1VE5A

Crystal structure of t.th. hb8 threonine deaminase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
310
structure length
308
Chain Sequence
PSLQDLYAAFRRIAPYTHRTPLLTSRLLDGLLGKRLLLKAEHLQKTGSFKARGALSKALALENPKGLLAVSSGNHAQGVAYAAQVLGVKALVVMPEDPYKKACARAYGAEVVDRGVTAKNREEVARALQEETGYALIHPFDDPLVIAGQGTAGLELLAQAGRMGVFPGAVLAPVGGGGLLAGLATAVKALSPTTLVLGVEPEAADDAKRSLEAGRILRLEAPPRTRADGVRTLSLGERTFPILRERVDGILTVSEEALLEAERLLFTRTKQVVEPTGALPLAAVLEHGARLPQTLALLLSGGNRDFSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of T.th. HB8 Threonine deaminase
rcsb
source organism Thermus thermophilus
molecule tags Lyase
molecule keywords Threonine deaminase
total genus 100
structure length 308
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 4.3.1.19: Threonine ammonia-lyase.
pdb deposition date 2004-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ve5A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ve5A02
5T6MA 1UIMA 2O2JA 3T4PA 1TYZA 1FUYB 5I7AA 1WDWB 3TBHA 4D9MA 1TTQB 4AECA 2ECOA 4D9IA 4H27A 3FGPA 1WKVA 4HO1X 5J43A 4NU8X 3VSDA 2J9YB 3PR2B 1KFJB 5C3UA 2ZSJA 1J0AA 3IQGX 5B55A 1J0BA 2CLMB 1QOQB 1D6SA 1TZJA 3PC3A 1A5AB 2ECQA 4D9KA 4D8WA 1M54A 3V7NA 1BEUB 1WTCA 2GN2A 2ISQA 3X44A 5JISA 3X43A 4LMAA 1K3UB 5D87A 5DBEX 3L6BA 3VSAA 1TZ2A 5DW0A 1TDJA 2RKBA 1KFCB 1C9DB 3AEXA 2O2EA 5B3AA 4D9BA 4D9FA 1KFEB 1A50B 2BHSA 4D8UA 1K7FB 5IWCA 1TTPB 1FCJA 1PWHA 2DH6A 3DWGA 1K8XB 3PC4A 2ZPUA 1KFKB 1K7EB 1A5BB 4LI3X 5B1HA 4D9EA 4I1YA 3DKIA 2ZR8A 1V7CA 5DBHX 5HBGA 3VC3A 2EGUA 1P5JA 2BHTA 4D99A 1Z7WA 1X1QA 4QYSA 4ZQCB 5I7RA 2JC3A 3ZEIA 2J9XB 2CLEB 3L6CA 3SS9X 5BW6B 2J9ZB 4HN4B 4HPXB 1K7XB 4XUGB 4F4FA 2CLFB 3AEYA 1QOPB 4HPJB 3FCAA 3IQHX 4PCUA 2TSYB 1VB3A 3VSCA 5D84A 1KL7A 3DWIA 5JJCA 4D9GA 2D1FA 2TYSB 2V03A 4JBLA 2C2GA 4D97A 1TZKA 4ZU6X 3L6RA 5D86A 2Q3CA 1Y7LA 2GN0A 4AIRA 2RH9B 4OREX 1WBJB 1J0DA 2CLOB 4D9NA 1UINA 4ZU1X 3RR2A 4COOA 1C29B 2DH5A 3R0ZA 1J0CA 5E0KB 5EY5B 5IW8A 5KINB 4L0DA 2C2BA 1PWEA 1V71A 2TRSB 2PQMA 3R0XA 5B1IA 2CLKB 5I7HA 1BKSB 2RHGB 1K8ZB 4L28A 4D9CA 1J0EA 4WX2B 3IAUA 2CLIB 5IXJA 4L27A 1Z7YA 4JBNA 4OFXA 2CLHB 2Q3DA 5J5VA 3SS7X 1RQXA 3IQIX 1A5SB 1TJPB 1K8YB 2EFYA 3CEPB 4Y6GB 1VE1A 5I6DA 5CVCA 5I7OA 1KFBB 4KKXB 2Q3BA 3PC2A 3BM5A 4LMBA 4D96A 5B36A 4HT3B 1CX9B 1JBQA 1CW2B 2GN1A 2WSYB 3SPXA 1V8ZA 5CGQB 4IL5A 3HMKA 4D8TA 4L3VA 5DVZA 1UBSB 1E5XA 1OASA 4D92A 5I7WA 1F2DA 5DW3A 1C8VB 2CLLB 3VBEA 5KZMB 5B53A 1VE5A 1TZMA 1O58A 4NEGA 5D85A
chains in the Genus database with same CATH superfamily
4P8RA 1ZI9A 5JZVA 4S1WA 4H4EA 1W0KD 2CCGA 2Y1CA 4O5AA 6CHYA 3L6EA 2I8AA 5KCZA 4GGPA 4HG2A 4KQ9A 3AUTA 2Q2QA 3S2YA 4CHTA 1EYZA 3DZBA 3EA4A 1SRQA 4L57A 4B7CA 5B58T 5ALXA 1Q84A 2C2OA 3WFJA 2XT6A 4J1TC 1RRMA 2XTZA 4RZSA 1JQKA 4UBLA 1Y7HA 2AN9A 2FMIA 4YAKA 2L42A 1JYSA 2CLMB 3K7EA 4KLZA 4JEHA 2E55A 5DH9A 3DT6A 1ZAYA 1JEJA 1CTQA 4GRIA 1Y9EA 4KO3S 4LOLA 2G71A 3M6IA 2I54A 2OG2A 5T5QA 3URMA 5JNVA 4WRRA 4C43A 1KJ8A 2C59A 4DHEA 4UM8B 2JFYA 4DLZA 1Z06A 2VP9A 3TIXB 5HKKA 4TVKA 4DIBA 1TE2A 1T0HB 4LZWA 1FFDA 4NYIR 1IEXA 1EX1A 2V3VA 3QSYA 1CQZA 1H93A 3KVRA 3VR6H 5CFLA 1RQRA 3HH8A 1MEOA 1LU9A 3VR6A 1ULTA 3AJAA 4I99A 4RGBA 4EGFA 4A2WA 4IIUA 1X8XA 1ESZA 1UL1X 3EY4A 2R79A 3OWHA 1FFCA 4H4CA 4YRIA 1FW6A 1TD1A 2BT4A 2XNSA 1F0KA 4WLVA 2B7BA 3ZY3A 2YWDA 3RFUA 3GARA 3S0JA 1Q16A 3EIQA 1P0IA 3AB3A 2BBTA 1W87A 2ZJ5A 3Q7TA 2Q5CA 1W96A 2W2PA 2BYTA 1FEZA 2Y0EA 1XHEA 4YPOA 3R8CA 3ENNA 4A6EA 3K6KA 3AR6A 3MB8A 1P1BA 2ZI4A 2GFHA 3BIJA 2GAIA 2B25A 4KLNA 4G01B 1IYZA 3DHWC 2R4UA 4HJRA 2XB6A 2GI4A 5HA5A 1W35A 3PNOA 1V0JA 2IVFA 2ZWAA 3LYUA 1RWMA 4HAOA 1Z2CA 3ZHQA 2H4HA 5I7EA 3ADBA 4ND8B 2APJA 1FJHA 1PQWA 1AB5A 1H05A 1U6KA 4Y2GA 5AW5A 5CEJA 1D1PA 4DSTA 3KSBC 3DB2A 2TECE 1TKBA 2WF7A 3L05A 3NPAA 4MA0A 3CGWA 1GUFA 1TVKB 3UMYA 1K97A 5ARDA 1I32A 1SBTA 1U1CA 2C99A 2OCGA 1EHIA 2RAPA 3KJQA 2ST1A 4C08A 3ODPA 1A8QA 4YDRA 5AJXA 1K6MA 1ZH4A 5I8PA 1UBEA 1C1HA 2M6SA 3ZGOA 4XFJA 3IQZA 3QEKA 5EXPA 1ST2A 1W76A 1YB4A 2J3DA 3P97A 4KAXA 3VHXA 4DLBA 3DMTC 3DV0B 2X9NA 2QMUA 2ZUSA 4HRXA 3GGSA 3IRUA 3HRIA 3GWGA 2PVCA 4FB5A 3OTOB 2PUAA 1POXA 2XUGA 1BC5A 4RKYA 4A8PA 4R54A 2FFRA 4FFOA 1L5ZA 5CGQB 4DJFC 3H97A 3IAXA 2OQIA 5G4KB 3W5SA 3GFTA 3OEHA 2JDIA 1FDTA 3QRWA 2W6IA 2QN3A 2P69A 2XE8A 1P5ZB 3DEIA 3RC9A 4MV7A 3GEEA 4LJAA 4BL5A 3KZNA 4ALNA 1T1SA 3G1TA 1XD9A 3RARA 3UOWA 4ZZ2A 1Z33A 4MB2A 5CB4A 4KQ2A 1JU4A 3KDSE 4K9KA 1K6IA 1I1NA 4DMFA 5KPDA 2B9EA 3TNYA 3DLCA 4LDJA 4O1MA 4G26A 1BXRA 3DPUA 5K3SA 1R6AA 4N40A 4OK5A 2F1JA 3A05A 3SHFA 1OBVA 2C07A 3R0QA 3V9PA 4X6YA 1XVLA 2ANBA 2HBZA 3A9SA 4BO2A 4F1JA 1CUUA 4M46A 3VM6A 3VZDA 1EG7A 3ESRA 2UXBB 1JR3A 1VRCA 3O1IC 3K5IA 1JNYA 2QJTA 2UZ1A 5CCXA 2IZ5A 3GRRA 2WG1A 5LP6C 1NVVQ 1WU7A 2X7JA 5DM70 2D1SA 3U3OA 1DUSA 3A14A 4AM8A 5HPYB 3IPLA 5I9SA 1O6CA 1VPEA 4GL2A 4LDAA 3DO5A 1II8B 2CUNA 2PQ0A 4AMUA 4NENA 2O8FB 2HK6A 4LXIA 4UAJA 4MS1A 1XVVA 3HA3A 4B31A 3E4DA 3VYUB 1VE3A 1XZLA 1Z28A 2V8OA 1JAYA 4RESA 5A1JA 3KVYA 2Z2IA 4GW3A 5B3AA 4CV3A 2I2FA 4BCCA 1EA5A 4ZANA 1L7AA 3VOAA 4ZVNA 1I4WA 4TZTA 4ARVA 4UOZA 2VF7A 3AO0B 2VTKA 4Q82A 1QZXA 2PL5A 3PHLA 3PXEA 4X1KB 2VTEA 3ZZTA 2YINC 2CVFA 5DCWA 1CYDA 2XJ9A 4PE5B 2GAFA 2IITA 4YAFA 5COQA 3FI9A 3LCMA 4PSDA 1Y82A 1CQXA 5K8JB 1TZBA 4EL0A 3R3YA 4MRMA 2W98A 5IKPA 4UTZA 1OZ0A 4FCWA 1A72A 1XWIA 2XRMA 2H08A 2XDQB 2JJ2D 5KTYA 1K92A 3F2VA 3BICA 4LRTB 3GT3A 2BC9A 4KMRA 1I2DA 3KR2A 1H1LA 4IJWA 4JR0A 4WNAA 4TOIA 4EGJA 1WXDA 2RJOA 5TRTA 2Z6QA 4YMUA 1REQB 5ALFA 5D8DA 2VP6A 2ZI5A 2QTNA 3R7SA 3BILA 3NORA 3PE3A 4IDHA 2LV8A 3I6BA 5H82A 3JWEA 2X14A 3RD5A 1DJMA 2D1FA 2Z4TA 3LG2A 1QHYA 2WD9A 3A28A 3V6LA 4BUCA 4CDRA 2IPMA 1XA3A 4PPNA 1SC9A 3TKAA 1GKKA 3AFHA 2J4DA 1X3SA 3FDFA 3ACBA 5HF6A 4OOEA 3RC2A 5EY5B 2OPBA 2R9VA 3K20A 1JSXA 5BSKA 5HBRA 4IS2A 3R0JA 3FE2A 1GPBA 5CYGA 2HA6A 1T6NA 1W19A 4JC4A 2AFIE 3AHGA 2OVBA 1NG1A 4MYUA 4P9NA 4K0KB 3ER9A 2MSNA 4JT9A 3JARB 1SJ9A 4N3GA 5CLHA 5SYAA 3SICE 4B8YA 4FB4A 5CCEA 1U0GA 2HADA 2OG1A 1EUCA 1ZY2A 1JHPA 1KU6A 1VCIA 2N75A 4IFIA 2DRIA 5T8KA 1YQDA 1KJWA 2ZBPA 2O2DA 1GDDA 1KGDA 4DR6B 4CMCA 1WB5A 4I4LA 4OBBA 1XNGA 1LPSA 2H52A 4LJ7A 2LIVA 1COWA 2CXPA 2OCYC 2V5UA 4QPJC 3SC2A 1ZZGA 3X2SA 5KTPA 5L8VA 3REFA 4L3VA 4XDZA 2XA2A 3P9ZA 2BELA 3F9RA 2YL2A 4RJLA 4P4TA 4O2AA 2PV0A 4YAEA 2NV6A 2QHXA 2WUGA 4P54A 3I0ZA 4FR5A 4UQPA 5G1OA 3THSA 1UMKA 1NAIA 4WESB 5E8RA 4JUIA 3KQMA 4ZN6A 2FPIA 2WJGA 3ZK7A 1G5TA 1KK3A 2PGXA 4TZKA 4RTQA 5ES4B 3DONA 2QN2A 2VT2A 2WAMA 3GGOA 4P84A 1LPMA 5D1NA 1RZRD 3QHQA 2V96A 1LWOA 1JAIA 1YDHA 4QHTA 1EM6A 4GMFA 4DCOA 3QQ5A 4NRDA 4ZI2A 2BM1A 4OHPA 1MX9A 2CSUA 4N0MA 1K27A 4RFLA 5TB5A 3OPYI 1PSDA 4CBVA 1WV0A 2V4UA 1G6OA 4MW2A 5BUSA 5EQFA 2H2WA 5IS2A 3C3MA 1L5YA 3MINB 2WTBA 4IIJA 2VRNA 4IQGA 3CTMA 4D0LB 3T3EA 3HJCA 1RDFA 4GBGA 3KFLA 4QTTB 3L4KA 3WK5A 4RM3A 4XJTA 4ZVOA 4MA5A 4KR3A 2VF2A 1L7PA 3LVRE 5K0SA 1M5RA 1JI3A 3ZGNA 5BYAA 1GTL1 3IPYA 4N47A 3N2EA 4AIIA 5F77A 3D3EA 1P7PA 3DDNA 4FSHA 3IP6A 3BD8A 1BXKA 1WUIS 2IOHA 1U7XA 2O0KA 1F4PA 3AHFA 3DFFA 4MQLA 1ODTC 4U2BA 5BQPA 1MIHA 3B53X 2ONJA 2B5VA 1IY2A 3E9MA 3NYQA 3GVPA 1XZQA 3TLZA 4D8UA 5FLEX 5B7GA 3CNLA 1ZJWA 3PLAE 4PZYA 1SXQA 2Q27A 1Y89A 4PXYA 4AG6A 1TQ4A 3CLKA 2ZTHA 3F9IA 1A4UA 3QJYA 5AHOA 1EFLA 2X8LA 5JS2A 4LHYA 2EP5A 5IBQA 4AVYA 3NCTA 4R01A 1TEXA 4Y2JA 1Y8RB 3LUBA 1TLLA 4N3CA 5H0IA 3T9EA 1JA0A 1A82A 2J9XB 3EEQA 1J70A 1GR0A 3QBEA 4M0CA 2VH5R 3NV7A 4M22A 3NTRA 4WK0B 5DP1A 5FDFA 1BTOA 3AEYA 5E2IA 1NV9A 1KZYC 1SVSA 4GOLD 3WV5A 1S7CA 5BN3A 3TF5A 4BWYA 3R9XB 3RV3A 4YRGA 3MSCA 1DIGA 2BRUC 2OM2A 2WJWA 2Q2NA 3H7AA 3NXKA 4XEUA 3RS4A 2IOQA 3VR4D 1J6UA 3M70A 3M6MD 1KO7A 2WTUA 1C7RA 1JIQA 1R8XA 2OFOA 1EE9A 1BCRA 3GPCA 3IX7A 4TS3A 1N9KA 2IDZA 4MV6A 1SKQA 1JLRA 4RHXA 1QTQA 4Q05A 3O73A 4UCXA 4X64B 2L18A 4JJ8A 3NDJA 5KVSA 1WBBA 3CW9A 1AF7A 3D1JA 4LMRA 4TWAA 3HTXA 2YJTD 4R3NA 4X97A 3V1YA 3OPYB 2GYWA 1EH5A 2I4MA 4J1SA 1C9YA 5CA0B 4L4RA 1PT8A 1G64A 1HETA 2AQHA 1SCJA 2VDRB 3CZ4A 3HEAA 4KO8A 2A0KA 2EKBA 4V0KA 2FN3A 5U4QA 4D41A 4JUCA 3TXAA 1C1DA 4FN5A 4IV5A 4G0WA 1V8ZA 4FEYA 1LVGA 4E12A 4GYJA 3MF4A 1ELOA 3D8NA 1CY0A 2C0QA 1HEUA 3DT9A 2DPGA 1P2GA 2AG0A 3A6FA 3PWKA 4EMBA 2EZ9A 1Z8HA 1KI4A 3DQPA 3OKCA 4HH1A 3SEAA 4WOPA 4M0KA 1LPNA 5FBQB 3BHJA 3T7EA 3TRJA 4DRXA 2GEKA 4UUQA 1SA0A 4Y9TA 4ES6A 4HWOA 5JS7A 3CRW1 2C88A 3VV3A 4UZSA 3KCNA 1PNRA 2EIHA 1R8JA 3W5BA 3ADDA 3FLMA 1XL1A 3RK4A 1V37A 1H6BA 5GOZA 3IQXA 3PLNA 2WDZA 2R6JA 3ANMA 2OL4A 3WL6A 2EQBA 1PYDA 3G59A 5JQWA 2VOEA 3A1VA 1Y1QA 4JGIA 4BUZA 2GBIA 4CMIB 2WWWA 4EGQA 3ROXA 2F3RA 2ALJA 4GKVA 1GCIA 1FRZA 4ZO6A 4E2YA 2CFCA 1A2QA 4KXLA 2MCFA 5DXJA 3WICA 3CVVA 4XR4A 3P52A 4RMJA 2AV6A 4EQ6B 4FDMA 1NFRA 3EUEA 1SU4A 4EFNA 4QYMA 2I4NA 1TCUA 1T4GA 3LP5A 1R6VA 2XDAA 1E89A 1Z3CA 3CV3A 3GFRA 1X1AA 4B17A 1RS0A 3I2FA 3N76A 3P5SA 3T5TA 4ZMSA 1TAQA 4U2GA 3UXHA 3GLHA 1C4WA 2PGIA 2CE7A 3FTCA 4HDMB 2FZVA 2VSNA 3ANYB 4Y2TA 1SWWA 2IU4A 5IVIA 3TNDA 6REQA 5BQ3A 2WFMA 4K9QA 4IIBA 2NUBA 4RS4A 4I1PA 4NV3A 4NULA 3KYIB 4WZ6A 4P2GA 2EU8A 3L1KA 1NUPA 5EE5B 2WYWA 1Y80A 1T3HA 2KB0A 4ZYZA 2JLCA 4D46A 2K4MA 5AK6A 3C3EA 1SB9A 2Q3LA 5C37A 1XF1A 4PLFA 5IAOA 1RI5A 1R0RE 3C6KA 5JMWA 1EJ2A 4ZRNA 4JQOA 3VR2A 5FTLA 2MSKA 4Z99A 4RD1A 3OECA 3AF0A 4KRGA 3PE6A 3MJRA 4KX5A 4I1IA 5T8KC 6PFKA 5JD4A 3PEYA 4ID9A 1G8KA 3G2KA 3IIKA 1T2NA 1LDMA 3GJZA 3OTIA 5M7EA 3W6UA 1OXVA 4KPGA 4DV1B 3M5DA 5JDIC 3N2GB 4R3WA 3AUSA 3BAFA 1XZNA 2J08A 4LBYA 4PSUA 3W4KA 2OKGA 4OKNA 4FMPA 3IHTA 4GT1A 3WGGA 1ZWLA 1NLZA 2DFTA 3H8VA 1UFVA 3F6EX 2X0DA 4JYZA 1EGHA 3D2BA 1AKNA 3TW8B 1MO5A 4WKGA 2HQOA 1QFSA 2TYSB 4JELA 4LE2A 2I2BA 4IJKA 9LDBA 3PUKA 1QP7A 4MUGA 2QTRA 2O1EA 2QTBA 1WF6A 3ESXA 4ND5A 4G4SP 2NU8A 1UANA 3O4FA 4GMHA 2HMAA 5MFPA 4HHEA 2DERA 3DOFA 2YIVX 1N5LA 3E15A 2QVYX 2CMDA 1VA4A 2CUTA 3UG6A 2EX0A 4QOFA 4IZIA 2PMDA 1J8MF 4B6JA 1B8VA 1OPXA 2JAQA 4QOJA 4PV7A 5KX5A 4E22A 1CJTC 2X8JA 3D1VA 2BFMA 2P5TB 3QEOA 3J7TA 4GBMA 2PH1A 4RHCA 4JDUA 5EJGA 4HGPA 3VNAA 1NDUA 4LCJA 5CX4A 3ZVLA 2WP8J 4V0SA 3NAGA 1Y4AE 4GBJA 5ECWA 1TYAE 1SXGA 2J3MA 3WGYA 1YULA 4D45A 1M0TA 3DLTA 5KHOC 3L7YA 1G4AE 1JFLA 4X6LA 1JIJA 1GA1A 1KR2A 1B93A 1Y6FA 3FXAA 4XJVA 3V2GA 5E9AA 3I2KA 4FDUA 1PS9A 3VZRA 2NX2A 3K73O 1FVOA 3DTYA 4MKZA 2AR9A 3CX8A 4NENB 4PXSA 4L9RA 5DK4A 3T4PA 2WIJA 1N5DA 3BD9A 3T3IA 1P3JA 1PT7A 2Z8YA 2PS1A 1KVRA 3N8HA 4H77A 4NMXB 4ZXFA 4CTJA 2O8DB 1V4BA 5P21A 4QNRA 3OF5A 3VI3B 4UBJA 1GTJ1 1CWUA 3WLKX 1B73A 1VKJA 2ANCA 3LP8A 1ZIXA 1R0WA 2QT1A 5LN1A 3HADA 2I6QA 1JEOA 5JV5A 1IDOA 4ZEMA 1RYEA 4URUR 2N9UA 2ZBVA 1YFZA 2VJKA 3GMDA 5IBRA 2GILA 2VJQA 4TRNA 4EATA 3EPHA 3ZQUA 1L5RA 3QUTA 4TRJA 3E7DA 3BBPA 3ROEA 1GXSA 1OBHA 2D6FA 2Y1XA 4ALMA 4BFVA 3SCZA 4CFZA 2GK6A 2NXCA 2Q5JA 3HBFA 4IQ0A 1ZK2A 2XPCA 3MERA 3A7DA 4G5QA 4K3VA 1HC7A 2FDCA 1T5HX 3KJIA 4OSEA 4CPDA 3AP2A 1RAIA 5LBIA 5LL6P 3WA7A 1SD2A 3K5WA 1LDNA 1KFEB 1WLYA 3I6ZA 1OTYA 3FFXA 1DAFA 5G4KA 2QVLA 4DV4B 5DX1A 1GIAA 1Q15A 3EE6A 3PWSA 4Z3KA 4Q39A 5BNTA 5ITSA 3OQMA 5ADVA 1QO0A 1UFOA 2NADA 3OZWA 4Q18A 3LW8A 1C1DB 3R1IA 4OM7A 5E6RA 3U13A 4CM9A 3QKTA 3JVEA 4P80A 2QKYA 3EODA 1BHO1 1GV0A 3FX2A 3KSRA 3V7WA 3SZ3A 4AJKA 2Q0HA 2EX4A 1PT9A 3ELUA 3Q3EA 4Q48A 4LK3A 2LIPA 3RU7A 1TW3A 2QJRA 4X92A 1E1KA 1HM5A 2BFEB 3KTAA 3OCUA 3EZ7A 3PGVA 3HR8A 1ORTA 4WV3A 5TVKA 1MB9A 1B1CA 5H70A 1Z7EA 1GDHA 4L08A 2H0AA 2XBLA 4ZOAA 4QTUB 1Q0RA 2O0MA 1SHKA 2RHOA 3U7QA 1AV7A 1JTEA 4CCAA 1ZG3A 2VHXA 4JLWA 3HVJA 3DLIA 4H0NA 3OWXA 3PCXA 4OMDA 5J2UA 2E49A 1U8TA 1PBNA 4JVNA 1JT9A 3FDZB 4FDLA 5HIKA 3GJ0A 3ONWA 3O91A 4ER7A 2J32A 2GVZC 2FB9A 1BMQA 1Q44A 1QIEA 2PDAA 3MAJA 1OXSC 3OO1A 4UHKA 3GJSA 4RD4A 1KE2A 3S99A 3T8YA 5FI5A 4C0QC 4AF8A 4EEKA 1EHCA 1HT1E 3LMKA 1UBGA 4XPIA 2A9RA 3D3QA 5EZYF 3VYRB 3JTMA 2VPPA 4XLLA 3L0SA 4X3PA 4FGZA 4C03A 2DCUA 4R9VA 4AP5A 2WVGA 1QP4A 1JDTA 4Q34A 1P0CA 4P4UA 1QMGA 3RKSA 2H07A 3T7IA 1PEYA 4JD5A 1OLOA 4RIIA 3K8ZA 4NLLA 1XD2A 3JRXA 3KAQA 4MICA 4BFXA 2NZWA 4M9ZA 4HT3B 5GM2A 2GPWA 3KHTA 4IOMA 1Z5OA 3AUXA 4KLCA 4YJDA 1JFSA 2F43B 4O4HB 2UZ3A 3GLRA 3P9QA 3QF4B 4O2BA 4YHBA 1HL3A 2X1VA 2XNJA 1PIWA 2X15A 3MPOA 1XOIA 2C9OA 3CE6A 3IXQA 3L0BA 2F9LA 3CH6A 1BE0A 3N5KA 2G9NA 2X86A 2ZRMA 2OYRA 4X7PA 4WXRA 4CF7A 5AIBA 2W2NA 1VE5A 4ETIA 2CXXA 4NL4H 4ER6A 3N5CA 3WKAA 2IF2A 2IODA 3MXTA 5KJEA 4Y2SA 1IHXA 3U60B 3V8BA 2PMBA 2BMFA 5CR9A 4RTOA 2QS9A 1PJQA 2UVQA 3BK1A 3MWDB 4JZYA 4JJ7A 9GPBA 1V6AA 4MWGA 1PQYA 4YGYA 1OFHA 5EIBC 2HU2A 5C4MA 1ZK4A 2Y0BA 4HLNA 1F8XA 4FE4A 1KIFA 1D8TA 3GX1A 4ND3A 3CA8A 3X1WA 1N3LA 4DMCA 2VJBA 1KVTA 2FG6C 1Z62A 1HQKA 2FRVA 3DUFB 5JDIA 1RM4A 4BMNA 1AKWA 5DLEA 3DF7A 4O02B 3UATA 3HCPA 4DAOA 2FEOA 3PCTA 3G02A 4HLUC 4D9HA 3TZBA 5CCBA 1JE1A 3WHPA 2RBKA 1MJGM 3TEMA 1MNQA 5KX5B 4DLRA 1XUOA 2HIHA 2XB8A 3IUPA 4YRLA 3SN6A 5T6BA 4D6PA 3HNRA 2JJ1A 4CTOA 1YBVA 1G20B 1HPLA 2Q5HA 3QW4B 3W6ZA 4A5OA 4F8EA 4Z1MA 1OC2A 1P77A 1VPWA 3SZGA 4H6WA 4TMYA 3DYBA 3IKTA 1OV4A 2O8EA 1L8OA 4FZ3A 3UWKA 4AO8A 1RRCA 2P4UA 1JA1A 1FRQA 4NK5A 3QOFA 3IKVA 3O8RA 3UH0A 5LB4A 3BULA 3IGFA 1UBFA 1WX1A 2ZWVA 3N0XA 1JZSA 5JAOA 5H9WA 4DN6A 4MRVA 5CVEA 5IC5A 3ROTA 3RSGA 3MW8A 4N5LA 1XP5A 1PFQA 1XEFA 1MIOB 1IXRC 3KWFA 4TLEA 5KB3A 4OGFA 2FZ4A 4DLLA 2ACWA 2OORA 3V8QA 5BUZA 2A9OA 1YL6A 3EZNA 4RSGA 1FFGA 3I45A 4ENSA 4G25A 2FMFA 3FSRA 5LD2B 4QAJA 3RE1A 3ETNA 1YJQA 3NASA 3MWFA 2Q2WA 4GR9A 3QKSA 4H3VA 1LNQA 3TR6A 1X7HA 4ARZB 2BTQB 5IDQA 4AXXA 5K7SA 2E18A 2EZUA 2XVAA 3L93A 5JYDA 2X58A 3AVQA 5IF3A 4Z7JA 2A5YB 3H9GA 2YV1A 2C3UA 5CA1B 1E1RD 1T1JA 4IKPA 4OQDA 1W46A 3PQEA 1LPPA 3GROA 4EL5A 3FOEC 1WB9A 5LLTA 4BBPA 5KOHA 2Z5LA 1YQGA 2DBQA 3RUPA 1T2CA 4N48A 4N6NA 1S2DA 2YMPA 3A6LA 3JYQA 3R20A 5EMMA 4CKBA 5JTTA 4C0XA 5EGNA 4RQTA 3X1ZA 3U48A 3G8CA 1R74A 3O1LA 3Q40A 1T1EA 3CPHA 1USUA 1A2OA 1ETHA 1G5IA 4IJMA 1RABA 2VK1A 3DPIA 4DR7B 4NONA 1KYIA 1JJVA 2QLJA 1A1SA 1R5NA 2OOSA 4KAJA 5EXDA 1KORA 1PDVA 1SXJC 4RD2A 5FLYA 5IZCC 1PLJA 4B9AA 2RI6A 2CUKA 1GRVA 3PR1A 5CFQA 2IF0A 3SDZA 1L7OA 2YOHA 3BOSA 3MJSA 3DE4X 2WJJA 2ZJOA 3KQTA 1RVV1 3P9NA 2EZ4A 2P9GA 4HDKA 5T6MA 4JI1B 3FKSD 4B84A 2ZT6A 4ZKDA 2G9ZA 3EAFA 4B6EA 5CBPA 5JJIA 1PNOA 4MRNA 4ZVUA 1Q14A 4RHEA 3LLVA 4ZT6A 3WLEA 4BNWA 2X13A 5TPWA 2X1HA 1O8BA 3KJXA 3LGSA 3PUVA 3VRHA 1VJCA 1DFGA 4XD2A 1Y7PA 3PYXA 3KKMA 3OBIA 4D57A 4E4YA 1T9BA 1JF8A 2VUHB 4PSKA 1G8AA 3WNZA 4JUAA 5DHTA 5JASA 4XPZA 4LXXA 4DM3A 1YDMA 3TI7A 1IWPB 1YNSA 5DTEA 3UB3A 2W2MA 2QL5A 3E7XA 1YS9A 3VKUA 4AX4A 4CTKA 3A3OA 1FP1D 1N6OA 2PAAA 4WKCA 5K8VA 1QC5A 2C9DA 4G67A 3TTUA 1SEVA 4BLVA 1I2AA 3DSRA 1RZ3A 2IZ0A 2A30A 2QL9A 4JWTA 3VJLA 1GZ4A 1SIBE 3DNMA 4MLZA 3PHHA 2QSZA 2HGZA 1VHJA 3EIUA 5AKLA 2G1PA 1CUBA 4J0JA 3ZK9A 5DTQA 1ID8A 4J7XA 1C1XA 2BFEA 1RIFA 2QU7A 2NWQA 2OOKA 1VKOA 3EBLA 1FE8A 5DHQA 1N9GA 1MAUA 4KZKA 3UXMA 3DCIA 4DRYA 1P2VA 1YA8A 1NYQA 1KEZA 1M0WA 3MCVA 4BTLA 4A0FA 1DCTA 3B1XA 1A5BB 1PZFA 4E5YA 1OPRA 1LSUA 1P1JA 1X7GA 5KYWA 2AYYA 4LOAA 4PYOA 3RWBA 4OQEA 4JJIA 3Q1LA 2JKVA 2XD9A 4G8JA 2B2CA 4OQXA 1FZTA 1E9VA 1NQOA 1ZM9A 2WA1A 2VK8A 4XRGA 4Q24A 3CR8A 3BT7A 2F62A 2H59A 3A1CA 3L8GA 4HNAB 4FFSA 4NYMR 4NJOA 3UT6A 3TB6A 4M1MA 4JLUA 3I30X 4HN4B 3ZCRA 3IP8A 1Q0PA 1EDOA 1T8TA 2YMMA 4JI7B 3IKJA 4NMWA 3AG6A 5GM1A 3BUSA 1Y6RA 1OROA 1KE1A 4BVHA 3EXAA 3IEKA 2AC4A 2J0VA 3GI1A 1MNAA 2Z3ZA 2V7EA 4KE8A 5E1OA 1YHYA 3QSGA 4KBFA 2B94A 3EMKA 2QTMA 2W2KB 1K2WA 3ZBQA 1JHRA 4L50A 4TWJA 3RAJA 4TT3D 2QMOA 2M9MA 4I3FA 4FWIB 4ZU1X 2P77A 4X3CA 4BU1A 4OQPA 3L4JA 4KXVA 6GPBA 1P4HA 1PFKA 5KX5F 2WYVA 3AFNA 2IEIA 4LQCA 2DGDA 4H1VA 2Z9BA 2FSSA 1Z2NX 3L1VA 4D4HA 3EWSA 2MINB 3MEQA 4WUTA 3K6SB 1QXSA 5HIIA 4KGVA 1YI1A 2BVNA 5I4KA 3CZPA 1BAPA 1QPGA 3WNDA 2ZDHA 2ORYA 2HMWA 5I6DA 1KEPA 4OP1A 2P2LA 3PRKE 3U19A 1K7SN 3E1KA 1L8LA 4V39A 1FU8A 2VOJA 1DKPA 3P0FA 4Z9BA 2ZU6A 4HAZA 1P9RA 2ZR0A 3CH4B 3I2IA 2PUTA 4MIOA 3DMRA 4K6MA 5AKHA 2JCVA 3GEDA 4Q3LA 4A0GA 4BZQA 5HF5A 3VDNB 4C2UA 3P0RA 4BQOA 5AI6A 4F8JA 1ODCA 1CQPA 3BX1A 4PFQA 3IAM1 4MP3A 3T4XA 4BOYA 5HP4A 2CLSA 4Q1BA 3QTBA 2PN1A 1ZR4A 3FJOA 2GXSA 4I8XA 5ALZA 4X1IB 3NX4A 5EWJB 3B7WA 1CDZA 2EAUA 2C4HA 3HBAA 3L04A 5EXEA 1YCHA 4UHFA 4ZJZA 3R74A 5AOCA 5FI0B 1J09A 1FP2A 3H2BA 2MMCA 4PYLA 3K32A 4F93B 2C1EA 2PZMA 1XNRB 1YZ3A 2F00A 2IU0A 4LHWA 4FYVA 3R3UA 2OCBA 3A1SA 3IDQA 1EFPB 3E9RA 3R5TA 3D43A 5H4GA 2ZM5A 1OX5A 2FHPA 3TVDA 2YNMD 1KAHA 2NU8B 1AKRA 1M5TA 2Q4OA 3F46A 3RRYA 4HDRA 4S1VA 4QBKA 3D0KA 1QDLB 3CG4A 1MC1A 1XN4A 4PFKA 4ZAYA 3VGPA 1A1VA 4EW6A 4FYJA 2YYYA 2O2XA 5DEIA 5SYMA 1UXIA 2NNWB 3NIWA 4K28A 4INZA 4J91A 4ENWA 1N77A 5REQA 1Z5VA 3RK0A 2R7KA 2OHIA 1GZUA 3AR5A 2JLQA 2ZRQA 1KY3A 4H7IA 4BVKA 2FEAA 2I29A 3FIJA 3AR3A 1R64A 3EF0A 5KJFA 1UFRA 2YN0A 2C42A 4L4YA 1H6CA 1OH5A 1K7CA 4JNCA 4LZLA 4ZOEA 2B9VA 3ZX5A 1HGXA 2X3FA 1ZM4A 3TI9A 3BF8A 1TQHA 4XASA 1UKCA 3CZRA 1Y8AA 3M3HA 4N8EA 2A92A 5KVQA 4HAXA 2O19A 4U0JA 5LZ8A 1B8PA 3MVEA 1CG6A 2CN1A 5IFKA 2O7NA 3KAPA 2BKLA 4FT2A 4YBRA 4DWOA 1AXRA 4BZXA 1E2QA 3K1ZA 4B6GA 3B1FA 2FW0A 3E58A 2JIDA 1BD4A 4KGDA 4R2JA 1T1IA 2ZCVA 3ZE2B 4D44A 5FLKA 2WT9A 4U00A 3TSZA 5J4YA 2YXDA 4YJGB 1XALA 5DWDA 3VUEA 3P9SA 1D4FA 1YOVA 4BRUA 1C80A 4CI9A 3DVLA 2Q4TA 5BMOA 3PQ7A 2D7DA 1DWUA 2IBMA 3HY6A 4RVUA 5CRIA 3B85A 4LRQA 1CNEA 4FE3A 4H7JA 3C70A 2P6NA 4DLUA 1PYOA 4HK4A 1JV2B 7AT1A 2Z30A 4C7KA 4NAUA 5LZ2A 1XK6A 4EUEA 1G9TA 4WIAA 2XUFA 4Q7KA 4GSYA 4U9IS 2CB9A 2M1ZA 3CCCA 5HEKA 2ADOA 5DPMA 4FOSA 1XLUA 3AI3A 1E4YA 3GA7A 1FYFA 1XCLA 1RD4A 2B69A 1SM4A 3CN7A 1U2RA 3A4VA 3R0XA 3M6UA 1L4HA 3CZCA 3TPZA 1J1ZA 3PWTA 4GVXA 1IZ8A 4ZMRA 1OD6A 2H11A 4WX2B 1P5FA 3M49A 4CMHA 4LSZA 4XVQA 4HUTA 1CS0B 1E18A 2XYRA 2ZYDA 4BKQA 1OFIA 1QK4A 2XTMA 3AIOA 3EXHB 3KZOA 2DFNA 2R1TB 2YR0A 3NOVA 1O5TA 2W11A 3JD0A 4Y1RA 5LLDA 5FUVA 4L22A 1OBOA 1FYEA 3PC2A 4EF4A 5DEOA 2P5SA 3BSFA 3KZXA 4L02A 3T15A 4UNRA 4MGHA 3DG9A 2AG1A 3O4HA 5F9HA 2INGX 4F3RA 3H2HA 2R8EA 1R8SA 4GOND 2FWMX 3HXQA 1E5XA 3VH3A 1M6EX 1ZH8A 4BLRA 1DXYA 2FFQA 1FDWA 1RJ9B 4C4RA 2YH2A 1K4YA 4WLEA 1P61B 1XCGB 2G9RA 4LV5B 3DW1X 4XLTA 3A70A 2BP7B 1YBHA 4X00A 2OAP1 3E9QA 1X8JA 3G2LA 1PGNA 3PRJA 4AY6A 2J5RA 4X3OA 3GJYA 1XHFA 1J5XA 4JB8A 3LNCA 5FFFA 1SY7A 4WGFA 1RNLA 1T36B 4M0FA 3LA8A 4FFBB 1ZD9A 4DTCA 1RI2A 2B4AA 1DIBA 1F2TB 3U3RA 4X44A 4PZDA 4B3GA 3NDIA 1PJCA 4XDGA 4Q21A 1TM4E 3DTNA 2K5UA 1CZHA 3A4NA 4CT4B 3TFOA 2OMEA 5EE0A 3RT1A 1GEGA 3QLTA 4UTNA 1G8YA 4OUKX 3M6XA 5H83A 1BXGA 3ZCQA 3VMFA 4D5GA 3ZWDA 3HCBA 5K8CA 5BN1A 3NUGA 3PHCA 4XARA 5KYWB 5M34A 3TDKA 5EXTA 4RPHA 2I91A 1GCOA 2FK8A 3GB9A 3AFIA 3AHDA 4LQ4A 5F5NA 4OGKA 1D6NA 1HMPA 4ZHQB 4WZBA 3OEED 1JFVA 2PYIA 1PG2A 3F4LA 4ZU3A 5K1ZA 1RAEA 5F23A 3W9BA 4P38A 1NE2A 4H6VA 5JS8A 1ZGCA 2HA7A 4LWOA 2CMFA 1HFEL 3FGNA 3FDJA 3H75A 1OY1A 5JHHB 3M4ZA 1QDEA 3BDAA 5EESA 3JASA 3GDFA 4F5EA 3KKPA 1F12A 1TVKA 1PJZA 3NNSA 3RVDA 3AM4A 1LQ2A 4EIWA 5F5LA 4DDUA 1OFGA 1TCBA 2HHJA 2ZWOA 4LFAB 2ASEA 2GZ2A 1T2AA 4MWEA 2JCGA 4GLLA 1GKYA 3R5JA 4IJ5A 4P4NA 4AZWA 2JFQA 3B9PA 3THYB 1EIWA 2C8VA 2EJWA 3ZD6A 1IUPA 4JQSA 1T5IA 3C3AA 3REOA 3ERCA 1WF3A 4XX1A 3FJ1A 3A4TA 4LNAA 2ZUUA 3JD3A 5EIBD 1EVQA 2WHQA 3AIIA 3ETDA 4YJKA 5TVGA 4ZI7B 3AW9A 4BX9A 1VIYA 3I2HA 3LPNA 2ZRIA 5EQTA 5BO5A 2HDNB 4O8CA 3IE0A 2JASA 1E59A 5D86A 3TQSA 1Z68A 2H65A 5EIOA 2IGTA 3P20A 3V3KA 1AKMA 1H2XA 4K5QA 3VKFA 3WIUA 5E0KB 3OOHA 1Z0JA 3UAGA 2H1FA 4L07A 5K4GA 4DPMA 4LBZA 1G4UR 4X6XA 1U3CA 4BNJA 2WOJA 3OHMA 3M1IA 1O6ZA 5A3SA 5AM2A 4GPAA 2G5PA 4BQQA 2VP4A 1MJGA 2G3YA 1SH7A 5A05A 1ZNWA 3HCCA 4RPKA 2ZRCA 3RS2A 1UPXA 4AKEA 2Y2VA 3GLFB 1Y4SA 2YJ3A 4JSTA 5G41A 3OE4A 1SBIA 9ABPA 3BWCA 3UHFA 3KPUA 3K8QA 4GOXA 4OTZA 1VI6A 1XTUA 5FNVB 3VPAA 1GY8A 3WB2A 3X1YA 1SKAA 5FWXB 4Z9FA 1E1CB 2C96A 2GBLA 2B4QA 2IPOA 3KFVA 3OZBA 4RCYA 2JD2A 3ZCVA 5HS4A 1EJ0A 4MDFA 2ZI6A 3OIUA 1UC4B 2OK7A 2PCLA 2PKRA 2J48A 4CE6A 1SN7A 2AD1A 3PK0A 3KE9A 1ZEMA 5YASA 3GPIA 2OBBA 1FFBA 3AMVA 2JB9A 4IZOA 1IU9A 2QBYB 5AHWA 2ZI7A 7ABPA 3OC0A 4KPUA 4L9AA 4MMYB 4CKYA 2H00A 2H85A 5FL7A 3DTVB 1S8OA 2JLBA 2ZXFA 3PQ2A 4L0MA 1AS2A 1IY8A 4O1HA 5I7AA 2ZIEA 1AK2A 3AIMA 3MELA 3NRBA 5GPBA 1M75A 4GF5A 2NAPA 4Z4CA 1IVYA 1GGVA 1IB0A 1P60A 4TMKA 1KMHB 4FNGA 3M4XA 4XVCA 4I36A 1N6RA 3WWCA 4JP1A 2C3YA 2D13A 4E2XA 1OZHA 4HGRA 1W4ZA 1V48A 2NQTA 4GPBA 4PICA 4V02A 1X2BA 3WGJA 4K03A 821PA 3L7AA 4AJ4A 3IIJA 2FPGB 2MR6A 5KKNB 3VJRA 5AYVA 1YGPA 3JQRA 2QAJA 2ETXA 5EXSA 3WRWA 3L02A 5A6SB 3LQYA 4CM4A 1LDEA 1QTNA 2WF8A 5I7FA 3EBPA 2EV9A 2JHGA 3CUSA 4Q9AA 2QV7A 4HH0A 4XWAA 1M6NA 2ATVA 4RORA 4CEIB 2WZBA 3PR3A 4TKLA 4ZYXA 2HI0A 3MMZA 4LZJA 1U28A 1SCDA 5DLPA 5JNTA 4RY8A 4YNBA 3UV7A 3KK0A 3RODA 3EXFA 2AOUA 1U0FA 1ZOOA 1D7OA 1T5DX 3FTQA 3R9KA 1V2HE 4ZAZA 2ILTA 4URXR 1VCOA 1O3YA 5LA6F 1MHTA 1DIAA 1E2JA 1F6WA 2G72A 2HIGA 2PFKA 3SY8A 4QGSA 3WI7A 5FIUA 1QYRA 1D4ZA 3KXPA 4DMLA 3LDHA 1G21B 1FLAA 2HK7A 1IZ7A 2PLFA 4I1UA 4TWBA 2VNKA 4GMDA 3IVMA 5JAIA 1M1NA 4MI6A 4HUQB 3GJ7A 1JB9A 1T4CA 4RZXA 1J4AA 4U7WA 1IZZA 4G5XA 1GGMA 2YFYA 2YVQA 3H0KA 2QWXA 3SOZA 1NBHA 2JBHA 1KMIY 1PFWA 2NO0A 4TSFD 2PUCA 4WNCA 2ZUDA 5DE3A 2O2SA 2YJGA 3RFFA 5IDXA 1D4OA 5F78A 4DZTA 4DV2B 3GLGA 3DZHA 1WXWA 3FKQA 3WIOA 4TS1A 3H2SA 3KWJA 1SC1A 3L6RA 3WGMA 5KJCA 3FUXA 3K09C 4TLBA 4E4TA 2R44A 4FBLA 5BP7A 3NM4A 4ZREA 4BMZA 5JQGB 1DMSA 4R1LA 4QPDA 5GV8A 1QG4A 1BH2A 1L4UA 2CLDX 5J40A 3UJHA 3PE4A 4X1YB 5A9RA 9MHTA 3ZHBA 4WDQA 4ZDJA 5D7BA 3N2GA 1JFTA 1BKYA 2X3YA 3MM4A 3QY9A 1PWYE 2IOFA 1QZ3A 3ZCUA 5KOJB 3S2IA 5CB4B 2ZQYA 3AM3A 5TDHA 5KSWB 2G82A 2L0XA 2HIMA 3OQ6A 1V35A 2E4UA 4DT1A 3T7JA 4KKXB 4ABYA 4IMPA 1EGVB 4CRWB 1U8AA 1ABFA 4II3A 2H1IA 3DE3X 4LWQA 1XVTA 1J21A 1LLCA 1P2TA 1VYUA 3IVXA 3W8NA 4DR4B 4J16A 3WZLA 2QAGC 2B1GA 2P68A 2IDKA 2PS0A 2W00A 3L49A 5FO0A 3OT1B 4D0GA 4TUYA 3I72A 3MWYW 4KQCA 3K9HA 4V1CB 4KODA 2J4FA 5EERA 3EZ6A 4AKGA 3S6JA 4YUXA 1CJSA 4I8IA 4IEIA 1Q5PA 1PGPA 2ZYVX 3GLQA 4WWHA 1BH6A 1B0UA 2PZAA 3T1VA 2O2JA 1XXHE 4JQCA 4XWOA 3L8ZA 3ZDZB 1MH1A 1TF2A 2R5WA 4DR5B 1CRPA 1UDAA 3N28A 2VHCA 4DQ0A 1MBZA 1RSZA 4UNNA 3OIDA 2WWIA 3LC2O 4N01A 5NULA 5CLFA 4YV2A 3KQNA 1YUMA 3OOWA 5CH5A 3CKYA 2CNDA 5LYJB 2Z9DA 3R5HA 4U4AA 2W2LD 2ZJYA 1JZTA 1M6VA 1YL5A 3LKVA 3ABSB 1W9MA 2GASA 4LDPA 5GONB 1G6Q1 1PZXA 5TR9A 4TQ9A 5JAUA 1P31A 2E4XA 2DUWA 3O0TA 1M2NA 3PF8A 1U7UA 3QMPA 2H4WA 1NQ5A 4JU9A 1LI7A 2XOKD 2BW0A 2GARA 2IHTA 1YC5A 1XIVA 3R3JA 4J0DA 5K0LA 3TLJA 4BJ3A 3KTAB 1N78A 3KSZO 4HYQA 4M1KA 3QXGA 4NNPA 1PWXA 1T6ZA 2EJCA 5JI2E 2UXDB 1WOYA 4RF4A 3RVNA 4BPRA 3ZZ0A 2PRZA 1QF6A 2NYAA 3IIEA 5BWBA 3FBTA 1WUJS 3DUWA 1XJCA 2VZ8A 5FR1A 3TN7A 1QR2A 2BM9A 4FCTA 3B48A 2FTKE 3BZWA 4UNSA 3T7AA 2FE1A 1KIAA 4RPCA 2VWGA 1X94A 2GJAA 1AN9A 1PFGA 1YR8A 3K9NA 3IMCA 2Q9AA 3RHZA 4A9AA 5EZ5A 2Y66A 4P6VF 3GGJA 1K9VF 2IEBA 5BYBA 4OI0A 1TI7A 2OZPA 3KL4A 3MN1A 2Z6AA 3PXGA 1ZD8A 4AJIA 5HKAA 4J0FA 1YE3A 2CCJA 4JLNA 2VJMB 4WY2A 3KR0A 1NLFA 5FBWB 1TKCA 1D5CA 3NLLA 2IV3A 3TLXA 4LY9A 4QDXA 4EBBA 3HVIA 4HNTA 1XCPA 4FP9A 3QPUA 4OXKA 3NATA 1FBNA 4JK3A 1VJDA 4Q7LA 1HOTA 2I3ZA 3W6OA 1Z39A 3SE7A 4PANA 3TGPA 4RABA 3T3DA 1BDHA 4UEQA 1S8FA 3L07A 2ZSBA 4ONEA 1BG6A 5TQ0A 4C6SA 1AZLA 4OMFG 4B5LA 3OZUA 3W8EA 3H5IA 3Q0EA 2JS7A 4C88A 4IJUA 4HQOA 4B4VA 4L4SA 4OK6A 4YREA 4C9BA 4LZOA 3S2ZA 3B6MA 4NZ9A 1N2HA 4MUNA 1EU1A 4G89A 2PRIA 2XXAA 3DBHB 1WMDA 1M2OB 1SUPA 1M1NB 2PH5A 2PUDA 4BVAA 4N5MA 5IKOA 4N0PA 2Z3VA 5E8JA 4A2PA 1QRUA 1QHIA 2AEJA 3OBBA 1RMQA 4LMBA 3USES 2OBNA 1NQUA 2CHUA 4E14A 1JKJB 5ENDA 4KPYA 1P19A 1Y1KE 3PJDA 5JD6A 1G7SA 4NY1A 2PIAA 1JS1X 1SG9A 4RZUA 1G9SA 3HXPA 5C1PA 3DB1A 2A2ZA 4G5SA 4US1R 4KI7A 1L4FA 1P1CA 3K1AB 4CN8A 2YHAA 4LG1A 5IM4F 4QZVA 1EWYA 3QKUA 3AEQA 1GUYA 4CTNA 1X70A 4CCYB 4X65B 3DHYA 4MAMA 5AM4A 3GHYA 1P45A 3PSHA 3RW9A 3F7MA 4DCJA 4CMAA 3EDQA 4RE6A 3QWFA 3ZXUB 4MEAA 4UOEA 3KE8A 4DLVA 4AL4A 1DO0A 3KVVA 1YVEI 2ZIVB 4BLOA 1Q74A 1GAXA 4K0RA 1YCFA 2V6JA 4L5YA 2VO1A 2NUPA 2FVYA 4TV8B 1M66A 2RKOA 1ADGA 5HR5A 4BNVA 4YJ3A 3SKYA 5CDHA 1BHSA 2HH9A 3KTFA 2HCRA 3DDCA 2DHRA 3E3MA 1NNLA 3I4FA 4F3NA 3RFTA 4UASA 1OA1A 3ZD8A 3HC7A 1WNTA 4M6WA 5GOTA 1FP4B 3G8AA 3FKSA 2CNWD 5JG7A 4BB0A 4QKQA 3DDSA 2GYUA 3ZHCA 1BGWA 1U2EA 1X1BA 3EZ9A 4NEHB 2P3QA 3SJUA 2VF5X 2NYVA 5JBQA 5JJ5A 3BH0A 1YQQA 5KI6A 4FYKA 4HSEA 3T7SA 2CFRA 1EPUA 3G82C 3ESAA 2ZDGA 2YJNA 1TU0A 1YI8A 2I34A 1FU7A 3O2JA 4DQXA 4RGQA 4ETMA 1VLQA 2ZR8A 2OV2A 4LJ6A 1IB6A 1NLUA 2G0NA 2JIZA 4I50B 2DY1A 3C85A 4TTAA 4ZVKA 2FG7C 4Q7EA 4G85A 3F6PA 1TM2A 4L4XA 4N7MA 4HWSA 2ENWA 5IKMA 2EATA 3ZEIA 4D80A 1E3WA 5HZMA 3H9JA 1HE1C 2GXUA 5AOAA 1GA4A 2VK2A 1X7ZB 2O0LA 2QR2A 3V2HA 3R4VA 5KYTA 3HDTA 4L0QA 3OJWA 4G5GA 1D6JA 1CETA 1S5PA 3UWOA 5IX8A 2D2VA 2ZBUA 1MF7A 3DWIA 3LUFA 1H0RA 1XRQA 2R5FA 2Q6OA 3JQ6A 3VC1A 1KRWA 1JHVA 2VQEB 1U3GA 4Y6LA 1DCKA 3MIZA 4ZU6X 2REBA 1JIVA 5CM8B 3ZIDA 4DLPA 1NPYA 1BD3A 3RGGA 5EHGA 3BGOS 2OTCA 4LY6A 4DNOA 2QJFA 1MZPA 3HMQA 3QEJA 3K70D 1SOAA 4NIMA 3BE4A 2ZVDA 2NV0A 5GGXA 5UKDA 4OU5A 4WADA 3DMFA 3G8YA 4ZVQA 2D2EA 3OT4A 3F49S 2WAYA 1DBWA 1B2RA 1XF9A 4XKJA 1QHXA 4DDMA 4FTWA 2G83A 1GAEO 2QPAA 3GJQA 4HTFB 2IGBA 3II6X 3VUFA 4OIMA 2EFYA 4XWKA 3PTZA 3JD2A 2H1SA 4MVJE 3X1MA 2FLVA 3QUCA 4AP6A 2QPLA 1TJNA 1NW7A 1GAJA 3KT3A 2PPLA 4GOKA 4MQ4A 4H15A 1Z38A 3V48A 2XQJA 4M7RA 4PINA 4JI0B 4KNWA 2PMCA 1H42A 1XXHB 2C3MA 4JIMA 4XYEA 1DBSA 1HEYA 1O57A 5ERXA 5IKXA 1I24A 5JH7B 4TRMA 1PV2A 4DUPA 1D1TA 1GPJA 4UHEA 2BKXA 3KV1A 4QA9A 5HX7A 2YJZA 4IXWA 2XUJA 4EKEA 3WX0A 3FB1A 1CY7A 1ZLYA 3PNMA 4AMVA 1DCMA 2IHYA 4HB4A 4JBXA 5EUQB 3TK1A 1VL5A 1OW3B 2XUDA 3GDGA 2ZPTX 5CB8A 2GKGA 4ZALA 1FUYB 1SXJE 1AY0A 3DDOA 4WD3A 3FVRA 2MT9A 1MW9X 4M0UA 3E82A 4LY3A 2I6UA 4NTZA 4P33A 3CLTD 4M9SA 3B38A 4WPGA 1W94A 5AFSA 2XI4A 4GPTA 4RXMA 1CP2A 4JEMA 5EE9A 3ZVRA 4LFBB 1DOZA 4REOA 4BWFB 5EHXA 3WGLA 4QICA 4O1IA 4F56A 1N3IA 4X0EA 3CRVA 3LWZA 3O8OA 1C9NA 4WK4B 2G8LA 1IG0A 5CAEA 4AP9A 4JLSA 4XRRA 1C3XA 3JYPA 1OLUA 2JJYA 3CNEA 1L5HA 4URFA 2RC6A 3DEAA 2C4KA 4HGYA 3AVPA 2BEUB 1M2OA 1BGVA 5BWCA 3DBHA 4KQFA 1N4AA 4N4AA 1M2KA 3QV1A 3MQFA 4RK1A 3VU9A 1X8KA 3B7GA 3R6DA 2FPMA 3RRZA 3CVXA 3D0OA 3ZDCA 3EIEA 4AB1A 4JC0A 1P1KA 2UDPA 3EMDA 1UXOA 5LC1A 1A27A 2O2IA 3PNBA 4ZYWA 1YS2X 3FW1A 4LHZA 4G1VA 2OO5C 1DWQA 1XPJA 2YYAA 3K4PA 3AVUA 1SULA 2LD4A 3N0RA 2PJRA 2FJ0A 5CT8A 3ILSA 4PO8A 4YV0A 4FJ1A 2AC7A 4LYFA 3W7VA 4O08A 3V4VB 2PKWA 1RC0A 3L41A 4TKUB 3UKDA 3OQ1A 3A4LA 1J8QA 4DLAA 2JEZA 1WUHS 4ARAA 3AKYA 2PX5A 2NN3C 3D3WB 3NEYA 2IK8A 3PB3A 1MTOA 2Y9PB 4R16A 3TLGB 3B6EA 3G0IA 1QOPB 3ESDA 3TWOA 4EB3A 4LF5B 2PKXA 2OY0A 2R6DA 4NZPA 4US0R 3GT7A 3H1GA 1ODKA 4FGLA 4GNRA 5JATA 2CD9A 1C7QA 4AUKA 2A67A 3QVWA 2DT5A 5KYUB 2ZJ3A 5JALA 2Y05A 4I4CA 1KOLA 4MUIA 5TS3A 1EDBA 5KWEA 3L43A 2XIQA 1Q1ZA 4LC0A 1D09A 1G19A 3LQFA 3TTVA 3A0RB 1SR8A 1TM3E 3EFOB 3JQBC 1AHHA 5LA6A 1KDYA 1TYDE 4JP5A 1GYQA 1GM5A 4BVJA 1H0SA 1RRVA 3BYZA 3MUEA 2D1QA 2YIDA 1XA4A 4MHOA 5G0UA 1Q3KA 4GWLA 3DBIA 1Q6YA 3P9KA 4O29A 3L4EA 5C5DA 1APBA 2PWPA 3G6WA 3TRHA 4A0SA 1O95A 5KQGA 1ZXLA 2G7MC 3FZEA 3TZQA 1HLFA 1FPMA 1OFUA 4PNZA 1MX5A 4CG0A 1DG1G 1QRSA 1XTIA 1L8QA 3DVAA 1KU0A 5AMXA 3DOJA 4MKIA 2QB5A 5FYDA 3B3GA 5CIYA 4M6WB 1XEWX 1V5WA 3DKVA 5CFNA 1Q7GA 4JI8B 4MARA 4Q9HA 2NP7A 2W9XA 2NXJA 2VXYA 3Q3HA 1O2DA 2LNDA 1JG4A 2DQ4A 4QUGA 1S6YA 3MLEA 1PAUA 1V16B 2WC1A 5FQNA 3EUWA 4HWGA 1KK1A 4OB6A 4AS2A 1MA3A 3UENA 4A91A 5JSHA 2VJAA 3QVTA 5JZOA 4FJ2A 2AZ4A 1LTKA 3WNCA 1MRZA 4IS3A 3VYVA 4A8HA 3AY0A 2JGKA 3I2GA 2PS9A 4LBVA 3T94A 3THRA 1WABA 3T3GA 5ALVA 2C20A 3JQDA 4LK2A 1XE3A 3ILYA 5EGSA 1XEXA 2ZYHA 1GNPA 1YNOA 3L82B 3AX6A 2ROQA 3BRCA 3PDCA 4C89A 1RHKA 1QRDA 2FPIB 4A73A 4RZ2A 1VE9A 4BJ6A 1C3EA 2C4MA 3IR5A 5I4IA 2BEWB 1ULAA 3OJXA 1BGXT 1FPQA 1ODIA 3VPBA 5CD1A 4NP6A 2H31A 4I50A 3ZU5A 3KO8A 1H4SA 4ASUD 2PR2A 4MO9A 4U7GA 3FLEA 2PRSA 5CDGA 1U0EA 1V3QE 4ISCA 5A06A 4H7EA 1NM5C 1S4MA 2F4VB 3U3ZA 3RNOA 4MO2A 1YO6A 3MOSA 1JJAA 1ZCBA 4KR2A 4C3VA 1C9EA 3CNHA 1T9HA 1E5TA 5ALJA 2C1XA 3P0JA 4J03A 4ZRMA 4KGXA 1KPIA 2X2FA 2FWRA 3AEXA 2B0JA 3UK6A 3JARA 4R31A 5B6JA 4V2UA 2G80A 3C6BA 1KZ7B 2P4EA 3AOEA 1UJMA 5JADA 2DFDA 3MMSA 1OZAA 2CDRA 3TX2A 3J81k 3BCRA 2BI7A 1UBCA 3GH3A 5LLSA 4B3BA 1EFRD 2WQZA 4XWGA 2AWNA 2BZSA 4KQHA 2CBGA 1I0LA 1AO0A 1WW2A 3QEMB 4MQEA 4XQCA 2FP4A 4BO9A 4XJSA 1IY0A 4DIEA 5AW4A 4A23A 3REQB 3EVBA 5DNCA 1T6YA 2GKSA 3KUCA 2PPVA 4KJXA 4HXYA 1NRXA 5F9FA 1WCV1 3O9ZA 2RJ3A 4MR8A 4QYSA 2QSJA 1MPTA 1ST3A 3FHOA 4D7AA 2Y0PA 4QL3A 2XY4A 1TM1E 1AQJA 1SNYA 1DDOA 2Q50A 3JQ8B 5CM2Z 3UC5A 3NVKI 2A78A 2GCOA 1EFPA 1ECLA 5BNIA 4DEYA 4RF2A 3TG2A 3Q7PA 3ZLBA 4Q3CA 4RF5A 3RYHA 5KTMA 2CKMA 1WA5A 4FYPA 3K9LA 3NM6B 1MAVA 4F8YA 1FVXA 2BKAA 2BGNA 4HNHA 3WRYA 4UDOA 3GJ5A 2FP3A 2QY9A 3FNHA 1WMAA 3C4JA 2AQIA 5AK4A 1C8KA 2FQWA 5KVAA 1OJ7A 4IGFA 1DRVA 4INPA 1GEEA 4M98A 4NX2A 3TECE 1PWEA 3O2QB 1RWQA 2ECFA 1KNXA 3LHSA 3PQ4A 3GDWA 4GQBA 3KUKA 1ZP6A 5I9TA 3H84A 3ZJTA 1PQ4A 3G0DA 4KW7A 2PSEA 5B37A 2PWZA 1LTQA 4WDRA 1G5RA 4PAGA 3JQ9C 4JYPA 4EP1A 1C2YA 3B6ZA 3BMNB 1BX3A 5IJXA 2HNKA 5DHUA 2ZJAA 4W82A 5JNWA 3HM9A 3PZRA 4DG9A 1F8FA 2I6TA 3FCYA 4O3MA 1Y1RA 2VP3A 4YFYA 2UXCB 4NCHA 4CXMA 1HZZC 1QYWA 1FBTA 1KDTA 1YZUA 2X6RA 4RELA 1NF3A 5ITWA 4G8DA 2PYZA 3UK1A 4D8TA 3I1YA 2IX3A 4P0PB 4JYAB 1Z47A 3OCXA 5F2NA 4WOBA 1YUNA 2V74B 5JSYA 3MFQA 1Y6JA 2Z8YM 1X7WB 3KYDB 3VHXB 2B6NA 3L0CA 1V96A 1ZH6A 4E0BA 1E79D 4UEKA 1SZDA 4S1TA 1HZJA 4NEGA 1YMVA 1FQWA 1O89A 4FLMA 3A6DA 3W0LB 1MV5A 2I4IA 4RUKA 3I64A 1OX4B 2FPPB 3H1EA 1UIRA 2AXQA 1AZTA 4REQB 4N7JA 5BWNA 4RXUA 1VGQA 4KIGA 4RSMA 4RVNA 3VMMA 3E5RA 3AFOA 3SC3A 4D0RA 1XMVA 4UEWA 4ACBA 1FYWA 1U2DC 4D9IA 1FYXA 2WSLA 3K1JA 4YLEA 4M1TA 2Q1UA 1Z0SA 5G0VA 3O93A 2WQ7A 1JW9B 1ZCJA 4X24A 3R7LA 1GLVA 2UYCA 4EJ6A 3X1KA 1B26A 5E6SB 1WUYA 3I5MA 2Y3IA 4BQRA 1ZNYA 3QHPA 1BE6A 4KSCA 2W48A 4EQZA 2I99A 3D5QA 3UJ3X 4PTZA 4DPKA 1U4NA 3CEMA 2GSDA 5LKRA 4AW9A 3VZQA 2D5IA 1BQ3A 4DJEC 1SK9A 1HNNA 3EC1A 3NG1A 4PX3A 4U0KA 4LMAA 4J1NA 1WZCA 3KR9A 2Y1LA 4ZEWA 6YASA 2AK3A 2FMHA 1DBRA 3M2PA 2SKDA 3B9RA 3OD1A 4PG4A 1O97C 3C24A 1EUZA 2CGEA 3HM2A 1CFJA 5F1KA 4CM6A 4P5PA 3OCJA 1ZHHA 4XGKA 1S4QA 3AI7A 4LDQA 4ZJYA 4IDDA 1RQPA 1U4OA 1Z35A 1DEAA 2HQBA 4AJ9A 4G0PA 1ZH0A 3W2IA 4N8SA 1H4VB 3DZIA 3DF9A 2G1KA 2ZWPA 4DZRA 3AL0C 4PG6A 3AOEC 3DKIA 4EA8A 3PHGA 1C0LA 3MRSA 4W6ZA 5EMKA 1CZOA 4EJ0A 3KJEA 3HCNA 2AWOA 2BHTA 4LAFA 3FWPA 2ACKA 4G81A 3VYTB 1Y5IA 2QTTA 3ZCPA 4GR4A 3NIGB 4ZDWA 2NNLD 1K63A 4HY3A 4EK9A 3LQ1A 5TXGA 1E8MA 3A4IA 3Q8KA 4EUSA 5FAKA 1EVJA 4NCIA 4X54A 5E38A 5IJAA 4LPSA 2LBPA 3NEPX 4JHLA 4S3MA 1JLHA 1K4MA 1P29A 4BECA 1KJYA 2QRGA 2R6FA 1DU4A 1VHLA 2BMEA 1X7XB 1P2UA 2C3OA 1RZUA 2CJPA 3H86A 4RO0A 4R0VA 1U02A 2VDNB 1JHOA 1PK7A 1Q17A 4IDBA 4NAVA 3NETA 4R2WA 5JLAA 1SKYB 3BJMA 4RVHA 3SJBA 4UM9B 1X3LA 4B09A 4BQSA 5ILQA 4KN9S 1QJ4A 1QWOA 1T10A 2G36A 1ZAKA 3ICCA 4BLUA 3P7MA 3F3KA 1KEVA 3HNOA 2GMWA 2PO5A 3LXUX 4KV7A 3AR7A 2H0QA 3IH5A 5IAKA 4YA6A 1UAYA 1V1RB 1S02A 4KOEC 2G6TA 1JMVA 4NI5A 4LZZA 4YUZA 4PC7A 3COPA 3MJ4A 4CL8A 4TYWA 2DBVO 4BKUA 2FAXA 4F86A 1T5SA 4ZCSA 4UZEA 3VNBA 5FWNA 3D4OA 3MOIA 3RT7A 3ZW7A 5JYEA 1RE1A 2QQFA 3S70A 4RIHA 3PD7A 4FFNA 5H9VA 1EVKA 3RU9A 5FHQA 2JFBA 3GA5A 4Q9DA 1ORRA 4BTVA 5L4SA 1YVPA 3MGCA 5M29A 4KQEA 2AKYA 2WYIA 4BO4A 1F2UB 3IB6A 3ZHVA 1O96B 3NTQA 2H5LA 4CIWA 3W2FA 2J9FB 1OLXB 4IINA 1G3UA 5DULA 2BMDA 3S8YA 4JIGA 5LWHA 2WE8A 2IYNA 3V97A 5C52B 1WG8A 2QW1A 5FCDA 2YMLA 1Z6PA 2QP4A 2UU9B 3TGWA 1VJGA 3X1JA 4RK6A 2XQVA 3H3XA 1G2OA 3B8EA 3I8OA 2IEYA 3ITNA 4X61A 5D5QA 3QWIA 4PONA 3ZZMA 3C6MA 1N9ZA 2QVXX 1YJCA 2OKCA 2UVPB 2W2LA 2Y93A 3ETCA 1T9DA 3IAM6 4N0DA 3W3ZB 2JGFA 3AM5A 1PNVA 4J0EA 2W71A 1QP0A 3FUVA 2H8GA 1KFJB 2V6MA 3L8YA 3FPEA 4M8NE 3TXYA 2XZOA 2C83A 3M9XA 4C0JA 3PC3A 3W3AD 4C6TB 1AB6A 5KYXA 3OHPA 4NBWA 2ISQA 2GN2A 1OREA 1JWLA 1Z2AA 2QMZA 5IAJA 2OHOA 1Z4IA 2W6OA 5TMEA 2QM0A 3ZG6A 4B83A 1J9GA 3H65A 2VWHA 4GYKA 5IEJA 4GZ6A 1HO3A 1EB8A 3OZAA 3FYHA 1UQTA 5BW8A 4DCVA 3EPPA 5GZ1A 3HCOA 5JXWA 1EXNA 2UZIR 4WK2B 2VT7A 1L5VA 4YECA 3K0FA 3TVTA 5JAZA 4HC4A 1G8HA 3O38A 2VHTA 1UDWA 3GBSA 3R7DA 3K9BA 3KEOA 1DIRA 5FOTA 1YZKA 4IDOA 2G9QA 4ILEA 2ZQ5A 1JVNA 4S35A 2I1QA 4P81A 3R9WA 3MHTA 2GEFA 2I87A 3R09A 4QUAA 5JSUA 2D1TA 2BM8A 2XIJA 3KVNA 4D3XA 2NMVA 3LCRA 2C7GA 2QRNA 3NHYA 4KFRA 4RH0A 3PPVA 2P6OA 3DBOB 3K96A 4PBSA 1BCSA 2ERYA 1GFSA 4BRZA 1Y9AA 1QVZA 2VHEA 1I9CA 2JHCA 2V6GA 1YOVB 1XWWA 2WIKA 4RGYA 4Q9LA 3RU3A 3TSOA 4BQPA 1Y8ZA 3LU1A 1IK4A 4LQDA 4KLRA 3EMVA 5TY0A 2JD0A 3U9SA 5BUQA 2UV8A 5KYYB 2IYOA 3ZD9A 3UJCA 1R37A 3M6WA 3IKLA 4MRMB 2W5UA 3PICA 2QMQA 2VYVD 5C4IA 1SUEA 3BRWA 1TKAA 3BIWA 1NZDA 1WKBA 4RLQA 5F4ZA 1CZUA 4HAWA 5GP1A 4EW3A 3DWFA 1UZLA 1P91A 2Q1TA 1JG1A 3YASA 1DRWA 4PHGA 3OQNA 1AQLA 2QP9X 2R25B 2VJPA 2Z3WA 3BGIA 2IBSA 2CW5A 3K94A 4C7OB 2QGZA 1QIFA 2GM3A 4GGOA 4ESVA 1GGKA 5DTIA 2PJUA 1HZZA 3G2IA 3IEIA 1XMOB 5HCNA 4F9TA 4V03A 4LF7B 5CJ2A 3AVWA 1B7GO 4KIJA 5TARA 2Y1WA 3ZIUA 1DIOB 3HKEB 3TSWA 1Z0DA 1Z5ZA 3GPDG 3PC7A 2YWJA 1H8HA 3RUFA 1DJPA 2UZAA 4TWRA 3JZDA 3PEVA 3CR7A 3LRXA 1EWQA 4POAA 5KDOA 2ASVA 3WJ7A 1ZUHA 1VBFA 3D6MA 2B1IA 2VQSA 1LWNA 1LJUA 1XP8A 4NCKA 5IJ0A 4AMGA 5BSRA 3UICA 4DXAA 4RJJA 1E1RA 5LU9A 2EBUA 3DJFA 2WICA 3WQRA 2EJVA 4IW3B 1JR3D 4P82A 4E4RA 3K0SA 1QH1A 2DULA 2NZ2A 1KARA 3AYZB 1FNBA 4FQ7A 4GG1A 4AULA 1Y3FE 2ZITA 3BRWD 3C1TA 2ERCA 1QVAA 3BMXA 4M8LA 3BIFA 1TA9A 3ZE8A 5AW9A 1J90A 3TQIA 2C5FA 1CSEE 1QYIA 5JO9A 5TEWA 5DWQA 1KS2A 2CXQA 1NVTA 4MKFA 1C4OA 1XJ0A 4XIJA 2Z58A 4B3XA 3K1YA 4Z7QB 2FXVA 3KFXA 3VR4H 1KIMA 3UWDA 1A7UA 1SU6A 1I51A 3EJWA 2HFJA 3EXHC 1GARA 2G9VA 4QQFA 1PUIA 5HTKA 4OX9B 1RPAA 2V3WA 4QIHA 3WADA 1AGRA 4O4JF 1A5AB 1DAMA 5ED4A 4AZ0A 1M54A 2JAWA 2SBTA 3I04M 2J3HA 2PLNA 3EVEA 2FEKA 4FI3F 2AJDA 4EENA 2RK6A 1WETA 3EIOA 3IOCA 1DJNA 3OIYA 1OAOC 1TL7C 4HL6A 3QLJA 1C0EA 2RB5A 2OBFA 1K3UB 3VPDA 3L6BA 1TQ2A 2AJTA 1JQBA 2EL7A 4AKIA 4HLQB 2H2DA 1WUKS 4L4UA 2GGSA 3QPCA 4JAVC 8OHMA 2VPZA 4U2DA 1KAOA 5ALWA 1CS0A 2QZPA 2YJ4A 4D0SA 2HF9A 3FFTA 3ITDA 4WCDA 3SX0A 1E2NA 2RGUA 4JUFA 5EJEA 4OA5A 1RW4A 1KEUA 5FBHA 3I34X 2PMEA 1P7VA 4DKJA 2D0IA 1U6JA 2P4SA 2Z0MA 4ND8A 2P5UA 1KO4A 3CUYA 2BAGA 3ME5A 1C3OB 2GBGA 4E5SA 3V8MA 3WLRA 2YN4A 2QV0A 1RYDA 4EB6B 2GTPA 5F3RA 4KB5A 3FF1A 4I4IA 4BCBA 1K7XB 4O5OA 4WTOA 5KWVA 3RV4A 3KBBA 2ZYTX 5C9ZA 3QVSA 1HYQA 3LHFA 3HLYA 4LIPD 4TTPA 5FBVB 3D8HA 3ZYZA 2CNWA 2UAGA 3DE5X 3TPCA 3CXUA 1WAMA 1L5OA 2A59A 4AJEA 2JIQA 1VECA 3HDGA 3MMNA 4AIRA 1JA9A 3V80A 3SYRA 5BN5A 3ELWA 3GRPA 3ZV4A 4M8SA 3O74A 4Z4IA 1SVKA 3QVMA 3E70C 3PDIB 2CHEA 3I01M 5AM5A 1FYVA 3ZGLA 1P4RA 5KINB 1PQUA 1D2MA 1PX2A 3OM0A 2ZI9A 3FNRA 1BKSB 3D8TA 1XQ1A 3EGOA 3LW7A 5KSPA 1K8RA 3GYGA 2A58A 1SQ0A 3G85A 1GGHA 3L6DA 2P0AA 2X4IA 4TYPA 3HXTA 3EXEB 4MAAA 3C3CA 2GM4A 1SKYE 1WVIA 4GM0A 4OQYA 3HVKA 5L45A 3B6KA 3HCFA 3JVUA 1TYCA 4BMPB 3M2TA 2G4VA 4JQZA 1YFLA 3UJ6A 3FUCA 5G53C 3SKVA 5B36A 5HUHA 2JVIA 3DD5A 4OQFA 2EEPA 2L69A 4EA6A 2FFHA 2IY7A 4F04A 3AP3A 1KHTA 3AWIA 5JFGA 1QYVA 1SXPA 3Q5GA 1NF8A 2GRUA 1NSTA 1OA0A 1W36C 1NKVA 3W5AA 3WOVA 1LEHA 2JGAA 3E27A 5FJJA 5B53A 2V9ZA 3QFCA 1TT5B 4BDSA 4J49A 5KOYA 1XYVA 2DQZA 4O0MA 1O6FA 5TJHA 2ZE8A 3WISA 3H8SA 4MUHA 4JKIA 4IM7A 4HZUB 5ANRB 3LKBA 4BYMA 3OZGA 3GQVA 1JUDA 3EQZA 2CNKA 4DMGA 3T54A 4MKXA 3GZJA 5B3JC 3H4IA 4KDCA 1GQRA 3GNSA 1KY2A 1W75A 1A0OA 5E95A 2YRXA 2O23A 3THWA 4Y2XA 1Y37A 4MR7B 1QTIA 5CB4F 3DV9A 1E3IA 1QP8A 3KIPA 3M0EA 4K46A 5SZKB 5AXCA 4EY5A 1Y9DA 3BCSA 4JMPA 1EXVA 2OV3A 2AXNA 4PS0A 1KZ9A 5IUNC 1A7JA 1PR2A 2G1UA 3SJZA 1CK4A 3JYHA 3VQTA 3LT1A 1GTG1 4FKMA 1XFAA 4TXHA 4UUOA 1PV4A 2ECPA 1PFUA 1Y5LA 3V7NA 4D42A 4BVBA 1CR0A 3NVAA 4B4OA 4C0HA 3WL4A 1C9MA 4MW0A 4D3DA 4QGHA 5GAJA 2V7XA 4AYXA 4PNEA 1HK7A 1XPUA 3QUQA 2RHWA 1FNNA 5B12A 1IL0A 1T13A 2EFHB 5L7WA 3C3JA 5EJ8A 1HYHA 1R5JA 3DR3A 2P6UA 3PX2A 5A7HA 5HIAA 1GQ2A 2AC2A 4B40A 3EXG1 1OWNA 1QU3A 2CYAA 1E6LA 5IWCA 5J2TA 3ZBUA 2P3SA 5H3CA 2G9UA 3CC8A 5ECGC 4IXTA 1CVRA 4E2WA 4IDFA 4ZCTA 4D9EA 1HFKA 1URPA 2Q6IA 3HJBA 1U7WA 1X1RA 5DYTA 1B8UA 2GK3A 4K81B 3NC1C 5GMOA 5BOSB 2XEXA 3VTZA 1DOAA 3EW7A 3TSAA 1OC4A 4WFQA 5C1DA 4IAOA 2KBFA 2X6QA 1IIRA 1HH4A 1A76A 2KS6A 3HUTA 4P32A 2BZ1A 4ZQCB 3Q6MA 2I2CA 1C81A 2JC3A 1VPLA 3CT4A 3D0QA 3ESYA 4XAQA 3NMUF 5BN4A 5K6AA 1QYXA 5A4KA 3NALA 1FP4A 4G6ZA 4DDWA 3TLAA 1V6SA 4BEJA 3RYFB 3VR5D 4QWMA 4B74A 3HR7A 3PDHA 1K8QA 3NVDA 1J97A 3QELA 1Z4JA 4GSLA 3N86A 1O94C 1U8CB 5C31A 4CCWA 1RAFA 1W9HA 2Q5LA 2QW0X 3FCXA 1NDQA 3SXUA 5LP6F 2HCJB 1QAOA 3QY0A 3A6PC 2H16A 2VPWA 3ZV6A 1YTLA 4IG4A 4NC9A 1WS6A 5FAXA 5M5BA 1ZR2A 1KYVA 2GN4A 4OFZA 1ORWA 4M89A 3FOCA 3O03A 2I1VB 5L3VA 4WI1A 2QRZA 3OZDA 3BMCB 4HRYA 4Q00A 4ZICA 5JVDB 5A0FA 3VU1A 2O5CA 5LYJF 2BUCA 3WMWA 4AG3A 3B82A 4B33A 1Y5RA 1RI4A 1XU4A 1GPH1 4ZVPA 1PV1A 2O3UA 2SNIE 7ADHA 3PXCX 1ZXBA 4WY8A 5TT0A 1XT6A 1RWKA 3H19A 2BGJA 2D5BA 2YCLA 1QS0B 3OJOA 4CL0A 4DS3A 2PBFA 1DS6A 1SBZA 2OUKA 3KQWA 4M88A 2WB4A 3SPXA 5LU8A 2UKDA 3CT6A 3O47A 1E4VA 2WJ3A 3M5PA 4G9GA 3ONNA 3ICPA 4P1ZA 1UBSB 1EQUA 2COUA 4F85A 3OURA 1QGUB 1THGA 2VP2A 3GGGA 4Y18A 2QJWA 3AONB 3OU7A 4A0RA 5E9QA 1C8VB 4HQFA 2A5JA 1H9BA 2XZTA 1I2ZA 4KWEA 4WLOA 1JYEA 3PX7A 1FMTA 1G98A 4RPLA 1LXCA 4OK3A 3B3AA 3PTLA 4D3FA 1LFAA 1LBSA 3RT9A 2FEPA 4ON9A 1GTMA 4J43A 1UIMA 1Q1QA 3HXLA 5K2OA 1VMAA 1MRNA 2C00A 2BEUA 2QRLA 4RCZA 3Q7RA 2AHOA 1BQ4A 3N0TA 1BJRE 3N3AC 1T25A 2HHAA 4KMMA 1SUCA 3PRHA 1UUFA 2RGNC 3Q2IA 3INTA 2OXCA 2CZGA 4IXMA 1FXSA 4LGMA 2OA0A 4X90A 5TPZD 2YXEA 1PGOA 3O8OB 1I4DD 5A3VA 2C8LA 1MGOA 1R16A 1WM1A 2VWQA 3EVCA 2EARA 3CN9A 4DHWA 5AXBA 5G1NA 1DB3A 4EJMA 5ILOA 1SBNE 4WBNF 2OGZA 2J0EA 3E9DA 1FZQA 1V95A 3DNFA 4QBFA 5ECYA 2BR5A 2CMHA 3KYBA 1PR5A 1WHTA 4TMXA 1FFWA 4BGDA 2JI6A 3H05A 3BD7A 5F73A 2Y0DA 4YRMA 4ZHQF 3MCZA 2ZAOA 3RLFA 4RTSA 3OJ0A 1PUXA 2ZIGA 4B47A 1O77A 1Z0AA 2OYSA 4NFLA 3GC6A 2H1CA 2P91A 3H2KA 5EE3A 2EKLA 4KUEA 3SM9A 1R0LA 3F96A 3UTDA 2ZBQA 4L73A 4MJLA 4XI9A 3GVIA 1CF4A 2RH4A 4G86A 4RVSA 4FLEA 1HDIA 1C30A 1H3FA 4K8RB 3QF4A 4O2BB 2GWRA 3I2YX 4PGAA 4UHJA 1DNPA 1XTZA 2QUKA 3C45A 1SQFA 2CXHA 2B3TA 1AQUA 3EGCA 2GH1A 4QYIB 4CDNA 4G5HA 1EM8A 3MAGA 1I5RA 1VDZA 3PXAA 4JLPA 5CBKA 5TE9A 3FBWA 1HT3A 2OXFA 1V3VA 4DC9A 2F8SA 4PSVA 3RASA 1MW8X 1NATA 5AKZA 1B14A 1PEAA 4LA4A 4XIFA 5AW8A 3BMQB 1KGSA 2GJKA 3KR1A 4MS3A 2PY6A 3L7LA 4HB0A 4DCCA 4N5NA 4Y0NA 3SMQA 3FD8A 4R9UC 3C39A 4NG5A 4R4JA 3TIGA 1I01A 1AHNA 2P9HA 3GQBA 3N6RA 2OFPA 5IHPA 2P9CA 2JIRA 2V5VA 2XV1A 4ARSA 2LXNA 3ZWPA 7REQB 2A8YA 3PFCA 1Y8QA 4F6CA 4QXOA 2HMYB 4YCMA 1WXEA 2JH3A 1GFWA 2FW1A 1N3YA 4P3XA 1JKIA 4FR0A 5AVTA 2IDMA 1MJHA 3G9ZA 3WJAA 3VR2D 4M1YA 1K9SA 1N92A 2NV2B 4CKWB 4GI3A 1BRTA 2XB4A 4GZ3A 4PRZA 4HZGA 4MDYA 3R7WA 3TQRA 3WB1A 1YJBA 2YC2C 5IG2A 1UXGA 2ADFA 2AF4C 4OJYA 4C5AA 4U7DA 2PGAA 2YFKA 4C4SA 1ENOA 1LLDA 4CT0A 5CT6A 1D9XA 2BHNA 2P78A 3JAWA 1RADA 1PGJA 4DWJA 3V1NA 3U6BA 1PN3A 1YRAA 5BN4B 1TVCA 1MP0A 5KNBH 3UV6A 3GIWA 1JQAA 3CUEF 5EEGA 1QIJA 5A7GA 3ROMA 1VIVA 1CW2B 1ZM3A 1ORDA 2W90A 3SP1A 4ZCQA 3TNLA 1IMOA 2ETVA 1BWSA 4RYDA 4CUJA 5K6TA 1XBTA 2GLUA 4IH4A 4LVCA 2O7RA 3C74A 3EQ9A 4I6JA 3F0TA 2PX4A 5AJUA 5BPHA 1PKEA 1T8PA 3EISA 4BIIA 1RE0A 4M0LA 2O8VA 1LK0A 5AW3A 3S7ZA 2EEZA 2F3QA 2JCSA 3ZD7A 1D2GA 3M4YA 5CLGA 3HB4X 1Z8FA 2X0EA 5E7MA 3AINA 3P2YA 1QGAA 3W5DA 3IDZA 3NQ41 1E96A 4I1SA 4BKOA 2B0CA 3BEDA 4TN5A 3QQPA 2QYSA 4DCSA 4YJHB 3Q5DA 4XOUA 5J9FA 3FCUB 4HYYA 4QATA 2BE9A 2OZLB 2TMGA 3RS9A 1WPGA 2OV4A 3IEPA 4LYYA 1PJTA 2OECA 3KYJB 4RA9B 5CA1F 2PVPA 3CEJA 3E3OA 3ABQB 1WUTA 3DEZA 2V7GA 2GN8A 4QLBA 4RK0A 4R68A 1ONOA 3IP7A 3E9YA 1GDTA 3FF4A 4W6QA 1UZUA 2F7SA 3ZVNA 1XV5A 4JEIA 1H4TA 1XQ9A 2XUKA 1WSDA 3AUYA 3D2AA 4IDGA 3VNRA 4OUDA 4XTRA 2HL6A 3EB9A 3GEBA 3DW3X 1TDJA 3GAFA 1K5DA 5DOVA 1OWOA 2AMJA 4RADA 1VG1A 1EBBA 2AEMA 3F2IA 3IPCA 1FUUA 1MOSA 1KC1A 1J33A 2Z56A 3FY4A 4ENPA 4W5QA 1J00A 2RARA 4FC7A 1X1SA 2VA8A 3DXFA 4N9WA 4F5DA 2JVKA 2NYUA 1SOVA 3OC6A 1CE8A 2ZJ6A 3GXOA 4G1UC 1DAOA 2QXUA 4C0LA 4KAAA 1II8A 1W47A 3H4MA 3GMIA 3IMFA 3QP9A 1PWZA 4QASA 2IDJA 2ZROA 1J99A 3I6IA 1KO1A 2G5CA 4AZ3B 4C0KA 1DWOA 1ZU5A 5JMOA 1NJ6A 1QQ6A 1PGQA 2XQGA 4BE7B 3L79A 2BR4A 3IALA 5FUBA 1JR3E 3Q3IA 4WVLA 2D1YA 2GHIA 4AUMA 1XZBA 2NU7B 1MEEA 4ER0A 5CDYA 2IRWA 5EHIA 5INTA 1POWA 1RAHA 3ZV3A 5EFOA 1RBZA 3OX3A 3VPGA 1TOAA 4Y2VA 2GEUA 5F2KA 3ZIAA 3WDLA 2G1JA 4CM5A 4RZ3A 3JAKA 3IO5A 1Q11A 3B2EA 1HDRA 2PLRA 4Q47A 2WF5A 3V1LA 3ZE0B 4CT5A 1MENA 2BMJA 2NZXA 2QI9F 3I0NA 4JJ4A 4KFTA 1XAIA 4DMKA 1P81A 1NNSA 1KKMA 2PRYA 4IY1A 5FNVF 3V9AA 5A03A 1SQGA 1FTYA 1HNXB 1U5CA 3BD6A 4UQOA 1G60A 2YJ5A 2ZE5A 5E4TA 4F60A 3T3MB 3GEHA 3DE6X 1I33A 2CF6A 2YXBA 5TC4A 4UQLA 5GJVC 1H2RS 1S3SA 4AKTA 4RV4A 4I9FA 1I1OA 4JB0A 3NH9A 3SZRA 4ZAWA 3ZHRA 4AKHA 3I5YA 3OIVA 4Y9RA 1S2NA 4HQLA 1J2TA 3B13B 2OP1A 3D7MA 3EVTA 4KYIB 5J4HA 3BMQA 1VE1A 2HW8A 2W7TA 2Z2JA 3OCWA 4NJEB 2JKZA 5E2AA 2BJVA 4WBNA 1UOOA 1C4KA 4XDYA 1G4HA 1NI3A 5C3MA 3U0VA 1B4DA 3F4BA 4HADA 3AP1A 4W5NA 4KX3A 1RXIA 3CKMA 4GO1A 4GVLA 4QYIA 1T5TA 4P92A 4I9NA 3FHCB 5C7OO 5J2UB 1L1RA 3OJCA 5HK8A 1CHDA 1VKNA 2CL5A 2O2HA 3I83A 4NHOA 4PG5A 5B57C 4H59A 3EFEA 3GLHB 2QTLA 2YV5A 5KTKA 4WCFB 1GA6A 2ZZMA 1QFMA 4KQKA 1ZK1A 1WCYA 3A58B 3MTJA 4B46A 1N2IA 2QDKA 1H2HA 3EX7C 1NN1A 4YO8A 1GG5A 2CXTA 2A9VA 2ZRHA 1Z0IA 2I7DA 2A0FA 2JKYA 5FRDA 3MJFA 2OBMA 5JCXA 3HACA 1F4LA 2ZYWX 3DKPA 1U6IA 3ICOA 3QHAA 1BROA 3I62A 2GHRA 3FA2A 2NO1A 5C5EA 4D0NA 4M86A 5J58A 1BS9A 1M34A 2SICE 3L7BA 3HLTA 2AX3A 2XMZA 5AI8A 5SZIA 2GEBA 1XK7A 1KPHA 2JJ1D 5E3JA 3H16A 3ILVA 4I2VA 1P7WA 4GC9A 3PJGA 2XWPA 2ZG6A 3LFTA 1QHNA 2PT5A 1XX6A 4JCCA 3K70C 1WMEA