4MX8A

Crystal structure of troa-like periplasmic binding protein peripla_bp_2 from xylanimonas cellulosilytica
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
302
structure length
302
Chain Sequence
b'PATASYTWDRNTATEEGADPVYEETTVEVPVDPQRIVVFDMAALDTIGALGGEIAGAPLDSVPDYLEEYLADDAFNAGTLFEADLIAIEAQQPDLIVVGGRSSGLWADLNEIAPTIDLSLRGSYLDTLEQNTTFLGKVLGAEAEAESVLAELEAGIAEAKAAVTEASGTGLGIMVSGGQLSALSPNTGNDPRGARGGLIYDVFGVQPVLEDIKAATHGEPISFEFLLEHDPQWLWVVDRDAATGAEGAQAAKVVLDNEIVNRTTAATEDHVLYLNPTAWYIVFGGVETTRIMIDDVLQVAAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Periplasmic binding protein
molecule tags Solute-binding protein
source organism Xylanimonas cellulosilytica
publication title Crystal Structure of TroA-like Periplasmic Binding Protein Peripla_BP_2 from Xylanimonas cellulosilytica
rcsb
total genus 90
structure length 302
sequence length 302
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4mx8A01
3.40.50.12260 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mx8A02
4OXRA 4PAGA 3PDIB 2AFIB 1MIOA 1K7SN 2Q8PA 3AEKB 4MDYA 3MFQA 3ZK8A 5KOJB 5ADWA 4TKVB 3BE5A 4WZBA 3AESB 1PQ4A 2PHZA 1G21A 2QI9F 2R7AA 4INPA 4LS3A 4MLZA 1K0FA 4JCCA 3MINA 4FILA 1QH1A 1G20A 2WI8A 1FP4B 5GGXA 5BVHA 1H1LB 3U7QA 5CX1A 1M34B 2WHYA 5CR9A 2OGWA 2O1EA 4ND8B 1ESZA 4OXQA 5HDQA 4TKUB 4HMQA 1MIOB 1XVLA 3EIXA 1N4AA 3MINB 4UTOA 2PS9A 5HX7A 5BVHB 3NU1A 4TKUA 2ETVA 5LWQA 4TKVA 4NNPA 4DBLE 3HXPA 4UTPA 5JPDA 1FP4A 4B8YA 5KHLB 2Q8QA 5CX1B 2CHUA 4PM4A 3AEQA 2AFHB 2AFIA 3AEKA 1EFDN 4GICA 3UJPA 1N2ZA 3ZK7A 4FI3F 4FNAA 5M34A 3MWGA 4WZAA 4MX8A 3AESA 4LJSA 4ND8A 5JG7A 2XDQA 4XPIB 4UDNA 3TLKA 3CX3A 4WNAB 1QGUB 4WN9B 3GI1A 3TEFA 3ZKWB 5M29A 4N01A 2RG7A 5B58T 4MO9A 5BVGA 3ZKAA 5KOHB 5A1JA 1KAEA 1K75A 4UDOA 5BVGB 3AETB 5LWHA 1L5HB 4H59A 2PS3A 3TNYA 4G09A 4BBPA 4XPIA 1N2CB 2M6LA 2MINA 2YNMC 3AETA 3K1AA 5JOQA 4IRMA 4H0FA 1K2VN 4HMPA 2OSVA 4INOA 1KARA 2X4LA 3GFVA 3R5SA 5GGYA 5FLYA 1N4DA 5AFSA 5M3BA 3ZTTA 2AFHA 3MD9A 4FKMA 4HN9A 2M6KA 5KOHA 5ADVA 1M34A 3AERB 4M7OA 5M2QA 1N2CA 2XUZA 3AEQB 3PDIA 1QGUA 3EIWA 4WN9A 1L5HA 3ZKWA 3AERA 2MINB 4WZBB 3LI2A 1M1YA 3U7QB 5JJ5A 3HH8A 2XV1A 1G20B 3G9QA 1TOAA 3AEUA 2PRSA 5AD1A 1M1YB 5I4KA 4NNOA 3K1AB 1M1NA 2R79A 1QH8B 3MWFA 4WNAA 4OVKA 1M1NB 2OV3A 4WESB 4WZAB 2XH8A 3AEUB 2OV1A 3PSHA 3ZK9A 1H1LA 2YNMD 1G21B 1KAHA 3LHSA 2PS0A 4WESA 5KOJA 5A5VA 1QH1B 1QH8A 1PSZA 2XDQB 3R5TA 4HMOA 5A5DA 4G07A 4K3VA 3BE6A 2XY4A 2XQVA 3PSAA 4CL2A 3HJTA
chains in the Genus database with same CATH superfamily
1NZJA 1RYFA 5LNK1 1OX4A 2ZETA 3T7CA 4KQ1A 5T3YA 4RXTA 4BQEA 2V6MA 4C14A 3P71T 2ZYDA 1YL6A 2FSPA 2WMDA 1NMEA 2Z8XA 2FGJA 4GR4A 4WDRA 1JHAA 1BJRE 3VYTB 1L1QA 4EUNA 1CQIB 3KLOA 1QP8A 1ICIA 1C3OB 4AKSA 1N2IA 1SBCA 3SDSA 2I6TA 3H5NA 4NQZA 1R50A 1RXSA 2RSLA 3AY0A 3BE4A 3H4IA 1QHHA 2BFWA 2HK8A 2WAAA 4G1BA 4CXMA 4M1SA 4ZALA 3S2FA 2SCUB 2WM2A 3HWSA 1J56A 4NYMR 1J5PA 4KLZA 1V8ZA 3GH3A 3I04M 5DGIA 1JMVA 3ON5A 1EB9A 1EFLA 4HDMA 4WY2A 2ZCVA 4M2LA 1W9MA 1HMPA 3EMKA 3TW8B 2CC2A 1JDSA 3NDRA 3ZXUB 4XGKA 4BQOA 4Z7NB 1SC4A 3JZMA 3KJEA 3TNDA 5KTYA 4RIEA 2OGUA 4A8JA 2RH9B 4I5GA 4ZKDA 3G2JA 3NKVA 4L4RA 3ROXA 2WJGA 2P2ZA 5DHSA 3WYEA 3UJPA 4QWWA 4EY5A 2W2LA 5IC5A 1K7FB 4YJ2B 5BNFA 3SP1A 3CXRA 3BD9A 1UT6A 1R4NB 4BVGA 1FU7A 1WMEA 4AN1A 2TMKA 3LQ2A 2D1SA 1EP2B 4M83A 3WFJA 2BEJA 3LPAA 4PU0A 2L0XA 6NULA 2ZRDA 2YW9A 1E3WB 2NYRA 3OTIA 4O5AA 4RGBA 2FLVA 3ANTA 5DM0A 4GC9A 3GT4A 3G9ZA 3H5IA 4KYTA 3S4YA 2YWDA 5KHOC 1O57A 4MKGA 1FRZA 1TTPB 1Q83A 1KJJA 1RQNA 2WKRA 2FW0A 4RJIA 4UEOA 3H16A 3G0HA 4YP9A 1D4AA 1QO7A 2M6RA 4NX2A 2J4FA 4TMTA 5KYGA 2HUNA 5C3MA 1ABBA 2BEKA 1HTBA 4PZAA 3I2HA 3Q1LA 1OWMA 3Q3IA 1I9CA 3L7JA 4HL6A 4CM7A 1TM5E 5SV2A 3RC9A 4DNPA 4TYNA 3H9UA 4Q3LA 3E8SA 1IZ9A 1Q1BA 2JS7A 3SIXA 3UV3A 6ABPA 3VZQA 1VMDA 2WD9A 4JJ8A 2HCFA 4NULA 1E9FA 1O96B 4P33A 1QRDA 3LUCA 2XVMA 2YXBA 3KJXA 3FH0A 1Y6JA 2B98A 3ESCA 1VC2A 2DFDA 4W5QA 1K08A 2OT3B 3DE4X 1HLDA 4XWWA 4G5SA 4R7TA 2B30A 3SZRA 3TW6A 2G5GX 3E8XA 4B3HA 4AYXA 1IJBA 4UPEA 2J32A 2Q41A 1SBQA 3NG1A 3PR3A 2HPVA 4JMLA 3Q0IA 3OQHA 1M1NA 3QVLA 4LGVA 1JQEA 2GD2A 5KCZA 4AUNA 3NVMB 1I80A 4NU6A 3A4IA 4E2ZA 5EHZA 3L9WA 5I9NA 5F5NA 5EMKA 4BLRA 3DA8A 4YMGA 1Z4KA 1RI2A 1JSZA 1SK8A 1LQUA 2YIVX 2ZB4A 5JXIA 1HL3A 1AMNA 4W5OA 1GU1A 1NV8A 3UIEA 2WE8A 1ZSNA 1NASA 4K8OA 4I3HA 1E9DA 1JAHA 2FUNB 1UZLA 3B9RA 8ABPA 3PPYA 2B9EA 3MWJA 4CEHA 5JEDA 1JDZA 2E21A 1VCHA 1YDEA 1JR6A 3CLTC 4N3AA 1HLPA 3VYUB 3VJRA 2WFZA 4IO1A 5LQMA 4MW4A 2X1HA 4O2BB 5M04A 1KGSA 4HZIA 4KWEA 3WIOA 4EENA 1RYMA 5TY0A 3SYLA 3LQQA 4OX9B 1T36A 4E4RA 4D9KA 2I9PA 4RY0A 3GA0A 3GEGA 4A6DA 5LBIA 1LI4A 1RE0A 2V9ZA 4DY4A 3P4UA 2HHJA 3NEYA 3BBLA 4YCNA 5DYYA 5HKKA 1JMKC 2JVJA 4IKEA 2PUFA 1B42A 3NCHA 1I13A 1OKKD 2C1EA 3ZE9A 3T1VA 3WTBA 3K05A 2I3GA 2ZJFA 3DDHA 4ND6A 5DOVA 1GZVA 1IY1A 1E3TA 1Q17A 1V8DA 1MB4A 2EJCA 3DBHA 3Q6NA 2LPMA 4R2MA 3OFVA 1XKLA 3VI4B 1ECLA 5IM4A 2FPMA 1PGOA 2BF4A 2RE8A 2HHHB 1PLLA 5HKOA 1RTTA 3RYFA 1VMIA 5E8RA 2FF7A 3UOAB 2XIQA 2QRVA 4JWKA 4PGHA 3JQ9C 1ZCJA 1CKEA 1YO6A 2CJWB 2DFVA 2F1RA 3VAYA 2CV1A 2J0SA 4GC5A 3P2IA 3HKCB 4KSBA 4UOEA 1EUCB 3BWBA 3MJVA 4X1KA 5HQTA 2IYWA 3U5ZB 5CK4A 1E6KA 2QM0A 3ZEIA 5IFKA 1U0OC 4X1OA 5AR1A 1MOPA 1W35A 4QWMA 3ICQB 3KEMA 3G8AA 2X2FA 3OURA 4GPBA 1O54A 1ORDA 1EFUA 5KYXB 5TPZA 4NPAA 2XUAA 4ZHQA 2EL9A 2VPQA 4OPMA 4G0WA 1SIBE 4GOOD 1RACA 1DBSA 1RLJA 4CCAA 5IEBA 1C8VB 5GMOA 1H3FA 4DDKA 1U28A 3WO1A 2VWGA 1F1BA 2HEGA 1OQAA 2I7CA 1K4KA 1QB8A 3RIMA 2B6HA 1AKVA 2HCRA 2R84A 4LSWA 1J0EA 1T8YA 3I64A 2ZB2A 4P83A 4NZYA 5AVYA 1MVNA 1Y6ZA 1LV8A 1XO1A 2WJHA 3NBUA 3OU7A 4HN9A 4BKRA 3CNNA 3GFSA 5JCPA 5KOHA 1D1TA 5AMXA 1QGZA 1OWLA 1KFJB 1ST2A 1U6KA 2ZREA 3OTQA 1JHZA 3BD6A 2QW8A 3RU7A 2PDAA 5EWLB 1P0FA 1CB0A 2YHIB 3IQWA 4M88A 3HYSA 4AJ1A 4KR2A 3G1WA 1L4LA 5DTRA 2VXCA 1WVMA 1I3NA 2FSVC 1V9LA 2Q7XA 1YK0A 3ETHA 4FGWA 4JX9A 1T9CA 1TJ4A 4IUDS 3GR6A 5H4GA 1Q19A 3HYRA 2H4YA 3KHUA 3VH4A 2O8EA 4XM1A 4Z53A 2QRVB 1P5FA 1KQOA 4U7WA 3BCHA 3AVOA 4LRYA 4KGZA 4D4LA 4E7OA 3R40A 3W5SA 3BIXA 2QVBA 3LY5A 4GPEA 4YA6A 2O2CA 1NV9A 3U37A 1E1RA 3ST7A 3EZ6A 4RPGA 4X61A 3INNA 4J1SA 3AM5A 3DLPX 4V0KA 1GTRA 4OKNA 4F6RA 5EESA 1LY1A 1Z13A 3WQHA 3NUGA 3IE1A 1MOQA 3PSAA 4WAUA 3R8XA 2HHAA 2EW8A 2VH5R 4MITA 4NS1A 4V0QA 3VPDA 2MYUA 4NV0A 3UHJA 4IWNA 4R2IA 1VJCA 3STVA 3VZCA 1U0FA 3NHKA 4XIYA 2ZI7A 3T38A 3USZA 3ZHUA 3OECA 4S1WA 4D9GA 3HYLA 4V0MA 2RMKA 3BD8A 1W47A 4MWZA 4X7MA 1WBBA 4G0OA 4WKPA 5F9MA 1W6RA 1W0KD 4YMVA 2YOGA 1FMCA 4PXYA 1JFFA 4WUVA 2VAPA 4RESA 2YWJA 3SDZA 1OYWA 4Q4HA 2IELA 3OLCX 5E0OA 4JL6A 3MWDA 4OXQA 1Z4JA 4YH1A 3UK7A 1A9TA 1XZMA 1Y7TA 3INYA 4EKYA 1P75A 3H4VA 4KR6A 1U90A 2IZ6A 4TSRA 1R18A 4X8OA 5BSRA 3SLGA 2QMEA 4IDQA 4B6OA 1M5RA 1NLFA 5DCYA 4GYWA 2E0IA 2RGDA 2ZUCA 3PXCX 5J40A 2IYUA 4IJUA 5JH7A 5K0SA 2EKBA 3WL4A 2XCQA 3AEQA 3CY6A 4EBFA 4U7HA 1T0BA 3CF0A 1LVGA 3G5TA 4HNTA 2FEAA 2ZZNA 1E5LA 2VHVA 3LQYA 2C7BA 3E7XA 1U3GA 3A2MA 3BM5A 1I33A 3P4XA 2FOXA 1M6VB 2BFEA 2C1ZA 2VOJA 3EHEA 4PSCA 3JARB 2B5WA 3H9QA 1BWPA 3H6KA 4RS3A 2CKDA 1HNWB 1DZIA 3UYLA 3WGLA 1SZDA 2G36A 1NU6A 3BGDA 3S2EA 3ANXA 5I6DA 2A78A 1SH7A 3RRMA 2CNWD 3EYAA 5LA6F 4YRLA 1M66A 5BWOA 4ACAA 1SM4A 3WI7A 5LIPA 2Z57A 3RJZA 1C7JA 3UC9A 3DE0X 1TTHA 2C3OA 2DTEA 4W4TA 1ID8A 3GELA 1CY7A 1Y63A 5B1SA 4A4DA 1UMDA 3RUFA 3IEIA 3EVNA 3GFQA 1TLTA 4O29A 1FCJA 5TS3A 1EFAA 5L3SA 2R1TA 1ZUNA 1QX4A 3K31A 1GNQA 1V35A 2ZAOA 4EGQA 3LD9A 3VO1A 4J90A 3JCZA 4FQ8A 1M3SA 4P54A 3AIOA 4GPD1 5D51S 4QFCA 4LSMA 5ADVA 1LEHA 5K8IA 5F7ZA 4L4YA 4WW0A 5AXCA 5SZIA 1SBNE 1OCEA 4WXYB 3ZWVA 4YMUA 1X3SA 1Q84A 4KTTE 4N8SA 3R09A 3M3DA 4YYEA 1XNGA 4D0LB 3WNVA 4EB3A 4ZK6A 2ZCJA 1AM4D 2GK6A 3K5HA 3T7AA 1OAKA 2N1MA 3H5TA 4H4EA 5LL6P 3V00A 3ZD8A 4OOFA 5HK8A 4UMFA 3C4QA 4EKDA 3OOJA 1GZ7A 1G8KA 3QP9A 3ZH2A 1NR5A 3NDPA 2JFYA 3CX8A 1WB9A 1FVFA 1V43A 2VUUA 3PU6A 4B84A 1U7DA 4LF9B 1KJYA 3L8ZA 4WNYA 3O1IC 2X5XA 5AHWA 4P0QB 3KE8A 3D6AA 4RLSA 5TV2A 3E7DA 4EEXA 2DQZA 5JTTA 3GEMA 3VA7A 1HMYA 1XC7A 4Y6SA 4Q9KA 1P6XA 3OZAA 2HV9A 2Q1TA 2JFOA 1IEXA 1J07A 2CWDA 1Z7GA 3DLIA 2HQRA 3D7RA 3OQIB 3PEVA 4BX8A 1VG9B 2VJKA 3P4YA 4AS1A 2R4QA 3GX1A 4QRIA 5ALXA 3ZI4A 3I1FA 3D6NB 3UWPA 2NVWA 3HA5A 3DHNA 2ORWA 4HK4A 4HYYA 5AW0A 3FSGA 5AK4A 3UTCA 4DBVO 4P8RA 3L8GA 4B85A 1WUJS 2ANCA 3LAWA 4PLHA 3QA9A 3NH9A 1MEOA 3AW9A 5CDHA 2A88A 4URWR 5J5CA 4M86A 2K7FA 2BTOA 3KYCA 3D2CA 1E2NA 3ZH9B 5JBIA 3QKRB 1QCCA 4BE7B 1TIPA 4EGCB 4BN5A 1IDOA 1SUAA 2AXEA 4ZVSA 2PKRA 3U6BA 2VVTA 2G28A 2LTAA 4BLVA 2FZGA 2PMCA 4NJOA 4CIAA 1QORA 2WG2A 1H6BA 1BE1A 1W88B 2VS1A 3L0DA 4RZ3A 1UBHS 3T1QA 1KFBB 1KYXA 2X23A 1S2OA 1T9DA 3IDOA 4M9QA 5FADA 1Z6PA 2XYHA 4NENB 5CA0A 3EJWA 2QF7A 4ETNA 4EUSA 5JT1A 2AFIA 1U9IC 4A6PA 1C9JA 4FEAA 4INZA 1YCGA 4FXPA 1ZXLA 3GLVA 2JJ2D 3IQGX 4G5OA 1ESDA 3RRXA 5FH9A 3JD3A 4NMWA 1RKQA 2XRZA 4RH0A 3OLZA 1NIPA 2HFJA 2OYRA 3JAKA 4JBLA 4AN4A 3C39A 4I9FA 4QDOA 1MIHA 5U9CA 2R96A 3P0HA 1AIPA 1TM1E 1NOIA 4Y2YA 3KG2A 3TTWA 5AJYA 1FA9A 3S2SA 3S2IA 3VZDA 4GBED 2OKCA 3D6FA 3LLMA 2QLLA 4WKNA 3FNRA 2ATVA 3G5LA 2EF0A 4KFTA 4WOCA 2HBYA 2QP4A 3NHPA 1LF5A 3A14A 2OYCA 4DMRA 4YHHB 1R0BA 2WOJA 1DEAA 1ULHA 1NG9A 1NUPA 3EZYA 5JSUA 1B8OA 2Z98A 3VKFA 4S3MA 2P9CA 3JSAA 1Q21A 2NXWA 3OHPA 4CRWB 3Q8XB 2CHFA 3LL4A 1D6NA 4EPXA 2AFHA 4P93A 2H6EA 1OPRA 2C04A 2X6QA 4FFLA 1G63A 2R8YA 1E20A 2FFHA 3QPVA 3WNQA 2EQ5A 3AF4A 1N2CA 4BB0A 4IIVA 5ENVA 3HA7A 3BL5A 5KSYA 2IU6A 1YHZA 2R47A 2PUVA 2EP7A 4JB8A 4B09A 5H8WA 4XQCA 1UJBA 1UQUA 3QVOA 2C7QA 2HMYB 3OFJA 5JVDB 5JI3E 4WZBB 3Q40A 3T1HB 2FMUA 2C2MA 5DSTA 4OHMA 2ZRNA 4U5XA 2G71A 5IBQA 2XV1A 3ILSA 4MI3A 4KQ2A 4CYMA 2OBMA 2GAOA 4FC7A 4U9IS 3A9VA 3PT9A 2OY0A 4BIMA 3AP1A 2AKEA 1GZSA 2BGWA 2ALJA 3G8BA 3P9SA 3TJRA 2CXPA 2G1AA 4HWOA 5FWDA 4D6YA 3TG2A 4U39A 3BHIA 3C8UA 3OQMA 1LTQA 1DCKA 4YJHA 1II8A 2NZXA 1KY4A 2P2DA 2X42A 3GJ4A 1L5ZA 3F7OA 3OIFA 4XSHA 3ITDA 2C58A 4CIDA 3ZWYA 4A73A 1DUVG 9GPBA 1GFSA 2FPWA 2O57A 4DR4B 4QOIA 3ETCA 4PLWA 4NCAA 1LLFA 3BTOA 2LVBA 3EF1A 3DOFA 1SG6A 4PAGA 1Q0UA 2BDUA 2FEKA 1EK2A 2QROA 5BXYA 4C0AC 1ZNZA 2ZLBA 3DFKA 3FZEA 3JSXA 3R7BA 4EDFA 4UXIA 2UVQA 1RZUA 1XHEA 4PPYA 2P3QA 3AXTA 3VKWA 1CQXA 2C92A 2Q6LA 2WEKA 3PKIA 3WK7A 4C7XA 5K3OA 1DOHA 2OD9A 1Z2CA 4E2YA 3MXOA 1AUPA 3NEPX 5E38A 3LUDA 1QU3A 1L5MA 1KQFA 2V98A 2R25B 1RQPA 4V2UA 3PLNA 1ZNQO 1A2BA 1M2JA 5HDQA 3X0DA 4PZ0A 1G8MA 5K03A 2IZOA 5BYBA 4EYQA 1FXWF 2PE5A 3MINB 3IO3A 1JQJC 1GGNA 4OUDB 5LKAA 1AO0A 3ROFA 3VSAA 4TLEA 5EXTA 4KIGA 4JQCA 1TEVA 2DYKA 3UT0A 1VGQA 3PPIA 5EMNA 4HWTA 3UQZA 3K2BA 1I2ZA 1HDZA 2HSJA 2PXCA 3OQPA 3SF8B 3ZW9A 2WP8J 3CEPB 4OCZA 2O8BA 1WA5A 2EGGA 4GQBA 5GONB 1VSUA 1ZICA 3NJ4A 4Y30A 3GIWA 4Z7OB 2ZTMA 2VLBA 3KL4A 2JNWA 4V0NA 4DMMA 3UMMA 3G17A 2ZAYA 1BGXT 1PWZA 3L8FA 4RFSA 2FN3A 1S8FA 4OHCA 5U4XA 4Z5XA 5KQMA 2J0UA 5DM2A 5JWRA 2ZJ1A 2AFIE 1QVAA 4IIGA 1WDMA 3ELWA 3OOHA 4J6FA 4JIGA 3FGPA 2NM0A 1G6Q1 1EAYA 1W5BA 2UUOA 2WAYA 4MYSA 3IIEA 3WGIA 2XTNA 2QE7A 2X0IA 1G16A 4GBMA 1E2PA 1Q2XA 5B12A 2AD1A 1PBNA 3HBJA 3EBPA 3FN4A 4H6PA 1MAWA 5CH8A 3N75A 4QZVA 5ITSA 5KNDA 1EQ2A 4XPIA 2NSYA 4JL8A 5D7NA 5B3KA 4RJJA 2NT4A 3ZD6A 3HB0A 1JMYA 2INGX 4QL3A 5EFZA 4OUKX 2GBGA 3AFNA 1U6JA 4JC4A 2PLRA 2VIIA 2C2BA 1UMBB 2D2XA 5AICA 4Y9DA 1EM8A 3DMTC 3QXJA 2AA3A 2W58A 2OEPA 2JEZA 4MIOA 2J9ZB 5CDUA 3AY7A 3M6UA 3O03A 2OAP1 5K2MA 2GKOA 2YR0A 3SBXA 5E6SA 3ZHOA 2VP0A 1MG0A 2X5JO 1OILA 1BS9A 2P68A 4IY1A 3TKYA 1FJHA 2XMCA 4YDQA 3RBVA 4BO5A 1CG6A 4L85A 2IYVA 3WMFA 1PUIA 4HNAB 1GITA 1OE0A 1SCBA 2NZYA 4MYUA 3VI3B 1AK2A 1KZ6A 2ZSBA 4H4DA 3L0SA 2NSDA 1BHQ1 1GRNA 2YY5A 3N2GB 4H17A 1H0KA 4OK6A 1NNUA 4I9GA 1FU4A 1VLLA 4S35A 3WRVA 2GNPA 2RB5A 4B8ZA 1LQ2A 1CQJA 5K3SA 4E03A 3TGPA 1K7YA 4ZAWA 3NDBB 3BTVA 2IEAA 5IJAA 1ZA1A 3LT4A 5JSZB 3R23A 3M1AA 3M6IA 4KJZA 2PXHA 3EARA 3G0BA 1TUIA 4S04A 2ODNA 5EGSA 5JFGA 2W93A 5B1DA 3R5XA 1EK5A 2H2DA 1QANA 1KFCB 1S3GA 4QFMA 5J2TF 5BR8B 3AJDA 1Z6ZA 1NYQA 4RF3A 5K3DA 4C7MA 4QYIA 3VNUA 2BKLA 1MOZA 2QMYA 4M36A 2RH5A 3CWQA 5DLQC 1GXSB 2BUBA 3H5RA 3HP7A 4H7FA 1JKFA 5CDGA 5HQ3B 3I3SR 2JIPA 1TZ2A 2FA9A 3VR6H 1ZN8A 3GRCA 4I55A 4PQYA 4R6WA 4QTXA 3NC0C 3K0SA 1DBRA 1DAPA 1PR0A 3MT8A 3QWBA 2QD5A 4NU8X 2E18A 3KKZA 2PSHA 3S2GA 3GYGA 3Q3JB 1XRPA 3V7UA 3W5VA 4PLGA 2WIAA 4TUYA 3HM2A 1J20A 1SXIA 3H6HA 3ETLA 2WKWA 4CEIA 3TL6A 2QPLA 1NVVR 1SZPA 3L7MA 5HOEA 3MCUA 1XZQA 2Y1CA 3UMBA 4K81B 2VNHA 3H5LA 5I9TA 4MP3A 1GL3A 4LY0A 3LUAA 2EZUA 3QSYA 4B7AA 4FGUA 1X9IA 1HC7A 2YHAA 4B6RA 4UFOA 4FWBA 4Q1EA 2CHUA 3ZWOA 1KBOA 1W0CA 2GZDA 2QZSA 5EE9A 4A2QA 4FI3F 2J3QA 4NV3A 4R1SA 4AQDA 4F4DA 1ZM7A 1CV2A 4AMVA 2VZLA 1DT3A 5AKHA 1ZFNA 1XRJA 5LYJB 4LG1A 3RTEA 5B6PA 2H4JA 3O3MB 3R4VA 4KBYA 5E1OA 3PJEA 4D3DA 5ITVA 2IWRA 4QBFA 2JLSA 2JCSA 3KOXA 5K6TA 2AQ8A 3HXQA 4PLZA 4ZI7B 2PA0A 4LCEA 4YRZA 2J3DA 1DQSA 1DKUA 1LU9A 1Z28A 1IYZA 4TZ6A 1HO3A 5EMLA 4Q6BA 2FUCA 1MMFB 1HOXA 1OU4A 4I1YA 4BNVA 4QOGA 2Z1NA 5HDBB 3J81k 3TTTA 3K0FB 4BP9A 5AXBA 2BEVB 1H2AS 1PS9A 2EDAA 2YJ3A 1WCIB 4NYIR 2A59A 1V1RA 3TQHA 5LQRA 4CEJA 4ZDWA 3P20A 4A10A 4I2VA 4X63A 3A4YA 2C9ZA 3BICA 3GUHA 3MJDA 1R0LA 1RFLA 3F6BX 1E58A 4JVMA 4OQMA 4QJ4A 1A97A 4X3CA 3K5IA 5EZSA 3ZWBA 1P7CA 1XT6A 4LZZA 4M1EA 3UJDA 2GETA 3I6QA 4MAFA 2KLHA 1VSBA 3RUDA 1D0SA 4HWPA 3IILA 1JZTA 1KYZA 1Q1QA 3C85A 3LTEA 5B3JA 4EAQA 4C7KA 1D9XA 4OB8A 4U9HS 3STHA 2VSQA 4B7ZA 4BS9A 3VMMA 1JG4A 1LV7A 2EZTA 5FP0A 4I6EA 1W87A 4HB0A 1LFAA 4XDYA 2XVXA 4YNBA 1M1YB 3NOQA 1SZCA 5GOZA 1Z47A 4BO8A 4IEIA 1CW2B 1AHPA 3J7AC 4OH1A 2YRWA 5I9IA 1G1MA 5DXAA 4X62B 1NMYA 1PNVA 1MZPA 1WV0A 2D54A 1W4CA 3B6ZA 1L9XA 3ADKA 3VTFA 1TJPB 4NZOA 3GLQA 2Z9DA 6Q21A 3IOMA 1Q3HA 1TZBA 2BLLA 2AK3A 3N6VA 3OE5A 4GWGA 3NT2A 5EP1A 1O7JA 2L18A 2IS1A 4IAOA 2O07A 1Z9BA 1XTPA 3DUWA 1EWYA 3LSTA 3OKAA 4KQCA 1A27A 2G80A 2EC5A 3K0KA 4PCAA 3UMSA 1T6NA 4OP2A 4EH1A 5MGBA 4QYTA 4N76A 4HC4A 4WXRA 4Q7KA 3H2IA 4K28A 1SBYA 4JUBA 4DDVA 5CDYA 1P9NA 3KB6A 3MG9A 3HYCA 2HJHA 3MQ4A 3ZE7A 2VTDA 4NDAA 3HZOA 4BQRA 1G5FA 2HK6A 4F6RB 5JSFA 3GP8A 4QQKA 4DEVA 2AJBA 4L57A 2VF4X 3V97A 2O8EB 3W5CA 3TQIA 3LUKA 3PCRB 5DBHX 1XA3A 2GNOA 1TECE 4OGGA 1SU7A 4DR5B 2YQ5A 5AQEA 5T8KA 4Y2SA 3DEAA 2QSUA 3WMXA 4JFAA 4MWOA 4B2LA 5C7YA 1Z88A 2FZCA 2ZIZA 3PNVA 3Q9UA 4LVNA 4M0MA 1P61B 3WGTA 4DCTA 1OB5A 3I73A 5CTJA 3EPKA 3R3XA 4HS9A 4F93B 2BMAA 4HYTA 4TYMA 1HSOA 1QV6A 1J24A 5JDIA 2AOTB 4CTMA 4EVRA 4WRRA 5A71A 5FYQA 2J59A 3WK4A 2DHEA 2ZYGA 3MUOA 3N70A 5T8KC 2R1ZA 2XGOA 2N47A 3AFGA 4DGQA 2J4CA 5IYZA 4LJSA 5K0LA 3RB8A 2VUTA 3DYIA 3NWBA 3ZU4A 2ZQ5A 1NC1A 5JAMA 2CDRA 3HVRA 1O5IA 2GUWA 1VHLA 4MZDA 1UQRA 1D6SA 3ETGA 1W5AA 3KLNA 1QCYA 4AT1A 1W8IA 3TNLA 3EYWA 3NEJA 3S5UA 3TTUA 5EXEA 1GCUA 3U61B 3I34X 1ZU4A 1GKUB 3T3EA 3VDRA 5HUJA 2H2FA 4C01A 3AETB 1OFVA 2YWGA 2BHNA 1ULUA 3DEKA 1RQXA 2OKGA 3EIFA 2XWPA 1UPUA 4RM2A 1KJQA 1SOAA 3PD7A 1J5EB 1XJ5A 1ZN2A 1F51E 2EJTA 2X3UA 2QR2A 1FU8A 3R3HA 2H16A 3K7EA 5KZMB 5CG2A 1IHXA 5KIAA 1S9DA 1QYVA 2XNDD 1NVFA 4ZYWA 2HT6A 3SBOA 3GFOA 5K51A 4F60A 5A5FA 1N8KA 2AI3A 3CUEF 2G1PA 3KO8A 3IE0A 1PVVA 4O2RA 1D7AA 5JO9A 5JHHB 2W2PA 1Y4AE 3OPYB 4A2PA 1QIMA 4FOTA 2EFGA 3TWOA 1VJ1A 2PMFA 3WY9A 1PJRA 4D3XA 2WA2A 3HEMA 4DSTA 4Z3KA 1ZW1A 5DGCA 3W2TA 1B6GA 1N78A 4MKZA 2ZYHA 5J4LA 1EP9A 4N0EA 3DWGA 4JLVA 5DHQA 2L2QA 2OE2A 3FCYA 4PG4A 1KS2A 3COZA 3GG2A 1QQAA 3OQNA 2J9YB 3AQ4A 1IPEA 4NBRA 3L4BC 5ARBA 3E1SA 5JDCC 4H1WA 4BBJA 1ITZA 4C3ZA 1O95C 5F5LA 1TADA 2VI5A 1IJFA 2E4XA 1CP2A 5D6OA 5K0FA 1JLMA 4H35A 1ADGA 2OZLB 5IDQA 1KPGA 2H3HA 1GPNA 2Z09A 2HA4A 5EKTA 1UOEA 1W4BA 3OJLA 4ICIA 4L73A 2CJWA 1ISHA 2W6NA 1ZNWA 2P30A 4E51A 1VIMA 4G0QA 3AB3A 3M8KA 2RK3A 1EUCA 1MTOA 2VJYA 3CR7A 2CMHA 3I9V6 4EB6A 3ML1A 2LNDA 2VYCA 2K2WA 3P9RA 4N7RA 1O9GA 2AOUA 3LPLA 1N6PA 3JZFA 5IVPA 1ZVVA 3AK4A 3NV9A 4MRNA 4BY9E 3K9WA 2JF0A 2J5KA 1W44A 3O94A 2JZOA 2C5AA 2J67A 2ZJ6A 3C5HA 3ZLBA 3T5AA 4KE6A 3I1YA 1WB4A 3HU1A 4L02A 1EX9A 1DRJA 5H5JA 4RAQA 1G21A 4TMXA 4ZYTA 3GFFA 1BGWA 4UHEA 4MIKA 1XU7A 3DHEA 4UHHA 1BFKA 3R3JA 4MEBA 2OBLA 1GR0A 2JAUA 2PL5A 2YYYA 3HYNA 1NJFA 3HBLA 3PHGA 4OL0A 5DASA 2JDIA 2P7IA 4AKEA 4BE9A 4ZVQA 3RVJA 4HF7A 4TV8A 4ECEA 2HOQA 3IMCA 5KKAA 1P29A 2ZYWX 3WZMA 1Q0QA 5JD4A 1ZAKA 2EEPA 2Z3VA 5IVIA 4REQA 1DAOA 1T2CA 3K1JA 1PTJA 4BCCA 5B3LA 4FZJA 2O0KA 3ERCA 4ZDJA 2HN9A 3E9CA 1V2GA 1NRXA 5T6BA 1FF9A 1E3LA 4ODIA 4YR7A 5EUQB 1DPFA 1XDWA 1L5NA 4HX5A 1RJFA 2YASA 1K2WA 4GHWA 2ID9A 2PX3A 1G8GA 2IBSA 2ODBA 3L7IA 2E5WA 3LX5A 4A0HA 4LFBB 1GUFA 4H7JA 2YKGA 4X54A 3TR6A 1WU8A 3R1IA 1V7ZA 4G4JA 1TZMA 4HDKA 3R3WA 1YNOA 4Y9UA 5JG7A 5KWIA 2ZIUB 3DT6A 3OG9A 1AV6A 521PA 3QMPA 3T9DA 1DMSA 4Y1RA 5FDFA 4E5SA 5F76A 2NZ8A 5A2GA 2XXJA 4MUXA 3E3LA 2OFOA 5DLEA 3UV6A 1PV2A 7AT1A 2X8LA 1KAQA 4MO9A 2A4MA 3WZ2A 1P8JA 5JY1A 4G67A 2EDCA 3KUCA 1G0NA 3G02A 4MWEA 4QBTA 3RIXA 3FYUB 4QJBA 1CZRA 2QN1A 1OWNA 4LI0A 4QEDA 5ECDA 1B1AA 3C7TA 1BW9A 3MRTA 1VI6A 1JKJB 1PCXA 1Y8CA 5FTMA 1ZK0A 3L8HA 4X7BA 5JOQA 2NTJA 4MK4A 2TYSB 2EW1A 3ZZMA 2LIVA 5FLKA 1SQGA 4PRKA 4LV6A 2LCQA 3UJ6A 3LIIA 1MAVA 3S99A 1XVAA 2GZRA 1PS8A 3GG9A 4K6HA 2BIFA 4R81A 3UHAA 4PAWA 3W8RA 1U9ZA 5IASA 1E2FA 4Y9SA 2R8OA 3FDJA 3T54A 2F4VB 2FCAA 2IH2A 3O6VA 4BNMA 1Z4QA 1WDTA 1SOUA 1UADA 2RKWA 2I99A 3O3OB 2IYXA 3EFOB 3RCBA 4Q01A 221PA 1UCFA 3KXLA 4GWLA 3GUZA 4JEMA 4M60A 3IAUA 3GDGA 3IDFA 3MTIA 3E2PA 4BNUA 2UUPA 1ADFA 3ED5A 5KOYA 1YHNA 3MNFA 4EEZA 3ZBUA 1RC1A 3NX4A 1CRPA 3K2EA 3LX8A 3TO5A 1N0VC 1FFXA 2HLNA 5IFLA 4KWTA 1BO6A 1YNSA 2Y9MB 3QOXA 3A6JA 4Y7DA 3OTWA 4LTNA 3ORHA 2X13A 5GM1A 3QVSA 2XD9A 2YDXA 3JQAD 4KLCA 3IOCA 2EIHA 2P78A 1E60A 2AN9A 2GMWA 1K06A 3FNGA 3WWYA 3A0RB 4E09A 4N7MA 2VHTA 1XLUA 3OJFA 4I9UA 5ALGA 2Q2NA 5LQUA 1R6TA 1Y9ZA 2VQ3A 1FFBA 1IU9A 2Q3CA 4DTCA 2JIZA 4PX2A 1J1UA 1WXDA 2QI9C 1T8RA 3L2OB 2G67A 3E4DA 1TYCA 4GMFA 4RNCA 5CAEB 3D81A 1AXRA 1A2OA 3OOWA 4CR6A 5CD9A 1GAEO 3EC7A 3IT2A 3V4ZA 4B4DA 3P2MA 1ML4A 4J91A 4B3SB 3RC8A 4B3GA 2P35A 1JNXX 1NR1A 3Q2IA 2VPZA 2VWPA 3H1TA 4O25A 2ECOA 5HJ5A 4KO3S 5I3ZA 2BUCA 4G4SP 1RWNA 2FUG1 2FZLA 3L6EA 4ZD6A 2VTBA 4JYCA 4IZIA 3EFEA 1ONSA 2OCDA 2DY0A 3D7LA 3AUTA 1P1JA 1K92A 4D43A 2WG1A 2X0JA 3VH1A 3SC3A 5A4JA 4E32A 3UO8B 2F1OA 1AUOA 3P9NA 3KJHA 4LBWA 3VNAA 5JJLA 1OV4A 3F6YA 4L5JA 4PHCA 2J7KA 3HEAA 3U7FB 2D1TA 3CIFA 1TTQB 2ERCA 1ZVKA 3EWNA 2HA3A 4F6LA 3TGWA 4C2TA 1YRBA 2FOLA 2FW1A 3B82A 3W5AA 3OIWA 3T1OA 1W2WB 1X8KA 1DQNA 3PGA1 2XQJA 2NWQA 5CIQA 4MRSA 4YV7A 4K9KA 4NOMA 3MTJA 4XR9A 3WMRA 1IVYA 5JFOA 1BSVA 5JRZA 1GWNA 3BK1A 4XOIA 1NLZA 4O1IA 3EXIB 4IO0A 4YJFA 4UKDA 5ALJA 3COJA 4N4AA 2ISCA 2R7LA 5FBLB 3LHKA 2HLHA 1M2VA 1H1DA 2Y3IA 3A3NA 2YQZA 3FCSB 3M6AA 3OT4A 3ND9A 1CZNA 1YE5A 3F8WA 3AB8A 3GZ4A 4GOXA 1EPUA 1WDKA 4W8OA 5EMHA 2RHOA 4B6JA 3GMIA 1WPGA 2O1SA 3ND6A 1FTWA 3HFJA 4YAEA 3GU3A 1YS1X 1TXGA 3LC0A 5NULA 2EP8A 4CMEC 2QP9X 3HKDA 3K1AA 2JH8A 2CJYA 3UENA 4DMKA 1DDOA 2OSVA 3B2QA 4S1PA 3SE0A 4B4VA 5HS6A 5B4TA 5HGJA 2CJFA 2VJQA 2FMIA 1A7KA 1JG6A 5IUNC 5AFSA 2PJUA 3DTVD 4E15A 1Z34A 1BD4A 1YR2A 2GHQA 1C7IA 3FKSA 5AVKA 4XM2A 5EJ8A 3O8DA 1TA0A 2GM9A 2G5TA 3C3DA 4UMVA 1E6WA 5JD6A 2FFAA 4UM7A 5IT0A 2X86A 1QV9A 3NGMA 4EHFA 4HCJA 4NMLA 3GJ6A 4PNZA 1L5HA 4NFHA 1NOJA 5JW6A 3GQVA 4LDJA 4EF6A 4L6IA 2PT6A 1KE2A 3VR6A 2F48A 2EFJA 3C3XA 4UULA 4X8MA 4D9BA 2FFRA 2H1FA 1P9RA 3ESAA 3FLMA 5FNVB 5GZ3A 3S8YA 2G82A 3IBSA 3WGHA 2OP0A 3WWZA 2LR0A 3TF5A 1ZGZA 5P21A 1VECA 2OB1A 1GL9B 1K5DA 3VR4D 5HP4A 3A4VA 4Z6KA 4QC2A 3DDSA 1V5EA 3FD8A 3JZDA 2Y2UA 1AVTA 4OTZA 1W59A 1G8YA 4FFVA 4LMRA 1RPNA 3QNWA 5CLQA 2QV0A 1XMXA 4R3WA 1F2DA 1WVIA 1CY6A 1DI0A 1N9GA 4KQMA 2FPIB 3WKDA 4ZDIA 2TSYB 4HXYA 3QY9A 4L9RA 2AWNA 4ZK2A 5ABPA 3M5PA 5COBA 5J2UA 4OXRA 5GVRA 3PV0A 3N39C 5DNEA 3MD0A 3HJAA 1YRQA 2JLVA 1WW2A 1L8XA 2EFHB 2OA0A 5BQXA 1PL0A 5L9AA 2HU8A 1SGWA 4RDCA 4YWJA 1HG1A 1BWSA 3DMYA 2NYUA 3CSSA 4ZT3A 5G40A 3B3JA 3BMOA 2V45A 3SVTA 2FJPA 2WDPA 2V74B 2C8LA 3D3JA 4UARA 3ZGXA 2W98A 4V02A 4ISBA 1ADBA 3U7QA 1MP0A 3ANNA 4PPNA 2UZIR 1OXKB 3SHVA 3Q85A 3WGJA 3K6SA 3JYOA 1AQYA 3OE1A 3OLXA 3DDUA 4ZCQA 2H4XA 3A7EA 2A9JA 2Q50A 4MPTA 4GOLD 4CLHA 2Q4EA 4UBOA 4S1VA 1OW3B 3BJZA 2C5FA 2W9XA 5ANRB 5FF9A 1T5HX 4D6XA 1TJ3A 2LDBA 1QCDA 2HYIC 1JUDA 4HATA 4RHFA 5LU8A 3KB2A 3P2KA 2IVZA 3EIHA 5EJMA 2F1HA 5HVNA 4W1PA 4YAFA 3LHIA 1VKNA 4GICA 5JPDA 5K8LA 3AOEC 3WA7A 2FXIA 3ZCUA 1OKKA 1SXPA 3KR0A 3LMKA 1EFRA 3AFHA 1A9XB 1YOVB 1O3YA 2KWIA 3F3YA 3GLSA 3IQIX 5IN4A 3KPWA 1PGJA 2IW1A 2WUVA 1DAKA 3QSGA 3CJTA 5AW6A 3QVVA 4MJ3A 4RK0A 1JU3A 4BNXA 1F17A 2D74A 4TSKA 3UJCA 3NPAA 3HY3A 1Z6XA 4UD6A 3L6RA 1OYOA 1NQVA 2WYHA 3ZBTA 3KEFA 2J85A 2RHJA 4MNTA 5EGNA 1OAOC 3E23A 2FFQA 5KJ1A 1N2CB 1KK3A 4C0QC 1TAGA 1SWVA 1WABA 2OHIA 2Z1DA 1HYGA 3N53A 3OUUA 3QENA 3LKVA 5C8ZA 1IN1A 4L16A 5JYBA 2PXAA 2G70A 2QWXA 1GM5A 2ZR9A 2XPCA 2ZT5A 1YUBA 3WIBA 4PAOA 2ZTSA 2HC9A 2PGXA 2VCEA 4TUYF 1BX1A 5CM8B 5D1HA 5K45A 3IP9A 1OAOA 1T9AA 3NP9A 3B9QA 3MQFA 3Q9NA 1NSYA 4KAXA 1F48A 3KTFA 3WLAA 5KOHB 2NU8A 1AKUA 1YJQA 4JLOA 2AMYA 5TEWA 3V8MA 5FEMA 3ZY5A 2XNCA 5IT9A 2W5UA 5J1SB 4JLDA 3IOBA 1J0AA 5COQA 2AG8A 2R8BA 1QYDA 4K03A 4A9AA 5EERA 1N6OA 4A8HA 5CVTA 2JLUA 1OH6A 2PX4A 2JHGA 2UVDA 2VPPA 4E5KA 1CLUA 1QIHA 4IFIA 4KQ9A 1V48A 2WYVA 5DIZA 4ZI3A 4GKJB 5G0TA 5K5EA 4IOMA 1IOWA 3QM1A 4UHFA 2I6UA 4D4MA 1U2PA 2AQHA 1RM5A 3FUCA 4R9NA 1BXGA 2QVZX 3E84A 1IPFA 1F12A 2UZ3A 3PQ2A 1CS4C 1KHHA 1Z4NA 4OBXA 3ZDEA 3CINA 4F7DA 3K0FA 3K6RA 4WESA 3FDIA 4BO7A 2XSZA 4DDWA 5B30A 5AT1A 1FFHA 4N82A 1O1YA 4FGSA 4PEVA 3F98A 3UATA 1JEYA 1BTOA 4XRGA 3O26A 2EFCB 4J4TA 4QNNA 3PDIB 5HF6A 1M0WA 4DJEC 3CZQA 3HR7A 3MFQA 4QXMA 2IXTA 3UWOA 1FJGB 4GE3A 1UIMA 3PL1A 2J08A 3CNQS 5JWOA 3GL9A 3HK2A 1GZ6A 2WWGA 2ZDHA 3H2YA 3P9CA 4ZVPA 3RVQA 4G24A 3Q8LA 1ZCAA 1I4TD 1P7YA 5CDFA 3VC1A 1E7WA 3FNQA 4RZIA 2WWHA 4YPVA 3QRWA 2C9MA 4XVHA 3QHPA 4HDRB 4WOJA 3U7RA 1J49A 3UJ3X 5DGHA 3K15A 3EIXA 5HBGA 3VHLB 2RHTA 1W48A 2OQ2A 3MUFA 2GN0A 1HEYA 2H08A 2UYGA 1WV1A 3D8UA 3FNFA 4Y9TA 4YRIA 1GTSA 2GX6A 2JBHA 4IQ0A 4PYIA 4ENTA 1H8HD 1G38A 2F8LA 3HXPA 3DDZX 1ICEA 3BKXA 1P8AA 3V48A 1AU9A 4IIJA 4PNEA 2HDOA 1AMOA 1FQWA 2N9UA 2UKDA 4WFQA 1UIRA 3AEKA 4LNAA 1E32A 1BEUB 4Z8YA 1PYDA 4XUCA 1LI5A 3CEMA 3H11A 4IFEA 5M34A 2HK7A 3A6PC 3DONA 4C4OA 3HKEB 2BWJA 4BVAA 1CYEA 5JC8A 1JPJA 1LBHA 2BUAA 3ZI7A 4Z9BA 1E4OA 1KGDA 3L1VA 2F67A 2Z2KA 4KBFA 3CX3A 3I39X 4WN9B 4O4JB 3B78A 5KVSA 3G2OA 5BVGA 5IJ9B 4MVJF 1L4BA 5KB3A 2W6JA 4BGDA 2GCIA 1G55A 1FP6A 1XHFA 2ZS7A 3GVPA 2HHLA 2PKCA 1G64A 5DDIP 4ZMBA 4L1KA 2G40A 2PX0A 2MSNA 4RIIA 1K8QA 4DM7A 3VHQA 4JDUA 1B1CA 4UNSA 2RI1A 2MCFA 4KVFA 4IG9A 1L1FA 2ZBDA 1WY7A 3H87A 4C3OB 4BMPB 2BH2A 5CLGA 4RJTA 1USIA 1LWOA 2A1TS 5H0IA 3GFVA 3LCMA 5JAHA 1RC0A 2Y1EA 3VQTA 1VHJA 1MQ9A 5EPEA 5AKYA 4J07A 1U0NA 2JAWA 2O6LA 3DVLA 3AILA 2XITA 3TSOA 3FXAA 3K2IA 5JYCA 1P5HA 3CBGA 4QGFA 4LW8A 4MRMA 3RFVA 2GCOA 3LCJA 5CP8A 4M0FA 2KJQA 4IDDA 2H1OA 2NUAB 3DYBA 4UVIA 1ZMBA 1IFXA 3AVPA 3OCJA 1I3OA 1QUEA 1JLRA 2BBTA 2DWPA 4OLJA 2O2IA 3IMEA 1OSNA 2QR5A 3K5WA 1H0RA 1SKQA 4HH4A 4C7VA 2IEBA 4F85A 2X5OA 1X8XA 1E3IA 3AU9A 4Q7LA 3L7OA 1A5TA 3RS2A 4AU1A 1A2KC 4LBVA 4RHTA 2WWXA 4KKVA 5IYZF 4B33A 5I7VA 2PX8A 3PYMA 5MN4A 1VCNA 3EQ7A 4ZTUB 5CLFA 3ZDDA 5EZYB 4P4GA 5K2OA 2QRLA 1PLJA 2BMWA 3VVMA 4K1XA 5BPHA 3OKPA 3ONDA 5I4BA 2EFEB 4AO6A 3Q12A 5ED4A 5ALPA 4MCAA 3VVLA 1RWVA 3ZQKA 5KOJA 2WUGA 3KFXA 2QVCA 3FMGA 4B73A 4EA8A 1JH9A 1F4LA 5EKSA 1T0UA 3I4CA 3OCXA 4V0SA 2C3YA 4FZRA 3BZWA 4JK3A 4GVXA 2J1LA 5A6SA 1ZNYA 3OZRA 1WPRA 2JCGA 3KIPA 4V1CI 3LNCA 1C8KA 1MF7A 4AD8A 5B3JC 2B8EA 1B0UA 4FFMA 4DARA 5AM0A 2CXXA 3WVNA 2VBGA 2UYYA 3C6QA 1W30A 2O48X 4G1VA 1VYVA 3NBQA 2PU5A 1BX3A 2WTAA 5HZHA 5J59A 4CF7A 3E35A 3C4JA 1PG2A 5BV1A 4Q3KA 4JP8A 5L51A 2VAVA 4YAOA 5BVHA 1YL7A 1PR5A 1DFHA 2AOVA 4H3KB 5EPOA 4EHHA 5KKNB 1OXBB 1VFNA 2YXDA 4HRYA 4U7JA 3BXGA 4Q5IA 4UCFA 4WZBE 3RFCA 2ZM6B 1R9GA 4I46A 1G3QA 3DW1X 1YB4A 1KI1A 3B60A 1BC5A 3G13A 4KP7A 4TX1A 4E5YA 3NU1A 4Q9HA 1W5EA 4RTQA 3L7AA 1ZWLA 2DKNA 2ZUBA 1FP4A 1YK1A 4PNHA 3TG8A 1KFEB 3GLFA 3HLTA 1C1HA 4FR0A 2IX3A 1E6CA 4BX3A 2WNHA 1LPPA 4K9PA 4HNRA 1OUMA 1YZHA 3BFKA 3L4EA 4TV8B 2BY4A 2IYRA 4RA9A 3PNLA 3MB8A 4HD8A 4ZI7F 4OLBA 3LQFA 4E5UA 4BWYA 4J0DA 1QWOA 5AUPB 5I7WA 1FTNA 4U2DA 3GCXA 4GXQA 1A04A 2CW5A 3HEBA 1YZNA 1RW4A 4EY8A 3GI1A 1YD7A 3IR5A 2WWTA 5CYOA 1FUYB 1HKHA 1K89A 1UKVY 2CK3D 1H42A 2I1WA 2IXAA 1VPWA 1UDWA 4MHSA 4UDXX 3KLBA 5F7XA 3QIVA 3S3TA 3UVEA 1XCGB 2BKUA 5IZCA 1JQBA 4XYBA 2D2FA 3UCXA 3UK1A 3WFIA 5JJBA 2XA9A 2VP2A 3SC4A 2Q2WA 2QRGA 3HKBA 1NQTA 3DLCA 1ZOLA 4QGGA 4ZT2A 1QIIA 4P3NA 1DL5A 1E79A 3GLHB 4BTEA 5LMCA 2RAFA 1E2LA 3I5UA 3IRUA 1I6LA 3KU1A 5CLJA 2NPOA 1XK7A 3HE3A 1KSFX 2QJFA 1B0ZA 4CNBA 3A9CA 3HRKA 3PC3A 2M6KA 4EI2A 3NPMA 4KPYA 5JZBA 4D44A 2ZSAA 1ZZEA 3WGUA 3BH0A 2XODA 2Y4NA 2GBCA 4NHOA 1IHPA 5ALSA 2DR3A 5DH9A 3VSBA 3R9XA 4K46A 2QM8A 1ULZA 1C3EA 3L06A 1B14A 1NP7A 1N0WA 1UPAA 2OCGA 4RZUA 4Y1EA 4OI0A 2R1VA 2Z5LA 4HXEB 4J2HA 4WXPA 3RK1A 2VKQA 1C4XA 4OQZA 4X20A 1MOSA 2XB8A 5E3HA 3GUUA 1G4HA 4FT2A 5AKGA 3T06B 4C3VA 1HDGO 3THSA 1BFDA 1S2IA 1VJDA 3KPYA 3ND5A 4L8GA 3V3TA 3K8QA 3CF4G 1QM5A 4RVSA 1Y4UA 4OK3A 3SQLA 5JARA 2NV6A 3K3PA 1F4VA 2C77A 4GR9A 1GP2A 1VRVA 1BS2A 2DJIA 4OLFA 5T4FA 4L76A 2Z4SA 4NBUA 4PSVA 2QN7A 3UOWA 3TGLA 5D3ZA 1XF9A 2VDKB 1SXJA 2XEDA 3B6KA 5KSOA 1NZFA 4JC8A 4GI3A 2XBUA 1UINA 1AGRA 1PQPA 1Y8RB 3PK0A 4G5QA 3IP8A 3WLRA 4DUYB 2WF7A 5E0KB 3OWHA 4D8XA 4C4PA 1JEEA 1QWSA 4LHZA 5BUCA 4MX8A 1P44A 3PQ7A 4CKZA 2Y92A 1U2DC 3O83A 4CF6A 1P9LA 4TMZA 2FE4A 4LOAA 1B0AA 4O6VA 3TD6A 1FYDA 4KTVE 5J4KA 1R6VA 3U44B 1V8BA 1MKYA 2ZWAA 3DV2A 1IXRC 1CQPA 1Q57A 1QKKA 1U7ZA 2ZSEA 3IVAA 4G0ZA 2YMMA 3ND8A 1JX6A 2H7XA 4HQ6A 2ETXA 4KVAA 1M67A 3TN7A 4A26A 3QXHA 1X3LA 5HBRA 2FPXA 3FUTA 4A8JB 4B6SA 3RWMB 4QEKA 3DB1A 4BPRA 4BXOB 4ZOLF 2R5NA 4CLOA 1A98A 2AX4A 5IPFA 3D4IA 3E27A 1AQLA 1TMGE 2CXOA 3WWOA 4Z4HA 1QOQB 3TLBA 3UT5B 3EDOA 1BQEA 2AZMA 3GD7A 1NG1A 1KQNA 4YCJA 1KMIY 3MHTA 2BP7A 4RGVA 5LZ7A 1U7PA 1NT2A 2OYSA 5FULA 3QX3A 2V96A 3FE2A 3QITA 3DZDA 4JLAA 3PA6A 5L7YA 4A8JC 1RXWA 2AEEA 1Q7TA 2D8AA 4Q7JB 5TE9A 2JKZA 4KLRA 1E7YA 3WMWA 1IIBA 4KIJA 4CTNA 2FR1A 1NXTA 1KRHA 3HCCA 2I1QA 4RY9A 5HIJA 5KNCH 3W3ZB 2OHHA 3PPWA 2XKBA 5ED0A 3E5RA 1MJNA 2FU5C 3GD5A 3DZKA 4RD6A 2VHXA 4RIGA 4UQPA 1R8QA 3V3KA 1BRTA 1ZK3A 2PVCA 3AR7A 4MQBA 2V7PA 1YMVA 4EHKA 3N59A 4NARA 1N1MA 1CYDA 2YWEA 5BORA 3GRFA 1T5DX 2QAGB 1U5CA 5IF3A 4HRVA 4Q3EA 2Z2YA 1JDBC 1C1YA 5L6LB 1ENOA 5U1PA 3E7WA 2DT8A 4O33A 4YJFB 1RJWA 3L5KA 4RK7A 3S6JA 4YACA 2RH4A 1NFRA 2B2NA 3BE8A 4GUAA 4AZSA 4BFCA 1T3GA 3CURA 4ZJYA 1GTZA 1RPZA 5KREA 2H2GA 2Y1LA 1OFTA 2PRZA 3BRWD 4U63A 4M38A 2XT9A 3RVNA 3VUEA 5DNDA 5C8DA 3WOHA 2C2HA 4WY5A 1YDWA 3AF1A 1JU9A 1ZG3A 2FUKA 3DCIA 1LDGA 3C5WP 2IPMA 1NVTA 4GLLA 4QUGA 1SVKA 2RJNA 4FLFA 5A7GA 2R8EA 3MGAA 3TEMA 4RSHA 3JAMA 3LOQA 4EUFA 3NAZA 1DIHA 2WF6A 3JARA 4RVFA 1UKBA 1ISGA 4CM4B 4MKIA 1JZSA 3ZY4A 4DEYA 4KITB 2WM8A 3R0VA 4NQRA 1EBBA 1VJGA 1KU0A 4DM3A 4HLUC 3X1KA 3SC6A 5IVKA 4B0OA 4L8WB 2OD2A 5J5AA 1JN0A 3O47A 1J2JA 3NOOA 6LDHA 1DKPA 2VXYA 4D82A 2YV5A 4K0RA 5KWJA 5B5SA 2X19A 3EPHA 2A7XA 3PFKA 3X1YA 1RKBA 3Q6IA 2AE2A 5EE5B 2X5KO 3GDHA 3IODA 1R6UA 4G0MA 4ZAXA 4C20A 1LDEA 2V7EA 5AI8A 1J33A 3CRRA 3TSYA 4DLNA 3G5MA 3HCBA 1DQPA 3CLUD 5F2NA 3ETNA 3F96A 3L3BA 1H69A 1RM0A 5EQJB 1F6DA 4QTZA 3PX7A 3FLBA 1SURA 1HBJA 2XE7A 3JAWB 3B6EA 5EZ6B 4BLTA 1N33B 4DNXA 2UYOA 4I4TB 1RQLA 4BEJA 4WBNF 3HNPA 2SCUA 2IQ5A 3H0EA 5TQVA 4OQEA 1QNFA 1WO8A 2QZ9A 3PUHA 1JQKA 1LH0A 5A5GA 1G5PA 4IZOA 3D6TB 2DU8A 1L0BA 1HDIA 2HH9A 4PAQA 1PEAA 3CUYA 3WLFA 5D84A 1JKIA 1UDAA 1DC4A 1PO7A 3BFXA 1PR3A 3M2TA 1WHSB 1B2LA 1YACA 4PYRA 3LLUA 4TGLA 1FDWA 2Y27A 1X70A 3KSRA 2XCTB 2I9KA 2UVPB 3PQ3A 2PX6A 2OOKA 1FXWA 3QG5A 1BJKA 2BHRA 3JQ6A 1N9GB 2JZCA 2KHZA 3G88A 5BQ5A 2XKKA 2GPYA 5CXSA 2BL4A 2ZIXB 2SKDA 3HUTA 5J1TB 4OQLA 2XZDA 1FC0A 1LNZA 1Q2UA 1FBTA 1ODLA 3IBGA 4EBBA 3EAGA 2B25A 3K1ZA 3UA4A 3AVXA 3SEQA 3FGOA 1AK1A 3SQWA 1Z7EA 4LJLA 1MDFA 3OEYA 1F8YA 4IDGA 4EO7A 2I65A 4LQCA 2ZJ4A 2FRDA 7YASA 4WT7A 1KI8A 1RJGA 1O8CA 4GEKA 4TV9B 3M70A 4FMCB 4G09A 2VDVE 1TQ6A 1XEWY 2XBLA 4W5JA 4YY3B 2IW3A 4B6FA 4EY4A 5CPBA 3V5NA 1MENA 3A1WA 2YWXA 2ZR0A 4V1CA 3B89A 1EM8B 2F3TA 1MC4A 1KTIA 2GZHA 1E2QA 3O92A 4IWXA 3V2GA 3HY6A 2WNIA 5E4JA 5GGYA 3SQXA 2QZZA 1NJ5A 2LV8A 2YL2A 4LAFA 1NW3A 4X90A 1P74A 2IY8A 1B15A 4AN0A 4DILA 2AYZA 5A3QA 1PZXA 2OESA 3PNSA 1ZI9A 2NYVA 3KLPX 3ZKWA 5K0NA 1ZD4A 2P62A 1OJLA 2J46A 3AERA 2Q6KA 4F45A 3HNOA 4CETA 3QQ5A 1O95A 3I9MA 4QXQA 4ABYA 5IDVA 1FUUA 2PSEA 3MTAA 1GSHA 1PHPA 3ABOB 3F6PA 4JJKA 4C3UA 1VL5A 2JB9A 2OP1A 2ZI4A 2F17A 4KFSA 4PONA 4A82A 2NUTB 2RJOA 4ZPJA 5INTA 5EQTA 4R2WA 1U9IA 4KZKA 3R20A 3OHMA 2YJNA 2QZPA 5AVXA 4J9VA 1XV5A 1DFIA 1C1XB 3F97A 4I08A 1FYEA 4KXVA 2QG9A 2FY8A 2WPDD 2QRJA 1S4MA 4O63O 2GPTA 4KKXB 1CZLA 1ESMA 1FLDA 5TPWB 4ZXFA 4JLMA 1YH3A 3HBFA 5DRYA 1AGNA 1TCBA 1IAVA 3AR9A 5BV8A 2Q5CA 4Z4IA 2E3JA 1KEKA 1ZGGA 3E1KA 2PZ8A 3KHSA 3IR7A 3DC7A 4OXKA 1ISSA 2D2EA 1T91A 2BGIA 1GYRA 5LIRA 3PUJA 4AVYA 5BSVA 4G89A 4QYSA 2P9GA 2VJOA 3LP8A 1MX1A 3IHWA 3M1YA 1QMGA 5IMBA 5C37A 1WLSA 2V4UA 3KDSE 4XZ3A 5AJZA 4A1FA 2GLTA 3OWXA 2OSBA 4HZUA 3GNSA 3WLNA 2PXXA 1SU4A 3OO1A 3WB2A 1QE3A 2BT4A 4WADA 2AG0A 4XI9A 3ZN2A 3R0IA 3CLSD 4X84A 2F8TA 1Y48E 2AVNA 5G41A 4IVRA 1MAUA 1YKGA 3WL7A 3KQMA 1A5BB 4FW8A 4I50F 3T12A 1UR5A 5JZMA 3TTYA 3D1LA 4PBTA 3JU3A 3IURA 2Q4RA 4BEWA 3I6IA 1M33A 1D1QA 3ELUA 4E4YA 5DHFA 1AQJA 1DFGA 5DTQA 4BKUA 2C2YA 1FW8A 2WR8A 4JI2B 5DGTA 1V1JA 1OLSA 2NO5A 4PCLA 4J7UA 1AN9A 5CCDA 3ENZA 2AN3A 1O95D 1U3UA 1L5RA 3EOZA 2Q1SA 5KBYA 1XZLA 1PK8A 1ISMA 2Z8ZA 4YT4A 3GVCA 1A77A 4TZTA 1W581 3QFTA 1JSRA 3W5DA 2JARA 2IC5A 3Q88A 3DOIA 4CF3A 1Z16A 2E82A 4FNOA 2HADA 4OB6A 1AKYA 2HNAA 3M3PA 3PRKE 2GEUA 4MLDA 2OZEA 2HDNB 4CKBB 1F5SA 2BV3A 4OO3A 2HMWA 3P97A 4KRXA 1XEWX 4YPFA 5LOVA 2MINA 1UZAA 3OPXA 4XJXA 1LLCA 1TA4A 3E9NA 4HQOA 4XQGA 2ZR7A 3RT1A 4XR4A 5AVVA 4O4JA 4WOPA 1RRPA 2DVMA 2H0RA 2J3IA 3HDJA 1W9HA 4YCMA 1N2CE 4KYVA 3EIUA 5J5VA 1FDTA 4WQMA 3ONVA 3P9PA 1U2QA 3TRKA 2HSGA 1XAIA 3WISA 4G0YA 3EZLA 2AC4A 3IP5A 2V5AA 3B7WA 4IUCS 4I4LA 5C7OO 2GBPA 3SQMA 3X1ZA 2QJTA 1FS6A 1H93A 2JGFA 1C14A 1TAUA 4J4HA 3WLSA 5CEFA 3VR5H 3T3HA 1TTTA 3L8CA 3CLVA 1PKXA 1BHO1 2PRIA 3U0VA 1ZCFA 2B8WA 4GEGA 2WJVA 2VK2A 4YV2A 4YS6A 3L1JA 1H1TA 1UKYA 4JX8A 2PK3A 4IICA 4U2FA 4Q9JA 4JUFA 3SC2A 4KR7A 1TX4B 2CNLA 5FTWA 3F5MA 1N0HA 3FUXA 4X8LA 3TZ6A 4EJFA 2R44A 4FHEA 3NWEA 4JSRA 2EERA 3JATB 3U9TA 1S5PA 3VRHA 1TA9A 4QT4A 5AD1A 3GJTA 5JCJD 1N5IA 1YI1A 2R62A 3EG9B 1GTJ1 3GWZA 3ROKA 2KW5A 2OB2A 4R68A 1FS4A 5E4YA 1SQSA 2IYYA 3O2SB 3OFKA 3CH6A 3STXA 4YXWA 4ZT5A 1POXA 1XJWA 3Q5GA 4TROA 3E9DA 1GN8A 1HE8B 2PEZA 4C21A 1HFKA 1M2WA 3H5OA 4OF4A 1PT9A 1YVRA 1P6QA 4JI8B 2CVPA 2ZPUA 4JHLA 3TE6A 1XQYA 4TLDA 1OI2A 1MZVA 2Q0QA 2YIJA 1QB7A 3AFMA 1HEUA 4CDGA 1BOOA 5KQLA 4JZYA 4NTZA 3F8TA 5DI9A 4LEIA 3IBCA 2OXEA 1ZJWA 4FDTA 2VZEA 4MVJE 1KY2A 3N05A 4UEWA 1Y9EA 4YCLA 4YX9A 3THWB 1BU5A 4TL9A 1Z2PX 4J49A 1THTA 1P1BA 4MR8A 3QQPA 4LXYA 1IXZA 1D0VA 2I6XA 1XTIA 4H1UA 4V0ME 4UASA 6YASA 1SPBS 5AJUA 4POOA 4Q19A 1ZRMA 1Z5ZA 3A3YA 3BTSA 3M6FA 1TMYA 3S81A 4ZYVA 2XECA 3C6YA 1JT2A 3CVJA 2B0JA 4YLGA 4B0PA 1GNTA 4I5IA 3N2GA 2XXBA 1JHOA 2PX5A 3BWDD 1I7NA 4EB6B 5DX0A 1WE2A 4YRQA 4XDGA 5AI4A 2X0EA 3ZGOA 5CJ2A 4DEXA 5B6IA 5T7BA 5AUQA 2G9QA 2JATA 1RI5A 3KJNA 2OG1A 4J2OA 5C1DA 5CITA 4ZVLA 1Y5RA 2W2VA 2Y0DA 3QWAA 2ZAIA 3CSDA 4PVCA 2YS6A 5EXXA 3RU9A 3KQNA 1RHUA 2J41A 2CN1A 2OWEA 2VPIA 3KT3A 4XJTA 4JLKA 3ZDXB 3C41J 3IPLA 5JZSA 3QEMB 1MAHA 3EGXA 4NL4H 4P4LA 1Y6FA 3GN2A 4HEQA 4RE6A 2DH6A 4AURA 2H18A 2QTVA 1U2TA 5EVCA 1GUBA 3OX1A 3D0KA 2WVGA 1QPGA 1L7DA 5I7FA 3C5CA 4JHXA 3O31A 1W25A 1AKWA 1S4QA 3L4SO 1HFJA 4CMHA 1EVZA 4DFDA 1QVRA 5F23A 1UMCA 2APJA 2D3WA 2OD7A 3A6EA 5L4NA 1ZR2A 1FMFA 4H1VA 2PGIA 1GTMA 3AGPA 3OZEA 1LLQA 3ZBQA 1EFPA 3PTLA 2M6LA 2D2VA 2SICE 1GOTA 4GOJA 4TTPA 5SZHB 4XB1A 3OFNA 3UV7A 4HNUA 9ABPA 1PN3A 3A58B 2CLCX 2DC1A 2JIMA 2X4LA 3NNDA 4EM6A 4YAUA 5T3UA 4G9GA 4MPDA 2WSYB 2K2QB 2W42A 1QFXA 4TLCA 4TM7A 5KYVA 5M3BA 3KKLA 2CLEB 1D04A 1XPRA 1WBDA 3VU0A 4AJEA 4F8YA 1FVXA 2P91A 5K3CA 3EDYA 3I5MA 3SNHA 1ZL0A 2J4DA 4NP6A 2HGZA 1SUBA 1N7IA 4Y1RB 4A2WA 2BCEA 4BP3A 4JI1B 2Z8YM 2RGRA 2W2OA 4MGZR 2XE4A 4LXQA 2FDRA 4ZVVA 2F55A 2YZ2A 1Z39A 3RNOA 1GEGA 1WDWB 1EU1A 4LMPA 3A1CA 4P7FA 2RK4A 3G2IA 4FFDA 4KPGA 5L95A 3IO5A 2FR8C 4MV9A 1KMMA 1T6ZA 1NM5A 3QPBA 4FT4A 4BOYA 4CCYB 5J43A 3FKJA 1MFPA 5ES3A 2EQBA 4ZCLA 2QE7D 1GTL1 1VLZA 2AMJA 1RE1A 6REQB 2Q1UA 2OUKA 1W4RA 1KK1A 2P3LA 1GZ4A 1U4OA 3AI1A 3AJEA 3FX2A 4UXHA 2ORVA 3I2FA 3MSCA 3VR6D 4B80A 1ISRA 3K71B 4AZ0A 2CE7A 2J33A 1SUWA 5E9JA 3DOUA 3UJ8A 3L4BA 1Q91A 4IV5A 3D7MA 2JFUA 5D5HA 3CWZA 5JANA 3SVLA 1OC2A 2WMNB 3NBXX 2G07A 4NBSA 1T9GR 2FWAA 1AY0A 3D3WA 5HCIA 4GM0A 3T7SA 4Q7MB 3V6MA 1DV1A 1XCJA 3UWSA 3ZGYA 4AY3A 4CDMA 1Z3CA 2AGVA 1XYYA 1ZONA 3OT1A 4ESHA 5HM6A 1F8UA 2FP4B 5DI3A 2QNRA 1G5TA 3NLLA 1U2RA 4PZLA 5FBHA 4XJVA 4JLUA 1D5CA 1SXJB 1QOZA 2OBXA 3S8EA 1YR7A 3QUSA 1P1RA 4U6QA 1EGAA 4CCSA 2SHKA 3TQQA 1XWFA 2EJVA 3IAM1 5K3FB 4JVLA 3Q7RA 3R6DA 1K86A 4RVDA 2OAGA 1W4ZA 3WS7A 2HLDD 1BCSA 4CBVA 1Y3FE 1P91A 1C30B 1RYZA 1ESZA 3AG6A 2ZJ8A 3LA6A 1YU9A 3H2SA 4FR5A 3BWMA 2VQFB 5L6MB 3I5AA 3ETJA 4EK9A 2RCYA 3PTAA 5DNWA 4HTFB 2P6OA 2AXQA 5HEKA 5BNZA 1NF3A 2I4IA 3AUSA 3FVWA 4RSMA 3WYDA 3AONB 1X87A 1XJCA 4RVHA 3STWA 2UZ4A 3U4MA 2QD2A 2ZBEA 3ELBA 4IWYA 2G1JA 3B13B 4S05A 2DBQA 5FAKA 4XTRA 1JFTA 3RYTC 2AW5A 1UWLA 4AJ9A 4EG6A 4UFPA 4V0LA 3ZU3A 4XPIB 2V5VA 3BXXA 4FMBB 4OAPA 2ZZKA 1XVUA 3R3UA 1KL7A 3H8VA 5FUWA 3W78A 2R6GA 2FQXA 4HVTA 2O4CA 2IH4A 2EW2A 3B1FA 1VHWA 1XAGA 3DMFA 2Q6IA 1Y6RA 2WDZA 2YQ4A 3MILA 5BW5A 3LFTA 5F2OA 1BW9B 5KDLA 4CF5A 3NM5A 1DC8A 4H7KA 4CKCA 1X39A 5AP9A 3HR8A 2L82A 1YDHA 2Z5FA 3PUKA 2BSXA 4BJ3A 4FOOA 4ZOEA 1MAAA 5BN4A 4Z0HO 2PANA 1NQAO 1VJTA 2Q3JA 3T5TA 5DULA 5EIAA 3ZVRA 1Z4MA 3U5TA 1ZH6A 5JYDA 2IYZA 5CGQB 3AWDA 2IBTA 2CBXA 4Z4CA 1E2HA 1TT7A 1ZJJA 3CEJA 3K4QA 3GLKA 5BW8A 3KEOA 3U6KA 3HXOA 5TC4A 2HDHA 1GYQA 1QYRA 2K4MA 4L4XA 4R98A 1PEKE 4P5EA 2VFAA 4RF2A 4ESEA 5JVDA 3EEOA 1SVIA 2XVZA 2VG8A 5IYZB 4RDXA 2QAGC 4EAAA 2ECPA 1YZGA 2J7PD 4HG2A 4X6XA 1I4DD 4XYGA 3TQTA 3TCNA 2AFHE 2AOTA 4XX0B 3HP1A 3TLGB 2LXNA 4RELA 2CLMB 5J9FA 4EJ2A 2GJAA 4BNJA 4WV3A 2YRFA 4DLKA 2YYZA 4JJZA 3SJ7A 2QRZA 4ZO9A 2LBPA 4BGVA 4D1YA 4GZLA 2HJRA 4UAGA 1CR1A 2QAGA 2Y99A 3DEYX 3K1AB 4JJ7A 4NRDA 1XDBA 4NAUA 4CUKA 5AJWA 3FROA 4D99A 1AMUA 3QG1A 1TQHA 4MMYB 4JI0B 1ZQ9A 1GQRA 4QOFA 3TNJA 3GRYA 4YT5A 3ZQJA 1L7QA 1QRRA 2JIBA 2NSJA 5CYGA 2A94A 4ZOCA 1VI2A 3KOOA 4EZIA 4DCCA 3TL2A 1HNZB 1ZM4A 4F96A 3CFYA 2C7GA 3KQYA 1KIMA 3B12A 2C5SA 1I94B 3EPLA 5F7JA 2J3LA 3UMRA 3W2EA 5EIEA 2AN1A 1PR9A 2DWOA 4N0PA 2X22A 3E3MA 2PTHA 4W5RA 2YCBA 4JENA 2OMEA 2FN4A 1U1EA 3ACCA 3PFHA 4WLFA 3ZHVA 2HA0A 3ZVLA 1YZQA 2CFRA 1IONA 3B5IA 3JWIA 1D1SA 1LRKA 1RYEA 3KXDA 2PHZA 3QI7A 3H13A 4CL3A 5P8WA 3PTZA 3FLAA 3MINA 4R4JA 3OPVA 5CVVA 4Z4GA 1SELA 2ZSUA 1FP4B 4JMPA 1MRNA 3X1DA 2FZWA 3IA2A 3IULA 4MA5A 1NURA 3W04A 1A4XA 8MHTA 1Q20A 2WWFA 1Z2NX 1SHKA 2DUUA 1ARZA 3BORA 1PAUA 2DFTA 2C2ZA 3BTUA 5CDTA 4KQXA 2FN7A 1DBPA 1CD5A 1F0KA 4LV5B 1TDJA 1YRHA 2XTMA 4KE9A 3O1HB 1BVUA 1VLMA 5TJ9A 2ETVA 2FG5A 3DT8A 4F72A 3T6KA 3W3AD 4P82A 4JXXA 2ORED 2WZQA 3KQPA 4FHDA 4RCYA 1NNSA 1PUJA 1QQBA 5FR2A 1NN1A 1NN0A 2RJ3A 2OO5A 1OYYA 3NBFA 3T7TA 4CQMA 1R0RE 1U7HA 3KAJA 3UKDA 4F04A 3CZCA 4I14A 5AI0A 2VEOA 4AS3A 1DIOB 4AKGA 3R0QA 5I9SA 3VNRA 3AJ9A 4WKCA 3ADCA 1SB8A 1JR3D 4P31A 4ZP1A 3E48A 4G5HA 5EIFA 4P3PA 5DLPA 4CG3A 2PUCA 4IH1A 5HRUA 2A9KA 3EDRA 3GRZA 2WJZB 1LD3A 4KR3A 3H9CA 1ILWA 1AKEA 1YASA 3VYWA 3FFTA 2FW8A 3JY6A 3Q8WA 5A9SA 1WXIA 1XRMA 2ODWA 4BRWA 5IABA 4J03A 3ZV7A 2CD7A 2IIBA 1J5XA 4N49A 1OWOA 2IZ0A 3O93A 3DR5A 4EYEA 1XCMA 4R54A 1LSJA 1NQXA 2JJYA 4FJ1A 4RUKA 3VOAA 1QGYA 1DARA 3EF0A 2UVPA 3ZCXA 3IDQA 2R86A 3H3FA 5DWVA 5E8JA 3OY2A 1BQ4A 1VSTA 1CWUA 1SFRA 1FLAA 2RGEA 1DIGA 3HJGA 1RADA 3LV8A 4FFPA 3L8DA 2ZROA 4FFWA 3WQRA 3WMGA 4C6RA 4DA0A 5JAZA 2RHGB 4S2UA 4K7JA 1X14A 1U94A 3WBJA 1OH5A 5JJIA 2JRCA 4KQIA 3QHAA 3X1XA 5SYNA 4LA4A 1JKJA 1HRDA 1WEHA 4L74A 2YXPX 1JWAB 2YFYA 1FBNA 4PC6A 5IDYA 3JVDA 2GA9A 2ISQA 2Q4DA 5HMLA 4GPTA 4MWCA 4US1R 3PEUA 3QKRA 2W22A 3EDCA 1KC3A 1U2ZA 3HCOA 5CA1B 4JT2A 2ZKLA 2R6JA 5GJCA 5FPKA 1KP2A 1Z62A 2LE0A 3HDGA 3HMQA 1PJQA 5HUHA 1GGKA 1ZIDA 3C45A 2ZRKA 4OHUA 2D8MA 1OC4A 3KKQA 2JLCA 2D7JA 3A1NA 2GT1A 2J3EA 2GRAA 3MWFA 4NK4A 2GR9A 1YQGA 3RV4A 4AS2A 2H1CA 2OCBA 2OXFA 1MBZA 3RTGA 5A02A 1HDCA 5WRFA 4F84A 5TR9A 3DW3X 5BSMA 1AXEA 4IGAA 2PS0A 3X2SA 3GT7A 5TGTA 1SU8A 2I6QA 4HMOA 4C0SA 1N77A 1SJ9A 4QARA 5I7OA 2AV6A 1DEXA 3L1IA 3HY4A 1G21E 3AJRA 1QP4A 2XNDA 3PQCA 2WJWA 1G5QA 2GPBA 1YHYA 2J45A 5CNIA 3HDYA 3T9CA 5ICGA 4Y2RA 2GDZA 4O08A 1UOPA 4PV7A 3ROGA 5DVZA 1USKA 1Z25A 4KSYA 1Y7LA 4B6QA 2QI9F 1C9EA 3F49S 3L7NA 3VO2A 2QX6A 4IVQA 2FJUA 2ZJBA 3U1BA 2FQYA 2IYLD 1G8AA 5L40A 5JLJA 5F78A 4Z1MD 2D1RA 3OZDA 2NNWB 3FDXA 3TX6A 2WC1A 3LNTA 4F4HA 5DNAA 4LIPD 4FFOA 3DMPA 1R6XA 1MORA 1YF3A 1GV1A 2RHCA 4ZGGA 2DBYA 5EJ7A 3AB7A 2WSSA 1QFMA 2V8OA 3QJ5A 3QVMA 3QYAA 3W8FA 5HX7A 3HXMA 1C80A 1OLXB 1UXKA 3DLBA 3DQPA 4OKIA 2C94A 3P0RA 3D0RA 4MQ5A 5DBGA 1ZLYA 3TBFA 4AO8A 3I92A 1VPTA 2JHFA 4JGGA 3D02A 1R8JA 2GBLC 4MWDA 1U8CB 5BNWA 2F2TA 4IINA 3FKSD 4IQGA 4KO4S 4URHA 5JS8A 4AY5A 4DCUA 2OXTA 2CF6A 1VLVA 2QX7A 4FMPA 2CV2A 3KDAA 3OF2A 3VR3D 4B5LA 4D5GA 4S0ZA 1ZH4A 4FX5A 4YDSA 4YT8A 1OHHA 3E5HA 3MMSA 4G8BA 1SVWA 1EESA 4Q4AB 4X00A 2MSKA 3A32A 1IB0A 1A72A 3SLKA 1NZDA 4G6ZA 4YRGA 1NQ5A 1K6IA 4MR7B 2QGNA 1MB0A 1QGUB 3WB0A 1L6IA 5FNZA 3O4RA 5H81A 4A0FA 5KJFA 3D7SA 1IM8A 3BB1A 4O2BF 5KKCA 3RARA 4GW3A 5REQB 3EEIA 1QONA 5A2QA 2R8ZA 3CUWA 4WWHA 1N2BA 4N0MA 4XFKA 4EJ6A 3HFRA 3ZV5A 4POAA 1IHYA 3VPSA 3ZCRA 4R9VA 1G18A 5CB0A 1NBME 5JQGA 2VDOB 1VE5A 1S3IA 1EG7A 4XGNA 1BX0A 5IARA 1Y42X 5C4IA 2PKWA 1XNHA 4EQZA 4ARCA 1ESCA 1A4UA 1CZUA 2R87A 1P7VA 2GESA 1KYTA 3ZWXA 4UU7A 2Q21A 3A4NA 4YP6A 4ZVKA 4J3NA 1A7UA 1I6WA 1DZ3A 2CNKA 2I55A 4MUJA 4QRDA 2HA6A 4I5FA 2AFVA 2GH1A 3WB1A 3ZOZA 3F67A 5E2BA 1OBOA 4QXAA 4P4SA 1T2VA 4FMDB 5AUNB 2Q3LA 3RRNA 3NUQA 3PLRA 2CVQA 2X8WA 2NZ2A 1OR8A 1T6BY 3O8NA 3WK9A 3WYNA 5JS1A 5HZKA 4Q47A 2CXSA 2YZ7A 2Z6VA 3B52X 3PIIA 4C0WA 4A0SA 3GJYA 1KE1A 2W6IA 5SZJA 3F2IA 3GJ8A 2A0YA 1K8XB 4UZSA 1QC5B 2FW6A 3Q7QA 2GYWA 5A0TA 3R4CA 2OO7A 4FYXA 3DEHA 1WLYA 3EODA 1N1GA 2GAAA 5JAOA 3F0TA 3AR6A 4FTWA 1FX0A 2BMVA 3OQ1A 1I2AA 3A6LA 5HMMA 3CGWA 2C42A 4NOKA 1P0PA 4ND5A 1NXWA 1X94A 1ZK2A 2ZUWA 1CVRA 3GNTA 3HKDB 2E49A 4L3WA 4NE9A 4RKRA 5EL0A 5CXXA 3FPKA 5T41A 2PEYA 3HL4A 1RWKA 3EDMA 3WKEA 1ENZA 3QFSA 1QRAA 4LHSA 4RKQA 1DXYA 1U5BB 1ZD3A 2PIDA 3KZCA 5FNVA 3HADA 5CB4F 5MGNA 3AVUA 4BP1A 2ZOSA 3R7NA 3RE1A 4XDHA 4MA4A 4Q3AA 4ZC8A 2N75A 3G2QA 3T95A 3WFZA 4P4UA 1XD8A 3C3JA 3EWIA 1UAAA 5LOVF 1C3OA 4PGGA 4HQRA 1LS1A 4FBMA 3AR8A 2HUPA 1GPWB 5THQA 4DMGA 5BMVA 5HTOA 4RL4A 3CVYA 3HB1A 2Z6UA 2F43A 3L84A 3AESB 3L18A 1IUPA 2LKCA 1YT5A 1G3IA 2XIJA 3IRVA 1KH2A 1U9JA 1VKRA 3BMXA 3H9EO 4ZAVA 3ZGLA 5FFMA 4BBPA 3KTAA 4TT8A 4LJ7A 2O2DA 2FSFA 3BJEA 4EMUA 2UXDB 3M4ZA 3ZG6A 1DJPA 4RL6A 2JAHA 1T9HA 3P96A 3T5BA 3QMMA 2W2MA 2P7HA 3M4NA 3L0YA 2ADFA 2XWBF 4D8YA 2CL5A 4F92B 1K63A 3DTYA 4V2IA 1R10A 3OD5A 2WHPA 5CLHA 1HOTA 2P67A 3R3YA 3MEQA 3RQSA 1CZHA 2JLBA 4BGUA 3EBLA 2C4KA 3QX9A 1SVNA 2H92A 1FX0B 1PR4A 1TU4A 2C4UA 3FF4A 3PUZA 3T0FA 2ZYVX 5LJIA 1CY4A 2MT9A 3ROEA 5DLYA 1J00A 3GFRA 3SOPA 3SHOA 3EAQA 4DR3B 1IBSA 1LPOA 2ODEA 5KSWB 5DX1A 4HWKA 1L4NA 4TTTS 5C4GB 4CV1A 1Q15A 2P9BA 3TQRA 3CU5A 1YE8A 4LDRA 4M49A 3KDPA 5K6AC 3W9YA 4NMHA 5KX5B 3CO5A 4BU1A 1QF9A 1OIVA 2YIMA 3RT7A 4ZMRA 4OQDA 2W4IA 1G5IA 3R2JA 5F1PA 5JNUA 4PC2A 4DT1A 3MWLA 2JGDB 4RAOA 3LC7O 2CHGA 2DJ5A 2RGCA 3L8EA 3KYDB 2XT6A 1YR3A 3GZNA 1YOVA 1A9XA 1EVJA 3LKBA 3RQIA 4CKEA 5IJ0B 3VTKA 4BKMA 2R1UA 4ZO6A 5DBIA 4DNFA 2FZ5A 3TLZA 4JNKA 1G291 2EFDB 3FYTA 1NRIA 4M0CA 1Y4DE 4LK2A 4M0EA 4WD3A 1RAGA 2O14A 1I8TA 1ZC3A 2WUEA 2VAWA 3D8HA 4DSAA 5FLEX 2I4LA 4X44A 2DHQA 1O2DA 1DJLA 3JQFC 1KWGA 1V3QE 4II7A 5IWCA 3LGSA 3I5XA 2VJPA 1JLHA 3OU6A 4QUDA 5EZ5A 4QSMA 2P1DA 3DHVA 2NN3C 1T25A 4A6XA 2BGNA 4LC1A 4GUDA 3N0RA 5ALFA 3RBXA 1KXZA 1C8BA 2WE7A 4B4WA 4G1CA 5LSAA 2R68A 4HEHA 2CMKA 2I3DA 3M3HA 4MQEB 3EGEA 1U3DA 5E1BA 3TPZA 2XUOA 1U31A 3ITNA 4X3OA 3MOGA 2HI0A 2ZATA 4ZV7A 4GMDA 3CR8A 1N5OX 2QGFA 2FPPA 1VCOA 5FA6A 5AWFC 4E2WA 4RJLA 4X1IB 5DNUA 1X7YB 2GBLA 3U1VA 4YAIA 3ZK9A 3PSHA 3EEFA 1MABB 4MB0A 3C7KA 5FXMA 4MQ6A 4YIHA 3I5YA 3O4IA 3B85A 2DLCX 2VHQA 2AJDA 1X1CA 2BTQA 3M5WA 1ZD9A 1JB1A 3IUQA 1GHTA 1QQ7A 3ADDA 2I2XB 1B73A 2G72A 2HWUA 4Y1FA 4MDYA 1GKYA 1BNCA 1ZBDA 3BSYA 3K0CC 4IIUA 3LZDA 4J6EA 3W05A 4JP2A 1ZH2A 4L22A 4Z2YA 2GSDA 3IKLA 3M34A 5CYPA 4BEBA 4R1QA 5IK2A 3P5BA 4DLUA 5IKMA 2QB5A 4K40A 1U65A 5CK5A 3RUAA 1N5DA 1NXVA 3K30A 3TECE 5FO0A 4J75A 1JE0A 1JILA 1NW6A 2Y76A 3A4MA 3DE7X 1E8DA 2VZ9A 3NKFA 4G86A 5IEJA 4I1SA 2J31A 1EVLA 1FB5A 2ZYTX 3IMFA 4FYIA 4BUCA 2PD3A 3K8ZA 4H3HB 4EQ6A 2RHDA 1G19A 5GONF 2JIRA 3FI0A 2QHXA 3SZGA 2GA8A 2ZSDA 4UTOA 3OJ0A 4C9BA 1BHJA 3CLUC 3RIYA 1HDXA 1R7RA 1K6XA 3UMCA 1K88A 5JNWA 3LPMA 4IJQA 1A76A 3MYYA 4IVNA 3UB2A 3OZWA 5K0JA 1A8IA 4TS4A 1XLWA 3P9KA 5BY2A 4KQJA 1CF2O 3AW8A 4GKBA 4IJ5A 3TX2A 3GFTA 3E2MA 3PEFA 3JQ8A 1ESEA 3DSRA 3ZCTA 3GPBA 2Z58A 4C2UA 2XBMA 2ZBGA 1F3OA 4H6WA 3K35A 1BXGB 3CMCO 1Z63A 5TVKA 1XA0A 4MKRA 4J0GA 3IALA 4TKZA 2XTJA 1CVLA 1H9BA 1HG0A 3FA2A 4D9IA 3NBYC 4WEQA 2DKFA 1IN4A 1E4EA 3BA6A