5B3KA

C101a mutant of flavodoxin from pseudomonas aeruginosa
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
150
structure length
150
Chain Sequence
b'MKVAILSGSVYGTAEEVARHAQKLLSAAGLEASHLPRASLDELKAFAPEAFLVVTSTTGMGELPDNLQPLYYAIRDQLPAWHGLPGGVIGLGDSSYGDTFAGGGEQVRELFGELGVREVLPMLRLDASETVTPETDAEPWLAEFAAALKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein PA3435
publication title C101A mutant of Flavodoxin from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Electron transport
total genus 51
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2016-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00258 Flavodoxin_1 Flavodoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5b3kA00
1X77A 4YAFA 3U7IA 4Y9RA 4C14A 2A5LA 2N1MA 2QX6A 1DXOA 1BVYF 3QE2A 1FLVA 4PU0A 4QODA 3ESYA 2V5UA 2V5VA 3P0RA 5EAIA 1WSWA 1AZLA 4GR9A 2X2OA 2BZSA 1FX1A 3KAQA 1FLAA 3NFRA 5EMNA 2BF4A 1QRDA 5FA6A 5F51A 3EYWA 4LAFA 3EDOA 2OHJA 4NLLA 2B3DA 1E5DA 4BMOB 4ZVMA 2R96A 2Z98A 3QFRA 3O2NA 2MTBA 4R81A 1RLJA 4LTMA 1FLNA 2Q62A 1CZUA 4QOFA 3N3AC 4PTYA 3G5MA 3OJXA 4Y7CA 2BMVA 1AMOA 4OXXA 4YAWA 5F12A 3FX2A 1QHEA 1SQSA 2ZKIA 2FCRA 3FVWA 3KEGA 1ZWKA 1RCFA 4QOGA 3NHWA 1CZKA 4CF6A 1GG5A 3B6MA 1T5BA 3F2VA 1T0IA 3GAMA 2QR2A 2BPOA 5B3KA 4LA4A 1F4PA 2XODA 4U7HA 4XDHA 4FGJA 3NHKA 5LMCA 4QOIA 3LCMA 3SVLA 4D02A 3NHSA 4HEQA 4QOEA 2M6RA 2QWXA 4U7FA 1J9ZA 2Z9DA 3NHFA 1OBOA 5LJLA 4YQEA 5EA2A 3F90A 1XI2A 3U7RA 3N39C 3LT5A 3GFQA 3OJWA 1J9GA 2QMYA 1DX9A 1CZHA 1D03A 4DIKA 2MWMA 3FJOA 3UXHA 1KBOA 2FAXA 3OX3A 3NLLA 5LLDA 2QX8A 3FNIA 5TGZA 2X2PA 4LTDA 1NNI1 5F4BA 1CZNA 2OYSA 4CETA 5LVAA 2FZ5A 1I1OA 4FX2A 1YCHA 4QOHA 1RLIA 3NHUA 3HLYA 1FTGA 4YAOA 1AKRA 4FGLA 3D7NA 3K1YA 1RTTA 1YKGA 1C7FA 4Y9UA 2F1OA 2W5UA 4J8PA 1D4AA 4GI5A 4ICIA 2RG1A 2HPVA 4ZVLA 3ESXA 1YDGA 5FUQA 3L9XA 2OHIA 3B6IA 4H2DA 4LTNA 1QBGA 2OHHA 2FX2A 3W77A 2FDXA 2FLVA 5JROA 1WSBA 3TE7A 3F6SA 5LJIA 1SG0A 3W79A 1DXQA 3NHJA 4M0CA 3OX2A 5ULLA 3TZBA 3OWXA 4ZVNA 1FVXA 4ZVKA 5B3LA 1BU5A 4HS4A 1FLDA 4C0WA 3ES9A 3B6KA 4DILA 2MOKA 2R97A 1CZOA 1YRHA 2QX9A 3ZHOA 5LBUA 3R6WA 1QR2A 3S2YA 3W7AA 3NHLA 4GQIA 1KBQA 1CZLA 4N82A 3GFSA 2FVXA 4N9QA 1AKTA 3OVMA 2XOEA 1J9EA 3NHPA 3FW1A 3OWHA 3NHYA 3L9WA 3ESZA 6NULA 4H6PA 1JA1A 2HNAA 1H66A 4U7GA 1XYYA 2QMZA 1FUEA 1CZRA 4NULA 4N65A 3O73A 3RPEA 2FZVA 2KLBA 1TIKA 2D5IA 3OX1A 1AKVA 1AKQA 1YCGA 5NULA 1YOBA 1JA0A 4S24A 1AKUA 1J8QA 3HR4A 3W78A 1V4BA 1TLLA 3N3BC 5BUCA 5FX2A 4YALA 3KLBA 4BMPB 2WC1A 1H69A 5A4KA 1D04A 1C7EA 2FOXA 1ZX1A 1B1CA 1YCFA 1XT6A 3TEMA 2GSWA 4QOJA 4F8YA 1AKWA 2KQUA 1OFVA 3F6RA 1OBVA 3NHRA 4FGKA 3B6JA 3HA2A 1AHNA 2Q9UA 3GFRA 3K20A 4PTZA 2BN4A 4C76A 4C0XA 1AG9A 2Z9BA 5NLLA 1XYVA 2QX4A 2MT9A 4ESEA 3JSXA 1VMEA 4XDGA 3QFCA 4YAUA 5LBTA 2ARKA 2V9CA 3KAPA 3UXEA 1ZWLA 2HNBA 2M6SA 4DY4A 2AMJA 2Z9CA
chains in the Genus database with same CATH superfamily
4AS3A 4LY9A 1ZQ9A 1JI0A 4DRZA 5MDHA 4KYUA 3ER9A 1F8YA 4RPJA 2VYNA 3U0VA 4BFUA 4M60A 2Z2YA 1KSHA 1EIWA 3QE2A 4OSOA 4URFA 4AZ0B 3OEHA 4IGFA 1K5PA 4QG3A 3L7IA 4GF5A 1RE0A 2ZSDA 3FAZA 3UJ8A 1UKBA 4L3OA 3PRYA 4HFMA 4ND7A 2I6FA 5KNCA 3X1YA 5FFMA 1VE9A 2LDXA 3R3YA 4HATA 1VSUA 1G8SA 5BQPA 5ALVA 4O2RA 4WLOA 4R40A 5ALHA 3CNHA 2VDMB 1V3TA 2CNWA 4FYKA 2G5TA 4DCTA 4MR7B 2Q2WA 3QIAA 4K0KB 3K1JA 3QK7A 1M2VA 3HY3A 3M6VA 4MGYR 3MTAA 2W2TA 1KF0A 4BB6A 2C7QA 1KZ4A 1SY7A 2C0CA 1Y4SA 1DAPA 2XRMA 1DG1G 1EFVA 5JMWA 2O8DA 1OZFA 1K08A 2Z1DA 2IYTA 3TSYA 1SZDA 3C1TA 1VPWA 4FYJA 1CQJB 5LIRA 4Q9KA 1H85A 2VDNB 2P2ZA 2B3DA 3F9IA 4IUCS 4UD2A 4O2AA 5FOVA 4EZEA 3RI3A 2J9GA 2X41A 3ELDA 3WGKA 2GEUA 4ARVA 1SFRA 3QX9A 2AMLA 3FYCA 1ZFNA 5BQ5A 4KRXA 1JXAA 1VMAA 4DC9A 1ADBA 3MWLA 5JLAA 4WUVA 1R8SA 1SC9A 1UMDB 2O8FA 1DQSA 3ESBA 5GAJA 2HBYA 4RESA 1M6VB 2YUIA 3DZ8A 3WWCA 1SKQA 1JIIA 2CFCA 3OKAA 4P7GA 5HUJA 3THOA 1JDZA 1EM8B 3JZAA 5AI6A 2C4MA 2O0MA 2OCIA 1OFTA 2QN1A 3NKFA 1M5RA 1DBWA 2BD0A 4WNAA 1R4MB 1V6CA 4PTYA 4KFRA 3IUBA 2QPTA 4MGIR 3VZDA 3WX0A 4NQZA 4L4UA 3VSAA 1C9YA 4NXNB 1U2SA 3O3NB 4P5EA 1U0NA 3GRUA 2QY9A 1P5ZB 3LK6A 2YJ3A 3WYFA 1V71A 1WHSB 3OQHA 3QUQA 3UJCA 2AKEA 1ZGHA 4KHPB 4Z0HO 2JRCA 4NR0A 3VTFA 4D3ZA 1PF7E 4AZWA 2HMUA 3UWPA 2WYHA 1JVNA 1LUAA 3PTZA 2OCKA 4C43A 4R54A 4RJLA 1M8KA 3RJZA 2JAOA 3HMKA 2H17A 4TMKA 3LT2A 3U3JA 3KZOA 4C21A 2YW9A 3I8SA 2DLDA 4OI2A 1KC1A 2CJWB 5CX1B 3K35A 1YRQA 4MEBA 3WGZA 1FXWF 2IOYA 2YJNA 1QUEA 2B0JA 3G2JA 4OIFA 4QOGA 2OA0A 3X0DA 6YASA 1EJBA 1TTQB 2N3ZA 2NU8B 3BL8A 1XTQA 4X95A 3CXRA 3MWJA 4P5DA 4BWFB 1V6AA 2RK3A 5I8PA 3QF4A 3T1TA 3DEIA 1LF0A 5LZ7A 4AXBA 4GXNA 4ZC8A 1I1HA 3PQ7A 4RTRA 4DB4A 2ASEA 2QR2A 2WABA 1P61B 5ALUA 2WW8A 4EGCB 2WJAA 1SUEA 1U5AA 1Y5NA 2CHQA 3HCDA 4PLZA 2G40A 1U28A 2JEYA 3AI1A 4R6XA 2D7CA 1VHWA 3BCRA 4WKPA 5EN4A 3ZHVA 4DSNA 5L45A 3K0AA 2BM0A 3QLVC 1CFJA 3H5VA 3AB3A 1NBEA 2AFIA 2ZJYA 3N2KB 3WS7A 5KNDA 2OLEA 3KT0A 1LJ8A 4J0GA 4PC6A 4HEQA 4NEHB 3C8HA 1JQKA 5DT2A 3QU2A 4BLUA 2ZVDA 3U56A 1XE3A 3B1YA 2YFHA 3LDHA 1TA9A 4D9FA 1JHVA 1RQ2A 1T3ZA 2IYOA 4R1NA 4WGFA 1DADA 1KRHA 5ANRB 4W5TA 3DO5A 1JVBA 5IC4A 3MJSA 4ALMA 3RC2A 5DMHA 4E08A 5EJ5A 1T6BY 3LWZA 4XSVA 3RVSA 5FTKA 2Q28A 1GRQA 1SB8A 4B6JA 4EW3A 2JANA 3DE0X 4QFBA 4J07A 2ES4A 4K46A 4NMLA 2C2GA 5ECWA 1ZH4A 5EHIA 2CUTA 1GA4A 1U7DA 4L4ZA 1S1CA 4JLJA 1Y6ZA 4S1NA 3WIVA 2Q5QA 5C3UA 3KQKA 4BLWA 1NW4A 3DR3A 4QBGB 4EGJA 5BN4A 1ZK0A 3R9KA 1HQDA 2CBGA 2VTDA 1H8HA 2F8MA 2PMKA 3DDZX 4Q4AB 2OXTA 2BYTA 5KWJA 3IEVA 4O4LA 3G2MA 1KJYA 2ORED 5FNVB 1P8AA 2QLNA 3A36A 3BXZA 5MGBA 4DV7B 4PZYA 3WO0A 1AK2A 1RYDA 1SK9A 3OTHA 3CEAA 3N6VA 1I4DD 4Q3LA 4ZEWA 3DUFA 2C94A 2YHBA 2GHTA 4YMWA 5ALEA 2X2PA 5F4BA 3KQWA 4BQFA 4R1QA 5UKDA 4EI7A 1YDWA 1T5HX 2YN0A 1B3BA 2EFJA 1VPTA 3E22B 3L4SO 3V1TC 3R9WA 3U1VA 3HZZA 2I7CA 3GLUA 2RSLA 4B7UA 3BGOS 5EZYF 4BATA 1XL1A 1OH8A 4D43A 1F38A 4P86A 2EDCA 1P9NA 1COZA 2PMCA 3QMPA 4OQZA 4BX8A 3D4BA 2TSYB 4I3FA 1F6BA 1S8NA 1EUDB 1E2MA 3OJEA 4JSTA 5FA5A 2V59A 3WLPA 2QVYX 2CZQA 2NO9A 4G01B 4P93A 4Q7LA 2C4KA 3O21A 1ZCJA 4PV7A 3P9IA 4EL5A 2H4YA 3PNBA 1GOTA 1VECA 1MV5A 3COZA 2RBGA 3L41A 3QV2A 3G8AA 1UM9A 2P75A 4HMOA 1E8MA 3D7NA 1O95D 4ZHSA 2B1IA 2YV5A 4UPEA 1LNZA 1SC6A 2F4NA 2WA1A 2ORVA 4GXRA 4H17A 3I9NA 5C80A 3WA7A 1HQKA 3KFVA 3WWZA 3CUEF 4CQLB 1UK7A 2VQDA 4TMZA 2GB4A 4YC7A 3SFVA 1CQZA 2Y0CA 3FPLA 2F1OA 3F78A 1NUAA 1OWLA 3JTEA 4YQZA 5LOVF 1YQDA 2JJ1D 3OZCA 4J43A 4JJIA 1M2HA 4HRVA 3VZQA 3E9YA 5CLHA 5CFZA 1PT6A 2AQ8A 4RYDA 1RIIA 4H9GA 5ALGA 3TQOA 4HDKA 2HFJA 2HPVA 1MOZA 3ESXA 3KJXA 4D8UA 3ZCVA 1KXJA 1TYAE 5TMBA 1JQLB 2NADA 2EU8A 3HRHA 2O8BA 2BEWA 1CK4A 3NO4A 3L9XA 2IYUA 1HFKA 3QQ5A 5G0WA 1WCIB 3UAZA 5DX0A 2H2IA 4DBLC 3D8SA 3TAUA 4WDRA 3IIJA 2NSYA 4NG4A 1PLJA 5JZ9A 1F6WA 2NUTB 3D6HA 1LEHA 2VSXA 4JASB 1EB9A 3CPSA 4C6HA 4O5OA 3AVUA 2BR3A 3FGNA 1E77A 3PUXA 1S4MA 5HG0A 1JSXA 1R50A 3IAXA 5KMGB 3F6SA 5BORA 3WHKA 3RYHA 1KU6A 5ITZA 3DEZA 1JHXA 1YDFA 3IVAA 3MRTA 3M70A 2XJ9A 1R5BA 2OHGA 1G21B 5EERA 1M2JA 3CRW1 3EIHA 1SOVA 5LQDA 1PJBA 2VQ3A 3BGWA 5C8DA 4H1TA 3ZJVA 5KPJA 2BLLA 1TF2A 1RI5A 1YS1X 2H4JA 1N9KA 1Q7BA 2UZAA 4GOKA 4JK3A 4ZVKA 3TK1A 3W5VA 2HJHA 2FUG6 2YWEA 3SKXA 4E11A 2WU0A 3U3RA 4NI5A 5BT8A 3BERA 4FNMA 1A97A 1NN0A 1Y42X 1PQPA 1Y1RA 4XSGA 2GN8A 1M34B 4ATNA 1W4CA 2WZDA 3UT5B 2INGX 3R24A 2C3UA 1N75A 1UJ2A 4RV9A 4DILA 1ZM7A 1W581 3K71B 1OREA 4RJTA 1SN7A 3PGLA 3UF0A 2RAUA 1A77A 1PR1A 4P3XA 2JFQA 3ONNA 3G0GA 4FSDA 2I4MA 3DDWA 3L04A 4C6TB 2ZM5A 1N5RA 2WWVD 3D5EA 3B53X 3IT0A 3X1ZA 4FFMA 3S2YA 4X45A 1KDYA 2XZOA 2NACA 3IO5A 2IV3A 3TGWA 5CXQA 3RVBA 4C0BA 3WB9A 1ZITA 3F8WA 4HLDA 4N49A 2ZEJA 3VR0A 1Y0BA 2NU7B 4K81B 4PGAA 3RREA 2BWJA 4X65B 2F9MA 1Y8RA 3EWSA 3GPIA 3O9VA 1G8HA 4C03A 1GV0A 1B43A 5FR2A 7ABPA 4MV6A 1RCUA 1RI2A 5TQJA 2V0NA 5EWLA 3R2JA 2GXUA 1KTVA 1XMIA 2LCIA 4MGEA 1UFVA 4FHDA 3HEMA 1HDRA 2VUHB 1E3MA 1L5YA 4AJOA 3IODA 1YHNA 5F21A 3ZVLA 1IHYA 3ITDA 4AWAA 1GTSA 1HETA 4P3YA 1TPZA 3DE1X 4UHJA 4QXQA 4XI9A 1HEUA 1DWPA 2G88A 1VG0B 2ZRLA 2ZUWA 2KX7A 3OPMA 1MNQA 2D5LA 4ME6A 5DFAA 2QNRA 2OP0A 2LCFA 2OAGA 5D87A 1A8HA 4FQ7A 4B6GA 1KI4A 3LHIA 3LYUA 3IPYA 3MQFA 5TVKA 4DMCA 2PUCA 4KVFA 3WQRA 1GYRA 2DPLA 2YZKA 4M1OA 3CLVA 2C59A 1TQ2A 4RDXA 1YDHA 3IS3A 3N5CA 2ZUTA 3U17A 3DOOA 5DGTA 5HCIA 5JVDF 1XQYA 1TLFA 2E37A 2QJFA 2I7XA 4HLUC 2AZ4A 4LMRA 2IIBA 2ERYA 2KMLA 1DKNA 5TPZD 1ZRNA 3FMGA 4PZ9A 4U6NA 3KQNA 2FN8A 1R5OA 4KBGA 4XVHA 4AVYA 1NNEA 3AG5A 5NULA 4U39A 1W36B 1NXXA 3W2HA 3HJGA 1I14A 1BXRB 1HZZC 3L6CA 3RGGA 4MUBA 2IW3A 3DQQA 1Q17A 4L4YA 2RFLA 3EIUA 2O5RA 3AJ8A 3HR4A 3LYLA 1XZBA 1ZU5A 1ZUIA 1IC6A 3TW6A 3N3BC 3T7RA 5AVVA 1WF3A 2I6SA 5B12A 3ZQUA 1TKAA 1DO2A 3KB1A 3PHGA 1NVTA 5C1BA 4L08A 3NATA 1U5BB 4MAMA 1E9EA 1XKLA 4BO7A 1E79D 2QBYA 1R0ZA 4HAWA 4W63A 1ZRMA 1WMEA 4N47A 1DBIA 2EWVA 1YFKA 4MJ7A 4BZXA 1SCUB 3T4XA 1D2HA 2G1KA 2JFPA 1RXCA 1DGQA 1ISHA 1P81A 3EXFB 2PKXA 2G1PA 4P83A 5E9WA 4IJ5A 2ZATA 1XUOA 2JFFA 3SLRA 3BMNA 4MS3B 4JJ8A 5G4KA 5EQTA 4Z4CA 1NQXA 1P7VA 2EFEB 4KQHA 4GPD1 4ETNA 1TXGA 4C4ZA 1PQWA 4YAKA 3JWPA 1VB3A 3ZTTA 2VJQA 3BSYA 1C4XA 4B84A 1AN9A 4MQFA 4FR5A 4C9BA 4HADA 1L3IA 2PMDA 3ROKA 3DS8A 1SIUA 3IAS1 4TV9B 2OCXA 1BHSA 2OEPA 2ZI9A 3UUFA 4C7MA 3VVCA 4NHOA 3EXEB 5AW3A 4PR3A 2ZRHA 4UU8A 4V2UA 2P9YA 3ABIA 1XEWY 3D8HA 4Y18A 5CRIA 2E5WA 3SDSA 4FLEA 4DM3A 2M32A 1TJ5A 3QYPA 5G1OA 4J3JA 2YH2A 1V5IA 1SUDA 1A27A 5K01A 4TTPA 1UXOA 4JOCA 4WVFA 1ZOSA 4J4TA 1L7BA 1DJNA 4UPDA 1PWEA 4DFDA 2PMWB 2XMZA 3OF2A 4JMLA 5JT1A 3LUKA 1YZTA 3EZ2A 3A70A 1G5IA 4NP6A 4XPIA 2QZ9A 3CX7A 5EFOA 3EBOA 3EUEA 4NARA 1G3QA 4R05A 1G60A 4BIMA 3UOAB 5DP1A 2AR7A 1Q3TA 1QKIA 2CL7X 1W52X 2FQYA 2RJ3A 3JZDA 1CY1A 4FPXA 1DELA 2B94A 4Q3DA 5FI1B 2QX4A 2YJ4A 4G1VA 2EKZA 1W87A 2MT9A 4K6MA 3W5JA 1RHKA 3SR3A 3LO5A 5IW8A 4WY8A 2FPSA 3FGPA 4ZEXA 1IBLB 5FL7A 3PGA1 3S1AA 4QTYA 3P2MA 4PQGA 4LCBA 2BFEB 3C3JA 4CWAA 2FZGA 2FDCA 1E3WB 3ETHA 4QE3A 4GLFA 2HA0A 4Y1RB 3WDSA 5HYVA 4WA7A 5KOYA 1XTRA 2QZZA 1SCJA 1FDWA 3ET4A 2D2VA 2HNBA 3BJIC 4M0DA 3WSTA 4AJPA 2IDMA 3JPWA 3H19A 4HVLA 3L7JA 3NM4A 1DUIA 3E53A 2IYAA 4NU6A 4Z9AA 4OJKA 1QZZA 1MG5A 3O83A 4FUQA 4REQA 5B3AA 5A3SA 3ADBA 3C6ZA 3RRBA 4E7OA 5K6AA 3AM5A 1Y6FA 2ATEA 3DE4X 4FJ0A 2VAXA 3H4VA 1F51E 1P5JA 2ZFUA 4ZCIA 1EU1A 2PX6A 2WUFA 4HZGA 1Y9EA 4CM5A 1ML4A 2HYIC 5TGTA 2IK8A 1RP7A 2PFSA 2PVPA 4JLOA 3VBEA 1JG3A 4X3OA 3DWIA 2W48A 3WY9A 3OJ0A 4B6FA 4IIFA 4ZVQA 4CODB 4F72A 2C54A 4PYQA 3PUZA 4ASUA 4OB8A 5B58T 1NBAA 3GD7A 4NL4H 4UFOA 3DMPA 1E64A 1N2CE 2GNOA 2P9FA 3WZ2A 3Q40A 5JAMA 2QY6A 3DEKA 2RJNA 5IVIA 3A6ZA 3R3XA 4N5MA 1TO1E 1J0BA 1ZN9A 2CCKA 1F8FA 2ADFA 1NOJA 2YWHA 3QM1A 3IBFA 3RSOA 3KLOA 3SJBA 2QBYB 4QWWA 1TA0A 2OT3B 5DW0A 3R3HA 4MA4A 1P1CA 2JGLA 3OLQA 4PG5A 2OZPA 3QJYA 3IP1A 3P9KA 1IZ0A 3EY4A 3O94A 4RK4A 4R3UC 2GBGA 2PLRA 2OYCA 3T35A 4ZZ1A 1UEJA 2IZ5A 2HJRA 8LDHA 1AV6A 4DG9A 3SICE 5IDWA 1WB5A 3PNSA 4UREA 3I2KA 2EYQA 5ALIA 4J2HA 1QPGA 3F7OA 4OO3A 3H2ZA 1UINA 2P2CA 2XMSA 1WUKS 4GYYA 4EGQA 4GRAA 4W5NA 4K6GA 5FD8A 3I34X 1Z73A 1BVUA 3DQPA 3I58A 4P7KA 4L0QA 2FPWA 1VRCA 2W4MA 4RZSA 3HK2A 1JLHA 3CLHA 4I66A 4LX8A 3QPBA 4UBLA 3FPKA 3KQHA 1F7VA 1Y33E 4I55A 3D6NB 1G6KA 3IDOA 5CYOA 4EPVA 4MRMB 1ULBA 4RK7A 3ETJA 3AIOA 3LXMA 4KWHA 2QL9A 2TMYA 2X3YA 1F9AA 1MIOB 1SZJG 2W6CX 4HXFB 4M0FA 2DUMA 1GUBA 2FWNA 5GQSA 1WSDA 3ROGA 4EAQA 5DCWA 1T3LA 2C8JA 2REQB 1JQ3A 2WZQA 3G6WA 3H1PA 4GI7A 1U3DA 4ZCPA 3W7BA 1KBZA 2P77A 2Z83A 5DT9A 2H2GA 5TQ0A 4RQBA 3G85A 1BCRA 2FQQA 3L6EA 5BMOA 5T4EA 3VSEA 1Z3IX 3LQQA 3QXHA 1HFWA 3E9ZA 3QVJA 5CT6A 2Q62A 4AQ7A 2DOKA 2QW8A 3L8DA 3ZE2B 4OAOA 4NMMA 5KNLA 1RD4A 2A1UA 1ZHHA 4CW7A 4KE9A 1IN4A 3CH6A 1T1GA 4TYPA 4M9SA 4MLPA 1AMOA 1DG9A 3C7KA 3EEBA 3V2GA 2C8KA 4RENA 1BN6A 1H23A 2AV6A 4G86A 4MIYA 5BV8A 2BH2A 4DABA 2G0TA 2HA7A 4OHUA 3W4IA 5K4AA 4LI3X 5CFQA 5IKMA 3B2EA 5L6MB 3ZDXB 3SSMA 3I2HA 1HE5A 1YCDA 3MJEA 1NLUA 3TTYA 1YIDA 1DKPA 4E6PA 3BHNA 3IALA 1XZQA 3PGKA 1KRXA 5JRDS 1YE5A 2AZDA 4XVUA 2P6NA 4QQRA 3SKYA 4MP6A 4V38A 5A9SB 1QE3A 3OCVA 1AXGA 2XECA 3CZQA 2I7TA 2PS0A 1NHWA 4FILA 4YRTA 2CW5A 3AOEA 4LMBA 3M9LA 4BX0A 2CVOA 3K4HA 1VE1A 1YKFA 2XE7A 2FKAA 1DQNA 1PJ4A 3GQBA 3H86A 5AI8A 5DRYA 4ALJA 1F0NA 1PUIA 1VE3A 4UAGA 1U8AA 1Y8CA 3C7TA 1NXWA 1KH3A 2J32A 3L7CA 4IWNA 4M38A 3ZPXA 3BJRA 1X7GA 3MGGA 4LRYA 4O0MA 5JMTA 1M73E 1KH2A 1BU8A 3S3TA 4O25A 5CIQA 1W88A 5FWXA 3P2YA 1DPGA 4LNHA 3UJ7A 1GLNA 1WCV1 2Q1YA 3T9EA 5IVPA 3IUEA 3ECCA 3T9CA 5K0TA 2C7GA 4DARA 2UVPA 4PF1A 3K31A 4HCJA 3WRYC 2E85A 5ALQA 1NN3A 2PKYX 3HFGA 3RS2A 1YJXA 1WOYA 4RGQA 4Z2YA 2EZTA 4DLPA 1XMVA 3DFKA 1OFUX 1QFMA 2R6CA 4I8DA 1GEGA 5E9QA 2FK7A 4UEWA 1P74A 4J4BA 4KBYA 1Q0TA 2UXDB 2AXQA 1PKEA 1PNOA 1P1FA 4HLCA 4MPPA 3I5YA 1PP4A 1UBRS 3UK7A 2G0AA 3VU1A 1MOSA 3MW8A 121PA 3RT1A 3TF5A 4OU4A 2YWDA 4N6GA 2HRDA 4PWYA 5C34B 3TMAA 3G2HA 3QELA 3RS5A 1KYZA 2FSPA 4AZ3B 1DZ3A 4IJKA 4QC2A 2P7IA 3R1IA 3WLMA 1ARZA 5FORA 1DTWB 4ZCLA 6REQA 4G0NA 4A6DA 2R48A 1X39A 3B51X 3KYIB 1V2GA 4PLHA 5CVEA 3A6PC 3PQ4A 3O74A 1AQNA 1BCSA 3WJAA 3HTXA 1E9AA 3L8ZA 4JKIA 3TQCA 1SPXA 1C3OB 2PK3A 2QMYA 3FNBA 3GVPA 4TSFA 1JP7A 5JYCA 3ZHXA 4NS4A 5KNBA 3HWX1 3TLKA 2SCUB 1X1AA 1ZDMA 3T3DA 3MTDA 3OPYB 4PGFA 1MHPA 3EZXA 4B4WA 3PT9A 1YTUA 1TCVA 4GE3A 4D3XA 1YRBA 2GUWA 2C9BA 3X3HA 2H8GA 2YL2A 4R9VA 4I19A 4DV2B 2I8CA 3OFVA 4KAFA 5AHWA 5JAUA 3BFPA 1PR4A 1LBEA 1UMKA 4E2XA 2X4GA 3EGEA 3CLTC 4YLYA 4B6OA 3ZXYA 1ORTA 4ZANA 4MCAA 2P6OA 3DAOA 2YJZA 3CJTA 3QPDA 5AK4A 5A4JA 2VT7A 1Q5PA 3GEHA 1IXZA 1LI4A 1AQJA 4KH0A 4F4FA 1POWA 2IWHA 3TPFA 5K3OA 5LA6B 2AZTA 2VHQA 2QV0A 3KJIA 4ZVOA 2EV9A 1JTFA 5CX4A 1PL0A 3OQIA 1YUBA 2DR0A 5FWDA 2FX3A 5BPHA 3N2GA 4G5SA 1RC8A 2QB5A 2F55A 1QRUA 2YHIA 2DWUA 2QJOA 3BHIA 2Q2QA 4HR7A 4RWZA 2YIDA 5ECDA 5ALOA 4AUNA 4NH4A 4BQRA 4BX2A 4DT1A 1JR6A 1JUDA 1U0RA 1XEXA 3AU8A 2D1SA 4Z8XA 3H2YA 1I24A 5EP3A 2QD2A 1S2DA 4RL6A 1YC2A 3LD9A 3FMIA 1A9SA 1PSDA 4ACAA 1PQUA 1GCOA 4IS3A 2WG0A 2WVAA 5JQGB 1C7FA 1UBTS 2DTDA 3H1AA 4L9RA 5EZ5A 3VR2A 3DMTA 4AQDA 3WMXA 4EH1A 2CNOA 5JVDA 3EFEA 5D51S 1NQVA 2E4YA 1ODJA 1A82A 2ZIVB 3DM9B 5HGJA 4EEZA 3CT6A 2QTFA 2PYZA 4D9IA 1O97C 5B57C 4JLKA 5BV2P 4ZVPA 1NXTA 2P0AA 4CN8A 4GI2A 1CUUA 1YWGO 3QIVA 3N0WA 2XT9A 1EFRD 2AX4A 1T9ZA 2P67A 4LISA 2BGWA 4GWGA 3VR6A 4L4XA 4PHFA 4KODA 4A0FA 3TG8A 1HO3A 1MPXA 1UBCA 4IHQA 3O91A 4KTTE 2QNBA 2B3TA 3OQ1A 3Q0TA 4IDOA 4IQ4A 1YDGA 2QUBA 3LBHA 2WJJA 3ZD9A 5DI3A 4I4TA 3LX6A 1SR8A 4JLSA 1JJFA 2WKPA 5CBPB 4IL5A 4O1MA 4W8HA 1W1IA 1EWKA 2EZ9A 3C3PA 4Q9IA 5IT4A 2XUZA 1OILA 1TYEB 4JBNA 4J2TA 3UC9A 1RJDA 2XMDA 3N6XA 3FCEA 4LY6A 2XVZA 2ZBFA 4OXIA 2Q6LA 3D4PA 4DJJA 1XRMA 3WYGA 2CHGA 4JLWA 3VAZA 5KYXB 2JK1A 3BGVA 5DMXA 1PZGA 4POOA 4B3RB 3K6SB 3P5SA 2Q5FA 4UQOA 5CDFA 3IVMA 1SURA 4MA0A 1QCCA 4GP6A 4TT3D 3H17A 3BHMA 5REQB 3V7FA 5J4YA 4EPXA 3NVMB 4HYQA 2I33A 2QN7A 1XFAA 3QA3E 4DMLA 4CHTA 1EI9A 2FI1A 2Q5LA 1MX9A 2REXB 3A6EA 3DE6X 5E4JA 3VTKA 4KI7A 3WAJA 3BGDA 3ZLTA 1GAXA 2XCUA 3OTIA 3JZFA 1YJBA 3WSVA 2H0AA 4EB3A 2EDAA 1QHIA 4J9UE 4KIFA 4NBRA 2RGNC 1S96A 2AFIE 1OVGA 3KOOA 1GN8A 4NEQA 2CK3A 2XD4A 3ZQKA 1U7OA 2OHVA 3B1WA 4Y9TA 3E2IA 2OBNA 2C98A 3LLSA 4HS4A 4LE0A 3RC9A 2JD2A 3Q3GE 3UAVA 4UDNA 1VL2A 2QLLA 4HX2A 1YAHA 2X8JB 3E18A 3WLFA 1BQEA 1GKIA 4B76A 1T1EA 1N0WA 1X7DA 1QB7A 2JHGA 3F5QA 1CZOA 1GL9B 1OMOA 1R3DA 2PUWA 3BQ9A 3LGXA 3NONA 4IF4A 3BRQA 2G8LA 4L02A 4Q4HB 4R9RA 5LMNB 4ZAZA 4G9EA 1I10A 1RKBA 1NUUA 5BR1A 4XQCA 3DEYX 3C14C 3ZWAA 3HJNA 2AIRA 1AF7A 2BI8A 2AW5A 3KR0A 2CHVA 3NETA 2QDKA 3SCZA 3WMFA 4LJAA 4ZYXA 2WBLC 1TZJA 2K7ZA 2V7VA 2LD4A 4ZHQB 4X1OA 1E9CA 2Y3IA 2YBEA 5LM3A 3AX6A 3GLIB 1GVHA 4BPRA 1SXQA 1J99A 2Z2ZA 2P9TA 1NGSA 2ZPTX 4M22A 1EYZA 3NUGA 1O94C 2PS3A 4RPCA 3RJMA 4C7OB 1H8EA 1EAMA 1K92A 3I05A 4PRKA 1WXFA 4BTLA 2G0NA 1G9XA 2NQTA 2YUTA 4KPGA 1QVAA 4O4JB 1JQEA 3LX8A 1MBZA 4NC9A 4TPKA 3ZY6A 5IH7A 1E2UA 3CLUC 3DL0A 1OXKB 3CKYA 3BRSA 4HGOA 3G2NA 4I9NA 3R0JA 4AKTA 3F6YA 1BDIA 3ZDBA 2DBYA 4MV0A 3ZDRA 4N7RA 3QA9A 3BE6A 2BGLA 1WZIA 3V55A 4TGLA 5DB4A 1B73A 2R8RA 4G5XA 3PX7A 1NVKA 3BFVA 3D7LA 2EJWA 2B98A 3F3SA 1SC1A 4HQ0A 4RY8A 4H35A 2JHAA 1OH7A 2YMMA 5B5SA 5BO5A 2Z6AA 1LDYA 1FNCA 1K6EA 2W6ZA 2WSSD 3A2MA 3JYNA 2IHTA 3OIYA 4UHKA 3WGMA 5J47A 2PS1A 2RAVA 3AERB 4X3CA 3RVKA 5TDHA 4WCFA 2YZMA 4BWVA 1G66A 2EFGA 3CRRA 3YASA 1T36B 2CY0A 5FPPA 5JALA 5AESA 4U9UA 3OPVA 3E23A 3QGMA 4KXFB 3JQCA 2QXTA 3FHTA 4F5EA 4XDZA 2NZVG 1CQJA 3I0MA 3MRSA 5C1PA 1ANKA 1Q92A 4I14A 3AL3A 3NALA 3EB9A 1QOPB 4UMVA 2ATVA 1W4AA 3O31A 3IVGA 1CR2A 1RXSA 4FDUA 1XZEA 4FCCA 3QNUA 1CEYA 4MB0A 4KP7A 2F9LA 5T7BA 1SVMA 1CY0A 1V1MB 2QSZA 2XJ4A 3AEKB 1QG0A 1I2CA 2MSWA 3IILA 4YALA 4B8YA 2Q4DA 3WBBA 3KUUA 1G8FA 5K51A 3ILSA 2ZE6A 4G5GA 3RVJA 4RK6A 1XZAA 4MYRA 3LO8A 4OQDA 2IYZA 1G20B 5HBGA 3NTQA 4B0PA 1TM2A 3QEBZ 1Y5IA 3HKDA 1B7GO 3LT4A 4S1WA 1ADYA 4HAOA 5FUXA 3KKEA 3RC3A 1T2AA 2EW8A 1T9HA 5KSOA 1JLMA 2FOXA 3LKVA 4U6SA 3C8MA 3BXXA 1Y1KE 3M5WA 2BJWA 4MKXA 1L1QA 1K3FA 1ODLA 1CCWA 2ZW9A 5FO1A 2DUUA 4KQ6A 4TTIA 1OWNA 2PZMA 2QM0A 3CVJA 2JGAA 5E6SB 3OQ6A 2NYVA 1G8MA 2YYYA 2ZWOA 4JXJA 4ZIRA 2VQEB 3WG9A 3EPHA 3HVIA 2BHSA 3RH0A 1U8TA 3OAAA 3A6HA 4ODIA 1EX1A 2H92A 1AK9A 1WRBA 4BTEA 4KX3A 1AKWA 1TCAA 3AUAA 1ZD9A 3MHPA 2XYRA 4IUDS 4HYTA 3GPCA 3Q2IA 2JZOA 4BO6A 3O82A 3EASA 4IP0A 3RF7A 1U6JA 1SKYB 3DBHB 4YMSA 4FM9A 4XIIA 2H3HA 2H2AA 3B3GA 4FXOA 4HI0E 5SY9A 4K9KA 1YA6A 1ODFA 3COPA 5B7PA 3NP7A 5ITWA 1VBNA 2PCLA 1YI1A 2XE8A 3I39X 1BQ4A 2Q8PA 4MGHA 4D80A 5ADVA 1JDPA 1MABB 4E5KA 1G98A 3ORHA 1QU2A 4P80A 2QMUA 3VNRA 4LQ4A 4E5PA 2DR3A 5GOTA 3RU9A 1E0SA 2G09A 3V8RA 3LKZA 4OGLA 5DBEX 1L4KA 5EJ9A 2HFKA 2AZMA 3RVOA 3NJ4A 4PCVA 1E2IA 2IYRA 3MRXA 1QG4A 1R4ZA 4CDRA 4F8EA 4LYGA 1Z06A 3JSXA 3VOTA 1VYTA 1YRLA 1NLZA 3KQQA 3I72A 3G0HA 4DR6B 1TX4B 2DHRA 3ZY3A 1OIXA 3K0EA 4MW2A 4ZODA 3ZGYA 3IKTA 1QPZA 3DVRX 3ZXIA 1QE5A 1XZHA 4UVDA 1XTBA 1CQIA 2HRZA 2AZXA 1LF5A 3U7EB 1L2TA 3ZX4A 4JP8A 3KQYA 1FTYA 1K2WA 1KI7A 2ZR7A 2B92A 3Q6MA 4YECA 4N3NA 1U0TA 3HUUA 1WNTA 1EP3B 4E5UA 4N40A 4AJ1A 1H2XA 4DY4A 3FIUA 5CW1A 3LH5A 3VTZA 4URWR 1Z83A 3AEQB 1IQPA 3KEMA 2GK3A 5CT5A 3A1SA 2PUHA 3LX5A 4G0MA 3H9BA 1AZWA 5FWYB 2Z1MA 4D8YA 4PYIA 5AVWA 4BX3A 2W6PA 2WJ3A 3ZWVA 3ASVA 4MWZA 4IIXA 3ZDQA 1D2CA 1U3FA 4C5AA 2V7GA 3RHFA 1GUDA 3BZUA 3FR7A 2X42A 4JJ6A 1X0XA 4P2GA 5L40A 3PPVA 4TLCA 2PUTA 1T6YA 5IEBA 2EX4A 3JYHA 5CFNA 5BN3A 3LA8A 3HCCA 2R1VA 5B7NA 3RT9A 1ECJA 4IDEA 1XXHB 3FOEC 4ENTA 4EX7A 3P0RA 5FPKA 1KDTA 1SVLA 3HA7A 3IHWA 1I3OA 2Q0QA 3LX4A 1P3JA 4RZUA 1C1XA 1F14A 4UNNA 3A9RA 2HU2A 3TJZA 2CV1A 1EXNA 1NI3A 5AM1A 1ZZEA 2YDXA 3NX4A 1HEIA 5H4GA 1L5HB 3NBAA 3NOQA 1IOLA 1GZDA 1KDRA 2IYQA 3EIXA 3HWWA 1EUDA 3PKZA 3NFRA 2ID4A 3F6BX 5LB4A 4URVR 1MVNA 2IYXA 5AW7A 2CYAA 2XQIA 3S7ZA 3OCWA 4PXSA 5TS2A 5ESXA 3ZI4A 4CFZA 1IZZA 1NF9A 5F3WB 3NEYA 2W6NA 4MVJM 4QEKA 4Y6QA 2FRDC 1M0WA 2XUIA 1ITZA 1WABA 1QFSA 1ZBQA 5MGNA 4GKKB 2VNHA 2A5GA 4NLLA 5F1PA 3K9FC 2BP7A 3QOFA 5A0FA 1NRWA 4ZYLA 2I0FA 2NTVA 2ZRQA 3S29A 5A71A 5LYJF 3EF3A 4I5DA 4OM8A 4FOPA 3FYUB 4MVJI 3RS3A 3LXRA 1GU7A 4GP9A 3EPRA 4JZKA 4B82A 3COWA 4AJLA 1HURA 3JYLA 1S5PA 3TOXA 1RNLA 4G81A 5K0ZA 4YO8A 3EVGA 3GJ4A 2ZRGA 3DC7A 3MCAA 5JJKA 2JKVA 4QLBA 1DBRA 1SBCA 1FLNA 4M8SA 4R8RA 3I1FA 3CONA 4NYJR 4PM4A 5EXDA 1GUFA 2G5GX 5EJAA 2YWBA 3PFGA 1JKXA 1ZNQO 2W6JD 1P44A 2WLSA 1UC4B 5DLPA 5I4KA 2FPXA 3OOHA 3RUIA 2P90A 4PZAA 4RJKA 4HWKA 4B3CA 3I6BA 1AQIA 1P1KA 1V1RB 2VJYA 2WIGA 3KOYA 3OJXA 1RLMA 1Z15A 2BV3A 3OCJA 4JFAA 4OXXA 2OGUA 3M49A 4P5PA 1OLSA 4OBBA 2QENA 5E4YA 5EEHA 4DWVA 2LKCA 2CNKA 3NIGB 4C20A 1OYOA 4K05A 3WK8A 1E5LA 2HO4A 4X3PA 3V8QA 2E18A 1GGNA 1XB2A 1XK6A 3BRWA 1D7OA 3L0SA 2NUTA 1LH0A 1DJLA 1Z6GA 1MKYA 1E1KA 4NPCA 1FQJA 2QP9X 5AKEA 1I33A 5ENVA 4I50F 5COBA 2AN1A 3FX2A 5KMGA 3A1EA 3WWOA 4LF6B 5IAKA 1ZEMA 1T24A 2VAWA 2VHYA 2JDID 4BUZA 1N33B 1WR8A 1XHLA 3I4FA 1I01A 2R8ZA 4Z7OB 2CFIA 1OFGA 1ZWKA 2JGIA 3MT0A 4JT2A 1KERA 1G3UA 2HV9A 3K9LA 4FYXA 1V8PA 2QLBA 1DU4A 6PFKA 1RBQA 1K7CA 1RLOA 3EA0A 3L7YA 1PYOA 3R7SA 2XKBA 5JS7A 4M86A 1LLCA 3A9VA 4BC1A 5LKRA 2OB2A 3JCZA 2ONYA 3CQ9A 3MN1A 1ACLA 1C8KA 1H94A 1KKMA 3OD5A 3U7QB 4CIXA 2OK7A 4ZOCA 5DIFA 3FNQA 2ZJ2A 5HR5A 4RVNA 1BA3A 4JT8A 4QBKA 3TIGA 3TSAA 4AULA 3QVVA 1Z47A 2W2PA 4RFLA 1M34A 5JSZB 4BQNA 3UT5A 4YCLA 4JP3A 4E51A 1EZ4A 3RVMA 1BE8A 2J45A 4HTFB 3EBPA 5F52A 3DCYA 2Q3EA 3GLHB 4O4HB 4BZPA 4F60A 4YHHB 5CUQA 4C6TA 1HF3A 2AFHE 3OF5A 4R8SA 5DBGA 5MFPA 4LFBB 2W2MA 3NHSA 2VEDA 4KNVA 1DBSA 2WD7B 3R4CA 4LJ5A 1AGYA 1E0DA 5CNJA 3LHSA 5IARA 5EEGA 3RHSA 2JG3A 1QVZA 4NPAA 3JYOA 2IRWA 3WL3A 2EFDB 1M9NA 3DVQX 3HO8A 3OSUA 1FZTA 5LJLA 2NU7A 1U7PA 1DAIA 2OO7A 3C6XA 1MAVA 2W11A 2PGIA 5KHLB 2FDRA 3WXMA 1JEQA 2Q46A 2OO3A 1H2HA 3OIDA 3IPLA 1U2GC 4BMCA 1II8A 4Y67A 5HNKA 1KEPA 3OLYA 3Q98A 3DP7A 2DX7A 3K0FA 1VP3A 1HE8B 2C00A 3UCFA 1K66A 4JYMA 3WWPA 1UP6A 2G07A 1KWKA 3K8ZA 1YI8A 3LQYA 3MYRA 3WK5A 4BPBA 2CEKA 2PQMA 3KT3A 4CKXA 5BURA 3L0IB 2A5JA 4GGPA 2O54A 1SCDA 4Q3NA 5JWOA 1YHYA 2HKIA 1G63A 3P0EA 2ECFA 3TIVA 3AM3A 3L7KA 5AK3A 5G40A 3Q8KA 2UYHA 4O2BB 5JJIA 13PKA 5JZOA 3VDRA 5KVVA 4LJ7A 5C46F 4IV8A 3QOWA 4JC5A 5CT9A 3RB8A 3BCHA 3ZHZA 2ZB2A 4QHYA 3RR2A 7ADHA 1TK3A 1DRJA 4FSHA 1CRLA 1I1OA 1QPBA 3PUKA 3QV1A 2YICA 4LCEA 5CLLA 4AAYA 4N76A 5L4NA 3L01A 1HLGA 4OHBA 4CRWB 4FVTA 2FFRA 2VSQA 1DI0A 2MSDB 3T9BA 4N41A 3EGDB 3IEUA 5E1DA 4Z7QB 2WIDA 4HJXA 4EW6A 3B60A 3E8MA 4RK1A 5EUQB 4BZZA 3EJWA 4LOHA 5LNK6 4KCGA 1MUUA 1FJHA 1D2GA 4IZ6A 3V4RA 5LQMA 4MUKA 4KR7A 3C8UA 1SQ6A 4ON9A 3OQMA 1CUWA 3P20A 2PTGA 1U5BA 1SU7A 1ZESA 1RTTA 4AJHA 3L7NA 3CUSA 1OT5A 1JQ5A 3VJRA 1KEZA 1SGWA 1U0GA 4J76A 1JBEA 3RUAA 2WSIA 2VZ9A 1J2YA 3ABRB 1U9IC 3N7TA 3OEWA 2PWBA 3D02A 3EXFA 3B3FA 4HF7A 3E5NA 3J80A 3IRUA 2OPHA 4BLRA 1LNQA 1N9GB 4TYWA 3U4QB 3D1LA 4D0SA 3JVVA 5IAOA 2O7QA 3NASA 4HFJA 4PWZA 1HDIA 1O96B 2R66A 4MUXA 1ZCBA 2XNDA 3X1XA 2JI4A 5AHOA 3MS4A 4YXWA 1T5SA 3LC1O 3MD9A 3TTXA 5EIEA 3M8KA 8MHTA 4OHFA 1NMYA 4BVKA 4PGGA 1FFXB 3B7WA 4BB0A 4Q3KA 1M76A 3GYGA 4HTAA 2VLBA 3WWEA 2G06A 3W9BA 1RJ9B 4UUBA 2FX2A 4NY1A 2YXLA 4MITA 5FOQA 3OTWA 3QP9A 5J2TB 2GAAA 3I9LA 1L8QA 3WGGA 2P0EA 1ACJA 1PFVA 4K9SA 4CQMD 2XHZA 3PDIB 4BNNA 3OLCX 1OAOC 4AMYA 4KKVA 4IDDA 2GBLA 4O8CA 1ECCA 3KU4A 2PX4A 4L5IA 3K9QO 1SG0A 3HCWA 1R6DA 1OHHD 1QYXA 5A02A 3W79A 5IM5A 3UMCA 4NMXB 3ZZTA 1JHAA 1SXJD 3TINA 4M0CA 3NV7A 1CB7A 3A3NA 3L8YA 2IPAB 3ZIAA 1E62A 4M83A 1M1ZA 4JVOA 1FVXA 2ODPA 5AVZA 1FLDA 4D9HA 2CC2A 5TMPA 3D5TA 1Y6JA 5BPFA 2JLAA 3QVKA 2DQZA 1NMEA 2H1RA 3MT8A 2IH5A 1YHZA 4W9RA 2BFEA 3ZW9A 4BECA 1J00A 1IHUA 2IPOA 4CTNA 4K28A 3RYIB 1MD9A 2H52A 3W04A 1E0KA 2ENUA 1AE1A 2J85A 2QRZA 2FNAA 1QF6A 4AJ2A 3HU1A 3RFXA 1JG7A 4YDRA 3I9V6 3ZNOA 4AMBA 5K8IA 2ZLBA 4DUPA 2NO5A 3DYVA 1A5AB 3JD3A 4UUMA 2Q3JA 5G1NA 2R47A 1JHUA 2BI7A 2JAWA 4WXHA 4EWLA 4I9HA 4IPTA 4YRIA 1XEWX 2H00A 1WY5A 1Y63A 1KHHA 1GQFA 3IOYA 3JD4A 2XOEA 3OESA 3CXUA 4O08A 3UK2A 3OOJA 4NENA 1U8ZA 3JWJA 3T8YA 3X1MA 4I99A 4DIFA 2I4LA 1UPTA 2OGZA 4FMCB 1KY2A 1N77A 4NK4A 3QSGA 3SZLA 2CSUA 4TWIA 4Q7MB 1K7EB 1ESZA 4F9TA 3QKRB 4E14A 3BXPA 4CMKA 1HRKA 4BNFA 3TLEA 5BMVF 4MARA 1X19A 3E81A 3WLIA 3PL5A 3A27A 4W1QA 5T57A 1LFDB 4YAEA 3H3FA 4A8HA 2QMZA 2XYGA 3PJFA 1GR0A 5BQFA 1NPDA 2VFAA 4IKEA 3IAFA 3GPDG 1E66A 2R60A 3N2EA 3HJBA 2PUBA 2AMYA 4UOZA 3DBLA 5HS4A 1RJEA 1B26A 2ZBPA 1A9XA 3IAHA 1LV8A 3LNCA 1QF7A 4L57A 4IILA 5AOVA 5LYYA 3GR6A 4GDFA 3R44A 4E07A 4YRPA 3EW9A 4V3CA 1NQ5A 2C0PA 1Q7GA 2AJBA 1BJKA 3MAGA 2AH5A 4YUWA 5TF0A 3VR3D 2J48A 4FKZA 1AKVA 3RV4A 1VMDA 2GVZC 2XYVA 1PDWA 3QVMA 4QICA 4QVGA 4TWAA 3EXHB 3V3KA 3D1VA 3NTXA 3Q12A 3HSKA 3V7WA 5HZKA 2ZSKA 4KWEA 4C7KA 3DOIA 4MRMA 5CVTA 2O3JA 4C22A 4DV4B 4R1MA 2UVQA 5I9MA 3KU1A 2H06A 2XOKD 3D3KA 4ROSA 5ERYA 1PG0A 4BNGA 1OTHA 1PVDA 2EAUA 3F8TA 3OJLA 4IGAA 4B46A 4WBNB 1HDGO 3K09C 2GYYA 4YBZA 3LV8A 1K1EA 4GOOD 4IZIA 3X1DA 3GZTB 5KQMA 1BE6A 1RXEA 5F3DA 2PUEA 4OHMA 1C2TA 2GARA 4IIUA 3SMVA 2F3QA 4HPXB 3VHRA 1A7JA 5A4KA 3RYTC 1PGNA 4P6VF 3RBAA 2QYOA 3NBMA 3ICVA 1GKYA 3GFPA 1VFNA 4PLGA 1HR0B 1LD3A 4UW9A 3RS9A 1YCFA 3EH1A 2VRCD 1UC8A 3I9JA 4M1MA 4Y0NA 3T7JA 4W9NA 2CLLB 4M2LA 2NVWA 5CDFE 3QLEA 2WUWE 4HQRA 4HUQB 4BGIA 4JUDX 4MSUA 4XXHA 4Z86A 2W6MA 2VQFB 2VOJA 2ZI3A 1T2EA 2GCPA 4NFYA 4XQ0A 2PM8A 3GFTA 3N8IA 5ICFA 1P2GA 3C3YA 1VKZA 2BHLA 4WKOA 4A6EA 1X1EA 2ODWA 4G4SP 4NICA 4YPVA 1DX6A 2A86A 5JJ5A 1PCXA 4Q4JA 4KO2S 2J31A 1R7RA 3KWJA 3CRMA 4MR8A 4WY5A 3G2LA 3V8NA 2GD2A 5T3YA 4FIZA 1OFVA 1EFDN 3K70B 4JY7A 5IJ0B 4XM2A 4JENA 1EVEA 4KQ9A 1TUBB 4NECA 1Y98A 4X92A 4Y6OA 1GKUB 2RB4A 1ES9A 3DZIA 3HDYA 3L05A 4ROTA 2OD2A 4I8XA 3T3MB 3U61B 2C58A 2F62A 4G84A 3REOA 1W36D 1O6BA 4L5BA 5HKLA 1JMVA 1D4OA 2H29A 2HO5A 2DTXA 2BN4A 3PUJA 1G1MA 1CP2A 3QPWA 4MKRA 3VR1A 1XPUA 2ZRIA 4FFPA 2E21A 3SYKA 1Z2PX 1NKTA 2NUPA 2Q5CA 2AYZA 3P9XA 1K0UA 3TXYA 1GPUA 2VBIA 3NKLA 1W5TA 4WBSA 1S9DA 3EA5A 4L75A 4KR6A 1ZH0A 5DBFA 2O50A 1VIVA 4IYRA 2WHEA 4ND1A 3RYFB 4CU5A 5HUQA 1ZK3A 5E2IA 5L3QB 4WFQA 1BHQ1 2HTFA 1TJYA 1E1MA 3FDZB 1KZYC 1LBTA 5IDQA 3M81A 1JEEA 1IJBA 2ZIEA 3UMYA 1FU4A 3BJMA 5BNZA 3K4QA 5EIHA 4BFSA 4AZ3A 5LP6F 5JO9A 4LGCA 1VIAA 2PMFA 1SZPA 1QOQB 5FV4A 1WEKA 5CCBA 1M1YB 2SECE 4EATA 4CCYB 2O19A 3PL1A 5DLDA 5L53A 4HAXA 4W7IA 3C41J 1BKYA 5F5LA 1X7HA 3GRYA 3WMRA 2B1GA 4HY3A 3RRYA 1IUOA 1KHTA 1X77A 2VOEA 3S8MA 1J4AA 4TV8F 1M7HA 1L4YA 1C3OA 1KY4A 4MVJA 1Z7GA 4JSRA 2ZT6A 3L46A 4XE5A 2Q3LA 2B36A 5DCUA 2SCUA 3WDKA 5HHTA 2I1WA 1IMOA 5KYWA 1XXLA 2A84A 2QPAA 2QQEA 3FCUB 4NK5A 1ADGA 621PA 4QODA 1Y34E 1Y9DA 3SM3A 1GG2A 3L7BA 3H9QA 2WVJA 2EBUA 2E3JA 4JD5A 3N76A 3AESB 3II6X 5DBIA 4UATA 5T4FA 4BAGA 1XQ6A 4EARA 3CUKA 4P58A 2WWXA 5JANA 3RGWS 1M0SA 2JPDA 1JECA 1KK3A 3FFXA 1Z4KA 2R5WA 3TDMA 3HLTA 2LGJA 4MI6A 5IABA 1SG6A 1ZCAA 2Y4NA 3DHVA 3K1ZA 3O4JA 4P3PA 1EKXA 1FX1A 1OF1A 5GP1A 5HE8A 4BO5A 1RE1A 3ED5A 1T3GA 1Z6QA 1NWCA 3KVNA 1Q12A 5LA6A 3TLGB 3WGVA 4U5XA 4MGKR 1EWVA 4UTNA 3RTBA 5JQWA 2D1RA 4EPRA 1MRZA 2ZRMA 4L78A 4K8RB 3WJ1A 2GAIA 3E0QA 4DCVA 2BH9A 1JX6A 4M0LA 4PG6A 4YV2A 4MRRA 3SZMA 2ZAGA 1F6DA 3PC8A 5A7FA 5E38A 3WLKX 5A6SA 4QYWA 2JK0A 4F4DA 1N8TA 2JB9A 2HMYB 4HNRA 3VYTB 1TI7A 5KREA 1N1DA 2APJA 2BFOA 1MC4A 4WRRA 1HUQA 5AUQA 2IBSA 4M88A 1W2HA 3T52A 5ENZA 1RRKA 4DVJA 2WJYA 1K8ZB 3H84A 4KQWA 2ZTSA 2MYTA 4QREA 3QFRA 5FLYA 5M2QA 2JLUA 2O0LA 3H65A 3PWTA 5IHPA 2ANCA 3ZV3A 1PG5A 5KYYB 1JWAB 2R85A 4URZR 1FX0B 1YMQA 3SQMA 5JY1A 3KR1A 1HA3A 2WP0A 1TTHA 3DWFA 4CVNA 2ENWA 4GGMX 4RANA 5L3ZA 2HMVA 3H8WA 2XGJA 2QZPA 1ZN2A 4YIKA 5CNIA 1O54A 1CZUA 1I6MA 2DE0X 3ND7A 1DFIA 2PH1A 1TC1A 4HWTA 1JE1A 2ZCVA 2QI9F 4JLBA 1QIFA 3E2MA 5CBPA 4RFSB 2N46A 1UZMA 2A7QA 2XLBA 1VZ3A 1QCZA 3NBYC 1L1RA 4LZZA 1ZNYA 5CH5A 5CVJA 5BVGB 3WIOA 3LCCA 4MPJA 5AYVA 1PLLA 1YQ9A 2A3NA 4HQFA 5K3DA 5GVSA 4PC3A 4F85A 4D4KA 5KYXA 4MW4A 1P0PA 4Z9FA 4AICA 1U4OA 5SYNA 1BG6A 3GO4A 3VR4D 5C4MA 1Q11A 1E3JA 3N9IA 1EVQA 5CLGA 5BWLA 4ZI7F 4QEZA 2ZSHA 4KUHA 3IPXA 5LQKA 3HFRA 5CTAA 3S2ZA 3GCZA 3OKPA 2V6BA 4Q19A 1CRWG 1SVNA 2RI6A 3UUEA 2PZBA 5AW0A 4HN2A 2OAP1 4NAHA 4LHEA 5CT8A 4HBGA 5JAIA 1FDUA 2SKEA 1QAQA 2WM8A 2BTQB 5JAPA 1ZQ1A 3CCFA 1XALA 1GPDG 1GQRA 3PUIA 3UMGA 1OKKA 5CVDA 3J7TA 421PA 4O4IA 2DPGA 3GAMA 4M9QA 5DCYA 1IUKA 2QP4A 4DSZA 4EMSA 2HT1A 2WNSA 3HVRA 4FDTA 2C42A 4PSAA 1PFUA 3ZEAA 5CU7A 4BWGA 1XQ9A 4K9OA 4P4SB 5C9ZA 4LXTA 1T6XA 2ZI7A 3F47A 4QUGA 2JGMA 5PGMA 5I3CA 1J49A 1FMTA 4Q4HA 3ZDCA 3LGSA 4MYSA 2FMHA 4RXMA 1E6UA 1RQNA 2PHZA 5IYZA 3KLNA 1M2OA 3HO1A 4EW2A 3A6JA 4EKEA 2I3AA 3GU3A 4FQ5A 2X0KA 4U7FA 1R2QA 2B8JA 2PZFA 4FI3C 4S35A 5C0OE 1LXCA 2MCFA 4ZQFA 1XNGA 1YVDA 2GYWA 3IEXA 5H83A 1Z0UA 3IBTA 2PH5A 4LDNA 4BJ5A 2EKQA 1DTSA 4ZHQA 4Z4HA 2WIFA 5K6TA 4UDYX 3STUA 2VJBA 4XPZA 1EX6A 2AK3A 2G08A 5P8WA 1L7QA 4B32A 1IBKB 5MFZA 2J0EA 4PQEA 1QOZA 2C04A 2RC5A 3U3KA 4ZEVA 5ARBA 4NBWA 2DG2A 3L18A 4BWYA 3GFQA 4H27A 4GX0A 4P35A 3RO7A 5IPFA 2C20A 1GAWA 4PAMA 1Y82A 4NESA 1G7RA 1SVUA 2GK6A 2VEOA 4I08A 1I9CA 2MYNA 4DIKA 4DWJA 2RK4A 3NNNA 3LQ4A 2IZ6A 2GEKA 4RABA 2VL7A 5K3SA 4F06A 1WZ2A 4FN5A 2GDJA 3M4ZA 3USZA 3PJRA 3COVA 3ZBTA 3GYBA 5E2BA 3IHLA 3ICQB 3SR4A 1KFBB 2D1TA 2HSJA 2CHUA 3L1IA 1U0EA 1KP2A 4L72A 1EFAA 2BKVA 3MAJA 3LTEA 3DDCA 4LTDA 2JFBA 4TLEA 1BXKA 4KWIA 1K5GA 1BN7A 5FJIA 4HGZA 3ZU4A 3DULA 5CLQA 4BLQA 3R09A 4RIIA 2IYLD 1CUIA 1Q74A 4BO3A 3AM4A 2YKGA 5HVNA 1JFVA 1Y81A 5SZHB 1Z2DA 3I4LA 1SBZA 1N7JA 4MUAA 4ZMRA 2HUPA 5MN4A 3EY9A 3ZGNA 2ZJ0A 3BXGA 3JQEA 4N6OA 2VQ6A 4HG2A 4UTRA 3ZGLA 3ZDEA 2GLTA 2O20A 2X86A 3MUEA 3OT1A 4PCAA 4ZAYA 3PD7A 5TJHA 1FU8A 1T34A 3W6PA 1O5TA 1UPAA 1XNHA 1OI7A 3FDFA 2DHEA 3TVTA 2WZCA 3CR7A 4LE1A 2VP3A 3BWCA 2QQ0A 1H1DA 4B3JA 1QGZA 4RPKA 4V2IA 1TD1A 2AG8A 1P2DA 4D02A 1YJ5A 4HGNA 5I51A 1N2OA 1AN0A 3KOZA 1FRNA 1L4GA 2OILA 2VWPA 3KUDA 1QX4A 1QYWA 3DVSX 2B4RO 3K1YA 2HJ9A 3DPIA 3OOSA 2R4UA 2C1ZA 3WB1A 3DLTA 3FMVA 1J1UA 4E46A 1NR7A 1DKLA 1F5NA 5AW2A 1VG9B 2OMEA 3IE1A 3HJFA 1KVQA 4TTTS 3ZNNA 1I3LA 2W5UA 2WTMA 2PRYA 4GM4A 4X1KA 3O2QB 5IBRA 3SN6A 3WE7A 4C6SA 5JSFA 2IH2A 3AUUA 3OT5A 5JCJA 1BX3A 4NVRA 3CE6A 1SHJA 3Q85A 3OIVA 5D2CA 1K6IA 3A4YA 2ONCA 4QDZA 4EHIA 2PZ8A 4FFWA 1O58A 1N25A 4CQJA 1NOKA 1KFCB 3EGCA 3Q5EA 4IDQA 3I09A 4MAFA 4ZQGA 4NXMB 3TR5A 4G67A 4GO1A 2QQ5A 1NW9B 2RD2A 1TGVA 2ZJ4A 2OCAA 2RC6A 3L84A 3M6IA 5BQ3A 5ABPA 2ZOSA 3U6BA 2D13A 4H7PA 4UOEA 5HWSA 1DFGA 3UK0A 2WNHA 4KNWA 4LXGA 2E4WA 3MMSA 3NORA 1YV9A 4ZO6A 3E82A 4H59A 3CZPA 4A92A 2CDRA 4WXYB 3DBHA 2IHKA 1J90A 4UHCA 5EG5A 5EZQA 1XRJA 2F43B 1RRPA 2VBCA 1L4UA 3L6BA 3ABZA 5IDXA 1J33A 4FW8A 1VZ2A 2AGVA 1NI4B 1BW9B 4OK6A 4CV1A 5A5DA 1V9LA 2P9ZA 2FSUA 1H4TA 1HDXA 1CUAA 1U28C 2NXWA 2XGOA 4G24A 4C05A 4MNTA 1G38A 3LBIA 3GCXA 4QSHA 4NEGA 1NVMB 1J6UA 3LJKA 4TYYA 1GNPA 1HE4A 3QPVA 1HKUA 1XZCA 4WCVA 5E6UB 2AEJA 3WWYA 3HE3A 3A9UA 3D3EA 3OX2A 2Q5JA 4XB6B 4DSTA 3V4FA 4QGBA 4TTQA 1BYIA 2X5NA 5CEJA 3N8HA 5I7WA 2YQ5A 2AN9A 2H5JA 3OLWA 2IELA 3PRHA 4XYEA 4ZOLB 3RLFA 5F2NA 2GT1A 5IAEA 3ZJYA 4KW7A 3AHCA 4BJHB 3B6KA 4MV9A 3F74A 1F4LA 4XJSA 4L7QA 4UTOA 3SSNA 4AWXA 2IX9A 3GUHA 2C5LA 2FU5C 3R7NA 5AQ1A 3K9GA 4TLMB 3CH4B 1MC8A 1MAHA 3N8GA 4J7XA 1MFPA 2I1LA 3FMPB 1WPQA 4DW8A 4Z7NB 3C4QA 4KQCA 5KDLA 3ZW7A 3CVUA 1R15A 2NV6A 1JEOA 4G09A 5J59A 4BQOA 4GKVA 4OP2A 2YRWA 2P78A 1QU3A 2K87A 5CFRA 4MYUA 1OBCA 3FDXA 4QJ3A 2YXEA 1KQFA 2BFFB 4DDHA 3B9PA 1R6TA 2ETXA 4I0WB 5DTMA 5FWYA 3TW8A 2IODA 3DDUA 4HNAB 4E33A 5DXFA 5BWBA 4OUKX 5F3RA 1YQUA 2C2KA 3FCSB 5E1BA 3WWDA 2VIIA 2ZYAA 3IJ5A 4J03A 1XAIA 5IANA 2XDWA 4JJ7A 3RTEA 2NU6B 1IRIA 2NT4A 3H6GA 2A0WA 2DLNA 3MF4A 2JEOA 2FEAA 3FSGD 5HS6A 3RK1A 1Q7EA 4YP6A 1X0VA 3BKWA 4DC1A 3PITA 1G0OA 1QE0A 1M0TA 1KEUA 2AYXA 3AKEA 3NWPA 1TVMA 2JIQA 3BILA 1M10A 4LSWA 4BJ6A 4RTSA 1BDHA 2R00A 3EDQA 4CMJA 1U0FA 3TI7A 4V03A 3GDGA 4YAGA 3U3DA 4OFZA 3D6JA 2CUZA 1FVOA 1KPHA 2QTBA 3R3JA 1A7UA 1TDJA 4KB5A 3KQSA 3B8HA 3H8VA 4QQ8A 221PA 3QNMA 5J40A 1L5HA 3DZKA 3T5AA 3PXUA 4CEHA 2EFCB 5HZGA 3QX3A 1H2BA 1TTTA 1N2XA 1X13A 3NGLA 4LDPA 1JILA 3UJBA 2QTWB 1G3IA 5KWEA 3T5MA 1R18A 3ZHBA 1RU3A 2EKBA 3N2LA 1N5OX 4MXDA 2VP4A 3UB4A 1KETA 2XITA 2YC2C 1NN5A 2Z5FA 4HQOA 3KKKA 3HH8A 5AHXA 1JXOA 5F9FA 1V25A 3FKSA 1ONBA 4Y0VA 1YZVA 2A0KA 3EUAA 3HWRA 1L5OA 2YZNA 1MTZA 1NM5C 1Q1BA 1R0CA 1YR6A 3PA8A 4IS2A 4K9LA 4MUNA 4XUEA 2IY8A 2KBFA 3L6UA 1U3GA 3T9DA 2CYBA 5ALMA 3V4LA 5EKUA 1B15A 1GDHA 1PW7A 2K4MA 3QVUA 4IXMA 4OBXA 3V7UA 2QOEA 3FYUA 2Q9BA 3V34A 2WDPA 1NT2A 5IH3A 4HX5A 1WB9A 1T8TA 3WHPA 2NO4A 4TV9F 5M3BA 1Z0KA 3SEQA 2XIJA 2F3TA 3LF2A 1VHTA 1MQAA 2D2FA 4C4OA 4DZTA 3IV9A 4PINA 2WAAA 1U2DC 3DSRA 2VHEA 4JT4A 5GWXA 2QG4A 2XD9A 3TZHA 1KO4A 1UZUA 2BBWA 2BIFA 2Y05A 4TL7A 3T1QA 2HC9A 3TIIA 3ZZ1A 4YRSA 4XOIA 4DA7A 2O7SA 2V97A 1F5SA 1V1RA 4NV0A 3H13A 4TKUB 1P4RA 4J16A 3A1TA 4FYHA 1SVWA 3T95A 3RHZA 2WFAA 1OT3A 2GRJA 1EK1A 2OQ2A 2WPDD 3D3WA 1YB2A 2W58A 2Q0XA 3O6VA 2JHCA 3D0KA 4G63A 3PU6A 5P21A 2JL1A 5BSGA 2YW2A 4TVBA 3S8EA 2FUCA 3QMWA 2QN8A 2C4WA 2RGYA 3ZI7A 4EX6A 4B3FX 1PDVA 5D6OA 4JB0A 5KSYA 3FNFA 3GAZA 1QO7A 5EJ7A 2JAHA 2B4YA 2IE0A 3WRVA 4N0PA 5EPUA 4RLQA 2QJRA 2XE6A 1CDOA 3L7DA 4C4YA 4CF3A 5AVXA 1BXGB 1G9SA 1KS9A 4P3NA 5D1NA 4BQIA 1BKSB 5COQA 4TXJA 2HLDA 4LEIA 2ZUDA 4UVGA 1UUFA 3OWOA 5JJBA 1YU9A 3B1JA 5TJ9A 1B14A 5J2UF 1F3LA 1LPPA 1I4TD 3GUVA 4U2DA 2C78A 2BVNA 4YRCA 4Z3OA 2R1TB 1LCIA 5AM4A 4UBMA 2GCNA 5ALNA 1A8SA 1QFZA 2DERA 1FTSA 1PEDA 1AHNA 1GCIA 1TEHA 4MS1B 1NTRA 5JAQA 3PZBA 3TOSA 5AVRA 4M8LA 3KXDA 5AVUA 1LW6E 2EP7A 2Y6UA 1H0KA 3OM9A 2QRUA 2LCQA 3R3SA 2JBAB 1CW2B 3FUVA 4YJFB 2DFVA 4MKFA 3BD9A 5AJVB 1XIVA 3EDMA 4FJ2A 1MNAA 2WINI 2AW3A 4HTFA 1MV8A 4KSYA 2ETVA 4LXXA 4Y8VA 2RHDA 3EW7A 4O4HA 5DOZA 3HNRA 2B8EA 3I9FA 4DYHA 2CXSA 4X62B 4B3TB 3T99A 3KP1A 2IUEA 3C4VA 1Z13A 3IKJA 1USIA 4GOXA 4TMTA 5ER9A 3J81k 3AR6A 4WZ6A 4LXQA 4YP1A 5LBTA 4TYNA 3SQXA 2GPNA 3A1CA 1HT0A 3V7YA 2XBUA 3X2SA 2WJIA 4U0KA 3VSCA 4CM4B 2PNJA 5B7QA 2WM3A 2GEBA 4FCTA 5JNWA 3KO8A 4N5HX 2W0MA 3R6TA 2Q6KA 3R20A 4WOKA 1Z0AA 4QX6A 1EK0A 1UPUA 4RF5A 4F8JA 4DR3B 3C3BA 4E1VA 1IK6A 4BNVA 8ABPA 4LMPA 2DBQA 1LC3A 2I4TA 1PAUA 3GT3A 2ZS7A 2P68A 1ENZA 4R1OA 5B2FA 1XN4A 3DP9A 4QRIA 2YHSA 2BKAA 3AF0A 3EQ6A 2OZKA 2X13A 3LZ6A 1NBWB 2AEFA 3C70A 4UM9D 4PRZA 4BGEA 2QRHA 3AR8A 4IQ8A 1FLVA 1YMUA 2Z2KA 3BD7A 3L8HA 3QQPA 1FMJA 1KOFA 2G3YA 3NBFA 3ZEIA 1I2MA 4OVKA 3D9QX 2G8NA 2WTAA 4KXWA 1ONOA 1VL1A 4HDSB 3DXYA 4W4TA 4XYMA 2DWCA 1JLLB 3MMXA 3G0OA 2PZKA 2J5XA 4FT2A 4IJ6A 3FROA 4L6IA 3VV2A 4V1CB 1CBUA 1UXHA 1HWYA 2GMWA 1WSWA 3F4BA 4GYWA 5CH8A 4QDUA 4YONB 3TRIA 4BUCA 1K4KA 4YQYA 2I7VA 1OBFO 1EP9A 2FR0A 1C9KA 1XMSA 1OZHA 2FY8A 3TM5A 1ADCA 9LDBA 1XNJA 3CV3A 4W6QA 4LF5B 1E2LA 3AEXA 3ZCUA 3K15A 2H3EA 2ZS8A 4MWOA 2DB3A 2BGNA 4QXRA 5CIYA 4H15A 4NZMA 4PLVA 1LPSA 1M2FA 1ZH2A 2WP8J 2B6NA 1E9DA 2G1AA 2GTIA 3EGDA 3NEJA 4RZXA 1FSZA 2QD1A 1F48A 4M6WA 1C50A 3DV0B 3EZFA 4G85A 1UH5A 2M6LA 5AW4A 1DAMA 1FMCA 2JA1A 3V8VA 3V1YA 3OCZA 4ZYVA 1GTJ1 1V7ZA 4YRQA 1NZFA 3K7EA 4ZVMA 4ZVVA 2PGNA 2YYZA 2ZJFA 3V00A 2WLTA 4U7PB 1P18A 4CEJA 3SHQA 3IIMA 4GSLA 4ZD6A 1BTOA 4A82A 5FOXA 4MCIA 1RRGA 4C0HA 2ZUCA 3O8BA 2UUCB 1D2EA 2QYHA 3AUSA 2IV7A 4FSXA 4HLUA 1N0HA 1OAAA 4JUAA 3TNLA 4TM8A 1ZA1A 2AS0A 3BL6A 4FS8A 5DK4A 3GRVA 4KU4A 2WIKA 4R5HA 4FFRA 1KVRA 4MLDA 3U4QA 2I76A 3C3XA 4FMPA 2OHOA 4NJOA 5H7XA 4JBYA 4MV4A 1IUPA 5SY4A 3PVCA 4YVFA 1UFKA 5KKNB 2P1DA 2ZIFA 1M2GA 3I0NA 3M7IA 5JNVA 3OY2A 1CY4A 3LRTA 3W2FA 4TL9A 4C2BA 2G9ZA 1P39A 3IBYA 3LQKA 2YJTD 2I1QA 2CE7A 4Q47A 2XCSB 2VLIA 4BP8A 5FO0A 5G41A 1RYHA 4FZ3A 3A1UA 3TTVA 5ITVA 2QRMA 9ABPA 4DR1B 4FUTA 3DZGA 2ID7A 3K5WA 1MCZA 1YRYE 4B6QA 1ZW6A 4HX9A 1QC5A 3STWA 1BDMA 3LL7A 1A2BA 3VKUA 1EG7A 1V96A 3UCXA 5ECYA 4BP1A 1KPIA 4A1OA 2CB9A 4ZI3A 4I5FA 4D79A 3K9CA 2ODNA 5KTMA 1H5NA 1HORA 1M6NA 2I4NA 4NX2A 3K0KA 2J9XB 1VYHA 1KAQA 3PRKE 4R7ZA 4UM8B 5EZSA 4DHEA 4A27A 2FQXA 2VWQA 2FB9A 1PJ3A 5AOAA 2QRGA 3PQ8A 4XJTA 5LOVB 3DO8A 1OY1A 4I36A 1BE1A 3B38A 1ZGAA 3NWOA 1SXGA 3PFWO 4R51A 4CF6A 1FTWA 4RCVA 4DQKA 4ES6A 3RSQA 3P9CA 4J0QA 3PUVA 5DU2A 4YMLA 1CR4A 4JXKA 5D00A 4LRSB 1T4BA 2Y8EA 1YJAA 3TNDA 2QUHA 3OJFA 1F4VA 1KAMA 5G0TA 5B1DA 4HK4A 4U63A 4KPUB 1L8OA 3C7DB 1M7GA 1HNZB 4JX9A 5DHPA 5JZBA 2H59A 2PWZA 2VT2A 3L49A 3BOSA 3P9NA 4HRYA 3A4NA 1AB5A 1OXMA 3LCMA 2ZBUA 2P35A 1LDMA 5K6AC 1GAJA 4QFMA 5B4UA 4DADA 1I1QB 4FNGA 1RQ7A 1EVJA 3T5CA 2VWHA 3UJ3X 5IM4A 1Q84A 1L4LA 1RAGA 5KKAA 4MDYA 4MVJE 2WJHA 3DHNA 1HG1A 1LQTA 4LJYA 1EFPB 1OI4A 3CURA 4WE3A 1LSUA 2QMOA 3V33A 4UU0A 3PHJA 1HTTA 4KL8S 5DI9A 2ZTHA 1KTIA 2D00A 4P8RA 5K0CA 4RETA 4J7UA 5FADA 3F90A 5DYWA 4D8VA 1LC0A 1RYEA 3VI4B 4HN9A 4KR9A 3FGOA 5LMUB 3CUUA 2CV0A 4AK9A 1JL3A 3F97A 4DLLA 5E3JA 1QWOA 3T1OA 4GPAA 4YLEA 1A7AA 3OJOA 1HYBA 4U7TB 3VPAA 3DLBA 2H1OA 3KAKA 1LS6A 1Z08A 3UXHA 5AUPB 5KTKA 3QKRA 4LWQA 1R10A 4M37A 2GTPA 4V24A 2P4SA 3T38A 2JI9A 3I37X 3KKZA 4HH4A 3FSRA 4BRZA 1L4NA 3OIUA 3EVNA 2QF7A 3FWHA 4II3A 3WVNA 3AI2A 3BB4A 2V7UA 1PR5A 3R4VA 1JLSA 3V8MA 3SWWA 4CGYA 1SMKA 3BS4A 4NV1A 3ZNQA 4DLWA 1CYDA 1O7JA 1SBYA 4UFPA 5DNUA 4RHFA 3AF3A 1II0A 1PTJA 4FX5A 4TMXA 4KRGA 2RGEA 2FN9A 4CM8A 1V8DA 1ORDA 3L1JA 3O5AA 4TTSA 3V2HA 5JAOA 5E6RA 2OD9A 2H2FA 3GCGA 4RD1A 1TW2A 5G2OA 4ALIA 3I62A 1P2BA 3N86A 5D5HA 4C5CA 4N5IX 3HJHA 1P62B 2E49A 2YRFA 2YWRA 4MH0R 3ZK7A 3OQNA 1DVRA 1JYEA 1RLIA 3L8EA 3EXHA 5B53A 4TWZA 1JZSA 2GF9A 3OCXA 1M2WA 2B8NA 4YCNA 3DZCA 1FTGA 4MWDA 5ALJA 4BU0A 1NVEA 3ZQ4A 5MF6A 1ZGGA 3FFTA 3UAWA 4QBTA 4RVFA 4TUYB 4AUKA 2FEXA 4OQFA 1TL7C 3GWGA 4UCWA 2I6XA 2DMRA 5ELMA 1W1WA 3G17A 3AFOA 4WBNA 3OO1A 1RRMA 5K3FA 3QW2A 2O0JA 3RS0A 4BVAA 5EC8A 2HPHA 3C97A 5BN5A 1ZR2A 4IIJB 4X7MA 5CA1F 3H0KA 3IERA 4W8GA 1JGTA 2JD0A 4X41A 2B30A 5EE3A 1NLYA 3S0JA 5BNWA 5L7WA 3EOAI 2SICE 4QLAA 4Q3OA 1GPKA 2Y27A 2YHUA 5B7GA 3IAAA 1L7XA 4HLNA 2CL5A 3WL6A 1DT5A 4EFMA 3WIUA 1VSQA 4IH9A 1KOGA 1GNRA 1JFRA 1RZRA 3E7FA 4XQEA 4ND6A 3CY6A 4GZ3A 4ZOBA 1RTKA 2IFTA 1T2CA 1UIRA 4HUQA 2JJ2D 5ECGC 5HCNA 4R2WA 4JV5B 1XP8A 5I6DA 1FB5A 4HH0A 2NPFA 3HB4X 3GFFA 1P60A 1N5MA 3AOEC 4OQMA 4Z0PA 3W3AH 4A0GA 4G89A 1NZDA 3JQ6A 2Y1CA 4KMMA 5IJXA 2OHHA 4EY7A 1JG1A 4UHHA 2ZZNA 1Y7LA 3ODPA 3TH5A 3MFYA 3WR5A 2YVUA 2VJOA 4E6EA 2HF8A 1ZUNA 3A9SA 3DPUA 4R01A 5AKIA 3SXUB 2X76A 3ZYCA 4BB9A 4IOJA 3V2IA 5IJ0A 1RKXA 1WBJB 1TRHA 3PIRA 2WMOB 5EUMA 4PR0A 2CE2X 5U1PA 2O5CA 3VR5A 5J5AA 1QXSA 6GPBA 1M83A 3WDLA 2E7ZA 1W8IA 4CF4A 4Y2UA 4XWTA 2JFHA 1LW7A 1OYWA 4C88A 3KELA 1YZLA 3ACCA 2H54A 2VCEA 1WIWA 3JALB 4B2YA 1N78A 4K7JA 4DUYB 2BTEA 2FWRA 1KI2A 1UAYA 1LX7A 3EGXB 2PQ0A 3LT0A 3ZBUA 1D6JA 2EP5A 3PRJA 2JZNA 3ILYA 4PSUA 3REQB 4EJ0A 4MWEA 1TM4E 2OZLB 3FNEA 3IP5A 4CIYA 4MKGA 3RYFA 4CG2A 4EB0A 5FHQA 2YJGA 5AW6A 2A6PA 1SKAA 3AVOA 5DULA 3K9WA 3EZ9A 2BAGA 3AXSA 3TRDA 1Z5UA 3EA4A 2MOKA 1DHTA 4H1WA 3U3OA 2HCFA 3AFIA 3IJRA 4O4JF 4R2JA 5DBHX 1ULUA 2J46A 4QASA 2P5UA 4ZRDA 5CA0A 4M0PA 4BXOB 2B34A 1QYVA 2WMNB 3KEOA 1VSBA 4DXAA 2F48A 3JAKB 4NCJA 1U4NA 4JP1A 4P34A 2JLYA 1D6MA 1S89A 1TU4A 3AVWA 2W4QA 2WAXA 2NTYC 4LVOA 1GY8A 3KKNA 5HILA 1KR5A 1V8FA 2AA3A 3RRXA 4OLFA 2V54A 3CEJA 1TEXA 2CJXA 4MRSA 4M55A 2FVXA 1MR3F 1WXGA 3FVTA 3ER8A 4MCJA 5CITA 1XLWA 1FUKA 3JPYA 2A5YB 2PMEA 4NZOA 3DV9A 3NYWA 1XJ5A 2FPIB 2NYRA 1JU4A 1IE3A 3SGLA 4JI0B 1MXFA 3BCUA 2QW0X 1R27A 5KSWB 2FN4A 5K8VA 5IMSA 3F9RA 4UHBA 2RB5A 3AESA 2JVIA 3AGQA 4QIHA 1JA1A 1H1LA 2GDZA 2HNAA 1IJFA 1H66A 2ZAMA 1BWPA 3EIEA 1WQ3A 3NIWA 4BNXA 1E8DA 3GHHA 1UJNA 3KTDA 3OC6A 3LBFA 4KWTA 5FRDA 5L3RA 1ZK4A 3FM9A 4PC2A 1J2TA 5EXSA 4RZHA 4ZCSA 4B7AA 3P0FA 5IZCC 3GGCA 2P2NA 4KPFC 3A6DA 2N9UA 5DGXA 4AZVA 1WZEA 3JD0A 3OJCA 5EP1A 1UEIA 3WSWA 3TLGA 5IUKC 4JQYA 3SC2B 3H6HA 3RIHA 1Y8QB 3BH0A 1QQBA 1JJVA 1CT9A 4MOWA 1M3SA 3D7RA 4R2KA 3PICA 1G59A 1TK9A 3DTYA 3D3QA 2BMAA 4IFEA 2RH5A 3DMTC 1JALA 3LUGA 3X2FA 2OCBA 1FMLA 1OX6A 2CNDA 4YJKA 2GN1A 5AW9A 3EMDA 2UYQA 2O57A 3LPNA 3QXGA 3RFCA 2HCJB 2VTEA 2VXOA 4LPKA 4ZT7A 5LD2C 3M2PA 4HSEA 2H11A 3VNUA 1PFQA 2B4AA 1V47A 4LOAA 4YUVA 1JXQA 1W0CA 1AVTA 4J90A 3LAWA 5KVCA 3LZCA 2XQGA 4D3DA 1H8ED 4ER5A 4CM6A 1G7TA 1L7OA 4YAIA 4BKUA 2CZGA 2XA1A 3CZ9A 1ZA2A 3ETEA 4NCHA 2JFZA 4K1XA 5DNVA 6ADHA 4FYVA 1EFHA 2ZPAA 3SJZA 1SEVA 4CR8A 4YMTA 2ZT5A 3AONB 4YDHB 1XTTA 3D4NA 1H69A 2WAYA 1CNEA 2LIVA 3NHZA 1IXYA 4BVFA 2QZJA 4IVPA 3H5RA 1N1MA 2OLKA 3FLEA 2ZRFA 2WG1A 1DJMA 3WICA 4OQQA 1O57A 4XWWA 4LDQA 4BBJA 4C4TA 3F3KA 5JRJA 1Z6PA 3IEPA 4QM6A 3GEBA 1RMQA 2DY0A 2D3WA 3GFOA 1MP0A 1QDLB 2WB4A 4LHYA 2HK9A 5KDOA 4LF7B 2BR5A 3KIPA 3U81A 3RANA 3DT8A 1T10A 1B41A 4LDAA 3WDMA 4B48A 2C77A 1Z36A 4ZO9A 1TADA 2Q9AA 1ZAYA 1TJ3A 1YIOA 2H18A 4TMYA 3SMQA 3GRFA 4J1TA 4MP3A 4LYAA 1THZA 1CJVC 3O3OB 4OMDA 3VXKA 1XU9A 1OU4A 1EZZA 2ZTUA 4HYEA 4PZLA 3CX3A 3GZNB 4BNTA 2C2HA 1QV6A 2BTQA 1RPNA 4Y2XA 1MGOA 2QTMA 3T7AA 4BGVA 4U2FA 4FGKA 1UBMS 3H1BA 3M1YA 4M1ZA 1ODSA 4RTMA 4NBTA 3W9UA 4E09A 3ENNA 1QHSA 3CSSA 1WP9A 4PZPA 2R9VA 3BMQB 1Z4LA 1SQFA 1PFWA 3MCVA 5JXWA 2XV1A 5KJFA 1PR0A 4GIBA 3HY4A 1LGYA 3P2KA 4NYIQ 5NLLA 4DDMA 4M0MA 2VG8A 5BOSB 1B93A 4CI0B 4ERXA 3ZWNA 1P17A 4EI9A 4OGGA 1ZXXA 2BDTA 4ZT3A 5I7FA 1WLSA 1KYXA 2D4HA 2QR3A 2V7PA 5HE9A 2Q99A 4TKMA 1U3WA 1I94B 2Q6OA 4QGAA 2FUEA 1NF8A 2WKWA 3N05A 3QBTA 4PGMA 2BFCB 4GAEA 2COEA 1T91A 1XZKA 2ON6A 4H4DA 5LLSA 4DBZA 1G17A 2XB2A 2X2EA 2IUTA 2ZBDA 3EQ7A 3H1TA 4GPZA 4P4TA 2VRWA 1BXZA 4YFYA 4EF4A 1IOVA 1KJJA 1HK7A 2NSLA 2ZIXA 4IUBS 2XWSA 4Q37A 4C7BA 5BYJA 4PNZA 1H2ZA 3KVYA 1H9BA 4PFQA 4HB4A 5IN4A 5JXJA 2BM9A 1NT4A 2Q6TA 2V5AA 1GKKA 3B13B 3VO8A 4YAFA 2TMKA 4GX2A 4K9PA 1XHEA 2VA8A 4UKDA 2IU4A 1C7QA 5IT0A 3T94A 3OFND 3F3YA 3JZMA 3KPVA 3JQ7B 1KEKA 1N5IA 4OBWA 3BQNB 5KYVA 4PU0A 3GLRA 3HHEA 4CI9A 2OLJA 4Z0TA 1GAQA 3ESYA 4CLXA 4UEKA 5A0VA 1R0LA 2R65A 1DINA 5DHTA 2V5VA 2YFYA 1PGPA 5K3BA 1M8JA 1Z37A 3AU9A 4OJQA 1ZUHA 1L1EA 1W6UA 1Z62A 2J67A 2RHRA 3WRXC 3UT0A 1T8YA 2RHGB 1FF9A 4ZU6X 3FPAA 3HWSA 2BTOA 5TNXA 2X2OA 5KDDA 1YB1A 3QHQA 2EYUA 1BGWA 2IVZA 3BD6A 4F1WA 3GUUA 1JKJB 1P3Y1 2A57A 3VPBA 3ANXA 3K2QA 2OFXA 3HSYA 5FI0B 4JITA 1XRQA 1XZDA 2I5PO 3ZVRA 4C1BA 2JGNA 3MUNA 4DCSA 5HOQA 1FFHA 1EA5A 3DF7A 4YS6A 1IIBA 1XAJA 4DQXA 2PGOA 2EG5A 3W3ZB 1VE5A 1A69A 2EW2A 4XVRA 2O2ZA 2Z2IA 3KJFA 1TMOA 4Q1DA 5ARCA 2AOUA 3INRA 5HF8A 5IJZA 5JARA 2GBCA 4FD3A 1D0VA 4BO4A 2FMUA 4PYKA 1GRNA 2PA0A 9GPBA 1TUGA 3DLHA 4N8DA 1IBMB 3VU9A 3WGTA 5FDFA 4N48A 1YZYA 4LMAA 1X8XA 5EHQA 2VYQA 3H16A 4QARA 1KQ3A 3R0XA 5GZ3A 2PBLA 3H5LA 1CF2O 3HSSA 1T6ZA 1FSGA 1C9JA 4KJZA