1VE5A

Crystal structure of t.th. hb8 threonine deaminase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
310
structure length
308
Chain Sequence
PSLQDLYAAFRRIAPYTHRTPLLTSRLLDGLLGKRLLLKAEHLQKTGSFKARGALSKALALENPKGLLAVSSGNHAQGVAYAAQVLGVKALVVMPEDPYKKACARAYGAEVVDRGVTAKNREEVARALQEETGYALIHPFDDPLVIAGQGTAGLELLAQAGRMGVFPGAVLAPVGGGGLLAGLATAVKALSPTTLVLGVEPEAADDAKRSLEAGRILRLEAPPRTRADGVRTLSLGERTFPILRERVDGILTVSEEALLEAERLLFTRTKQVVEPTGALPLAAVLEHGARLPQTLALLLSGGNRDFSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonine deaminase
publication title Crystal Structure of T.th. HB8 Threonine deaminase
rcsb
source organism Thermus thermophilus
molecule tags Lyase
total genus 100
structure length 308
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 4.3.1.19: Threonine ammonia-lyase.
pdb deposition date 2004-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ve5A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ve5A02
5B3AA 4HPXB 1K8YB 2ISQA 3CEPB 2WSYB 5HBGA 3IQIX 3BM5A 5D84A 1C29B 1Y7LA 2JC3A 3IQGX 5I7AA 4D8UA 1TZ2A 1J0BA 4IL5A 1WKVA 1KFEB 4D9KA 4D9NA 4D96A 4HPJB 4Y6GB 5JJCA 4I1YA 4XUGB 2CLHB 1E5XA 4OREX 5C3UA 2ZPUA 1K8ZB 3DWIA 1BKSB 5B36A 5KZMB 5D87A 4COOA 4NEGA 1M54A 1TYZA 1TZKA 2BHSA 1KFJB 3AEYA 1TTPB 4L0DA 4HT3B 5I7HA 5B55A 1PWEA 5D86A 2Q3DA 1CX9B 4JBLA 1K3UB 1OASA 2RH9B 3R0ZA 1CW2B 1KFCB 3AEXA 1K7FB 2J9ZB 2CLEB 3TBHA 4D97A 5KINB 4ZU6X 3PR2B 3IAUA 3RR2A 2GN2A 5IW8A 4QYSA 1A5AB 2CLMB 4NU8X 1FUYB 2PQMA 2CLLB 2D1FA 5D85A 5DBHX 4D8TA 4D9GA 1QOQB 3DKIA 5I7WA 2J9YB 5JISA 1TZMA 4ZU1X 1Z7WA 4D8WA 1WBJB 3PC3A 1TJPB 1KL7A 4LMBA 2GN0A 1K7EB 5I7OA 1TZJA 2TRSB 4D9CA 5T6MA 2DH6A 5CVCA 3VSDA 2J9XB 1QOPB 4WX2B 4F4FA 1F2DA 1K8XB 2Q3BA 4L27A 2O2JA 1J0DA 3X43A 1J0EA 1WTCA 1V7CA 1FCJA 2EGUA 1P5JA 2BHTA 3VC3A 1J0CA 1RQXA 1Z7YA 2ZR8A 2RKBA 4HN4B 5B53A 4KKXB 3R0XA 2DH5A 5B1IA 3T4PA 1VB3A 4D9BA 5IWCA 5IXJA 5J5VA 3L6CA 2O2EA 3FCAA 1X1QA 3V7NA 4D99A 2CLIB 1UINA 5DW0A 2TSYB 5I6DA 2CLOB 4D92A 2C2GA 2GN1A 3HMKA 4D9IA 3IQHX 3PC2A 4H27A 1TTQB 5B1HA 3ZEIA 1J0AA 2CLKB 5DVZA 1JBQA 2EFYA 4L3VA 3L6BA 3PC4A 1BEUB 5DBEX 5EY5B 1V8ZA 2ECQA 3FGPA 4ZQCB 4OFXA 3VSCA 2TYSB 1D6SA 4D9MA 1WDWB 4AECA 5BW6B 3L6RA 1C9DB 4D9FA 5CGQB 2C2BA 5J43A 1PWHA 3X44A 1O58A 2ZSJA 1UBSB 3SS9X 5I7RA 1VE1A 1TDJA 1UIMA 3SS7X 3SPXA 3DWGA 4JBNA 1V71A 2RHGB 4LMAA 5DW3A 4L28A 4HO1X 4D9EA 4AIRA 2CLFB 1KFBB 2ECOA 1A5BB 2Q3CA 5E0KB 4LI3X 1VE5A 1A5SB 1A50B 1KFKB 2V03A 4PCUA 3VSAA 1K7XB 3VBEA 1C8VB
chains in the Genus database with same CATH superfamily
1JIKA 1FSFA 1ZRHA 2CLCX 4HATA 4KCGA 4MINA 2NGRA 4S0XA 4P3OA 2AJDA 5IN5A 2GBFA 1RNLA 3HDYA 4CLDA 3ZWWA 1RQGA 3HM2A 1JDNA 4CGYA 2P6MA 2Q1TA 3WS7A 2FN3A 4AXBA 4BNYA 3W9SA 2P11A 3MBOA 2HMWA 3K0KA 1EXDA 2B94A 3ET4A 4C78A 1FTYA 4UMVA 3FNQA 4N0EA 2WB2A 3OE7D 1ULHA 1GN9A 4EPXA 1JDBC 3F6EX 3VAAA 4YP1A 5DB4A 1SKMA 2PX3A 2ZVJA 3FMOB 3N05A 3M3DA 1R74A 4ZKDA 3R0ZA 4WK6A 4GKVA 1KFCB 2X9QA 3DE3X 4TTVA 5BSUA 5KKNB 4EZEA 3NDIA 1CS4C 2Z5VA 1QRDA 4B3FX 4DQUA 4E13A 4KO1S 3F7MA 2DF8A 3VH4A 1I6MA 4OHCA 3OMLA 3GLVA 1CQJA 4FTWA 5FAKA 3RVKA 4DUZB 1UAAA 1X77A 4KQ6A 3ESYA 2W00A 3C41J 4B3HA 5C1DA 2JLYA 5EIXA 2JVJA 3VHXA 3CWCA 4G97A 2WJ4A 3TIIA 3AESA 4CHTA 1RPJA 3JW8A 1WCYA 2FAXA 1LW7A 3U3OA 1YZFA 2CDAA 3GA7A 3R3WA 4ITVA 5E8RA 1RKVA 3BHNA 3NZEA 2YJ5A 5KU7A 2UUAB 1S1CA 2O1SA 4RFSA 3ZBUA 3E9ZA 2B4RO 3KYCA 3LC2O 1OHHD 2ZRPA 1Z4PX 3VOBA 3VNBA 5DHSA 4F1KA 1GCOA 1GZ6A 1O6GA 3SOZA 4KITB 2XPCA 1WPRA 3ZX4A 3Q8MA 2DWPA 1M6YA 2RG7A 3AIMA 1RBZA 3KOUA 2QTGA 4XCXA 5TDHA 2ENUA 2IYYA 5IVKA 2QX4A 3MGGA 5C7YA 2YC4C 4UHBA 4Y2SA 4B76A 5JTTA 4LF9B 2IYVA 2P8SA 3ENQA 1A9SA 4DR2B 2BHTA 5EJIA 3VC3A 3NYIA 3ASZA 1FFBA 1M1YE 2CNWA 4WDQA 3N2GA 5BV2P 1NKVA 3NP9A 1Z35A 3TI7A 3KT0A 5AM3A 7MDHA 1RZRD 2RHHA 4QG3A 3TUZC 3NVMB 1H0RA 5FULA 4DV5B 2JBWA 3IS3A 1WHSB 4X7RA 1AV7A 1BJRE 5JPCA 5EJ9A 4HRXA 1AQYA 3A4NA 4FD2A 8AT1A 4LBWA 5BXQC 5KTTA 1TUBB 1TA9A 2G70A 2Y8EA 2NAFA 3D6TB 3IE0A 1U6JA 3F6YA 4FX2A 4LOHA 3T9BA 5I6DA 1QH1B 1X19A 4FS8A 3L84A 4NPCA 3V7UA 4F6LA 4K1XA 3ZWQA 1DZIA 1JNXX 2C95A 1BCSB 2DU8A 3L7IA 4I9GA 4NSNA 2I9PA 2RAVA 2OCGA 4JUIA 1XFDA 2B1GA 1NDUA 3NBKA 3V8VA 2QTCA 4KYTA 4Q9AA 3HM9A 3FVRA 3TEFA 1MAHA 3EWAA 2HOQA 3WICA 1B76A 4LY3A 4Q18A 2CVZA 1VKJA 3K96A 2DTEA 4TVKA 2C57A 2N1MA 3OKAA 4MQFA 4BIIA 4BCBA 2JGMA 1D4AA 5DDIP 4X64B 4Q16A 5CB4A 3FF1A 3ROGA 2P90A 3QXGA 1WE2A 3CR3C 2P9HA 4GUDA 2NXJA 4CN8A 5LSAA 3W4JA 1JW9B 2ZUUA 3FZNA 5A6VA 4BMZA 4J0JA 2E55A 4E15A 1Z8NA 3DAPA 5AVXA 3QXHA 4G8DA 3GJ8A 1N6NA 1N4DA 1QBKC 4YTEA 2C00A 2EGGA 3R76A 3AJAA 5DX0A 4HDRA 4WJLA 2DQYA 1X8XA 2LUOA 4H17A 1DXYA 2WP8J 4QAJA 4C0QC 2RI6A 1C8VB 3TX2A 4D9JA 4NMWA 4P9NA 1LBSA 2ZETA 1JG2A 3FMGA 4M86A 2BHNA 3IPAA 4WTOA 4KE9A 1PAUA 3BM5A 2ONJA 2OBBA 4C3ZA 5CA1B 1GR0A 4U2BA 1FXSA 3QOFA 1HQCA 3PB3A 5EJAA 3MGAA 3EZGA 3Q6MA 4HQLA 4B4UA 1DLIA 3IIIA 2ZR0A 3GP3A 3JQAD 1XJ0A 3E1SA 4RENA 1JLRA 3NHMA 5CR9A 2QUKA 3K0FB 3LT2A 3FYTA 5L3QB 4OX9Y 1MENA 2QMQA 4KAAA 4C6TA 2EQAA 1W93A 2Q8QA 2QDXA 4IDEA 1DAIA 4NYIR 1SC3A 1XYYA 4DDVA 2IV7A 2CE7A 1CX9B 2GTPA 2HNBA 3GWZA 3M3PA 1K86A 2J3IA 4MA0A 3WB0A 3GLGB 4DKJA 1B15A 2AMYA 5JSKA 4ZXFA 5EAIA 4FOSA 1UFRA 3QVVA 2BEUB 3EVFA 1DQPA 1E8NA 4F6RB 5JASA 2FP4B 2WHRA 4KXLA 4XJTA 2DFPA 3I1FA 1UXJA 4D74A 1G4AE 4N48A 5CFZA 1LK0A 3V6LA 4A8JA 3OCYA 1NZJA 1Q12A 1V6CA 2HN9A 1TEVA 4UQLA 2ADMA 5BMVF 5LMNB 2FUNB 4L0MA 2QTNA 1HYEA 4P53A 3PUZA 3OUTA 3ZW7A 4CM4B 5BSTA 3PC3A 1P9WA 2VTEA 1Y33E 1LI4A 4LTDA 4D9CA 2IRWA 1ORRA 1CIJA 1ID8A 2OG2A 3EPPA 1LWNA 3KR0A 2H1RA 1K06A 1VIMA 4KLNA 3VO8A 1YHZA 5E7QA 3HYCA 4N6GA 2O8BB 3KUUA 5F2OA 1LVGA 4CF3A 3FPAA 1RHMA 2IIBA 4GOND 2H4JA 4WCDA 3FNGA 5F51A 1RHRA 1K3TA 4X93A 1J2RA 1EVEA 1G16A 4R68A 3VYRB 4DRXB 3B6ZA 3BH6A 1FTGA 3SZRA 2ETVA 5HJEA 3O82A 1IAQA 3E7PA 3RUFA 2P1RA 4OHUA 1KJNA 1XMVA 1KEUA 2VXYA 3DFMA 2FSIA 3O47A 4OQMA 4REMA 4WUVA 4YJGA 4TWAA 2B25A 3CT6A 1GNLA 1NVFA 1KO5A 1ORHA 2GBPA 4GBGA 3RS3A 5C5DA 1AQNA 3VZSA 1XZGA 4AG3A 3HE3A 1KRHA 3H1GA 2HDNB 4G89A 1EG7A 2WJJA 2XY4A 4LVOA 2CDRA 2GJ9A 3QA9A 1BXRA 1MRSA 4MYTA 1WNFA 4DVGA 3QEBZ 3PX7A 2E85A 2QUIA 1BXZA 4KR0A 2CBGA 4NJMB 3REFA 1K97A 3ETGA 2YMPA 4J91A 5FF9A 3NTQA 3IP5A 5B1HA 5KO2A 2IDMA 1SXJE 3AB3A 3AOEA 2I7VA 1RAFA 1PEYA 1VHLA 3HUUA 3IBSA 1HC7A 3NC4A 4QGAA 5BYBA 1G8PA 1TK9A 4H1WA 3ZNOA 3HRKA 4BPBA 2WU3A 3A3PA 1QFZA 1ZUD1 4HFNA 5M29A 3L01A 5AW1A 2PBRA 4Y0NA 4IJUA 2B4YA 2RIPA 2VP0A 1IPEA 2WVHA 4KE7A 4MMXB 4QQRA 1NQOA 2AKAB 4CLEA 3FOBA 4LRWA 4BNFA 1FNMA 2YN0A 3QBEA 3DPSA 1Y82A 4TKZA 2XTJA 4K8RB 4N49A 3COPA 1HDRA 2ZQZA 3G79A 3ZHSA 2V3CC 1RLJA 3MC1A 4HLDA 5FO0A 2OFWA 4J4BA 4C29A 1MVLA 4LF5B 1EFRA 2Q3HA 2WAMA 4NK5A 4DLLA 3GMDA 4NQRA 1KYVA 5HRCA 5TVKA 4L0CA 1GL3A 1JFVA 3CNHA 2INGX 3CW8X 4BNIA 1VG1A 2PIAA 3LWZA 4M89A 1G7CA 3IH5A 4LXXA 5EJ8A 1E1YA 2D2VA 4N5IX 1T8SA 2H2WA 4HX5A 4I3HA 1K75A 5BYJA 2HAEA 3IQGX 4QYIB 2PKQO 2OXFA 3V6MA 4D8XA 2HLDD 2OWEA 1GZ4A 1H6CA 3PF9A 4J2HA 5DO9A 3RIHA 2A9PA 4LN1A 5FOUA 1FXWF 3B8EA 2MIIA 4M49A 3U17A 3W5SA 4LJ6A 3D1JA 3IIKA 4QBGB 3JALA 5ALJA 5K4GA 4HK4A 1HV8A 4HFJA 1Y3BE 2ZDHA 2F2TA 1LDGA 1YA6A 1F5NA 4KK3A 1L7PA 4QVKA 4CV3A 3Q7TA 4E5PA 2EW8A 1KIFA 4O8CA 1EM8A 2OKCA 2GF2A 3IA7A 1RXSA 3BMCA 4JOBA 4CU2A 5CB6A 3AVYA 3BSWA 4CEJA 4A9AA 1KKLA 4L4XA 1D2NA 2DULA 1V8BA 2HHHB 1PL0A 4FT4A 1BNCA 4DWOA 5EN4A 4GH5A 4F2WA 1LVUA 2RGRA 1N3IA 2G9UA 1E4YA 3LUJA 4GBMA 3WL4A 2A86A 3F3MA 3K8OE 5JO0A 4CMHA 3BAZA 1DKNA 3ZXYA 5J23A 2CJPA 1R9MA 5EWMA 1NJ5A 1VIVA 3TLJA 4JYBA 1SB8A 4MV0A 1PUXA 4AJ2A 4KQKA 1KZ9A 1PW7A 3OCCA 4IHJA 1C1XB 2ORVA 3DXZA 2FQWA 3VR2A 4EA6A 3JAMA 4YRBA 1RFGE 1CJVC 4HGQA 4L78A 4WNAA 4E32A 1J0EA 3JQ8B 1AD2A 2ZYSA 2OBNA 4RS3A 3ZIAD 5LMZA 1N6PA 1USWA 3PXDA 1LC3A 1RQXA 1HF3A 1FS6A 2H8GA 3L06A 2JLBA 5FQNA 4OXXA 3G5TA 3DQQA 1H2HA 3MINB 4HH0A 1LLCA 1PK9A 4PHTA 3EE6A 3ZNNA 2XUOA 2X0FA 2PR2A 1IBCA 2AR0A 2DQZA 2A33A 3E3MA 3A3OA 1SKAA 4X6XA 4YJ3F 5L45A 3JAWB 2Z30A 1TVKB 3KEOA 2VDLB 3HU1A 4JC4A 2DE0X 5G4LA 4AZ0B 3H5LA 3IP8A 2XEDA 2J85A 3L6DA 3G0BA 2YJ3A 2FWIA 4HDQB 1TTQB 3SQXA 1DIAA 1RAAA 2HJHA 2YIDA 5BORA 1OW3B 3D43A 4UU7A 1AXEA 2A5JA 3UXHA 1BEUB 1IEWA 1LBHA 4RPHA 4F5DA 3QI7A 3I64A 1OKKA 2FK8A 4L1KA 3FRHA 2ONYA 4B81A 2VZLA 4W9NC 1CUDA 4KLZA 2BEKA 1V7ZA 1O94D 1ZMRA 1PTJA 4K0KB 4I36A 3STHA 4EIWA 5H80A 2W90A 1IB0A 1YHYA 2FX2A 1BFUA 1EB9A 1SBYA 2VP3A 5DLDA 5CDYA 1IHUA 2B99A 4DXDA 3RU9A 4MS1A 1S4MA 1WB4A 3KQYA 2XB6A 2ODBA 1KI6A 1RLTA 2HCBA 4F91B 2VA9A 1RM4A 1UXHA 3HSSA 1UPTA 3O8DA 3EG5A 3VU9B 5K0JA 2F48A 1FU7A 1PJTA 1CDDA 2XMZA 2GBIA 3RJ5A 1R0BA 2IEDA 1FDRA 1EZ4A 1NF2A 5DGHA 1JHOA 1K63A 1K8YB 1N2CB 3CWQA 3DE0X 2D1QA 3HB7A 4RF5A 5SICE 4BQOA 2C7QA 3TN7A 1AGPA 3ZTYA 3E9RA 3VDXA 4UBNA 3V1TC 1PSDA 2C5BA 5DT2A 3ZDCA 2VBCA 1HFEL 1EEXB 1XK6A 3CLTC 4H6WA 4K9LA 5B6IA 1KP2A 1SZDA 2J7KA 1J0BA 3H2ZA 4TKLA 3PHBE 1N1EA 3OX3A 4AYTA 4P92A 4V03A 3TZEA 4Z1MA 1NR7A 1XRQA 3KELA 2XXAA 2R1ZA 4KJZA 5EKSA 2GBCA 1ZH6A 3BE6A 4LY9A 4JGBA 4XJSA 2XVMA 4QT4A 2ZCJA 2F3TA 5DI9A 1OXKB 1T6YA 1EWYA 1KO8A 1PGJA 5C8DA 4NBKA 4FWIB 4ZIRB 5FDFA 2IOFA 1IMOA 2ZRFA 5U4XA 3ZY4A 5HS4A 2VDVE 4ZU6X 4P4NA 3CNOA 2AFIB 4NCHA 2C83A 4D82A 4GE0A 4C7BA 4BQRA 1QKKA 4KRXA 1DRWA 4OM8A 3W8FA 1IIRA 4QICA 1UT6A 4WACA 3P9YA 3PEUA 3QLUA 1U28A 2JFNA 4DB4A 2OCYC 1T2VA 4LOJA 5KNBA 3WYCA 1WF3A 4YLGA 4HNQA 2FPLA 4XB1A 2B4AA 5CLLA 5IAEA 1K6EA 1LDMA 3N8IA 4GYKA 4MI3A 1IVYA 1XHEA 1Y1SA 3THWB 1QYRA 3VSDA 1QRSA 4Q66C 3AVVA 1HDOA 2QE6A 1NW5A 1B41A 3WFZA 4ER6A 1J4AA 2WF6A 1CJTC 1E7MA 2LDXA 4YRLA 3AI2A 4F3NA 2ID4A 3IHTA 4E70A 4YRMA 1B3BA 3W4IA 4YY3B 3M6AA 4H6PA 1G2OA 1II9A 1XRSB 3A1WA 5CEJA 1LKZA 2UUOA 3NOXA 3IKTA 1DEAA 3CH5A 4ZMRA 3F7TA 3A27A 4XM2A 3E18A 1HWYA 2NO4A 3BFKA 3NAMA 1ADFA 4NHEA 4TLLB 1NFQA 5JNRA 4AN0A 5JTUA 4OGGA 1QKJA 3NGMA 2Q9CA 4W5QA 2DQSA 4J1NA 5E4JA 1R6XA 3LA8A 4NNOA 1QGAA 9LDTA 5IJ9B 2QN7A 2ZUVA 2JD0A 3WKCA 2EG5A 2WD7B 1IZ7A 3OFNA 3FYCA 3HU5A 2IXBA 3GLFE 2ODWA 4P35A 1JIVA 2PGAA 4R9NA 4C0JA 1NW6A 3QPCA 4NESA 4QC2A 4WPGA 2P78A 3WXBA 2C94A 4J6EA 2IEBA 4JODA 1SD1A 1SKYB 3EIUA 3K4PA 3REQB 5K0GA 5ESXA 2WY2D 4F3KA 4MUAA 2OORA 2R6HA 5FPKA 3S55A 1P8JA 3IGFA 1DHTA 2F9FA 3I5UA 2QM7A 2OQRA 2Z5FA 3ANSA 1UWCA 4R1QA 4DCUA 5HFJA 1Y1RA 1T36B 2ZE7A 2YVQA 3T3NA 3C5VA 1RCFA 4HO1X 5KX5F 4EY4A 1BU5A 2F1OA 1GUYA 3HCDA 4R81A 4R8RA 3GRCA 4BBJA 5CVTA 1ZJWA 1Z7EA 1TCAA 1AM4D 2IYFA 2PZEA 2V03A 4U3JB 3H7AA 3SE0A 5EUBA 4E2XA 2R3SA 2Y9PB 3AIIA 1FB5A 4C5BA 3CTMA 4XI9A 3FN4A 3URKA 4IFBA 3T3OA 2FHSA 3MBKA 3KZNA 1V95A 3NV9A 4P7JA 4TTQA 5HBGA 2BGRA 2PLRA 4Z99A 1W75A 1NJ2A 3WYEA 3NYRA 1XCBA 2O1XA 4F4IA 3ZHQA 1HYQA 4RTRA 1YB7A 4X7PA 2GPWA 1OXSC 1QCZA 1T6XA 1T8TA 3H9UA 4JELA 1XTPA 3RRYA 2V4UA 5KTYA 3H42B 2VWGA 5CPFA 1RMYA 3KT8A 2PGXA 4MJ3A 4E07A 4LGVA 5CLHA 5GOTA 3IPCA 1YDFA 2ZRNA 4J0DA 4M46A 3P9CA 3D4IA 3UMSA 2OGTA 1F3LA 1AT1A 1XLVA 2QORA 2RJ3A 3OM8A 3DT8A 4DMLA 1E6KA 3K5WA 1NJSA 1EK2A 3QX7A 4R05A 3ZD7A 1YQTA 2HSEA 1E92A 4JB0A 3UWKA 3DLCA 2VUHB 1UMKA 2WAYA 1A2BA 1E1RD 2ZATA 4PYOA 4HDSA 3WGNA 4OHMA 1QVZA 3CZRA 3TL2A 4UBJA 4ALMA 2EC5A 3S0JA 2PU5A 5L3SA 4CI9A 4UBOA 1SZPA 4ENUA 1ODIA 3GLUA 3BHJA 3B7WA 3VYWA 4ETMA 1PWZA 1EE1A 4ECAA 3DKVA 6LDHA 1YZVA 1ZR2A 2J07A 1XD8A 3NKVA 3TPFA 1KR5A 3HN6A 1ZOOA 3OOHA 2O6LA 3Q10A 4HWGA 4UUMA 1R66A 2O07A 2PSSA 5GTDA 4O4HA 1GV0A 4DA9A 3MERA 1QV9A 4CCAA 4XEUA 1LPNA 3MCVA 2JIZD 1XGKA 3SIPA 5IULC 4FQ5A 3AW8A 3BXHA 2MYNA 1QG0A 5KPJA 4NH0A 5BR1A 3U0VA 2YZ2A 4FILA 3VR6A 2FSVA 3HXLA 1EVLA 2GZ3A 1CV2A 4II2A 1GQ2A 1P2SA 1XMPA 1Z6YA 2HRRA 3WLLA 2O8DB 3ID6C 3BZUA 2GS9A 3LVQE 3B2EA 3S40A 2AJLI 3IJEB 3AFHA 5HMMA 3RSHA 3AGQA 3BGVA 1ODTC 4J9UE 2QOEA 4TL8A 4BZPA 1K5HA 4TS9A 3AINA 1H6DA 2BM0A 4JH0A 4L5IA 4N3BA 1EM6A 1D4FA 4UPVA 5AJVB 3TMAA 1P9OA 2XUAA 4US0R 4V1CI 1DQZA 3L6BA 1XUOA 2FZ5A 1EA7A 4ZWNA 3DZFA 3LLVA 4N18A 3RUHA 4RMNA 1N2BA 5TQJA 3SBEA 2HV8A 5AKZA 4EG0A 4TYMA 2X23A 1UMBB 1O54A 4UU1A 4ZAFA 3EA4A 3GDGA 2NT3A 1GZ3A 4NU5A 3UTDA 2X6RA 4NVRA 3O26A 4WEQA 3EC1A 4PG6A 1HZJA 2VDJA 3DEAA 2IK8A 2GXSA 4XXHA 1Z7BA 1NVEA 4DYDA 5IAGA 4IDCA 3BKWA 1NBEA 3K7EA 2OC4A 4JJGA 1OTHA 3I9KA 5EIBD 1CZOA 4X8HA 4QXQA 5AK5A 3H5AA 4HB0A 3V4PB 1VE3A 3E5HA 2H63A 3LBFA 3VBEA 4ALJA 3ECSA 3GDFA 4BYMA 2ODTX 5KYTA 5TX7A 3P9RA 2PZAA 2H65A 4G5RA 4M53A 1UBEA 4GPBA 4EHIA 3AERA 3R3YA 4YROA 5JANA 4ZFNA 2NXNA 1ZN2A 3DOFA 1Y3DE 3B1WA 3TVYA 4ZI7F 4HPJB 4MAMA 4WZAA 1G55A 4HMQA 5J4LA 1R7RA 2WYWA 3PD7A 3PNBA 4OP1A 1KDYA 3VR3A 3PNOA 1KH2A 4IRXA 5E1DA 5C5IA 5T3YA 1JJAA 2EBWA 3H97A 4UUPA 4YXFA 3NEYA 2JFOA 4GRDA 5ALIA 3TLMA 2C5LA 4W5OA 5LZ2A 2XQKA 5KI6A 4HEA1 1W8DA 4YJ2F 1DARA 1NNLA 4UHFA 2JLSA 1DRVA 1P18A 4JLNA 4XAQA 1MR3F 4GYWA 3LLCA 1NSFA 2O6HA 4QD3A 3W04A 2DUWA 3T1OA 3RUIA 5CEEA 3JYNA 3OFKA 4IWNA 5I7WA 3F8WA 2CMKA 3QPAA 2VLIA 3MIZA 2Y6UA 3QTLA 3K31A 1CQIB 2UZ0A 2X5KO 2H7YA 2V7GA 3BUSA 1F8UA 4KB5A 3ZUPA 4BMOB 1YFLA 2VSOA 4EECA 1TXGA 1FSZA 3DV0B 2H18A 3DO5A 1T6NA 3NUGA 1AF7A 2I8LA 2XE8A 4MEAA 1N5IA 3ED1A 4G2NA 2ZTLA 1GCAA 3OOJA 4ND8A 4RV9A 3VPHA 1GNQA 4LY6A 2VYND 3ZQ6A 4NI5A 1BGWA 3OETA 5FA8A 1G9TA 3R6WA 4DQDA 1QR6A 3U7IA 4ARVA 3CH6A 3H6HA 4R1MA 4DDUA 4TMTA 5A04A 4IHQA 4H1UA 1PK7A 1AK1A 2ID7A 3TQRA 5IUJC 5B5SA 5E2AA 3DTVB 4WCFB 3OZCA 2BPOA 4R6XA 1J1ZA 4DV3B 1EGQA 5JNWA 1M6EX 1I3NA 5T5QA 4RLFA 3TIFA 3F3SA 1ELOA 1YJXA 4WCVA 1RT9A 2Q29A 3GLGE 3FGNA 4FJ0A 1GJRA 3IHKA 2YXPX 5CT6A 3GX1A 4DTCA 1P62B 4LF6B 3AHFA 1WB9A 3E9YA 3LFTA 4CIBA 5GADl 2OCBA 4C88A 3R23A 4JI0B 2FTKE 3C8ZA 3LW8A 1QH8B 4H15A 4JB2A 5TJ9A 1JNYA 4UNRA 4JL8A 3IQXA 3T0GA 1GG5A 1I5EA 2I3ZA 3EAQA 3IA2A 3RAEC 1W46A 4GP6A 1W34A 2IPMA 5AXCA 1DCTA 4DBLC 1TCUA 1RQ2A 1WEKA 1QK5A 4H3HB 4OQDA 2IH5A 3MRTA 4RX1A 1IUNA 3OZVA 4O08A 3F5QA 5C9ZA 2E48A 4TKMA 2WLSA 4IOLA 3KTAA 1EX7A 4EATA 3AI1A 4JUAA 3KZOA 3AT1A 1MA3A 2PKXA 2QX7A 3EVCA 4R7ZA 5ALOA 4U2GA 1ORDA 4A0GA 3THXA 3GAZA 1E89A 5IJ0A 2CB9A 3PHCA 5DWVA 1D9XA 4C21A 2IEGA 4RAQA 3O4HA 2PL1A 4L08A 4URZR 3A58B 2PKCA 2D1TA 2QYSA 3PU6A 2C4VA 4B4WA 2DOKA 4GEKA 2D59A 4O4JF 1TC1A 2FWAA 1G60A 4GX1A 4Z3DA 3I6IA 1VIAA 1YOBA 1K0FA 2B69A 4LYYA 5CLIA 3QEMA 3RYHA 3WO1A 1GAJA 4DSUA 5A7FA 1A9RA 2EKQA 3E5NA 3QE0A 4GMKA 2C2KA 4AZ3B 3FLEA 4J0CA 4N9WA 1NDQA 1KQFA 5H3LA 4GL2A 1GA4A 1CY0A 5B3KA 1ECGA 2EHDA 4DQXA 4BE9A 1I3LA 1J07A 1M5TA 1Z17A 2BFFB 2XTZA 3PFFA 1OYWA 1C3VA 3N9IA 4ZEOA 1ARZA 5A03A 1MO6A 2QV0A 1GFIA 1EHYA 3QKWA 3KQTA 3ESCA 3G5MA 2NW6A 3PR2B 2M1XA 4CCSA 2QRGA 4OMDA 3OTIA 3GQBB 1JR3E 4OY3A 4QYTA 1E94E 1UK8A 1M0WA 1QUEA 4BKPA 3LHDA 1JLKA 2W2LD 1UKBA 1Z26A 3KLOA 2A35A 2RHMA 3K1AB 3Q98A 1UM8A 2N42A 1KA9H 5K7SA 5AUQA 1X9HA 3HJFA 2NSYA 4BBAA 3S3TA 3UVEA 3PE4A 3ASYA 5C1OA 4J49A 3LA6A 1R0KA 4YAKA 3STXA 3FOFC 4BP3A 2VBGA 3IODA 5E6SA 5D2CA 4V0RA 3B9BA 4FUTA 3OIVA 1UQTA 3I9LA 2YFKA 2WAAA 3BH7A 3IVXA 3LF2A 3IAS6 1GYPA 4QUGA 5FBZA 3F73A 3MJDA 3IP6A 3N28A 3GDOA 2F1HA 3D5QA 3HKBB 3KT3A 2Q4TA 5AXDA 3SC4A 3DGEC 4KAJA 4IXDA 1JILA 2F64A 1YR8A 1IONA 1GL7A 4JJ6A 2GRJA 5BQ3A 1GYQA 2DHDA 1IYZA 3EZXA 1KIMA 1BXKA 3F78A 4PHGA 3B1KA 3V3KA 3H2BA 3HRHA 3U56A 4TQUS 3M33A 5E3IA 4DFDA 4V0QA 1MAAA 5FORA 3SFZA 2NYVA 3WMFA 3DCIA 4AJNA 2CXHA 1HGXA 4JUDX 2BIFA 4G9BA 1YRAA 1AMNA 2VDWA 1B26A 3SHWA 1A9YA 2WUFA 5IM4F 1NXSA 1RRGA 3FGPA 4TMWA 4WA7A 5ECYA 2B4TO 4HNAB 3EIHA 3L9WA 5B30A 3BD6A 3TFWA 3TZLA 1X1EA 1R50A 1NRXA 3FUUA 1RXCA 1XCGB 1AZSC 1XLTA 3DR3A 3JQAB 1CCWA 3W8RA 4Z0TA 4R7GA 2ZP1A 3AJ9A 2CXTA 1JL3A 1VE1A 1HG0A 3EULA 2CMHA 2XKAA 3S81A 1K0UA 1KAHA 4MPJA 4JLMA 4QU9A 1JEJA 2A9VA 2LCFA 4YFYA 3GLRA 3ZV3A 4AVYA 4C0HA 4KR6A 1OX5A 2AG0A 2MSEB 1Y1QA 4RACA 1D4ZA 1R0ZA 4GBJA 5JSZA 4DM3A 4LG1A 1S1MA 4RY2A 2A3RA 3F9IA 3KCNA 4QSHA 2HXYA 3VU3A 5CDUA 4ISCA 4MAAA 3BERA 4XPIB 4EYOA 2BEVB 5TJHA 4I19A 1N5MA 3DTTA 3FTQA 3SIXA 1YO6A 2ZW9A 3S1SA 4LY0A 4HDNA 1W5AA 2DAPA 4YT4A 4DYVA 3COZA 3IJ5A 3MA0A 3AY0A 3PQ5A 1NQTA 4HD8A 2EF1A 1T25A 2ZJBA 3P9QA 3BVPA 5EZYA 2BGGA 3VDMA 3MWYW 1CEYA 1YE3A 1IUOA 3LQ1A 5AOBA 1HK7A 1M2GA 1Y8RB 3ZZUA 1NX9A 3IRVA 2Q9AA 2KSQA 2PRZA 3MS7A 2FWRA 2W58A 4ZOLB 3FHOA 3GGPA 4JJEA 4QOIA 4COOA 1H3FA 2RHJA 1Y5RA 1TTPB 3IEPA 1KSHA 4KR9A 4B2PA 4FZ5A 4J16A 1RPTA 4OIMA 4QNNA 4YJFB 3MWFA 1KEEA 4PSVA 5JSFA 1JE0A 2RGAA 2AA3A 1YRBA 3EGOA 2IHJA 4WINA 5AR1A 2EOAA 2EBFX 4FHCA 2C7VA 4XIIA 2OVFA 3A4MA 1UP7A 3L43A 3RRJA 2GASA 2G4LA 2GEUA 2LRHA 2WG1A 4YCNA 5CFMA 2A59A 3ANYB 3PNQA 1Z62A 4GSLA 4YXWA 3VBCA 2NO6A 4AKHA 2PZBA 3VGJA 2Z6VA 2VL7A 3OEEA 3FJYA 4G85A 4LYEA 4NPHA 4PR3A 1XVTA 2F3QA 1YBFA 2QUHA 3AXTA 1U11A 4HRYA 2ZG6A 1DKLA 3LK6A 3ZIUA 4FK8A 4RDIA 1EUDA 2XMQA 4V0NA 1N78A 1KXJA 4OKIA 2BMVA 1BWPA 2LGJA 3MS2A 4J0IA 4KXYA 4Y6PA 5CXQA 3HCEA 2Q3BA 2R5FA 3DAOA 4JVLA 4F4CA 5HF6A 2FG6C 4LFAB 3Q2OA 3B2NA 1FTWA 1N2CE 1OV4A 5IPFA 3RVSA 3U1VA 1F4PA 3A2MA 4QWMA 3OZRA 4LHZA 3AB8A 3FIUA 1LFDB 3E15A 4G9EA 3FCXA 4B6SA 5TIIA 2KX7A 5JADA 4RZUA 3U1BA 4XQGA 2PYZA 2FCAA 1K66A 2W2XA 2X0EA 3T5MA 1KAGA 2CNWD 4CR8A 4BMNA 1TUEA 1X7GA 1EIWA 3ZV4A 2R8YA 2YMLA 4D92A 1PT6A 3HMKA 3RFVA 3SXPA 2JKYA 3LXMA 1FJHA 2UZ4A 2H4FA 5HRAA 2BLNA 1QG4A 3D7RA 2GPAA 4HUQB 2XTNA 2AFIE 3FTPA 4KPGA 2P7IA 3IQWA 5HP4A 1OH8A 4D79A 3MT9A 1EFCA 2Q2VA 1G3MA 1A7UA 1V41E 2UZIR 3RBZA 2P9YA 3RT9A 2ZXUA 1MZPA 3AEUB 2PSJA 5C5EA 1EWVA 1AO0A 2XYQA 3MZ0A 1Q3HA 1W29A 1DADA 3GZNB 4LZNA 1K6XA 1KMMA 3N2LA 4L02A 1S01A 1VJGA 4BFUA 5EXEA 2BBWA 1HLPA 3DVLA 2POQX 3LDGA 4H3KB 5DW3A 1FA9A 4CTJA 4YP0A 4RMJA 3D8TA 2QTLA 4LXIA 4RMHA 4D4IA 2O50A 3PXBA 2WIFA 5LPNA 3AI7A 2YDXA 4AO7A 4B6PA 3OMXA 5BRNA 1JX6A 3FWNA 1QYCA 2BFWA 2FR1A 4FCTA 5A05A 1NBWB 3HPQA 4A0RA 4MWSA 4FKZA 4IUDS 3R75A 4J94A 2VA8A 2ZRAA 4HAIA 4XB2A 5D7NA 7MHTA 1TK2A 1W87A 2GFQA 5EFOA 4HZUA 4NE7A 2VHVA 3SJ7A 4OLAA 3G6KA 2XKJE 5JRJA 1C29B 3LL7A 1MQ8B 2P9QA 4XX0A 5KYVA 1G7RA 3E8MA 4MPDA 1JJBA 3DL7A 3PJEA 4N03A 2O0LA 4F46A 5EWLB 3TUJC 5A9SB 4ZQFA 3RAGA 5DSZA 1U3FA 1S8OA 1ATZA 5ALQA 5FJJA 5K8JB 1N1MA 1ZICA 4MS3B 3T7AA 2Q3MA 1KOGA 3M2TA 4M9XA 3CVVA 3O3NB 1NT2A 1Z16A 3C1OA 1FP4A 4AF8A 1V39A 1R8JA 5B7PA 3LCVB 4L6CA 3JYPA 3PLNA 3KKEA 1DDGA 1V16B 4H31A 5ESRA 1IEXA 1SKYE 4ZN6A 3IIJA 4RDXA 1N9GB 3CLHA 2VT3A 3N86A 5TXGA 2AFRA 1NG9A 3UJBA 1DKUA 2COUA 3E1GA 3L6EA 2ALJA 5CBPB 4RD2A 3N5KA 5BN5B 3CVYA 1ZUHA 1JIJA 3A25A 4IDDA 3ZD9A 1I4LD 3LQ4A 1P1BA 5JDIC 3PHJA 5LYJB 3V4SA 3A1NA 4HCJA 4MW0A 4OXNA 3HCFA 3WSWA 1ZW1A 2PM8A 1P0CA 3GG2A 3ROKA 4WX2B 2XGGA 1IZ8A 2QYTA 3I9V6 3PSAA 4I0WB 2WTAA 1YR1A 3HMQA 4ARIA 2ZJ2A 4JWKA 1FW8A 3R77A 5FCDA 1AXRA 3CX4A 1YI0A 4R2LA 5CT5A 4DILA 3IAHA 1HE8B 3RC8A 1YRLA 2NV6A 3QUCA 4NMHA 4BP1A 2H1IA 3HZZA 5SZIA 8MHTA 2BEWA 4FT2A 4FYXA 4W8GA 4CCYA 1O7JA 3SZGA 3NJ4A 1LJ8A 1NASA 2I1VB 3GLQA 2O2ZA 4JI1B 3PQ2A 3JQDA 3PL5A 4K7JA 3C6MA 3BF8A 4FN4A 5CIQA 4QGBA 3S1AA 3A1CA 1GM5A 4A27A 4RF4A 5KDOA 2P62A 4FOLA 1I30A 4Y6QA 1W2HA 2WE8A 3JQ7A 1K6MA 3QWAA 2CJXA 1JEYA 1NW9B 1ODCA 1G1AA 4EBBA 4IDOA 4U9UA 1E9VA 3DO8A 1CXZA 3DHYA 4Q7LA 4YAWA 4LAFA 4PPGA 3NLLA 3HACA 4F06A 2I91A 2B6NA 2J87A 1OXMA 1Z38A 5LQMA 3DFZA 3NBAA 3NWPA 1NMEA 4U0JA 1ANKA 5C4IA 4U2FA 3T7SA 3TECE 3D5TA 3ISVA 1KYTA 2JCGA 4JDPA 4OJKA 2CC2A 5FL7A 3TLGA 1VDMA 5HILA 1PR6A 2WTMA 4GLFA 2GAOA 1M75A 1NLZA 1XU9A 1PBTA 2GZRA 3BWVA 3DNMA 3E6AA 4PNPA 5E4YA 4CTOA 3RHFA 3CIFA 3T99A 4QFBA 4S2UA 5J2UA 1H66A 3KU1A 4WLNA 4GECA 3DOJA 4ED9A 2JFXA 4LOIA 5DMHA 1F4LA 2VHTA 1YCDA 1LSUA 4G8JA 3N8KA 2C2OA 3Q6NA 4OBWA 4BVFA 4KN9S 2G5CA 3R9XA 4XQEA 8ATCA 1BTOA 4B6EA 2PNFA 4HLQB 4AMVA 4YAGA 5H83A 2NZVG 3FY4A 1EFRD 3L18A 2DJIA 3PJDA 1GDTA 1L8QA 2C59A 3MK31 1VBNA 4CQLA 3EBLA 1KSGA 1GYRA 3HCAA 3PR3A 2K5UA 1QGOA 3EBPA 2HJVA 2RFLA 1QZUA 4R0VA 5FRDA 3WMXA 2B1QA 1ZJJA 3K8QA 2P4QA 1Q50A 4W9NA 1TZKA 3GYGA 4C6HA 2B1IA 1GTVA 6REQB 1TQ4A 2JI4A 1X3LA 1YQGA 3D6UA 3IB6A 4QDZA 5TPWB 1VPLA 5E6UB 3QXSA 3AEKA 4KTVE 3UHJA 1U3CA 3M4YA 4AY2A 1VPVA 1YBAA 3LW7A 4NRDA 2IXDA 1J09A 2IYAA 2VXOA 4MW7A 3KKNA 3CA8A 5CNKA 1LRLA 3EXHB 3IVRA 3OT1A 4DIKA 3KUDA 1XZHA 3DDNA 1XTTA 4N5HX 4N3AA 5LCXA 2ZK7A 1VKHA 4X1IB 3G7NA 4FE3A 2VRCA 4G36A 1UFOA 3QJGA 4FE4A 4M88A 5EMMA 2PRYA 3PUYA 5ARDA 1YU9A 5JISA 1BZYA 4RVOA 2OHGA 4RWZA 1EHCA 3G2LA 2AZ4A 2A1UA 2BSAA 1AZWA 1L4KA 2V6IA 3TEJA 1A95A 1ZC4A 4RK7A 5F2KA 3CO5A 1OWOA 4OQXA 1H23A 3JVDA 3GBVA 4LYHA 3I37X 3OE5A 2Z5LA 3HKDB 4URYR 4CMBA 4HR7A 2NVBA 3BL6A 1J7JA 4ZT7A 2XUGA 4C0XA 4Z8XA 1MABA 5LUBA 1C9JA 3AJEA 4IRUB 5JH7B 1I1NA 4G5HA 1R3UA 1COWD 3BCRA 4IINA 4DADA 4ENPA 4DREA 4JQOA 4HN9A 3HP1A 4H6VA 3VR2D 5EE3A 3ESRA 3P7MA 1DC5A 1I2AA 1FP6A 1IBSA 1Z0IA 2ZYVX 5KIAA 1XCJA 1R2QA 2AJBA 4JVMA 3BIOA 5B1SA 1DX6A 3KQVA 4DCNA 3BMNA 5CU7A 4BGIA 3B6KA 1FVOA 5FLXA 4CKWA 5L7TA 1H4SA 2B3TA 2VUTA 4HAOA 3OZ7A 1U8YA 2BGTA 4K26A 4W5RA 2QY9A 4YAOA 3ND5A 3E3LA 3NNNA 3V9AA 4BVGA 3T3DA 3X1WA 4KGDA 1CVLA 1L4EA 1NRJB 5FPSA 4Z7QB 5SY9A 2WT9A 2H11A 3RLIA 4QFDA 3L6RA 1JLMA 3C7TA 3LP5A 1TF2A 2PO7A 5LL6P 4Y6RA 4BC0A 4OB6A 1ZUIA 1EVKA 2B20A 1EWKA 1Q1BA 2BE9A 1UBSB 2GN8A 1M76A 5KNLA 3TBFA 1V3UA 4U6NA 1GT91 4D46A 1M34A 3IPYA 1OKKD 2ZT7A 2ZWOA 3BBLA 3FPJA 1RMQA 3WJ1A 3I9NA 4PQYA 4A8PA 3V8BA 4UC0A 2QAIA 2QAGB 1BDMA 1TF5A 4GIBA 5FTNA 5B3JC 3H99A 2BFPA 3KVNA 4A5SA 1E61A 1L5VA 5IBCA 3TTXA 1NE7A 3PITA 1I3CA 3QU7A 1T6BY 2ZAOA 1HKUA 4C43A 5A5EA 4Y1RB 4ITUA 4M98A 5ISMA 4DIUA 1R8YA 5T3UA 4ZYTA 1RYYA 2ZS9A 2JFZA 4ENVA 1KYXA 1LSJA 1ZD5A 1N3LA 1PLJA 3A3YA 2ZYWX 4LSMA 5DLEA 1ISPA 2AG1A 3R09A 5DP1A 5LP6C 4CUJA 1FSPA 3H2KA 2VQDA 3QZUA 3ZDYB 1GGFA 3BWMA 4EG8A 4S12A 1MEEA 4XQCA 1Y6ZA 4PZ9A 1YDWA 2J3HA 5SZKB 1YDEA 1I80A 1HE4A 3LWNA 4XYLA 3WBBA 5KYKA 3UBTA 1AKNA 1KRWA 4LFCB 3L7LA 2FPRA 1LZKA 1Z2AA 2SBTA 2XCQA 1YJQA 3O1JC 3BCHA 4I6JA 1H4QA 4XWKA 1PUIA 3KM0A 4KK4A 4ZGWA 2NM0A 2COEA 1Z4NA 1UADA 1ORIA 1GRRA 1Q77A 2GR9A 1I9CA 2H7CA 1GEGA 2QTFA 2HDHA 3C45A 3DR5A 1G8JA 3DT9A 3ICCA 3IMCA 2I4IA 3ZDEA 3W5BA 3KQQA 5G1OA 3UENA 4Z1MD 2P5YA 2VBFA 3UG7A 3WE7A 1V6AA 4WN9B 2HPVA 1G9XA 2C88A 2ZRDA 3RRXA 5IEJA 2PUDA 4J07A 2OHOA 3HGQA 1FVXA 3UATA 7ADHA 3HV0A 1Y98A 3LY8A 5GPBA 3ILYA 4MJLA 2KPOA 1P60A 2O23A 3ENKA 3UH0A 5BV1A 5KEIA 1ILWA 1T5TA 1H2RS 2FN9A 4OAPA 3ZLUA 2DHQA 1MF7A 4B3DA 3QFFA 1GAXA 2KBEA 3WR5A 4GYYA 4GVPA 2ISCA 1NQWA 3V2UA 3DGFC 2FPGB 1OROA 3RTAA 4AKSA 4JJ4A 3DDZX 2OHVA 5IJWA 4EP1A 3DE1X 1YZTA 1U0FA 3V7YA 1NNI1 4Q3EA 4ZRNA 4EM6A 5K6AA 3ICQB 1TJ3A 4B2IA 3VYSB 1Z6PA 2Q2QA 2K4MA 3JPWA 3WJ2A 1GUAA 3L7JA 2E87A 3VPAA 3ZNQA 3JQPA 3HDGA 1U2RA 2ZLBA 2PAFA 4HYEA 2GLXA 1T43A 1BQ3A 4HB2A 3NIFB 1EWTA 1GTMA 4CF4A 3W5HA 2C4WA 4HDMA 2RGDA 4M8LA 3RYIB 5FI0B 4FONA 5BNIA 4NS1A 2ZJAA 1Z33A 3NATA 4W6QA 4WWHA 2Q7DA 5KNDH 4N8SA 1LF5A 1JKXA 1KS9A 3GH3A 5EGNA 2ZIAA 2W6QA 2QTVB 5HCIA 3SSOA 3NYWA 1PR2A 3MMZA 3QPDA 5IP5A 2Y2UA 1F4VA 1AO3A 2JW5A 4YJHA 2XQVA 5EHXA 3CRMA 2WM8A 3FZGA 4YLEA 4YUVA 3P2JA 4X62B 4EO4A 3EQ7A 1Z45A 5DN6A 1YZUA 4WJZA 2R00C 1D1TA 1PO7A 1H65A 3N8NA 1DEOA 2BTQA 3DFKA 2NU6B 4M1KA 3QVGB 4EQ6A 1CEXA 2DFTA 1ZR4A 2WA2A 2ZE5A 4LJRA 3MGBA 1SCKA 2G7ZA 3RC9A 2ZFUA 3DONA 1QGUA 2OG1A 3BWBA 3EWNA 3I0MA 4Y9TA 2D5CA 4ZAZA 2DGDA 3L4JA 1MLDA 1ZM4A 2C2XA 4KPUA 1OVMA 3KFVA 5BR7A 2HA6A 3ETJA 5H02A 4CJXA 4ZHQF 4OYRA 3TAHA 2WHPA 3TSAA 1EDBA 3W79A 1FC0A 2CFIA 1TAQA 1ZI9A 1REQA 3HUEA 2PX4A 3OP4A 1OV6A 3RJMA 1NUPA 4IIGA 1UP4A 2Y1WA 1ZEMA 3A1TA 4L85A 4PWZA 1EE9A 1RHKA 4HDOB 4CL3A 3MG9A 4UMDA 2DCMA 5CTAA 1Z06A 1XU7A 2ISQA 4F72A 3IQIX 1UEIA 2BDUA 1WAMA 3PWTA 1BS1A 2NU7A 3CX7A 2EL9A 5I4CA 2OOSA 2AX3A 3QU4A 1N92A 4RSRA 2FEMA 3VVBA 5EL0A 3GEGA 5CXXA 4IO0A 1G8MA 1U1GA 2CEAA 2UUPA 5MF6A 1DC4A 3I4LA 1XV5A 2UYCA 4GX0A 1G8KA 5C4MA 3LDAA 1UBOS 1SUPA 2V0NA 3KCQA 4CLXA 5TQ2A 4B3MB 3X1XA 4DR3B 2ZITA 4TZ0A 5LA6F 2RH9B 1KO7A 2IY9A 4B8WA 1IIBA 1QG6A 2YFQA 5ANRB 4RIGA 3QV1A 4NC9A 5CDGA 2O2HA 1JEEA 2DYKA 1JRLA 4D02A 2G80A 1VMAA 4RADA 1D8TA 3IO5A 1H6BA 1KF0A 1V8DA 2R1VB 2J5RA 4MZXA 1YQQA 1R0XA 1U4NA 2V65A 3D2AA 3D6MA 4HWKA 421PA 4D9GA 1GTRA 1C4WA 1QHHA 2COKA 3LBNA 7GPBA 2OY0A 4WKBA 1B3RA 1JAXA 3IUSA 3ON5A 1H9CA 3AU9A 4PGAA 5EQDA 5C7OO 5IKXA 4PPFA 5KB3A 2W4IA 5TQ0B 3RYCA 5JARA 3D3JA 1NQUA 1T5LA 4PGGA 5AK3A 2ZJOA 4UNSA 3RLFA 2F55A 4U7PB 4ZI3A 5HM8A 1ZRSA 2FZKA 2GMWA 1R0WA 1GL9B 2IZOA 2ZIWB 3D2LA 3HFSA 3HGMA 2EGUA 1QP8A 4MVJA 1LLQA 1GZ7A 3IKMB 3K6SB 1RRFA 3RGGA 1UH5A 1AB6A 1CUUA 2CF6A 3R7LA 4G5OA 4HB4A 1XC7A 1P3DA 1SU7A 3EUEA 4UM9D 2RIRA 4K9RA 2JFUA 1X80B 4CDGA 1SVNA 1ZM3A 1TA0A 1DIHA 2E6UX 2WF7A 2XNHA 4IG9A 4HNGA 4DM4A 2OILA 5DOVA 1L4NA 3IO3A 3OX4A 2W8BA 1JKJA 5EP3A 4N0PA 4NPAA 4PPNA 5EZSA 3VVCA 4B45A 3U7QA 1GG8A 3K0CC 2VJMB 5DHFA 4IZ6A 4KQIA 3VR6D 4EB6B 2CLKB 3NHBA 4PEVA 3IXQA 3SP1A 2HA4A 2WA1A 3ZHVA 3WO0A 3TOXA 6NULA 9GPBA 1NSTA 1DZ3A 1VI6A 1UBLS 4TV9B 1UJ5A 1F2UA 4RCVA 5B6PA 4P4LA 4X0EA 2GESA 4BJ3A 3CXRA 4JSRA 4YA6A 4LFBB 4YS6A 3D6HA 2R7AA 2EFCB 2O2IA 1IM5A 2GJ8A 2V7UA 2OLEA 1OB2A 1GV1A 1WDKA 4NFLA 1RAGA 2ERXA 4HNRA 3T1VA 4CM9A 4OA8A 4KRYA 2SICE 3P9SA 4AWBA 2XV1A 3KQLA 2XYPA 3ILVA 3FNRA 4HDKA 2J3LA 2AX4A 4H59A 5EHGA 3PGLA 2FMFA 3RBVA 3GEDA 3EXFA 2E82A 5JCJA 4TV9F 4RW0A 4GMDA 3IL2A 2FWBA 2D7DA 4GFDA 1QAMA 4R69A 1ODJA 2HUPA 1KQOA 4D80A 1ISMA 5CLJA 4RO0A 1GR1A 1S3SA 1KPIA 4GUAA 5EJ4A 1J9GA 4GS5A 4WK2B 3A1FA 1MQSA 4PC3A 1M33A 1MC8A 1D2EA 3DZIA 1GRNA 3OX1A 2QRKA 1UDAA 4I1YA 3BFPA 4RE6A 5DTMA 1JT9A 1K8ZB 1Z0SA 3VR5H 2X5JO 1JHQA 1K2VN 1VSTA 1P9NA 2YV1A 1L4BA 1OI4A 2V7VA 4EMUA 3WDMA 2X2OA 2JARA 2HRCA 1KYYA 1L4LA 4F92B 2RHTA 4LYFA 5EHQA 2E21A 4LRYA 3UEOA 3OQIA 3QMPA 3L0IB 2ZRHA 1QX4A 1M9NA 5C1IA 2OHXA 3FFXA 3ICWA 2HFJA 3AYXB 3KKKA 4MW6A 4NBRA 3EVBA 5K01A 5JS1A 1MOSA 2E49A 1IHPA 1VJDA 1VCNA 2BI7A 2ZUWA 1YL6A 5JAPA 2FEOA 3N8HA 4RYDA 4A8HA 3PXCX 1RTKA 1ZI8A 3RROA 2NUAB 5IS2A 1CUYA 3T5TA 3B1YA 3I05A 1BHO1 2CD9A 5CNJA 1WCV1 3ELWA 1KSJA 2IY7A 3CZ5A 4UCXA 4ZI2A 2GI4A 2V55B 3CKLA 5LQJA 1FX0B 4YMUA 5AH0A 2Q5LA 3RCBA 1BMTA 3THRA 1ZZEA 5EJ7A 3LDUA 4X1YB 3ZQ4A 2ONKA 1YGPA 2OZVA 2JA1A 3U0BA 3FCEA 4PHHA 2OT3B 3IJRA 5ER6A 1E4EA 4AI6A 2QZ4A 4EW1A 1F06A 2BMEA 2WFLA 3WIUA 4EHLA 3PEFA 3ENVA 3TRJA 4WOKA 1E2QA 4O3FA 4MUNA 3LHIA 4IX9A 4L6AA 2ZREA 5F5NA 5GINE 1CU1A 4BU0A 2FQXA 3H7IA 4LNAA 4UM7A 3HVHA 1WLYA 2AQKA 4IGIA 2X7HA 4PFJA 2VP5A 4IIJA 3IE2A 1DGQA 2X15A 5BQFA 1SC4A 4F9FA 1PGOA 5DYGA 1I4TD 1SA0B 3PCRB 1IJEA 2O5EA 2PSFA 4OI0A 4JOQA 4GPZA 1ULSA 1F5SA 3DFUA 1HMPA 3HJTA 5ECGC 4DY4A 2IHNA 3UOWA 1I4DD 5EOVA 1YZQA 3PGJA 4UHDA 1E1MA 1T4GA 3C1TA 4E2ZA 5JCXA 4TKUA 5KOHB 5FA6A 3EFOB 4P0PB 5E0OA 2RE8A 3M34A 3OLVA 4MR9B 1VSVA 4BQEA 4CETA 3CZ9A 1J21A 1D04A 2EEPA 1TZCA 5C80A 4M0PA 2P2GA 2TYSB 1OFVA 4LBVA 1WP9A 5MDHA 1UBKS 4EELA 1PS0A 1TRKA 2X0JA 3GA5A 4HQKA 1FDSA 3QPBA 4MSUA 2RK6A 3G0IA 2Y1OA 4F21A 2IYQA 5I01A 4OQQA 4NONA 3R8FA 1FVFA 4CEHA 2VOEA 4J76A 2W42A 4KR7A 3KB6A 1S2DA 1V4BA 3B7PA 3F2VA 4LVNA 3V80A 1GPAA 3C6KA 3R5HA 4WI1A 5ECWA 1DAFA 1SBZA 3JATB 1HT2E 4IVNA 1FLNA 2GTHA 4JUBA 1PCXA 4YK7A 1NN5A 4DRYA 4XIFA 1PZMA 3PXUA 2I55A 1X8JA 4HMOA 1JEDA 2XTMA 4QU8A 4PZEA 5J47A 4R83A 1KH1A 1YOVA 1VRVA 3M4JA 3ZDQA 4ZDJA 3N8GA 2OMKA 4LMRA 5EPOA 1X14A 3B85A 2CV1A 3WL6A 2J0QA 1YI1A 1ZJ5A 1DCFA 4C0LA 3H5OA 4OYYA 3N75A 3B53X 1N0HA 1THTA 2GZMA 3PDIA 4JOCA 4XGRA 3UUFA 4ENTA 5F98A 3L7YA 4MWEA 3HNRA 5FTKA 5JNVA 3CNEA 1CQJB 4L9WA 3W6OA 5AUNB 2H8KA 1FYDA 3IAFA 4FFVA 3VHXB 2QN2A 4OREX 1HNZB 2AWOA 3AESB 4YWJA 4QJBA 2HZ7A 1Q11A 4FJ1A 3LKVA 5DTEA 1PR9A 1RYEA 4WUTA 1RJGA 3ISTA 4HAUA 3WAJA 1ZISA 5I7HA 3TW6A 3WQRA 1Z0DA 2OV1A 2NAPA 1JECA 2GCPA 2WV7A 2PMBA 2EFGA 3KYCB 4N4AA 2BKLA 4PLYA 1RP7A 4JBXA 4INPA 2IH4A 3VKFA 4GLLA 4RK0A 5H5JA 2O8FB 1VYTA 4HFRA 3NX4A 3COJA 5GZ3A 1ZK0A 1J0XO 4K9KA 4Z9AA 1SVWA 2E37A 2BGNA 1M72A 3CE9A 2GBLC 2H1LA 4M54A 4RHFA 4W5WA 4BUJA 4C4AA 1U63A 3OO1A 4J3FA 1SOAA 3ZLJA 2ECKA 2XZPA 1WTAA 2VP6A 1I2CA 1FUUA 3EFHA 3GT3A 3O8QB 5KTRA 4DEYA 3LD9A 3N2GB 4LNHA 2VWHA 4KZPA 4ZO6A 3ZE1B 2YVKA 2OCIA 1FP7A 1QYIA 5KCMA 5GQSA 2PPVA 1IC6A 3TZCA 5EXTA 3WL5A 4ARZA 1O8CA 2VDPB 5KYNA 4DNXA 1JEAA 4J1SA 4B84A 4AUMA 1ZGJA 1CTQA 1TT7A 3O8OB 4OL9A 1V5EA 4XVCA 3JD4A 2NZ8A 2AQ8A 5J40A 1XEFA 4O0LA 3TTYA 1V7CA 4RH0A 5HDBB 2BBTA 2OXRA 4TROA 4MYCA 1F48A 3WDSA 1T3HA 2WAXA 3ECCA 4YMGA 1SC1A 3TZ6A 4IUCS 4QBKA 4C3VA 4DJFC 1Q0PA 3DF7A 1U4OA 1Y9JA 2OPHA 1GARA 1M2FA 2JH8A 4HQOA 1GA6A 4TKVA 7YASA 1KI9A 1NY6A 1E3TA 3U39A 2X0RA 3Q88A 3M8KA 4X45A 5DBGA 4YI3A 2AFVA 2PS9A 4MQFB 1PX2A 3TRKA 5CB4B 2JLZA 3KHUA 3EGDB 3MRXA 2R7LA 3PT5A 2WUEA 2WMNB 1IQPA 2YWCA 1HE1C 2CCKA 1I9GA 4CNBA 2Z08A 1AXGA 1T9CA 4TGLA 1J9ZA 5AKGA 2WWXA 1P72A 1W76A 1ZO8A 3QNUA 1RLIA 4FP9A 4YQFA 4GGPA 3NG1A 3WB2A 2G1UA 2JCXA 1GU0A 1WD5A 3UGKA 2C58A 4XD2A 3PFWO 3JQ9C 5JC8A 2SKEA 1P5ZB 1E2PA 4BVBA 3R1IA 4DJAA 1U0BB 5CFLA 4R98A 4TVBA 2HSJA 4KDEA 4KN6A 3OTGA 3I04M 3NEPX 3OCUA 4UQPA 4N65A 2CWDA 3NUZA 4EB3A 1RJWA 3AZPA 1A76A 2F1RA 1SXGA 4F71A 4QUBA 4KE6A 3KTFA 4JT4A 4Z9XA 4C6TB 1RWOA 2XDWA 3KWLA 1TL7C 1CUXA 1ZN7A 2AUMA 3HUTA 2XCRB 3FOCA 2Q6LA 3LPCA 3WY9A 3O2NA 1SBQA 4IXWA 1XZ8A 2Q1UA 3LQ2A 2YZMA 4NBSA 2IHUA 3ZY3A 3CONA 2AZTA 5FQOA 4J0FA 4MVYA 5D8DA 2YV4A 2WYUA 5K0FA 3JVUA 1V4NA 3E84A 4E5SA 2AWNA 2HU8A 3DD5A 1KFEB 2JD2A 3MTEA 1AZTA 3NANA 5AMXA 5MHTA 2YWXA 5CIYA 1ZBQA 1U99A 5ALDA 3ZHTA 2JBAA 5E95A 4A8JB 1VA5A 1AA9A 3BILA 5A5DA 2RHOA 2R6FA 3BA6A 3L8FA 3BL5A 3DSRA 2JH9A 3FWZA 5EE1A 2VDKB 1JYFA 4BV9A 1ZVVA 3RVRA 2WTXA 5HJ7A 3O2JA 1CW2B 2HGSA 4JX9A 4U7TB 1TGVA 4BLRA 5DNEA 1MOPA 2IYXA 3MGKA 2QD2A 2YIMA 4B3GA 1ESZA 3I9JA 3OA2A 3RUDA 1C3XA 4DWWA 3AKZA 2RHWA 3NRBA 3F5DA 3N0TA 4ZCQA 4MDYA 5ALMA 3HLKA 3R7SA 2JCYA 2L0XA 2WG2A 3LRXA 1Z28A 1EEHA 2GEBA 3EXEA 3AVWA 4V0KA 3C43A 4YHHB 2D3TA 1S2NA 2JEOA 1GKKA 3AONB 4YJGB 3UJ3X 3ZCVA 4CVNA 4DR4B 3S2UA 4BQPA 3FNBA 3DBHA 1KI4A 3NI2A 4WZBA 1PGNA 2BISA 4DZRA 5JAIA 4YXWD 2C20A 4R3WA 2TRSB 1PV1A 5GJCA 5LU8A 4K9MA 4DDMA 3GRZA 3FPBA 3OEED 3O31A 1JFFA 2CXRA 1OZFA 4G8BA 3HI4A 3ET5A 4EGQA 2YWFA 4EKNB 1M1NA 5EFZA 1EQAA 1P5FA 1Q3KA 4K9NA 1GGJA 1U31A 2QUJA 1ZC3A 1ZKDA 3ZHBA 3EIXA 1KYZA 2GILA 1OBHA 1LNQA 5B53A 1C3OA 3IT3A 1VDZA 1ETHA 3CR7A 2CV0A 3B82A 2J5XA 4JQSA 1JVNA 1MB9A 1PNTA 4Q1CA 4HX2A 5LBUA 3H2HA 4FDLA 4YUXA 1NUTA 3MGCA 3I1YA 4KGZA 1CR0A 1LSSA 3JWGA 4QNMA 3WIDA 2MCFA 1KMIY 1ZQ1A 4LWOA 4WLEA 1UBFA 2QKYA 2PLNA 1JIIA 1ADCA 3BWEA 4G1EB 5TT1A 2PRSA 2QLLA 1MB3A 3AKCA 1E7RA 4LYJA 4LWPA 3V7FA 1T5HX 1QS0A 1F2TA 1J1UA 5IF3A 3EF3A 1R5BA 2QIOA 4XVRA 1J25A 3AG5A 1TKAA 3ZI4A 4HVLA 2EWMA 1NHGA 4FSXA 3B1XA 1IRIA 3EISA 3QENA 1HTTA 1Z4OA 2J0UA 4PO8A 3FPCA 5KUTA 4C0SA 5I7VA 2YWRA 3K05A 3HZOA 2MR6A 5EZQA 3G68A 3TWOA 3ZHZA 1DSSG 5E9QA 4ERXA 2DETA 1RQNA 1ADYA 3CH4B 1E5LA 2OB2A 1ENOA 3SS7X 3OQBA 3R0QA 2JEZA 3ROTA 3RTGA 3J81A 4Y1FA 4GMXA 4R2HA 2EQ5A 3KOZA 3SG0A 8GPBA 1VL6A 3DMFA 1SHZA 5CHYA 2XRMA 5COQA 2FPPA 4K5QA 4Q01A 4QVIA 1QPZA 4Z49A 2CLFB 1GSOA 1OLSA 2CWWA 4FI3C 4ZZ0A 5LLDA 4PSDA 5C4GB 3TXYA 4DLVA 3OM1A 4UUBA 1P39A 1ZW6A 3JALB 4AKTA 2Q41A 3I12A 4EVRA 4F0JA 2O3TA 2GFHA 2DR3A 5ALUA 4Z3OA 1W52X 1XRRA 3ACCA 4RGBA 5A62A 5DM60 1Q0TA 1IY8A 4OGLA 1KOFA 3BQMB 3CLUC 4RFVA 1EM8B 4BFLA 2REOA 5F3WB 2Q5IA 3A2LA 4Y9SA 1UKZA 4MICA 4FINA 2HO4A 1N7JA 1X8KA 3LT1A 5CX1B 3WL7A 3JQEA 4RL4A 4D96A 2VK8A 4AQDA 1BE8A 1U9IA 4OHWA 4BNHA 3QE3A 4DV1B 1IBKB 4RTSA 3O21A 5I7UA 1BHJA 4I8DA 4ZO7A 1KVQA 2JLAA 3TQOA 2P6OA 3DP9A 4Q9JA 3I3OA 5TS2A 4KLCA 2OHHA 1ZNZA 2PGNA 5CH5A 1G21A 4X1KA 3I61A 4F2GA 1UBCA 3PFKA 2OD7A 3ENWA 4IEEA 2X1LA 4TZTA 2QUAA 1QTNA 2PH5A 1XQ6A 4L3WA 4IIBA 4D3YA 4OIFA 1O87A 1Z74A 4JAVC 3GJ3A 1SXJC 2DUMA 1CY4A 1QUFA 2YYZA 1QVVA 5DJ5A 3ZLTA 1BA2A 2O54A 4C4RA 1AU9A 3VH3A 4ALNA 3ZDBA 3MJHA 4FGWA 4NDNE 3VHQA 4PCAA 3FD8A 5H0IA 2YZKA 1TNDA 3FAZA 1LTQA 1JAYA 2WB4A 5EC8A 4TYYA 4F3TA 4FXPA 4MIKA 1OZAA 1JHMA 4HAZA 1Z39A 2VYFA 4S1VA 2NP6A 4MV6A 2FZVA 1WSAA 4MV4A 4LZOA 4IHJF 4M8NE 5FEMA 4A2QA 2BF7A 1FMCA 4G23A 2UVDA 2A5DA 4OQPA 3ZE9A 1G18A 3M4XA 4UMFA 2O14A 2H9YA 3RUPA 3WWYA 1H9AA 1XF1A 1XCMA 4MP8A 5SYNA 4B2YA 2IXAA 3BSFA 1RM3A 5B1IA 1AV6A 4PFKA 1JXAA 2ZSHA 2YH2A 3PICA 5HHTA 3ZLVA 4LSGA 4XM0A 3CVWA 5EMJA 2IYNA 1BYIA 1TPZA 1BFKA 2H2DA 4GLOA 4UEKA 2ILVA 3ZHXA 1GA1A 4ZEXA 2IYOA 2G09A 2P0AA 3T3PB 3WTBA 3G1UA 4BV2A 3AY3A 3GBSA 5CFPA 1Y3IA 3MS4A 3UMJA 2EKZA 2ZAYA 4MWGA 1WZUA 2F3UA 1KI6B 2ZJYA 3KBOA 4PIVA 1IZYA 4ZVNA 2NTNA 4L5YA 4XZ3A 2CLSA 3OLYA 2LNDA 5T6BA 5CYPA 2JCVA 3C48A 3JY6A 1U6IA 5IT4A 2V3WA 3EA5A 1FXWA 4IF6A 10MHA 2GAAA 3A9UA 1DJPA 3M70A 4EVSA 1HORA 5L7YA 2H2IA 4E5KA 3LCRA 5J1SB 1M2HA 4OB7A 1K1EA 1BW9A 1NBAA 4W4TA 3SZ3A 3T9CA 4DMGA 1N8TA 3VVMA 4R1UA 3FWYA 1GUZA 1QNFA 2O2XA 2GPSA 4PE5B 2RSLA 1RBQA 1F6WA 3INNA 1HEUA 1O97C 3DVRX 5KTNA 1ORVA 2JIMA 4CF6A 2WAOA 4G5YA 4NABA 2XXAB 4J0EA 4AD8A 1HFWA 2DKNA 2FGJA 3BJEA 3RIYA 3CW9A 2I34A 3ZCRA 5C0OE 1JP7A 2WUDA 1NE2A 5A02A 2IZ7A 1Z88A 1B6SA 1IOLA 1R6BX 2QI9F 1Q0SA 1CZKA 4UQOA 2Q3JA 4O29A 4QDUA 4TYPA 1STOA 3JQGA 4G86A 4OHVA 1ZNWA 2V6BA 3NDPA 3QVTA 4PQGA 4DVJA 5B58C 6ABPA 1MXFA 3A28A 3DE6X 1RVDA 1S2IA 3TD9A 3SC3A 4ZTZB 3BTOA 5HOQA 2B8EA 3J7AC 2HCRA 4JI2B 3SMQA 5TF0A 5BSWA 2C7BA 2XT6A 4P82A 3KNZA 3C6ZA 4ZICA 5FWNA 4A0QA 3H83A 2OXEA 2P4SA 2JEYA 1XMOB 1NOIA 3WRVA 3MYYA 2C1XA 4DLZA 5BP7A 1V9SA 3DEYX 2HIMA 3OAAA 3PRJA 4ZQHA 4HNTA 1KEWA 1MNQA 2OYCA 2L19A 2D0PB 1T3ZA 4LYGA 4EJFA 1CETA 1O3YA 1GN8A 3FUVA 3P1JA 4OVKA 5DYNA 4QEZA 5BVGB 4OMUA 5M2QA 1DFIA 1Q1AA 4GXQA 3L82B 3B3GA 1P73A 4WNYA 4XE5A 1PL7A 2JGDA 2YOFA 4YJ3A 4PG7A 5DOZA 3DKIA 4MW5A 5B3JA 3SSNA 3H4MA 3JD1A 1SCDA 1R6AA 3CVJA 3VSEA 1F1JA 1IZZA 2HBZA 2PX0A 3VDNB 1EGAA 4KZKA 4ICIA 2IUTA 1KMHB 4JHXA 4KTTE 1E2NA 3N1UA 4KLRA 4B4DA 1GGMA 3IP3A 4YNBA 4CBVA 1AJEA 3NFRA 5LP6A 1LC0A 1EX1A 1RXWA 3D0RA 4YAFA 3Q4GA 3SKXA 3NVAA 4ZVOA 2Q28A 3GGOA 1CY1A 2ZRBA 5K1ZA 4YAUA 1CRLA 2FF7A 1U2QA 4CMEA 2HF8A 5AKHA 2CB0A 2NO1A 3AFIA 3DYVA 1OF1A 1OJLA 1KDTA 3GCXA 3ZHYA 4RJ2A 3SM9A 1CY2A 4XVQA 2AT1A 2GM5A 2QRNA 3HCCA 2EARA 3CLTD 1ZWKA 4IH9A 3KPJA 4NHOA 4IQGA 4CQMA 4O33A 3PHIA 4MPRA 2WU8A 4V02A 3IBGA 3VC2A 1TA4A 4JJKA 6GPBA 4P33A 1VJ0A 1IQUA 2ZBVA 2WHYA 3O2SB 4RZXA 3OM9A 3WA6A 3R44A 1UOOA 4BMCA 5FWYA 4PIPA 2P27A 4G63A 1OPXA 1BAPA 2ZB2A 1D6JA 2QVCA 2KHZA 2VAMA 3LO5A 3NJRA 5HG0A 2VC2B 4ND6A 2JNWA 5K3AA 4LTNA 3V8NA 5A9TA 4B32A 4BFZA 3ZJTA 1CQZA 5JCOA 1WCXA 1USKA 2LCIA 3VUEA 3W6UA 2C78A 4RULA 4Z2YA 5KOJA 3B5JA 3GFRA 4AP9A 4BMPB 2PUVA 2P0EA 3X2EA 2EEZA 2B7LA 4PX9A 5F5LA 3RK4A 3WLAA 3ABRB 3ZQUA 1GAQA 2ZPTX 3GP5A 4G4SO 1A82A 3GRUA 4TLAA 4AMZA 7AT1A 2IOFK 1EFPA 3F4KA 2HJ9A 5GMOA 4EJ6A 5JZMA 3INGA 2AJTA 4WQMA 2AG6A 3KL2A 3RTCA 3K70C 2XVAA 3NP7A 1XQ9A 1Y8QA 3DBRA 3GELA 4OJMX 3EB9A 1EUCA 1KJYA 3UY4A 1V7PC 1M2VB 2G6TA 4WKCA 5ALNA 5AJWA 4N7RA 4CT5A 1ZD4A 1NVKA 3X2FA 3DTNA 4LDAA 4AROA 5J4KA 3P0JA 3V2IA 3K16A 3ZW9A 1UCFA 2VQ6A 1L7DA 2WYOA 3H9QA 1PUJA 3NPAA 4F11A 2CXXA 3T1NA 1NIJA 3FI0A 2JFGA 1U0LA 2EAUA 2P2SA 2QVZX 3L77A 4RNDB 3Q5DA 2EATA 3B48A 3BXFA 3ETLA 4HWRA 4HBGA 2YJ6A 1L5SA 1NMQA 2P9ZA 3C5CA 2WRZA 4QX6A 1QF7A 5AK4A 4M0CA 3QA3E 5B7NA 2IP2A 2QL7A 5K9ZA 4D3XA 1VYVA 2Z56A 3FPFA 4KQ2A 3QG5A 3IOMA 1EFUA 1NLUA 2W0MA 1T2AA 3BD8A 5CP8A 3IUJA 4RZ3A 1DUVG 2X9VA 2WK1A 1XCPA 4HDSB 3TPCA 3L0CA 1XDZA 4QOFA 4YEDA 5L3SB 1GFZA 2VYVD 3ZN2A 1W85A 3JRXA 4CF7A 2V1UA 2NVUA 2WWFA 4IXMA 1UFVA 4N0QA 1KO1A 1RQPA 4M8IA 1QKIA 2M9MA 4GOKA 4TYNA 2HMTA 4L4UA 4R8MA 4M0EA 4TXLA 3T7TA 1Z5WA 1SBCA 4UM9B 1X38A 3V4OA 5FXMA 1HDZA 1YV9A 3EK2A 3FUCA 1E9EA 3AL0C 4FC7A 3DVSX 2XKKA 2JZNA 4CIVA 4ZHSA 3PJGA 5JHHB 3E81A 4IV8A 3KPVA 2TECE 1FU4A 3CT4A 4ND5A 3FCOA 1QZZA 2J5KA 3T15A 2H4ZA 1NXXA 1G8HA 3HCOA 3JQ6A 4H1TA 2A6PA 1T2FA 3T38A 5FUWA 2IXTA 2DFVA 3KUKA 1UXIA 1SUWA 4OD0A 2WM9B 4UAJA 2H6EA 1QHXA 2EXXA 4AMBA 4B74A 4B40A 4I1SA 5HA5A 2VJQA 1KTVA 1K8XB 4QYXA 2YQZA 1VG0B 1S2MA 4XH9B 4LNUA 2Q3LA 2PZLA 5TGZA 2ZB8A 2ZI7A 4L3OA 4S0ZA 2JFHA 1O9GA 3F5MA 1P5JA 1MEJA 2IQIA 2LV8A 3ONEA 3BK7A 2X1VA 4GSYA 3RANA 5FI3A 1G2QA 2BWJA 3QW4B 2C03A 2P9JA 5CJJA 3DMTC 4O4HF 3PQ7A 3B12A 2VPIA 4ZVMA 3LQQA 5EUCA 1BE6A 4IS3A 4JP1A 5KX5A 5I9BA 1RPAA 3MWJA 1B14A 1MDBA 4FNMA 4RQBA 2WFAA 2RK4A 3G5AA 2I6QA 4MPTA 1Y5IA 2FE1A 2O2SA 3NFYA 5TE9A 2J09A 4PZCA 3AP2A 3E9QA 2R0QC 1HO3A 1LCIA 3TNFA 2C2ZA 1VFNA 2W83A 1TQ8A 2Y05A 1MGPA 3KYDB 5CD9A 2XZLA 3ANMA 2WMYA 1GD1O 4C5AA 5AXAA 4YR9A 2YVUA 1RC1A 1QJ4A 1COZA 2RHRA 1M8JA 3CXUA 3E1KA 4HEA6 4WKNA 3W2TA 3X44A 3F46A 3EDYA 1CJKC 1LX7A 1T10A 5DN6D 4S1TA 1U2DC 4RJTA 3SYKA 2X6QA 1PI3A 1L4HA 4EENA 1ABFA 2VQEB 4GZ5A 1XU4A 1V96A 3AERB 4L8FA 3GOHA 1JAHA 2J6CA 5A4JA 2VP2A 3SBOA 1WVIA 1Y3HA 3WFJA 2ODEA 1A2KC 4PZUA 2I6GA 2OXIA 3NHLA 2X0IA 4WZAB 3P4YA 5JRZA 3SF0A 4A6DA 1PL6A 3LBIA 3OQMA 2QB5A 1LQ2A 2VYCA 4QUDA 1ONSA 2P5UA 2R8OA 3A4TA 4HP8A 2WWVD 3TM5A 4RHYA 2HWWA 2P6PA 5GIOE 1ZGHA 3N7UA 3DW1X 1SOUA 3RBAA 1KYWA 2N0SA 5TGDA 3VO9A 2IYZA 5ALTA 5FEUA 2JH3A 2KB0A 4BUCA 1E1QA 1OU0A 3ESAA 3RODA 4RANA 4GOOD 1PBNA 2FQQA 3ZYCA 2HJRA 5BSFA 4OU4A 3ODPA 3QE4A 2P41A 1Q0HA 4MUBA 3SI7A 2IEZA 4IIXA 4G1VA 2EIHA 5AI9A 2AQHA 4TRJA 1ZINA 4Y1EA 2ZBRA 4UATA 4G67A 3F6RA 2B8TA 3KWJA 1NBMA 2NO5A 1I4EB 1Z5OA 4UE2A 2XRFA 1Z3IX 3CUYA 4AY4A 4UAUA 3VZDA 1VKNA 1E3WB 4MOWA 4Q7JB 3CBGA 1ZJZA 3IVMA 2PCJA 1WQ3A 1YK1A 2R68A 3TD2A 3I6MA 3UAZA 4P34A 2GARA 4ND8B 5F9MA 1YCHA 4KEAA 2RBKA 1QWSA 3IP7A 2P35A 4ZOQI 2Y1FA 1NPTO 2W2TA 2QMUA 2DY1A 3BXXA 3DULA 4FIDA 4HZGA 4CIAA 1FDOA 5IN4A 1QR2A 4EAAA 1XL0A 2R5NA 1V3QE 3LSTA 4RXUA 5AKKA 3ETCA 3AW9A 4Q93A 1XR3A 2ON6A 2EF0A 1QFYA 2J5QA 3DL0A 2QEQA 4KQWA 4NOJA 4RTJA 1PFVA 3OPYA 4JB3A 1K7YA 1PQ4A 2Q5QA 2X4LA 3DFFA 4GMGA 1J23A 3SSMA 4Q1FA 3TUIC 3F3KA 1I1OA 5BYKA 3WKDA 3B6IA 2BZSA 3RE1A 2PUWA 3HO6A 2ZJ8A 3L49A 4BP8A 3PDWA 2BFBA 2PL9A 4WV3A 1O4WA 4EPTA 3VKWA 4RE5A 4AKGA 4A82A 4FEYA 4C20A 3IDZA 2E6KA 1EXWA 2CMFA 2OENG 4W99A 3FNFA 3GJTA 3ZWNA 3Q0TA 5FPHA 13PKA 1G20A 2VSNA 2AVDA 3L6CA 3WKAA 1ZVQA 5B4TA 2NO0A 2ZGVA 5KQRA 4DR1B 4MVJD 3KV1A 4X60A 1TLTA 3TDKA 4RIFA 4DIEA 4EUFA 1KEPA 3HB0A 2VF7A 4C87A 3C1UA 1OX6A 1A8PA 4Y9UA 1ESCA 3ORFA 4MO2A 2JAWA 4U7HA 4YX9A 5AVWA 2OZLA 1B42A 4NCNA 5CA0B 4UMEA 4YUWA 5AVSA 1P1CA 4U5QA 3C8MA 2GX6A 1A9PA 3OE1A 1BHQ1 4DLPA 4QASA 3AHJA 3IVAA 1O4VA 3MTGA 4ZI7A 4C30A 5IJ0B 1IHXA 4NMXB 3U16A 2Z8YM 1WDMA 1B8NA 1R4NA 2OAEA 3MOGA 4MMZB 4XWAA 5JVDB 3IUBA 4M1WA 2PT5A 2DFKB 5EQFA 1JHAA 1ZJ6A 1QM5A 2IFTA 2Y9MB 4CL8A 1L5QA 2YRFA 3RYHB 2D2XA 4QEKA 1AH2A 2P2YA 3OLCX 1KVUA 3PFGA 4RWEA 1PN3A 4F97A 3CO0S 4LDQA 2CHFA 1A5BB 3HDQA 3M5PA 1K68A 3NCTA 3LGXA 5G0WA 4TUYB 3ZKWA 2PAAA 4P4SB 5GVSA 1FVHA 1USGA 3UJAA 1K7XB 2YVLA 3ZOKA 3ZQJA 4CM9D 5INTA 1P81A 5LQNA 5CM2Z 4ZOCA 2Y1XA 3UMFA 1FDWA 2BSXA 2NNWB 1X9GA 4ONEA 1SHKA 1KTIA 1NZDA 1ZWLA 3B20A 5CW2A 5E38A 3WFIA 1FMFA 2ZIEA 1G2IA 2I62A 2QE7A 2YV3A 3E9DA 1TOAA 2POCA 3I8OA 1ENZA 1HBJA 2ZI6A 4I66A 1R15A 4KQFA 3VPBA 3WK4A 5JCJD 3BJMA 2GWHA 3WL8A 2ZRCA 3R0IA 1VM6A 5L6LB 4QPNA 2LW7A 2JHCA 1YFKA 4NZ9A 4KOAA 2HNKA 3JWIA 4YDQA 2HRBA 3BD9A 5C81A 1T4BA 1DWUA 4KX5A 1R5OA 1U7PA 2PUTA 1VCHA 2Q27A 2HB6A 1F7VA 4DPLA 4OK5A 1Z75A 2AXPA 3DMNA 1OUMA 3H8JA 4QHYA 2V74B 4TT3A 5KVQA 4TRMA 4DCJA 5BRJA 1XZDA 5ED4A 1FP2A 4WASA 2W6OA 5PGMA 2ZE6A 3UJNA 1WRBA 3GFSA 4U4AA 4UFPA 4YRDA 4FJ2A 1W25A 3D6FA 1ECFA 1KAQA 3K0AA 4I9HA 3L5OA 4PXAA 2BBSA 2C8LA 1LBIA 1CPYA 4XVHA 1IH8A 1UBGA 1BKDR 3IUPA 1XXHA 2ZVPX 3JAKA 4D8WA 2NP7A 4YRSA 2EJBA 4GVLA 1DG1G 4V0MA 1LVHA 2ZRIA 4ZV4A 2B5VA 1UIRA 2EQBA 1YIAA 3L0BA 5FD8A 1VA4A 4A6EA 5BOSA 1V37A 1A4UA 5BUCA 5I3CA 1XTRA 2J9XB 3PNSA 4Y2VA 2O5VA 1QSGA 2GCEA 3G9QA 1SBTA 1I33A 5TEWA 3RD5A 2AE1A 3V4FA 4W1QA 4PO9A 1WCIA 1LPOA 3P26A 1OTXA 3N2IA 3EIWA 1UMCA 3LTEA 3PC6A 5BWNA 2IF0A 3DH0A 1KI1A 3ANNA 1F2VA 1XLWA 3C8HA 3T0IA 1OX4A 2RARA 4M8KA 4Q6BA 2OHIA 5KINB 2H7VA 3TNYA 3A4IA 4IEIA 2UVPB 4B73A 3FE2A 1OOEA 4C7VA 1YR9A 2PT7A 1HA3A 3JXEA 4JI8B 5C8YF 1AK9A 2YQ5A 4OHKA 2DC1A 2CXNA 1YMVA 3EMVA 1JMYA 5EERA 4R01A 4B83A 2YMQA 1IBMB 2NZWA 4COKA 2CVHA 3AUKA 1XMSA 2GBLA 2WMOB 1PR3A 3EUAA 1IQ0A 4KU4A 4X9XA 1L2TA 3RC3A 2Y68A 1UC8A 1U4SA 2H9AA 3FBWA 3BJRA 4L50A 3MFYA 1I6LA 4O4JA 4RD0A 1IJFA 1T1SA 3F2IA 3DNFA 1W4AA 4MLDA 2IH2A 1DMRA 1IULA 2WFMA 2JGLA 2XW6A 3F7NA 1Z37A 2JRCA 3OO0A 3DAGA 4RKFA 3TDNA 3V1YA 3W1EA 3LUKA 5KDLA 3NT5A 3UWMA 4OG2A 4A2WA 1A98A 3EODA 4HDNB 2OMEA 3IUMA 5ES3A 2FV8A 2Q6KA 3NB0A 1LQTA 3STVA 4DE5A 2AW5A 2Z5GA 2R8BA 2XKBA 2FSUA 3UB4A 1BXGA 3GF4A 1LQUA 2YNMC 2IQ5A 1V3TA 1QB7A 1DKOA 4KN5A 1E79D 5EZYB 5KS2A 1WMFA 3I23A 3Q12A 3I2HA 1ECBA 4E22A 3WV4A 3LO8A 4WOPA 1CY6A 3C74A 1C5KA 1OXTA 2QG6A 3TE7A 4BE4A 3AOGA 3I58A 3MBIA 1P7YA 4H16A 4QDKA 3T6KA 4DIFA 1O1YA 2HF2A 4KJXA 4YLYA 1JVBA 1W0KA 3C8DA 1HZZC 4LZJA 1HDEA 4MVJG 1K8QA 4OEHA 3S8YA 5D51S 2AE2A 1O6CA 1B0AA 1NI4A 1R27A 1KEEB 1LRKA 3B9QA 2ZR9A 5D84A 2H1OA 2C98A 4X91A 4TYWA 2D1RA 4Q4JA 2GZ2A 4M9CA 1XQWA 2WSSA 3ED5A 1M3SA 4M0UA 1JBKA 4YCDA 2H1WA 3BGSA 2LR0A 1Q14A 1R64A 2EVWX 3PRHA 3N5CA 2FSGA 1QLJA 3I39X 3QUQA 1OFUX 4IJVA 3I8XA 2A92A 1YFJA 4IOMA 2V98A 1X7WA 3QKRA 2XUJA 3KXKA 4QEDA 3EX7C 1JJFA 1OIXA 1H2ZA 2WNIA 4NZMA 4A5OA 4JT8A 3TGPA 4IMRA 5B4VA 4US2R 4CMGA 1TC2A 3ORSA 4FLEA 1XEWY 1VPTA 3CY6A 2V96A 1SJ9A 1JJIA 1ZUNB 2A1TS 2QQ5A 5B37A 1VCOA 1ZRMA 3KSUA 1JQKA 5CFQA 4OLJA 5DYIA 2QYOA 3D4BA 1F0YA 4PRLA 1Y63A 1SCUB 5SY6A 3SJAA 5EXDA 4AKEA 1M2NA 3LYLA 9ABPA 5D3KA 1CS0B 4DLAA 1SHTX 4MR8A 1E98A 3UOGA 4EPVA 1AQIA 3C3KA 2OFOA 3FSJX 4Q9DA 4QREA 3MN1A 3PE3A 4TS4A 5JWHA 1LS1A 4I4LA 3VR1A 3V4RA 4RMIA 1F0KA 4PBRA 2GJSA 5IM4A 3OIFA 2XE4A 1WR8A 2R86A 1CIPA 5DGIA 4D56A 1ZK3A 2GPBA 3EH1A 4MGEA 3CVOA 2H48A 1JDPA 4X92A 2IU4A 4O4IF 1O96A 4NJEA 2E4UA 1QBGA 2M98A 1RRCA 1Q3TA 3HJRA 1M1YA 2CCJA 4IVQA 2DT5A 2BFDA 4EUHA 1P7VA 3PK0A 4YVFA 4RLQA 2H5LA 2ONZA 3BIFA 1L6RA 4HXYA 3WQBA 3ANTA 2J59A 2ZBPA 3A2NA