2DR2A

Structure of human tryptophanyl-trna synthetase in complex with trna(trp)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
373
structure length
373
Chain Sequence
b'GIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFTDSDCIGKISFPAIQAAPSFSNSFPQIFRDRTDIQCLIPCAIDQDPYFRMTRDVAPRIGYPKPALLHSTFFPALQGAQTKMSASDPNSSIFLTDTAKQIKTKVNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords transfer RNA-Trp
publication title Structure of human tryptophanyl-tRNA synthetase in complex with tRNA(Trp) reveals the molecular basis of tRNA recognition and specificity
pubmed doi rcsb
source organism Bos taurus
molecule tags Ligase/rna
total genus 139
structure length 373
sequence length 373
ec nomenclature ec 6.1.1.2: Tryptophan--tRNA ligase.
pdb deposition date 2006-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.240.10 Mainly Alpha Orthogonal Bundle Tyrosyl-Transfer RNA Synthetase Tyrosyl-Transfer RNA Synthetase 2dr2A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 2dr2A01
4HJRA 1O5TA 2G36A 3H05A 4WNYA 4MUHA 3DV2A 3LOQA 2DR2A 3A04A 2ZUEA 1JIKA 4MW0A 1K97A 3TQIA 3IMEA 4ZT3A 4MULA 1GLNA 1PG2A 1YUMA 2VXOA 3FIUA 4U7JA 1G59A 3G59A 1PFUA 3A05A 1JEEA 3MXTA 4R2LA 2J09A 1KH1A 1YUNA 1J70A 2GKSA 3CLUC 3FWKA 2DUMA 4JFAA 4NZPA 3SEZA 4MW5A 3TQOA 4CQNA 3TS1A 2A7XA 2J08A 3KFLA 4MUKA 4MWCA 4E1AA 2GOYA 4P2BA 2IJGX 1H3NA 2QJOA 3KT8A 3N9IA 4AQ7A 2E0IA 1H3FA 4HPWA 1O96B 4HK4A 1Q19A 2E89A 1VLHA 1G8FA 3DO8A 4MWEA 2J4DA 1T9GS 2AKEA 2JANA 3Q4GA 4J76A 1WOYA 1JILA 2PFSA 1MJHA 3HFJA 1QQTA 2D5BA 3G5AA 4MWBA 5HG0A 5TS2A 1VBMA 3F3MA 4MAFA 2PG3A 5LFAA 1GTRA 2WQ6A 1NUQA 2X0KA 4MUFA 4MWDA 1A8HA 1FYDA 2A4MA 3LCJA 3ZUGA 1Q11A 3CLUD 5DB4A 3HMQA 4ZT7A 4EG7A 1WKBA 3CLRD 2RE8A 3CR8A 1NSYA 3ZJTA 2HMAA 2A1UA 4ZT4A 3IUBA 1N77A 1G8GA 2EJCA 3TZEA 2YY5A 1KP3A 1S4MA 2RD2A 3LE8A 2CYCA 1M8JA 2X1MA 1TYAE 3FH0A 5FO1A 1N75A 3K9WA 4CDMA 2DEUA 1EFVA 1TQ8A 3OTWA 4KPUA 3UMVA 2QTRA 3FY4A 3X1KA 4KR9A 3X1MA 4OUDA 3GUZA 3SP1A 3VU8A 3KT3A 2O8VA 4DE5A 1OWLA 4MW4A 3COZA 3GLVA 3PNBA 3K32A 1R6TA 1NURA 2PIDA 4U63A 1GZUA 4YP5A 4U8HA 3MLAA 4QBTA 1M1ZA 4MLPA 1U0BB 2CFOA 1WJGA 1OWNA 2YXNA 2A84A 4MUIA 2QTNA 3IMCA 4MVYA 3AG6A 1GN8A 2H2AA 3A2KA 3P0IA 2IELA 4DDHA 5HUJA 4TS1A 2AZXA 1MC1A 5KCMA 3IVGA 1U7DA 4WSOA 3CA8A 4EG8A 3L93A 3COWA 3S3TA 4DDKA 1JMVA 1M8GA 4F4HA 4MUEA 3ZJVA 3N2YA 3P52A 1ILEA 1QTQA 1FFYA 3IMGA 4G5YA 1I2DA 1N2BA 4L2IA 4ZCSA 4XFDA 3UK2A 1F7UA 1Q77A 1XNGA 2JA2A 3CLTC 2PZAA 3AFHA 4KR6A 3CVYA 3Q10A 1N1DA 4YP6A 1KQNA 5HUHA 2BYTA 1PFWA 1H1TA 3SEQA 3ND7A 4ND7A 3HL4A 1R6UA 1XNJA 5K0SA 4JYZA 4I6JA 3CVWA 4MUGA 3RJZA 4PBTA 5DASA 3H97A 1JIIA 3OP1A 3G6KA 3ND5A 4EF6A 1M8PA 3ND6A 5IHXA 3RK0A 1D2RA 1O96A 1VBKA 4K03A 3IVCA 5FO0A 2CV0A 5LM3A 1O97D 3CLSC 2CYAA 1MAUA 1TFUA 5FNZA 1OWPA 4MUNA 5F23A 4GRIA 4I6EA 3MLBA 2O5RA 2CT8A 1J1UA 1K92A 1NP7A 4HJXA 1QJCA 4NAUA 4NX2A 1IQRA 2Z09A 4UZEA 3NV7A 1WZ2A 1EUYA 4DJAA 1B6TA 1DNPA 1T6YA 3FG9A 1QU3A 2WQ7A 1ZUNA 1U3CA 3UOWA 3VRHA 4JXXA 1CT9A 5TEVA 1OBCA 1I6KA 3ZIUA 4RUKA 1JGTA 5KHAA 3RHSA 1OWMA 1QRSA 1TYDE 1KQOA 1MB2A 3ZGZA 5J58A 4UZFA 4G5FA 1F4LA 5IJXA 2PXHA 3IUEA 5DK4A 2D54A 4MW7A 3D6UA 3RBAA 1V8FA 1OWOA 1N2OA 4ZCRA 1N2JA 1T6ZA 3SZ3A 1N2HA 2Z08A 4KKVA 1JECA 4NATA 4PBRA 3COYA 2IP1A 3M5WA 3RFFA 1WY5A 3INNA 2J07A 3PXUA 4Q93A 2A88A 3ZXSA 1KH2A 2QJFA 1M8KA 2CV2A 1ZH6A 3QE4A 3COVA 2XRZA 2EL7A 1OD6A 1XNHA 5K0TA 4J75A 1O0BA 5BNZA 3GMIA 1I6LA 2PZBA 4MVCA 1IH8A 1NI5A 1O95C 2A1TR 1JEDA 1M83A 3FNRA 1JHDA 2B7LA 3TZLA 4ZCQA 2V0CA 3A4IA 3E27A 4JXZA 1WQ3A 1QRTA 3IVXA 3IOCA 1ZJWA 1WXGA 4EG4A 1J21A 2DETA 3HV0A 4ZCPA 3N05A 1LI5A 3SYTA 3FDXA 4MW1A 2QUJA 2GM3A 2WB2A 1KAMA 1NUSA 5J5AA 2BTEA 1SURA 4S1OA 5AHWA 1KP2A 4X0EA 3KT6A 4YBRA 3H9BA 3H99A 1R6XA 1I6MA 1JZQA 1YIDA 1EFPB 2NZ2A 2VTBB 4ARCA 1EE1A 1GAXA 4ZT2A 1EFPA 2VTBA 5H16A 2XRYA 5EKDA 4ND6A 5KWVA 3VGJA 2C5SA 3ELBA 1JZSA 1O95D 5JBNA 1COZA 4A91A 1LI7A 1MOPA 1BS2A 2H29A 1WQ4A 2OQ2A 4RPIA 3NBKA 1T6XA 2ZUFA 4JZYA 1N2EA 3PRHA 1KORA 1N2GA 3L92A 1KQPA 3KT0A 3FI0A 3HZRA 3FHJA 4ZCTA 4MVWA 1ZH0A 4EG3A 1F7VA 1G8HA 1KH3A 3UY4A 4XFJA 4GU5A 3Q12A 3FETA 5DEOA 1J1ZA 4ZT6A 4PBSA 4EFKA 4YMIA 2I1LA 4OJMX 4CT0A 1LW7A 3ZXIA 1PFVA 4R2MA 1UFVA 2DLCX 3CLTD 1EJ2A 2HGZA 3CVUA 3IH5A 1PFYA 3CLRC 1TYCA 4DDMA 4EG5A 1VBNA 2CUZA 1PG0A 4QRDA 4K0RA 3IODA 3NBAA 1H3EA 1O94C 1MB9A 3IOBA 3DLAA 1MAWA 1JIJA 1O6BA 1KAQA 1GTSA 1NUUA 4CDNA 4ARIA 3PNVA 3AIIA 1O0CA 1Y42X 3SZGA 3P0HA 1OBHA 1T9GR 3H9CA 4DLPA 1N2IA 2YWCA 3ISJA 3RK1A 2D13A 2QUHA 5H7XA 3X1JA 1TEZA 5TEWA 3N8HA 4Q16A 2HZ7A 3HGMA 1N78A 5LLTA 3AL0C 1IQ0A 1EUQA 3FOCA 2ZP1A 2X1LA 2CSXA 1MBZA 2Z3VA 3ZJUA 3DPIA 1IQUA 4ZT5A 2WSIA 2NSYA 4EGAA 3D6VA 2PZ8A 1U7XA 3U1VA 3CLSD 1NYLA 2QJTA 1U3DA 2V0GA 4EG1A 2DXIA 3AKZA 1XJQA 2AG6A 4DNXA 1GPMA 2A1UB 3CVXA 2CV1A 4I6GA 2E18A 1WXEA 2QTMA 1K4MA 1QNFA 4H3SA 2A86A 4NDAA 1O94D 1WXFA 1YIAA 1EXDA 4FZJA 1IVSA 4XSVA 3MMXA 1Q15A 1N3LA 4G6ZA 4MW6A 2A1TS 1QU2A 1EFVB 4KPUB 4MW2A 2J5BA 4F3RA 5J59A 1X8XA 1NZJA 4OUDB 4YP7A 1P7PA 1IRXA 3TNJA 1K4KA 1J09A 3I05A 2E21A 3P0JA 2R5WA 3AG5A 3CVVA 1QRUA 3SDBA 3PNYA 1X6VA 2CYBA 3JXEA 1YI8A 2QUKA 3C8ZA 3MUEA 1MRZA 1NUPA 1F9AA 3IDFA 1M8FA 2TS1A 1IHOA 4MUJA 1ULHA 4BWVA 1WXIA 1NUTA 4MQ6A 3QTTA 4NAHA 3IOEA 2X3FA 1V47A 1KR2A 2QUIA 5TGTA 1RQGA 1KKUA 2YWBA 3ILVA 2DERA 3BL5A 3QTBA 3UC5A 4EG6A 2JAXA 1YULA 1J20A 2OV4A 4QREA 4AS1A 1HYBA 4KR7A 1VL2A 4L2IB 2DPLA 1TYBE 1WXHA 1O97C 4MVXA 4MW9A 1IFXA 4PY2A 4R0NA
chains in the Genus database with same CATH superfamily
3G0IA 1NQAO 2VCHA 2VWQA 1HT0A 2BGRA 3IR7A 4KXVA 3G49A 4R5HA 1SBNE 3LHKA 3CF0A 1BDHA 1JIKA 4MW0A 4LHXA 2O3RA 1RHQA 3BA1A 4TQUS 1INLA 1KFCB 1PG2A 4KI7A 2IL1A 4YNBA 1L3BA 1TD9A 2BFNA 3GGSA 3DNMA 2XE6A 4BZZA 5FXMA 5KNDH 4IXMA 5IU6A 2JFFA 3RC2A 3TW6A 3ZDXB 1WU7A 2RKBA 1X7WA 4YQFA 5CA1A 3LSTA 4NQRA 4A1FA 4BMNA 5T4EA 3SJZA 4J4BA 5ICGA 2PYZA 2NP7A 2HPAA 2J46A 3D3WB 4G0ZA 3DXXA 4O33A 3AW9A 1E2QA 1HL7A 1J0EA 1XVAA 1I10A 2IJGX 2XVAA 2YJZA 2Z6VA 4P1ZA 4GP6A 4WLUA 2G6TA 5E6UA 2DCUA 5A1JA 1HDXA 3QVLA 1QAMA 5JAHA 4ZHSA 2J6CA 2Q4OA 4FB4A 1GP2A 3I4CA 4DDWA 4ZPXA 3GRKA 1E9SA 4TKUB 3CVJA 3UJDA 2WU8A 1G8FA 1VE1A 2C96A 2O57A 3HB9A 5IARA 3H16A 1ZWKA 2ZRKA 3BAZA 5DX0A 3LBFA 2D0OB 4I1SA 4HV4A 4PXSA 4HSGA 1ZJZA 2R8YA 2XE7A 3HCRA 5D6OA 2SCUB 4JDUA 4TSFD 1AUXA 1W4CA 2E5FA 5G0WA 1XXHA 2I3ZA 3JALA 3OE7D 4Y0VA 3NAMA 1A96A 3C5EA 2MDTA 4MV5A 1JKJA 3K5PA 1IK6A 5DYNA 1P2BA 1XEWX 4YFYA 3T41A 4QUHA 2QL9A 1T9BA 3L0YA 1EFKA 4ROSA 2AHRA 3JU3A 4R3WA 5EMJA 2I7DA 3JRWA 3ADCA 2RHTA 1GPKA 2WD9A 4QBKA 2VJMB 2FPUA 1MLDA 2VKQA 3LFTA 4OOEA 2UV8A 2P4EA 1NI3A 4M0CA 3Q8KA 4YROA 4YRMA 1O6CA 2CZCA 2P3QA 4RA9A 4KMOA 3L1IA 4IDCA 2WYVA 4J0HA 4MDEA 4HN9A 3ZD6A 1MNAA 2NQTA 3HFRA 4KMMA 1BAPA 1X3LA 4O1IA 1AO0A 4OHXA 4RTKA 2P2CA 2J9XB 5CDYA 1ACLA 3SVTA 4RHUA 3V4SA 4JLKA 1IZ0A 4UDYX 2ZBPA 3F8TA 2B8WA 2ZTSA 2O1WA 3RH0A 4A0SA 1K5HA 4WBNF 3EQ2A 1FQOA 1Z0UA 4PZ9A 2QEQA 3U7GA 3T1NA 4QFDA 2QNBA 3L05A 1U63A 4D41A 1TU0A 3PQDA 1PDOA 5ALMA 4A73A 3FY4A 1E3MA 1U2PA 4UAJA 5BXQC 3KK0A 1I80A 1L4YA 3DCNA 3EVGA 3H2KA 1IXRC 4FCVA 2ZBFA 3EIUA 4RSRA 3NBZC 3IDOA 3VUFA 4DR3B 1TPZA 2WP8J 1BFUA 5AI9A 4H3HB 3ZVKA 1E9FA 1JYEA 3MERA 3ZDZB 4R7ZA 1T3SA 3R6LA 5FWYB 4QYWA 7MHTA 1LUAA 4KAJA 4YAUA 2AEMA 1WEHA 2X0RA 4FMDB 4LXQA 4TLDA 1XU9A 2X15A 2KMLA 3RJ5A 1OKKD 1USWA 1XN4A 3IV9A 1CS4C 2CFOA 2CD9A 4BP8A 3V4VB 4XRGA 4AZSA 3JATB 1LTHR 1R74A 1V37A 4D3SA 4CQLA 1A5ZA 1LZLA 5C8ZA 5FV4A 1QAOA 3ZW8A 1VYTA 2ZRAA 1M6WA 1DAEA 1GN8A 1I0LA 4Z0PA 5JAQA 1R0BA 3ZH9B 3WYAA 4DDHA 2R11A 4BQFA 5HUJA 1YFLA 3CRMA 1AGYA 1M0WA 2XCUA 4EMSA 1JVNA 5ADUS 4JASB 1RC0A 4R31A 1U7DA 1R4ZA 2EEPA 3STWA 2BLNA 1Z7EA 3KR0A 3WHLA 5A02A 3DUFA 2C7QA 3U7QA 1X42A 5F1OA 1W88B 1O77A 1SBZA 4X3PA 5KJ6A 1QP7A 2GK7A 3ROGA 3UUEA 3P52A 3ZHXA 3J81k 3EUAA 2ZCJA 3ROMA 4LY3A 3I92A 1IE3A 4JVOA 3ZVRA 1I2DA 1N2BA 1R9MA 2RH9B 3LCUA 1NMYA 1NJ8A 2JA2A 3NBFA 4XIFA 2HWXA 3JYOA 1NHGA 3LFUA 3W04A 1W0KD 3I9MA 5IC5A 2UUOA 4ZGWA 3CVYA 3HUTA 4ZI2A 3F4BA 3ONFA 3DFKA 3V8PA 5FX2A 1Y9EA 1YHYA 3VNRA 1P0QA 3H75A 4G1CA 3AFOA 3R3JA 2R97A 5A5DA 2XGGA 1ZVQA 2ODPA 3I8XA 4F9TA 2PK3A 1EAMA 4UBJA 1CR6A 1F6BA 4CCYB 4PSUA 4RXTA 5C1IA 4KO8A 2AFIA 1LWNA 3DC7A 4JVNA 3NOXA 2QYSA 3MM4A 3B6MA 3RJZA 1I7QB 4Z4IA 1JBQA 2G04A 1IPHA 2I6FA 4IZHA 4Q9KA 3OTGA 1LZKA 1JYSA 5DMXA 2DPXA 2ZG6A 4E2ZA 3RADC 2JJ2A 1YXMA 2F7SA 2BOVA 3N1UA 2QM7A 2JGFA 2AN4A 1EXVA 1GL6A 2C2HA 3GYGA 2FVYA 2J0SA 3EGXA 4C5BA 1H2AS 4FM9A 4N5NA 3S6JA 3FNQA 4RJKA 3ND6A 2WZQA 3BB3A 2VWPA 3MVEA 4JLPA 4TM7A 5FLEX 1HURA 2J30A 2ONJA 1Z0IA 2C1EA 2HZBA 2J1LA 2CXRA 2VH2A 1WHTB 3VYSB 4BRSA 4MI6A 4Y0AA 1DQZA 1KA9H 4EABA 1G41A 1TVKA 2P7IA 3PG5A 4U1RA 2VHVA 3UUWA 4C20A 3MMNA 4D99A 1M5RA 3BMNA 1YOVB 4F4UA 4XGIA 1DKNA 3NM4A 3B85A 3G88A 1JG4A 2QN9A 3LY7A 3ZQJA 5F23A 4KB5A 4MCAA 2WZDA 5EE3A 4LVCA 2VBCA 2CLSA 3DDWA 2O5RA 3GYBA 4JBHA 3RUEA 1ACJA 4G8DA 4NYJQ 3M34A 4TWJA 4EG0A 4LE0A 4ZZ0A 1WV0A 2K2QB 2COKA 3PIIA 4O2RA 3KTFA 1OLUB 1WPQA 2VH1A 3C48A 3FPJA 3NDJA 4LRQA 1JDVA 3D02A 2WWGA 3W78A 3E7XA 3Q7PA 4UNQA 4R54A 5TGZA 3VRHA 2ZRMA 4HVCA 2QROA 2JEZA 2BH2A 2WFMA 3U3RA 1SVUA 1SHUX 3IALA 1IG3A 3DLCA 3UMRA 3MOGA 1Q74A 1TYDE 3R0QA 2GHTA 2WTEA 4H1HA 4ZMBA 4ZEVA 5J58A 5K0CA 4XWKA 2QL6A 4W9MC 2GUWA 1EWVA 3JSXA 1ZVKA 3RK4A 2I4MA 4PG8A 5AW3A 1L5WA 3BH7A 4U7PB 3V1MA 4HADA 4IO1A 4KPEC 4D9CA 2G8LA 1P4GA 1XZHA 1M1YE 1D03A 2WDPA 3GGCA 3CJRA 5K0GA 5LKAA 1PN3A 3JYHA 1Y8CA 3O38A 2Z08A 3ECCA 2QD5A 4RGYA 3UH1A 1C30A 4OJNA 1RWQA 4GNRA 2GPJA 4I55F 5CG2A 5BWMA 2OGWA 4C4YA 2V1XA 4OK6A 1C2YA 4TUYB 4Q9LA 1NJFA 4E07A 2HA7A 3Q3JB 4PGHA 1EG2A 5A4AA 1W4RA 2L69A 1L1EA 3A9CA 2BEVA 1V8ZA 1PUXA 4PAOA 2QJFA 3KQSA 1YB2A 1KMIY 1JHUA 5AKZA 5LQSA 2EW2A 5A0TA 1JJAA 2CV2A 1SCBA 1K8YB 1NQWA 4OLAA 5CUQA 5E6RB 1P2GA 2VDOB 3OZCA 4LQLA 4OQQA 5HW0A 2Z04A 1AMOA 2A8YA 3ER8A 1P2FA 5FUBA 1EWRA 1Y1LA 5LDHA 2BSQA 2W2TA 4TL9A 3QSGA 5DSTA 3G9TA 4GYYA 1GGNA 3VR4D 1CFJA 2J7PD 4XIGS 2ZTUA 4GXRA 4W5TA 5BW4A 1IU9A 2PO5A 2GZ2A 1DQPA 4MSUA 1SC6A 1RACA 2BPOA 4BGEA 2XCRB 4MTCA 1H0HA 3THXB 4TWRA 1ISJA 1HT1E 3E27A 1CC1S 3N39C 3L0DA 4QG3A 5LLSA 3E05A 2VDNB 1RQLA 5M7EA 2YBEA 1L6IA 1JHRA 1OX4B 3T1QA 1QF6A 1XQXA 4LMPA 1H0KA 4OAOA 4RW0A 5EMKA 3U37A 2A58A 1NPYA 1V4VA 2JAOA 3FB4A 4QD3A 4UMEA 4CKYA 2NXJA 1UJCA 3N8DA 5I7EA 5AM1A 2EQBA 4O1HA 4B8ZA 3SZLA 4LHZA 2XX3A 4GI7A 3WWDA 4J1QA 3E9CA 1U0OC 4BLRA 4AMGA 4YWJA 3CNBA 2MSWA 4DMRA 1V25A 3LK7A 3MAGA 4B7ZA 4MHSA 3HPRA 9ATCA 5HM6A 2HSDA 2G8NA 2WUDA 1SKYE 4Z51A 4GPAA 1D1SA 2VPIA 4ND6A 2JGRA 2HU8A 1GQYA 2ZSEA 1TO2E 4R6XA 3GNTA 4IVRA 4HZUA 1Q7GA 3IURA 1FJHA 3ONEA 1JA1A 5J1TB 2J5RA 1U90A 3T52A 1U3GA 3CRNA 3HVHA 2NSDA 5JNUA 1QO9A 2H1VA 2ZUFA 2Q99A 4JZYA 1N2EA 1SVLA 2OEPA 3D6AA 1YSCA 3PRHA 1MX9A 1V9LA 2XYHA 3ONWA 3Q5EA 4O2BA 4B76A 4R16A 4RY0A 2IIBA 4PC3A 5T5QA 3E9RA 5JPIA 5T8KC 2W00A 1IDOA 2VJOA 2H4HA 3DOJA 4UUMA 3LLUA 5BQPA 1P75A 1NOKA 1A2QA 1U0LA 4WFKA 4FI3F 5JO9A 3TLZA 5BVHA 5BPFA 1BMDA 3VSDA 4XPIA 4W5QA 2Z5FA 1LBTA 1F5SA 2CLHB 2YC2C 3NTQA 4Q24A 4H08A 2R4TA 3KR2A 2BRUC 4I1OA 1TAHA 4P98A 5B1YA 3SQXA 1MVLA 3ANYB 1NASA 1Q1AA 2UVPA 1A9TA 1PFVA 5C7YA 4D6XA 3EUFA 3QUTA 4HN4B 4N49A 5F3RA 5G3ZA 2HF9A 5AI6A 3ZY6A 5BRAA 3OQVA 4L5IA 1R4NA 4XM0A 3KQWA 3A4NA 3CLRC 2VDPB 4ZU1X 2IYFA 3PD1A 5D3ZA 5TX7A 3TNFA 1A9RA 1KMMA 2UYQA 3C14C 3O26A 3ZGXA 1YCDA 3ORSA 2DPYA 5GJWC 4P54A 1JDSA 1A71A 3KQOA 2I6GA 1DKOA 3EC7A 4R01A 1ZGHA 4GQBA 4QULA 3LLVA 4WOJA 5IBQA 5LYYA 3U7IA 3ZJ5A 5IXJA 2CD7A 3DLAA 1Y8RB 3HA7A 1GTSA 4GX0A 1T5HX 3WXMA 2VZ8A 3A0RB 4ERNA 3AIIA 3DCIA 2WKRA 3JASB 4JKIA 5FLXA 3SM3A 1WXDA 2EZ9A 2FK7A 3HADA 1SIUA 4Y2UA 2QU8A 2IQ5A 1GPAA 1USVA 1KSFX 1OZHA 3RTAA 3UG6A 4Z7QB 3KE8A 2FR1A 4PZLA 3LS2A 3ZI4A 5KX5F 1TC1A 1UCFA 3SFTA 5ITVA 2GCIA 5LLTA 1KYIA 2X4LA 4H16A 2ZTMA 1IOWA 1BDMA 3FN4A 4Q39A 3RIYA 4XVCA 5JAMA 1CCWA 1WG8A 1G291 2NU9B 1QWSA 2AMYA 1V8OA 2WT8A 3JR7A 1ORDA 2WSIA 1RLJA 3QYJA 4YJGA 1OH8A 4PCVA 2EKPA 4FEEA 4DABA 1NYLA 4CMIB 4UHHA 1DBRA 3VOTA 4EEZA 1OB5A 4KXUA 4ZVUA 1DCFA 4GL4A 3AK4A 2ORED 5TLSA 1TL7C 3STXA 3O95A 1Z6QA 2AG6A 2A1UB 4B3MB 1QZTA 3RUCA 3U0VA 4KLNA 1ZCBA 4M83A 3GFVA 1QNFA 3IQIX 3MTJA 1OC4A 2IZ1A 4NJEB 5DLEA 4IUBS 3RPEA 1SG6A 4NDAA 4B3XA 3L0CA 3QUSA 2X42A 1AKTA 1VKNA 2RAUA 3LX8A 2FAXA 4XSVA 2A0FA 4GC5A 4CI0B 2OC9A 4D3YA 4YRAA 4EKGA 1MJNA 3QVUA 4LDPA 1EDEA 5EMHA 1MB0A 2BGLA 4E5UA 1VFPA 3K0AA 1NTOA 5F98A 4ISBA 1JR3E 5I7FA 2HLPA 5B5SA 2P6UA 5J59A 1C8LA 1U0GA 2KW5A 4URVR 4OUDB 2OXRA 3L4SO 1MN6A 4I9NA 3LP5A 5G41A 2BCJQ 1IHPA 3H86A 3A6DA 3C98A 3ZS8A 1TIKA 1KEZA 2JHPA 3TDKA 4I8XA 4RABA 3VR2D 3P27A 3WKCA 4MJ7A 3T7AA 2Y1EA 3EAGA 5JT1A 1Y7IA 1J07A 3VNAA 1OAAA 1M73E 4I9HA 4IIEA 3ZC3A 3AEQA 3KVNA 2E4YA 1P4HA 1M0SA 2WPDA 2UZ1A 3BIJA 3HY3A 1T13A 4IP0A 4XCXA 4EW2A 5JECA 5K4GA 3ME5A 2PH7A 3IDFA 4QAQA 1GTJ1 3L2OB 1QBKC 4MUJA 6LDHA 2RHJA 3HQ4O 2VNSA 1FFCA 3HRKA 3OLVA 3ZCQA 4DSOA 5JCJD 4EFDA 4JWTA 1QOZA 2HK8A 1TZBA 2QUIA 221PA 3CX8A 1E3SA 2YWBA 3DJYA 4Q37A 5AJHA 4Z1MA 3N6VA 1W5TA 2I2XB 4REQB 1TAUA 1OYVA 2BKEA 4D82A 5JNTA 3D5QA 1FYXA 4HDMB 1G6KA 4NY1A 4DR7B 3A7DA 4RFVA 4AT1A 2WIDA 5H0IA 4EEXA 5HCUA 2C2KA 5F1PA 1AK9A 1YRLA 1O97C 1P0IA 3PHJA 1PGOA 2OUIA 4IDEA 1IFXA 3S68A 1O03A 4FYHA 4EHJA 4MA0A 2L19A 2DAPA 4KX5A 3RF6A 2WTXA 3DGFC 5DTMA 3JVEA 4JS0A 3CCBA 5B1HA 5FLKA 5JE8A 2UUBB 2WWYA 1D2CA 5KYKA 2WG1A 1P1HA 2OXTA 4FYYA 1T1IA 2ZS7A 4RLSA 2Z5VA 4TS9A 2JW5A 4ZAXA 1GT91 3F7OA 1UT8A 3O8OB 2HREA 4WXPA 1D0VA 3FVRA 3VV2A 1ARZA 3E0XA 1L4KA 4BNZA 3DDUA 5THQA 5DNYB 1P3Y1 1Y5RA 1HDZA 2ZAMA 3WK8A 5CB6A 5IWAB 1XDDA 4HWTA 2ZBQA 3QVGB 3M4YA 1QGUB 4CR8A 2FVXA 3D6MA 1UPAA 5KPJA 4U6QA 2P9ZA 3HVKA 4DQLA 4ITVA 4I8IA 3IAEA 1LBEA 2WKQA 3GDGA 2VF4X 4ZD6A 1ZD2P 4LWPA 5TF0A 4DJJA 4TTIA 3B9QA 4R8RA 3MCZA 2ZE8A 3DB2A 1OBVA 2JIPA 2XECA 4LECA 3ZHUA 1SUIA 4NXMB 1FB5A 4DM3A 3TPZA 4ZO7A 3TCKA 4B6OA 3MWEB 4L74A 4FQ8A 3AM5A 4BZPA 1T9GS 1YJ5A 4Y1RA 3WBFA 2ZT5A 4J6FA 2KHZA 4AMYA 5KJEA 4UNSA 3V1YA 5L51A 5AKIA 3BILA 3GG2A 4MGZR 1OTYA 4URZR 4ZVRA 5JALA 1XPOA 1OI3A 1UK9A 3CWQA 2O2HA 1JV2B 1YC2A 4PPNA 1NW7A 1MRNA 1RTKA 1EXMA 1ZM4A 3MQFA 5CFLA 2KPOA 4WDQA 2GYVA 1CW2B 4BECA 1T5BA 3V42A 1YBMA 2Q9UA 4KQEA 4DSZA 5AKHA 2C20A 2WQ6A 4MWDA 2JCBA 4Z7OB 2ZDHA 2VN8A 3ETNA 3QWFA 4EPWA 2UDPA 5JZOA 3TECE 2V7EA 2PGJA 3ZCRA 3C5HA 5IBPA 3LC2O 4FWBA 3N5KA 3CLRD 4KLAA 3ETEA 4Y6RA 1XZBA 5HS4A 2OR3A 4J0DA 1HMYA 2BFDB 3RS8A 2QXTA 2H11A 2J87A 5JAPA 2ETXA 2YZ7A 3TGWA 3E18A 2C4KA 1KBZA 2B34A 2ISQA 3E15A 3QKTA 5IAOA 1NKSA 3VJLA 3ASUA 3WGKA 2HCFA 1YS1X 5KTRA 4RF4A 3DBHB 1PDVA 1TYAE 5JDIC 1E9CA 1N75A 1NXXA 4QSMA 5L3SA 1FJXA 2DEUA 3O47A 3OESA 1X94A 3FRJA 2AJTA 5LWHA 4A2WA 1CZRA 2OB1A 3ITDA 5BSTA 3U49A 4Q9HA 2XRFA 3VPAA 3GLFA 1Z29A 4R8KA 1ANKA 5J4KA 2OOKA 4LOHA 2C8LA 2RH5A 4EJ6A 3VHRA 1HC7A 5DN9A 4M22A 2PUCA 1QV6A 2XODA 1E2EA 1YQ9A 4MB0A 5DMHA 2XYPA 2QN2A 4WK0B 1KMCA 1CXZA 2JHCA 4N9WA 3BRCA 3WRXA 4MV7A 3I9V6 5TS3A 3P94A 4W5WA 4FEYA 4BKMA 5CVVA 2F3PA 1NLYA 4O4IF 3T06B 2Q5OA 4B4UA 4TTSA 2YXNA 3HKEB 2RGNA 2IHYA 1MIOA 1AN9A 1OROA 4TRMA 1SIBE 4PVCA 2JI6A 5J3JA 1PKXA 2UZ3A 1BU8A 5EJ7A 3L1HA 1A2KC 3GCXA 3IBYA 4E6PA 5IG2A 2OO5C 4WZBA 4WKOA 3PWZA 3ZYCA 1MH1A 4ZICA 2DTXA 1EINA 1FDRA 1Z82A 5I3ZA 4EFLA 3HG7A 4W5HA 1J00A 3TOCA 1M8GA 4Y9SA 3UFXB 1M1UA 3ZHYA 5H70A 1AH2A 1QX3A 4FE3A 1WBJB 4MUAA 4IVPA 4Q3LA 1T5OA 3LH5A 4DGSA 1GCAA 2MCFA 3WHPA 1QC5A 1TO6A 3SICE 5ALOA 2QTVB 2LPMA 5A6SB 1V5IA 1TQ4A 4KR6A 2J6BA 3FKSA 3SS9X 3ZZMA 3N7TA 4B34A 3REGA 5ALVA 3OTHA 4ARZB 4FX2A 4DC0A 1H69A 1UBUS 1CRLA 2W6ZA 1R3DA 1OIWA 1Z4JA 1O58A 1YVEI 4IOKA 3TH5A 3GQVA 3HXKA 5FTLA 2R6ZA 4AJLA 3K1TA 2C4NA 4K6FA 5IFKA 4BMYA 2VPXA 4IZOA 1MXFA 3HL4A 1E2IA 4H1TA 3VISA 3FPSA 2FFRA 4EPYA 1Z75A 1VDMA 2HNAA 4TN1A 3C2QA 3FYSA 2RJ3A 2O3SA 1YRBA 3MRSA 3EISA 4XYBA 1GGKA 3A2NA 2CWDA 2CVHA 2UZ4A 5IMSA 5LA6B 5BURA 1TEHA 3T34A 3HR7A 2B36A 2UVDA 2VJQA 4X1YB 2QVCA 3GBSA 1S8FA 1E1LA 5AXAA 1E2BA 3SHFA 4FDTA 5HBRA 2WNSA 3D4LA 3QV1A 4KO4S 4OLHA 5HE8A 3TW8B 1J0CA 3JAMA 2RC5A 4D44A 4E08A 1ZBQA 4Q1FA 4UUAA 1I4EB 3IVCA 2P4QA 1C3VA 1O97D 1HQKA 3IIEA 3E3AA 3L3BA 4KNVA 4F4FA 4LRTB 1NQUA 3KXIA 3ZE1B 1TOAA 4FUQA 5J5VA 1Q95A 2V7VA 1P1JA 2PCLA 1CJMA 5AVZA 2C29D 4YMUA 5LP6A 2CFRA 1G4HA 2WZCA 1W4BA 1CUIA 1NSFA 1VGRA 3OTOB 1K92A 4QFBA 4E13A 3O83A 2R9VA 4PANA 4G0OA 1D5WA 4D7AA 1SULA 4ZQFA 1UODA 3FG9A 4FGKA 1RHRA 2NM0A 4Q1CA 4MYSA 4RJ2A 2C7OA 3IPCA 4DV2B 3HRHA 3QLEA 1FTYA 2AXQA 3MBOA 3UGQA 1NLZA 4RPGA 3ZVMA 4QM6A 3NS7A 1DS6A 1LDEA 3Q0TA 1S8NA 4MINA 5GAJA 4FN5A 3K9NA 3RT1A 1RJEA 1DX9A 1FUEA 2CK3A 4X1IB 5LBTA 3NDIA 1VKRA 1OIXA 2Y8EA 2YZNA 4G1UC 3CFYA 1FFWA 1FPQA 5U4QA 1EXWA 3IUEA 4HAZA 2ZAOA 2VF5X 3JD0A 3O4RA 5L7WA 3D6UA 1ZD5A 2EJUA 3T7IA 3MHPA 1T6ZA 3DFUA 4R8VA 4KKVA 1HDGO 3DH0A 3DBLB 3T15A 3IXQA 3PXEA 3R0ZA 1A8UA 3VJMA 4B1FA 2IUUA 5C7OO 1NOJA 3RBXA 5HF8A 4PFKA 4B09A 4J4TA 3RO7A 4Z7JA 1PW7A 1D4ZA 3JQ8B 1FRFS 1IAQA 4JC5A 1PL0A 2G67A 4GKAA 3OWHA 4URYR 4I36A 1JDBB 1L1RA 2JLXA 4O3MA 1ES9A 2XOEA 2Z8YA 3GRCA 2NZXA 5K6TA 2WWIA 1XZGA 1YWGO 4HEHA 4O4LA 4YA6A 3T7EA 3WYBA 3ZU2A 1OHHD 4ARAA 1EA7A 4AS2A 4IS2A 4DSUA 2DY0A 1C1XA 3KX2A 3R5XA 2PD6A 1SXJA 4H3KB 3EK2A 4K2AA 1M83A 3DV0A 2BCGY 2O7SA 2ZWOA 1H4TA 3L6OO 4DMCA 5AW6A 1Q14A 5IVHA 1JR3D 2JCSA 1SK8A 3ZX4A 1UFOA 1CRZA 3AEYA 5CDFA 2AC7A 3UQYS 3BTVA 3NHUA 5CX1B 3VJKA 3EN0A 4ZAGA 4TOIA 1JLKA 4M87A 5A04A 1J2YA 2XF8A 4HUJA 3ZKWA 3DR5A 3ZWVA 4MQMA 2NVOA 2OBFA 3KETA 1VG9B 3T3DA 5KYYB 1J8DA 3SIWA 3A8TA 3VVCA 1GPJA 1G3RA 1OYOA 2XXJA 5J5AA 2Y1DA 1VE9A 3IMFA 4LISA 5KWEA 1I1NA 1GQQA 2GN6A 4LVUA 2VK4A 1PQUA 1B4DA 4BRUA 5AHWA 2PL9A 3L8YA 1E96A 3KV3O 3TMYA 5ISMA 1JH8A 4DLXA 2UZ0A 4KK4A 4MKIA 4UEQA 3IUPA 4XR9A 3X2EA 1D7AA 4LXGA 3L07A 5FOTA 2D59A 3QLJA 3K2IA 4LJSA 2YFKA 1TYZA 3ZXYA 5GGYA 1L5LA 4IMIB 1Z0FA 1RAAA 3S55A 1M2OA 1QYDA 4XARA 1VA5A 3KQVA 4TPKA 2EIXA 2FW7A 4OM7A 2BGKA 1COZA 1OJLA 1E7QA 2XI4A 1ML4A 4HMPA 4WTOA 1EH5A 1H6DA 2LTAA 3PQ8A 1MTZA 4IIJF 3MWGA 1CJCA 1EI9A 3D1VA 2MMCA 4P3XA 2UXBB 2RGAA 2VCEA 5FPTA 3R7NA 2A7QA 4H4EA 4EUSA 4BN0A 3E84A 3HUUA 3L92A 2ZJ6A 4NCAA 1G21E 2J8ZA 2P1ZA 5ALZA 3W3ZB 1EX9A 2R8ZA 1MG5A 4S1WA 3RC1A 4QYIB 2FGKA 3GLIE 3QEMB 1FFEA 4ZCMA 2PT7A 1AK1A 3HSYA 5IMBA 1QHIA 3RIMA 4LVOA 2YKGA 3C5CA 2BP7B 4X1KB 4NECA 1E98A 5HE9A 3ZIDA 3S2IA 4JQOA 3RLIA 1IIRA 4KR2A 1NULA 5AJVB 4PBSA 3DHWC 2ZT7A 5KYXB 2Y99A 5TPZA 2YXEA 3SX2A 2VYVA 1GIAA 3KL4A 5K8CA 1AQJA 3ZE9A 1KO8A 1A69A 3AY7A 4XYEA 4CUKA 4F1WA 4MKFA 4D2IA 3RIHA 1L3CA 3MWDB 1PFYA 4NS1A 3EPRA 3PPXA 2Q4EA 2Y67A 5EWMB 1BVYF 1EK2A 4IRUB 2Z2IA 4WZZA 2FQ1A 2XVMA 3FPHA 3AESB 4HDRA 4YQZA 5GONB 8MHTA 2GA9A 2IEIA 3PI6A 3LT2A 3R6WA 4KPYA 3HVIA 1USIA 4G9BA 3DC2A 4N65A 4HFRA 3G7NA 1ABBA 2GEKA 2O8EA 1MAWA 1ECJA 1YDFA 1Y4SA 2CGEA 2AJCA 4GH5A 3KQHA 2ENWA 1FMJA 5DRTA 3NV9A 2LIPA 3Q7EA 2CHGA 3W9SA 2ZSUA 1JXAA 2QA5A 3OPYI 3S5JA 4XVUA 2FEOA 1RSZA 3GUVA 4FR0A 3T7CA 4CIAA 5FJJA 3N0XA 1CUZA 4HKTA 5JWRA 4IQ4A 1TVEA 4JGGA 4PM4A 3NAGA 4JV5B 2XT6A 1K5DA 1QIMA 3F6BX 4HNHA 4KXWA 4TV8A 1GAWA 3PWSA 5CB8A 5HKKD 1KARA 3ZE6A 2XR1A 3PRKE 1OFUX 4QHSA 1YA8A 1AHNA 3CB4A 2FWIA 3TE7A 2VUTA 5JWOA 1PGJA 1M5UA 1PG5A 2VT3A 4LJ7A 3W1EA 4EL5A 2E55A 1J6UA 1G20E 3GU3A 2NVBA 4MCJA 4WACA 1U7ZA 2NO9A 2G82A 2P3SA 2OV6A 3KTOA 2KSQA 5KHLB 4BFSA 3OT1A 3HKBB 5D85A 4HWSA 4BX8A 1THMA 4JNKA 4KQGA 5MHTA 5JJLA 3MT9A 3NDPA 4RLFA 2XNJA 1NR5A 1JA9A 3B2NA 1YDEA 3T9CA 6ADHA 1IBRA 2P90A 2HRCA 4OSOA 2O2DA 5FT9A 4DQKA 2RHRA 1HNZB 4UHDA 1JMYA 1Y3IA 2BDTA 4IQ8A 4N9QA 2GXQA 2IHZA 1CK4A 5BNWA 2M6SA 1PWHA 3E3NA 2Y0PA 3GT3A 1TZ2A 3G9QA 4JJIA 5IKMA 1VMDA 1PJZA 4U02A 3SNHA 5CB4F 3DS8A 4HAOA 2B78A 4ZQCB 3TSCA 5JR3A 1RQNA 1YU9A 2O2GA 4EHHA 4F97A 1OFHA 1JQKA 2WIBA 3R0XA 5EERA 1LK5A 3C6QA 4KTVE 4DIUA 1T2UA 1J5EB 5LZ8A 4RDHA 3ANSA 3MB8A 2E21A 4W9NA 1VGVA 4LV6A 3UMFA 2ZQYA 4Z2YA 3AG5A 5DLPA 1B00A 2OHGA 1Z8DA 4QJ3A 4ERXA 2YS6A 4UD6A 5BWNA 3L46A 2RK6A 1F1BA 3JR3A 5JXGA 4AULA 1NC1A 3AUTA 1NPTO 3M6AA 3CT6A 1IOZA 5AVRA 3VU1A 4W63A 4BWVA 3O8DA 1ZAKA 1CUXA 4GDMA 4IRMA 3T1OA 1WDMA 4IDAA 1AZWA 4NS4A 4DC1A 4CKWA 1SCAA 2CXNA 2QG6A 3W5IA 2DGDA 1E7MA 4RV5A 1JU3A 1CTQA 4KPGA 3BJMA 5FI0B 2B7BA 3P0RA 1BA3A 3WGVA 5DHPA 1K27A 3AOEA 3HCPA 1XCPA 1U4SA 4XVQA 4EJ2A 1I94B 3DXYA 3H9GA 3KRTA 4L51A 3WRVA 5DNCA 4H60A 4R4JA 3RYIB 1NLFA 5BP7A 1XHFA 2YR0A 1JFSA 2ID4A 4ZMSA 1UANA 4KR7A 1GG2A 4G0NA 3FFAA 4MK4A 4MVXA 3OJXA 1XRPA 1JSXA 2ZUDA 4QATA 3GC6A 5DVZA 4PY2A 4O08A 2HBQA 3JW8A 1N0HA 3HEAA 4DS3A 1ZHOA 4FDMA 4B2LA 2ZI7A 3SEAA 1FTSA 2R96A 1EM8A 2GN0A 2H1OA 1FIUA 3DV2A 5IKPA 3RRNA 1W8IA 4AYWA 3BKXA 4YIHA 1V3QE 2YY6A 1V4NA 3EPHA 2X8BA 2OZKA 4GX5A 4EHBA 4A2QA 5BOSA 1W75A 3FCXA 5MGBA 2LV8A 2YJ6A 4P4TA 2PUTA 4K8OA 4MULA 3V4RA 1VJ5A 4C6TA 3HXOA 3SKVA 1IBKB 2EEZA 1H2WA 2OV1A 1H2BA 2M32A 4LZZA 2P4HX 4QRHA 4K9MA 1OC2A 2ZVQX 2RKOA 1JAXA 1YJBA 2E7ZA 1JEQB 2ZSIA 2HO4A 3QWHA 3VGPA 4KYIB 2FUG6 3ER9A 3I23A 1TQ6A 5A5EA 1YZLA 2VQ6A 5LYJF 3O8NA 3O73A 1EPUA 1GRRA 4G97A 4HFNA 4NZPA 4MW5A 1XTRA 5E2IA 3KR9A 3H8JA 3OSZA 5I45A 1KMHA 1ZOOA 2BW0A 2AN3A 3ZWBA 2OXFA 2PZEA 1EK0A 1T9HA 4PAMA 3KT8A 1Q3TA 2E0IA 4D3DA 4I2NA 4PRYA 4KRGA 5HIAA 2D7JA 4FYPA 1C7FA 1MB3A 3E9QA 3TD9A 3KKEA 2V9ZA 2E89A 1HRDA 1TFRA 2ZQ5A 3G9XA 3Q8WA 4KRXA 4N3NA 2ZSFA 3UAWA 3CUYA 3L0BA 2Z3WA 3QOXA 4HH1A 3W8FA 4B46A 4ALNA 4CFZA 4IJUA 4G01B 3T9DA 2NO7A 5FLYA 1RIIA 1Z18A 4I7EA 4K9NA 4RFSB 1JILA 1LCIA 1G8KA 1AS0A 1LRKA 3LY8A 3OTIA 1JIVA 4HX2A 2RGXA 4M38A 5GM2A 2G63A 2XA1A 1ZUNB 5BY2A 5DM1A 2O0MA 1OXSC 3WYEA 1BEZA 2PN1A 2YWDA 2C5AA 3LX4A 2V58A 3QE0A 3WLKX 2ISCA 2PZJA 4J16A 3P2KA 4LE2A 3RIEA 1Y34E 3TIFA 4BO9A 4QHTA 4DPLA 4EJSA 3M6WA 2HDNB 3QOFA 1QH1B 1ZEMA 2CCJA 2AZTA 4K9OA 4M8KA 5HP4A 2IXBA 2NUTB 4RCZA 3TKAA 4EECA 5EIEA 3PTZA 1GSOA 3T8YA 4CKEB 4M9QA 3VR6D 2ZRFA 5LUBA 3DXFA 2A5YB 3PQ6A 2PU5A 3SEFA 1NXVA 2HMAA 4CEJA 2RJNA 1HSZA 1G2PA 3OQJA 2X4GA 3BN3A 4FHEA 4KBGA 1EESA 2PMFA 1LVUA 1W44A 3QKWA 4CLEA 2QD1A 3QRWA 4LA4A 4ALKA 5C4IA 1NNEA 9MHTA 1BE6A 1YMUA 2ZYHA 1DXOA 3BHNA 1M8JA 3IRUA 4XTRA 2W2LD 2A9JA 4P86A 2H5EA 1EFRA 5SZHB 3UJNA 1TX4B 2G4LA 3GMSA 3KBBA 3PQ2A 5ILQA 4A6PA 1PW5A 2NO6A 4BUCA 4BWYA 3X1KA 4A8JA 5DSZA 3HCCA 3ZQUA 5JPCA 5G2OA 3I12A 3HU5A 3O03A 5ARDA 3TLJA 2HRDA 3Q8XB 2D06A 4DG9A 3CS3A 3OBBA 2B2NA 3PZBA 1TB4A 1E7WA 1L7QA 1NIPA 1JFRA 5CDGA 4M1QA 1I0IA 2OP1A 4QYSA 4U7GA 2BC9A 4TKVB 3SLGA 4WECA 3TSAA 1JDPA 3K0BA 4B85A 5JV5A 3EGOA 2R4QA 2AFIE 3QNMA 4MLZA 4D4GA 5MGNA 1Q0UA 5KOHB 2QSYA 2WTMA 1DKUA 1OTHA 4JEHA 1ZK3A 2HLDA 4KMRA 3R7WB 1QFYA 2QTNA 3ISVA 4BZWA 3MTQA 1X1AA 2PBFA 5BQ3A 5BRJA 3ZPXA 1MHTA 4NMLA 3AF4A 4L8WB 5EE0A 4TS1A 1QIHA 2W2XA 4JJ7A 2XY4A 4DB4A 4G2TA 4ZIRA 1WUTA 3LUHA 4GR9A 3B2EA 4RMJA 3ZDCA 1GNLA 3L4KA 5AW0A 4OLBA 2EARA 4JYBA 3BWVA 2WJWA 4IMPA 5DSXA 8GPBA 2ODTX 1T24A 3ZJVA 2BEWB 4L02A 1H1LA 4N5IX 3FPBA 1SA0B 2NXCA 2WICA 1F8GA 3T5BA 1E7RA 1GRQA 1OBOA 3STVA 2EYQA 3E5RA 1OXKB 3GFTA 1E0DA 4HP8A 4L57A 5DNVA 3W6UA 1KI7A 3CRVA 4RZQA 4HNAA 3ROKA 2QP3A 3Q7IA 4XUEA 2G5GX 4BQPA 3I83A 5LJIA 2GHIA 1T8RA 4OFZA 1IN8A 2H2HA 4FDVA 4P83A 1SHTX 1E1NA 2IZ6A 1HZZA 2JFYA 5H5JA 1T36A 5EP2A 2H65A 1XELA 2GD6A 4WLOA 2AKAB 2P0AA 2FP4A 2PGXA 2Q6LA 1YS6A 2X5NA 1L4MA 1L4HA 2YJ5A 3KKQA 4G0PA 2F4NA 4MUGA 4ZDJA 1Z37A 1N33B 3H4VA 5C37A 4AP5A 5IFLA 3RVNA 1OU4A 1OFVA 4JKOA 1A5SB 5FBKA 1Z26A 2HWYA 3CF4A 4RENA 3ESDA 1PWEA 4RU1A 1L8LA 1ZHFA 1L7PA 4J0IA 1Y37A 4HDSB 5HFAA 1DPGA 4BHTA 3VNQA 9LDBA 1UJMA 2GR9A 2QRLA 3C7CB 5TR9A 1Q3KA 3KQMA 1HE4A 4RD3A 1VSQA 5KTNA 1CUHA 4TRNA 3AM1A 1FFGA 2YICA 3HZZA 4MQ4A 4TTRA 1GUAA 4IUCS 3RK0A 3P71T 2OMKA 4HXGA 4K03A 1VBKA 4I46A 2J0QA 4U5XA 4IDBA 3O91A 4B3DA 2QE7D 3RYHA 3FHOA 3VVLA 4HT3B 4BUJA 4LCJA 4TMZA 2EFEB 2XGJA 2WD7A 3K53A 1TIPA 4RQAA 1N0IA 4Y6SA 2XOXA 1PJRA 1Z2OX 2C77A 1ZSNA 3LF1A 1GADO 3M4NA 4FYJA 3VDNB 4WBNB 3CF2A 4RDXA 5I4CA 5K03A 1EFAA 13PKA 2YNMA 2Z1NA 4KACA 3E23A 1S2LA 1TTQB 4QBIA 4LF5B 4NV0A 2UUCB 3AYXB 1MGOA 1VPEA 4C4AA 1HE5A 1W46A 4TT3A 3DJFA 4W1QA 1ZBDA 3N0RA 2F59A 4JR0A 4NENB 2O5EA 1J9EA 2PUHA 2Z0MA 1H8EA 3RQSA 2ZIEA 2M1ZA 1CWUA 3CLHA 4NMXB 4TKZA 3DVAA 3SK0A 3R3VA 3EY9A 4UZFA 5TQJA 3JQAA 2PJUA 3GUHA 1DELA 2VHCA 4WZAA 3GLIB 1XEAA 1MVNA 1JSZA 2GEJA 2WSYB 4O4JB 5DK4A 3HJAA 3KAJA 1Z28A 3SF8A 4C7MA 2ONYA 1UC8A 2IXGA 1TT5A 2DMRA 1WVGA 1GPWB 1SWWA 2HMTA 2ODAA 3ESQA 3U0BA 5D00A 3AVTA 2QRHA 3IS3A 2CCKA 2QYTA 3PDUA 1HORA 2OORA 1QYXA 4GMXA 4MS3A 4MYCA 2Q7OE 3W8NA 3VBEA 4ZAWA 3F90A 3S44A 2J07A 3AQ4A 3YASA 4X92A 2VL7A 1SN7A 4EY4A 3KYJB 4LQCA 4L28A 3AKYA 1RDFA 4H4CA 3I2HA 3UANA 4K8RB 2C82A 4ZC8A 1RC8A 2GSWA 3ZWDA 4QU8A 1M8KA 4DNQA 2VF2A 4MKXA 5LB2A 8ATCA 4NXNB 2F3UA 4F8JA 1Z0KA 3PGA1 1PFQA 1U2SA 3OQ1A 2V7TA 1Z2EA 4MPDA 3PDHA 5AK4A 2GMWA 2P62A 4KGZA 2COUA 1USKA 4MGEA 2PVSA 3A4VA 2B8JA 3UVEA 3RS9A 4ESEA 3I9V1 5I8ZA 5EJ6A 1E1RA 4FCCA 2Y05A 3PGLA 3AWIA 4ZN6A 3OCXA 2Q21A 4QICA 3D4BA 4R5MA 1QHHB 1XMXA 1B6GA 2C4VA 2RIPA 5THXA 5J4VA 3A6GA 3TZLA 1JHYA 3GNLA 3HU2A 1K63A 2PMBA 5IT9A 3QPCA 4Y3UA 4BVLA 4XCQA 3VTFA 3JWIA 1PNOA 1QS0A 2JBAB 4PC2A 4ZU3A 3QU5A 1NBME 1QVWA 2QMUA 4P93A 1W94A 1SVOA 4IEFB 1XMVA 1MO3A 5F3WB 4GP7A 3G2PA 4TGLA 2AQHA 2CMGA 4EYGA 1IB6A 1K86A 5CA1F 5LOVB 3F3YA 1QGED 1WVMA 2WEKA 3NRJA 1RRMA 1PR0A 4B17A 5B3JC 3ESAA 3L8DA 4MDYA 3LYAA 1UPBA 3QVWA 3JQGB 2WHPB 2JGDA 2CDCA 3DA8A 1EEHA 4Q4HB 4TVKA 1C1DA 1EFPB 3O6VA 3S0JA 1QHFA 4EELA 5LZ2A 1HT3A 3JV7A 4TLLB 3VR4H 2GERA 2H1RA 2QX4A 4ZOEA 2ZRJA 4CIXA 3MD9A 1Z16A 4R8MA 3LT4A 4BN5A 5ES4B 1S2OA 4QVIA 1PJ4A 3F71A 1N6RA 4B2YA 2WV9A 5DLYA 4B3RB 3VKVA 4B3GA 2JFWA 4EB6B 4NICA 3GPBA 3Q7TA 3EMBA 5EMLA 3LBHA 3L7DA 4HDOB 3ADKA 3V7FA 3OIUA 3WJAA 5BN4A 4QYMA 3F98A 3HJNA 4JBYA 1UKVY 1LC3A 2I4LA 4A91A 2B25A 3F9RA 2MHCA 3EGVA 5J4YA 5CCDA 2ZRIA 4EP1A 1KI6A 2EBFX 3AF2A 2LXNA 4RYLA 4I81A 1MO4A 2EAUA 4RESA 3ILXA 5CAEA 1CE8A 3FMGA 1UJ5A 5SV2A 3AP1A 3WZMA 3C39A 1GNSA 1DRUA 3IDQA 3OBIA 1E2NA 3AOGA 4JT9A 4P4NA 3FI0A 3ZGLA 2X6TA 2C7GA 1Z4PX 1YA4A 2GJ9A 4XM2A 1G19A 2IA5A 1MW9X 2GEDA 5LNK6 1F7VA 1AMUA 3NIBA 2O8FA 1E92A 1KYQA 3QPWA 1YFKA 2I7XA 1HKHA 2XQIA 4ZT6A 4JOSA 1R16A 1SC4A 2CZQA 2Z83A 1CX9B 4MR9A 2XMBA 3HBLA 1UBOS 4A03A 2PD4A 2W6PA 4M86A 3M3HA 3JWJA 3WOVA 2G70A 1D1QA 3GUYA 4L16A 5WRFA 3H2HA 5HKLA 4ESOA 2FFAA 2C4HA 1KAHA 3R3WA 5E6UB 1YZFA 1Z8HA 2QRNA 4EG5A 1ZMTA 1KY5A 4YDQA 2FPXA 3E7PA 4QRDA 3TJRA 4DCVA 5L45A 3IBTA 1E7SA 1KFEB 1Q2UA 2Z9DA 4GUAA 1HSOA 1OR8A 3P8ZA 4INOA 1MB9A 2X41A 3TTYA 1P1RA 4UMDA 1A1SA 2NO0A 2VH5R 1YJCA 1PR6A 4G9EA 1GWNA 1ZN9A 2R7AA 5CPFA 1L7OA 1XPRA 4CDNA 3KCQA 1CR0A 1ZNZA 1UH5A 2X7XA 3AGPA 3JWEA 2IPNA 1DIOB 3PHLA 1NVTA 3JSAA 2POCA 2WOJA 2VHXA 3BX1A 1OBHA 4Y2SA 1FXSA 1QDEA 3PC2A 1A98A 5FULA 2YWCA 3DDHA 1ZGZA 3B20A 1MABA 1ZK4A 2OUKA 3ZQKA 1E1QA 4M9UA 3RB8A 1Y3DE 4B9EA 1XXHB 3JALB 1R0YA 4RZHA 2YWGA 1JKJB 4Q16A 1WUIS 3O31A 4CFSA 4UVEA 2ZJAA 4TSRA 1MJGA 1NWCA 3K0EA 5BN1A 2UXCB 3T3GA 1N78A 1R0LA 1EUQA 4QUKA 1R0KA 3IUSA 1Y1QA 4YMVA 4W5JA 2VBFA 5L7YA 3RUAA 5HIKA 3GP5A 4YLYA 4QGBA 4BTEA 3L7MA 4EGAA 3HKCA 4NBSA 3B6KA 3H1FA 1X9GA 2WAOA 3ZNPA 2R85A 4WADA 4DLUA 4RA9B 4YDSA 4K9LA 4CFYA 1A9QA 5AJTA 3QA9A 4DNXA 4BO4A 1XP5A 1UC4B 1I1HA 2BI7A 2D5IA 2WINI 3A32A 3BE4A 3IESA 2HT6A 4I9GA 4KAXA 1WXXA 4PV7A 4UHJA 4B0OA 2V6GA 3U31A 3U9TA 5E4TA 4BLSA 4UTXA 5IANA 3E5NA 3PC4A 1WCWA 4P3YA 1WS6A 4UUBA 2DBRA 1EXDA 3MMXA 1Q15A 1ORWA 4HAYA 2HA0A 5HKAA 2Q3DA 3H2GA 3W5AA 2P2ZA 1WNTA 1O6ZA 3AHCA 1OH6A 5GGXA 3A27A 4QRIA 4RLQA 3DZDA 5DM4A 1AG9A 2IWRA 2ZXUA 3S1LA 5BQFA 1K4KA 1MFZA 5AI4A 3LVBA 4CIBA 1XYVA 5KZMB 4P7GA 4Q1BA 2J59A 4DREA 1K0FA 3R23A 4PCUA 3DR3A 5DYGA 4ZK6A 3TFQA 3ED5A 5A4FS 3WWPA 7YASA 1W5EA 4U39A 1UOQA 5KREA 4I3HA 1C81A 3ONVA 5HM8A 1XE3A 2FRDA 2MWMA 1JXQA 2DERA 5EXEA 1E64A 3B8HA 4ZDWA 4TRJA 2QPAA 2RCYA 4YP1A 5DLQC 4N12A 4OHYA 1WZIA 4M9CA 4QXAA 2YYYA 4B7CA 4L4RA 5BWOA 4LRUA 2QXUA 1JPJA 3LXRA 1V6SA 2O50A 3OF3A 5B36A 4XSHA 2IVZA 4NAHA 3D6NB 3N8KA 5CT6A 5HCIA 2ZSDA 2G0AA 3SDSA 1QP8A 1HXHA 3E03A 4PS1A 1XZLA 3R7AA 4EBFA 2YINC 5KVSA 4XGQA 4RC9A 1C9KA 3T3MB 4B73A 3P4UA 3UYLA 3DUFB 3IT0A 1X8LA 3U7QB 1BOFA 2NYAA 3ELDA 4N40A 3UTCA 3UTDA 1XGKA 3GPCA 3DOHA 3NIGB 1WD5A 2JAXA 2Q4TA 3LHSA 3VR0A 2X9GA 2ZI5A 2Z6UA 2GBLA 1J4AA 2IHKA 4QGSA 2EFHB 3L8EA 3PL5A 4JXKA 3WXBA 3SR3A 5LDGA 3K15A 1RVV1 1HRKA 2X0EA 3AGQA 5ENVA 3ZK9A 3DF9A 4G0WA 3GGJA 1T5LA 1QRRA 1YS4A 3IBGA 2X8AA 2BFAA 2GJAA 3LQYA 5CIYA 2NVUA 4PYKA 4HJRA 2PWBA 4HPXB 5A5FA 1P9WA 4DJFC 2CB0A 4KIJA 3PUYA 2OBXA 4WNYA 4MUHA 5ESRA 2I99A 3K16A 3L77A 2G28A 2J6HA 4HUQA 4ZQGA 1SU4A 4NPAA 1W8DA 1I01A 1OBFO 3QPAA 4DR1B 4IIBA 2EQAA 5CB0A 5BSFA 1KETA 3KB1A 4JN6B 3PXBA 1LDGA 4QBGB 4DL9A 4BNLA 1NVVQ 4C0HA 4KODA 3LDAA 1QZZA 3G59A 3RRBA 5BYBA 4V2IA 1VSTA 2Q4DA 5L9AA 5HZMA 2AD1A 3PFKA 3FZYA 4H6PA 4J1TC 1HTWA 1ZQ9A 2FETA 4C07A 2LWIA 3D4IA 5TB5A 4IF6A 3ZCSA 1G2IA 1PD0A 3EGXB 3TS1A 2GVNA 1NVXQ 2V5VA 3EXHA 1Y3CE 2FUNB 2IOYA 2DUJA 2XUFA 3KLOA 2Z9CA 1Q7BA 3MYYA 3C1TA 4FMCB 4PQGA 3NPAA 5DNWA 2AUMA 4RHXA 4XQCA 5KDLA 2VYCA 1EWKA 1T4BA 1M2VA 3ZI0A 1TQDA 5EUCA 5JHGB 3GNQA 3GEEA 1TVKB 3WIDA 4F5ZA 3KOYA 4ZYTA 1IWPB 4E31A 3HJRA 3BMNB 2ASEA 3SIPA 3ZDBA 1H5UA 5LD2B 4ZRDA 1KDYA 2GXAA 2C42A 5EJ4A 3BDVA 2CMHA 3IULA 2X7HA 1Z63A 2QUBA 3VH1A 2FHSA 2OXEA 5KOJA 4EI8A 1ZD4A 4U2GA 3SNKA 3CIFA 5KTTA 1ZJ6A 2I4TA 4ND5A 5HGXA 2P6MA 3GMTA 2R62A 1HZJA 4DCJA 2ZR7A 4H0FA 1QLWA 5JO0A 5FBLB 3V7WA 5BUCA 4GO1A 3CTPA 2AFVA 2C97A 2W2PA 3PSHA 4RY2A 4AU1A 2DF8A 5ALLA 3OM1A 4HQLA 1TA4A 4X9XA 3CGWA 1T15A 4YIKA 5IKEA 4JELA 2DHDA 3F3SA 4NYJR 2UYYA 3BD9A 1OZAA 3T3HA 5A5VA 4N0PA 4AJ9A 1B6RA 1IUKA 2I2AA 3B3QA 3BORA 2JI7A 3F74A 3GJYA 5ED0A 4ZJUA 4O2LA 1UAAA 1TAQA 2H9YA 4UAVA 3S2UA 3UMGA 3HA2A 1E3TA 1G55A 3CW9A 3D7NA 5DNEA 1X9IA 4Q18A 2FH5B 5F7XA 1QF7A 3TX6A 5HKOA 5M29A 4KWHA 1EIWA 1U2QA 2J3HA 4GKKB 4YRNA 1C30B 4WZBE 4ZT4A 5I8WA 2Q6OA 3WKDA 4GRDA 4INAA 3FWHA 4QEZA 1N77A 2BHTA 3CNQS 3KJFA 3PXXA 3SQWA 1AX9A 1RS0A 4PFQA 3NHFA 1ULZA 5AW7A 1DC8A 2UUPA 3CUSA 3P9XA 3PLRA 4UCFA 5BXYA 3QX9A 2WMOB 2BEVB 1Z6ZA 2MSEB 1PJQA 2VIIA 1M2FA 1EFVA 6PFKA 1EJ6A 2V6MA 3UMVA 5BMVF 4GXTA 2QTRA 5B2FA 2G7MC 2GLUA 3RNLA 1U0SY 3D6TB 4AMVA 1V45E 1JEOA 1NM5A 3BHMA 3OD5A 1RWOA 1NXTA 2ENUA 2C31A 4Q7EA 4D26A 5C7LO 2WAAA 4G86A 5HVNA 1XU7A 4DE5A 1Z45A 1BDBA 4OQLA 2EVWX 2PT5A 3OJ0A 4LXYA 1ZP6A 2B8NA 2OCBA 1FP1D 1ZA2A 3L0ZA 4FMPA 1JIXA 3FHLA 1Q50A 3HEMA 1L5NA 3V1KA 1WJGA 2I6QA 3NGLA 4GF5A 2I34A 2W71A 1CQJA 2RBEA 3CUKA 5F21A 2B82A 3GPIA 4ARBA 2VRCA 3N2EA 3HJTA 4NI5A 2MJLA 1PZMA 3WB0A 3UA3A 1E2MA 4F6CA 3PYLA 1GV1A 3A2KA 3BMOA 4KAFA 2EW1A 7ABPA 2W11A 3RSZA 3ZDEA 1NBMD 3QWIA 3FXAA 3C1UA 1RCFA 3ANTA 5IK2A 3KLMX 4DCGA 3COWA 2RIRA 1R4AA 1ATZA 3PK0A 3SMQA 3AIOA 5IXSA 5JBQA 1O87A 3L82B 4OK3A 1NNLA 1YS2X 4IY1A 3N2YA 1YQDA 3NH6A 2ZIUB 5I5GA 4DIKA 1RXYA 4Z53A 1WR8A 3HJFA 3RREA 1N7GA 1V1RA 4WY2A 2YVKA 3OZDA 5E0OA 1FW8A 2W2QA 1S89A 1FFXA 1E9BA 1XKQA 2C2YA 2CJPA 4ZQEA 4ONEA 4F2PA 3CG4A 3G2NA 4JIGA 3N8NA 2Q6TA 3RVLA 4IDGA 3E8SA 5A4DA 1DRKA 4HZUB 1PD1A 4CV2A 4HDNA 3FGNA 3WMRA 1EQAA 3UWDA 3LJKA 3GJ4A 2PD3A 2HY7A 4Y8VA 1GNPA 1QYIA 3RAFC 3IV6A 3P9YA 4LOLA 2A1IA 1JHAA 3RSCA 1YR6A 3V2GA 1EHYA 3O0DA 4GYKA 3S2GA 5K0SA 4JYZA 4M1MA 3LBYA 4DUZB 1WSWA 3H4TA 1T29A 4V3CA 3WIUA 2YDXA 3DO6A 1BG6A 3HO6A 3OIWA 4EB0A 4LFBB 3GRUA 5LB4A 5FEMA 1JKFA 2PWAA 1TMYA 4F9GA 3KOWA 5BVHB 3C70A 3OY2A 4XPIB 4DCNA 4XPZA 1F06A 1I36A 2E2WA 3IOMA 1EBUA 1O95A 5K01A 1PDWA 1D4AA 1XZMA 1CUJA 2PMWB 5IABA 4Y9RA 2YWEA 4N5LA 2UVPB 3TI7A 4WFJA 3BFKA 3TTWA 1YF3A 2R6DA 1O96A 1FLNA 3JX9A 2G5PA 5KKAA 1NU8A 2H51A 3PJDA 1UKAA 4L4YA 3HABA 5UKDA 1R4NB 3WRXC 5I7RA 4REMA 3IJRA 2CYAA 1X8JA 4IQGA 5KYWA 3BXPA 2DC1A 2J9FA 2PX5A 3HDYA 3RRZA 1C14A 2ORIA 4UEKA 3O4FA 2EJVA 2CT8A 2C4MA 4PCLA 1NP7A 4FGZA 3GEDA 3KSUA 4BGIA 1VLVA 2I2CA 1UK6A 2RGNC 2VCYA 1UWLA 4B3BA 1SR8A 1TLTA 2YV5A 2I8CA 5IZCA 2ZB8A 1JR2A 3NZEA 1T6YA 1YKFA 4GR5A 5GY7A 3WP1B 3NWOA 3KNZA 4HWRA 1OLXA 3AEKA 5IAKA 2VF7A 3R74A 4OQYA 2GBPA 1C1YA 2I3BA 5GP1A 1ID1A 2B4AA 4Q3NA 3TDNA 1F48A 5B58T 4ARVA 1SCUA 5JIBA 3RHZA 1QRSA 2NGRA 1T2DA 1EDOA 2AOTA 1T8SA 1SCQA 1ZIYA 4D3FA 4CCSA 4EYSA 2HQSA 4OFWA 2YXLA 4P0TA 2VDUE 5GZ1A 2V96A 2Y93A 4DV7B 2WF8A 1R8YA 4CF3A 1Y3FE 2QAJA 4LJRA 1Q1NA 2NVWA 3F7NA 4RELA 1SHJA 4J7AA 2J5QA 1E6KA 1N2HA 1R37A 4YJGB 5G4KA 5BQXA 2NU6A 1IBSA 2XD9A 2ZSKA 3DHEA 3PUHA 2CL6X 2IP1A 4ZP1A 4Z99A 3CR7A 1D2EA 3EH1A 5F1KA 1SOVA 5A4KA 1S02A 3KJIA 5A03A 3FSEA 3KLNA 1MRSA 2A88A 1Y3AA 3LZ6A 1H2XA 3ZXSA 2VQEB 3FA2A 3NXKA 1JN0A 2GT1A 2PX8A 1KH2A 2WPDD 1AQNA 1UMDA 1ID8A 2FV8A 2I4RA 4KXYA 4CIWA 4E4TA 5SICE 5BMOA 2JJMA 1WXQA 3B1VA 3H7AA 1SPBS 1O0BA 2DTDA 5E7IA 1UBLS 2NU8A 2BGUA 1NUAA 3K2QA 3OJEA 4I50F 1RJGA 1RM0A 1QB8A 1ZNQO 3K0AB 4RORA 5JQWA 2HK6A 1JWAB 2R2AA 3OH8A 4YP9A 1NF3A 5DNDA 3T5MA 1L5SA 4BQEA 1KQFA 4KQ9A 4C7XA 4U6NA 2RH8A 3SOZA 2HEGA 5JWHA 3NAZA 1V1MA 1UEXC 1X70A 1W7AA 1CUWA 1RHMA 4DLSA 4ED9A 2PSFA 4EG4A 1O94A 4MQEA 4HPJB 4JH0A 3RIXA 3HV0A 4ZCPA 5LP6C 1LLCA 3BGOS 3H2ZA 3RVBA 4BOYA 1EVIA 1C9DB 3MRXA 3GI1A 5G0VA 5J2TF 3ZWAA 4C0XA 2UZ1B 5DYTA 3M4XA 4QGFA 4R1SA 1JEYA 3AFNA 3HRIA 2WSBA 2RSLA 4RKQA 1ZY2A 2XEXA 3WNCA 5AHXA 3AF6A 3WNZA 3WAJA 1YL6A 1KL7A 5FQOA 2J3DA 2CUKA 3SVZA 1DO2A 3QNWA 4J0FA 3QEKA 4NH4A 2HU7A 3NAQA 3L7BA 4ECEA 1GAXA 5ESWA 3T5TA 5JS6A 3UMSA 4U9HS 2VTBA 2QV7A 1U7OA 4AWAA 3L0IB 3H42B 1KAGA 4R9RA 3D8HA 2XV1A 5AVSA 5CK4A 2CXUA 1JQ5A 1QRAA 2V4MA 4WKPA 3DM5A 3H5WA 4TLBA 2BJVA 1KYTA 5HIIA 5DX8A 3RVMA 4JJ6A 3TL3A 3JWGA 3U26A 4Q7QA 1APBA 1XA3A 3IV7A 5JBNA 4BFCA 2Q3EA 5CX4A 1SXQA 3T3OA 2CLEB 1QFZA 2CNBA 3SOPA 1PX0A 1XJ5A 2QZ4A 3A9WA 1JAIA 2WOOA 2WTUA 2HA5A 4J6EA 5INTA 2M6RA 1MOSA 1HOTA 5B30A 2FMTA 1EK6A 1XFAA 3BWBA 2X19A 3MUNA 1E3JA 4NEQA 1UKCA 3I1IA 1LS1A 1IUPA 1V39A 3P9KA 1GNRA 2GRUA 5GZ3A 4F3CA 1R6AA 3ITKA 3NCHA 1H9BA 2WFAA 1PJ3A 1TM4E 2CL7X 3AUSA 3R3SA 4HGQA 4NOKA 2D1TA 2HRQA 7GPBA 2FG6C 1AUQA 3KPVA 4LOKA 2IUEA 5EXDA 3SXUA 1TADA 5DEOA 2CHFA 4LE1A 4UW9A 1PF7E 1I3LA 1CQIA 2I1LA 3NTOA 4OHVA 5IWCA 4KLRA 1OILA 1QGYA 1D2HA 1P1BA 1X1CA 2CBXA 2I6TA 4N03A 4OXKA 4KQCA 4P2GA 3WLLA 4JBWA 1SXJC 5CLHA 4DT1A 3IH5A 2P75A 4PQYA 4YRQA 1XLTA 3T54A 4E09A 3L1VA 4R40A 1FUIA 4UZSA 4YMTA 1R10A 1CUCA 1T8YA 2CUZA 3LPMA 3PUVA 3LFHA 1L8OA 3PHCA 5F9MA 2GN4A 3NBAA 4H4DA 5LMZA 3CX7A 4CODB 3RNOA 3ICEA 4X5OA 4S1VA 4LUCA 1N9KA 1JIJA 1GV0A 2QNIA 1YRAA 3IPXA 2ZJ8A 3QGMA 3DKKA 2X8JA 4Y1RB 5EAIA 4XSGA 5BYJA 1HX7A 1TCCA 2N0SA 1PJAA 1E1DA 2CXOA 4FFNA 2GWRA 5EE5B 2Y2UA 1QQ6A 1C80A 3PI7A 1UKEA 4JUBA 3DTNA 2PA0A 4IFTA 3H18A 5IDXA 1TJYA 1BWQA 2CMKA 4NE2A 5CNMA 4HWPA 1P3DA 5KYUA 5COBA 1TK2A 2JEYA 1ESNA 3P97A 2A5JA 5DOVA 1M76A 4B3CA 2JA1A 2V4ZA 4NWIA 2IOFA 5IDWA 2R8OA 2F1JA 4F1JA 2CSXA 2WYIA 3ESYA 1DC5A 5DT2A 1QHXA 1YB7A 1RMTA 1U31A 3QELA 4UREA 1PCXA 3VPBA 4W1RA 4D4MA 2IBSA 1A8QA 4IV8A 3U1VA 5A4IS 2QRJA 3B3FA 2OBYA 3T7DA 4B6PA 3TQFA 1XJQA 2HWUA 3B70A 5I9NA 3GLGB 5BQOA 3UWOA 4B3SB 3EA4A 4Q1EA 2PGIA 2W7TA 3GEGA 2GI4A 4N5MA 2Y27A 5ALUA 2FWRA 2QTFA 2ZETA 5EZ5A 2I67A 3NP7A 4Z8YA 3WQSB 5K3SA 1AUOA 4ZK2A 3E1KA 1T1RA 3GUUA 5HXAA 3BTUA 2PHZA 1D6SA 4RSHA 5CHYA 2CMDA 3EW9A 4XWYA 2EGUA 4CTMA 5L3SB 4I4TA 3GAFA 1RP1A 3AZQA 4Q00A 3IJPA 3E7FA 4NLLA 5E8RA 2ZYSA 3CINA 3GLFB 1O4WA 2CC2A 2WZBA 1XVUA 3KHTA 4EPVA 1KERA 2AS0A 4QOGA 1PBNA 2C9YA 3C6KA 4HH3C 4GLLA 5FR2A 1QVVA 4NMWA 3THWA 3E1GA 1JP7A 1XDWA 2QW1A 3IAXA 4KV7A 4TZ0A 1REQA 5KDOA 1AHHA 1ZKMA 3LECA 1Q7CA 3RRFA 3U81A 1DWOA 3NXSA 1UP7A 3CVVA 3FKSD 1SUDA 3MGKA 5MN5A 2H0RA 1E3EA 4MVJM 3DOUA 1ZO8A 1MH9A 1XALA 2EWVA 2JLRA 2HHLA 2WF7A 3HNPA 3ENZA 3MUEA 1JKXA 1P7CA 3AH8A 3T5AA 5JD4A 1DIHA 3E82A 5C46F 2G40A 1MIOB 3AO0B 3PNKA 1TRHA 1AKQA 2GCNA 5HYVA 4D9IA 1NU6A 4U2BA 2NV6A 3QLVA 4FZ3A 5AHRA 1BOOA 3E0QA 3EBPA 3TQQA 1AM4D 2CHUA 5EXTA 5F33A 2C00A 1FFAA 1PFKA 5F4ZA 1RQGA 4C2AA 1AKMA 2X4IA 5C18A 1ZR4A 2HHCA 4A0RA 4LC1A 1E9DA 2G80A 4NESA 1Z15A 2OCPA 1VL2A 5CLQA 1QC5B 1D8TA 5CMLA 4M8IA 2EFCB 3K8OE 2NO5A 1ZIDA 3FMIA 5DM2A 2MSNA 2J33A 2WHXA 2WSSD 4G8JA 2FSIA 3CRQA 1OQAA 1A4UA 3UXMA 2PKEA 3NOVA 2AGVA 3NWPA 4DBLE 5LNK1 4II2A 4ZYZA 1IJFA 3KUKA 5T57A 3EBLA 4DW8A 1UP6A 2BT4A 1ONPA 4NBKA 5CCEA 5FUYA 2ZR9A 3NTUA 3U40A 4YGYA 3KQLA 1QIJA 3DO5A 1SVIA 4QPCA 3DZBA 1OGYA 2P9BA 4XDGA 2VHZA 4HLUA 4I5FA 1YBAA 2C9ZA 5L3ZA 2R48A 4LGVA 1SXIA 4YXFA 2B8EA 3ILHA 2GPWA 3BG5A 1JHPA 4ESVA 1PVDA 4UULA 3PGJA 3F6RA 2CY0A 2D7DA 3G0DA 4R2LA 1J70A 2YX1A 3MN1A 2F9FA 4H1VA 1XA4A 3GLRA 2IHBA 3N8IA 1DIBA 2Q1SA 4NCJA 2BHLA 2ZYRA 4JP8A 1GKYA 4S1PA 4YBZA 2AMLA 1H3NA 5PGMA 3E58A 4B75A 3AVVA 3FGZA 3AJRA 3KALA 4R9NA 5EP1A 3FHCB 4DB2A 2D2IA 4PG4A 1VIDA 4NU5A 3SSOA 2IZ7A 4K28A 4UARA 2F2TA 5EJ2A 3O82A 4W9NC 4E94A 1MJFA 1Q19A 1TI7A 2J85A 2V54A 3A6HA 3CZ9A 4GIBA 4U7FA 2JFGA 2A3RA 1Q1EA 1FMFA 3QUBA 5JSUA 1VL8A 1GUYA 5KTYA 2BONA 5LP6B 3CNEA 3A1WA 4AFNA 2YTZA 3B7PA 4ZKDA 1XKTA 2I5PO 3ZWYA 3AUFA 4M53A 3UMJA 1YA6A 4KSCA 2YIDA 2MTBA 2Y1KA 2RHHA 1YDMA 3RHFA 1N2SA 3MT8A 1UAGA 2PYIA 2FU5C 2X2OA 1SH7A 2BV3A 3D59A 4LY0A 1GEGA 2I4OA 1HFEL 5EA2A 5TV2A 4N7RA 1JG3A 5B7GA 4A10A 1ML3A 1Y6FA 3WTCA 5EJEA 5HF5A 4KKXB 3W3AH 5E2BA 3WDKA 3FVTA 5F7ZA 1FU8A 3BE5A 2GNAA 3W1VA 1XCBA 2ZZMA 2VP4A 4TXLA 3GDOA 4BP3A 4IMRA 1OFTA 5E9QA 5LXTF 1SBTA 4UOZA 4DILA 1MU0A 2H9AA 1O6FA 3B12A 3DDSA 3TBKA 4Q3AA 2R1TA 3MRVA 4GS5A 2EXXA 4PG6A 1VJTA 1Y48E 3M6FA 1WV1A 3NUZA 4KWTA 4B3HA 2EJCA 4J43A 2GCEA 3DFMA 2Q8NA 5D6NA 5CR9A 1OU0A 2H3HA 5I5EA 3O3OB 4WGGA 3BL6A 3Q0IA 2M6KA 1ISGA 2PJZA 1QIEA 5KNBA 4HYQA 3ZCTA 5AK0A 2RDMA 4UBLA 1IN6A 2HMSA 4LNUA 4EO9A 1LRJA 1MJ5A 4PWYA 5JVDF 4IZIA 4QTTB 5K7SA 1ZISA 1YB6A 2V6IA 2VI5A 2F9LA 2XMDA 2R7LA 3ONDA 4G84A 4G56A 1Z5OA 5G53C 1TPYA 5I7OA 4N48A 4DCOA 3LYLA 3A58B 5C34B 1F12A 1DDIA 3MHTA 3DB1A 4OB7A 3E9ZA 4O4LB 3VX4A 5DP1A 3O2QB 2PUWA 2J5KA 1OWLA 4RCYA 1JFFA 3ICCA 3PNBA 1C1XB 3T38A 3S8EA 1SXJB 3ADOA 4U6SA 3DV0B 4TYMA 1P2DA 2DSTA 4X61A 4F9FA 1KVQA 4YRZA 4CM5A 5FWYA 2HYDA 2H8GA 4JROA 3TIXB 2G0TA 5LU8A 1T1JA 4M1KA 3DBIA 5B53A 1OWNA 4ZDIA 5DKFA 1JIUA 2Q0QA 2GK4A 3QF4A 3L1JA 1NL3A 2OM6A 4AY6A 3ZKWB 3U4QA 2PT6A 3UHPA 4KRFA 4BB5A 3FYUC 3WNQA 5K4AA 4BFTA 3KO8A 1O5IA 4IFEA 2OAQ1 3ASVA 2CUTA 1WNFA 4YN3A 4M1YA 5HF9A 2OTCA 1Y6RA 3A1EA 3E35A 5A1TA 3FYHA 5HHTA 2FSPA 1E32A 2ZWMA 3WDMA 1RXUA 5FDFA 3QXXA 3EXEB 4YUZA 1W88A 2CLMB 2X58A 3GJ3A 4J16C 3A3OA 4QOFA 3OQNA 5TPZD 3DPSA 3EB9A 1QBGA 2AVDA 1KMNA 4QXRA 5JJ5A 3GRVA 1GFZA 4ABYA 1FUYB 4HUTA 1M2OB 2EJTA 1UOEA 3LF2A 3NHKA 4ZKEA 2WT4A 3RT9A 1WY7A 5HUHA 1U8CB 1IY8A 1B0UA 3ND7A 2V6JA 4MIEA 5FBHA 4PC6A 3G8CA 5GINE 4D8UA 4DYDA 1PHPA 1RAFA 2YVAA 3TTSA 5LUAA 4FPXA 1R4MA 3QJGA 1ZW1A 5ALRA 2FOLA 3W6NA 4BJ5A 4IIYA 4AL4A 2P2GA 1Y1TA 3NMUF 1U1IA 3O9ZA 4EMUA 2JLVA 5AVJA 1ZOIA 4LFAB 1U02A 2AW3A 4Y9TA 5GV8A 4OCZA 1U8FO 1J2EA 1ENPA 2O1EA 2YIJA 2Z5GA 3O1HB 1J0BA 1F8FA 1YZQA 2WWWA 3Q98A 4GOLD 2AEEA 3GZ4A 1W5BA 4IW3B 4Y6OA 4A8JC 4DEXA 4EW3A 3OT5A 3KPWA 1PJBA 4NE9A 3BH0A 3KXPA 4PN7A 2PGDA 1SBIA 2X0JA 3BSSA 4Q3DA 1IVYA 4HEJA 5IKOA 1Q0TA 1XG5A 5GM1A 1G16A 5IYZF 1LW6E 1ULBA 3EWIA 4M49A 4IQ0A 3VTKA 4BBPA 5C8YF 3P9IA 3LDHA 1G2QA 4KMSA 4MUNA 3KSRA 4N39A 3HHEA 1X77A 3DG9A 2AI3A 3H13A 4HDRB 3G1WA 1FNSA 1UBMS 3ABIA 2O8NA 3KDAA 4JLAA 4BTLA 2HA2A 5KOYA 3T3PB 3VU3A 5IZ4A 5YASA 3AL3A 1SEPA 4UTRA 3PHBE 5KMGA 1D09A 4K1LA 2WQ7A 2JJ1A 1ZCJA 4YDRA 3S7ZA 1A76A 2JBHA 5TEVA 2IV7A 2RHMA 4C4RA 3W8RA 5KO2A 5KQMA 1VXOA 2BGNA 2GB4A 4RUKA 1GLGA 1N6LA 5HIMA 1CFZA 1CRWG 1I2BA 3CM0A 1CZLA 3RHSA 4C03A 4D6PA 5BW8A 1L4LA 1DBQA 2AE1A 1V4BA 2QGFA 2FZWA 4RVGA 2G88A 4UHKA 4YRRA 2FZGA 4NCXA 2BMEA 4TV8B 1W5AA 3OFSA 4JBNA 4ITRC 4QYTA 1Y4UA 1XPUA 5IF3A 1QHEA 4HLQB 1NMXA 4WJLA 4FLFA 1YFZA 4JMLA 4BX3A 1Q0HA 1QO0A 2D3WA 2LNDA 2XUHA 3D3KA 3H9UA 5KB3A 2P68A 4ZVQA 5TGDA 4RHEA 3KYBA 4NATA 1P5JA 4OGGA 4XM1A 3OT1B 2ZRLA 4KE9A 1P2UA 4C29A 3AINA 3PIRA 3KYDA 1PQWA 2E48A 4HX5A 1HZZC 5LZ7A 3U4MA 1YQWA 1AF4A 3ROPA 2GZSA 3TWOA 4BO7A 2C2ZA 2FTKE 3A9RA 1EVJA 3F9CA 4OGFA 1FJGB 2GK3A 1Y98A 2FG7C 2FZKA 1Y82A 3M1AA 3V1UA 4N7BA 3WK6A 1Z5NA 4H7KA 4F4CA 5DTEA 2VLIA 1NN1A 5AW5A 3R5HA 4YJKA 1QVRA 4OD0A 1W93A 3K6RA 2B20A 4CLRA 3ZNQA 4RDCA 4BNNA 1O3YA 3RJ9A 4ZOQI 1DQSA 5B3LA 2C2GA 2B6NA 5K2MA 3Q85A 1PUIA 5TPWA 5BUSA 3O93A 2GHRA 2Q07A 4NZYA 4OBWA 2JFVA 3AKDA 1Z3IX 4HB4A 4MGKR 4S35A 1KJJA 4QECA 1A27A 4X1IA 1Z39A 1B8UA 4TZ6A 1S2GA 1A4XA 1Q12A 1SBHA 2P8SA 5BOVA 5THKA 3ZXXA 4CR6A 4G0YA 4QM7A 2VJAA 1I3KA 1KDTA 1RC1A 4RZ2A 1C5KA 3UKJA 4JNCA 3D0KA 4PX5A 4KOEC 1ZM2A 3AHJA 3KJHA 4PYNA 4EKYA 2ODNA 1Y3HA 4ZZ2A 3S70A 4TZTA 1ZK2A 3DE6X 2QX8A 1DJPA 5E3IA 3TZBA 4V0QA 2I33A 3VKUA 1Q92A 1RU3A 3R41A 4ND2A 4D74A 4ASUA 3KT6A 1QE0A 4ZPJA 4RJTA 3ICOA 4RFLA 3N87A 5J5CA 4AZVA 1NBIA 2Y0DA 1U80A 3DBVO 5DHTA 3I8OA 2EP7A 4CKWB 4E2XA 1VB5A 3UHFA 4Z4QA 1YE3A 5AYVA 3UHJA 2J0UA 4D4JA 4EB3A 2GO7A 4XWTA 3LNTA 1SC1A 4BASA 4E7PA 2O2ZA 1G18A 2GZ1A 4Y6PA 1UL1X 3ZHVA 2PWYA 2WM3A 5FUQA 1EVYA 3FPKA 2NUBA 5KWVA 1C7JA 1DTWA 1T3LA 4S1NA 3WK4A 4G1FA 4ABTA 4RJJA 2O1XA 5TT1A 3AB3A 3Q87B 4ZWNA 3I73A 2A9PA 1GUBA 3FFXA 4M3NA 2KX7A 4R1MA 1RZRA 3OD1A 4LDZA 2HK7A 5A9RA 4D6YA 1UMCA 1DT3A 2OORC 1NX9A 1TF7A 2LDBA 3CQ9A 4RPKA 3AUYA 4MI9A 5BR4A 3KE9A 3H1EA 1EM8B 2YHIA 3PENA 1FDWA 4UQPA 4ETMA 3PFWO 4LZWA 4OXIA 4R1NA 4H6VA 4BVFA 2XB2A 5ALWA 4EZBA 4Y9UA 3ACBA 4BNGA 5H4GA 5KNDA 4BCBA 3F4KA 2AOWA 1XU4A 1ZH0A 1NJ2A 2ZUWA 5HCNA 2EP5A 5BOSB 1UDWA 4ICIA 1NBOA 4O3FA 4ZAZA 4C6TB 2I29A 3DOCA 1RXIA 2EWMA 2GN9A 3I64A 3QIAA 3R44A 4KYUA 3MWJA 5KTPA 4B79A 3LVQE 2IUFA 2IH2A 4N76A 5KUTA 4HRXA 2QZZA 5JATA 4X6UA 3ANNA 4QXMA 1SKMA 4L3OA 1L7DA 3KYCB 5ILOA 2O0JA 4UBKA 4E2FA 1I3CA 1F2TB 4QJBA 1STOA 4NOJA 1KMHB 1U2GA 3QUCA <