ST1A 1NT2A 1JKFA 2JBHA 2GZ3A 1F3OA 5KTKA 5FL7A 4YBRA 3ADDA 2GLTA 1IOZA 4HQOA 4JUIA 1KRXA 5DIFA 5BMOA 4NBSA 1T5HX 2P67A 4IMRA 2DFNA 2WSMA 1L4LA 2DY0A 2FB9A 3MWDB 1MJGM 1U6KA 4WK6A 1XV5A 3EFHA 5AJUA 4KXMA 1G2QA 4DGSA 3L3BA 2ESRA 1DHTA 1Z8HA 2BGKA 2IODA 3E70C 5CK4A 1MV8A 4MW9A 4WGFA 3ABSB 4GOOD 4CIXA 1MXHA 1KK3A 3UVEA 2A0FA 4DYHA 2I2BA 4O4LB 1EJ0A 2WAXA 5IFLA 2JATA 2XXJA 3EARA 1CUZA 3LZCA 4I55A 2GAAA 3KEFA 3R8XA 4BNKA 1M67A 4G4GA 5K8JB 2C3YA 3S8YA 10MHA 1POWA 3F6YA 5D2CA 3OIVA 3IULA 2RKWA 1C29B 2H0QA 2ZRDA 2CHGA 4FGJA 5TT0A 3PQFA 4EB3A 3NJRA 1UAYA 1EUQA 1OXUA 1KP9A 4PHCA 1E1KA 3ZNNA 1MFPA 4KFSA 3ZWBA 3I61A 5ALSA 4QOJA 4G24A 3KVNA 2G7ZA 3ZV4A 3L1IA 4OKSA 4WY2A 1YGYA 1BKDR 1UF9A 2OD2A 4J0EA 2BGIA 1X87A 2WAYA 4FFOA 3GY0A 1AKMA 3JZIA 5LOVA 1T3TA 4Q21A 2KBFA 4MO9A 2JLCA 5LU8A 3W5UA 3PQ3A 5CW1A 1XEWY 4MQBA 2JGAA 2G09A 1WSAA 1FUUA 1HLFA 3TTUA 3AF4A 4BKPA 2WDPA 1GU7A 1WW2A 3NDBB 1FTWA 2JCVA 3Q8WA 1C8VB 1YDMA 3O95A 4JS0A 3MRXA 2I4IA 4NENB 2NADA 4JR1A 3WLIA 3BIOA 2AFVA 1A2OA 2WHPA 4CTMA 4LCJA 2GJ4A 1CQJB 4RA9A 2Y68A 1XYGA 1NT4A 2EXXA 5B37A 1AMUA 5A6SB 3NANA 3KT3A 5DOVA