1VE5A

Crystal structure of t.th. hb8 threonine deaminase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
310
structure length
308
Chain Sequence
b'PSLQDLYAAFRRIAPYTHRTPLLTSRLLDGLLGKRLLLKAEHLQKTGSFKARGALSKALALENPKGLLAVSSGNHAQGVAYAAQVLGVKALVVMPEDPYKKACARAYGAEVVDRGVTAKNREEVARALQEETGYALIHPFDDPLVIAGQGTAGLELLAQAGRMGVFPGAVLAPVGGGGLLAGLATAVKALSPTTLVLGVEPEAADDAKRSLEAGRILRLEAPPRTRADGVRTLSLGERTFPILRERVDGILTVSEEALLEAERLLFTRTKQVVEPTGALPLAAVLEHGARLPQTLALLLSGGNRDFSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Threonine deaminase
molecule tags Lyase
source organism Thermus thermophilus
publication title Crystal Structure of T.th. HB8 Threonine deaminase
rcsb
total genus 100
structure length 308
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 4.3.1.19: Threonine ammonia-lyase.
pdb deposition date 2004-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ve5A01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ve5A02
2DH6A 2Q3CA 5DBEX 1TJPB 1V71A 4QYSA 1J0DA 1FCJA 3VSDA 4LMBA 1WTCA 5DW0A 1K7FB 1C9DB 1UBSB 3VC3A 4I1YA 4AIRA 2CLKB 4D9GA 1KFEB 1TZ2A 5D85A 1J0EA 1C8VB 1WKVA 3AEYA 2GN1A 3BM5A 3IAUA 3L6BA 2DH5A 1K7EB 1J0BA 4D9EA 4NU8X 5DVZA 1M54A 4HPXB 1O58A 5JJCA 1E5XA 4D9KA 4D9NA 5CGQB 5I7RA 5KINB 2GN2A 5CVCA 1PWHA 5T6MA 3TBHA 5IWCA 3DWGA 4D99A 4LMAA 3VBEA 4D9IA 2TSYB 3ZEIA 2CLOB 4D9CA 3PC3A 5I6DA 4OREX 4D9MA 4LI3X 1TZJA 1UIMA 4HO1X 3IQHX 1V8ZA 3HMKA 3SS7X 1OASA 3PC2A 4L0DA 5IXJA 4D96A 1TZKA 1K8ZB 5J43A 3CEPB 4H27A 4NEGA 5EY5B 1J0CA 2J9YB 2RH9B 1C29B 2JC3A 3FGPA 3X43A 3SS9X 1WDWB 2ISQA 5D87A 2TRSB 5C3UA 1PWEA 3DWIA 1CW2B 3R0XA 1F2DA 1CX9B 3RR2A 2D1FA 3AEXA 5DBHX 5HBGA 2ZPUA 3T4PA 2C2GA 2CLMB 3SPXA 3PC4A 4D8TA 2O2JA 3L6CA 3V7NA 3VSAA 1P5JA 3L6RA 2RKBA 4Y6GB 2RHGB 1J0AA 2BHSA 1KFCB 4HPJB 4JBLA 2Q3BA 1VE5A 2WSYB 5E0KB 2CLHB 4D97A 2PQMA 2CLFB 1KFBB 1TTQB 1VB3A 2C2BA 1K8YB 4JBNA 2V03A 5KZMB 4OFXA 4F4FA 4L3VA 5B1IA 5I7HA 1A5AB 1BKSB 2ECOA 4ZU1X 5B1HA 5BW6B 4COOA 5B55A 3VSCA 2EGUA 4PCUA 1TYZA 1K3UB 2O2EA 1K7XB 5DW3A 4IL5A 5D86A 1A5SB 1JBQA 4AECA 3PR2B 1A5BB 2ZR8A 3R0ZA 4ZQCB 4HT3B 5I7AA 5JISA 4KKXB 1X1QA 1Z7WA 1KL7A 1K8XB 4XUGB 4D8UA 1BEUB 2J9XB 5B36A 1RQXA 2GN0A 5B3AA 2EFYA 3DKIA 4D92A 1WBJB 1KFJB 1TDJA 5D84A 1QOQB 2CLLB 2TYSB 4D9FA 3IQIX 2CLIB 5IW8A 5B53A 2Q3DA 1A50B 1VE1A 2ZSJA 4WX2B 3X44A 4L27A 5I7OA 4D8WA 2J9ZB 2CLEB 3FCAA 4L28A 1TZMA 1V7CA 2ECQA 2BHTA 1D6SA 4ZU6X 1UINA 5I7WA 1KFKB 4HN4B 1TTPB 3IQGX 1Z7YA 4D9BA 1FUYB 1QOPB 5J5VA 1Y7LA
chains in the Genus database with same CATH superfamily
2HZBA 3TNYA 1JECA 4TTAA 1H6AA 1M1XB 5REQB 4EA6A 3C6QA 5F3DA 1FSPA 5CFPA 1CKEA 3PKIA 3HEAA 4BO4A 3M6XA 5FNVB 2ZUDA 2GPNA 1H69A 3BJEA 3HR8A 3WL7A 3AKZA 1U0FA 1STOA 2PKEA 3G2LA 1XA0A 1PSZA 1V1RA 3KQMA 5BNFA 3K6SA 3W1VA 1KOGA 3VM6A 4MGEA 1P7CA 3OPVA 3ZGYA 1HDRA 4K3UA 1USWA 4J3NA 1U0EA 3IP1A 1X8KA 2I2XB 3U1VA 4G0QA 3WZLA 4NG5A 1YKSA 1Z2AA 4A0FA 4R2IA 2BDEA 5A4MS 5YASA 1HG0A 4FYXA 3FKJA 3MSXA 1J5EB 2J3HA 1SK8A 4Q1BA 3P27A 2J46A 1AMOA 2W90A 4CL8A 3QF4B 3WQRA 1T9ZA 1C8BA 2HEGA 4M88A 3TOXA 2VDWB 3BE5A 1VG0B 2YN4A 4CV0A 2EJUA 1DELA 1P1BA 2H17A 3E61A 3NYRA 5K20A 1DMRA 4O4HA 3TRKA 1YJ5A 3AUJB 2FHPA 4ZIRB 3D3QA 2VT6A 4J8PA 4DUGA 3K9NA 1JG3A 3BWBA 3THYB 3BGIA 3JR7A 1ZX1A 4DABA 2IUFA 4HAZA 4D82A 4O25A 1S4MA 1ANKA 4C21A 5JSZB 3EEIA 5HXAA 3DMFA 4Q3AA 3C74A 3A14A 5FO1A 2CNOA 2VQEB 3GK3A 2C0PA 2E7ZA 2PH7A 4G0WA 3AEXA 1X2BA 2IEIA 4RACA 1K9VF 1C9EA 4FUQA 3LHIA 3QV2A 3SP1A 1QIDA 4K6HA 3SG0A 1T2VA 2H63A 3OF3A 2RKBA 3A1WA 1LV8A 3A9CA 3L0PA 4REQB 1KGSA 3HY4A 1U7PA 1PU2A 3PSHA 4N5DA 4TWBA 3UK6A 4D57A 4PCAA 3WFJA 2WSYB 4V0NA 1IK4A 1YL7A 3HY6A 3P1JA 3T6KA 1NQOA 4AKIA 2QWXA 1YE5A 4ER5A 1TT5B 1VIMA 3OPYA 4LRQA 3MRSA 4XCQA 2FK8A 4WEOA 3FPLA 5BRNA 2V7WA 2A0KA 5C0OE 4UUPA 3HDTA 3NM5A 3P0RA 4H4DA 5BVGA 2XZLA 1ULSA 3W90A 4GXNA 4QVGA 2GM4A 2NO7A 4Q9KA 1R4MA 1XMSA 1Q17A 1K7XB 5DB4A 5EE5B 4YAGA 1T2NA 1FYFA 1DEOA 2HXYA 3U80A 4ZCMA 1FLDA 2W2NA 2PD4A 1N0WA 4MW4A 3MD9A 5FBVB 3L8GA 1CU1A 1D1PA 1SCQA 1OLUA 4E12A 1Z0AA 1GP2A 3KFXA 2ZRDA 4KFCA 2QTCA 5AVRA 4D4MA 2CJWA 2XNSA 5AFSA 2O8BB 3MAAC 1NY5A 2B8JA 4XVHA 2I2AA 3EY4A 3PNYA 1ZNZA 3HCOA 5D84A 3NBKA 1XTVA 3PFWO 3QXJA 2IDMA 3P9XA 5IMSA 1XQYA 2VJPA 4BMXA 4TT3D 1YBHA 2X0RA 3RROA 3H5NA 1FFYA 2QTZA 1DO2A 1SKYB 1Z5OA 5FBZA 1U5BB 1FRZA 3F78A 4W6ZA 3V8PA 2C8KA 2OD7A 5K8TA 1OX4B 3RVOA 2TECE 5ERYA 1R8JA 2YQZA 1MOQA 3EZGA 2MSNA 4Z9YA 2XMCA 3OWOA 4FFMA 1MDFA 1H66A 3PENA 2IE8A 3WY9A 3ISJA 2VLBA 4JK3A 3NM4A 2PH3A 4RORA 3UOGA 4OA5A 3UJDA 1Z18A 3KKMA 3TQRA 4F91B 2MIIA 5BXYA 4G1CA 1K7EB 2P2ZA 3FIUA 2PL9A 1GUFA 3B1JA 4B3GA 4BGEA 5SZIA 4CMBA 3H1PA 4ESOA 2D5AA 4A2CA 4JD5A 5T8KA 3MFQA 4EL5A 1O4VA 1NI3A 1XF1A 2PT7A 1DCTA 3HVUA 5KNDD 4NNPA 4BXOA 3KOYA 1Q2UA 4BS9A 4H3KB 3A70A 2JGJA 2YZMA 2KW5A 1XVIA 3GGOA 3T5GA 3AR9A 3WVNA 2QL5A 4BVEA 1PNOA 3RNLA 4NV1A 2HQRA 1JDVA 4K03A 3HVHA 1BMQA 2O1EA 2FUEA 1N7IA 2VDUE 3ZCTA 2JVKA 4C0QC 3IIIA 3TSWA 3HFSA 3K2IA 3UUFA 4AFNA 4OSPA 5BUSA 1SXGA 2BMDA 4G1EB 4RTJA 3NWOA 5L7YA 4IFTA 2REQA 1W4CA 4YUWA 3HRKA 3PR1A 1EBBA 3QRWA 5EZYF 1XMQB 2YCLA 4FP9A 5EXEA 3R9IA 2D1YA 4U8GA 2GTPA 3KFLA 2FW1A 3AONB 3D0KA 4DMRA 2ODQA 3BF8A 3MT9A 4MGYR 4AP5A 3OHSX 5AJUA 4D8TA 5KPJA 5AUQA 2AMYA 2BHLA 3QU5A 1UL1X 1UBFA 2ACVA 5ICMA 1J56A 2WAOA 1H2WA 2Z04A 4U2FA 3EGWA 1YB4A 5F73A 4BFSA 3U19A 4ND8A 4DKJA 4GGOA 2EGGA 4PVCA 5IK2D 2UZ1B 5EHQA 2QRUA 3UA3A 1G59A 5A0TA 2DEUA 5A9SB 3C1UA 4OQ4A 1UZNA 2DTDA 3LP6A 4XQGA 3PR3A 4F71A 4CIBA 1T1GA 5J4HA 1Y1SA 3NDJA 4B6OA 1TT7A 4E5VA 5AM2A 3EW9A 3JQGB 4MX8A 1HE3A 2C0QA 2ORVA 2Q4RA 2ZWAA 3CZCA 1C30B 4FBMA 2B4AA 4RFVA 4XVRA 3EEYA 3GPIA 4B6EA 2E6KA 1I36A 1U6KA 3SKXA 1BFUA 2H4FA 2AE2A 4DQKA 3CW8X 4HXFB 1E7MA 4XVUA 4MMXB 3EA0A 1KI7A 3KJXA 3OZXA 1DAIA 4YYZA 4FNAA 3SX2A 1R88A 5F7ZA 4XYLA 2BEKA 5IZ4A 2XGJA 2NPFA 3Q4GA 2BR5A 5BQ5A 4ALJA 5E3JA 1RZVA 2VXBA 4GZ5A 2ZCUA 3PPWA 4OVKA 1FU4A 3SDBA 3PVSA 3ZLTA 2PUBA 1IZ7A 2A3RA 1DEHA 2QTMA 4M22A 2APJA 2GBGA 5T7BA 4JROA 2OCYC 1A50B 2VATA 2P4QA 2ZRBA 3D7RA 1NPTO 3KQWA 4UXJA 4LRSB 3TPZA 3U13A 3CVYA 4PYLA 4C14A 4KR0A 1JHVA 4C0JA 2K2QB 4R1MA 3TNFA 3LWDA 2ZXFA 2ZGVA 3IPRA 3L9WA 3SLKA 3ZNQA 5EP3A 5B3KA 5BOSA 3FAZA 1A7AA 1X7ZA 2AG1A 4KHZA 5CUQA 1B6TA 4LRUA 4TRNA 3IXQA 3ZYZA 1G3QA 4G0YA 3H42B 4C0HA 1T2EA 5JC1A 4FR5A 3LGSA 2J45A 4L0MA 4I3HA 4D9JA 2REOA 3H83A 1P0PA 1RBQA 1UK9A 2ZIGA 2Q9UA 1UXIA 2R1TB 3PFCA 3KZVA 2LIVA 4UE3S 4EVSA 2C5GA 2Q5QA 4RPLA 4A0RA 5KHOC 3CRRA 2RC6A 3KZOA 1K7SN 3U7EB 1A5ZA 1W5AA 2HK7A 1AF7A 3CZ5A 3C85A 3SS8A 1G3IA 4G97A 3QTTA 1Z6GA 2AD1A 3T1HB 1K7YA 5GQSA 3OD5A 2J30A 3R7WA 1N6RA 2C9MA 1TKRA 4G5QA 3THSA 1AM4D 2P3SA 3CPSA 2X3YA 4ZYTA 2MR5A 2WMNB 2YQ4A 1NMYA 2CVZA 2OLEA 1PGOA 4QZVA 1YTUA 2D6FA 3OPMA 3MXOA 3ZHYA 4L7QA 2OYRA 5EJGA 4YDSA 5BV1A 1WXEA 2A3NA 4W9RA 4UJ5A 4GRDA 1J2YA 3KB2A 3TBKA 1YCFA 1D0VA 1ESNA 5BN5A 4QXOA 4BO8A 3STUA 4QPCA 2NGRA 2OGTA 3H8JA 4X7RA 2XODA 2ZBDA 1R50A 3OQOA 5JH7F 5F1KA 1NRIA 1Q20A 3HKCB 4B8WA 4K88A 4C08A 1EB8A 2BW0A 3GD7A 4XPZA 4D4HA 2K2WA 1X80A 2R96A 4ZANA 4C2AA 2GCPA 5A6SA 2Y1KA 2IXAA 4DXHA 4CMJA 3LH5A 2WHEA 3B6MA 3X0DA 5B3JC 2XQIA 1NZJA 4II3A 4H59A 5BRJA 4XDHA 1IVNA 3HYSA 2F4VB 1WCYA 3N3AC 2AWOA 1CY8A 2FQ1A 5KEIA 1BXZA 3GR6A 1T9CA 2GCOB 2HLNA 4L85A 4UVHA 3TYXA 4Q66C 3QYAA 1Z35A 2QJOA 3D5TA 3N6XA 2G5GX 3FBWA 1V6SA 2ILTA 3O0TA 1AN0A 3VA7A 3ANSA 4NESA 1U81A 2JZNA 2XUPA 3TDMA 2O4CA 2IHVA 1A9SA 1FX0B 3DF7A 5IKXA 3NUZA 4GZLA 2KYRA 4HWPA 5LIPA 1OKKD 3P20A 1A1SA 3C6BA 3ITEA 3AP2A 4QASA 1QFSA 2LZ0A 1HO3A 2AHOA 5CM8B 4D6PA 1FPMA 3PDWA 1FW8A 2OCLA 1K9SA 1X70A 4P4NA 1RWVA 4LJKA 3R7AA 3UJPA 3ER9A 2BTEA 4YP6A 3PJGA 4ALMA 4E5NA 4K9MA 4KJXA 1RE0A 2W6ID 2GR9A 3GVPA 3TWOA 4C0XA 1OD6A 4KRXA 3VMMA 5LDHA 4NQZA 4BDTA 3B3GA 3KM0A 4C1NA 4OHCA 5EPEA 4ANFA 1YR6A 3HEBA 3WWYA 2IXEA 1Y1TA 4BMYA 4C4RA 1UWKA 2R2GA 3QYJA 1PJTA 2EG5A 1MB4A 2W0MA 5DTMA 3HL0A 3U56A 1DFHA 2JZCA 4YJ2B 4BJ6A 3M34A 5AM0A 1ZOOA 4WKCA 1GQOA 2VDJA 1KHTA 4MPTA 3NEAA 4BNKA 1BVUA 3BCSA 4JQSA 4TVSA 5JEDA 3TZEA 1AH2A 1TA4A 4IDBA 1NVKA 4ER6A 3T5AA 1RBZA 2AMFA 2Q3LA 5IK2A 4EZBA 2O5EA 2HV8A 2P2GA 4GPZA 4AYTA 4WY8A 5L8VA 4X71A 3T9AA 4E07A 1JBEA 3KL4A 1WULS 1JJBA 4I4TA 5TEWA 4FLMA 2MWMA 3CGWA 1GZDA 1IG3A 1ZM7A 2F9MA 3PCXA 1B8OA 2ANCA 2C03A 2P9HA 4PLYA 4UREA 2XBMA 5KSOA 1FZQA 4GI7A 4HFRA 2ROQA 5K3EA 1L9KA 5LYJF 2PY6A 3OM1A 3EYAA 1PV1A 1HQCA 5KNDH 1QZ3A 3DT6A 3OCZA 3LRXA 4L72A 2O7QA 2CL7X 4YAKA 1KTVA 1KH3A 5HFNA 1WHSB 3MYYA 2W2QA 5DWVA 3VPBA 1NC3A 1QH0A 4QFMA 4A0GA 1Y1RA 3SN6A 1GFZA 1G20B 1TIBA 1RM4A 1V95A 1GZSA 3HPRA 3KEFA 4DZRA 1GQ2A 1KI6B 1Y4DE 3TAXA 2Z6QA 2FX2A 3V4ZA 4UM9D 5IJZA 4AROA 4RCYA 1TQDA 4C0AC 2PXHA 1TM3E 4B33A 1H1TA 2IHTA 2BCEA 2EIXA 2IOHA 5CCDA 3REQB 3AR6A 4RBNA 3W5SA 1OXSC 1OWMA 1YQXA 1L7BA 2OG2A 2ZAIA 4PXSA 3WDLA 2V7GA 2XUAA 3QEKA 2P68A 1NDUA 4ECEA 3B51X 2PD6A 1XKTA 3R09A 2Q62A 5BVHB 4OYYA 2F67A 1MBZA 2P4EA 4MKRA 3KQUA 4E31A 5HOEA 4QU5A 3JZDA 1QRRA 2XMPA 4X1IA 4LQLA 3NXSA 3TE6A 4U7DA 3KYJB 2C95A 4K6MA 4AWBA 4D5GA 3LDAA 1VJCA 4C0SA 1O5OA 4YIHA 5ITWA 4N49A 1FDRA 3GU3A 3KQNA 3F96A 5AICA 1CK4A 2GZHA 2JFOA 3ZCQA 3AHCA 3C24A 1PR2A 3OFNA 4UARA 5DGDA 3Q0TA 5IXYA 3FOFC 5JTUA 1Q3HA 4WZBA 2BMFA 3U44B 3NIGB 5AP9A 3T1YB 5AD1A 3FSRA 4LF7B 4O3MA 4CM1A 3JCZA 3AVOA 2ZVDA 3EIWA 4DADA 1WB9A 3WJ2A 1LVHA 2ZE6A 2GH1A 2K7ZA 3DR3A 4NPAA 2PK3A 2ZI5A 4U00A 5TRTA 3SQWA 1EAYA 2JI4A 1AXRA 5AI5A 5HA5A 2FRDA 3T9EA 3WQBA 1WU7A 1SQ0A 5HIAA 1TTQB 3GDFA 4JB3A 1MA3A 1UKZA 1D6JA 4L0QA 5DYGA 3WFIA 3UXMA 3RBVA 4BGDA 4EL0A 2GN6A 2RGGA 1I6KA 3NFRA 1PT6A 4OTZA 5ITZA 4ZARA 3DEHA 2ES4A 1T9KA 2Q8PA 3L7DA 5SY9A 2J31A 4KO1S 2IOFK 3PX2A 4PCUA 1OWPA 3THWA 1MABA 3EW7A 3N6RA 1W5TA 5CT5A 5JTTA 4B3BA 5ER9A 2V96A 1AZSC 3GUUA 3M89A 3WYBA 4QRHA 2PZAA 4GVPA 5T67A 1JEAA 4ZZ0A 5JNTA 1PN3A 1JPNA 1KL7A 2DKOA 3B3QA 3FKSA 4I3GA 1M8GA 2B2XA 1DRKA 1M5TA 2YTZA 4UE2A 2QPAA 4M89A 4X9XA 1SEVA 3WK9A 2P2YA 2X6TA 1R37A 5LZ5A 1F6DA 3RU3A 5ADWA 2G80A 1KDPA 2C2MA 5A5DA 1DDIA 3HUDA 2FFJA 4UU0A 1RXWA 4ND8B 1YFJA 5FTWA 2F3SA 2P6NA 3R9KA 3I30X 2AX3A 2PXXA 5JEEA 1E3DA 3MPUA 5JS2A 2QYOA 2LKDA 3I72A 4YMUA 2LE0A 3E9CA 3AUKA 4TSKA 5JCOA 2Z8YA 2XBUA 3PIIA 3A36A 4K9OA 4LHEA 4EJ2A 4OQLA 2NSDA 1SVKA 4LDQA 3SYKA 2D1TA 1ECPA 2EFEB 5L95A 1WW3A 1YULA 3AR7A 5LA6B 1VPVA 4M9CA 2B0JA 4W7SA 3WRYC 3IRVA 5JAOA 5SY6A 3MILA 5DBEX 1KQFA 3EDQA 3MRTA 4RZIA 4HK4A 1DC6A 2BUCA 2JFGA 2VUHB 1XZJA 3OURA 3GP8A 3HCWA 1QVWA 3TAUA 2AJTA 5DX8A 2VPIA 3LLCA 1JG2A 2YDXA 2RHOA 4KWCA 1C4OA 2DAPA 3HO8A 4JAVC 3GI1A 4L4RA 1F4LA 4MYRA 1Y80A 4UEOA 4YMVA 4QYTA 2P2SA 4HGNA 2VNHA 5DTIA 1TUBB 1OSNA 1RI1A 4N6OA 5P8WA 2WMOB 4R7TA 1R0WA 4WA8A 4F3KA 4EF5A 3EWIA 3IEPA 4DR4B 4HP8A 3G2OA 1XN1A 1J7KA 1I3OA 4NH4A 3QX3A 1G7TA 2H9IA 1JMYA 1X9GA 2VSOA 4IJUA 3BTSA 2A4MA 4BVHA 2DUUA 1D2AA 3NTXA 2FK7A 2C7QA 4YRKA 5JD3A 3TTUA 5EMKA 4Q24A 1ZH0A 2NV0A 2XUHA 4CU5A 5JPCA 3R20A 4PO3X 2J5BA 4MQEA 5C7LO 3U4GA 3H2HA 1SOUA 4OGWA 3Q10A 4WEQA 1PZEA 2OQIA 3OTHA 1GFSA 3DNMA 3OEHA 4L0DA 2ZM5A 3EOBI 4RZSA 2HA6A 1TLTA 5LXTB 2XUIA 1V1MB 2JIPA 3NHUA 1F2TA 1JU4A 1KVTA 2QA5A 1KWGA 3Q1KA 2WAMA 4W63A 4IQ4A 2ZPAA 5DT2A 3UK2A 3ORFA 4AJNA 3VH1A 4N39A 4BZQA 5C51B 5FUXA 1EX1A 4KLNA 4JEUA 5B58T 3SQXA 2P7IA 2QTNA 4B5LA 3TIVA 1EM8B 1RQRA 3ID6C 1JPVA 2RGNC 2A1TR 4HEA6 4CMGA 1ZR2A 4IQFA 3UFBA 3EGDA 4YPVA 1MV5A 4UNSA 3AF2A 1TVKA 1ZKDA 2OHGA 3AR3A 5F1PA 4GBGA 3NU1A 1VDZA 3ZCXA 4TLCA 4DJAA 2I9PA 3KTDA 3OZAA 3BDIA 5DK4A 3PJRA 3MCAA 4M83A 5E6UA 4F8YA 5IN5A 2C31A 4PTYA 3GBSA 2X1HA 2E0IA 2P0AA 5KC9A 1OCEA 2DQYA 2V6IA 3NATA 1YUBA 4BQNA 2AEFA 4BLPA 2A78A 5LDDC 1NBME 4IMJB 5DM60 4KUEA 2FZCA 1EKXA 2PD3A 2OZKA 2EL9A 2P4HX 2VH1A 3NVDA 3MMSA 5ECGC 3WK4A 4U2GA 4KMMA 4WDRA 3KV3O 3PHGA 2CD9A 4X0EA 3NT5A 3L4KA 4CVNA 2FYTA 2NYVA 4CG3A 2GEKA 4G09A 4MQMA 5I7AA 2WU4A 2ZSFA 3EGIA 1OUMA 4TSFA 4PRKA 4BKRA 3BGSA 1HDGO 3W05A 5KYYA 1QCZA 2J9XB 3AKEA 3ZE2B 5K03A 1UH5A 4JVOA 4QQRA 4MWZA 5AJWA 4ZAYA 5FL7D 3D7SA 4YMTA 3LA8A 3OOSA 4KODA 4OXYA 2J7PA 1XJCA 3W6UA 4C89A 3WGKA 2Z56A 1KH2A 4FYJA 5EZ5A 4DWWA 1CRZA 1OQAA 3SVTA 3ILSA 5JLAA 5B4TA 2HTFA 4ID9A 3NASA 4S04A 5JCXA 3GFVA 1MHTA 3KR1A 2W93A 2J9ZB 4O2AA 2FN7A 5D51S 4YCSA 2WIKA 6CHYA 4J4HA 1SAYA 5CLQA 2X2PA 3KCQA 2CSXA 1JQDA 1XYYA 3UMCA 5AHOA 4U6QA 1QP0A 1ZK3A 4FYPA 4B2LA 3F47A 3QLVC 4IG4A 3WMXA 1QVZA 1V4VA 2FWNA 4BWGA 1OJ7A 4F6RA 3DAYA 3QFCA 3BSWA 4YTEA 5E1BA 1OI3A 4NP6A 1LNZA 4IICA 2WINI 5EVCA 1PYDA 1ZUD1 5TE9A 2WNSA 4C78A 2DH5A 3QG5A 4MYUA 1I8TA 3N8IA 3MG9A 4PYJA 1WCWA 4X1KA 5E95A 4N3BA 1II0A 1PBTA 5DIZA 3N2GA 3FKSD 2R4UA 1F5SA 2VG8A 4KV9A 3V8VA 1UJMA 4ZYUA 2XXAB 2YXNA 4EYOA 2OZLB 3GDHA 2PRJA 5DSTA 1NNUA 2X0DA 1PKEA 3KUKA 4AYXA 3W4JA 1YWGO 4DT1A 4EKYA 4MAMA 4MGZR 3GZJA 3LYUA 3PL1A 2CLDX 1XE3A 3B3JA 3MUOA 3BEDA 1QHHA 2Y6UA 1W87A 3T3PB 3PC2A 3IBFA 4RD6A 5AW1A 1A2BA 3CO5A 1TZKA 3FROA 4MUGA 3GOQA 4FGLA 1KO8A 4YRLA 1MEOA 2DWQA 4G1UC 4E4TA 2X22A 3D4OA 1AQLA 1ICEA 3L8HA 4W9NA 3DMTC 4L6AA 5E9AA 4XH9B 4AKGA 2F90A 2HJHA 3F3KA 1N5IA 3ESQA 2XEDA 3GLVA 3TXXA 4E51A 2GHTA 3TLMA 2Y93A 5T41A 2B5WA 4HNTA 2XVZA 3TBFA 3L40A 3AM5A 1XAHA 1B4DA 3C0KA 3VTKA 1L7NA 3FRHA 3EGXA 1QYRA 3E9QA 4RVHA 4AN4A 5CLLA 3M3HA 4OH1A 1FFHA 1QYDA 4EAQA 3CLKA 2W6NA 4OX9B 1ZOSA 3Q7SA 5JH7B 1NBHA 3OJEA 2YOHA 3SFZA 3ITDA 1T9GR 1T4MA 4M98A 3T7EA 3U17A 3UBTA 1A8SA 3QVXA 1V35A 1T4DA 2QR5A 3AU9A 1A5SB 3EK2A 3MM4A 4MNTA 2XZOA 1UKBA 1CQWA 1FLNA 1NQAO 1T10A 1FTSA 1ISJA 2IP2A 1NJFA 3GBPA 1ATZA 2GYVA 3U39A 2BR3A 3WK7A 3VNVA 3OSZA 4JL8A 1UODA 3IE1A 1K6MA 2XADA 1IG0A 3VR3A 2Q46A 2NVUB 4FE4A 4DCSA 2XBLA 3ELYA 1OB2A 2Q1WA 4B43A 4NONA 1DWUA 5K0NA 1R6AA 3PSAA 1U6JA 2PWBA 4FK8A 4PLWA 4PRLA 4R8VA 4RQUA 4EOGA 2UYCA 4F3TA 1P2DA 1G4AE 3U3DA 4DCMA 3MJFA 2P69A 2IA5A 5GTDA 4GOKA 3TFQA 2R44A 3HMQA 1P72A 3IGFA 4RZQA 4ER7A 1BOOA 3AI7A 1GRNA 5IC6A 3ROFA 5CXUA 3RYFA 2WT8A 3NPAA 5FWXA 3IT2A 5JOQA 2M1ZA 4KGXA 4BP1A 5HK9A 4W5WA 1XHLA 3HNPA 1MOSA 1Z0JA 1DZ3A 2R97A 3FPSA 4MVJH 4JBIA 2Q6OA 2Q2VA 4DYHA 5DNYB 3VC3A 5K6TA 4J3JA 3M81A 4W5OA 4GM0A 5TEVA 3BMNA 2FRVA 3OEHD 1NSFA 4LNAA 3SC4A 5B7QA 4B4UA 3WGMA 1U2DC 5J2UF 1NQWA 4P7JA 5HRCA 5CGZA 4L6IA 1ZZEA 4EIWA 1G2QA 2O1WA 2BGIA 4IUBS 4KO4S 4N8EA 5B30A 1KDOA 1OBVA 3GD5A 4NE7A 5G41A 2C7PA 1AQUA 5EIBC 1YTLA 2I4LA 3DDSA 2O3RA 1RWQA 3NWBA 1VI6A 5CBKA 1KQ3A 1UQTA 4R1TA 4B79A 2CHUA 1GQQA 1GZVA 2H1FA 4K9SA 1SQ6A 5JHGB 3ROEA 2PR7A 2MCFA 3P2YA 3CG0A 1JR3E 2OB2A 2WHPA 2WWFA 2ZS8A 3PUHA 4D56A 1C1DA 3UNXA 1E20A 4MWDA 2UV8A 2IELA 5I3ZA 3DWFA 1FP1D 4FYKA 2RIPA 5F98A 2QX4A 4EKIA 1OKKA 3TN7A 4FU0A 3HXOA 2ZCJA 1E2NA 4IIJA 1RJ9B 3A31A 4NFLA 1YBFA 2A9QA 1C7RA 4TWJA 3A1SA 2HIAA 4CV3A 1HZZA 3LKDA 5EE3A 4I5DA 1C1XA 4RK1A 4KX3A 3F4BA 1V11A 3ROZA 2P30A 3FGOA 3JD4A 1YF3A 2D54A 2FE4A 4NHOA 2OOSA 1FVXA 4XD7A 1N2CE 4AJ2A 3LZDA 3OMLA 2JJ8A 4LHYA 3L6CA 4RENA 5KI6A 5ICGA 1DT5A 4Y6GB 4LHWA 2X8BA 3VNUA 1M2EA 3AZQA 3C4JA 4ITRC 4NPHA 1BGWA 1KEPA 1ZCBA 2IF2A 2IEAA 3DBRA 4MKFA 1YS6A 4LRTB 2F9LA 2C94A 3BFXA 4N82A 4NWIA 3VHQA 4NXMB 2J9FB 2Q7DA 3IHLA 1GU7A 1B15A 2PQMA 3SIRA 4GYYA 1KO5A 3FMIA 1GILA 3OH8A 4IIJB 3CG4A 5BMVA 1I7DA 1CQIB 3IQDB 3B1XA 1J1UA 1K0UA 5BQPA 1JG1A 1NSTA 1ZN7A 5K3FA 1FQKA 2XMGA 3QEJA 5AI0A 4DARA 3MERA 3TZLA 1SHZA 4PXAA 3EH1A 4HFJA 4Q1DA 3HCDA 4B4VA 4R2HA 2UVPB 3IAAA 1IY9A 1B6RA 1I3LA 1WWKA 4BQQA 3HJNA 2PUHA 1F48A 4H6XA 5LB4A 2ZK7A 1XVUA 5GY7A 3CNBA 4BX9A 1Z3IX 3ONFA 3DLAA 2OAQ1 4FWIB 5FJJA 1K75A 2YY6A 1IWBB 2GI4A 4AY2A 4CIDA 2FXIA 4YMSA 5DH9A 3BWCA 4WECA 3CLTC 1T8PA 3ZDRA 3TCNA 4B31A 4DHEA 3ZKWA 4NENA 4UW9A 1SC6A 2F9FA 2QRVA 5EERA 2OFFA 2HGSA 2ZW9A 1RQ7A 3CUUA 3N7AA 1Y42X 2PL1A 3IBGA 5D3MB 5ALYA 1J8VA 1VJRA 2G5TA 5TT0A 4R8MA 5CBPB 1J2EA 2H1SA 4ED9A 4RD4A 2AH5A 3HXQA 2D4HA 3W34A 1N5JA 1GT6A 1MC4A 1U1IA 2MU1A 3EB9A 4G5GA 4PHGA 4UNIA 3WMRA 3QUQA 1I9GA 5D1HA 1Q92A 2IOFA 5E4TA 2FEKA 3M82A 2W6OA 5SY4A 3RQSA 3RYHA 3V2UA 4RDXA 4KAJA 1EQ2A 3K70B 4Y7DA 4Z0NA 3HHPA 2CHQA 3SMQA 3U49A 4AIRA 4LF8B 1KYYA 2WTXA 4FD3A 4RTLA 4BAGA 1UOQA 4TQUS 4TYMA 4ADSG 4D9EA 1YVDA 1QG6A 3KYIB 1JMKC 4MOWA 1TVEA 4D9NA 3Q3GE 1JRLA 4GDFA 2NSLA 3AOEC 1NI4B 5DMHA 3NTRA 2CNWA 2ENWA 3A1EA 4IZHA 1MAUA 4V03A 2H08A 2O52A 5AVSA 2VI5A 3EPPA 4Q4JB 4WK6A 5DEIA 1T34A 3UO8B 4KEAA 4P33A 1U2DA 2VHYA 2I5PO 1Q77A 3E4DA 1LSUA 1DQNA 1U4OA 1U0JA 3OHMA 4JHLA 4K2AA 4RV5A 4YRNA 4GOLD 4W7IA 5DFAA 1HT0A 3T8YA 1T13A 1JFLA 2O4UX 3WFZA 3R6GA 4IVNA 3QSGA 4OHYA 3ZDYB 3C3DA 1Y8QB 3FNEA 3KQPA 5KNLA 1L5ZA 3MUNA 2IPXA 4BEWA 3RUPA 4H7FA 3ZUGA 3FJYA 5B64A 3N0TA 3AERB 1GPH1 6Q21A 5DYYA 2VFAA 1ZN9A 5E2IA 5FKJA 1MENA 4ME6A 1E92A 2R00A 4K1LA 3AVTA 4B4OA 2VT3A 3MIZA 1AS2A 4LJ5A 3TUZC 4Q0MA 5E8RA 1H2XA 4F5EA 2V7PA 2RHHA 1HE1C 2X9GA 4WJZA 4CJXA 5BSEA 2CLMB 1DQSA 1YJ8A 3F9IA 2EAUA 1R00A 1WSDA 2DULA 3PC4A 4LX8A 3VU9B 2AW5A 4QODA 3FBTA 4RDIA 5JD4A 1WBBA 1E8DA 2ECPA 3KYDB 5BPFA 4EGQA 4P82A 2F48A 2FPKA 2QYHA 2XCTB 2W2TA 2C9CA 4OOEA 1M34E 2BFOA 3FHLA 3SFTA 1NIPA 4F2PA 4UOEA 5HP4A 2I4IA 4RWZA 3ZGZA 3VZCA 2O8CB 4FJ1A 1Z5NA 2B94A 1IUPA 2PVPA 4PG5A 1Z0KA 4CODB 3OE7A 1EDDA 2RCNA 4WFJA 3CC8A 5TGTA 1YI0A 3L8MA 2WWXA 4ZYZA 1EP9A 4II7A 2BFEB 4V02A 1TQ2A 2IXDA 4HOYA 4O1MA 1ZIOA 3HB9A 3V7FA 2QXYA 1I5RA 3ZHBA 4XVCA 3FZYA 3KKLA 3ME5A 2G08A 4EB6B 1D4OA 4ARIA 4DIOA 3HBNA 3ZQKA 1AJEA 1WV0A 1LRJA 2FEWB 2YXDA 4PNZA 4NULA 1NVVQ 5IC5A 4JUIA 1CBUA 1Y1QA 4NS4A 1XB2A 5BWMA 2EFYA 3M1LA 3A04A 3THRA 3TTVA 4P3OA 4RD2A 5EJ7A 4GS5A 3CR8A 1WY7A 4YUVA 1HKUA 2VTKA 4AUEA 5HOQA 1DAHA 2VUIB 4G6ZA 2GPTA 4DSAA 2CYCA 2OVBA 3PXCX 4K0RA 4TKVB 2X8WA 5AHKA 1YQ9A 1FNMA 3AM3A 3CE9A 4L27A 2P6MA 5HHTA 4JLWA 5IKPA 5JATA 5MF6A 4A5SA 3PD0A 3KQHA 1QHIA 4KDRA 2J09A 5HGJA 4B83A 4FKMA 4QQFA 4XLLA 4JR2A 1EWYA 3VPFA 2ZYWX 3ZWXA 3AWIA 4DIFA 3R3SA 2Q3MA 3H04A 3QOXA 4IDAA 4KWIA 1PG0A 1R6XA 3CM0A 2EATA 3IP6A 1XLTC 4GNRA 3HADA 4MLDA 2EWWA 3V80A 3KELA 4GMKA 2WVAA 4BQEA 3GPCA 1N3BA 2IXFA 3GIWA 3N39C 1BZYA 1E1CB 5E9JA 2Z4SA 2BFWA 3SF8A 5EJEA 3BQ9A 2W4QA 2HSDA 2XT9A 2AKYA 2M6RA 5DISB 3THOA 2FWBA 2ZPTX 1I5OA 3KPUA 2QXTA 4RVDA 3L5KA 1U0TA 2V9ZA 3U5TA 1CHNA 4OLAA 1MO5A 2HMTA 3NEPX 4NCXA 1DG9A 5IAJA 5KVCA 3E84A 3C7CB 1JQJC 4YP9A 3WB2A 1ZIDA 1PDOA 3G2PA 2GJAA 2HHLA 4X66B 3HCBA 3F73A 3B3FA 3RYCA 2OWDA 3GRUA 4BNUA 1HDZA 3TRFA 5AVQA 3NKVA 4WE3A 3KT8A 3H17A 4I4IA 3FGPA 1TVMA 1EGMB 3CH4B 4MIOA 3L46A 3SS9X 2NM0A 4AZ3B 2N47A 4QXQA 1C3LA 4CUJA 3ZQJA 1SBHA 3CQ9A 1JIKA 4R9RA 4Z4GA 4IS3A 3KSBC 3M4JA 1UBHS 2C4WA 2CC2A 3LQYA 4Q9DA 4TTRA 4YROA 2ODTX 2OXEA 3FNHA 1Y6RA 2EJTA 2FPGA 3D7KA 1PZXA 4KBYA 4O08A 2ZIEA 4DSNA 2QNBA 2WJAA 1XHEA 3OIUA 4FUTA 5LU8A 1ETUA 5AKYA 1VYTA 2I78A 2R87A 1VG1A 4QTUB 3W5UA 4UTNA 5JQGF 1V2HE 5KYYB 1Y33E 3K9LA 1GPBA 4QDUA 3SFVA 5D2CA 3SOZA 4C7MA 2FMFA 1RS0A 4C3VA 1MT0A 3RREA 2FG5A 5AK0A 3KQKA 1T1SA 1OWOA 2EJVA 3PYMA 4LCBA 4ZVRA 4EG4A 2X8AA 3FZEA 3RJTA 1OXUA 4X63A 2X77A 4UHDA 1ZHFA 4DMKA 4X3PA 3T7CA 1Y9DA 1KPIA 3FHTA 2ZJ4A 5CNMA 3OEED 4XI9A 3BCUA 1KEEB 1QQ5A 1Y7HA 2NAPA 2Q0QA 4JP3A 1V45E 1JILA 1VBKA 4YCJA 3EZ7A 5LD2B 1A88A 1G8GA 1B8VA 2HA5A 1P2GA 2OBYA 2MJLA 5F5LA 1PLKA 3TR0A 3ZWKA 5CB4A 2DBQA 4N0MA 3WNVA 3WRXA 4EYEA 3N0RA 4CMHA 2IUYA 4OLFA 4CIXA 4RJKA 4HDNA 3CNOA 1AXGA 3KTAA 4DR6B 3WJ7A 2WHXA 3N2YA 3QOFA 5E3HA 1C1XB 1RHQA 4KPGA 4RY8A 5IW8A 3HJBA 3PVCA 2ID8A 1L8AA 2XDQB 3CIFA 4N47A 3NC1C 3WL4A 3P96A 1CRPA 4S2UA 3ZIDA 2W58A 4FQ5A 5IVKA 3FMGA 4EDHA 3L7JA 3RBZA 1YHYA 1N7GA 4G5SA 3P9QA 5E3IA 1P2FA 3ZWDA 1JJAA 1FFBA 1H2EA 1C1DB 4AURA 4IH1A 3UWPA 4FLFA 1XJ0A 4CKXA 3IUYA 5E2AA 3TQQA 2V6JA 1II8B 1A7UA 2XDWA 1WMBA 1ZP6A 2GFHA 3B1WA 3MBOA 2C58A 1E6WA 1D8AA 1NQ5A 2AG5A 3E1KA 2NU8A 3SY8A 4B6SA 4DXDA 1LI7A 3EBPA 3A4IA 3D6FA 3P2EA 5K0GA 5DVZA 2QEQA 4YMIA 5AM4A 1SZJG 1JG4A 1Z07A 1J9ZA 3H2BA 3HUEA 4C4PA 3EXHA 2QMHA 2G40A 3ONEA 3ZUPA 2FPMA 4TKVA 1IXKA 4Q6BA 2BFDA 4B7XA 4IHQA 1IN1A 4XYGA 1DADA 3T0IA 3G59A 3V46A 3IALA 2YWFA 5A4IS 1JIUA 1QYWA 4MVCA 1XJWA 4ZFNA 2QL6A 2WOOA 1N6IA 1PR1A 3OM8A 1CETA 1U4NA 1S8AA 1ZYUA 4MGHA 2WJVA 5JBNA 1QHGA 2CBGA 4YAWA 4BFWA 1O94A 1SBCA 3W9UA 2PGOA 4XLZA 4FFNA 1YOVA 2JGDB 3WAGA 1OFGA 1DQZA 1I0ZA 4PBSA 2PJZA 4A3SA 4EMBA 4GP9A 1LJLA 4ARZB 1QORA 3O8LA 5F7XA 3IKMB 3A6GA 1J6UA 3T52A 4F04A 3DL7A 1DIBA 1TKAA 1KBOA 3EASA 4LN1A 3DP7A 1PV4A 1E1CA 4TS4A 2DB3A 4WOJA 2MSLA 1HZZC 2X4IA 3B9BA 1TFUA 4Z9AA 4MJXA 1CF9A 1BSVA 3QVLA 4RVUA 5EUQB 3UVEA 1GTL1 3EF3A 5CM9C 4ZT7A 4D79A 5M2QA 4QUGA 1SHTX 1EK6A 4ZC1A 5MN6A 1M6VB 1W35A 4HXEB 1VL6A 1Y48E 3HKDB 5I7WA 2RG1A 3SNHA 1T5LA 2P3QA 4IVPA 4M53A 4O0LA 2QJTA 2AFHB 3WZ2A 4IMRA 1EPUA 2R5NA 2UZ0A 2YWRA 3BMNB 2JI8A 3NVKI 5CG2A 5DM1A 5JAPA 4L3VA 3CKYA 3QXCA 4GRIA 1VHWA 4RMNA 3R7WB 1E99A 2Q1YA 1VE9A 1TYZA 4B7UA 1KK2A 2O6HA 4CT4B 5BUCA 4XWKA 3I8SA 3VGJA 1Z37A 3K92A 4MUYA 5AW2A 4XGQA 1M1YA 1ODIA 3E8MA 3KSAC 1DWQA 1NI5A 1RLUA 3AJRA 4LA4A 3UQZA 3II6X 4BZXA 3D31A 3HJFA 1WETA 4YUXA 2NMVA 4EK9A 5F2OA 1I9CA 1XZPA 1VTKA 1BGXT 1ILEA 1C9YA 2A88A 1ZUNA 5FPTA 2A9PA 2EBUA 3E7FA 3IUBA 3N75A 4J9UE 4WLUA 1Y1LA 3UM9A 3VU8A 4EENA 2ZUSA 5CLFA 2Q1XA 3HM9A 3HWX1 1RSZA 1J49A 3KU1A 1D6NA 3WBFA 2JRLA 1XRMA 1RHJA 1XU4A 5KJEA 1T3TA 2OORA 4EB8A 1JB9A 2ISCA 4G5OA 2IU4A 3WLRA 4GXTA 2HMSA 1YL5A 1VBFA 1NJ5A 2W2OA 5JFGA 1RRKA 3VISA 4GKKB 5FFNA 4JDUA 4BJ1A 1U3DA 4JA2A 6REQB 3GCWA 1VSTA 2OFPA 3DL2A 4XFKA 1RW4A 3LCMA 4Y18A 4PS1A 2BYTA 1LDEA 5A05A 3UMSA 4OP2A 2W11A 3HPQA 1ODLA 4AKEA 5EIBD 4XYMA 5AJXA 1S96A 1XP8A 1V5WA 2NW6A 1WTCA 2V6FA 4QU0A 4X45A 3D59A 3COSA 4QBKA 1KAHA 1IEWA 4KXUA 3VPAA 1AKTA 2AJDA 5JAZA 1T1IA 4FX2A 2XXAA 3O8RA 5FUVA 3C97A 1D5CA 1X15A 1FQJA 3IBCA 4MWGA 1DU4A 4G1MB 1EK0A 1SZDA 2MOKA 2DHEA 4ZQGA 4RL6A 1VFPA 1U2SA 3W8FA 3MK31 4IW3B 2CVFA 3QE3A 1OFHA 4JLMA 3AY3A 2PFSA 1ZNWA 3EG9B 5JJBA 2ZWMA 2YVUA 3H3FA 3SYRA 4L50A 1Q11A 3OJ0A 2UAGA 2JLSA 4B6GA 2DYKA 3OEEA 1MOZA 2JBHA 4A36A 5J2TB 2FEPA 3C3PA 3PGA1 3DVAB 4GXRA 2DBYA 4MWBA 5TSDA 1W34A 2IY8A 4C04A 1YONA 1T24A 1XOIA 1PQUA 1QKIA 3IEMA 2JFZA 3TTXA 5DNVA 2IU6A 2R8BA 2RHTA 3V4OA 5EL0A 3BIOA 5LQSA 2QORA 4OM8A 1PS9A 3C2QA 3RIMA 1QK3A 1QCDA 2EZ8A 3DFKA 3O83A 1V8DA 4LZLA 4QGFA 1AB5A 2PSJA 4D96A 5DNCA 2GSDA 5ENZA 1KRWA 3DE7X 2JGKA 1GQSA 4HMOA 2WU0A 4DMMA 1TYCA 3PITA 1O97C 5LZ9A 5K3FB 2XNDD 1L4BA 3GLUA 2BE7A 3KIPA 2QQFA 3ZTWA 1B8PA 4KRYA 3E5NA 4EO9A 4NLLA 1Y98A 4QC2A 5ULLA 1UFOA 4YHHB 1ADBA 2X41A 1OH7A 4TX1A 4YP5A 3RQIA 2UYOA 4E5MA 3OY7A 1GIAA 3ADBA 1GQYA 1AMNA 5E0KB 2C9BA 3IVCA 1KFCB 4QSHA 1S9DA 5DNDA 2BJVA 2V8OA 2XT6A 1K5HA 3BMXA 4KFRA 2G0NA 3DOEA 3IVMA 2JHGA 2OP0A 3VOTA 4JL6A 2Z5GA 4UEWA 2CBXA 1R0RE 3KSRA 3HP7A 1QQAA 2FMUA 1QYIA 4YJ2F 4PGFA 2R7AA 1VB5A 4KQ1A 5IFLA 2XWQA 4IIEA 3LDUA 5CVVA 5IDVA 2VCEA 2QAGA 2VC2B 4JC8A 4ENSA 1TMGE 1XJ5A 1H9BA 2O50A 3LBYA 2NG1A 3L7MA 1KVSA 4B81A 1DC5A 2HGZA 3JQBA 4RQAA 3X1KA 1MX1A 4RZXA 1L4KA 4BKPA 4KOAA 4DLRA 1N2HA 3IJ5A 4HVLA 3A4TA 1PFUA 4MCIA 3E4CA 4CDGA 1Q3TA 2WD8A 3MWFA 3FB1A 3M5WA 5C3MA 2VKQA 4S1PA 3NNNA 1CZOA 2ZS9A 3FYUC 2V6MA 2J9RA 2WTEA 3WBKA 3AIOA 5JADA 1VJTA 1K2VN 2G1JA 4ZZIA 1AO3A 1H6CA 4P53A 4PSKA 4Y67A 1XEXB 1CVLA 4X54A 5CFMA 1WMFA 3MGKA 5H5JA 4RU1A 2IV2X 2BM9A 2FWPA 2I34A 3ZLUA 1QAQA 5FWAA 4ENPA 1FSSA 4FTWA 5IUJC 3Q41A 2HNAA 4KR2A 1A95A 5HW0A 3ZJUA 1DKUA 1U8EA 1W0JD 3OJWA 4F5DA 2XCUA 1I30A 1T5BA 2BEJA 3UWMA 4MXDA 3GW8A 1ZHOA 3A1NA 4HKTA 2VDKB 2A2ZA 4JX8A 1RXSA 2H54A 2AFIA 5FRDA 2ONJA 1EX9A 3FDZA 1DBQA 3AVXA 2GB4A 1Q74A 4MR9B 4Q4JA 4AYWA 1ITZA 2YXPX 4A6XA 4RD0A 2QJRA 5BUZA 1G6Q1 3FSGA 2VHCA 4TL7A 4F5WA 2PLFA 1KZ9A 1AHNA 1G0OA 2EBHX 2MHCA 3F7MA 3JX9A 1E6KA 1GUBA 4QIHA 5U1PA 3TIIA 5IN4A 2IH4A 1E9EA 4WIAA 2P9ZA 2HA3A 1ZSYA 3F2VA 4XWAA 2AUNA 3DHEA 2H7XA 1U0GA 4PBRA 3IMFA 5M34A 2QUAA 4R3UC 5E4FA 1FXWF 1W1UA 1ENPA 4RA9A 1W4RA 1Q7EA 3UGQA 3BHNA 3K20A 4LNHA 3D0RA 2PE5A 3VQTA 2E2WA 1F0KA 2X2FA 2IXBA 3LBIA 3QWIA 2CD7A 1L4LA 1NUAA 4BEVA 4D3XA 2GA8A 2N42A 1WV1A 4F2WA 4LDNA 4J0GA 2GGSA 3HYRA 2PKCA 2I2CA 2X4GA 3H6GA 1YS2X 3IC5A 1FMCA 4WCFA 1JKXA 3RC9A 4B6RA 5HR5A 4BCBA 4KXQA 3QSYA 4YAOA 4Q05A 4OHVA 1Y9EA 2V3VA 2IIQA 2LDBA 1AKYA 5JD6A 1PDVA 2HA2A 2WUWE 4D0LB 5EHXA 4BVFA 2VJAA 3C5VA 3IPCA 3N28A 4IWYA 2IXTA 3K2EA 8LDHA 5D5HA 3G6WA 2VUUA 4INZA 4UFNA 1SUEA 4RJIA 1O97D 3IPLA 3KALA 2W6PA 3S27A 1YJCA 3C7TA 2PVCA 4DUZB 3TKYA 2X3FA 1XDSA 4MRAA 4TTPA 5HS4A 5ENDA 5BNWA 1E2PA 2Z2IA 5EEHA 2QD3A 3PWTA 4Z1MA 3G8DA 1E1QA 1OGIA 4DQUA 2FDRA 2LKCA 5KTPA 3P94A 5J2TA 1XA3A 5CDHA 2FDCA 4JZKA 3F5SA 1LVUA 1A9YA 4R3WA 4ZVOA 4EI2A 3BFPA 2QW0X 3BXHA 3ZHOA 2JI9A 1CRWG 2OFXA 1BW9A 3SQNA 1YVEI 2WOJA 1GVHA 3FF4A 3ILXA 3U4AA 1CDEA 4ML3A 1KIAA 3DL4A 1JAHA 1P44A 3GMIA 4L3WA 2E5LB 1SOWA 4QBHA 1UFVA 1L4GA 4AIIA 4WH0A 5KYNA 4MQ6A 4JIMA 1BJRE 1OC2A 1YR9A 1UPUA 3CF0A 4HDSB 2VAXA 3EHEA 1ISRA 2XCOA 3L3BA 1GTRA 1AKNA 1QSGA 1XTUA 3DE4X 2WTAA 4LZOA 4YCCA 1S8FA 3QKTA 4JS0A 1DEKA 2YWJA 2JCGA 3ND6A 3O2SB 4LDPA 4EX7A 4WBXC 1EIZA 2QSUA 2IPNA 2ZT8A 3OPYI 4UXHA 4ZO8A 1PVDA 3BH6A 5FUQA 1YZ3A 2FSUA 4RZ2A 4I8IA 1MMFB 4KQJA 3EFOB 4OBXA 1MZPA 3G0OA 4L8YA 4DQVA 4PZ9A 3W1EA 1C9JA 1XTTA 2CNBA 2VHUA 2ZBVA 3RU2A 3O8CA 2O8VA 2W71A 2Q8NA 3CT6A 3E48A 1BS9A 1WDTA 3MWJA 5TS2A 5JH7A 2AK3A 3RSOA 2CUNA 5FH9A 2QRGA 5DBGA 1GDHA 3KDPA 4GMXA 3RYTC 2W2KB 3KR9A 2XD4A 2DERA 1GRQA 5K8LA 3ISVA 3DEIA 1XRLA 5AW5A 4KQKA 4YJHB 3A9TA 4RSHA 3ZS8A 2DY1A 3DTVA 3VH2A 2DHQA 1E77A 5FV7A 1US8B 1SNYA 1QBKC 5DBOA 3VOAA 3LV8A 5L4NA 4GKJB 3K2BA 2EEPA 2MTBA 4DDTA 1NW3A 3BM5A 3C8HA 1IQPA 3FPJA 2ZSBA 1Q0HA 4P5EA 1UC8A 2VVTA 1WOYA 3I1JA 4HPXB 4RLHA 4EH1A 3V4PB 1E5XA 4PYKA 1W4BA 3AUUA 4IQGA 5JW6A 4OFWA 3KJEA 2HMAA 5T4EA 4IDFA 4OGGA 2Z4TA 3OICA 5ELMA 3WICA 1JA1A 1JE1A 5ALOA 3H86A 3NS7A 1KDZA 5CR9A 4EJFA 5B6PA 5TMPA 2Q2NA 4FINA 1DAKA 2K6GA 2ZSEA 3ENQA 3D3JA 5DWDA 3R3JA 2NPIA 5HMMA 4LF6B 1KI2A 5EKTA 4NBLA 4B32A 3ZVKA 2Z8YM 2F8SA 1YQTA 3U60B 1OOEA 2O8EB 3TX2A 3JPWA 1S7GA 2RGUA 2HYDA 1HDIA 3IX7A 3NHPA 4GICA 5K5EA 4M1ZA 5HM8A 1PG5A 2GF9A 3HB5X 1E1YA 1YA4A 3TLGB 3A8TA 3DC7A 3L0DA 2DUWA 2J3KA 1I4EB 4MUXA 1P17A 1ZD5A 2LCFA 1FDIA 3EC1A 3LBFA 5KSWB 4JVNA 3NGXA 3FPCA 2VAMA 1MXHA 1DMSA 2WJIA 3DM5A 3T5MA 2UYGA 1M6WA 5ARDA 3VNQA 2AW3A 3Q7TA 3UH1A 5LP6B 3GCGA 2H5LA 4QPDA 3WDKA 1P5JA 1T8WA 3O1JC 5EHGA 3FUWA 4R8SA 5HFAA 3DZGA 4F1KA 1XDDA 1VLJA 3AUXA 2EFDB 1THMA 3EXEB 4G89A 2ZAOA 2H2FA 4CR8A 4GPTA 1U1CA 3D4NA 3FPAA 4IJMA 1W48A 2NZYA 1EESA 3L4SO 5H02A 2VQ3A 4JLSA 4HEQA 1UP7A 2W6MA 1LI5A 3NOOA 1WUIS 1SA0A 3ND7A 2FUKA 2FAXA 4DDHA 2O9JA 1KVRA 3J7AC 1QGAA 5BW6B 3IEUA 4Y2TA 1ZM4A 3GGJA 1CVRA 1VYUA 2DPXA 5TGDA 4A2WA 5JZBA 3JVVA 2P6RA 4IIYA 1KYWA 1M10A 2BL4A 2WHPB 1SKQA 4DR5B 1VPDA 1KYVA 4MUHA 2X13A 3EGEA 1ZW6A 2HZ7A 3GGGA 3ZV3A 1GLGA 1PL0A 2VPPA 2NVBA 2A9RA 3CF4A 3ZDDA 1NASA 1RBYA 3MUEA 2AUMA 4A8HA 2C1XA 5K45A 2ZRHA 4EJSA 3KUDA 2X7HA 1KMHB 1X9IA 3FVQA 3LKBA 4P5PA 3NBUA 1IEXA 2FOLA 1G5HA 3D54D 3H8VA 1EFTA 4PSVA 1RRPA 5IM5A 2C4TA 2AF4C 2VNSA 3W5VA 3NR2A 1GKUB 1KI1A 1CQJA 4H6WA 4QL3A 1J7JA 1S3IA 1KJIA 5GIOE 2ZYDA 1KZGB 2OXIA 3ZVLA 4ZVSA 3RUAA 3ONVA 2BLNA 5CK5A 3IE2A 3UMVA 2GYWA 4TTSA 4DJDC 6REQA 3H75A 1DLIA 3LPLA 4K9RA 2FR8C 4NBTA 2C2OA 2OHHA 1ODCA 4MRMA 1OE0A 1IHPA 4U7PB 1D9ZA 3OF2A 4QOGA 1IUKA 4ND1A 1LW6E 5AW7A 1J0DA 1R16A 3FOCA 2N1BA 3O4RA 5E6UB 2W2XA 4ZAWA 2E49A 5FL3A 1OAAA 1O5IA 2W6JA 4LV6A 3VOBA 1KZHA 3G1TA 2XEXA 1RWXA 4LKOA 1XI2A 3AY6A 1Y6GA 4Y2QA 4COKA 3PQFA 1SVOA 3QI7A 1KQNA 3G7NA 1U1GA 5FV4A 1XNGA 1YAJA 4NTZA 1PT7A 1U9CA 4URUR 4QXPA 2X19A 5HKLA 5AVXA 5DHQA 3THXB 2PGIA 1A4RA 4L9SA 1TGYA 2F1IA 3QIVA 3TMKA 5IT5A 2IF0A 1JI0A 1LQ2A 2WIAA 1XR3A 4BMOB 2OCXA 2QT0A 2AQ8A 1N8TA 3LFUA 3T4EA 5EKXA 3WYFA 2QVGA 1ISPA 3F7OA 1SKMA 4K40A 4U4AA 2P6OA 3A2MA 5EESA 4Z7QB 4JI4B 4BX3A 1IWPB 2XECA 2J3LA 3T3EA 3STXA 3PUZA 1R12A 3SD7A 5J43A 1U2ZA 3D6MA 1TO6A 2BEUB 2WDPA 2WUVA 2YVQA 1MW8X 1PFKA 3DE0X 3HN6A 4MV1A 1Z22A 4R6WA 2IYTA 2IHBA 1PNTA 3R1IA 4B74A 4ZT2A 2ZKLA 1YS1X 5FA8A 2FLWA 2YJNA 3I6BA 3QVVA 2HWXA 4CQJA 5E8JA 5C53B 3S5JA 2R4TA 1C7IA 4TXJA 4Y2XA 2AOXA 5DNUA 1BU5A 3AIKA 3GJ0A 4Q9LA 4FILA 4XIFA 5G3YA 2AWNA 2ZTHA 2RHRA 1F14A 2DF8A 2VYQA 2YYSA 4IDPA 4TUYA 5JI3E 1A1VA 1G9SA 1IXRC 4MMYB 1E7YA 4J2OA 3BFVA 5KQGA 3EE6A 3JTMA 3PXGA 3MEQA 2V7EA 1QKKA 2ZEJA 4JOQA 4EQ6A 1QYXA 2CLHB 2LCIA 3FB4A 2DT8A 4UD6A 2H5EA 1KKUA 3OOHA 2FFQA 2AQKA 3D8RA 3EVGA 3L1KA 3R7NA 2GHIA 3E3LA 4D80A 2CXPA 4OKIA 1SB8A 4YY3B 5LLTA 1E8NA 2GPSA 3B1FA 4FFWA 4N12A 2JFUA 2CXHA 2KBEA 3EOAI 4BATA 3VR4D 1JWBB 2AMLA 4DA0A 3RVSA 1L5SA 4RHYA 1G63A 2PU7A 6PFKA 2XTZA 1Z0UA 4MZDA 2ALJA 1E79D 2O8NA 1N1MA 3B70A 1DRWA 2A35A 2ZOSA 1OXVA 1UKCA 9MHTA 1K4MA 4GPAA 1N0IA 1CJMA 3PRHA 2W0SA 3TLKA 3V7WA 1UDWA 1RHMA 1EXWA 4QOSA 2ONYA 1CUCA 1NRXA 2DCMA 3OO0A 4P4LA 9LDTA 1A2QA 1ZD9A 5J4KA 1CLUA 4IHAA 4XJTA 1SQSA 5HRUA 2XMDA 3ZDCA 1OVGA 3QOYA 3FSGD 2OXRA 1SVSA 3U37A 2Z08A 4NCKA 3L7KA 2OB1A 3H2SA 4Q1AA 4AXXA 4KGDA 4B0PA 4DCNA 2OZVA 1QOZA 1RCFA 1TI7A 1XTIA 4OSEA 4TTTS 2FUG1 1F6BA 4YYEA 2X8JA 4YRAA 4RWEA 4UMFA 3OCXA 4AMGA 1G9XA 1HI9A 5LQNA 1FSZA 2QUZA 5CB8A 5GZ1A 1QX4A 4MUFA 3AOEA 3QKWA 3I64A 3T7TA 4DQDA 3GEMA 2F1OA 2Z8ZA 3M4XA 4LZAA 4K86A 5TQVA 2VSNA 5JVDF 1AV7A 2GD0A 1H1LA 1C0EA 1I1HA 1WAMA 3T06B 4KSCA 5A7FA 5TIIA 4OMFG 1D2NA 4PGGA 5MN5A 3JRNA 2WK1A 4CKEB 3L18A 2C5FA 4J49A 3MN1A 4L4XA 3RNOA 2DP4E 2RGBA 4GM4A 4WACA 4J1TA 2GN1A 4Q3BA 4PN7A 4GQIA 2G09A 4X84A 1J99A 1QIEA 1Z29A 1SBYA 4D9KA 2JIQA 3IKJA 1M2WA 4LYYA 3BRQA 2VF5X 4PYOA 5DCYA 4W99A 5B3JA 5KQSA 2WU1A 2FSVA 1JHAA 1DIOB 4JVSB 1R0KA 2B8NA 4JOSA 1GGFA 3DMNA 1JLSA 4TL6A 1HNZB 4Q02A 3OEWA 4KWHA 4KLAA 1C5KA 3RRBA 3OQMA 1SB9A 1IHYA 3DCJA 3QLUC 4LWOA 4QJIA 4U2BA 5A4JA 2OZPA 2DFLA 4GMHA 2O8DA 2DFNA 5CTJA 5DO9A 3UHAA 1XEAA 3A3KA 1RTTA 1TZBA 3H2JA 3MCTA 3AFIA 2P0YA 1LLQA 3W5DA 1KJYA 1TB4A 2O7SA 3OT4A 1JR3A 5EHIA 3B12A 1K1EA 5CYOA 5KREA 4UEQA 4WESA 3JAMA 4QVIA 1C80A 4CG0A 3CIOA 5C35A 4M9XA 3SYTA 1Q0RA 1COWD 1XCBA 1N3LA 2FFAA 5IF9A 2PIAA 4DTCA 1UDBA 2Q0HA 3G5MA 1Y8QA 3KPWA 4EJMA 5BWLA 3QE2A 3ESAA 1Y3DE 1T5HX 1UJ5A 1Q1AA 2BI4A 1S8NA 1XZAA 4PQFA 5A0FA 4BMVA 1W4ZA 4IS2A 4ZI3A 2VNKA 5C5DA 5K3AA 5ALDA 4O2AF 1DV1A 1UEIA 1T3SA 4D3ZA 5KBYA 4CN9A 2CEKA 3PFGA 5DU2A 2DETA 1DLJA 2D7DA 1D5WA 3EMKA 3G5UA 4W8GA 4TUYF 3LBHA 4WBNA 3IA7A 2ZZNA 2VJBA 3BXPA 2AOWA 2KHZA 3Q40A 1Q7GA 1ZUWA 1ONNA 2A0UA 1L5FA 1UMCA 2CF5A 3OT1A 5WRFA 1OT5A 2WBLC 3ZPXA 2RC5A 4B3JA 1LK5A 4ZZ3A 5IS2A 1Z4JA 4CIVA 1CEQA 1GU0A 2VHJA 1RAFA 2QYTA 3AV3A 2E89A 2H65A 4F97A 4JV5B 4RTSA 1HFEL 1ZCJA 3VO1A 4TV9A 2P9EA 1EX7A 3AILA 3STHA 3LIPA 3QX9A 2COUA 2FW8A 1B2RA 2OXFA 1NR5A 1WXDA 5JZOA 1I7QB 1GL3A 1MXFA 1XZQA 1OWNA 1TDJA 1N32B 3I5YA 4EI8A 1M6NA 5GJVC 2QHXA 1ZD3A 1U4SA 2ZZMA 1DX9A 1DBWA 1SPBS 3EPLA 3RJ5A 3EPJA 2PMEA 3Q2IA 2XWPA 4K6FA 2OCIA 5TPZA 1U1DA 2CLEB 2NQ2C 2R48A 2A1TS 3UFXB 1N0HA 4B73A 1BDHA 5HK8A 3UYKA 2CHGA 2CNKA 1M2OB 1U3WA 1UJ6A 1BXKA 3LC2O 1NW9B 1Z17A 4LXTA 4PNPA 4NV3A 4HN4B 4LRWA 1QLHA 4CQLB 5HUQA 1N36B 3IHWA 5CLHA 3WQSB 2JIMA 3OE5A 4Q7KA 5K99A 3VRHA 1LW7A 4UDNA 4FDLA 1WMSA 3QXGA 4N40A 4NZYA 1XEWY 1GNVA 5KU7A 1PLJA 3UT0A 4X7BA 3NTOA 3DFUA 4G0MA 3FZGA 2RGYA 1PUXA 3MSCA 3UN1A 3WNDA 3WXBA 3PUWA 4RLFA 1C0IA 4NCAA 3VR5D 2P41A 1E1DA 2XE4A 2O0JA 1WW2A 4KE8A 3UH0A 4BNZA 3F0TA 1RQPA 2OVFA 3DMPA 3FTPA 4A8JA 1MU0A 3E6AA 5JAHA 3L7LA 3LUGA 4NBKA 5CT8A 1I3CA 3IAS1 2XTMA 3RFFA 5B2FA 1AO0A 1SOAA 2GERA 2XNJA 3HBAA 3R7LA 2C61A 1ESDA 3HFJA 1OAOA 4PZPA 3W2TA 3A4MA 5CH5A 2VHQA 4EPRA 1E62A 1GG5A 3FPGA 3RAGA 4B3RB 2HTEA 2ZT6A 1Q1EA 221PA 3QENA 4QFDA 4RW0A 3OZIA 5BOSB 2I4OA 3D5EA 5SZJA 4GL2A 2FR8A 4IXDA 3PEFA 2XX3A 4GWGA 2R65A 4Q00A 3ZJ4A 3LUJA 2DLCX 3DDZX 1E1LA 1WEKA 5SYNA 3VPDA 2OGUA 4JT9A 4JKOA 5BURA 3EZLA 2YJ5A 1J22A 4RDCA 3IJEB 4M60A 1R0CA 3LQRA 3PJEA 4UFOA 4DVJA 5LN1A 1J0XO 3OAAA 4AZ0B 3TKAA 2YFQA 3VZPA 4EZEA 5AVZA 1S02A 1JA9A 2OGSA 1F0YA 2Z2JA 5HGXA 4UAUA 1SC9A 2GYUA 1MW9X 2GJ4A 3PB3A 3OZVA 1PW7A 4X60A 3PHLA 4YCDA 3DMGA 1R4AA 3HBLA 1XQ6A 4LC1A 3GLQA 4P9NA 3WK6A 4PQRA 5BSKA 1BDBA 2HF8A 1SBIA 2PRKA 1E3EA 2JLXA 4P83A 1QS0B 2EVWX 3BWMA 4TWZA 3PT9A 2P1RA 1L7AA 3VHLB 1VE5A 2HIGA 1A8IA 2WB4A 4ATNA 3FCUB 3M33A 4TKMA 4BNTA 1K5DA 4DLNA 4JN6B 1ZM3A 5H81A 1T2DA 1RYDA 3GYBA 1OT3A 1CY7A 3D1LA 3NALA 1IZ0A 4OB6A 4P3NA 2XCSB 3R5KA 3DAOA 4YECA 1JT2A 2DUJA 4IHJA 4YIKA 3F67A 4CM9A 2GAAA 2QGNA 1KMIY 1DX4A 1KSHA 3QUBA 2XOXA 1UJ4A 1BEZA 3PJFA 1F4PA 5K0JA 3T5CA 4JA0A 2HM7A 2QVZX 4DA4A 4HEHA 3LF1A 1P9OA 1Z2NX 1OZHA 1N1DA 4PPFA 5B1EA 4UCWA 1A8QA 4FFLA 1CUBA 4D74A 2RJ3A 4MP3A 4UM8B 4B6QA 3MELA 1X7WB 3COWA 4JEIA 1T9DA 3EVAA 1HT1E 1Z0ZA 2AXPA 2IP4A 3DGEC 3EF0A 3ELDA 3EVDA 4IUCS 4JJ7A 5ALEA 4HAVA 3N59A 1YZUA 4I55F 1B3RA 1PV2A 4ZC8A 2Z83A 4KWEA 4UUBA 1UWVA 4CNBA 4JI7B 1W4LA 3OTGA 3UC5A 2JFHA 5KNBA 3LCUA 3BD9A 3OJCA 2WZCA 2ZTMA 4PX9A 4EHHA 5A6SB 3RPEA 3F5DA 2IH2A 5CK4A 3QVUA 2Q0SA 4O4JB 4Z4IA 1NQXA 3A9UA 1Z5UA 3UMFA 3UT5A 1BHQ1 4ZDKA 5THQA 2ADMA 4IFEA 5A5FA 1Z7YA 5CB6A 3ZY4A 2AFHA 1QU3A 1Q1QA 3B85A 1Z4QA 2Y1DA 3AFMA 1KAGA 3U9LA 3D6HA 1T6XA 4W82A 1ZDMA 2VRCA 5EJ2A 3RT7A 5EJ4A 1LLUA 2ATCA 4BCCA 4I46A 1QP7A 1DAPA 1KFEB 5CIWA 3W3ZB 4IYRA 3WSTA 4CMIA 2FN8A 5HUJA 3ZWNA 1K97A 3PFHA 1AA6A 4MWCA 3EYWA 1BX0A 1M67A 1ZNXA 3E70C 2ZJFA 1EBFA 5FO0A 3SDZA 5CD1A 3QFHA 4C2TA 1UAYA 2GBPA 3HS3A 3DTNA 1J2RA 4M7OA 1P4AA 4UAVA 4B09A 5B5SA 1JEQB 4PYQA 4HNAA 2NZXA 3AEUA 2SCUA 2OO3A 4BRUA 4RXMA 3PE3A 3DEYX 4MEJA 4W4TA 5BORA 4UATA 4XX0B 2OPBA 1MJHA 1U7WA 3Q9LA 4JSYA 1E9RA 4JIGA 3M5CA 2AG8A 3MWKA 4M8NE 4J2TA 4BMZA 4ZI7A 2M6SA 1JHPA 3KLOA 4PPYA 2A57A 2WYHA 3ADKA 3OA0A 4EGSA 1TQ6A 3GH3A 3KTAB 2AOVA 4R16A 3QE4A 1W29A 4O33A 3TDNA 4R01A 1TYEB 2O59A 1BX3A 4MUIA 3DE6X 4Q15A 3I2IA 4MS3A 3BN3A 1I3NA 1ZHHA 3DDWA 1BE0A 1UUFA 1C7EA 1G5IA 1U2EA 3PYLA 4JGGA 1WDWB 4LJ4A 3I9LA 3SSMA 3WLHA 4G5FA 4BKQA 3U7QB 1L5HB 2DXIA 1WB5A 2WA1A 3RSFA 1KKMA 1OAKA 2IXGA 2OZEA 3LPNA 3W3AH 1R9MA 5HE9A 2E6UX 1D07A 1XX6A 2GMWA 2XF2A 2QTAA 5GP1A 3SPXA 4DIKA 3UPTA 1E9DA 1AVTA 5I45A 1UBCA 3HBJA 2I8LA 4FMDF 4O02B 1OJLA 2GF0A 3A6KA 4WD3A 2H7YA 4IBOA 4ZRNA 2HSJA 4FS8A 1CQIA 4MW2A 2FPSA 1EU1A 2YZGA 1FC0A 1LY1A 3H0EA 4H17A 2AJCA 1IOZA 4Q1VA 4WZ6A 1AQYA 3B13B 3FHCB 1L5NA 5FBHA 3FHJA 3OLQA 4N5NA 5GOTA 4YAJA 2ZSDA 4Z4FA 4MIYA 4PC1A 1DJPA 1JUDA 5L3RA 5SZKB 2QDKA 4PIMA 3VR1A 1QQBA 1YB2A 1WJGA 4R9SA 4DA8A 1F60A 3DMRA 2PYIA 2QI9C 5EINA 4XSGA 2JHFA 2R6HA 2YZ7A 4NZPA 4L07A 4OH7A 4PTLA 4DMCA 1BROA 1HT3A 2HI0A 4I1SA 4E1AA 4URVR 4TTJA 1FDSA 3E3MA 5IBRA 2O23A 2VIIA 3TQOA 3NC0C 4F8JA 1W0KA 4XFJA 5G1NA 5CA1A 5K2OA 2JDID 2JRCA 2R751 1PP4A 5EIWA 5JSQA 1LUAA 3AYXB 3L7OA 2AHRA 2H8KA 4ZOAA 2WC1A 3ZJ5A 4EUHA 3ISTA 5L3QB 1V9SA 4FZ5A 1X38A 4PGMA 1K3FA 4D4GA 2QRHA 1EUYA 1SD2A 2CK3A 3PKJA 2YYYA 1T6ZA 4BFCA 4DV6B 1NW7A 3GEBA 4A8JB 2XRMA 1AQ6A 1EFPB 1EXNA 2IYQA 1QFYA 4U2DA 1Z4IA 2IGTA 4QQKA 4EZIA 3WTCA 3HYNA 5FWYA 5JECA 2JKZA 1YDWA 2QM8A 4PE5B 1E3MA 2CGEA 3H2YA 1U7HA 3A58B 3N2LA 4GKVA 4MVJG 5IU6A 1N78A 3B3AA 1AN9A 1JLMA 3JD0A 1RZRA 1I2MA 2O7RA 3VH4A 1UKVY 4LG1A 5AKXA 2GSWA 2H2IA 2GTHA 3MGAA 5DXJA 3M6UA 3MJDA 1IN5A 1K7FB 1WM1A 2OHJA 3L84A 1R5JA 3EWSA 4MUMA 4PX3A 2QNRA 2GN4A 3SJCA 3VTFA 2ILVA 2PUGA 4DANA 3CYFA 3HLTA 3H9GA 3Q88A 4QVKA 5AW9A 1C8VB 1GPAA 1LRLA 1NKVA 1UXGA 2SNIE 4IG9A 1V0JA 1YZLA 1OFUA 2IYSA 4BVKA 3ETGA 5KTRA 2QAGB 4ON9A 2NO0A 2DTXA 3K05A 3S3TA 4AMBA 1GPKA 4AMUA 3BB3A 2FOXA 4JWTA 4PLTA 3SSOA 2QTGA 3H6KA 5ICCA 2PR2A 4IP0A 4HWRA 4MQFB 4PSDA 2F43B 4HQKA 1IZ9A 3MJEA 4W9NC 3ZIAD 2J3DA 4DMHA 3B7WA 1Z7BA 2O05A 1R3DA 4TVBA 4JGIA 3GBVA 4WUVA 3WKCA 5GIPE 2DR0A 2XCIA 4W6QA 4EEKA 3HZZA 1ES9A 3JQAA 3U3ZA 1KVUA 3ZIAA 1ID8A 1T0HB 3EAGA 4H7HA 5B6IA 2PUTA 1GPUA 5JG7A 1WCXA 3LCRA 3C3WA 1L3IA 2VQSA 4JL5A 3SQDA 1EJ6A 4LOJA 4BVAA 3OSUA 5KJ1A 1JHDA 4XE5A 1BQ3A 3FH0A 3RW9A 4WTOA 4MUJA 1F8UA 4GE0A 7ABPA 5A2QA 2DKFA 2H06A 2IE0A 3UAVA 3Q12A 1VZ2A 3U9TA 4QQNA 4ILEA 2O19A 1RZRD 1M75A 1OZGA 4M6WB 4P98A 1F5NA 3RHSA 2B82A 2XA2A 2RHMA 2VJCA 3RIEA 4L5YA 5FB3A 2GJ9A 4HLUC 1X92A 1U0HC 4TLEA 1UFRA 3KSDO 4FR2A 5BSVA 5JZSA 3PIDA 4GIBA 1CY6A 4A9AA 3AQIA 2F2TA 3LUBA 4ARBA 1R2QA 4EG7A 2RHGB 2EERA 2ZVPX 1DUIA 1GZ6A 3MW8A 1ZC4A 3OP4A 4WKOA 1XBTA 5HDBB 3SEAA 4E5UA 2NP7A 1KZYC 2B8WA 1BD4A 4IFIA 5IRCD 1Z4OA 2F00A 2VSFA 2V03A 1AZWA 4DLWA 4TMYA 5EJ9A 5IJWA 3DULA 1TRHA 1Z6AA 2ZIAA 1CV2A 4F3NA 5AVTA 4MTCA 5BV8A 1BE6A 3GFSA 3N87A 4G84A 3TKLA 3PHJA 3BWEA 4QDJA 1GPWB 4K7JA 2G5CA 4E2YA 4EBFA 4GI1A 1GYRA 2HO5A 3UIEA 2I3ZA 2QW8A 2Y05A 2JD1A 2BMEA 2Q2WA 2GFQA 1HEUA 1XN4A 3CWQA 2KQUA 3HQ4O 4LOHA 4HWTA 1ILWA 3LT5A 2VCYA 3G2KA 2IWRA 1AKRA 3E82A 4G65A 4LE1A 4PU0A 4GMFA 5JARA 2JAWA 1SWVA 4QOJA 3V8EA 4R71A 1M5RA 3LLUA 4BP8A 1CNMA 2CF6A 1SZCA 2DZDA 3Q98A 1IQ0A 4IOJA 3O84A 3L49A 1B16A 4N1AA 1GZ5A 4HTAA 4M8KA 4DQXA 3ZX5A 1T35A 4HQ6A 2VP5A 1E9SA 4JJFA 1EMDA 3A37A 1TK2A 3DKVA 1NY6A 1XRRA 4P35A 1E18A 2J07A 2PWYA 1M2NA 1SVLA 3B9PA 3O94A 2PAFA 4KJZA 2QK4A 3WISA 2B99A 4L2IA 4U2EA 4DWOA 1VHDA 3EFOA 3EISA 2OA0A 3ZHVA 1JSXA 3C3CA 3I0MA 5AJTA 4YUZA 3P9KA 1XHFA 1EA5A 3AEQA 2AK2A 3UW3A 3K0AA 3M6AA 3ABSB 3OKAA 1QV9A 4JBHA 3K71B 1EM8A 4K0KB 2P2LA 3C4QA 2BZ0A 5JRZA 2CB9A 2I6TA 2FKNA 3NTQA 4DDMA 1TM5E 5TNXA 5C52B 3LPCA 4B3FX 3A4NA 2Y1CA 2BFBA 4C87A 1JFTA 4AZ0A 2Q6VA 2B8EA 1EUDA 2BPOA 2IHUA 3GLHB 1C14A 2XQFA 1CEXA 4OY3A 4XM0A 3HC7A 4RGQA 4YJ3B 1Z9BA 3K16A 4GVLA 4ZVQA 5JSHA 1USGA 2V97A 5H59A 2XNHA 4DNQA 2YZ2A 3BH0A 3NJ8A 4MAFA 3WJAA 3TJMA 4DCTA 5EFOA 3NKFA 1MNAA 3IOEA 3QM1A 2F4NA 4B40A 1N2EA 2HRCA 3D6AA 3T1TA 2YFHA 3KT6A 1MTZA 4GBED 4OHMA 1ACMA 2BKLA 2F59A 2ZS7A 1QF9A 1Z36A 1PGPA 5EPUA 4DC9A 2A59A 4HMQA 1DIHA 1VLVA 1VJ5A 4ZI2A 3HCNA 4G5YA 4JT8A 1AGRA 1PJCA 2PMBA 4ZO6A 2RBGA 3HB7A 4FYMA 2ORYA 5E0OA 4F84A 1O0BA 3VC1A 3EMBA 4X5OA 4Y9TA 2VOEA 3DDNA 1MO2A 3ACCA 5DCWA 5KHAA 3E58A 3QX8A 3HKBB 3HA5A 2H4XA 1JSZA 4DILA 5FWNA 1AKMA 1HNNA 2P7HA 4LNUB 1UPTA 3ILYA 1SCNE 3FNFA 3KKPA 1FXWA 3FFXA 2XE6A 4OHKA 3Q8WA 2EX4A 3PDCA 3EIHA 2TRSB 3HA3A 4CUZA 4DC1A 4LHVA 4JFAA 2DKNA 4D9MA 4KXWA 4FMPA 3LRPA 1XCMA 3WBJA 5K0BA 4HAUA 3GNSA 4CV2A 5BSMA 2PZEA 1OBCA 1XZFA 4HWOA 5CNJA 1QFJA 1QLWA 2I3AA 2A5YB 3ADPA 3GRYA 3ETHA 2PUVA 1YJQA 4KQXA 4P8RA 5BN3A 5JQWA 3D3KA 2ONKA 2BHSA 2C2XA 2R6CA 2XTJA 3JQAB 2YHUA 4AO7A 5LIRA 2I2WA 2RKWA 1T0IA 4EHKA 5M7EA 4KI7A 3WV4A 2Y9MB 4OO3A 3TW8B 5AVJA 4Y2YA 2FCRA 4JI5B 2DT5A 5ADHA 1SK9A 2HK9A 2QLNA 1N8NA 4NMHA 2Q5LA 5DHPA 2ZSUA 4F4HA 2CZGA 3SJBA 2J87A 5TLSA 4BU1A 2V5AA 2JGLA 3Q1LA 1X74A 4O0MA 3I9KA 3MRXA 1TU0A 5H68A 3WQHA 1FVHA 1LBQA 2VYCA 5C5IA 3U40A 3L4EA 3Q8KA 1ZGGA 2A67A 4H0CA 4C07A 3LCJA 3AL2A 4CM8B 3GHHA 4TTIA 4YQFA 4LAFA 3K9BA 5B3AA 3DHNA 3O4IA 1YGPA 2WHQA 3IUMA 2HU2A 4GYKA 1HNWB 1EP1B 3CUYA 3EZXA 2ZAGA 1WHTA 4DNXA 3WDSA 4MDEA 1GCOA 1C2YA 2VRWA 4ENUA 4KPUA 3ELUA 5JHHB 3EX7C 1U9JA 2VA9A 3FWNA 3MQ2A 4ZVNA 4HNHA 5FI1B 2NTEA 3TGWA 4FGZA 4BMPB 5EJAA 5G0TA 3VAAA 2ZAMA 3ORHA 3EC2A 3QH4A 3S68A 4L15A 1B1CA 2BKAA 2W22A 3B6JA 4G1VA 4UHFA 3ZZUA 1C4WA 1L7OA 3HVRA 4KLCA 1INLA 1FXUA 2QTTA 4ASUA 1HSOA 3JRXA 5BVHA 2BH2A 4RQTA 3PK0A 1H4SA 1YZYA 1NN0A 3JPYA 3QP9A 3L0SA 2Q6KA 3ZDBA 4NYMQ 3AH8A 4MB0A 1P19A 3EOZA 3REQA 5KYUA 4NDZA 1K68A 1ONBA 3E5MA 1AGPA 1PX2A 3GZNA 3O8QB 4KNWA 4LS3A 1FRQA 3G3EA 4YRCA 5E7MA 4DKXA 4UVEA 4DRXA 2FZEA 4O4JF 1HMYA 1THZA 2POQX 3EVTA 2D06A 3OBBA 3RWBA 1Z8NA 3G5AA 3K15A 4HL6A 1TA0A 1DIGA 1O94D 4HQLA 3C8DA 1Q14A 2IU3A 3T7RA 3Q7EA 4CM6A 4F72A 1QK4A 3PP8A 4OFBA 4RE6A 5GVSA 1C7JA 2O0MA 2VWHA 3C8UA 2FXVA 2RJOA 2HQOA 1W85A 1NHWA 1NOIA 1KQGA 3Q3HA 2W4MA 3U62A 3WKEA 2OBBA 2PZMA 3HCAA 4CEJA 1T29A 2PEZA 3AF6A 2WJHA 1PWYE 3F3MA 1Z45A 1FNNA 1AZTA 3SR0A 3IDFA 5A4KA 5K0FA 5EWLB 1XNRB 2HQSA 4OQDA 1GCAA 3PHIA 1R5OA 1N2BA 3QQPA 3ABIA 4JCCA 4CL3A 3HJAA 4L4UA 1SBQA 1YB7A 4FS3A 1R8SA 3PA6A 3WNBA 4QLOA 3P9YA 1O0CA 3NH6A 3MWLA 1K8ZB 2C5AA 1LGYA 2Y1LA 2O2CA 4J0IA 4RK6A 1VOTA 1C0PA 4TKZA 3K9QO 3VZQA 2YQ5A 5ILGA 3HWSA 1FDWA 3DDHA 3I9JA 4F9EA 1AG9A 2CT8A 5D87A 1ORWA 3NP9A 4GOMD 2C2HA 1SUPA 2V0NA 3OFJA 3FUCA 4OAPA 1VJGA 4OGLA 5DCUA 2PUDA 2CSUA 2OAEA 4KK4A 1RWPA 2SHKA 3L7BA 4HV4A 4Q7QA 4KSYA 1M73E 2IX3A 4NJEA 2EDCA 2RMKA 3CZPA 3HVJA 2Q50A 3S55A 1NMQA 4XTRA 1A82A 2AL7A 2GKSA 4PFQA 2C83A 1ZISA 2PMKA 3EXAA 4DG5A 2EIHA 3LDHA 1QPGA 4B3TB 4JC4A 1ZJ5A 1OH8A 3N6VA 3T0FA 1FBNA 2CLFB 3GDWA 4KX5A 2CXRA 2NQTA 1O0SA 2IVFA 2BEVA 4NIMA 2VKTA 3RF7A 2O8FA 3FLAA 2VDVE 5GAJA 2PZGA 1ORIA 4YT4A 2F1KA 5FHQA 2AOTB 5MGNA 2ZKIA 3E2MA 1NGSA 3U6KA 1SOVA 2VAPA 3BQMB 4RF4A 2EJWA 4RK5A 1V6AA 2A6PA 3ED5A 4LVNA 4AZVA 4UEJA 2HOQA 2CBZA 2B4KA 4O4LB 2Y1FA 3B38A 3BGWA 4HVAA 4Q4AB 2E37A 2MSKA 3F97A 2Q4BA 3URMA 1Q95A 3MJHA 2ZUTA 2GARA 3UHPA 1ISHA 7MDHA 2XB9A 4XIIA 1XLTA 1LBTA 2CUKA 1XL1A 4Y30A 3BAFA 1J8DA 2PV0A 3PG5A 2XUOA 2ESRA 3TW4A 2J4CA 3KB8A 2ETVA 1NJ2A 4DCJA 1E2JA 1WXFA 1C3VA 1SD5A 1MABB 4OJQA 4RFSA 4X93A 4EGAA 5A6VA 2A8YA 2ZI3A 4N3CA 1L6RA 1IXZA 4REMA 3ECAA 4HQFA 5EMLA 3W5HA 3QPUA 4TROA 5FBWB 3RVBA 2JGMA 4IO1A 3QNUA 2H8GA 4BNMA 3FWZA 1O4WA 1TTPB 4GYWA 3FNGA 4E4RA 4EY8A 1VE3A 2RB4A 4LXGA 2PX6A 4UPEA 1NUSA 1UIRA 4QG3A 5MFZA 2O54A 3KUUA 1U8AA 1P2SA 2IDKA 2R5FA 3L1HA 4J3FA 2WKRA 1LFDB 2P9CA 4MSUA 5FI0B 2JAPA 4YO7A 1JIVA 1MVLA 3PNMA 2OD2A 1NVMB 1JIIA 4FW8A 4V0QA 1A8UA 3DLCA 1JW9B 1YRWA 1SCJA 1TQ4A 2CMFA 5FL7A 5JSYA 4JI6B 3RAJA 4D2IA 3TLCA 4AJOA 1LBHA 1TF7A 3B9RA 2C5BA 2PT9A 3AIIA 3G8AA 5E4JA 4Q7LA 1IJKA 3C43A 4AUMA 4BJ5A 2Q41A 4KHPB 4JEMA 3LUDA 1TKBA 4MKZA 3R74A 1UPBA 5DKFA 3RTDA 2VSYA 1R4NA 2JGEA 3KAQA 4J43A 4L1KA 4Q47A 3P2KA 5CXQA 3A6ZA 2PO7A 1U94A 2QM7A 1FP7A 1KDVA 2OE2A 5COBA 2JAHA 3I52A 3DZBA 3HKEA 2QX9A 3IAM1 3WAKA 2GVZC 5C8YF 3ZW9A 5H3LA 3NAMA 3BFJA 4A5OA 2Q6LA 1Z56C 3GZNB 3JWHA 3QF7A 1EHYA