5B3KA

C101a mutant of flavodoxin from pseudomonas aeruginosa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
150
structure length
150
Chain Sequence
MKVAILSGSVYGTAEEVARHAQKLLSAAGLEASHLPRASLDELKAFAPEAFLVVTSTTGMGELPDNLQPLYYAIRDQLPAWHGLPGGVIGLGDSSYGDTFAGGGEQVRELFGELGVREVLPMLRLDASETVTPETDAEPWLAEFAAALKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Uncharacterized protein PA3435
publication title C101A mutant of Flavodoxin from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
total genus 51
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b3kA00
1H69A 4C76A 4FX2A 4YQEA 4Y9UA 5B3LA 4PU0A 2XODA 5LBTA 2XOEA 5F4BA 1QBGA 1CZUA 2Q9UA 2QWXA 1D03A 1AKTA 1SG0A 3W77A 1FLNA 1DXQA 3LT5A 1AKUA 4DILA 3B6KA 4BMPB 3N39C 3OWHA 5LMCA 4Y7CA 3P0RA 1DX9A 4CETA 4ZVNA 3OX3A 1ZX1A 2M6SA 2V9CA 4LTDA 3HLYA 4YAWA 5FX2A 2FCRA 1YKGA 1YCFA 1QRDA 1J9ZA 2M6RA 1QR2A 4N82A 1YCGA 3NHRA 1C7EA 3SVLA 2QX9A 3B6IA 4DY4A 3JSXA 4QODA 1X77A 3B6JA 3U7IA 1CZKA 1RLIA 1YCHA 3F90A 3OX1A 3HA2A 3NHSA 4QOGA 2ZKIA 4CF6A 4LA4A 3N3AC 4ZVMA 2F1OA 3EYWA 5LJIA 1T5BA 2BMVA 4QOJA 4H2DA 1D4AA 4S24A 3UXHA 1YRHA 2V5UA 2FAXA 1QHEA 4HEQA 4QOHA 3NFRA 1FX1A 4GQIA 3L9XA 5LLDA 3R6WA 3GFSA 5NLLA 4U7FA 1CZNA 1ZWLA 2Z98A 1J9EA 2KLBA 1FLDA 1FLAA 2MOKA 1JA1A 4NULA 1VMEA 3KAPA 2BZSA 3NHKA 4BMOB 4N65A 1TLLA 4M0CA 3ESXA 1KBOA 1DXOA 3NHFA 3FW1A 2X2OA 3OVMA 5ULLA 3QFCA 5EA2A 3OX2A 2QX4A 3NHYA 1CZRA 1AG9A 4YAOA 2HPVA 3NHJA 4XDHA 2QMZA 3F6RA 3ZHOA 3L9WA 1CZLA 1XYVA 3NHLA 4FGLA 2R96A 1AMOA 5FUQA 4GR9A 1D04A 1YDGA 3ESYA 2QR2A 4J8PA 2OHHA 3TEMA 2HNBA 1AZLA 3KLBA 2OHIA 1B1CA 1FTGA 4YAUA 1YOBA 1KBQA 3GAMA 3N3BC 3ES9A 3FVWA 1AKWA 2Q62A 5A4KA 1TIKA 2W5UA 1RLJA 3GFQA 4QOIA 3U7RA 2B3DA 3O73A 3HR4A 1OFVA 5NULA 4PTYA 2Z9CA 1FUEA 3KEGA 2FOXA 3D7NA 1CZHA 4N9QA 1AKVA 2QMYA 1AKQA 3OJWA 1FLVA 3G5MA 4QOFA 1WSBA 2HNAA 4LAFA 1AKRA 4ZVLA 5LBUA 4NLLA 5B3KA 1XI2A 2QX8A 3QFRA 3TZBA 4QOEA 3QE2A 4PTZA 1J9GA 2N1MA 4YALA 4DIKA 1FVXA 1SQSA 3FX2A 4U7GA 3FJOA 2MTBA 3K1YA 3OWXA 4F8YA 1CZOA 5EMNA 3K20A 1H66A 2FX2A 3F6SA 1OBOA 1BVYF 3LCMA 2Z9DA 4HS4A 5F12A 4FGJA 2FZVA 1XT6A 1RTTA 4ICIA 2WC1A 1V4BA 1OBVA 1BU5A 4ZVKA 2BF4A 1NNI1 3RPEA 2QX6A 5TGZA 2X2PA 4LTMA 4C0XA 4D02A 2FZ5A 4H6PA 3W7AA 5FA6A 3TE7A 2R97A 3UXEA 3GFRA 2BN4A 2ARKA 1T0IA 2MWMA 3KAQA 3W78A 4C0WA 2KQUA 3NHPA 5LVAA 2MT9A 3W79A 2FVXA 1J8QA 2OHJA 1ZWKA 3OJXA 3ESZA 3NLLA 2GSWA 2A5LA 5F51A 4YAFA 4GI5A 1I1OA 4XDGA 3O2NA 1RCFA 6NULA 3FNIA 1AHNA 1WSWA 3S2YA 1E5DA 4R81A 2AMJA 3F2VA 4C14A 3NHUA 3B6MA 5JROA 5BUCA 2RG1A 2BPOA 5LJLA 1XYYA 4U7HA 2D5IA 3NHWA 4Y9RA 2FLVA 1GG5A 2Z9BA 1F4PA 2FDXA 1JA0A 4LTNA 1C7FA 2OYSA 4FGKA 4OXXA 3EDOA 5EAIA 4ESEA 2V5VA
chains in the Genus database with same CATH superfamily
3QG1A 3G5LA 2D5BA 4N8EA 2VXYA 1ZSYA 1Q74A 3AHJA 5LLDA 1P9RA 3IBTA 4L22A 3DFKA 4AICA 1IQPA 3WADA 3F71A 1C1DA 3IQZA 4XJSA 2PVPA 1E7WA 2AXNA 1IVYA 3V33A 1P4HA 1Z4LA 1E7RA 2W2KA 3FWNA 4LRSB 5EMMA 1K1EA 1OWMA 1UKCA 2IKSA 2GPWA 3I92A 4H3SA 4P4GA 5EZ5A 1VLZA 5L45A 1E8MA 3IBCA 4KR9A 1WPGA 1UOEA 4DDMA 5JYDA 4GC9A 2EJUA 3EOBI 4KB5A 5JDIC 4DHEA 4RIEA 1W4BA 1E6MA 1JIQA 3VBEA 4DEXA 3QVGA 3D8HA 3H11A 1PDOA 4PLWA 1XTTA 4J0IA 3LNCA 3T9FA 1F6BA 1MB2A 2GPSA 1EHCA 3PXEA 2XMZA 3TL6A 2ID7A 3UV3A 3RVSA 1DG9A 2ZETA 1GPNA 5DASA 3VJKA 1OE0A 3AEYA 3IP7A 3L7JA 4H4DA 5C7LO 2IS4A 1PS8A 4WN9B 3C41J 4ZA2A 2FFQA 2MSCB 2PVSA 1N6RA 2HH9A 3E84A 3JD4A 4JXJA 2QD2A 4NMWA 4D2IA 1NWHA 4DCSA 2PT9A 2RHGB 4CETA 4CQNA 4OMDA 5HTOA 1CG6A 3ZGLA 2ZRMA 4MW1A 1IN1A 2R6JA 4HLUA 2D1QA 2EFHB 2IEYA 5FOVA 1PR1A 3TZHA 3ZY6A 4EI2A 1KK3A 2VSFA 2I0FA 2R48A 1E2PA 1USIA 3G02A 3JTEA 1HLFA 2NU9B 3TW0A 4C5CA 4LF6B 1PTKA 2D06A 2VHEA 2P2ZA 1O9HA 1SQ0A 1XZIA 3PNOA 4M87A 4XB6B 3PUVA 3VR5D 3T3MB 3PUWA 5IBCA 2IP2A 1Y0BA 5F3WB 2FX5A 1L8QA 1NUQA 2H1LA 4BL5A 1LVHA 3TZCA 4B44A 4YRIA 5L8VA 4N82A 3QXJA 4LPKA 3NC1C 5BURA 1OX6A 1IU9A 1I33A 1YCGA 4QBIA 5GJVC 1TAUA 3L1KA 3WIVA 3ZLUA 2AZ4A 4G67A 4MW4A 2AN3A 3PDUA 1NLMA 1B8OA 2VEOA 2QPTA 4JB3A 4V0QA 3RYHB 4AN4A 3SICE 1CJUC 3NO4A 2I66A 3NALA 2MHCA 3OD5A 3OE7A 4V0RA 5JCJD 2PKXA 2QE6A 4Y2VA 2HD4A 3MJCA 2BMAA 1PAUA 2IOQA 4Q6BA 4RY9A 2K6GA 1XIVA 3F2IA 4D6YA 4EYGA 3FB4A 4J2HA 2AEFA 3RYCB 5GONB 4U2CA 2LCQA 1E1QA 3NHSA 4AZ3B 2WV7A 5LQJA 3GRZA 1UBUS 4B6RA 4S2UA 3I76A 2OORC 2WZCA 5JC1A 1AF7A 3IAAA 3EPPA 3QLEA 3C3WA 1NJSA 3OECA 4PLTA 4DBLE 5M29A 4YASA 4MYHA 4YDHB 5DHUA 3PFHA 5J3JA 4WV3A 5FOTA 1XXHA 2EQ5A 4RK4A 3RKUA 2QMQA 2FK8A 4A2CA 4XYLA 5TVKA 3WAGA 2HJHA 1GQFA 1M5RA 1ZC4A 4JVMA 4V0LA 2A4MA 4PO1A 4JI3B 2JAWA 2ASVA 1RJEA 4UTVA 4FNAA 2ZYVX 3MIZA 3SI7A 4B83A 1BSVA 1R0YA 2XVAA 5CDYA 1XVLA 3KTDA 2COUA 1IPHA 5JSYA 3QE4A 3W5UA 1F51E 5EJGA 1OJ7A 1QFSA 3HKEB 3RUDA 1DKLA 1HOXA 3BVPA 4RA6A 4WCFB 5K8JB 4TMVA 1MIOB 2VJMA 4QQ8A 3K1TA 1MZVA 1JKFA 1E2KA 1GSIA 3PWTA 3SDBA 2W6ZA 4TZTA 2HRDA 2Q5OA 3AF5A 1MH1A 2VTDA 2W11A 4GQIA 4GRIA 5ERGB 5FL3A 1B14A 1H4VB 2WUFA 3OMXA 4M36A 4XQ9A 3W5SA 4W8HA 4QGGA 2QZZA 3IEMA 1WD7A 3K0AB 2I91A 4CKBB 1UMKA 1ZNYA 5BQ3A 5BR7A 4Y6RA 1RQGA 3VC3A 4XUCA 3CM0A 3O2SB 4TV9F 1OFUX 3A7EA 3C3PA 3WP0A 5T7BA 3JVEA 3B5JA 5JO0A 3GZJA 3DV0A 2IXDA 2SKDA 3P9SA 1J97A 4GBGA 3FM9A 1PYOA 3PPYA 1R64A 2Y27A 4WXRA 1G38A 4C4XA 3B20A 1W29A 1JKIA 4AY5A 2FX3A 1X7HA 1ZIDA 1XNQB 5AXCA 3RFTA 3HH8A 3CR3C 1FQJA 1P6QA 3AVYA 1RHKA 1CD5A 2FK7A 2PSSA 3G2HA 2C29D 4JEIA 3VR0A 3WK7A 2OQIA 3EZYA 4Z9FA 4OXNA 4DSTA 5CYGA 5JALA 1OY1A 3EF1A 3FLAA 4IJMA 4RKYA 5A2QA 4MWOA 1NBMA 3DKKA 3GUUA 4MS3A 5FWAA 4C7VA 2H16A 1S6YA 1P1FA 5FYDA 1BEUB 2ZBEA 4ZYZA 5AKXA 1ADGA 1M34E 3IPYA 4F5WA 3ZGXA 2XWQA 3ZD7A 2GZDA 2ZB2A 4GT1A 2F9MA 3NHFA 1IUPA 3BHMA 2PAFA 1JFRA 2Q3DA 2W8BA 2ZVDA 4L27A 3RHSA 3HVUA 4I50B 4B73A 4PC3A 4EY3A 3WSWA 3FI0A 3UJ9A 4RETA 4O4HA 4QBTA 2W2MA 5LOVF 5AXAA 2E55A 1EK0A 4RZIA 3VTZA 3DVRX 3TJMA 4ZHQA 2WAOA 3FMVA 5EA2A 3BH7A 5KJCA 3JS5A 1Y37A 1YJ8A 5HE8A 1G55A 3NHYA 1EM8A 4A91A 3KXPA 4DJFC 3VJLA 4OJMX 3W9BA 3WKEA 4G0WA 3K94A 2HBQA 3N0RA 2RHMA 1PR6A 2EGGA 2W6CX 3P4XA 1FRQA 1MB0A 4R8RA 5CB4F 1CUFA 4NDZA 2JI6A 3GXOA 4TMFA 5GMOA 2V7QD 3WIUA 3X1JA 3C3KA 3QHAA 3UWPA 2QLLA 6YASA 2JIBA 4YUZA 3G0CA 1BRMA 3G8DA 2QY9A 3H9EO 4UAUA 3L06A 1MBZA 3BC1A 3K6SB 5C51B 1JLSA 5HMLA 4JWKA 3DEHA 5CXUA 5F33A 3V1MA 3ZWOA 4TXHA 5A05A 3T4UA 4C4OA 5ADVA 5I7VA 4M0UA 2PUJA 5KDOA 2Q4RA 3HYCA 2HSGA 3U31A 2AUNA 2Z8YM 5J1TB 2HRRA 3HV2A 5DLEA 1TC1A 2PMBA 2QTFA 4IIYA 2CNNA 1ZK2A 1TK2A 2CFTA 3ZQKA 1SM4A 1TIBA 2XNHA 3TLEA 1U2GC 2HNBA 2ZSHA 3GNTA 5CT5A 3PNYA 4G4SO 3QJ5A 1XEWX 3K9BA 5ALVA 1ODLA 3B3GA 3I28A 1A5BB 1E79A 2P9EA 4LNAA 4C7OB 3K70D 5K3AA 1JZQA 3GCXA 3AT1A 2I87A 3GLKA 3N3BC 2V3CC 4QJBA 1ZITA 4NKRA 2BEUB 2HRBA 2JFZA 4QFCA 1PR3A 2HJWA 1P4AA 1H8HA 1N2GA 4RE6A 1JALA 1X0VA 2IXAA 3W2TA 2GAOA 4E2XA 2O2HA 5JTTA 4O63O 3RS9A 2ERYA 2POCA 4EEKA 4KIJA 4LHSA 5JRZA 3R0JA 3TKLA 5FD8A 2BEVA 1SXIA 3PJDA 1E1CB 2CK3D 2FSPA 3RVRA 3TTVA 3X43A 4B8YA 4CLEA 1PJRA 2WYHA 1QVRA 4Y9TA 1CIPA 4GGMX 4UXHA 3RWOA 1ZK3A 2VDKB 2PMDA 3DP7A 3ZDCA 1OYYA 4FS8A 1T2CA 3I6ZA 1NJ6A 1R0RE 2YWDA 1UP4A 3DO5A 4L8FA 3MJFA 4JOBA 1G3RA 2CLDX 2GETA 2QAGC 4E1VA 2Z9CA 4B31A 4ZRMA 4AY2A 4OO3A 4ZO9A 4M7WA 2DFVA 4BQPA 5KSOA 1S8OA 4DFDA 4QLOA 2GBFA 3ENZA 3H87A 1OWOA 2YMPA 3FSGD 4MKHA 1KH3A 2WG0A 3R7AA 3BL8A 3C3AA 4OREX 5CA0F 2G0NA 1G19A 2WYWA 1CP2A 3NNSA 2AEJA 2E4YA 3UENA 5AIBA 3HXQA 1Z4IA 3L6BA 4YMUA 4B33A 3WJ1A 1GADO 4XM1A 4C0AC 2OBNA 5LQRA 3W5BA 1XNRB 4MW9A 1X1QA 1HNWB 3DZFA 1EUDA 2H1CA 3UNXA 2GUWA 1N9KA 1OAAA 5KKCA 1QB8A 3W0LB 4Q4LA 3EPJA 2C2XA 2OGZA 4D0RA 4ERXA 2O3TA 4B17A 3QFRA 4FHEA 4QPDA 4UAJA 4IJ5A 1YS4A 2RB5A 4YALA 3FHJA 4PYMA 2IUTA 1QJ4A 1KZ4A 4H6XA 3ZY5A 4BFWA 2YQ4A 2GARA 3PE6A 3G89A 4UD6A 2RE8A 4PHGA 3PJEA 1G2OA 2DEUA 1VG8A 3RANA 5EXPA 1UFOA 1V3VA 2AZTA 2C4WA 2EBHX 1EI9A 2MTBA 2VCHA 4X7MA 3E2IA 5EJ9A 4PN3A 4JIGA 1DFHA 2Y8EA 3WB1A 1HL7A 2AMFA 2L17A 3NHMA 5BRNA 3SJUA 2G9QA 2G9VA 1CZOA 3L7NA 3U7FB 2FWRA 2GPYA 1T1SA 2KE5A 2IHTA 4F2PA 2HA0A 1N5MA 1T2DA 1IUNA 5ALNA 2Y1LA 5ICSA 1P80A 1MVNA 2WIGA 1Z5GA 3ZTYA 4ANFA 3IB3A 5ALKA 3EG9A 1QH1A 2AXPA 1THGA 5H16A 1K2WA 3WYCA 4CZ2A 5KTTA 3UMVA 1F0PA 4JYPA 1V5WA 3AP1A 3PNVA 3UT0A 2J31A 2L18A 3A2NA 5EZYB 1QG0A 5IF9A 5KX5B 3H1PA 2PMEA 4D43A 4KNWA 2GAFA 4CQLA 1JEYA 2Y1GA 4P3PA 2CVHA 1Y1KE 3R7WA 4Q4JA 2FE4A 1MRSA 1MUUA 3KPUA 3LOUA 1VGQA 2B1IA 1CXZA 4A9AA 3RFUA 4D8VA 1KYZA 2GI4A 5T64A 4AMGA 4MDFA 4Y2TA 2H1SA 1SXJD 3GWZA 3SCZA 1TD9A 5DO9A 4ZI7F 3A4YA 4TYPA 2VH1A 4GE0A 2FEPA 4LJ9A 4YCMA 1DQSA 4OATA 3GJ3A 3JQAD 5CGQB 1UK8A 5B2ZA 1GGMA 1CUJA 1K9VF 4MPJA 5FA6A 3RNLA 3U3JA 5JS7A 4FILA 1QHHA 2JFWA 2IXTA 3O1LA 5HGJA 5KNBH 5DK4A 2R97A 2ZYTX 4P31A 2NYVA 5DMXA 3EPKA 1MPTA 1U63A 4YJ3B 4PZZA 1JDSA 3HR7A 2HN9A 2QNIA 1UEIA 4R1QA 5KYTA 2VT3A 3WB0A 2YX1A 2IF0A 3ZJUA 1V25A 1EZ4A 3R6TA 1NONA 2J6BA 3GUHA 2CNWD 4HNVA 3GP8A 3PU6A 3ZCXA 3UICA 1OGJA 1IVSA 3BERA 1E5XA 4MWEA 3KEQA 1AQJA 2XUPA 3LIPA 3PENA 2FUEA 3GJ5A 4ZT5A 3USCS 2DETA 1F0YA 5JLJA 4JJKA 4X1YB 1SCUB 1S2OA 2QD1A 1H0RA 3EBLA 1FYFA 3E0QA 3PHBE 4ALNA 2P5YA 3F6CA 3HEAA 1IWOA 1Y80A 5TC4A 5IDWA 4QVKA 2J3DA 2QVYX 3PE4A 2WK1A 1MQSA 1RWVA 2PANA 2ZAGA 4XCQA 4BLOA 1KPIA 2QN9A 3KAJA 5LKAA 3VPGA 2ZJ3A 3HADA 1RRMA 1YB1A 1ZD1A 3UB3A 1UPUA 5CLLA 4B87A 2P27A 5LDDC 5K3SA 1GYQA 3MRSA 1A2BA 1WD5A 2AOUB 1MRZA 5FA8A 3ZGZA 3DE7X 5AK4A 2AYXA 3L8HA 5GP1A 3KJHA 3PDIB 5FCDA 4A8JB 1E2DA 3HUTA 2XGSA 1P81A 1Z6ZA 2RCNA 1CR2A 4GVPA 4ZVQA 4WCVA 3OZUA 1YZNA 3PLRA 3GOHA 2V54A 4DR3B 4R6XA 2HFJA 5KSZA 1T43A 4GSKA 1GTMA 4K9OA 3DFUA 1IBLB 1QHIA 1KI6B 2FQQA 3O8BA 2GN8A 4XIYA 1HNZB 1XSEA 2WAYA 1ISHA 3GFOA 3GK3A 2X8JA 3AR8A 5JCPA 1JVNA 1DOZA 5HILA 4AKGA 4KYTA 3RBXA 4S04A 3BTSA 1UBSB 4QL3A 1QUEA 1SU4A 2V58A 2YJ3A 2JIRA 4MA0A 4RH3A 5JS2A 3ZWDA 3DNMA 4E6PA 2O3SA 5EVCA 2HSWA 4A2QA 2Y1KA 3G2LA 3PEEA 2PZLA 2Y9MB 5F5NA 1XXHE 3F5DA 4OQMA 4AFNA 2OCIA 4R51A 2A7QA 1U3DA 2H9AA 2JPDA 4MUYA 2V6GA 2REOA 1I6MA 3RSLA 1KP3A 1YOVB 3H3FA 1CERA 1WR8A 4PWYA 4R1TA 5ES4B 4BLTA 4B82A 3OA2A 4K9SA 1P45A 2W90A 4PYNA 2B8EA 1LS1A 3K16A 2YCLA 3D6UA 1O94D 4FW8A 3OOWA 1K8XB 3C6QA 1F4PA 3O8NA 3SX2A 3JAWB 2GJKA 3B8HA 2WTAA 1QCYA 2YNMC 3COYA 1JP7A 4BV9A 2SICE 1VMIA 2YY5A 2B6HA 3D3NA 4CR7A 3GF4A 3F0TA 4FM9A 4H1UA 4C87A 2VJNA 4FGZA 4IXDA 1G8GA 1V41E 1YQTA 3GDOA 4UVDA 4C9BA 4JB2A 2QX7A 5BWOA 4GMGA 4LZJA 1L6RA 4B6SA 1V47A 2HF2A 2PMFA 2XHZA 3PUHA 5FTJA 5G1OA 2J5KA 1GYPA 2ZRKA 3OT1B 1QVZA 1EFRA 5FFFA 4BFVA 1TPZA 2VI5A 1EP2B 3S8EA 5TXGA 3BXFA 3DZIA 2I67A 1B2LA 2YXEA 2AC2A 2I4OA 4IMIB 4KIWA 4YT4A 2W2NA 1G42A 3T1HB 1FRFS 1ENOA 1H69A 4G5SA 4DR2B 2WM2A 3KZNA 5DNWA 4B3SB 3RIMA 4M76B 4DUYB 3EIEA 4WLUA 4RWEA 5H70A 4KAAA 4RWZA 4LQLA 5JVDB 1Y42X 2Y77A 4K86A 3M4XA 1DXHA 1JR3D 5JZ9A 1Y6RA 2ZJ6A 5ESXA 4DXDA 1Z5UA 3DDNA 4IOMA 1AUVA 4YMWA 3S29A 1JXMA 4JELA 4F97A 2F3TA 3V7FA 3I39X 2J08A 1DVRA 2GX6A 5FNVB 3JZMA 4OI1A 3TIVA 4DARA 1M10A 1RP1A 2IOHA 1EBUA 5G0TA 4J4BA 4IOKA 1VI2A 2ZXFA 3CKYA 2B6NA 1UPCA 4RMHA 3C8ZA 4KPUB 1SHTX 5FV7A 3SHOA 4IJVA 1J99A 4LXHA 3KQVA 5I3CA 2X58A 2Z5FA 4D80A 5FWXB 4NYMQ 3K9QO 4WKCA 1U5BA 1UK6A 2J07A 1UPTA 3GFPA 5CLFA 4DILA 1H8ED 1ZNZA 2D2FA 2YHSA 3B3AA 3JZAA 4K81B 4IR7A 3WWCA 4DGSA 3OWHA 1LNSA 1KOGA 3MGCA 4OL9A 4Z3OA 1FUUA 2O2ZA 3AF3A 3E8XA 1L6IA 4Y1RA 2AKEA 3KYIB 5FEUA 3W9UA 4H4CA 3P9QA 3KC2A 2D7CA 1RQRA 4UE2A 3TI9A 3OX3A 4PG7A 2I4IA 1OFUA 5AI9A 1VLMA 1L4GA 1MENA 1RM0A 2CD7A 4J0CA 3KWLA 1AIPA 3A8TA 3Q0TA 1GL9B 4NE9A 3LFTA 2KLHA 1QZXA 3GRCA 4B4VA 4M9SA 2HT6A 1CY7A 2Q2NA 4S35A 3S1LA 4L95C 1CV2A 4G0XA 1JQEA 4TM8A 3OZAA 4BO3A 1EDBA 4ZC1A 4BU0A 4F93B 5KYYA 2XZLA 4FQ8A 1LW6E 1E3DA 2QJWA 1E4EB 1SXJB 1WCIA 5H7XA 5E1OA 1JHXA 3SS9X 1EB8A 3PPWA 3UMBA 2MSNA 3I9V6 5GONA 5K0BA 1TT5A 2FJUA 2FPKA 4JUCA 1MV8A 3JQAB 1KY2A 1WUYA 3H9GA 4IUBS 4OA5A 4A82A 2BM1A 4QU8A 3DLHA 1YGPA 3BD9A 1KZ9A 1T1GA 2QTBA 4JBHA 4EUNA 2AS0A 2CFCA 2CFOA 2FWJA 3GARA 5AOVA 3E82A 1CCWA 2ANBA 2BSQA 3AONB 3BCUA 1OTYA 1Z4MA 2CLHB 2H7YA 4MS4B 5LB4A 5A04A 3D3WB 1UBFA 3UK7A 4RJIA 2WLSA 2O3QA 2UVQA 3LUFA 2PX4A 3MWGA 1GGVA 3I9OA 4Q3BA 2OZEA 4KXNA 3UEOA 1XDGA 5AUPB 5I4CA 4IJ6A 1OOEA 4TYWA 2AFIB 1AS3A 3PVCA 4CT5A 3K0HA 4MQLA 5HKOA 3C45A 3RTAA 2GZRA 2BWJA 4BXOB 4I8DA 1W6RA 3HLTA 3REGA 3H1BA 3OAAA 3AHIA 2CMFA 3EULA 2PSEA 4WCFA 1JIKA 5TMBA 3S2GA 1N34B 1Y9AA 2GEBA 2Q3JA 4D25A 1KJYA 3QPUA 2DUWA 3K31A 1D1TA 2NO6A 1CJCA 2VSXA 4DNOA 1T5BA 5JO9A 5A1TA 4FOTA 4LE2A 4MQ6A 2I1VB 3T0IA 2BZ1A 2HB6A 3KO8A 4OFBA 2PZBA 4PPQA 2VRCD 3O4JA 5EIBC 3GIWA 4R1MA 4C4AA 4CKBA 5HK8A 3NGMA 3AEKA 3AIKA 1DC8A 3PHJA 1QH0A 3KOWA 4LXQA 3I9JA 4O1IA 1F3LA 4B43A 4AROA 3VQTA 1P3Y1 4PTLA 4RYDA 3KL2A 1D2GA 2VBCA 2X1VA 1IQUA 1UEJA 1NVVQ 2OT3B 3COWA 1P18A 2P6UA 3LQ4A 1A71A 4MRMA 4B2PA 2ILVA 4CCYA 2I4LA 4UTZA 5ES3A 4Q7JB 3TPCA 4RGVA 1F2TA 3OMWA 3I62A 2WABA 4G4IA 4QFMA 1ECLA 2Z98A 4RXMA 1L4MA 1IH8A 4G0QA 5JFTA 3K0CC 4BBAA 2PKQO 1O7JA 4K26A 3GRVA 1Z5ZA 5IVKA 2YY7A 3KBOA 3K6RA 3TXAA 2WQ6A 1TADA 2H7XA 3KJEA 4IIUA 1JG1A 2IOYA 4LKRA 2YS7A 5E1BA 1L5HA 3IDOA 1OAOA 1DT5A 3VU8A 1GA4A 2QGFA 3CMCO 1DTSA 2VNJA 5JWHA 2QTTA 1XCBA 2VDUE 1IG3A 4HWKA 3ZWPA 2H06A 2WYVA 1QM5A 3QNWA 5CLJA 4GUDA 3LCUA 3KAPA 1VHWA 3KSRA 4CV3A 5KTPA 3K1JA 3NV9A 4DMFA 1ZOOA 5JAZA 2BZSA 2ZUUA 1JFTA 2FLKA 4JFRA 4GKKB 1XD9A 2V0CA 1S4QA 4A6PA 8GPBA 4JZKA 3ISTA 1CBUA 4KQJA 3D6FA 3DBLB 2XWJI 3LFUA 4C6RA 4BP8A 3SC2B 1W2WB 4NVRA 5KS2A 3G2KA 1WBDA 4F38A 3M3HA 5IUKC 4EJFA 5JNLA 2DFTA 4MYCA 4NCIA 4R8MA 4HWPA 1EYZA 1ULUA 3IEPA 4JLWA 3KYCA 1NW8A 4TLEA 3QU5A 3UOGA 4E11A 3TI7A 1R18A 2WHQA 4HDCA 5FJJA 1GPH1 4ILKA 1YAHA 1ULAA 4ZEVA 4DYDA 2R66A 1YC2A 2ZRBA 4QU5A 5F9MA 4BKMA 1CTQA 1F8FA 2XE4A 2FSVC 3L7CA 3SR4A 2GM9A 2RHTA 3LG2A 3KKLA 1WE2A 1F7UA 1H0KA 2ECFA 1IY9A 2HWWA 2XDQB 4LWOA 4ZCPA 2M2IA 4OFZA 1YRQA 3IL2A 1USWA 4QFBA 2FSGA 4PWZA 4IHJF 3EOAI 1VIVA 5GGXA 3RVPA 2JHGA 3G49A 3NHJA 4G36A 4GDFA 2R47A 2P8JA 4P53A 2WU1A 2QZ9A 1G3UA 4OK6A 4MV6A 2V5AA 3B7GA 5G1PA 3UAGA 3LXRA 2OCYC 1WEKA 5H81A 1JLKA 1T5TA 5EQFA 4OY3A 5JAUA 5JNRA 2XBMA 4RMNA 2R96A 4R05A 1N4AA 5JSZB 1VXRA 3QW4B 4AJEA 4B4OA 2R84A 4YCDA 3FNHA 1AM4D 3E58A 3RSQA 1QYVA 3GLHE 3HJAA 5CJJA 3L1JA 4R2KA 1NUPA 4FYMA 5D3KA 3G17A 4RW0A 4NMXB 4M1YA 5COAA 3CJTA 4W7SA 4EJ6A 4F1JA 2PLAA 3KZKA 2NU7B 3WO0A 4EL0A 3VC1A 3FCSB 2ZRHA 3JQ9C 3KBBA 3MLEA 2HYDA 3VPAA 2I2WA 3K09A 2NU8B 3TQHA 4WK2B 2PZGA 1KI2A 4G9GA 5D00A 1LTHR 3I6YA 1RIFA 2LIVA 4RTKA 4YMIA 2ZIUB 5G4LA 4AS2A 1AF4A 2KPOA 3EGXB 5JQWA 1EX6A 3LOPA 1NLYA 4PXAA 5K2MA 2VNKA 3FD8A 4C06A 2FW1A 1RE1A 3AUYA 3UANA 3H4IA 3NC0C 4KJXA 3OT4A 4HS9A 3UWMA 4O6VA 5JCJA 3I4LA 3DUWA 4AS3A 4ARIA 1EFPB 3I9KA 2WJAA 1DZ3A 4JI0B 3CH6A 4MR8B 3U7RA 2ZOSA 2B3DA 3IUBA 3GCGA 4UZEA 3NXSA 1RJDA 2JH9A 3O73A 4JYZA 4AP6A 1RLMA 1PGOA 2C4VA 2XNKA 3HB5X 4JJFA 4MX8A 1PS9A 3ZI4A 4DG8A 3UKJA 2FN3A 4EHNA 1WDMA 4OLAA 3K0FA 2Q3BA 4I1VA 5EP3A 3U2QA 4ZAYA 1T36B 2YIMA 3U56A 4IQ0A 2FLWA 1RXVA 2F17A 2GD0A 3BQMB 5BSTA 3VA7A 2IZ1A 4REMA 4FDUA 5K4HA 3TXYA 3SFVA 3KB2A 2ZRQA 1D4FA 1YKSA 1CULC 3E6AA 3MRVA 3P1JA 2WT8A 4X8HA 5B30A 4IKOA 1J1UA 3GI1A 3ME5A 4I9HA 3M70A 3HYLA 4LAFA 2VIIA 1MTZA 1ZPDA 3OE5A 3PQ8A 5K0CA 4ENSA 1VL2A 3TIGA 3I9NA 2IQIA 4AM8A 2FRXA 3RROA 1YE8A 5AI6A 1V8OA 2GFQA 4E51A 4FIZA 1TVMA 1PWXA 5KVAA 3AI7A 4N40A 2V59A 5C3UA 3ZE2B 5AW6A 3R8FA 5CFQA 1WJGA 2GJSA 6AT1A 3ACCA 1I01A 3LVRE 4PYLA 6GPBA 4UUAA 3E7FA 2CHQA 3FTDA 3UPDA 3F8WA 5KNBD 4PTZA 4IWNA 3S2SA 3CCFA 4ML3A 3VU9A 1Z37A 4X20A 4FBLA 1U9CA 2Y99A 4YRGA 1Z38A 3FYUB 1SUPA 1G8AA 2A0UA 2WPDA 3VH2A 3ZHSA 4MVJI 3ZJ4A 4BLWA 2VBFA 1WZNA 1TUEA 1ZVJA 2J33A 5JD4A 1HDGO 4LI0A 1A7UA 4M89A 4Q5IA 3F3KA 2TYSB 3M81A 3Q7SA 4G0YA 2YJTD 5KX5A 1QPZA 1AKNA 4OHKA 3UMSA 2I29A 3L04A 4GM4A 3K20A 3IQHX 4OIFA 4HDOB 2QT0A 1BVYF 1GPLA 1M1NA 1Z22A 3UQZA 3WFJA 3ZCRA 4KXLA 1K3FA 2EKDA 5G4KB 1HTBA 4YI5A 5DP1A 3I23A 3X1XA 4MLPA 1R0ZA 3FMGA 3NYRA 1CKEA 1JSXA 3UYKA 2WC1A 4R4JA 4RORA 2D0IA 1OD6A 1IM8A 1OBVA 2OCDA 3HZZA 3PL5A 5M04A 3UKOA 3OC0A 3CRNA 1P7VA 4MRNA 4ZN6A 3N5CA 4KUHA 2V7TA 3MCWA 5I47A 4A0FA 3EMVA 4I1PA 5COQA 2ZUBA 3Q3IA 2B3TA 1XN4A 1C9DB 5CR9A 5C4GB 4BNDA 1ISGA 5B6PA 3N9IA 3R41A 2VHJA 3H18A 5BR4A 5AKEA 3ZVRA 3PSHA 5AI5A 1QIDA 2YCBA 4EZBA 1ZRHA 5JYBA 4MICA 1U8UA 2WIDA 3ZE0B 4HXGA 4KWHA 1SB8A 2HKIA 2WD8A 4TX1A 3QUCA 1REQB 3FRHA 4D3ZA 4G8BA 2ZAYA 1YNOA 5DBFA 1QIHA 1YNSA 4FHFA 4I14A 4S1TA 3WLAA 1GAEO 3KQYA 4L75A 3CVWA 2FW0A 5I8WA 1UK7A 3FG9A 1YUBA 7MHTA 5MFPA 3O7MA 2BR4A 2PWAA 1WF6A 2ARKA 1JQJC 1XVAA 2JASA 2X5NA 5M5BA 4X85A 4OXIA 3L84A 3EZ6A 1CUEA 3AUAA 1NXTA 1V37A 1PK9A 1G5FA 2QRKA 5IBRA 4D4MA 5DT9A 2F8TA 3T3IA 1TQ6A 4RM3A 4TSFD 4JENA 2GZMA 2PXCA 2RHHA 4PLGA 4JT2A 3CISA 1BS9A 821PA 3QTTA 1I13A 1AXEA 4CQJA 3OESA 4BZXA 3CUTA 3G0BA 2FW8A 2CL5A 2O0HA 3PJRA 1EE2A 4L74A 1CJKC 4AJPA 1R15A 1P5FA 2BE7A 4J1QA 4YWJA 3WLKX 2OAQ1 2OV4A 1BYUA 1CRWG 1X1AA 3PDIA 4XB1A 3CXUA 1ZWKA 3HKDB 5F2OA 4Q3OA 4LZAA 1CY4A 2X9NA 2P35A 4EYQA 1W46A 4I1RA 3V5NA 4RVGA 2HA7A 2ZI5A 3FDZB 2A5LA 2QPLA 4HLCA 4ID9A 3PF9A 3JYPA 5HHTA 3WNCA 4YAFA 1HPLA 2HADA 1HL3A 2WAMA 3CZMA 1Z33A 5DHQA 3UWKA 4DZTA 1OTXA 4QUDA 3A6PC 5IC6A 4EVIA 5AFSA 5HMMA 1ZGAA 2AI2A 3P19A 4IW3B 4B1FA 1K6MA 1MX1A 2PQMA 5LR6A 2QU7A 3B1JA 2K2WA 3D6AA 1BN6A 1VHQA 1WKBA 5AI4A 5FWYA 2WUGA 1U7PA 2DWCA 3I5YA 3V4PB 1MO2A 3P52A 3LLUA 1DUVG 3A2MA 4II7A 3JQGA 3L7LA 3L93A 3RYFA 4I9GA 5CYPA 5EPOA 2IL1A 2B4TO 3LX8A 4M0PA 4X8OA 3ZIDA 4FBMA 4URXR 3KEFA 3BD7A 4D82A 3A6KA 4B3JA 3MB5A 4BWFB 5AK5A 1PVVA 4FC6A 2B0CA 1KJ8A 3C24A 1GUBA 4WWHA 2ZAIA 3RB8A 1HE4A 3RR2A 5TQ0B 4CM7A 5A5FA 4RY8A 4ZAFA 3VV3A 3DHYA 4QC2A 3MB8A 5LQNA 3R3WA 2X19A 5MDHA 2BSAA 1RC1A 2IYXA 2H08A 3UT5A 1ZOLA 3BX1A 1LV7A 3VVMA 3SJAA 4X61A 1BQ4A 3O31A 5F3RA 2JL1A 3F96A 5K6TA 3EVDA 3BXPA 4TXMA 2FDXA 1S02A 2R3SA 5A9SB 5I3ZA 3FSGA 3TLYA 1DTEA 2GN4A 2F00A 2GPAA 2J4DA 3G7NA 4QDUA 5KQGA 5KNDA 1IQRA 1STOA 4J1SA 4HGYA 3GAFA 5BSKA 4DSNA 2VC2B 4RD6A 1CSEE 4YT2A 3OMLA 3O1JC 4PSUA 3TW8A 4FQ5A 5I7SA 1JJ7A 2FSIA 4KTVE 4WUTA 4X97A 2AVNA 1G63A 3ROEA 4DSAA 1U0SY 3JD3A 3LECA 4OYYA 3A26A 4RD2A 2EW8A 2YXBA 1C4KA 2R85A 4KN6A 5IN4A 1GITA 2PYDA 1H65A 2P68A 3HP7A 2FWNA 5FBHA 4G23A 4F71A 1XWFA 4EEZA 1NOKA 3JQFA 4W82A 3DQQA 3O0TA 5IT9A 1H3EA 3DO6A 5L40A 4NPHA 1ZUHA 2H2GA 3MEQA 4FX2A 1VCIA 4RAOA 2HJVA 3ODGA 4DPLA 5JADA 1NAHA 1J4AA 1KOFA 4DJEC 2X0NA 4CKCB 4QG7A 4DUGA 1SQFA 1XHEA 5AO9A 3HY6A 2G82A 3SYKA 4P0TA 3EUFA 2UZ1A 5CD9A 1KH2A 3CPHA 1X3LA 4WDQA 3CPJB 5JZSA 3VSBA 1TKRA 4IDPA 1D03A 2XPCA 4XRGA 4C3UA 3CEJA 1P0MA 3UMCA 4IFEA 1BHO1 1S2NA 4BO4A 4EY5A 2SHKA 5HBGA 3MC1A 4LV8B 1NVDA 3STHA 2CEAA 5BW4A 5I7OA 2GKOA 1ID8A 3CZPA 2FEOA 3F3SA 2LUOA 1W0KA 5ALSA 2Q8PA 5EEHA 2W6NA 1M2VB 4BMPB 2MSDB 2J0UB 2WNSA 3KUDA 4JJEA 5LZ8A 3D7SA 4HWGA 4M53A 1Y9ZA 3GQVA 4TVSA 4KAJA 1JEEA 3HUUA 4YJ2A 2WVAA 1UOQA 4CKEB 4UMDA 1K4MA 1GG9A 3FPSA 4J7UA 2E5LB 4FWBA 3MVEA 5DTRA 2GKSA 4FGUA 3VYVA 5FR1A 5AW4A 4KBFA 3WKDA 2VBGA 4AT1A 4HZUB 4CFYA 2EZTA 2O7RA 2OGUA 3AETA 2Y66A 3LBAA 1LQTA 1ELOA 4FZRA 4KDRA 5DP2A 4AJ9A 2QRQA 3KQKA 4FVTA 1LPAB 3HU1A 3P9NA 4NV1A 1DCKA 4DLLA 4AZVA 3BH0A 1PLKA 4OK5A 1KHTA 1QU3A 4C4PA 2FZEA 1OLSA 3H75A 1LBIA 3AFHA 4JP3A 4A73A 1C2TA 4DC9A 4UEWA 4P4SB 5DYTA 1HX7A 3RTGA 2ZJ2A 4JVSB 3EGVA 3CT6A 2QW8A 1T9GR 2NWQA 3GD7A 3ONVA 4PZLA 4BBZA 1EXVA 3N7UA 4D3XA 1ADJA 1QQ6A 3HDJA 5AKJA 2CNWA 4DY4A 3Q8LA 2O8EA 5T67A 4E2FA 1U2RA 1OWLA 1UOPA 3W6OA 5C8DA 2HDWA 2AFIA 2IUYA 3JWPA 2WBLC 1DB3A 4HAYA 4ISCA 3B70A 2JFOA 4J0HA 8MHTA 1ECCA 2GYWA 2HGZA 2OXFA 4O4LF 5DPMA 1EFAA 4BKUA 4PFSA 3BUSA 2NMVA 2BTOA 3LQRA 2RHJA 1Y5MA 1KYYA 2QT9A 1ULBA 3ZVLA 3KSDO 3P0HA 3KG2A 3FYHA 4Q4HB 4ZOEA 2EOAA 4LVCA 2VTBA 1TTTA 2H1OA 1V9LA 3E5MA 3GJSA 4K2HA 2XMBA 4OJQA 2D54A 3MFQA 3L18A 1WB4A 4OGFA 2ZYUX 1JJFA 4YUAA 2NO7A 1I7PA 1G21B 4MR7B 4BMYA 1LRJA 2PGIA 3PEFA 3QBJA 3FUXA 3ORFA 4QKQA 1PQPA 3RJTA 3E15A 3FTEA 2GN2A 3KTOA 1QS0A 1HEUA 3JPYA 1X7ZB 2JHAA 4M1TA 2ZT5A 5JFOA 3ZLJA 4WLVA 1NW6A 3IAS1 3KQOA 3AEXA 4DV3B 2YJ4A 3UV6A 1QIIA 1M33A 4NBLA 4TWBA 1OZGA 4RESA 2IS1A 3RAFC 1WA5A 2ZE7A 2ZJ0A 3SQDA 1EJ2A 3VOSA 1ZD4A 3OTWA 3OQVA 5DM0A 1QO0D 2GHQA 2OV6A 4WT7A 5C1IA 2RGYA 1RYHA 1DC4A 1FL9A 1JSLA 3AKCA 4TUYA 4DA0A 4OL0A 3G2QA 1SH7A 4ND6A 2CCJA 1KI9A 2HNKA 2XA2A 4FHCA 1EVIA 1TJ4A 1UKEA 2CUNA 1YZLA 4J1TC 4RMIA 4RPCA 1NLZA 1J5PA 2ZB8A 3AIOA 4DM7A 4DOMA 3N8GA 4QJ3A 5JS6A 1EDZA 2PX8A 1M6EX 2WWHA 3OIDA 2FFBA 4AYXA 1PO7A 1XN1A 1IN6A 3OSUA 3ZCPA 1NDHA 2REXB 4Y2JA 4ETIA 3HYRA 4V1CA 3I5AA 2F43A 4UZFA 7ADHA 1ECPA 4CM3A 4LMBA 5IZ4A 5I8ZA 1QIKA 4AP5A 3T1YB 1HURA 1JF8A 1S7GA 2VAVA 2KLBA 3EA5A 4MGYR 5KKNB 1SELA 4AJHA 2WICA 3LBYA 3VZRA 4S12A 3TWOA 3RVBA 3N2NA 4F11A 1U2DA 1WY5A 1NRXA 1CP3A 1E69A 3KQLA 4DV5B 2CN1A 2QD5A 2I3AA 3EIHA 4K2AA 2D2IA 1YDMA 1XCGB 4R2MA 2P9YA 1X86B 1DINA 1XZCA 2FPPA 3C5EA 4JGBA 4NOLA 4QQKA 1SUIA 1U3FA 2Z3VA 2Q6VA 3LZDA 5I9MA 521PA 4R9SA 3VC2A 6ADHA 4OJNA 2J5RA 5FOQA 1PQWA 2XGOA 1AN0A 2BD0A 3EPLA 3JQ7B 4G5HA 4XUGB 5FPPA 4OFWA 1FFXA 4H7HA 4HFRA 2D62A 4BO5A 1SQ6A 1SWWA 3GRKA 3TN7A 2WUVA 1QRRA 2X15A 2GXUA 2IZ5A 3I04M 5CHEA 4FHDA 1IN5A 2A5GA 4RV9A 4EKNB 1NE2A 3D5TA 2HDHA 1GT6A 1GNVA 4Z4CA 4KN8A 3QLJA 4X6LA 1KMHA 3QPBA 1R6VA 5T8KC 5KNCD 3LCCA 2YUIA 8LDHA 3IUQA 4G0VA 5JAIA 4GQBA 4QUJA 4AO8A 1WCYA 2BUAA 2QUAA 2XDQA 4QRIA 2OHGA 3IUPA 1JR3A 4M22A 1GSHA 3IJ5A 3JV7A 2M1XA 4RC9A 4AURA 4DAEA 5FFNA 2G7ZA 3J80A 2P0YA 1Q1BA 3QFCA 1ZY2A 4LE0A 5AM1A 1HZZC 4CN9A 5C80A 1VMDA 5H5JA 4Q6WA 5EJEA 4B09A 1N1DA 1RRCA 2G0AA 1N36B 3SEZA 2C4UA 1BOFA 1B8NA 1AG9A 2G67A 4IQ8A 2EKQA 3U49A 3QPAA 1Z0FA 3B51X 2EIHA 3IOEA 2A9QA 4N8DA 4RQUA 1PJSA 3IAM6 2NU6B 1M1YB 2J48A 1R0KA 5F2KA 5BR1A 5FL7D 1CY6A 3AQIA 3DMNA 3VU3A 1W49A 4A15A 4J1NA 1C30B 1G3MA 1Y1QA 3N8HA 4MW5A 4PX5A 4EGQA 4BTVA 1MHTA 7YASA 3F98A 1KJIA 4DA9A 4HWSA 5HF5A 4B48A 3KJZA 2ZPUA 3IPCA 2D0OB 1CR6A 4ZQCB 2GYYA 5AKKA 4D9FA 4ENVA 5LYJB 3ZVKA 3GWGA 3RFCA 2J45A 3QFFA 4BVEA 5DCWA 4XGRA 2QHXA 3IJEB 4X3PA 3M82A 4X3CA 5T3UA 3SJBA 3G23A 5DM60 4B3BA 4Q9LA 3LHSA 5HXAA 1NBHA 1P6XA 3V1NA 3KXIA 2XB9A 5IUJC 2PMWB 4MR8A 2CLKB 3L5KA 3H1GA 1GQRA 1ZI6A 4KFSA 3KE8A 4PXYA 1KAEA 2OECA 2Z0MA 4R68A 1PT5A 5JDIA 1Q1EA 3DDCA 2QYOA 4AS1A 4C4RA 2R1VB 1FPMA 3HEBA 4NF2A 3MFYA 1XJCA 3AWDA 5DK6A 3RD5A 3TD6A 1NJFA 1I7DA 1BX3A 3EXEA 3O2JA 1TKBA 1C8KA 1KI1A 3IEKA 3LYHA 3CUKA 5K09A 2JZCA 2CLEB 4MJ3A 2AN9A 2HIMA 1H0SA 4G8CA 3MUEA 2NQ2C 1BXGA 3NZEA 3X1MA 1IY8A 2OP1A 1NVKA 3AVWA 2P78A 4D56A 1A0OA 1L5GB 3E9NA 5AWFC 3OETA 4ZHSA 4OGGA 1NVMB 1NVGA 3PXUA 4QXOA 2ZM6B 4NZYA 3O8QB 4B76A 2ZSFA 2JGIA 3ENKA 3TLXA 1K7SN 2VAXA 3GHHA 3LBHA 2CF6A 5L51A 2QMYA 2RFLA 5A5EA 2NP6A 1MAAA 1UM9A 1FVFA 3B82A 2V98A 4ZCQA 4Q1DA 1WPQA 4PSAA 1TRHA 1JDZA 2CLLB 4M1QA 3EASA 5JPDA 1SCQA 2K87A 5LP1A 3F8TA 2VJAA 4CMIB 1U2PA 4INAA 2C5FA 3DB1A 3OPQA 2VOJA 4WGGA 3UHOA 4E94A 2WIBA 3VHRA 3U7QB 3GNLA 4MMYB 3VC7A 4PSKA 3S8MA 3O3CA 4ZEMA 2C96A 1E0KA 3S27A 1ULHA 2R4TA 2ZJ8A 2H54A 3B52X 5I7FA 3RJMA 1W4RA 2C59A 2A2ZA 2XX3A 3USZA 4WY5A 1KARA 3R4CA 2CDBA 5H4HA 3SIRA 5T4FA 3QKUA 3TZBA 4MYTA 2W37A 1P2GA 3OHSX 3PC8C 5D5HA 1JHRA 2QIPA 3KYDB 3IBYA 4ZODA 3VO8A 1T9AA 1K8RA 1VE1A 1V9CA 2E9SA 5FWNA 5IK2D 3PQFA 1JFSA 4MEBA 1UC4B 4UW9A 3PUIA 4MCAA 3UFXB 4C7KA 1N9ZA 2J7PA 3OCUA 1MA0A 1ESNA 2OORA 3O47A 1K63A 1NPTO 5IC5A 3EEFA 3OWXA 1X1CA 2GEKA 4LJ7A 1ETHA 5AOBA 3AL0C 1H66A 1OB2A 5FP0A 1EK1A 4OP2A 3L4SO 2I4TA 4P58A 1XVVA 1Y9DA 1HSZA 4FNOA 2BBWA 3I6BA 4KQ9A 1P62B 3A3OA 4OJTA 2Z9DA 2R1TA 1VZ2A 5CK4A 5JG7A 4FGJA 3SXUB 4DNXA 3I8XA 1Q19A 4Q4AB 2EX0A 1Y4UA 3INRA 4KO8A 2HUNA 4CG1A 2NNWB 3MTDA 2XHEA 3MMSA 2X0EA 2CXOA 4OSOA 4CKXA 3MPUA 2VDPB 3EOZA 3JAKB 4LXGA 1UBOS 4OQDA 4Z7NB 3W1EA 5GZ3A 2R4QA 3ICPA 1OU4A 1VJ1A 4JA0A 3AOGA 4UREA 1JHAA 2I62A 2PS1A 4O4HF 1EJ0A 2RGDA 4FFVA 5TS2A 3UWOA 5LP6B 3QPDA 3RIYA 2BP7B 1L5WA 3I45A 5DM1A 3V80A 1PBTA 4BUZA 3QEMB 1JWAB 4MI1A 5F5LA 4YR7A 4ZHQF 1II8A 1GFSA 1PW7A 3NKLA 2FF5A 4OLHA 2WJ3A 4WTOA 5GY7A 3HPRA 3DW1X 1T1EA 1KSGA 1U4SA 4Q1CA 1NSFA 2YS6A 4BGUA 2DHRA 3WGGA 4JJ7A 2RC5A 4R5MA 3IMKA 1RS0A 1Y5RA 3MCAA 3RE1A 1VCMA 2WG2A 5JAPA 5KYUB 2JFPA 1V0JA 4QAQA 3NHBA 4BP9A 4AI6A 4LKOA 3ZVNA 1Y3CE 1OI4A 4ZJPA 3E0XA 2AYZA 2C2WA 4GNKA 4QECA 1YMVA 3MT9A 3P2JA 1OX4B 5ALQA 3TTTA 3SQLA 1GG2A 3YASA 4EENA 1RZ3A 2BH9A 2JGJA 2W6QA 5DDIP 2PE5A 4BDSA 1KFKB 3ET4A 4HR7A 4CTOA 1U9YA 4ZZIA 4BO8A 1MG5A 4GYYA 3T12A 1OC4A 4MUKA 3U3KA 3TX2A 4BNKA 2BBSA 1NUTA 3L7MA 1KP2A 3CHYA 3F7OA 1U8XX 4ZKDA 2QUZA 3VM6A 3BB4A 2QBYA 3FDZA 2O3UA 1SXJE 2YFKA 3PDCA 4LOIA 4MW2A 4TSKA 4WOJA 3TD2A 2EP8A 2F3UA 3OKFA 1PJAA 4R1LA 1M54A 4IHKA 2FVXA 4WKPA 2HJRA 1RYDA 3LBFA 4DQLA 4ZAXA 4B34A 1GGHA 2EP5A 4G5FA 5KYNA 4B6OA 4FXOA 2FUG6 3ESZA 1NP6A 2HY7A 3BN3A 2BCGY 3H8VA 5IZCC 2XTAA 3EZNA 5IDVA 3GFVA 4GZ3A 4ECEA 1GZVA 4D46A 4FWIB 4EAAA 1WNFA 4G3XA 3HJFA 1I1OA 1V2GA 4NOMA 1S5PA 4ZI2A 4WA8A 4FP9A 3H9CA 1T9KA 3IODA 5KWSA 4IEEA 4F4DA 4OI2A 1KR2A 3H5RA 1GG8A 2AFIE 1QGAA 4L16A 1ZZEA 2AOXA 4UCQA 4I6GA 2I9PA 2P90A 1PR9A 2BM8A 4YUXA 1VRCA 2ZUWA 3BFPA 5AXDA 3G1UA 4OHWA 4YRPA 4JCCA 5L3QB 1ZK1A 3L0IB 4DLBA 3LF2A 2PZMA 3QBEA 1SVNA 3PRJA 1RWPA 4Y9DA 5LQUA 2ZVQX 3A6DA 5FPYA 5CLIA 5JBQA 4RKWA 2QV0A 1DIRA 3WTCA 4R2JA 3ETEA 2QROA 4ARBA 2VXOA 4YDQA 1BFKA 2ZCJA 3O8LA 2NW6A 4IQ4A 5JQGF 1WBBA 1T25A 2AV6A 1WUHS 4X84A 5P21A 1OFHA 4MUXA 4PRZA 1KFEB 1LJUA 1GPKA 3M83A 4MKZA 3BCRA 1QK3A 1GPDG 1TEVA 1UFQA 1H2HA 1LLUA 3NOOA 2ODWA 3PGJA 4ND7A 4L9RA 3WHKA 4WQMA 1G3IA 1E0SA 2OXRA 3SHTA 4V03A 1B76A 5KYVA 4ER6A 5BWLA 4OQFA 1RPZA 3WWYA 3CB4A 4XR4A 5AKLA 4DPKA 1A2QA 3ZY2A 1DMRA 1HKUA 4MHSA 4WNAB 4WVFA 1BA3A 2N47A 4GMDA 1AV6A 1M5TA 2VLBA 1Z0SA 3A1SA 4LY9A 1JHQA 2HGSA 3WO1A 2O59A 5TF4A 2ZJFA 1W4CA 4GLLA 2H2DA 1HGXA 3MWEB 1TJ3A 1U2GA 3TQCA 1R9JA 2C5EA 2B21A 3QSYA 3BAFA 621PA 4KVGA 1R5OA 5EMKA 4OXXA 3RIGA 1NASA 4DDVA 1XDDA 4WJKB 1A76A 1IUKA 5LM3A 5KYGA 1CJVC 4WPGA 4XVQA 4MUMA 3B89A 3FNGA 1XQ6A 3T9CA 3PEVA 3QIAA 2NVBA 3PFWO 3RBZA 4ZARA 1C1HA 4E7PA 1O2DA 2H4XA 3WC4A 3IP9A 1O5IA 3O94A 1DT3A 2B8TA 3DL7A 2IJGX 3QV2A 1AU9A 1XZNA 3F78A 3UJCA 4C6TB 1RZUA 3BZUA 3JZDA 1SQ5A 2OESA 4GI7A 4K6KA 3QOFA 1TW3A 5EQDA 1XC7A 4LDAA 3TOVA 1WDWB 1YZQA 2AQKA 2KJQA 3KKQA 4O33A 4F84A 4OHOA 2W2PA 3K1AA 2VPIA 2DT5A 1NW3A 3HFJA 4KDCA 5KTNA 1MA3A 1CWUA 2H11A 5BMVA 3KS9A 1JPJA 2LIPA 2VCEA 3MJEA 2QAGA 4IIJA 3OJCA 3HWSA 5FEMA 3STWA 4CIVA 1PR2A 4V0OA 3VR1A 1I1HA 3HVHA 2OGWA 3EWIA 1A1VA 2Z95A 1SHJA 2IDMA 2Q9UA 4FE7A 2BFNA 2GSDA 2H0AA 3D4IA 2FPLA 3TEJA 4A5OA 5JCXA 2VRNA 3RU9A 4CKEA 3SQWA 4JAVC 4K6CA 1GUZA 4QJ5A 1BXZA 5TEVA 3X3HA 5EIXA 1VMAA 5TQVA 1I4OA 2LCIA 3S0JA 5KYXA 2VDVE 4IDQA 1N6NA 2GWRA 4O2LA 1V3TA 2ASEA 2IX3A 2Y6UA 3NX4A 2D74A 2ZR7A 1Q44A 1SIWA 4N49A 3QITA 5JW6A 4YYEA 4CEHB 2VF5X 1V26A 4L4UA 4M38A 1WPRA 1UPXA 5CTJA 2A0FA 5I5GA 2BI4A 3WV5A 5L95A 3ZIUA 2PKCA 3PHHA 1U8TA 4D8TA 1JR3E 5AVOA 4KNYA 1SKYB 3MRTA 4L78A 1TAHA 2B69A 5JXIA 3M5CA 3HXKA 4D92A 1GSAA 4L0MA 2I33A 4AZTA 2G04A 4QDOA 1U3CA 1UDAA 2C9BA 2V74B 4J3JA 4EG7A 5LQMA 2BFDB 2NXEA 1YJ5A 3QKIA 1D1QA 3NUQA 4YAKA 2RGWA 3A6ZA 4R7TA 4ABTA 2YZNA 3STYA 1NSYA 2W6OA 1CQIB 1Q7BA 2HRQA 3E2MA 4RD3A 4KO1S 1YIAA 3E5HA 1YH3A 5EIAA 4A7PA 2ONZA 3AEQA 4WDRA 3OZXA 4FUQA 1XB2A 4COOA 3V7WA 4BQFA 5B7NA 3GFFA 2QLMA 2Q27A 1Y98A 3G6WA 3E3MA 3ZKWA 3WYNA 1JH8A 3L1HA 4IJUA 4MUFA 5JJIA 1JMVA 4AU1A 1SIUA 1XEFA 3W2IA 5LQAA 4XLTA 1YTUA 2QUHA 4CMHA 3AB7A 4GX0A 1X8KA 1T1IA 3LW7A 4N9WA 1F17A 3ZQJA 1D5WA 2GM4A 2JIZA 2NV0A 3VU1A 1I6WA 2LZ0A 4QGBA 3CX6A 2GAAA 2NTJA 1DRJA 4PRYA 4QFDA 4BFYA 1GAWA 2YY6A 3KNZA 1FMCA 1AN9A 2BFEB 3DMRA 2CXNA 3A0RB 1XWWA 1DNPA 2XZTA 1FFCA 2IU3A 2FEXA 3CS3A 4GPAA 3A9VA 4RHYA 5LFAA 2DF8A 1MLDA 3WB2A 1X7ZA 3K9CA 3MJ4A 4I55A 1O8BA 1OA1A 3NBFA 5DJ5A 5CRIA 2WHPA 3EZXA 3HUDA 3C5WP 3HI4A 3EEBA 3M89A 3U17A 1U3TA 3E8SA 3EYWA 3IMCA 3B7PA 4DJTA 1ZGJA 3EWNA 3LDGA 1A8SA 4AVYA 4Q3KA 3M4YA 3MIIA 3EXIA 4M6WB 5HVNA 4ARCA 3DE3X 4CTJA 2A58A 4AMUA 2ODAA 4K6OA 2QVBA 4H0FA 2NAPA 3PITA 4BRUA 5LJIA 4DRXA 2X5OA 4HAXA 5C7OO 4MJ7A 1QP7A 2VOEA 2IA5A 4RL4A 1Z13A 2IE8A 3H2KA 2ZIZA 4REQB 3SBEA 4CL8A 3LDAA 4ER7A 4ENQA 1NX6A 2PY6A 4C05A 5JH7B 1HSOA 4N39A 5SV2A 1JT9A 4ZWNA 1YWGO 1QHEA 1YRWA 3SE7A 3Q9UA 5T3YA 4IMJB 2WILA 4HAWA 3IEIA 5DISB 5ISMA 2ZQ5A 2J9FB 2WIJA 3B6EA 1JYFA 2ZJAA 1TK9A 5AW7A 3NMUF 3HKCA 4JLMA 3V48A 2OSBA 2B4KA 3SFTA 2HBZA 1VM6A 5JBNA 3QVMA 2UVDA 3EK2A 4RPJA 4IHQA 3OTIA 4FEAA 3EZLA 1XMOB 2DBRA 4UPEA 2W9XA 3HL0A 3QPWA 1G18A 1Y63A 4BMZA 1VP3A 4BZQA 3QYPA 3TAXA 1E60A 3BKWA 4PYQA 2MOKA 3B13B 4JU9A 5K3OA 3CEMA 4RZ2A 1IOLA 1OHHA 4NXNB 1GUAA 2B1QA 1H6BA 3Q8MA 1JQ3A 3FAZA 4N01A 3VKHA 1C3LA 1X74A 3UGQA 2ZBQA 1SNYA 1Z0AA 4E5VA 5BSFA 1TT7A 2DJIA 4BO0A 3IRUA 4H7FA 3ORSA 3M2TA 2R2AA 1WL8A 1KSFX 5AYVA 2VL7A 4BWVA 3WLRA 2YYAA 1YULA 4W5JA 4LDPA 3HL4A 4XOIA 1L7DA 1GYRA 1HE5A 2RH9B 5DBIA 5EHIA 3RTEA 1W52X 1KK2A 1XROA 3FPBA 2Q8QA 3CU5A 3ZQ6A 5CFPA 1JMYA 2ZTUA 3ADDA 3RUIA 2C4NA 2OFWA 5B37A 4CTMA 1ZGGA 3TZLA 2KW5A 2PLWA 4LZPA 2ZE8A 3BB3A 1CJSA 5THKA 2YDXA 1W36C 1XZDA 1VSTA 5AVQA 3SZMA 1YR9A 2WWFA 4NBSA 1M1YA 4L57A 5A5GA 2HRCA 3MWFA 1RMYA 3UJ7A 2X23A 4GH5A 4PHHA 3UJDA 1E5TA 4R3NA 1GFZA 1TM5E 5AJHA 4DMKA 4DR5B 2PTHA 2VDWA 3V2UA 4AZSA 4UVIA 4FKMA 4PBSA 3WJ2A 3RJ9A 3BKXA 3PD0A 1DJLA 2YNMA 4X62B 1NQVA 3OPYB 1FPQA 2VPWA 4AD8A 1GXSA 2GOYA 5LDHA 1EQAA 3O93A 5E6RA 2B2CA 1KXJA 4L6IA 3R5XA 1LC3A 1T8TA 5JRDS 4EA8A 1FU8A 1YDEA 1L4HA 2ZW9A 2JVKA 3ELDA 4RFSB 4QASA 2P9HA 2QEQA 3N87A 2HPZA 3LT4A 2W0SA 1FP2A 3WX0A 1CUGA 5I9IA 1H85A 1T10A 2G6TA 4XVHA 4QVIA 3TGLA 4FYXA 4ILEA 4Z3DA 4BC1A 1XAJA 1QE0A 3BICA 5B4VA 3FHTA 2FZCA 2P2YA 2HV9A 2AX3A 3RUHA 1VXOA 3SBXA 3GRPA 4LSMA 3IGFA 4LCJA 1CC1S 3RTBA 3IP5A 1NW4A 2PQ6A 5EJ2A 3H0KA 1JXAA 4MH0R 1A8QA 1BD4A 3ES9A 3QJGA 4YJGB 1I0LA 3CRQA 1FNCA 1XOIA 2FEAA 3A2LA 2PPLA 1UQUA 3SC4A 4AJNA 2R8ZA 3UVEA 3FVWA 4HMQA 4P36A 1LPPA 3N70A 1GU7A 2PLFA 4UKDA 3RG8A 1L0BA 1NFFA 2GZSA 1LTQA 2FPMA 1K7YA 3A9RA 3G2NA 2XUFA 4QGAA 3AR7A 4NENA 2G80A 2QB5A 3DZJA 3L0ZA 1A95A 1S3FA 1TZ2A 1JS1X 1K86A 3DG9A 4HDNA 4W4TA 3ZH2A 1LDEA 2CDAA 2FYTA 1VL5A 3T7IA 1V16B 3OLXA 4US0R 3HQ4O 1VECA 3PT5A 5CBPA 2ZTMA 3EXHC 2CCGA 1ZH0A 4QQFA 3IHKA 4D4GA 4AZ0B 3PLAE 1FUEA 1Q20A 3MINA 5SYNA 3PYMA 1CK4A 1CQJA 3H4TA 4IQFA 5PNTA 5HZHA 4OHRA 1RPNA 1CNMA 1N1EA 4R5HA 1E2JA 3BMCB 3ITEA 4FZ3A 3GGSA 1CZHA 5KKAA 3QF4A 4NZNA 1X3SA 1P2VA 4WVLA 5KJFA 2IYFA 3ZV6A 2ZJYA 4P7BA 1E3QA 3LUDA 4NZZA 2VRBA 4U02A 2ZSIA 1G0OA 4DCNA 1BAPA 2B8JA 3M6AA 2GK7A 1BDBA 2LW7A 4JNCA 1LD3A 4COKA 4DF3A 3QWBA 4EY7A 2EFYA 3LTNC 1FUKA 1RM5A 1TVKA 2XMDA 4YP1A 2XWSA 1VPLA 1Q1NA 2PKWA 4IRUB 1B73A 3A6LA 1W0CA 3JX9A 3KT6A 3RHFA 3F1LA 5JECA 3LP8A 4NDNE 3W6NA 2OILA 2UAGA 3A36A 3SJ7A 2UUBB 4O2AB 4HRXA 5BW6B 2C9ZA 3N1UA 4W1RA 1JILA 3DDZX 4NTZA 3OPYI 3JWGA 1E1KA 1GR0A 4N54A 3ZI0A 3HK2A 2Z08A 3FHOA 2H07A 5EHQA 1XPOA 2W43A 3LUGA 3FOZA 1E6KA 4BQOA 4F4CA 4L5BA 4ND2A 1VSVA 1J9GA 4U0KA 1TLTA 1BEEA 1F8GA 3AR6A 3CR7A 4UAGA 1FQKA 1FVXA 2LP4Y 5FBQB 2ORVA 3VR6D 1N6PA 1O0CA 4CM9A 3C6KA 3ESAA 1HXHA 2ORED 4KK4A 3RSOA 3RRYA 2Z5LA 3BJEA 4YDRA 1RE0A 1U0LA 3MYYA 2R6R1 2D0DA 4U7GA 2QTGA 1NIPA 1XTIA 4YRNA 2HLHA 1KZ1A 2EIXA 1XZPA 2V7UA 3FDJA 4NCJA 2QYTA 4B3IA 4W99A 1NT4A 3KV1A 4PGAA 4F8YA 1PW5A 3F7TA 2ZR0A 1O9GA 3VI4B 1XCLA 4TYQA 3QXGA 1RYNA 4M1ZA 3T9DA 3B85A 4G41A 1SKBA 3AIIA 3P8ZA 4KQ1A 5F12A 3K8QA 3PI7A 2PJZA 3VMMA 2QS9A 4WESB 5A3VA 3AUKA 4MPTA 4BHTA 1M0WA 1P0CA 1T8YA 4NBWA 1JSRA 2A94A 3MD9A 3H4MA 4TV9B 1N6OA 5KHLB 1J8YF 4ZVKA 3Q9NA 5P8WA 1G8JA 1PFGA 5A3RA 1V35A 2VYQA 5JZOA 4J49A 2PZ8A 3SF8A 2B8WA 4KVZA 4TPKA 3RO7A 2FP4B 4S1NA 1EWTA 3ACDA 3W90A 3QFHA 4FB4A 1J8VA 5J4LA 1Q2XA 1XZJA 2RIRA 4CT0A 4ZTZB 5E0OA 1XK7A 2WMOB 4FMCF 1K68A 1KZGB 1PR5A 1THMA 1ZMRA 1Z08A 3QGMA 4CKZA 5ITZB 1E2MA 1MQAA 2A30A 2ZIEA 5FO0A 3RBAA 5GIPE 1U4OA 3PQDA 5IJWA 1UXJA 3PKIA 1Y82A 4LHYA 3WLIA 5LMUB 1X80B 4PE5B 5JISA 4K3UA 2XBUA 3BE4A 4HFJA 4AX4A 1KJJA 5AXBA 3KCNA 3L0SA 5J2TB 3V55A 2ONKA 1C8LA 1MHPA 1GRRA 4RZHA 5EIHA 1M6VA 2G4VA 4G07A 2V6IA 4NJEA 1MW8X 3CVOA 2IHJA 3K0CA 4AN0A 2VZ0A 1T9BA 1QV6A 2I54A 2IKQA 1QB7A 4PPGA 1ZGHA 3CG0A 5JEEA 2HU7A 2I80A 3TLMA 5LCXA 2R68A 1PR0A 3LWZA 3RT7A 4N7MA 2OAGA 3TH5A 1G8SA 2GK4A 3DAGA 4UDXX 5IAGA 2D8AA 5JXGA 1R37A 5KVCA 1Q6ZA 1QE5A 1GNQA 3G5UA 1RXYA 3PI6A 4QBHA 4QT0A 4B75A 2O2IA 1YBAA 4C4ZA 1Y1LA 3CY6A 3V8EA 3DHWC 3T5GA 2OHJA 5CB4B 4MKXA 5TLSA 3LBIA 4GEGA 4HVLA 1NMYA 2YN2A 4RHCA 4KTTE 3IURA 2DQKA 1SJ9A 4X8LA 1NI5A 1W47A 2WWGA 2XYPA 1P7YA 4GWLA 4Q37A 1X15A 4RVHA 3PQ2A 3UF0A 4AUNA 1J0AA 4UCFA 5B36A 1R88A 4RANA 2KM1A 1Q0ZA 1KJWA 3GG2A 1XTUA 2DFPA 2XYVA 5BWMA 2XCRB 2XVZA 4IDGA 4M98A 3RFFA 3QVOA 1VJTA 2GM3A 3ZU3A 3U09A 1DO2A 1F60A 2CFSA 2IEAA 4IX1A 2OR3A 1AHNA 4XGNA 2YZ2A 5D6OA 2HCJB 3W2EA 5A3QA 3KD3A 3ELBA 4F85A 4PM4A 1GU0A 1G59A 5JPIA 2IYNA 1LBEA 4N8SA 4HQ0A 1AA6A 3BIWA 1GAXA 3DMTC 2E5FA 5AVVA 4QBKA 2AEEA 5JROA 1PJLA 1FTYA 2R5NA 1BWPA 5E6SB 1JU3A 3WICA 3R7DA 3X2EA 1C0KA 6REQA 2ECPA 5K9ZA 4BV8A 3IXQA 3UN1A 2CXSA 3WFIA 2GB4A 2RKBA 3A9TA 3R09A 3V1TC 4EGFA 2JKVA 1RFGE 1TCCA 1W5EA 2AFHA 2G7MC 5KJ6A 2F8MA 2CSUA 4WK6A 1PSZA 5ILQA 1CQXA 1BMDA 1D3AA 1I7NA 2QL6A 1P75A 1QTIA 1N2CB 1ADYA 2ODTX 2QTAA 5G1NA 3SC6A 2Z9BA 4RCZA 4QX6A 5I4BA 1YFZA 1B8VA 2CB0A 4XW2A 4KI0A 3D8NA 3Q3VA 3B38A 4D26A 2P77A 4RPIA 4YRLA 1ZIXA 2B7LA 1SBHA 2PGNA 4LDQA 3JXEA 2QYSA 2IYEA 3SMQA 2I8CA 4ZVPA 3IERA 2E5WA 3NOXA 4M9QA 3VISA 1NP7A 4GKVA 4CDMA 2NN3C 1NC1A 2CDNA 4O4IA 5C37A 2GVZC 3UUEA 1TU4A 4UOEA 2Q2QA 1VE5A 3JQ9A 3OICA 4LZZA 4QDKA 4PCVA 1CYDA 3VPXA 3WWEA 3M3DA 1QRUA 1W4AA 1KHHA 5DNCA 2X5JO 1QOZA 2FWAA 1AQIA 2PR2A 1TYDE 1CNFA 3BEDA 4G5GA 4AXXA 3AF4A 1N3YA 1FQOA 2O2GA 4MKGA 3R9IA 4DG9A 5E7JA 1D4OA 3GEMA 4XWGA 4WOKA 1B6SA 2J6HA 1VMKA 2ZIVB 2H2WA 1E2NA 3GVPA 2NUTA 2VK1A 4TMXA 5BVHA 3ON5A 3I53A 4X1IA 4Z9YA 1VGVA 1GGKA 5EPEA 1N5RA 3HBFA 3WRVA 2DUUA 2HO4A 1N7HA 1LSUA 1W9HA 1W73A 4TLAA 5JXHA 3KQHA 1FVHA 1R10A 1DDIA 3KVRA 2HK9A 3I5XA 4MQUA 4H08A 3TUIC 2UDPA 1UBEA 1YR3A 3BDIA 3INTA 2P9JA 3RTDA 2R6GA 4BS9A 3ORYA 2NSJA 3PNMA 4Y2UA 1IN7A 4D4KA 3BXEA 1MO5A 5GTDA 2P11A 4JEMA 4CR8A 2HQSA 4HRAA 2IPOA 2XMCA 3T3NA 1QSGA 1R0LA 2AMYA 2D1FA 1SG0A 2QLNA 3N05A 1OLXA 4JBNA 3DEZA 4L4ZA 5FRDA 2Y2VA 3GVIA 2GCEA 2HU2A 4L5CA 3OM9A 1BNCA 1YZGA 4CGZA 1XDSA 5E7MA 3LBNA 4MZDA 3UYLA 3VAYA 1SU7A 4AF8A 4CM4B 2PZKA 4EHBA 4JODA 4F6CA 5LMCA 5BNZA 5DWDA 1YL5A 2JGAA 2FQWA 2P2LA 3DLCA 3MTQA 3OFND 1N92A 1ZD2P 5HQ3B 2GKGA 3A9WA 1KEEB 1UMCA 4MMXB 4YV0A 5BOSB 1CQIA 1OV6A 3AINA 3UA4A 5A6SA 1OKKD 3CLUD 3NFYA 3M1IA 1LX6A 1M1YE 3WIOA 2BCJQ 3QM1A 3WMWA 2UZ4A 3OQOA 3U3DA 3P5BA 1FDTA 2PZAA 2Q1UA 2JGRA 4HADA 1EGMB 5E1MA 4Z7QB 2CJFA 3GCDA 1H6CA 1LU9A 1P44A 4FFSA 3H2SA 1NN3A 2OCXA 1I32A 2FVYA 2OZLB 4E30A 2HZBA 3K70B 3VKFA 1U0BB 1DV1A 5BN3B 1FYXA 2AR9A 3I61A 1GL3A 2ZB7A 4ZT3A 2EP7A 1ESMA 1J9ZA 4ZI7B 1OBFO 5GADl 4HCJA 4DVJA 2P2SA 1ZOSA 5CAEB 1POXA 3H9QA 1WMSA 1UT6A 3UPTA 3J81k 1N0WA 3SVLA 3UJ3X 2P2NA 1SY7A 3H8JA 3NJ8A 3DBHB 1BCSB 3EGOA 2QX9A 3ZD8A 5JXJA 4IWYA 4D97A 1C41A 1I4DD 1YI1A 4PNHA 1CIJA 3H7IA 1PR4A 2BKEA 4TN1A 4ZZ0A 5BN4A 3N28A 4URUR 1QCCA 4BKRA 4IAOA 5AM5A 4A6EA 2ZULA 3JRNA 3W8EA 1CZKA 4W5OA 1WF3A 1YCHA 1THZA 3ICQB 3D1JA 3EGEA 3KQUA 4LRYA 3EMKA 1MAWA 1PFYA 2OZKA 2YFYA 4IZIA 4G8JA 5IU6A 3C4QA 3A6GA 3CRRA 1UMBB 3TNFA 2HJSA 3DUFB 4P3YA 1YHYA 4M83A 2XGGA 4CMJA 2DSTA 3DKIA 1VFPA 5KINB 3N3AC 1G20B 1E3JA 1E9FA 4LY6A 2NUAB 4YCLA 5E3IA 4REQA 2GCGA 3SNHA 2WF8A 3BHJA 1ZN8A 1SBIA 3QENA 3NP9A 1ACMA 3L3BA 2JGDB 3N8NA 1YRLA 3C15C 4KUEA 3UGJA 1ZRMA 3KXKA 3ZK7A 1U1CA 3V32A 1Y1SA 3EIFA 4A0QA 1NQTA 3EYAA 1Y6FA 1XNHA 2BMVA 5FOSA 2H8KA 4XB2A 1OZHA 3UXHA 4Q7KA 1KVRA 2EGUA 1ZCZA 3M34A 4HWTA 3PTLA 2V5UA 3U4AA 2W42A 2WFLB 3OKAA 4X95A 4FFNA 2EBFX 2WHXA 3UMYA 3C1UA 4RXTA 1DC5A 3C5VA 1XQYA 1E3EA 1WV0A 1W9MA 1O5OA 2BGLA 3JARB 3N58A 4XQGA 3TMYA 4QTYA 5LMNB 1JZSA 1O96B 4GSYA 2OG1A 1T6BY 5IMBA 1GU1A 3I5UA 2D1SA 1JQDA 3IBSA 1WOYA 2C5GA 1BGWA 3LY5A 4U7FA 5NLLA 4YAGA 5AHOA 1M8KA 3OF5A 4I99A 4U3JA 4X1OA 2W6ID 3MZ0A 2WM3A 2NUBA 3P20A 4PANA 3OCCA 1DV2A 2P91A 4MQEA 4YFVA 1G7SA 4FD3A 2JKYA 3UB4A 4JI8B 1O6FA 1S9HA 1N57A 3F9RA 1K6IA 3AFNA 3GFBA 3C3JA 1G291 1Z8HA 3QA9A 2IU6A 4C1NA 3BMNA 3SY8A 2JIOA 1WEHA 5BQXA 1BE8A 1OASA 3Q85A 4KUGA 5SY4A 4NBTA 1QZUA 1V5EA 4X8MA 4A1OA 4KN9S 3R6DA 3L1VA 2UZIR 4PQFA 3BH6A 3QKRB 3WLMA 5T4BA 3AR5A 3LKBA 4IIVA 3HCBA 3M8KA 3JWHA 1TYBE 3BJRA 1M5UA 5EE3A 1KPHA 3CLRD 2RJNA 1NFQA 2XGMA 3A4MA 3F5MA 3R0ZA 4MW6A 4WZAB 2YN0A 5FWDA 5IM4A 4Z4QA 4ZK2A 1LH0A 3N8IA 3NVAA 5EMHA 1T4CA 2OV8A 1EVZA 3AY3A 2MIIA 3L0CA 3LQ2A 1AGYA 3QPCA 2P2CA 1HYHA 3HCAA 2PIAA 1ABFA 1URPA 3MWDB 1FB5A 4XD7D 4EYEA 2KBEA 1U1EA 3CMMA 1MDBA 4B3GA 2EBWA 2DLDA 2SNIE 1Z9BA 2PS0A 4IV5A 4WOPA 5DGIA 1ST3A 2WJ4A 1W5SA 3CPEA 4C89A 1R4NA 3VXKA 3O9MA 5EY5B 5HFJA 3Q8KA 2L82A 2FP3A 1FZTA 4Y2GA 4ZVUA 4UNNA 4FJ0A 4YJ2F 1CZRA 4L9SA 3DWGA 1OR8A 2B0JA 3CX3A 3RJ5A 3RKSA 4IDNA 3DWEX 2E37A 4B4DA 1J2JA 1XR3A 1EVKA 2Z2ZA 1ND5A 2R86A 2B36A 3EQ2A 4TL8A 3VH3A 1KL7A 2YHAA 1BMFD 4LBVA 2UUPA 4MS1B 4BNNA 3KJXA 2P4EA 4WLFA 3LX5A 1BXRB 3T41A 2A5YB 4ZK6A 4HGQA 2PEZA 2WW8A 3NBYC 4IYRA 2CV2A 3CN9A 1XLUA 3FSEA 1CZLA 1NV8A 1R6BX 1T91A 2P4SA 4I4TA 4J6FA 4J0JA 4LVOA 3V7YA 3W6UA 4BRWA 4FGLA 4D3FA 3MJDA 4PPYA 5CVCA 1GTSA 3ET5A 4GR9A 4P81A 1D04A 1L5OA 4Q21A 3PNBA 4HMOA 2MSLA 2QDXA 2QIOA 3GNSA 4EF6A 2PT7A 1GILA 3W2FA 2PYIA 4JBYA 1KGDA 2B20A 5EJ7A 1ZYUA 1KAMA 1PX2A 1GOTA 2JC3A 2ZXEA 3L8MA 4FR5A 4UU0A 3SLRA 5IWAB 2HOQA 4RGBA 2WQ7A 2C0QA 1SB9A 1JX6A 1X94A 3LC7O 5CBKA 1L3IA 2JCBA 4OK3A 9ABPA 2ZDGA 3PFIA 1NTRA 4PNEA 1TUBA 4TWJA 1T4DA 1MAHA 2X14A 1Q0LA 3BB1A 3JATA 3FRJA 4MZXA 4S0ZA 4U4AA 1SXGA 1U7HA 1M1UA 3DZHA 1AB6A 3RUEA 2JBAA 1BWQA 3DLTA 5U4QA 2O06A 1L8XA 4ME6A 2GM5A 5CA1F 3U7GA 5DNYB 5LD2C 2XRZA 1GIAA 2YJ6A 3T0GA 2ZSDA 3SLKA 3LIIA 3OIWA 1CUWA 1QGZA 1XRJA 2JI8A 3F6PA 3FZYA 4YROA 4RCYA 4BEBA 4L1KA 1PIWA 2ICAA 4I3FA 1Q83A 4LYYA 2GS9A 1JTEA 3TECE 2XEXA 3A06A 4IH9A 2CL6X 3RSZA 4C7BA 1SKAA 4LYGA 1FMLA 1VCOA 3SN6A 3HPQA 1KVUA 1E89A 2GXAA 2BFPA 3THWB 3TBHA 2NUPA 2VP5A 3O3NB 4UVEA 2ZU0C 3L4JA 3IIEA 4XPIA 3RVDA 5TV2A 2YVQA 2V1XA 2BJWA 1TFUA 3L49A 2UZ0A 3DOUA 2NT3A 3UGKA 1Z17A 4N9QA 4U7JA 3DYIA 3ZCVA 1FJXA 4MSUA 1T2NA 1CX9B 1D6JA 3D3QA 1Q16A 2PZFA 5B53A 3PUZA 4TUYF 4BKPA 4BO9A 1E77A 2J0SA 1TLFA 1K27A 3CBGA 3OU2A 2HNAA 3P2KA 4HDMA 3A9CA 3TTYA 2F9LA 4GR5A 4HGZA 3TUJC 4RKQA 3HA7A 4MWTA 1DKOA 1P39A 3UMFA 2AHOA 3QP9A 3K6JA 1P2TA 3QELB 4N0QA 3U1VA 3BRWD 1O8CA 5K6RA 4ZQBA 4PQEA 5EE0A 4EIWA 1JFFA 1WMAA 4YQYA 4TQ9A 2D2EA 4ITVA 4PAMA 1LWOA 2Y1CA 2X1HA 3G1WA 4MJLA 5HS6A 1F4VA 5B3KA 3L6DA 5EL0A 3THXB 4W9RA 1XAIA 4N47A 2BF7A 3MG9A 5H1YA 2X8LA 2ETXA 3IIKA 5F64A 5BNTA 1PUIA 2XQGA 4JS0A 1VIMA 4AQYB 4FOPA 3BGDA 4TTPA 4O08A 3DMGA 4DABA 3D8UA 3WGIA 4B74A 4RVCA 2P67A 4U1RA 2CT8A 5K8TA 1W85B 3BJZA 1CY1A 1LNZA 2HIHA 2WJ6A 3G82C 4X1KA 2H1FA 1T2VA 2ISQA 1CEXA 1FYEA 1R00A 2HMAA 2EATA 1YHZA 2WD7B 1PDVA 4IUDS 5CW2A 5ALGA 4EJ0A 2VPXA 2JVJA 4TRJA 2HMSA 4TV9A 3FNRA 2AOTA 5TGDA 5L3VA 1L5NA 4GGPA 2XCTB 4IIFA 3JR3A 4OAOA 5HDBB 2Y93A 1RKQA 4NJMA 4WK0B 3PYXA 4O5OA 4QUKA 3ZK8A 1QDUA 4I4IA 3R9XB 5DB4A 5ALUA 1TCVA 1PGPA 2A3RA 2BGJA 2O5RA 3C6XA 3G3EA 5CM2Z 3REFA 3UXMA 3FSJX 2OBFA 4BQNA 2QL5A 1V7PC 4GOXA 2Z83A 3A1CA 4KQ2A 1BU5A 3WNDA 3ZJYA 4RQBA 3WHPA 3WRYC 3QWIA 5ENVA 1XA4A 2PCLA 3CKMA 4L02A 3P9CA 4BP3A 2I03A 3NIBA 3HGTA 1M8FA 3QWHA 1A9RA 1JKJB 4PIMA 4DV1B 1LS6A 4UPVA 3PD1A 3HM9A 2X0DA 1ISSA 2BE9A 4BVFA 1OSNA 1NNEA 1VJ0A 1ZUD1 5E9AA 3SAJA 4OBBA 2BKVA 4H1TA 5KQPA 1MOSA 4QWMA 4QM6A 5DYNA 1Q95A 1KS2A 4N5HX 5AM0A 4FTWA 1H4TA 2EZ9A 2C0PA 4HN9A 2VK4A 5AIAA 1U0FA 5TPZA 2IYZA 4YXWD 3V4RA 4M0FA 4J1TA 2RHCA 3NI2A 5LOVA 2YXNA 3PRYA 3HA3A 4HBZA 2BTQA 4MTLA 4B9AA 3IKJA 1SKYE 1DDOA 3L92A 2ZRFA 4NU6A 3I6MA 1NG1A 2MMGA 5B1HA 5AW3A 1A4RA 1PT6A 3QVKA 4RA9A 4UMEA 3FZGA 4KGDA 1GTRA 1NUSA 5B1SA 4HDRB 4DE5A 2AK2A 2R6DA 1J5XA 4X7RA 3MTGA 2EZ8A 4H77A 4AWXA 3HKBA 3M49A 2OENG 4ESVA 2D2VA 5CB4A 1ZC3A 5ICMA 2GNOA 4CMAA 3M4ZA 2Z8ZA 4F6RB 4JOQA 3SBDA 1ZJ5A 1R9NA 4HH0A 5EXDA 4OYLA 3VGPA 3VPBA 2K2QB 1MCZA 2VYNA 1PG2A 5BSMA 4G1UC 4HXFB 4RVFA 4URYR 3S1AB 3VNVA 4HH3C 1I2CA 4ODIA 3W4JA 1P2FA 4OXKA 1QC5A 1K06A 2G8LA 1ZOIA 5FI1B 1Q57A 3EW9A 3RK4A 5C1PA 5FUMA 3GLTA 4JB8A 2IPXA 1COZA 4PR0A 2R7MA 2PLNA 3P4UA 3F9CA 3GLVA 3H0EA 1BROA 1P19A 1XRQA 3K0BA 1T1RA 2WF5A 3Q1LA 1FU7A 2FZKA 2FSHA 4GEKA 1AT1A 3DW3X 3KX2A 5T8KA 3U48A 3U4GA 3WAJA 1XEWY 1N6HA 1S2LA 2DWUA 3L46A 1G9SA 4R9NA 4DCJA 4ROTA 1J20A 2EKBA 4LF8B 2AN1A 1DWQA 4EM6A 1KEZA 1Z7GA 3F2VA 1P8JA 1TRKA 5FULA 2ECKA 3B6MA 4PRLA 4DUPA 1U0TA 1R6XA 4LNHA 2WEKA 3N0TA 2I4MA 4RENA 1DJNA 4O8CA 4BRSA 421PA 4DMGA 2R00C 1TJ5A 4GMXA 1YQXA 2C83A 2CXUA 4NAUA 4B3DA 2Z2IA 3FKQA 4HZIA 4UTPA 1DSSG 2D1YA 4ZO4A 2H4YA 3QEBZ 2R7LA 1T6XA 4ZU3A 2BMWA 3NHWA 2ZAMA 1PBNA 2CMHA 3PFCA 3WLQA 5FLKA 1D0VA 1IC6A 3FPGA 3FCOA 3N2KB 2OV1A 3DLPX 2V0NA 4DL9A 1JH9A 2E6UX 4EOGA 2GT1A 4MPDA 1I6LA 2ZWMA 1XD2A 4DWWA 1KQGA 1EX9A 1L7RA 1I4EB 2BFOA 2ADOA 2G6BA 2QLFA 2XITA 4L51A 4QXMA 3E7PA 3NRJA 3VYTB 1JA0A 1J39A 4FGSA 3DDSA 5CA0A 5ADHA 1OFIA 4L50A 3QY9A 2IPMA 3OCZA 3LU1A 4KR3A 2EZ4A 3KDSE 5BN5B 4EMSA 5DT2A 4OYHA 5MF6A 2OLKA 2FGKA 2GGSA 4OBXA 4MV4A 2I22A 5DV9A 3WRXC 1EDEA 1TMYA 1ZG3A 1DCTA 4TKUB 3VDRA 1YBVA 3AW9A