1NQXA

Crystal structure of lumazine synthase from aquifex aeolicus in complex with inhibitor: 3-(7-hydroxy-8-ribityllumazine-6-yl)propionic acid
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
154
Chain Sequence
MQIYEGKLTAEGLRFGIVASRFNHALVDRLVEGAIDCIVRHGGREEDITLVRVPGSWEIPVAAGELARKEDIDAVIAIGVLIRGATPHFDYIASEVSKGLANLSLELRKPITFGVITADTLEQAIERAGTKHGNKGWEAALSAIEMANLFKSLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6,7-dimethyl-8-ribityllumazine synthase
publication title A structure-based model of the reaction catalyzed by lumazine synthase from Aquifex aeolicus.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 55
structure length 154
sequence length 154
chains with identical sequence B, C, D, E
ec nomenclature ec 2.5.1.78: 6,7-dimethyl-8-ribityllumazine synthase.
pdb deposition date 2003-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 1nqxA00
5IM5A 1RVV1 1W29A 2A59A 2B99A 1KZ1A 1W19A 2F59A 2C9DA 2O6HA 2JFBA 1XN1A 1NQVA 1NQXA 1ZISA 3NQ41 2C9BA 2VI5A 1KZ4A 1NQWA 2B98A 2C97A 4KQ6A 2C94A 1C2YA 1KYYA 2C92A 1HQKA 1KZ9A 1KYXA 1NQUA 2A57A 2OBXA 1EJBA 5IM4A 1DI0A 1T13A 2A58A 3MK31 1C41A 1KYVA 4J07A 1KZ6A 2I0FA
chains in the Genus database with same CATH superfamily
4DCGA 4EFLA 1MX5A 2JGJA 1FYFA 4FNGA 2F8SA 3U7IA 4Y1EA 3FMFA 2GRUA 2WYOA 3WMXA 1JIVA 2CE2X 3JWGA 3WHLA 4PFQA 4D25A 4LJ4A 3QI7A 5JO9A 3P9ZA 3AF1A 2OORC 3N7TA 4O0MA 3G17A 1X2EA 3KLOA 3G88A 4KFRA 4NF2A 1DFHA 5BN1A 2F3UA 1P3JA 1IL0A 1HDZA 4M88A 4B6OA 3R3WA 3HP7A 2QRQA 1E5TA 3O91A 2WFLB 4HQKA 2BL4A 4JDPA 1ZJ4A 3LQKA 3TPFA 4DIDA 1E94E 3LKVA 3OKCA 1NDQA 2ISSD 3BD9A 1W36B 1GILA 3G0IA 5K9ZA 2AR0A 2K2QB 2RAUA 2W71A 3P27A 2WWWA 1GXSA 1Q84A 2WIBA 5JNVA 3IUNA 4CMIA 1USWA 2GASA 2G9QA 3RQSA 3HEMA 1W8DA 1T10A 4TGLA 4X45A 4E30A 1XVIA 3Q15C 5JUWA 4F9TA 2X5NA 3G5LA 4JOSA 4QBKA 3ZV5A 2ODEA 2C7OA 1K5HA 3DLCA 2LIVA 4ZKEA 1RZVA 3MMPA 4GKAA 3TTYA 5IJ9B 1QDEA 1OZFA 3UEOA 4BKPA 3TRDA 3AI2A 1D4OA 3BWCA 2D0OB 3BXXA 3WQRA 4JP1A 2O7RA 1WDTA 4L4RA 1M7BA 3BHMA 3OJWA 2BEUB 1JZSA 2ZSJA 4JLOA 3EIEA 3IAS1 4NIMA 1G8KA 3NRBA 5EY5B 3FLEA 2HDNB 5H0IA 1RXSA 3ELBA 1YIOA 3I39X 3L4KA 5DCYA 1Y3HA 3A58B 1Y6RA 2ZU6A 3ZS9A 1DT5A 4GXNA 2ZRLA 1SCJA 1RLJA 3KJIA 4UDNA 4WNYA 3DOHA 4ZMBA 5L9AA 5F9HA 3HXQA 4ML3A 1GL3A 1WMDA 2VP2A 3KQWA 5HG0A 4LF5B 1P9WA 2VWQA 3TLJA 4ZO9A 1MQSA 4O4HB 4QO8A 4KUGA 3I2JA 4FWIB 1XG5A 2H51A 5D86A 3OUUA 5BV2P 3BCUA 1IZ0A 4BN4A 2TECE 3DPUA 3MLEA 4RSMA 2BFNA 2PDAA 3D0RA 3DAPA 4FOSA 1BEUB 1UPUA 3QKRA 4HWSA 1INLA 1I01A 1NJ1A 1TMYA 4Y3UA 3WNZA 4G8BA 5KJEA 4B48A 4C7XA 4P3KA 2ZITA 1QAOA 1OC4A 4DA7A 3B7GA 5LOVB 5LZ7A 3MJTA 5TMPA 3IVMA 2ZB3A 4HCJA 4Q7KA 2I2FA 5JS7A 2JA1A 1AQLA 3VH3A 4LRQA 1DKRA 2X0IA 1GTJ1 1IB0A 1QR6A 2C57A 3RSCA 4AF7A 1KJZA 1FFBA 1OWLA 1RXYA 2VDPB 1TT5A 3IEPA 4KO4S 3SYMA 1ZEMA 3EPJA 2B8JA 3QV1A 3V7YA 1Y7PA 2P9EA 3H18A 4BP9A 4L16A 2VL7A 3A3PA 1EHCA 2DWOA 4QRIA 5IF3A 3BHNA 1O94A 1O95D 3PPVA 2C82A 1Z36A 5AOVA 4RJTA 5CA0A 3G7SA 2A7XA 4RCZA 3IJRA 2EQ5A 3PQFA 3R5HA 3LBFA 4K6MA 1K08A 4UUBA 4YMHA 3O93A 2AFHB 2QP9X 3D7KA 3GUHA 3NUQA 3TBFA 2AUMA 1VLZA 2HGZA 3F6RA 2WIAA 3C39A 1JG4A 2CVZA 3GH3A 2CNOA 1XZJA 1WUIS 1R0SA 3D6VA 3PEUA 5G0WA 3VZSA 2O3TA 2O2SA 3MINA 2WU0A 1FQWA 1MD9A 4CL2A 5ULLA 1U9IC 4HUQA 4IFIA 3NDPA 5CFMA 3FTDA 3VPFA 3AU9A 4OF4A 2YFQA 1X9HA 4DV1B 3CVXA 3KHKA 2JI6A 4OKIA 2XNSA 1I94B 4LRXA 3HVHA 4FEAA 1W9HA 4MVJH 1VCIA 5IJZA 3TW0A 3ENKA 4D4KA 4ZYTA 4NBKA 1P4RA 3S2ZA 5JS1A 1HRDA 2IE0A 1PYGA 4GI5A 4NCNA 1EX9A 4JT2A 1ZGBA 1TXGA 5EKTA 1QZTA 1CY7A 2TYSB 3WO0A 4FM9A 4JLPA 4M54A 1JTFA 3A27A 2EJCA 2O3JA 2G36A 3PXXA 3BMCA 1TAQA 1ADYA 1PJAA 3H2YA 3KXLA 4OSPA 1JPJA 5D2CA 3Q3VA 4OQMA 2X0JA 1ND6A 1CZNA 1C29B 3FYUB 3GGJA 4EB0A 1DKOA 3D4OA 4E14A 5K01A 5H70A 3MQ2A 1LB1B 1JXAA 2PLAA 1L7DA 3PC6A 4LC0A 3LXUX 5JZVA 2J0EA 3QU9A 3WIDA 1EFHA 3K96A 4UU0A 4PSVA 4FONA 4I1RA 3EWSA 5AHXA 5TPWB 3ZWMA 4JODA 3A11A 1I3KA 2R6ZA 4LTDA 5D84A 3KOOA 721PA 5KYUA 2QRGA 2R85A 2QU7A 1OLXA 3AFIA 3PK0A 3U37A 4AN4A 4HD8A 1P8AA 2G0NA 3U49A 2PD4A 2ZSKA 2NSHA 4MKHA 4Y67A 4DM4A 5IUNC 1GKYA 5LLDA 3CVUA 1CQIA 2J0UA 3UVEA 4OHXA 1NJSA 1KEWA 3I30X 1DEKA 1N3YA 2C78A 3NYWA 4I4TA 1USIA 1YZ3A 1T0HB 3UTDA 4GPEA 1P72A 1ZH6A 1CHNA 2J0SA 1FU7A 1US8B 4WRRA 2O7NA 2JFBA 1WVIA 3OEYA 4AUKA 1H05A 4B3MB 5AM4A 1WDMA 3HZRA 4PGMA 4F3KA 1EVJA 1OU0A 1V8DA 3HYCA 1XMXA 2IYAA 2PX8A 3LI2A 1R6TA 2CMGA 2QTTA 5KINB 4DPMA 2HA5A 2Z30A 5FA5A 5KTPA 3T5PA 4PQGA 3NNSA 5HDQA 4E5PA 3PUHA 2GZAA 1N92A 1VDZA 3K0CC 2FMHA 3VOBA 5IM4A 3L04A 3JYPA 1QIMA 1X80A 2WJWA 3BMOA 1K6EA 4MCJA 4OUDB 2DLCX 1CV2A 2J5QA 3O4HA 3AVOA 1KFCB 1VLLA 4PQFA 3R6TA 1IXRC 2A59A 1HLPA 4MO9A 2CT8A 2YY6A 1T8SA 3UW3A 3ADDA 4A6PA 2P27A 1JRLA 2OYSA 3E82A 1O03A 2OQIA 3MXOA 4E7PA 1X0XA 1BWSA 1FVXA 1U28A 2V4MA 3WLIA 3JASB 1V4VA 3O8NA 4MIYA 1XKQA 5DH9A 4B34A 2IE8A 5JC1A 4IFEA 8MHTA 2IS1A 2R48A 3K20A 2V7BA 1H42A 1XRRA 4RKWA 5IT4A 4LFCB 4CODB 5K0NA 2ACEA 1T4GA 5EJIA 1DEHA 4R9SA 4XARA 4RPCA 2IF0A 2NXNA 2DR0A 4FGUA 3PVZA 4U7PB 1ACLA 3TUIC 3V1MA 1X77A 1DJPA 3DAHA 2UAGA 1F4PA 1KI2A 3N8DA 4QGFA 2P2GA 1P45A 4EGQA 3I9V6 1R6AA 3SXPA 2OZLA 3K5IA 4HWPA 3T52A 4JASB 4UD6A 2RAFA 2ZT7A 3A0UA 1TGYA 3COWA 3JQ7A 2XUJA 3CN9A 3NOVA 3RC7A 3BK1A 3VXKA 2P1DA 1MQ9A 4KODA 2JIOA 1KDPA 2CXOA 5H7XA 1I2BA 3ZQKA 1YZGA 3GLHB 4MDFA 2G04A 2F90A 2HHLA 1Y4AE 3CX3A 4ZVUA 3SEZA 4D99A 3ZDBA 1DE0A 2UXDB 1WPGA 3FJOA 3BA6A 3U5ZB 2D54A 5HXAA 1NF3A 4YAWA 2B8NA 2H1RA 3QKSB 3EODA 1GRVA 3WL5A 2JGFA 4CG0A 1P5FA 2IDMA 3BL6A 3CGGA 2JK1A 3MRTA 4F97A 5IAAA 4IO1A 3BVPA 1O58A 1JJAA 1Q0ZA 3OLXA 2I6QA 4BKRA 3RLFA 1JA1A 2BLLA 2PPLA 1D1TA 3GEGA 1IN4A 1ORTA 2BCEA 3ELWA 3E3LA 4P2GA 4QE3A 5TF0A 5BNTA 1MA3A 3RIXA 2QJRA 2Z6UA 4UUOA 3RUCA 3TSWA 3QXCA 3QBTA 1VI6A 4EKDA 3QHQA 3ZVMA 4DBLC 1CZRA 1VHDA 1KHTA 2Z4RA 1AOXA 4MI9A 4OFZA 4OHVA 3WGOA 3LNCA 3AM5A 5CDGA 3C3KA 4QWMA 4B3XA 4BS9A 2O8DB 3RTGA 4GQBA 3CSDA 3G82C 2AN5A 3N2NA 4WKNA 5EMLA 3S5UA 2XYRA 5DN9A 3ZV6A 3Q9NA 2CLIB 3OO0A 1T2DA 1KYVA 1WAMA 2H1HA 4Q48A 4PHFA 5DU2A 3T7CA 1SC4A 2J6IA 3QVSA 2VPPA 2WMNB 5ALNA 2X0EA 4HDRA 3EVDA 3W78A 1CJUC 3ETDA 2CXQA 1MO3A 1UC4B 4K6HA 4JUAA 4DCVA 4F06A 1HF3A 2PUAA 3C85A 2V54A 2OT3B 1Z0UA 1SVLA 1BQ3A 3FPFA 3KQKA 2G6TA 3TDNA 2DLNA 1J8FA 1AGYA 2OCXA 3AR5A 2FNAA 3P9RA 2WZQA 5DLPA 3RF6A 4FFNA 5JI2E 4BQRA 4JKOA 4MW9A 4HI0E 5LYYA 1M3SA 1P33A 3K6RA 4AP9A 1MPXA 4CQMA 1RFGE 2DQZA 4PCAA 1EQ2A 1FZQA 1GCIA 1I80A 1OZAA 3GMTA 1DRJA 1C3LA 2NQTA 3UB2A 5LQRA 1ZUNB 2D00A 4ENRA 4L6AA 3GD5A 1KMHA 4BO7A 3PE6A 1EP1B 3WJ1A 1TCVA 1U1DA 3HDJA 2OSVA 1MZPA 2JIMA 1NKVA 4KR9A 1WPRA 3EJ6A 2FZ4A 4JYBA 2IV3A 5M29A 2VP3A 3W7AA 3ISVA 9ATCA 2G28A 2GD0A 2WUGA 3NTQA 4TS4A 3BAZA 3HDTA 2YIDA 1THZA 3U7HB 2RD2A 1BJKA 1SQ5A 3ON5A 3CX6A 5KJFA 4Q16A 3P9QA 5AR1A 2VYVA 4C7KA 5I7SA 1XEXA 1HNNA 1EGHA 1AKEA 3UQZA 2I76A 3WICA 2O19A 1GZ7A 2G1JA 1X7WB 2Y4OA 4IDFA 4MKIA 4DXAA 2XVXA 3G02A 4R69A 4BX0A 2VJCA 1UDWA 3DHVA 4F9FA 5IXSA 1GM5A 4KYTA 4X1YB 3ZV7A 3H9JA 5KKCA 3WKBA 5LMNB 3ZLBA 2Y05A 2ZJBA 5TT1A 1JB1A 3K92A 1K0FA 5IDVA 1MG5A 3ROEA 2ZXEA 3BGDA 3KTFA 5FUBA 4FE3A 1XZNA 3KLNA 1Q0RA 1VJTA 3BGSA 3QYFA 4LG1A 3EOAI 4WOJA 4ZT5A 5FOWA 1FMFA 1U0TA 4JIMA 4TTIA 3M3PA 4B73A 2RHOA 1EFVB 3FZEA 4Y6SA 1GUDA 1IEVA 3G9UA 3CH7A 4LMPA 2IS6A 1JPVA 2G7ZA 4KRYA 1DELA 2EZ9A 4MV5A 4ZV4A 5BYKA 5T4BA 4AVYA 5FYQA 1MAUA 2UUCB 5AFSA 2HY7A 4IV5A 4AZ3B 4R54A 3T3MB 3K0BA 1VRVA 2GPYA 4FYWA 1PL6A 3L8YA 2XTAA 5BT9A 3W5SA 2Z9BA 3T7RA 1AT1A 1GQSA 4OM8A 3DAGA 2WKQA 2PUGA 3TGPA 1BFDA 1VL6A 3PNBA 5JJLA 1PR2A 4XLZA 2ECKA 3F6YA 4AN1A 5AW1A 3F6PA 3SR0A 3PD0A 2VPQA 3UYKA 1GA1A 1FIUA 1BCSA 4BLPA 2QLFA 1SEVA 4F21A 2LKDA 2Q5LA 2XDWA 2YXNA 4OB6A 4R8RA 4C0AC 1XD9A 4E2YA 1NR1A 2X1MA 4BKQA 2CJXA 1R6BX 1R5BA 1X1EA 1O6GA 4M55A 4PZCA 3M4JA 1N2JA 1GTG1 1PZGA 4JLWA 5TS3A 3V8NA 1N6OA 3VKGA 1BQEA 5FO0A 2J67A 1AB5A 1T1GA 3L7OA 1ZO8A 4URFA 2APJA 5G3YA 3IMFA 3WHKA 5GZ3A 4DC1A 3IODA 4CL8A 2CDRA 5LFAA 3RVSA 1C1XB 5BUZA 5SY6A 3UMSA 3ACBA 1MHTA 4UZSA 3GEEA 4G1UC 3RVNA 2BUAA 3WIUA 1S3IA 3PGMA 4JVOA 4EQ6A 1OX6A 3UMMA 1ZD1A 1A4UA 4WZAA 2K87A 1PKEA 3DE6X 2RK6A 2NAPA 4I0WB 1GT91 5BT8A 1ZRSA 3HL4A 1YD7A 1SXJB 1GADO 1C81A 4M0FA 2X0DA 4BQOA 2WUFA 3HB1A 3SBDA 3QWHA 4R3UC 3JTMA 5G53C 2HQOA 5D7BA 2YS7A 1JTVA 1QH8B 2FN7A 3SDZA 2FOIA 1P1KA 4LNUB 2YZKA 3HLKA 1Z74A 3OJOA 4ZCRA 4V1CA 2UUAB 3JYQA 3TLAA 4J90A 5D87A 3OCCA 1U2GC 1MTOA 4KXUA 5CLJA 1Z2CA 1GPYA 2QLBA 3OQHA 4OHUA 1MV5A 1NASA 4Y2RA 4FC6A 5EMHA 2R11A 1QZUA 3NEAA 3NTLA 4BP8A 2ZRAA 3R41A 4TZ6A 3DVAB 4HWKA 1NOIA 1ZLYA 4JJZA 3MAJA 1OV4A 1D6NA 2JKVA 3DOOA 1DOAA 3NBYC 4TV8B 5T8KA 4ERXA 3MTJA 4L78A 3ESDA 4FFLA 3QVXA 4HZUA 3G2HA 3WMRA 4A9AA 4C6RA 2KWIA 2AH5A 2UVPA 3UN1A 2AFIE 3VOTA 3T15A 3LUJA 2BKEA 1ILWA 3E0QA 3U17A 1BCRB 2GPWA 3QPBA 1QSGA 1ISRA 3CRRA 2XCTB 1XJCA 4ZEMA 5AJTA 2JVKA 2NUAB 4DMUB 4XOUA 3UWKA 4CQJA 1KVSA 4RPLA 3SC6A 5K6AC 3HWWA 3EQZA 5CGQB 2J07A 4NJMA 4C76A 1FTSA 2P6OA 2C00A 4D9IA 1EDZA 1NF9A 4I3GA 5KIAA 3HVRA 4YP7A 1U8TA 2GN6A 3KEQA 1EX1A 3FNEA 3KL4A 1OV6A 5AW5A 1JEQA 2WY2D 1QHIA 1XHEA 1Z15A 3GMIA 1PVDA 5C1OA 4HLCA 5IEJA 1PZFA 1BIFA 1YQGA 2PZEA 1U31A 3AFOA 3WI7A 4EPTA 4Q9LA 1NM5C 2GNPA 1L3BA 2C2XA 3D9QX 3KKQA 4TMWA 4ZOLA 2O1WA 3VDMA 2B5WA 3DJYA 2J41A 4OJTA 1UPFA 4MJ7A 3U7GA 3T99A 1IN7A 5HJ2A 1W1UA 1S89A 4MS1B 4XW2A 2K2WA 4C89A 1T5HX 3KOZA 5C8XA 2P4QA 1IG0A 4R8VA 4G8CA 1RP1A 2H9IA 4LKRA 3H9GA 1QHNA 4Q7LA 1GUZA 2FQYA 4W63A 1QNLA 1UDRA 3RVDA 3ZS8A 5LJIA 4YT5A 4QOFA 5ALPA 4PS1A 5THQA 2HN9A 2WG2A 1PS0A 3PWTA 1WUYA 2FWIA 1USKA 2PQ0A 4RVGA 1CPYA 1FXWF 1DAOA 1EYZA 1XDZA 2GVNA 3O9VA 2NZXA 3TOZA 4JITA 1F51E 1NNUA 1UUFA 2CHFA 3LGSA 1D2EA 4KG7A 2JJ2A 2BTQB 4WFQA 3VJKA 5BW5A 4PAMA 3P5BA 5MFZA 3NV9A 1E7RA 2WD7A 2PTGA 3DE5X 5E7MA 1L7EA 1BEEA 2CNWD 2Q27A 4OHWA 3Q7RA 3BD8A 5FP0A 5BSFA 4KRFA 5HZGA 2B0CA 2BZGA 2XMPA 3O8OB 4ZJZA 3UO8B 1DG1G 2PANA 2J9RA 1ZU4A 2AW3A 4NEHB 1ZQ1A 4NH0A 3UWOA 4ARSA 1GRQA 4DNFA 4EZBA 2R6DA 4MUBA 2QMHA 4YRJA 5KDDA 3DTNA 1FL9A 1OIXA 2YZ2A 3VFDA 1CYEA 4TXLA 5K3CA 1KDTA 3WLJA 4HQFA 4KWCA 5C5DA 2F9MA 4KVGA 1DRUA 4XJSA 4QYIA 2PKEA 4BLUA 2CXNA 3E58A 3NHKA 3FCYA 3OP1A 4KWIA 4LYHA 1GG2A 1QC5A 1TA0A 2AHRA 2O3UA 1NRIA 3P94A 1YXMA 5DNAA 4OLFA 3V3TA 2C9OA 2Q6IA 2YQ4A 2ROQA 4L2IA 5I9SA 3BHJA 4P7GA 1G8JA 3EXG1 3H4IA 4IVNA 4WHMA 3VR5H 5ILOA 2JG3A 1SKYB 3H0EA 3R1IA 3OPQA 3LZ6A 1XTTA 2GUWA 2JCBA 3AK4A 2A5LA 1ZR4A 4ZP1A 1YMUA 4M89A 3FVRA 1J9EA 1DQZA 1QGDA 4JVNA 4UBLA 5D5QA 3WLSA 1D7OA 2DQSA 4B9EA 1LQUA 4BE4A 3FZNA 3ASZA 4XPIA 4B3HA 3X1ZA 4IOKA 1KKLA 4QU5A 4LF4B 2WSMA 1IY0A 5P21A 2R87A 1DAGA 4YCSA 2IY7A 3EVNA 3O7MA 4B6QA 3CRMA 2FK8A 3KKPA 3LPNA 2HRRA 3QM1A 4R8LA 4EITA 1SOVA 1Y7IA 3B5JA 5JVDB 3SIRA 4B3RB 3SWWA 1M10A 3HM2A 3Q12A 3KXIA 2J3JA 3RSOA 1ZMTA 2WJVA 3CJRA 5ADUS 1ZAYA 1OPRA 3QPVA 2VSYA 3B1XA 5DX8A 2Z5FA 1J2RA 1T8TA 4QDTA 3EGWA 2ZU0C 4YCDA 2OMEA 4QQKA 1WA5A 1KVUA 1IE3A 4CG1A 1G20B 5A02A 1R3DA 2CLDX 2GILA 4UTNA 3S55A 2XY4A 3C5HA 2B82A 1NI4A 4K46A 4BVEA 4U7DA 3JRWA 4Q47A 2KJQA 1CP2A 2V1UA 2CJPA 1AZLA 3ER6A 3HWRA 3WK9A 4G1CA 3IT2A 3WSWA 2WHRA 2OQ2A 2D13A 3TVYA 1R88A 4BV3A 1G21B 1OQAA 1A7JA 4XFKA 2Z4SA 4YJGA 1JR4A 2CLHB 2VSXA 2WJZB 3LBYA 4NARA 2AK2A 5JSKA 5J4YA 3PCXA 1N2BA 3VM6A 3OQVA 1QXSA 5EESA 3QV2A 2X2FA 1WLYA 3NUGA 1BFUA 1NBEA 2ODBA 3RT1A 4FOTA 3R3SA 5FTJA 4WVFA 3HE3A 2NU7A 3KEMA 3ZTTA 2W0SA 4CIAA 4HH3C 2PWAA 4O2BF 1YZTA 1MC1A 2GJ8A 2YN2A 1BX3A 1VGQA 4FCWA 5G4KB 3EXG2 3UV7A 3ZIAD 4KSCA 4D56A 3PFKA 2IS4A 4RU1A 3TTVA 3P4XA 4IY1A 5B5SA 5I8PA 2YV5A 2FA9A 4MB6A 5KPDA 2B4QA 1UPXA 1GTZA 2Z2YA 1I13A 1MJ5A 3OZIA 3EB9A 3EGIA 2KB0A 3MAGA 3M0EA 3O3NB 1XIVA 1OGJA 1EAYA 1R6VA 2B8TA 1A95A 5I9MA 3RSHA 4OHBA 3ZJTA 4F9EA 1F3LA 4BWYA 1XRMA 1USUA 1F06A 4LSWA 1BKSB 2ZDGA 4KVFA 1D2AA 3NLLA 4JY7A 3ZY5A 1EEXB 1SCDA 3CB4A 3QE3A 2I1WA 4B1FA 3NBUA 2CF6A 2MMCA 4OA8A 5IG2A 5FA8A 3GUVA 4F9GA 5KU7A 2ZVPX 3NTVA 1GXSB 4HLDA 2B37A 4CMIB 5JXHA 3HACA 4CF5A 3JQAA 4H4DA 1AQJA 3R9XA 1EB9A 3CUWA 2SNIE 1B8OA 1YQEA 2W9XA 5JDCC 2EFJA 2ZPUA 5CCBA 2OXIA 1QAMA 2CNBA 1H8HA 2XXAA 1AGRA 3CRQA 4O4LB 5KQSA 1NR7A 3FGPA 1VECA 4Q03A 3UUWA 4QPDA 1I4WA 2MSWA 3CKKA 4JC5A 2EP8A 1PS8A 2Q6TA 4LRYA 5T6BA 1ZVKA 3V2GA 1J06A 4NDAA 4ZHQB 4E5NA 5HQTA 5K4AA 3UJNA 1G4AE 1NW5A 4RVNA 5KNBA 1GA4A 1R5OA 3ZHZA 1JKXA 1GSHA 1ORHA 4U5QA 5AD1A 1E3MA 4RA6A 4EPWA 4FYMA 3PHGA 1FTWA 3ZIDA 3A9CA 4Y7CA 4FDTA 4AT1A 5DJ5A 4BFZA 2FXVA 4EUKA 3LX6A 4QT4A 3KUKA 1RPJA 4M98A 1TK2A 4JELA 4IZOA 5GGYA 5JROA 1XE3A 4M7PA 4PZZA 5AW2A 3BIJA 1XPUA 2HD4A 4ZJYA 2JFQA 4GZMA 5BQXA 5K0SA 4LXIA 4TWJA 4E15A 3PQ6A 3ZZ0A 4WZBA 2F59A 4BNTA 4BMZA 4ZDJA 1P3Y1 5ICCA 5JAHA 3QKRB 3F6EX 2JEZA 1LDNA 2CF5A 2PA0A 4O2AF 1Q0HA 4UM9D 1ZGCA 2X9VA 3O82A 1OB2A 3A1VA 1WKBA 3M6XA 5AKYA 2QHXA 1TC2A 4H60A 4EDFA 3DQPA 1OLSB 3M1IA 5F7JA 3RCBA 3KPVA 4ENTA 5AJZA 1KJIA 1L2TA 1AK9A 3QEAZ 3JWPA 4P83A 3WGTA 4OUKX 4EAQA 1ISSA 1TT5B 2FSPA 3F2VA 3IE0A 4YLEA 3G6WA 2DSNA 1OAOC 3HO6A 1FTNA 2G5PA 3O75A 1Y1RA 1BDMA 1Z08A 1KHHA 3LT4A 3K32A 3ZR4B 1NWCA 1YZHA 1MEJA 2FVXA 3TTTA 4A0FA 3GLFB 5CPBA 5CA0B 5TMDA 4K05A 3O95A 2XDAA 3JWJA 3GAMA 1ULZA 3ABZA 5EWLA 1UPTA 4GBGA 2Z2JA 3QJYA 4Q3BA 4BP1A 4C7MA 5ENZA 4CMEA 1PEDA 4CM5A 3H16A 1BVRA 3AR2A 3SQLA 1GPH1 1J1ZA 1E9BA 3R77A 2Y67A 5H5JA 5KYXA 3DJFA 3FTCA 4LVOA 5F7OA 2BZ1A 3PPYA 3MINB 4JC4A 4MQLA 1P5RA 1R0ZA 3EBPA 2QF7A 3GO4A 4HUQB 2W2PA 1GNRA 1N6HA 4OB8A 2ZZNA 4MVCA 5I7AA 3L7JA 2QR5A 5DHUA 2FPGA 3C3WA 4DJEC 5F51A 2LCFA 4BNDB 1GTL1 3BRCA 4R16A 5HKLA 4PLZA 1ZFNA 3RE1A 1D04A 2VF2A 3E48A 2Y6UA 1W4RA 3AWIA 5MN4A 1SGWA 3FD8A 2CLKB 1HSOA 4EI2A 4TPKA 1SC6A 5LDHA 1HUQA 1GN9A 1ZGJA 3BDAA 4L8GA 1F8FA 1P4JA 2I54A 4H31A 3N2GA 2JLBA 5BXQC 1BHO1 3WDKA 5JCZA 1GEGA 3NKFA 5GADl 5D51S 3ZVRA 4L4YA 2GESA 1H9CA 1K8QA 3GGDA 3FKJA 4P4NA 3WK8A 3KDPA 1CDDA 4ND5A 4QEZA 3IUJA 1AMUA 3FLAA 5LXTF 5C53B 4HNUA 3ANMA 1P1FA 4L0QA 1ODKA 2I3BA 1KR5A 1NZDA 3DEKA 1KJ8A 1JEDA 1O3YA 5E9WA 1VMIA 3OEED 4ZT2A 2WD9A 1L5HA 5IZCA 5KYUB 1OLXB 1A8QA 4UBKA 3I8OA 1B0UA 3WL4A 2LV8A 2OCPA 3QXXA 1V5WA 2IKSA 2X2PA 4FKZA 2NSLA 4H7EA 1CQIB 2J0UB 1AGPA 4C04A 2F6RA 5FR1A 3CUUA 3VO1A 3FPLA 2NT3A 2CE7A 4I4TB 1PFGA 4LE1A 4LYGA 1PW7A 2PAAA 4P5DA 3A3OA 5TQ0A 4UD2A 3L1JA 2AD5A 1HQKA 1Z45A 2B9EA 1QLWA 1J6UA 1GSOA 1TRKA 4K88A 5DTIA 4HXYA 3BILA 1G3QA 2C5BA 1HYQA 2D3TA 1OYYA 2RGCA 2ZRNA 1KY2A 3I4FA 3Q1KA 4DMRA 4G0VA 1N75A 5JH7B 4YMIA 2BISA 2Q0QA 5AOCA 3DXZA 5IUKC 3L92A 4I5EA 2HSGA 3U7JA 2JLYA 4W8HA 1RKQA 1ULSA 1OPXA 4OH7A 1Z2OX 4KTVE 1U2PA 2P75A 1T2VA 4HMPA 1SMKA 1T35A 1KXZA 1X80B 3BMOB 4XQ9A 5LQSA 1ISFA 1KAMA 2BE7A 1T3ZA 3U3JA 4BFYA 3RGWS 1H94A 1WB5A 5JXGA 3KQLA 2OCLA 4IF6A 3FUCA 2C8VA 1E77A 1XEWY 2A0WA 2W43A 3ZEIA 5KNDA 1LY1A 1JDBB 2D8MA 1HNXB 4MR9A 4AL4A 1E20A 4TWRA 3DOEA 3OOHA 4I8XA 1QU3A 4PZYA 5CLGA 5FEMA 1XNQB 1V26A 2CYCA 2VCYA 5JNUA 2V7XA 4KGZA 3HJTA 2WM3A 4DA9A 4PLFA 3N07A 3ETLA 4N7JA 1ZIXA 3M49A 2V0NA 2X6TA 3LUKA 2CD9A 4UFPA 5EGNA 3TI7A 3VA7A 1DC5A 1PG2A 3C7TA 3UC5A 4QRHA 1VA5A 1FRFS 4MRNA 1SJ9A 2HQSA 2JHCA 1WDLA 4WBNF 3CT4A 3IPRA 3PHCA 4CUKA 1Z47A 3REFA 1VI2A 3AFNA 1VMKA 4HNVA 1NQUA 2OZLB 5CIYA 3CWCA 3VUFA 1YR3A 4R7GA 2ONKA 1E3SA 1NUHA 4OKNA 3JQ7B 1JQEA 2EAUA 3AP2A 3MD0A 3D8TA 1J0DA 1TM2A 1XF9A 4EDHA 2ZI7A 1JFFA 4PO8A 2VVTA 1DC3A 2G40A 2VCHA 3D4BA 1F5SA 1B6GA 4E31A 4XM2A 4EHNA 1I36A 1ZHOA 1BEZA 4Q3EA 4J7UA 4OHFA 3W34A 2JDIA 3HDGA 3OMLA 1A8PA 4FI3F 1AKVA 1B0PA 2AXNA 3EUWA 3F0TA 3CE9A 3NEPX 4J1QA 2X1HA 4K8OA 5DSXA 5EJ2A 2R7MA 3WADA 5A4JA 2O59A 5EJFA 3ZD7A 2Q1XA 4EF6A 4MQFA 4RQTA 3ADBA 4BUJA 4ARAA 2B4RO 3F4BA 4LSMA 1CJKC 4WLFA 3SMQA 4ACBA 3K7EA 5CA1F 3M6WA 1T5OA 1TGVA 3FR7A 1P2BA 3MHPA 5EOVA 2FB9A 4MDHA 4CFYA 5D00A 4D9NA 4O0LA 5J9FA 2OG1A 3IXLA 3WK5A 1FSPA 3NHLA 4D9KA 4Q7JB 4FDVA 1KZ6A 4GZ5A 2O8VA 1KOFA 3FCAA 3GPIA 4ZANA 5TT0A 2QTFA 4AWXA 2E21A 1RIIA 3DVLA 3D4PA 4WLNA 3J80A 5I9IA 3WQSB 2JAXA 4ITUA 1R1DA 3G9TA 2GD6A 4N48A 3BX1A 2WPNA 4BGEA 2IQ5A 2MSKA 1KEPA 2WWHA 3N74A 2MMGA 4WLUA 1E5DA 2V4UA 3LLMA 5JANA 3BXZA 3KZMA 3LHIA 2WJHA 2WWIA 4CL0A 5A71A 1VG0B 2QIPA 1HXHA 2N46A 2PZFA 2VUHB 3H42B 2W98A 1E58A 3F5DA 2VHZA 5ECYA 3ILXA 5JEDA 1AGNA 2C3PA 2Z2IA 3JXEA 4N4AA 5E6SA 4BFCA 2DFVA 1QHHA 2RHWA 4XGKA 2F3SA 3V80A 3MUOA 2COKA 1E66A 2ST1A 3OHMA 1IZ8A 2XB9A 1IRXA 2K5UA 4ZTZB 5FR2A 2IXTA 4MRMB 4O3FA 3AX6A 5CK5A 1FZTA 4MZXA 1I3LA 3B6JA 2YOFA 3L41A 4PXAA 1TAUA 3IEUA 1MU0A 1U7XA 3KP1A 1YV9A 2HMWA 1KMHB 2Q2NA 3HXMA 1CUAA 3AT1A 1WCIA 3C7KA 4RIFA 5CVJA 3VZPA 2AD1A 5A3VA 1OT5A 5SZIA 1ZUHA 121PA 3HJCA 5FL7A 4TKVA 2GETA 2PMCA 3F98A 3PA6A 4PC1A 3PFCA 5FHRA 1VXOA 5H1YA 5CB8A 5HKAA 1FRZA 1CB7A 5L45A 4F2WA 1J70A 2AKAB 5DK4A 5GAJA 2OZPA 1BC5A 4DSAA 5JNTA 1W35A 2E6UX 2WV9A 2BYTA 1XEXB 3KXPA 4MMZB 5J4HA 2GN4A 6ADHA 1L5GB 1VOTA 3ETEA 1V39A 3L8ZA 4DCSA 1N2CE 2CMDA 5ITWA 2Z95A 4YRQA 2FSFA 3I64A 2RKBA 4C3UA 4RS3A 2QM3A 4D42A 3TBKA 3FWNA 4Q4LA 3SX0A 3QLTA 1R8QA 1X86B 3GNLA 1VLVA 4P32A 1AKYA 1UBRS 4E4YA 2XZDA 5CVTA 1UKYA 1B74A 4M1SA 2O50A 3KJXA 2AQIA 3HU5A 5IKEA 2XA9A 1CNEA 1CRZA 3DLHA 3AF2A 3G5MA 3PGLA 3J81A 3B3FA 3U3ZA 5B3LA 3A4NA 3QU5A 1U0OC 4URZR 5CFZA 4ON9A 3E22A 1NC1A 3K53A 5FX2A 1WKCA 1RVV1 4GPIB 4TRJA 5AXCA 2QE7D 2JK0A 1Z5GA 3E15A 5T7BA 3ZW7A 3NVKI 1EVYA 2Z04A 1ZJYA 2WJPA 3AF3A 4CM8A 4P7JA 2DXIA 5LMCA 2XQKA 2IYPA 3G1TA 3M1AA 3P19A 4YPOA 4XDZA 1BCSB 5DGCA 3OT4A 4I6JA 3TRJA 1DARA 3LPAA 5ED4A 4HWRA 1QRTA 5TPZA 2AEMA 3ORQA 5AXAA 2FWBA 2ZBVA 4G1VA 3AP3A 3GFOA 4KLNA 4ZK2A 1N9GA 2TMDA 4EHLA 2C0PA 4G67A 1N9ZA 2FN9A 3V8RA 1OGYA 3DFUA 3F7TA 3K0CA 4KRXA 3EULA 1ZBQA 4CWAA 1EVLA 1UM9A 1M34E 5EMJA 4MI1A 2Q3DA 3M6VA 1KZYC 4GU5A 3GQBA 3PJRA 5A2GA 4HYQA 4A3SA 1FFDA 1M6WA 5KU1A 3ZNNA 4ZI7A 2AXPA 2C8JA 4BL5A 3GCZA 4EQ6B 2IYVA 5FCDA 3KSRA 3MS4A 3VR0A 4WZAB 3ZCSA 3EUAA 1M76A 1USVA 4GVLA 2AR9A 2C7GA 3I2HA 4BAGA 1E8NA 1GZ4A 3N0VA 1LNQA 1QVAA 3NAZA 4UXJA 2XQGA 1H66A 8ATCA 2ZUFA 3X1MA 4PZLA 5HS6A 3BJZA 1LKZA 2QUKA 1EM6A 3E7DA 4NJOA 3TQSA 4PYIA 2E82A 3KZ1E 1NSYA 1ZNWA 1Q77A 4V1CB 1SCNE 3VKUA 2IUUA 5JRJA 2P11A 3G7UA 4CTMA 1F2UA 2O1XA 3ESRA 1GKUB 3R7SA 2BZ0A 4IOMA 3O2JA 1Z2EA 1V41E 3KYIB 2JD2A 1RCTE 3SIPA 4DB2A 1J24A 2OB2A 3WLFA 3KQVA 3G9QA 1IRIA 1AV7A 4YJ2A 3T1HB 1Q0UA 3OJEA 2Y4NA 3ROGA 1A98A 3BM5A 4MRAA 4RLFA 3X1XA 4J0DA 4YDRA 3TOCA 4AN0A 4MQMA 2ZJ5A 2Q4TA 3I9MA 4RFLA 4IDQA 1M0TA 2OUKA 1PLKA 1TO6A 4YXWA 1YUBA 3F74A 3W5VA 4UTVA 2BSQA 4HZUB 3BFPA 2UVPB 4I4LA 2FPRA 3I9JA 3PS9A 3VJLA 4NYMQ 4EW6A 3D8BA 4H1WA 4E21A 4RTPA 1JQLB 1V11A 3DMTA 4U2EA 5CW1A 2A78A 4FJ0A 3LUBA 4JLKA 1FS5A 2C5HA 2JAHA 5AVYA 4O02B 5JS2A 3IEMA 2PA3A 3LVFO 1C3JA 1WZNA 3QVOA 1WZIA 1E7MA 3RFVA 4NJMB 3FBWA 1GNSA 3LXMA 5TVKA 4PM4A 1ZISA 2NW6A 4YWJA 1GDDA 1QWOA 3DEHA 4UVHA 1X13A 2PJUA 2AN1A 4MWBA 1NW7A 3L6EA 3OQIA 4OH1A 2ESRA 3JQ9C 4AMZA 3ZCQA 5BMOA 3IOBA 5KZMB 5DLDA 4JFAA 5K4GA 3RC1A 4BOYA 3QQ5A 4JFRA 3D6UA 2ZUWA 2GLXA 1CY4A 1MOQA 2XEDA 1PBTA 2HCFA 4UTZA 4K0RA 4ZOLB 3CX7A 2VAMA 2H4ZA 2GZ3A 2IHZA 2REBA 1HE1C 2IELA 2WM2A 2WJYA 1YR6A 3FPKA 4ZQIA 3W5AA 3BGVA 3AB3A 1F9EA 16PKA 1QV6A 2DUJA 2DUMA 2QX6A 4MB2A 4Q15A 3WDLA 4AK9A 4GC5A 3CC8A 4JN6B 4M86A 1R50A 2CL0X 5KDOA 1B7GO 4IMIB 4E5SA 4G0QA 3CRVA 2XRYA 1E92A 3C4JA 5I3CA 3K9QO 1EZ1A 1Z83A 2OK8A 1FJXA 5F52A 4PLTA 4RYLA 3AF5A 3KV1A 3P2EA 5IX8A 3E61A 1JJBA 3HVIA 1SHZA 4F4CA 1IUNA 2IH2A 1OW3B 1I4TD 5EUCA 1B26A 2WD7B 4LZOA 4S05A 3E1GA 2W4IA 3M5WA 3Q3HA 5CDFA 1MV8A 1MO5A 4IIDA 3LDAA 2OHFA 4JL6A 3UF0A 3DTVD 3HY4A 1R2QA 4J1SA 1LDEA 1SQFA 2DTDA 4FKMA 3SZUA 3E1SA 3THYA 1HEUA 4BQSA 4EJ2A 2F1KA 1ML3A 1V1RA 2Z8YM 3K6KA 1RAAA 1ZMXA 3TRIA 2FQ1A 5MN6A 4HV4A 2P9ZA 2QRLA 2X0NA 2GQ0A 1CRWG 5KX5F 3HXOA 3JVEA 3NRCA 4MUKA 4MWOA 1M2FA 4QYIB 1KDOA 1TCAA 3B48A 3DGFC 4JLUA 1U1GA 1TFRA 5HBGA 1QC5B 1KR2A 1WHSA 4M9CA 3HCWA 5KUTA 3AZPA 2CBGA 4KK4A 2R47A 4L2IB 1N4DA 4BFWA 5KI6A 5E9JA 4Y2XA 1XEAA 3KR0A 1FDOA 5EZ5A 4OYLA 4GL2A 3C6QA 4NCXA 3M1LA 2ATXA 4NONA 3ZI7A 1VRWA 2J45A 1NSTA 2C5EA 3OKPA 2RHTA 3QSGA 1X8KA 1N77A 3N2LA 3BH7A 3D3KA 3TLYA 4XPIB 3TTXA 4KR7A 4DZTA 2A9JA 4XEUA 2Q1WA 3Q6NA 3MYYA 3VX3A 1RKXA 1HH4A 3MBKA 1PR1A 2ZCUA 1CDZA 3KRTA 2Z1DA 3WLRA 2IHVA 2XMCA 4OIFA 4TL6A 4RO0A 3IPXA 3EWIA 5C5CA 3O74A 3QLVA 2ISQA 2PM8A 4AY4A 1G5HA 4S04A 2BHLA 3A4YA 5CH8A 4CEHA 2H06A 4OLBA 3T54A 2VOJA 2OLEA 2V6IA 5GM2A 3RTDA 4B85A 3DH0A 1LWOA 1ZH2A 4LQDA 1K8ZB 1MB2A 3T3IA 1M66A 4DNXA 5J4LA 4F3NA 4M22A 3U6BA 1UC8A 3I01M 2E5FA 3EUFA 4IGKA 4IZHA 4L4ZA 1KEEA 5BR8B 2GPTA 5FTLA 3OQJA 3MWFA 1QRUA 1DPFA 2FQXA 2VH5R 4PWZA 4NZZA 3VAAA 3OQMA 4HEJA 1JIQA 3I8XA 5ITZA 1BN7A 4MKRA 4DB4A 3O90A 1Y0BA 2ZREA 2CV0A 2V4ZA 3IAS6 4YJGB 1I6MA 2EJVA 5JG7A 1D5WA 1Q1GA 1BXGA 2CVOA 4HDQB 1MVOA 5IVDA 3KOMA 3W4KA 4LVNA 3L6BA 3UT0A 1SULA 1COZA 4NVRA 3WRYA 2ZTSA 1MHPA 1JQ5A 1YJAA 3S44A 5JIBA 1YRAA 5C46F 2AVNA 3DAFA 3L4BA 4HLUA 4NPAA 1QF9A 4OMFG 3T4EA 5IF9A 2DH5A 4D8XA 1HDGO 1WU7A 4QT0A 2GLUA 4FDAA 5IBRA 4LJYA 1Z29A 5BQ5A 2P69A 3BF7A 3VPCA 1P5ZB 4ILKA 1RTKA 1EX6A 2ALJA 4GLJA 1L4LA 1FF9A 4L50A 4NZ9A 1ZGZA 3LVQE 2HT1A 1KSJA 1L4HA 4JCCA 4P7BA 1BMTA 1PUIA 2VF7A 1BMDA 4JNCA 1IEXA 1NLYA 4YROA 3QVGB 3ZXXA 2CXSA 2OGUA 3GFRA 2IYUA 1NJGA 1Z6AA 3VR4D 1R4NA 3QBDA 2GA8A 2ZUUA 2FFBA 3LX8A 3EMVA 2EFCB 3R6GA 1QQAA 3QZUA 4DLWA 1Z28A 3STWA 4A82A 3K05A 3O8BA 4ENSA 4Q05A 3RKRA 2P35A 2YUTA 2PVCA 2XE7A 3ADPA 1BKDR 2P3OA 5H4HA 3EPKA 1ZRHA 2DFDA 4GOKA 4MZDA 3U39A 1U8AA 4KOEC 1RKVA 1SZCA 4KGDA 2QQEA 3TYXA 5LD2B 4RF3A 3JQAB 1FX0A 1PGJA 2XAUA 2XSZD 2V97A 3CLUC 3N6XA 4RMJA 5AKHA 1K98A 3R9XB 2GEKA 1CUJA 3K4PA 3IQHX 1UBJS 1TZBA 5CH3A 5DT2A 1UIRA 3W8EA 5I7RA 1LPMA 3FHLA 3S1AA 3FYCA 2ZRHA 3SJBA 3L0PA 1N25A 5BQOA 3WB1A 2XXAB 3MSXA 3QVKA 4C7OA 3I53A 1XKTA 3C3JA 2RGBA 4MYUA 1LUAA 1P2UA 1JZTA 1V1JA 3FE2A 4AAYA 1YU9A 2Q28A 1ESEA 5ALUA 1H8EA 3CNLA 1IHOA 3KUXA 1IUKA 1XUOA 4OLJA 1E1RD 1P31A 4RA6B 3UMFA 1SUEA 2RGWA 3L7CA 4QFDA 1VPVA 3X43A 4D9MA 1AKRA 1XKLA 4NK5A 4O5AA 1X1AA 1KPIA 3DR3A 1FJGB 2YWEA 4TLEA 3SEAA 3R8CA 1NM5A 4XUCA 5ALXA 4F60A 5JJKA 1XO1A 1IIRA 3KJHA 4GYYA 4NOJA 1B3BA 4C0JA 1C3EA 1F2DA 4ZQGA 2WTBA 4RNCA 2V5AA 2GF9A 4AQ7A 5CJPA 4ZARA 1S96A 3S4YA 5CDSA 4TYYA 1K06A 4KYUA 1TYZA 2WAAA 3PV0A 4I9NA 5KCMA 1Z62A 2NG1A 3X44A 3OWHA 3ZDYB 4CHGA 2RGAA 1GDHA 3RVKA 3VC2A 5BWCA 3PHLA 2J6CA 4ARVA 4WZBB 3JPWA 1ISPA 4LY9A 5KVVA 1EZZA 2Q5HA 3KT8A 4DQVA 3LBHA 4M36A 3CRNA 3CVVA 3LOPA 4BJHB 1QYVA 1FBNA 3L0BA 1OKKA 1P0FA 2CDAA 1Z3CA 2NVOA 2Y1LA 3OFNA 4JLSA 5A7HA 4CIXA 2PX4A 4IDAA 3M4ZA 1LBEA 3N0XA 1Y5NA 3P2IA 2GH1A 1OYVA 2P2CA 2EU8A 2DX7A 3KZXA 1GITA 1QX3A 2VDNB 2I8AA 2J3EA 2QY6A 2PCLA 1QTNA 2IIPA 1NN0A 3QNMA 3SYTA 4HEA6 3IBTA 2VKQA 4IHJA 1DAIA 4QNMA 4UHEA 4DLRA 1RWNA 4DDVA 3A4LA 1WDKA 2W22A 3HLTA 4IIJA 5CT4A 3QELA 5JXIA 1YR1A 3DVQX 3H3XA 4JSYA 4GGPA 1HETA 4RJLA 3W6UA 1TF7A 5EWLB 4F6CA 4YMVA 1JLKA 1OMOA 2HZ7A 4MVJA 3RBZA 4AY3A 2NU8B 4DBVO 5HGXA 3EEQA 1BFKA 3IS3A 1N3BA 2VLIA 4PZEA 4C0QC 4PN7A 3GH1A 4P5PA 4RKYA 3G13A 3RT7A 5KYXB 5DM2A 5EL0A 3GCWA 4YPFA 4BB6A 1YJQA 2Z6QA 4PSAA 3W9SA 4YV2A 2WIKA 2C8LA 3CXUA 4FXPA 2GBFA 3IO3A 2FPGB 4RMNA 3WSVA 1N1MA 1QRSA 4LMAA 3RIGA 1G8PA 4JJGA 1PO7A 2OGWA 1HNZB 2HDOA 2AC4A 3JZAA 4RTOA 2ZSIA 3I0NA 1CERA 2VIIA 3WGVA 2P2DA 2YHSA 4EARA 1DBRA 1OXMA 1PQUA 4H7DA 1C0LA 3QJGA 5H9VA 5ALZA 2GHQA 2VRWA 4JR0A 4ZCQA 2UZ4A 3OEWA 2ZUEA 1JLMA 2BFPA 4DEXA 3IIEA 3A8TA 1QCYA 2JIQA 1LBIA 3N2GB 3NIBA 3QMWA 4KVZA 4X3OA 3ZC3A 4YPVA 2VK1A 4Y9DA 1WNFA 1N8KA 1XTKA 4DMCA 4F8JA 2YNMD 5AI5A 3ZHVA 4DDKA 4DE5A 2QW8A 4FQ8A 4WINA 5A04A 3ZU4A 1P7PA 3LECA 1NBMD 4YAKA 1MN6A 1NIJA 2WRZA 3V33A 2Z57A 2Z9DA 5FBHA 1EP2B 1U7PA 2YMMA 3OVMA 4S1NA 1QCZA 2WAXA 3H3FA 3MT7A 2OXFA 1J09A 1L5HB 4R83A 2VHXA 2A86A 3TX6A 4EVSA 2OGTA 1JT9A 2PZLA 2AF3C 5EIWA 5TXGA 4DC0A 1HURA 3W8NA 1SZPA 3ZWVA 5ALKA 2PBFA 1M0WA 3CXRA 3I83A 3KO8A 2B4AA 1V2HE 3BCRA 1NE7A 4S1PA 2I8LA 2HWWA 4EHBA 5DM70 3TM5A 2DP4E 3X1WA 4KO2S 4CU5A 1NIPA 1MORA 2Z5GA 3O4JA 5C8ZA 1VDMA 1T5TA 5TQ0B 3VTFA 4CKCB 2PO5A 1PK7A 1YAJA 2YIVX 4NFSA 5DYTA 4V38A 2XYHA 2O6HA 1J1UA 1KJYA 2B7CA 3E3NA 3ZGVA 3A1UA 4I55A 4XX0A 4NE7A 3WXMA 4DV3B 1RLMA 4LNHA 4ASUA 3BZUA 2PMEA 2CXHA 2PUEA 4HSEA 4JUBA 4F2HA 2WKRA 4K9NA 3MJRA 1LPSA 2HPVA 1A1SA 2XYVA 3HZHA 4RFVA 5EJ4A 2PRKA 5ALQA 2AYZA 4WCFA 1JF8A 3D7RA 3TCXB 5DWQA 3AVWA 4YMTA 3ST7A 2HRZA 1UMCA 1M2VA 1U7TA 2BFCA 2JA2A 1LXCA 2IYZA 2VA8A 4Y6OA 5EQFA 3KBOA 4EFMA 3FFAA 2A0XA 4HNQA 6ABPA 3U40A 3H4MA 2QTHA 2B2XA 4EO4A 1BHQ1 3WJAA 2X5KO 4UCWA 5TRTA 1PR0A 4FW9A 3RF7A 1SD2A 4NYMR 4O6VA 2EJTA 4B8WA 2E1PA 1C3OA 3AUSA 1JSXA 1G4HA 1KJ9A 4MR9B 1S2NA 4QUAA 4S24A 5BP7A 4AS1A 3CF0A 2ZE5A 1VIDA 4CM9D 3QE4A 4YJ3A 1B43A 4OAQA 4X71A 3ZIUA 4HKTA 1VJ1A 2V9PA 2O3QA 5ALEA 4HRVA 4EJFA 1T5SA 2MCFA 3QUSA 4P4GA 1RCFA 1TM1E 3DKPA 2ID9A 3FYSA 1DIAA 3HB7A 5JJBA 1E99A 1Q83A 2OKCA 4H0CA 1UDAA 4AUNA 2ZVQX 3EIWA 1OZGA 1BA2A 1TMOA 2QWXA 4MWSA 1NBHA 5CFLA 1F5NA 2WWRA 1UDBA 5DHQA 4CEIA 4JP5A 3DZDA 2PZ8A 4RTQA 4ZQHA 1E9RA 3A2MA 3PWSA 3NV7A 2HLDA 2YFHA 2HCJB 3CNNA 1J9GA 1ZMRA 1EP9A 2QVYX 4LJSA 4LISA 2LKCA 4NOMA 4XTRA 5DIFA 3FTEA 4ETMA 1M2KA 2XUQA 5JW6A 3ZNPA 2H54A 2JIZA 3H6GA 3OT1A 1MABA 2WTNA 1M2NA 4KH1A 1JFFB 1EFRA 3FYHA 1ZOLA 4YFVA 3RWBA 4N9WA 3UUEA 3F9IA 2R8RA 1DDOA 4BNMA 1G42A 1DQRA 5ECWA 2FSUA 3VSBA 2IOYA 1M7HA 3GFPA 3I76A 1G8GA 3SNHA 1OBHA 1U65A 3TZLA 3B6KA 4NZPA 3LDHA 3LNTA 3WYEA 4BZQA 5IK2D 1C8LA 1LJUA 2ZIVB 5ICEA 2WWFA 1LLFA 2FPWA 2IYXA 3O7WA 3ROXA 4BGUA 1DO0A 1F2VA 1PLLA 3I8SA 5DM60 5BPHA 5I7HA 3MT9A 1II9A 3NHAA 4MQFB 1OROA 2BHRA 5HM6A 3T1TA 4RL4A 3RJMA 3OE4A 3QP9A 4YUAA 3DZBA 4WJLA 3LU1A 4X94A 2PSJA 1JAZA 2GPNA 5G1OA 2JJ1A 3Q6IA 4RPGA 1WY5A 3R24A 3SKVA 4GWLA 3OCZA 4FLMA 4ZIRA 4AY2A 2F1OA 1V7QA 3NVMB 3QA3E 4G1BA 4TWZA 3VTZA 4DS3A 3LDFA 3C5VA 4BASA 3R3HA 1OU4A 2EBHX 3H2IA 1WO8A 1L7PA 4PNHA 3FHJA 1E5QA 4AJHA 1WB6A 4KQJA 1Z9BA 2Q21A 1FDIA 4IV8A 5CCEA 4DA8A 1XCOA 2I6UA 4GX2A 3BCHA 1T8PA 1A9TA 4O33A 4KE8A 5LP1A 2XQFA 3F9CA 3VC7A 2H4FA 2QN2A 2FRXA 3DV9A 3U9LA 2YOGA 5DBGA 2JI4A 3WKDA 4BFUA 3U44A 5DNVA 3NIFB 4IV0A 3TLXA 4TVBA 4O4JA 1W581 2EHDA 4KP7A 4US2R 5KQLA 4XOIA 3AV0B 3KVOA 5E6SB 3AXSA 1QF6A 3AC0A 3FH0A 4H7PA 1QHHB 1P1JA 1NTOA 3KWLA 3EA4A 4PYRA 4TKZA 3FWPA 3UK7A 1A5AB 3KQUA 2FSVA 4D9HA 4J49A 2FX3A 4B7UA 3HA7A 1P18A 1DJLA 1E1YA 1QK5A 3U60B 3CLTC 2R44A 1DQYA 5J4KA 2AOXA 2VDVE 3GLFE 1YIDA 4ARIA 1ESMA 3G7NA 3WJ7A 1V45E 3G5TA 1AA9A 1AE1A 4TXNA 3KSBC 4BKMA 2UZ3A 2BEVA 4WN3A 4H35A 4E70A 2J32A 2QROA 4W1PA 1SUBA 1X15A 3H5IA 4RGYA 5JAQA 5F2OA 1HE4A 1K7XB 3M6MD 3E1KA 4Q00A 1N2ZA 1NL3A 1V6SA 3HCPA 4CR6A 1WCIB 2WHYA 3OBBA 1W1WA 4N65A 5EJMA 4TKVB 1CQXA 3P52A 1ICEA 4PYLA 4X8MA 1EFDN 5DHTA 1CSEE 1E3TA 1J4AA 3BL5A 1TE2A 2GBIA 3I2YX 3OHSX 4JEMA 1WB4A 4WH0A 2WKPA 1TTTA 5JY1A 2WWXA 2ZLBA 4RSRA 1L4MA 1U0BB 4EG7A 4FMDF 2HWKA 3GT3A 3WSTA 4CTOA 2J9YB 1P1IA 1QFYA 4MS3A 2ZAIA 1P3DA 3VVMA 4CN8A 2H2HA 1JDSA 3JSXA 3EZYA 1NUAA 1ZCFA 4N3AA 3WWEA 2JLXA 1O95C 5E3JA 1GD1O 4WFKA 1Y3BE 2W37A 4Q9IA 4YO7A 5DSZA 5C3MA 4P92A 2ET6A 3SZMA 2AXQA 4INOA 5F3RA 2DPXA 4TV9A 2P9GA 5IBCA 3IPLA 2MR5A 2OQVA 3U1BA 4F3TA 1NZFA 2X6RA 4UHHA 3REGA 1NXPA 2Y2VA 3ZYZA 3QLUC 3D5EA 3MTBA 3A2KA 1AKWA 4R7TA 5KHLB 2ZYRA 4IHKA 5GVSA 3LYAA 2EL9A 2OD2A 2OXRA 1JSZA 3E22B 2PVSA 3TNLA 4P4LA 4ZK6A 3AKDA 1B8NA 3NX4A 1KMIY 1D5CA 4C3VA 1IJKA 3V2IA 5ARDA 4CM8B 4JEUA 3Q98A 1WU8A 2Y6VA 3ORRA 5B1HA 2FOXA 1PQPA 4G36A 3UJHA 1QQBA 1KAGA 3BZWA 1KGDA 3MLBA 2QYOA 4YRMA 5JWOA 3DF7A 5A1TA 2RH4A 3W3AD 1SUWA 2NO6A 1NVKA 4GRAA 1Y8AA 1TK3A 5GONA 1Z33A 2GEDA 1RHUA 3EASA 3OM0A 1NVEA 2BR5A 4O1IA 5AKKA 4LE2A 4XWKA 2BDUA 3U5TA 2GLTA 3CX4A 1UM9B 3QK7A 3U7FB 3NQ41 2AJCA 3RU7A 1IU9A 2BKVA 3GQBB 4HEQA 5FAXA 1GFIA 1K8YB 2YOHA 4FZJA 1JGTA 4NZNA 4B3BA 3DTTA 5ITSA 1XU7A 3DD5A 1ENZA 4OK5A 3DM9B 3RJ9A 4ZI7B 1E3IA 1GG9A 2QRHA 3EZXA 5FBRB 3Q7TA 4QOEA 4YYEA 4DLNA 2Z43A 3GU3A 3UC9A 1T2CA 3HYSA 4KQEA 1Y34E 3C24A 5E6UA 1ZITA 4P0QB 1P2VA 4LOLA 5BNZA 4LC1A 4PYMA 2YV2A 3B1KA 1DKUA 2JAOA 4CIDA 1PZMA 5C8YF 3DKKA 2HR1A 3SD7A 4C9BA 1HOTA 3RUEA 4QARA 1P19A 1YRWA 3GWZA 3IALA 2Y92A 4PICA 4NAVA 4YAFA 1P29A 1FFYA 4FYKA 2C03A 1UC5B 4IJMA 4QXPA 4AXBA 4E32A 1XKXA 2PKWA 2YASA 4DWJA 1RXWA 4KHZA 3W77A 3G8CA 3I2IA 4BLVA 2CSUA 5JAMA 1F2UB 1Y3AA 4DEYA 2X8LA 4BLRA 3Q5EA 4Y2YA 4WLOA 1RWMA 5K3FA 1I51A 1WEHA 1P2GA 2A5FA 3GYBA 4FZRA 1C7RA 4IHAA 4UBJA 4ZMRA 4I36A 3D81A 1GGMA 1NVVQ 2I2DA 4JVMA 4YJ2B 1CT9A 3RRBA 2FEWB 2Q5CA 2QSUA 3HS3A 1FRNA 2E9SA 2H4HA 4QIHA 3ESZA 1VKHA 2ZGVA 2VEOA 2C4KA 3DMFA 4N6GA 5MFPA 4BKOA 3UTCA 4WZAE 2E4VA 4HPXB 3PUKA 4QODA 1VLJA 2EJWA 1Q0PA 3IP9A 3TZQA 3A1FA 1IEQA 3FWHA 3GEHA 3G85A 3HBAA 1CNMA 3PEEA 3IOCA 4TT3A 2CB0A 3RM3A 2FW9A 4D02A 4YT8A 3CVYA 1A5TA 3ZXIA 1V11B 1Z34A 2RGYA 4CV3A 1W44A 4Q19A 2GDJA 5A6SB 1ZR2A 4LFAB 4H77A 4OREX 1NW3A 1DVRA 2ORIA 3Q4GA 3BE8A 3V8QA 1E9FA 4LGVA 2GPJA 1CEXA 1C7EA 2ZUBA 4RFSA 4P08A 1JDUA 3KR1A 1R8SA 3WZLA 4CMGA 2FU5C 2I2BA 4WSOA 5F7ZA 1LRLA 4LWQA 8ABPA 3GQVA 1W0CA 4XFJA 4CM7A 3LFHA 1ST2A 3RROA 1H2HA 1YZQA 2A1TR 2L42A 2P0EA 1VHTA 5KWSA 1FFWA 1G5FA 3P1JA 3OQIB 2QK4A 1MCZA 4NDNE 1CXZA 4TXMA 4L22A 2V6MA 4G84A 5C8DA 4RBNA 4ZDKA 1Q0SA 2E3JA 3ISJA 4RWEA 3RRYA 2O2GA 2FFAA 1YDHA 2ZIZA 5C7IO 1UAAA 4PW0A 2WYHA 2JIBA 3RO7A 3B53X 4EY8A 3QI2A 4GAEA 4TS9A 1LSOA 1Q95A 2QV0A 4KXLA 3V2UA 1X1QA 1YB2A 4HS9A 1OFHA 2QORA 2WUEA 3COSA 4BWFB 4D81A 2NSDA 1CZLA 2OV1A 4MPTA 3LK7A 4WD3A 4XXHA 4QUGA 3V7UA 5HHTA 2GA9A 2XA1A 3L43A 4TTVA 3D3NA 1GU1A 3CUKA 1D4ZA 1Z68A 3G79A 5LCXA 3AEKA 4UMFA 5AM0A 1WRBA 1U63A 4W5OA 3TM4A 4YRCA 4OHCA 1JQBA 1G18A 4KWTA 3AJ8A 3RAGA 4E5KA 4F2PA 5F73A 5KS2A 3RK0A 1NBME 1XZIA 1HDOA 3AMVA 1YHNA 3JWHA 4CCYA 3DEJA 5CK4A 3KZKA 4U3JA 1MPTA 3UHPA 4B33A 3G8DA 4NBLA 1QOPB 4BV9A 2H7XA 2CUKA 3SNKA 2ZFUA 1I0ZA 2GN2A 2ACWA 1BNCA 1TQHA 2HADA 3W5IA 4PYNA 1X3SA 4NU8X 1XI2A 2Q4EA 1O9HA 3B3QA 5EPUA 3VSCA 1IOZA 1EH5A 2B4YA 3C1UA 4PYQA 2BGIA 1IHUA 1TEXA 5J1TB 4O4IF 1M0EA 1TF2A 1KARA 1KIMA 1NVGA 1BD3A 2UZ0A 2W2XA 3O1IC 4L6IA 4CCWA 2QAGC 4EATA 1BDHA 3DKRA 2NN3C 1WXIA 5IJAA 3THYB 4MUGA 2B4TO 3G8YA 4M0CA 3VR5A 1ZK3A 4I4IA 1V1RB 1KBQA 2JB9A 4CW7A 3IA2A 5GVRA 4A1FA 3SFZA 1LDBA 2JFNA 5AVKA 1XWIA 3WC4A 4FN5A 3TGWA 1GRRA 4Z1MD 1ECBA 1E1MA 1O9BA 1QYRA 1R7RA 2HBRA 3ZQ6A 5F21A 1WHSB 5LQNA 3I62A 1BRTA 4EKYA 4LJ8A 4F2DA 1GCGA 1R9NA 1T2UA 1X74A 2PGLA 4F38A 3KKZA 3QEMA 1H23A 1O57A 2I7CA 2FR0A 1CQPA 3EN0A 4MUIA 3SJUA 3GLIA 2JLUA 2O8CB 3LMKA 2P6UA 3N2EA 1LV7A 1T26A 3G2QA 5K3BA 5DGHA 1JL3A 1TKAA 3N58A 1U8YA 1AK1A 4BB9A 3CPHA 1ZPDA 4N5HX 2EJBA 1IXYA 3C6KA 1OAKA 1LDMA 4D0GA 3AEUA 1DC7A 2IUFA 3N87A 5CT9A 5FTNA 4D4IA 4G0YA 2DEUA 3HO8A 2BGGA 2I66A 1GL7A 2WWGA 3FZGA 2VSQA 1PL7A 3KQSA 4JYMA 5HEKA 3WWCA 1KF0A 2DFTA 4D0RA 3QNWA 2NZYA 4YDQA 4Y2UA 1N7IA 1RM0A 5DNEA 2IPAB 1ECFA 2IZ7A 2X5OA 2JJYA 3LWBA 2HOQA 1M83A 4QJIA 4R9UC 4E33A 1XD2A 1XLTC 2CFOA 2HF9A 1AZSC 4CEHB 3RK4A 1CVIA 2VS1A 3KSMA 1XXHE 1A5SB 4RVDA 2QM0A 3PNLA 2GCGA 2W6JA 5C3UA 3KUDA 5KSOA 4RIIA 4I14A 4AJ4A 2EW2A 1KEEB 2GBLC 4MUXA 1V37A 5LP6A 2P41A 3KCQA 2E1RA 2I78A 4LJ7A 2H17A 5CVVA 4B4VA 1PUJA 4LZAA 4ALJA 2FFRA 1FUYB 1Q12A 3C8HA 4GQAA 5ITZB 2O48X 1UZLA 3GJ8A 4GZ3A 2X0FA 4EL0A 5BXYA 1Z22A 5JCJA 3UCFA 3CZPA 1N0IA 3WK4A 2GJ9A 4MIOA 4HBGA 1BXGB 4PX9A 2O2JA 5DGDA 2O57A 3PU6A 2H1IA 4WJKB 4DDWA 1QPGA 5HBRA 2QMQA 5HKKA 1CY2A 3V8PA 2MTBA 3ZZ1A 2HT6A 1VIMA 1DQNA 3NP7A 3U6KA 1FTQA 2QMUA 3K09C 1W5BA 4P22A 2R0QC 1PX2A 2LBPA 1ZNQO 2X14A 4O4HF 3JW8A 5KQRA 1L9XA 2YXBA 3FOZA 3ZU5A 1WTAA 2PZKA 3DT8A 1YS4A 3B5IA 4RD4A 3LQ2A 1IXZA 4NTZA 3RU3A 3FTPA 4AD8A 3FVWA 1R4NB 4EEKA 1E2GA 1D9XA 3FFBA 3UPUA 2P6RA 5LM3A 1X3LA 3KVNA 3ZWQA 3GDHA 2GZDA 5DHAA 1S2DA 2I4LA 1OWOA 3SC3A 4C01A 2JZNA 3FHCB 1RYNA 5ALOA 4MAMA 4PV7A 1ZX1A 3ME5A 1BD4A 3NGMA 2XQJA 3I1YA 4QFMA 3PX7A 3HCCA 3QF4A 4ZOEA 1UBSB 1P6XA 1FX0B 4LXTA 1SRRA 2LR0A 3OU2A 1IJBA 4Z86A 5I9TA 3V4FA 3C1TA 4TSKA 5HS4A 1KY4A 3R74A 3AVTA 1XRLA 1CEQA 3S1AB 4YAIA 1W2WB 3SK0A 1HDRA 3LC1O 4C7OB 1IQ0A 1GZSA 1I4DD 1GV0A 2BRUC 3EGXA 2GXQA 1P5HA 4L4SA 3TDMA 3X1JA 4AI6A 1QBKC 4P3NA 3GUUA 2J4FA 1HK7A 4Z9FA 4UHCA 4F5DA 4EMSA 4M8LA 3ABRB 3CBGA 4YQFA 4K1XA 2CLFB 2CYBA 4FZ5A 4ZOAA 3U4AA 3ODGA 4O29A 4DR7B 3E03A 4JB3A 4X62B 1MRNA 4F4IA 3DZGA 3NBKA 4Z49A 2FPMA 1VCOA 2X8WA 4LPSA 4QAQA 4WOPA 5CNMA 4K9RA 1FVFA 1ZGGA 4IJ5A 1FYXA 3PRHA 4EB3A 4JEHA 2FYTA 1Q2UA 4DJ5X 1UF9A 4I99A 3UY4A 4YRKA 4KPGA 4P84A 2ZZKA 1QP4A 1M2EA 3L6RA 4GR9A 5GV8A 1UZMA 3Q8WA 2ZS8A 3E9EA 1MT0A 1JA9A 3TQRA 2PZAA 3JQEA 3M6FA 5K0BA 1A5ZA 1LF5A 5JS6A 3K9GA 4RTNA 3HKEA 3V4PB 1KK1A 3ZE1B 5MGBA 3DE4X 1F8XA 2PLFA 4FHEA 3WYAA 4B2PA 2QAJA 3S1LA 4QTTB 3Q11A 4E5VA 2FDRA 1L6IA 2GAFA 1NYLA 5JQGA 4CMJA 3S27A 4KO1S 1DWPA 3ANSA 3BOSA 4RL6A 5B58T 4N5IX 3WIVA 3C6BA 1CUCA 2OHJA 4Q7QA 4IIJB 5GZ1A 3QELB 1QYWA 2J9GA 2GPBA 4NBTA 4BX9A 3U3XA 5I47A 5JALA 3EG5A 3QFRA 1L4BA 1VBNA 5DEOA 3TEJA 1E1KA 3DKVA 3NDBB 4GI3A 3TIFA 3ZWOA 3FWKA 4OJKA 3WL8A 1D2NA 3QPWA 3JQ6A 1W0JD 3NWOA 2E4AA 2EW1A 5H3HA 4RTLA 5BURA 3OJXA 2G25A 4EF5A 1YS7A 2IOHA 4R1SA 3WX0A 2RKWA 1FQOA 3D2CA 4RZQA 5EZ6B 1SXJD 1F12A 1L1EA 4EJMA 3T8YA 4B6SA 3HABA 2PS9A 3RASA 3AH8A 1QJCA 2W6CX 5CIWA 4ZCMA 4OAPA 4EG6A 4B6FA 3GZNA 1SHUX 4DMLA 1NG9A 1ZIYA 4CKZA 3GPLA 2D1TA 3K70B 2VHEA 1CEEA 3GNTA 4Z9AA 1VJ5A 3VSEA 3UXMA 2R5WA 4DV4B 4C3OB 1Q11A 4NNOA 5JJIA 2V6FA 1V4NA 3KKOA 4Q1CA 5EE1A 5KTMA 2QVCA 4N18A 5K3SA 3M34A 2BI7A 2N9UA 2WQZA 3MGGA 1EK6A 1R5JA 4UBMA 2X8AA 4TQGA 3ZGLA 3ZHUA 5BR7A 3N3AC 2NUPA 3E70C 3B2EA 4RZ2A 4OQ4A 5IARA 3K9FC 1F7UA 1UFOA 3FMGA 3JCZA 4GLLA 1DZIA 2YWDA 3NASA 5MF6A 5EP2A 2V3WA 4QFBA 2QXYA 4W5JA 4F5YA 5L3VA 2ZT5A 2UU9B 1AA6A 4Z4QA 4LDZA 2RCYA 4L27A 3ZDXB 1MDBA 2AOWA 4EA9A 4URHA 4BO0A 3RUPA 2BHNA 4K6KA 1THMA 3N8NA 4XAQA 1NQAO 5CMLA 3LP8A 4IQ8A 4L85A 1U1EA 1Y4UA 3WGKA 1KETA 1XQVA 4BZWA 5K0GA 4I55B 4KQ2A 4XX0B 3QGMA 4PCVA 4RWZA 2A5GA 2QZ9A 2IH5A 4OXQA 4PG4A 3LUPA 2CDBA 4DSUA 4J16C 5SZJA 3AUKA 4JBHA 1NVVR 5IJXA 2AN9A 3HPRA 1JPNA 4J1TA 5KJ1A 5A4FS 2HCRA 2QGZA 2Q41A 3GLTA 3D2AA 1RI4A 1T8WA 2WT4A 4HS4A 4HX2A 4PSCA 4WCFB 4WUVA 3V1YA 1U99A 5HRAA 4K9QA 2DERA 1SWWA 3BDIA 4IICA 5DIZA 3B85A 1OH7A 3A7EA 1M2VB 1TJ5A 2BFCB 3RC9A 1EUYA 3ONVA 2O2ZA 1WXGA 3NOOA 2V1XA 4RSGA 1HFWA 1ONOA 3NFYA 4ZICA 1YRBA 1XFAA 2LDBA 2PGIA 2HQ1A 4M0MA 2C3OA 2TMKA 5AJXA 2FTKE 2UV8A 4U0JA 3A0RB 4PGFA 3VR2D 5A9SA 4PLHA 1B93A 2ISCA 1C3OB 2JLQA 2E4ZA 2FLKA 5EG5A 1G291 1XL0A 1XVUA 1ZYUA 1SVKA 1Z4QA 3HR7A 2VHCA 5A7GA 4RJJA 3PFBA 4YJ3B 3GAZA 1VE3A 4U63A 1YACA 3T7IA 2ZRCA 2YY7A 2DB3A 3IKLA 5KTSA 4ZU3A 2XV1A 4BZZA 3EIHA 1AHHA 4RD1A 1OHHD 5P8WA 2PCJA 2VHWA 2HJ9A 1KP2A 1NQXA 3COVA 4OGGA 1C8BA 2PXAA 3U4IA 1L8XA 4MV0A 5CUQA 5FD8A 2XVYA 3I4CA 4MR7A 5H16A 3VZDA 4TXHA 7AT1A 2JCVA 4RTSA 2CB9A 1KO8A 4V0ME 1JBKA 3GRCA 1IY9A 4CEIB 1MIOA 1C9JA 2GOYA 2EWWA 4B4WA 1SIOA 2J30A 5AVZA 4GX5A 3QF7A 4OYYA 4WESA 4H7FA 3ZDQA 3W5BA 1H5UA 3LY8A 4B71A 1QQ6A 4HQ6A 4D41A 2J7PD 3OT1B 4Z7QB 1MABB 1KK0A 1R64A 4UNSA 5BSKA 4MUNA 2QTBA 3QBEA 1TAHA 3VHXA 2QL7A 3L0SA 3V48A 4DLTA 4KMMA 3C16C 1WEKA 3CIOA 2R97A 3G0OA 3BZBA 5IWAB 4JJ8A 1AQNA 4YJHA 5JDIC 1YDFA 1XN4A 1Y4SA 2IHKA 4UHDA 1L5FA 3LUGA 3OWXA 4Z3DA 4D98A 5B12A 5CJJA 4Q3AA 3HTXA 3PNVA 1GQ2A 4HHEA 4P34A 4G0XA 3RNLA 2L82A 3H2JA 4OLAA 4K6CA 2RBEA 3HSYA 3WIEA 1ZOSA 4FYYA 4DUGD 4W5HA 5AM2A 5EIXA 4M9XA 4RF2A 1HMYA 4ZIRB 1A3CA 4Q9DA 1RLIA 3PXCX 3K1ZA 2W90A 4MW4A 2VF5X 3AG5A 3T4XA 2HK8A 3U26A 4E2WA 2NSYA 4JJ6A 4W1RA 3KUUA 4FI3C 4X7PA 3CZ9A 2QXUA 2ZAYA 2P7HA 2OV6A 4H0NA 2FWMX 3SI7A 4W5QA 5CTAA 4XQ0A 3AVPA 3DB1A 3JQ8A 3JD1A 5JSYA 1DADA 1FNDA 3FNHA 5K0LA 3U44B 3AERA 3JPYA 3FVVA 3L9WA 3S8YA 4FILA 4O2LA 4O4JB 1NHWA 4EAAA 2J9XB 4RJ2A 4D74A 2ONYA 2ZSEA 4YRTA 1KK2A 3MIIA 4KQCA 3OJCA 1QMPA 3QUTA 4UM5A 3T1VA 1M1XB 3UYLA 2WVHA 3GPDG 2XNDD 3P0EA 3FF4A 4CLRA 3D6TB 2O0HA 5K0CA 1NMXA 1PVVA 2J8ZA 3SZGA 3FCXA 5CBKA 1KQGA 4JQCA 2Y1FA 4ZAYA 3L7DA 3REQA 4FGKA 2P9QA 1GU7A 1BTOA 2IP4A 4WLVA 4KI0A 1PTJA 1P62B 2BELA 1X7HA 2ZPTX 3H19A 1S8FA 4P82A 1PNTA 4MV3A 4CG2A 4JWKA 2KYRA 1MQAA 2GD2A 4K5QA 5AQEA 1OBCA 3QUAA 4ZU1X 4AX8A 4N6NA 3HI6A 3SX4A 4DVJA 4AQDA 5C81A 2G76A 3GOQA 4KRGA 3CA8A 2OM2A 2W6IA 2JHAA 3OQNA 2RGXA 3PPXA 5DYNA 4Z6KA 3IKMB 2QD1A 1OXVA 1C50A 4AJEA 4C6TA 5CH5A 2J6HA 3H05A 3MBOA 4MS3B 3ZWPA 4IDCA 1CBUA 2ODNA 3HXKA 1F2TB 2AG0A 1V8ZA 3K1YA 5ALRA 3AUTA 4A8JC 1O87A 1WOYA 1HFKA 1CF2O 5BYJA 2HHHB 4TMTA 3RAEC 2DAPA 3H4VA 2LUOA 4O2RA 2WSSD 2IDZA 3BFKA 3GGSA 3IEKA 1EVEA 2AYYA 3BGIA 4J2OA 1RRPA 5KJ6A 4RLSA 2ZULA 4IJKA 3IMEA 1LPAB 2XZPA 3GPBA 2RDMA 4TV9B 3IAAA 1AUVA 1ECLA 4HRXA 5IFLA 4U9IS 4DTIA 4QM7A 1ZINA 3OPMA 3LCUA 5AH0A 5T4FA 4JJKA 1WMFA 4TM7A 4FBGA 5FTKA 3OEHA 2YH2A 3NH9A 2VA9A 1I6KA 3DV2A 2HF7A 3J7TA 4BMCA 3IV9A 3LY7A 3WIBA 5BN3A 2FVYA 2IP1A 1WV0A 1SKBA 1B1AA 1CG6A 2CLMB 2P91A 2WU4A 2L69A 1DBIA 1QONA 1T25A 1AXEA 2FZCA 2RI6A 1OYOA 1C7IA 2CUZA 1YHYA 2NO1A 3TD2A 4ZYYA 3IKTA 3NUZA 5EIHA 4TV8F 1DOHA 1XQXA 4XUEA 5GONB 4WKBA 3F78A 4QU8A 3ROZA 1OXXK 3TZEA 4DHEA 4DQLA 3NVDA 5CVUA 2YVKA 1FMLA 1W4BA 3QVWA 4X41A 1PWHA 3IQFA 2YZNA 1AKMA 2WPDA 3QITA 4J94A 4XB2A 1XMOB 3BJEA 1Z0AA 4EO7A 4LWOA 1VZ2A 1SR8A 5TGDA 4PRZA 4TLCA 5G1PA 1PX0A 4HMQA 1E1QA 3O1LA 3UGJA 3IEXA 2QN6A 1H3NA 4CF6A 5EHGA 2R2AA 1AUQA 1VIYA 4UMDA 3ZQ4A 4IEEA 4JB8A 5E6UB 3L1KA 1XU9A 4QEKA 5ERYA 2OYCA 5HNKA 3O8RA 2B35A 3UUFA 3BIXA 4F5EA 2FP3A 3GDGA 5ALSA 5KWIA 4E1VA 4LOJA 4B4KA 3TJMA 2AHOA 4ZAWA 1I6LA 4AROA 1FNMA 3LTEA 3H9UA 1QHSA 4GNKA 3HCDA 4N49A 5D1NA 3NBZC 2NO0A 2FPUA 1B8PA 2COEA 4OBEA 3K9LA 4RACA 1ECJA 1SXIA 3Q8KA 3I9V1 5FLKA 4MQ4A 1ICIA 1KBOA 1PJ4A 1CRQA 1Q3TA 2C4WA 2OECA 4HUJA 4RYDA 4J03A 4WK0B 3GPCA 3WLMA 4Q3OA 2W83A 5A62A 2WBLC 1RRFA 2ZW9A 3E8MA 1I9CA 2OY0A 2V5UA 3CEHA 3NEJA 3OTGA 4L5CA 5K3FB 4MLPA 1MGPA 1EDEA 2RK3A 4JOBA 1PHPA 4MRPA 5AI9A 3OA2A 3GRFA 1GLVA 4QXRA 1QHXA 4IUBS 1BS9A 2SCUA 1SWVA 2IX9A 3MGAA 4FX2A 1EFLA 2O0MA 2W00A 3TEMA 4BO2A 1GPJA 4V0OA 2OXCA 3ZGYA 4UREA 1EWRA 2WIFA 1T3TA 5FOTA 1E9EA 1J0AA 2Z3ZA 3A4VA 2QUZA 1ZUD1 1KDRA 3HG7A 3TQTA 1D2HA 3ZWNA 1XZGA 1GQQA 3A1NA 3CZ5A 1RVDA 2NPIA 4M7RA 3P9KA 1W85A 4L28A 2NPFA 5J23A 1ESCA 1Q7BA 2XBLA 1I10A 1XTJA 1KQNA 1DBPA 3PI6A 4F96A 1BWQA 4A1OA 5I48A 4YCNA 2GAOA 2JASA 2V7WA 4RFSB 3UMCA 4KE9A 1YJ8A 1IIBA 3AG6A 1RQGA 3CEMA 6PFKA 3EPRA 4QA9A 4BMPB 3PTAA 3JZMA 3SAJA 3VR4H 1S3SA 3JQDA 3N7AA 2HMUA 3LPCA 2W8BB 2WTUA 1GKIA 4B3IA 2ZUDA 4FP9A 4PYOA 2FSGA 4TQAA 1XTVA 3L1HA 1KYIA 3USZA 2XKJE 4BQIA 1BE0A 4YHBA 3PI7A 1JHXA 2AOTA 4KH0A 3VKVA 2NTVA 1JEAA 1N5OX 4DIKA 4XQCA 2BTEA 1E64A 2BDEA 1PGQA 1SM4A 4X65B 2VXCA 3FOWA 3JATB 2ODWA 5KQPA 4EJSA 2X40A 3GAFA 4G24A 2Y0BA 2C2HA 4TWIA 1GYPA 3GIDA 4II2A 5JRDS 5CRIA 1GPDG 4WQMA 1MB0A 2BSAA 3E81A 1HDYA 3O3OB 1C1DA 1U0NA 5C31A 4EELA 1GPNA 2IPOA 1RYEA 2F55A 3VVBA 3AEKB 3I32A 3ANYB 3C41J 1A9QA 1D9ZA 1ZK0A 1SBCA 1G2OA 4JQOA 3WMWA 3IURA 2J3KA 3Q72A 3TKLA 5K51A 4CCYB 2I3DA 1FEZA 3OM1A 2BI8A 3Q0EA 4NKRA 4U3JB 3MF4A 2A0UA 2XTNA 1RLUA 3O1HB 1BVYF 1CLUA 3OFKA 4K3UA 4Y6RA 5J2UF 2HRBA 5BOSA 2KM1A 4BV2A 3OMXA 4G86A 1T1RA 3CLSC 5ES3A 2AKEA 5F5XA 4IDOA 3SY8A 3EVFA 3R3JA 2J48A 1JIJA 1YBAA 2MIIA 2WJ6A 2G67A 1ZONA 3QW2A 4GECA 4WEOA 3RVOA 1SQ6A 1RABA 2FPIB 4PYKA 4BO1A 4CR8A 2D7DA 4P3YA 5HF9A 5L51A 2RGRA 3CURA 1M2WA 2GBGA 4YA6A 4MI3A 1KFBB 5M04A 4MB0A 2I7TA 2Z0MA 2QNBA 2EZTA 4HWOA 1V4BA 3H9CA 4IKEA 3ZWWA 3WGJA 1U3TA 1F1JA 4OQYA 5HCUA 4YWHA 1GYRA 2FJPA 3SEFA 1EE9A 4JJEA 4EABA 1A82A 5CFOA 3GZTB 8GPBA 2AFIA 3WMFA 1LU9A 1HFEL 1SCKA 1WS6A 3KWJA 5CLHA 4HN2A 4JXZA 1O95A 3CNQS 1EFPA 4EL5A 2YYSA 2VJOA 3QE2A 5KYWA 1UC9A 4GG1A 1FDUA 3L5OA 3ZHTA 1E18A 3GK3A 4TWAA 3X3HA 1NXVA 3F3MA 3QEMB 3ZDCA 4CE6A 3TAXA 4C4OA 4AP6A 4HEHA 4HGZA 4UARA 1KFEB 1QHEA 3ILVA 2G17A 5HOQA 4HDAA 1DKMA 3FVQA 5B3KA 3G8AA 4YAUA 3GLRA 3O2QB 4M9SA 2G06A 3AONB 5JCPA 3DUFA 4FQ5A 2QN8A 3VGPA 2BKLA 3AEUB 3HYNA 4PINA 5CDFE 3LDGA 2ID8A 3BMXA 4YCAA 3WRWA 1Q7GA 3NYIA 2F8LA 2P7IA 2IYTA 3MLAA 3EAFA 3K2EA 3VHLB 4LOAA 1IHDA 2O3SA 4W5TA 1ZD5A 4HUTA 2BV3A 3ONNA 5HZMA 5HFAA 1JV2B 3P0HA 5EN4A 1KA9H 1XD2B 2FGKA 1JBQA 1XELA 1K92A 2WYVA 4GIBA 4QTXA 4FIZA 4E13A 2GM4A 5LA6B 3FWZA 1N57A 1I0LA 3NATA 4R81A 2Q49A 3K4QA 3UWSA 2KLHA 1G17A 3H5VA 2W2KA 2QN3A 1GY8A 1BMFD 1G8MA 1SVOA 1J0BA 2IYLD 3IL2A 2C4NA 2QAIA 4DWWA 1E3JA 1DFIA 1C0EA 5LP6B 2X5JO 3SM9A 2K7FA 5HIAA 1N6KA 5G1NA 1RYDA 4I6GA 5SYNA 4QGAA 3C3MA 5FNZA 1Z7EA 2Q9CA 1C7FA 3CLKA 3DGEC 4J0FA 4OJNA 5KYVA 5HW0A 3S2IA 1R15A 2VXBA 2VYQA 3D8SA 4O4LF 5KB3A 3HNRA 1E2QA 2XOXA 2FFHA 1PGPA 4TLBA 2YIMA 1G7TA 1T6BY 1TYDE 1P39A 2X2OA 2GWRA 2IBMA 2SECE 3AW9A 3BQ9A 1GV1A 2P9CA 4JQYA 4YRFA 2P6MA 4ZHQF 5CXSA 4TSFD 1SELA 2ZYIA 4ZALA 4ZZ3A 1YB6A 3N5KA 3I28A 3ZQJA 2NZVG 1MKYA 4DN6A 1EPUA 4H4EA 1IJEA 4X1OA 3A1SA 4E1AA 4WASA 1RLTA 4KN5A 1E6KA 3T0IA 2ORWA 2WIGA 4R2WA 3SF0A 1E2MA 5H4GA 2X9QA 4YJFB 5DNWA 1CIPA 4UJ5A 1M2GA 2QYHA 4Y0NA 3UA4A 4YUWA 5BNWA 1D1QA 2QQFA 1P0CA 1H2ZA 2AI1A 2PGXA 3PRKE 1D03A 1SAYA 1A8UA 1XZHA 3OIGA 3VH1A 5KREA 1R9JA 1RWXA 4NPHA 2MSLA 3RPEA 4D45A 1AO3A 3Q40A 1M6EX 4DG5A 3QTBA 5GJBA 1SZDA 4HAVA 2RGNC 2YN0A 1SD1A 4LOKA 2ZB7A 1D2GA 1RFLA 3DUWA 2PS0A 3N8GA 3RFFA 4NAUA 3LE8A 3R5TA 2I3GA 4YQZA 2YFKA 3FPJA 5EJAA 3VC1A 4G0OA 4ONEA 1EZ4A 3T7JA 3ZN2A 4LF8B 1DOZA 1H2AS 3R0JA 2D7JA 1R0KA 4HDCA 3T9AA 4DJDC 2WIJA 2XX3A 5EMNA 1FRVA 4LCEA 2H9AA 1WE2A 2IGBA 3KBBA 1ZWKA 3HXTA 2JGKA 3BH6A 1U0LA 3QF4B 4P33A 4TL9A 2FZKA 3O4RA 1L7MA 1BH6A 3AJRA 4H1UA 4IMRA 3GRYA 2IEBA 3U4DA 3ZZNA 1Y37A 4G9EA 2W0MA 2Y9MB 1CETA 2XDYA 3HJHA 3LVBA 3NC4A 3AI7A 4GHWA 1R4ZA 2CL7X 2YXLA 4ME6A 2PGNA 1ZVMA 2H65A 2YINC 1XJ0A 1Z7WA 2X15A 3H86A 1EG2A