4HD8A

Crystal structure of human sirt3 in complex with fluor-de-lys peptide and piceatannol
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
272
structure length
260
Chain Sequence
KLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords NAD-dependent protein deacetylase sirtuin-3, mitochondrial
publication title A molecular mechanism for direct sirtuin activation by resveratrol.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 260
sequence length 272
ec nomenclature ec 3.5.1.-:
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4hd8A02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4hd8A01
1YTLA 4BV3A 1UPBA 1T9DA 3EY9A 4BVFA 2NYRA 1PT9A 3EA4A 3HWWA 5MGNA 4ZZIA 4V1CI 1YC2A 5FEMA 3U31A 1M2GA 1V5GA 5K3SA 2Q5LA 1Q6ZA 4JUDX 4UUBA 2VJYA 4JU9A 4RJJA 1DJLA 1YBHA 2FR8C 1UPCA 1ZPDA 2EZ8A 4KGDA 5EJ4A 2IHUA 4X3PA 5BWNA 4MZXA 4KXQA 1YI1A 4IG9A 2B4YA 2FWNA 4QQ8A 2V3WA 1OVMA 4FEEA 4K9LA 5AHKA 2VK8A 1YHYA 2VK4A 3GLUA 2Q27A 2AG1A 1EFPA 4Y6LA 4FVTA 1Y9DA 1T9AA 3GLRA 1PVDA 4K9KA 2JI9A 4MPPA 1SZCA 4GPEA 1D4OA 1OZFA 1UPAA 4QELA 1OZGA 2A1TR 2JI8A 5MFPA 2H4FA 5EJ7A 4BN5A 1U2DC 3RIYA 4K9NA 1SZDA 4J16C 4UUAA 4RMHA 3PKJA 4TWIA 4UU8A 3ZGVA 1YI0A 1OZHA 4FZ3A 1M2NA 2DJIA 2EZ4A 4IAOA 2X7JA 4C78A 3PDHA 4JUBA 4I5IA 2H2FA 2H2GA 5K6RA 1YHZA 1PO7A 4HD8A 3U3DA 3JR3A 1U2GC 5IMSA 2PGNA 2AG0A 2Q5QA 4MQ5A 2NXWA 4BVGA 5FYQA 4JD5A 2BRUC 3PKIA 1Q14A 3E9YA 2HJHA 4L3OA 1M2KA 4Y6OA 1HZZC 4G1CA 1PYDA 3IAFA 2JI6A 1JSCA 4IF6A 4K9OA 4COKA 2OO5C 3GLSA 2W93A 3CLSD 1U31A 3K35A 4UTXA 4BN4A 4X3OA 4GM0A 1XLTC 2FN3A 4R8MA 5EJ6A 2IHVA 5BWLA 3D7KA 1M2HA 2C31A 4L2IA 3F6BX 3IAEA 1PTJC 2VK1A 1V5FA 4FEGA 4RJIA 3ZG6A 2H59A 2EZUA 3D4BA 2Q5JA 1EFVA 4F4UA 1PNQA 3CLUD 3RIGA 2QQGA 1O96B 4BUZA 2JIBA 4JUFA 1S5PA 4D5EA 2Q29A 3LQ1A 2VBIA 4JU8A 4D5GA 4RMIA 2H2HA 4GM4A 4JUCA 1Q17A 1T9BA 3F6EX 5EJMA 2FRDC 4JT9A 1N0HA 3HWX1 2UZ1A 3CLTD 2QQFA 4UTNA 1POWA 1QPBA 4MPRA 4UTZA 1MCZA 2Q28A 1M2JA 5D7NA 1J8FA 4UTVA 3FLMA 5K6TA 4BVHA 2UZ1B 2EZTA 5K2OA 5EJ8A 1MA3A 4BVEA 3JWPA 1Q1AA 4JSRA 2H4HA 5EJAA 2WVAA 1BFDA 4TWJA 1NM5C 4Y6QA 2OD7A 1ICIA 4BVBA 1PI3A 3CF4G 2A1UA 2WVHA 4RMGA 2IHTA 5MFZA 3D81A 1YC5A 4K9QA 5BWOA 5DGTA 3OE1A 4C7BA 4JT8A 2JLAA 3ZGOA 4UTRA 4JUAA 4Q9DA 1T9CA 2PGOA 4RMJA 2EZ9A 1Z8NA 5EJ9A 2Q5OA 4RJKA 3CLRD 1V5EA 4ZP1A 2H2IA 3EYAA 2VBFA 4QPZA 2H2DA 1YNOA 4UU7A 4K9MA 4V1CA 3FZNA 4F56A 2JLCA 4MPJA 3FSJX 1POXA 2OD9A 5EJ5A 1E3TA 5DEIA 2FSVC 4HDAA 2H4JA 4KPUA 5MF6A 4GP9A 1O97D 2OD2A 4K9PA 4BV2A 4V1CB 4O8ZA 1PNOA 2WVGA 2PANA 5DGDA 3GLTA 4GM1A 2JI7A 4J1TC 2VBGA 4GG1A 2OORC 1U28C 1S7GA
chains in the Genus database with same CATH superfamily
3KQOA 3X1KA 1G2OA 4UU0A 4BP9A 5KWIA 2O1WA 3BE5A 1H3FA 1Z7WA 3VO9A 1Q92A 3ZXSA 4DADA 2F4VB 1K66A 2P0YA 2Q9UA 4E2WA 1LX7A 3T1VA 2K7FA 2PKEA 1ZGZA 3AJDA 4YP6A 3A70A 3WNQA 4CM8B 4X44A 4A8JC 5K3CA 3S70A 4DXDA 4Q18A 4LWQA 4JVNA 4UBOA 5IZCC 4UTPA 2BFPA 1P31A 3H84A 4OHYA 5HDBB 4MVJE 1EYZA 3U2QA 2IF2A 3R76A 1JDTA 4OBBA 1M2GA 5A04A 2PSEA 3L1UA 1OTHA 1N6PA 2X1LA 2ZRPA 3DKRA 3RYIB 1ZUNB 4TTIA 1A97A 2B8WA 1GQFA 2Q5LA 1DXOA 4G25A 2I4IA 1FTNA 3P0RA 1B8OA 2R6CA 4WKNA 4BNKA 2PUBA 4FXPA 2W6QA 4JUDX 5E4JA 5EP3A 4EB6A 2G09A 2VJYA 4R2JA 3DTYA 4DA6A 3PTZA 3MGCA 5F51A 1JXOA 1YL7A 4OPMA 1R0SA 3F78A 3F5DA 1MT3A 3N2EA 4XSVA 5C9ZA 5EIXA 2ODTX 1YBHA 2J5KA 4ER6A 2R6JA 3BT7A 5T4BA 5LWHA 1G3MA 5EE5B 2IPLA 1TT5B 4Y2HA 3CYFA 1YL6A 3E7XA 3EEQA 2VJQA 1QKJA 1W581 1N0VC 2W58A 3K15A 3QVTA 4J0GA 4II3A 3ZUPA 1K4YA 4ZJPA 5IT4A 5KOHB 3CIOA 4RTMA 4KN8A 4QYIB 2OCLA 1PQYA 4M1KA 1XPRA 1J1UA 4PS1A 3HBMA 5EVCA 1IRXA 4ZMRA 1RXEA 1SIWA 3EIHA 1K5PA 1ZLXA 2DTEA 3KAQA 4K3UA 1W4AA 2E5LB 1O94D 4TTAA 1ZC4A 1T1SA 4V0ME 2XA2A 3TIGA 3VH3A 1ZRHA 2PAAA 4KG7A 3STUA 3PFCA 1GPYA 2VJMA 2EIHA 5K8JB 2BHTA 1XVLA 2IY8A 3IQGX 3ITNA 4NIMA 1J23A 1ZK4A 2QSUA 1P60A 4EYSA 2P3OA 4TGLA 1A71A 5EJ4A 2BR4A 2HDWA 4FZJA 4OXXA 1P80A 3JQDA 4QIHA 1UWVA 1YZTA 1X86B 2F1OA 1KNXA 3PXBA 2JAWA 4N76A 3W8EA 1M1YE 2TMDA 3Q4GA 4HNQA 2AFVA 4Y7CA 5L40A 4M4SA 3GJ5A 2OC4A 3AQ4A 4GVPA 2A88A 1JAZA 1ZK2A 2B4YA 1TF5A 2W0SA 1H0RA 1W36B 2JFXA 2C9ZA 2Q62A 3A4TA 5G4KB 1J0CA 1HDZA 1N2JA 4Q9JA 3ZHOA 1PNTA 4B8WA 2H51A 4EJFA 2BIFA 2I76A 4RE5A 4ER5A 3W3AH 4RA9A 4UNQA 5B1SA 3OE7A 1ISGA 4RE6A 1A4UA 1CV2A 1K3UB 2VK4A 1FSSA 2Q27A 3ANLA 4JI6B 4ASUD 4YPOA 1TD1A 1FLNA 3RFXA 3HEAA 4LXYA 2AQKA 1WCV1 2JGAA 1V3UA 3NM6B 2ZWMA 3BXFA 2ZSEA 3NM5A 4CDNA 1RCUA 1UF9A 2QYSA 2ZJ5A 1N36B 4FVTA 3KB6A 2AFHB 2OE2A 5JW6A 4OHMA 4AVYA 1COWA 1DELA 3DLPX 1TM5E 3WYEA 2H65A 2HX1A 4BCBA 5KTTA 3EIUA 2R751 4H7EA 2EP5A 3CZPA 4I19A 2JF0A 4QQFA 4H6XA 1L8XA 1GCAA 1UMCB 4QOIA 4WGFA 2RHOA 2DPGA 2ASVA 5ALWA 3V8PA 3BHJA 4GPEA 1AKNA 3KTAB 4MV7A 3U1VA 5H81A 1HOTA 4NYMR 2ZR8A 3A58B 3DW3X 4WADA 3UXMA 2BE9A 3VVLA 4E5KA 1U99A 2DFNA 2P7IA 4QRHA 4RA6B 1Y8QA 1G20A 3AT1A 2GXSA 3DMNA 1N7HA 1DEAA 1FTWA 2X8JB 1NOIA 1UKCA 2SICE 3M4ZA 2V7UA 3EUFA 3RUAA 1GN8A 2BZ0A 5ALVA 3U44B 4CQMA 2WNHA 2PS3A 3GD7A 5CJJA 4E33A 4AJPA 4UEJA 3HH8A 4XCQA 2HU2A 3NOOA 1FK8A 5LOVA 2IS4A 3RIYA 4HEHA 3R6DA 1C14A 4LJKA 1VBMA 3BSYA 3TZLA 4GHWA 1Y82A 3IEIA 4AL4A 3V4RA 1B2RA 4L15A 1SD2A 4FM9A 4B1FA 1VCOA 3OPYI 3IURA 4HWGA 3WV4A 3MWEB 1I14A 1U7TA 3BZWA 3CPHA 3LM8A 2I54A 2LGJA 4PICA 2BCJQ 1V8ZA 2PT7A 3KSRA 4OXRA 1S3FA 4LPKA 1C3XA 4PPGA 4XIFA 4YA6A 2BSQA 1NBAA 2BGIA 4B7CA 2PXHA 2W83A 1OZAA 5JNLA 2EIXA 1DO0A 4LC1A 1DC6A 1YHNA 2RB5A 5ICGA 1OA1A 2BHSA 1EP3B 3ZGVA 3PXXA 2V03A 3KR9A 4U02A 3NDPA 4YJ3B 1DC7A 1DMRA 2EHJA 2GGSA 3R8XA 3WQHA 1UWCA 3ZI0A 1ACJA 2GM4A 1GYRA 1P77A 1SKBA 1VMEA 4V39A 1DO2A 2WFLA 5J47A 2F8LA 3CKKA 3JRNA 2P11A 3IMFA 5G4LA 3RSZA 3ZK8A 1TO2E 4YHHB 3BMCB 1NBMA 1QIHA 4U3JA 4TRMA 5D85A 1R6VA 4F5YA 4U2CA 5L4SA 2L82A 3BC1A 3PDJA 2OO7A 3V4PB 3LT0A 4NE9A 3MUNA 2PM8A 4LRWA 1T3LA 1E2DA 4DR1B 4M1EA 4CDGA 4PQFA 3BIFA 5CA1A 1VSBA 1BC5A 3PJDA 4FC6A 3QRWA 4AP6A 1E96A 3F6YA 1KOLA 3FYUA 5KYWA 2G17A 3LTNC 4IX9A 1DAPA 1W1IA 4TM8A 1ZNYA 3CE9A 2CLEB 4TT8A 1OFTA 3DZFA 3GN1A 4YP0A 1GPJA 1JU3A 3TJRA 2G82A 2JFGA 3IE0A 2TMGA 3JD0A 4ZAYA 4A9AA 4QT4A 5JS6A 4LQCA 2Z2JA 2QTFA 4HX9A 3FFBA 5JV5A 1USWA 3FSGD 1BQEA 5IUKC 4H0NA 4LQDA 3W1VA 3KYJB 4UW9A 2CHGA 2AUMA 2BRUC 3LGAA 4D8XA 1UKZA 3DZJA 1ORDA 5IU6A 5K01A 3E22A 4LYDA 2O8EB 3GCXA 4MWZA 2WT4A 2J9ZB 4YRJA 4E12A 4IWXA 3VZBA 3NHFA 1CRQA 3KD3A 3RUIA 4A2QA 3ZPXA 1Y4AE 3P52A 5DLPA 1H4SA 1AJEA 1R0ZA 2IW3A 3WVNA 3IH5A 3FOAA 2QAGA 4OYLA 4Q7LA 3I05A 2CDNA 5EINA 4Y9UA 2VF4X 3HCOA 1BE8A 1WF6A 3C7DB 3M70A 4GI7A 1G4AE 3G8DA 4P2BA 3UT5A 2HPVA 2G40A 4RABA 4UM7A 2AJCA 3LHDA 3MAAC 3TD9A 1VJRA 2HA3A 3DE0X 3R8FA 2W4MA 4QTUB 2X13A 2Z98A 2JI6A 1XKTA 4ZV9A 3PNLA 2OXTA 3WK7A 4RF4A 4NLLA 1SCJA 4TUYF 4ZHQF 2VYND 3C3KA 3OPQA 4FMCF 1T4CB 5FUYA 1GZUA 1K7YA 2BZGA 4DUPA 3AR2A 1UH5A 3HXQA 1UBGA 1GNVA 4X41A 2FLKA 4BNFA 1G8FA 1Z5NA 3CURA 3HP1A 2BF4A 4AMBA 5BN4A 1VJGA 3GLSA 1K88A 1S3GA 4QRIA 1EUDB 2CKDA 5BN3B 1R9JA 1W8DA 4I1VA 3T38A 4DV2B 4KSYA 3LH5A 3TO5A 1GNRA 1K9SA 1IZZA 1IY9A 5L6LB 2JLZA 1E9CA 3E6AA 3JD4A 3OJWA 1X7WB 3N0XA 5BWLA 3K20A 2RHCA 3Q2IA 3QX3A 3AY0A 2HQOA 2QVXX 3K5PA 5TPZA 4IXDA 4V0RA 2C31A 5F76A 3SZOA 3HYSA 1JIQA 2O7RA 4FHEA 5CDUA 2OTCA 3EIQA 1BOOA 3M1IA 1JQAA 4ERXA 1UWLA 3NHAA 4FLMA 4HHEA 2CJWB 3U3RA 4IDFA 3RYHB 2FSIA 4DWOA 1QIDA 1VZ3A 1O8BA 2Q5HA 3KQQA 1YACA 3NKLA 2BFMA 2I5PO 2YWEA 2R00C 1W88A 2GM5A 3VJLA 3DAHA 4H18A 2VTVA 3SC6A 1TLFA 1J33A 4AW9A 5H16A 2IIQA 3MEQA 4L8YA 3O91A 2EZUA 2HCBA 1J39A 3RU2A 4BATA 3P9QA 3ZWWA 1RLJA 3K3PA 4JOBA 5G02A 5JO9A 1FMCA 2QQGA 1C80A 4Q9LA 1KAOA 5CIWA 5IAJA 3CBQA 2GQ0A 2XNDA 3C41J 2NOAA 4QGHA 1WXXA 3OQPA 1M1NA 4Q6BA 2OCPA 2XR1A 3L0BA 4WKOA 2ZYRA 1F3LA 2G0AA 2HXSA 3HBFA 4MVJF 4UM5A 5ERXA 1TU0A 2HDOA 3IIKA 3H5OA 1KZ7B 5BW5A 1J0XO 1S6YA 3HI4A 5JD4A 2JFHA 3H4IA 4IEFB 4HPWA 1SAYA 2XUPA 3TLAA 4AWXA 4G4SO 4U6SA 3M49A 5JRDS 3I72A 2AK3A 2CHUA 3KKOA 4Q3OA 3U4QA 1IZ0A 4I3FA 1WMDA 3LCRA 1JALA 4U5XA 4JB3A 4YJDA 1F4PA 4JT9A 2Z57A 1BMQA 2YW9A 3HWX1 2FPSA 1OI7A 4FFVA 2EG5A 5JNUA 3INYA 3NHRA 2CMHA 2NZVG 4ARZB 16PKA 1JDPA 4EO9A 5FUVA 3KUKA 4PG4A 4C0HA 4M87A 1XA3A 1Y1RA 5I4BA 1TUEA 2QN6A 4HAYA 4KXLA 2BGWA 1TFRA 1IQPA 2VH2A 4M7OA 2A9PA 2I4RA 1BJTA 3ETEA 1RYYA 2BFWA 3ILXA 4RHCA 1N2IA 2XGGA 3DMDA 1OBFO 1KO1A 3CV3A 4GC9A 4FI3F 1SOUA 4CM1A 1OB2A 5ENZA 4XPIB 2LP4Y 5KMGB 4BFXA 2DHQA 1XNQB 2EZTA 1KMQA 3JZAA 2SHKA 3C97A 3G59A 3S29A 4N6NA 3T9AA 3U80A 2VQDA 2EW8A 4DMGA 2AOVA 2IIVA 4KRGA 1RPAA 1R5NA 2IY7A 3N7AA 1DDOA 1WXEA 4OP1A 1KJWA 2Z3ZA 3MJ4A 4JSRA 3PJGA 2GWHA 3GRAA 2HO5A 3KLMX 5I7FA 1C2TA 4OQPA 4KNYA 3KTFA 1JFFA 1XTUA 1R6BX 3KJXA 5E6SA 5KYYB 1QONA 1QYCA 1Q74A 3HXPA 2PCLA 5PGMA 4O5OA 1RDFA 4BUCA 2M6RA 1ATIA 4Z0HO 3UM9A 1SIOA 4ZO8A 2OFFA 5TMEA 3HLTA 1EGHA 2OZPA 3Q88A 4LNUB 4PLVA 1W5TA 3DTNA 3FCSB 3EBLA 1L7MA 4BEBA 4EJSB 4ZYXA 2JEYA 5IVIA 3T7DA 1JA1A 1YSCA 2AL7A 3KU1A 3EK2A 5IBCA 2WVHA 4RMGA 3BXXA 3VOAA 1LDEA 3QSGA 4KO4S 1I80A 1FDVA 1E2PA 2VATA 3L7CA 3OCXA 1USKA 5JS8A 5KTMA 3AB7A 1YB6A 1QQAA 2AN4A 3G8BA 1FP6A 2FE4A 2B7CA 3ZYZA 3ZGOA 1XYYA 1O6CA 4NEHB 3CUEF 3NBUA 5K3FA 3NTQA 1ZJ5A 4C5CA 3P27A 4HDMA 3WGQA 3F98A 4HLCA 5HW0A 5JMTA 1T2FA 4RY0A 3ZEIA 1S89A 3DE1X 1QO0A 3PFBA 3GMDA 3N86A 1JAIA 1C30A 5C5IA 4N5MA 1EIWA 3U49A 1XZFA 4XWAA 3QUTA 1GT91 4X20B 2O7VA 3RRMA 4ENRA 3O82A 1R4ZA 1TC1A 2LW7A 3F7TA 4PX3A 3WB2A 4ZVKA 4HAWA 5JYEA 1RJEA 1Y37A 4HNSA 4LDQA 1GZDA 3IVGA 5I8PA 2OZEA 4B43A 2VBFA 4QPZA 3HLYA 1R8QA 1XD2A 2OAEA 2RCNA 1PYOA 1UEXC 3TZEA 3QELA 4PCVA 3PJEA 4D0LB 1FFEA 5AJYA 2JLCA 1GA1A 3FCUB 4QQKA 2WV9A 3S2ZA 1BDIA 4HVCA 5F2NA 1A2OA 1POXA 1C0LA 2X8BA 2V7QA 4B6QA 5C7LO 1WEHA 2JW5A 2RI0A 2Y76A 4KQHA 4OJKA 3U0VA 2YFQA 2DETA 4F12A 3I6YA 2J30A 3K4QA 3I01A 4C2BA 4N9QA 1PT6A 3EA5A 3LG2A 3M6FA 2PX3A 4A92A 4Z51A 1X1TA 1QV9A 3PDIA 3UGTA 1SKAA 4D0RA 1A98A 1QYRA 5DHPA 3GNSA 1E2HA 2DX7A 2VZLA 5GWXA 5B7NA 3GEMA 3TW4A 4R3UC 1EI9A 3A06A 5CDFE 3FR7A 5FPTA 4K6KA 2Q3JA 4PZLA 1YFKA 3C7TA 3DKKA 4J0QA 4Y2SA 4NCXA 4C9BA 3DHWC 1ID8A 4AKHA 4R0VA 2J3QA 3U7HB 1KJ8A 2DG2A 3GEBA 4AUNA 1E1QD 3P2EA 2O2SA 4RVSA 4INPA 4YRTA 1CZUA 2F3RA 1J2UA 4Q0MA 4Y8VA 1PWHA 1WF3A 2WU4A 4TVKA 3SGLA 4ZQFA 4HH4A 2A6PA 1THZA 2IYTA 3FKJA 2WD7B 3SF8A 3WYDA 5JJBA 4RO0A 2WYVA 1BVUA 3IBYA 2EBWA 1T5DX 1Z56C 5D2CA 7MHTA 3IQWA 1C4KA 1JLRA 1BW9B 1T43A 3DCIA 3KLOA 3M6VA 5LU9A 5BYAA 4Y1RB 3AM1A 2IDKA 2IA5A 4C43A 4YUVA 2QY9A 3DD5A 2YVKA 4I50B 1OSNA 3RT9A 1QG4A 2XQFA 4U7GA 2XE7A 1N7JA 4WQMA 3OQJA 4CV1A 3JTMA 1YTLA 3W6NA 1L5NA 4YJFA 3HZRA 3TKLA 2ORYA 4OXKA 4QUIA 3FPKA 4UEWA 1OROA 1TQDA 3CEHA 4Q05A 4JI5B 4YRPA 5GINE 3KO8A 3GBVA 1DQRA 1ZAKA 3C1TA 2C2HA 3FY4A 2OCAA 2JIZD 3A11A 1JG1A 2PZFA 1O97C 3MRSA 5ITSA 1YC2A 4MW4A 5EE3A 4BIIA 1X1EA 1ADBA 1REQB 3F9RA 1OASA 1DMSA 1ID1A 4REQA 2JFWA 3QLJA 1XMIA 5C2JB 3M9XA 1RFLA 3PWSA 4II7A 2GPBA 4L5JA 1ZCZA 1RZ3A 3ZZ1A 3D3EA 1SVOA 1CUGA 3OZFA 3UB4A 1Q3KA 4Y1FA 2P6MA 3IQZA 4JC5A 3G5TA 3S44A 5AVOA 4MQUA 4TV9F 1NY6A 4WDRA 5BVGA 4IIUA 3WKEA 3J81k 3WK4A 2GHRA 3EVDA 3V5NA 2LIPA 3W3AA 4KU4A 5ENDA 1B8VA 3E7FA 1WUTA 3Q3CA 2IQIA 1BE6A 2Q3FA 4OQZA 3M9WA 2GZDA 1M34E 2EOAA 2VUHB 2YVQA 5FUWA 2I6SA 4F04A 4UKDA 1JDBB 2R6HA 2SKCA 3AJ8A 2Z04A 3DL0A 3HU3A 4C7VA 3PF8A 3SXJA 1K7SN 2DU8A 2E4YA 3F3SA 5BYBA 1ZMRA 1KA9H 1U94A 3BRSA 4J0CA 3T52A 3WXBA 4B81A 4AAYA 4YRCA 1DC8A 3AUKA 3PUZA 1OUMA 2WTAA 3A3NA 4N9WA 4AC9A 1QIMA 5JSUA 2WJ4A 1NXTA 2ZYHA 3AU9A 3H11B 3LCVB 3GH3A 4DC1A 5JXGA 1G21A 2B4AA 2XLCA 4X9XA 3WK9A 4L74A 1XALA 2MYTA 2OP0A 4U8GA 3SJBA 4GDFA 1II8A 1JQ5A 1SC4A 5K0BA 1LTKA 1NV8A 3AF3A 5EAIA 5LKRA 2IUEA 1DAGA 4JN6B 5TR9A 4CM6A 2W2LA 1MAUA 1VPEA 4CM3A 1CJSA 3QF4B 3SI7A 4WW0A 3TW8A 4NMHA 4HMPA 2O7QA 3QX8A 3L93A 3UJAA 3QHQA 1KE2A 2V6GA 1ISMA 3F74A 5EY5B 3CM0A 4E6EA 3JQAB 4QULA 3BFJA 3PTLA 3F4KA 4DKXA 3GF4A 3PQ4A 4ZI2A 2CBZA 2WIJA 4V0NA 2JJ1A 1CR4A 1ONPA 2VT3A 8ATCA 2OM6A 4G1BA 3OF2A 1R0BA 1WMAA 4OL0A 2JCBA 2RHMA 3O21A 3GN2A 5KYUA 3ADPA 3O7MA 4Y6LA 1D7OA 1ZA2A 3EBOA 1J09A 4L28A 3AB8A 1PZMA 3T5GA 2HRZA 3PNBA 1HM5A 2HM7A 2YYZA 2L42A 5DLEA 1E8NA 3LC1O 4GL2A 3LKDA 4MULA 1J24A 5F1KA 5IC5A 3RWMB 5JSQA 2YIMA 4GZ5A 2VR1A 2HA4A 2QNIA 4XSHA 1VSUA 3ONWA 3OEWA 5CXXA 4DQLA 1A8HA 1I2MA 1D4OA 1SEPA 2UYYA 2XMSA 4ND3A 3SU8A 4BP3A 5LMZA 5F33A 1J1ZA 4R7ZA 1AC5A 2VP5A 1EFPB 3GVPA 3M4XA 1Z83A 1E3JA 2J59A 2W2PA 2IYQA 1I4WA 5FTKA 2ADMA 2W11A 2WJZB 1CJUC 4EGSA 1GGNA 3Q7QA 3WBKA 1YIOA 3NFRA 1FS5A 3V80A 4WNAB 4PLWA 1P5FA 4EYGA 3HJAA 4K6HA 2X4LA 2AUNA 3EDCA 3P2KA 3IDAA 3TYXA 3D31A 2OAQ1 1QXSA 5KSPA 1DIRA 1FL9A 4FMPA 1LVUA 3WJ2A 3C43A 3ZWKA 5T64A 1HK7A 1K3FA 1RRKA 3FNGA 3LBHA 1C4WA 4M21A 3V7WA 1U6JA 2QVZX 5KQLA 4CEIB 1E62A 3JYHA 2WJJA 2A9JA 3A4IA 2D2XA 3PD7A 4PAGA 5HRAA 5JAMA 3AEQA 1OREA 3N53A 3CE6A 1B6RA 1S1MA 5DYNA 5JD6A 3EGDA 3WKAA 2J3DA 3E8MA 2I87A 2RSLA 4QBHA 3W90A 3ZH2A 1KI9A 1ZM9A 1R10A 1PSZA 1T24A 3P2YA 2VP9A 1MTZA 1ABEA 1HI9A 1QFSA 3MMSA 1EK5A 2HRDA 3U81A 4W4TA 4DLLA 3ORYA 4JLVA 2V5AA 4R9UC 5EPEA 3S6JA 5M7EA 5FPKA 2HK9A 4CKYA 1C81A 1EQ2A 4K1XA 3FFAA 3ZIAD 2WAYA 2HHLA 2ZITA 2GEBA 3A9WA 5A7FA 1H22A 1KFEB 2AR7A 3VPBA 4FCVA 4X92A 4MUJA 1E18A 2IUUA 3T3HA 1G1MA 3A1NA 2QM7A 5E4YA 2WWGA 5AJXA 1AKQA 4OHWA 1KI8A 1VTKA 1KC1A 4O4LB 4DV6B 3ZCSA 4ZMBA 3K6SB 1AN9A 3PDHA 1BRTA 5FFNA 3ROQA 1NSYA 1MRZA 2IDJA 4YAFA 4X7RA 5CX1A 1NNSA 1GNQA 3UMMA 2DBVO 1W4ZA 3E9QA 1RR6A 4YDRA 2BMEA 4B87A 1F38A 2XNJA 1A5TA 1Y3DE 1X13A 1ZD8A 2XVYA 3LC7O 2R79A 4HD8A 1CRWG 2HQBA 4X85A 3A9SA 5I51A 1P2VA 4OEHA 4OJNA 2QE6A 5CBPA 2IDMA 1KEWA 4MXDA 1PJ8A 2XQGA 4BNLA 4KQGA 3H2IA 3K0AB 4BEWA 4FOTA 3AGPA 4GKAA 4JA2A 3NCTA 4A7PA 4D6YA 3MS7A 4YCAA 3T5CA 2AVNA 5I7RA 3SQMA 4UUPA 3VKWA 5CVVA 2XUDA 5KHLB 1FLAA 2GVDC 4J0EA 4REMA 2I66A 5REQB 4DLAA 3PJFA 4PSVA 1PU2A 3ZKWA 2GJ4A 3NHPA 4WZAE 2IYEA 4CZ2A 3CB2A 1ZKMA 2ONKA 4L3OA 2C4UA 1T2CA 3K9LA 3MOIA 5AI6A 2ZEJA 1GLGA 2WPDA 4MEBA 1AQNA 2A9KA 2OFWA 3PNOA 3NYIA 4KX5A 4IO1A 3RBVA 4MGIR 4JNKA 4G97A 2FUNB 3P9RA 3M4NA 1FTQA 3VTZA 1PGQA 1UBNA 3HXTA 3D0RA 3R0JA 1YRBA 3QKRA 1IIBA 2QZ9A 4N8EA 4QATA 4UDXX 5IAEA 1XCJA 1P7CA 3QTTA 1KOGA 3DE6X 1XHFA 3BPSA 2Q1XA 4OA5A 5GVRA 5E7JA 3GLFA 3MZ0A 4IIXA 4V24A 2CMDA 1XU4A 2CXRA 3CUSA 4PYIA 2G8NA 5L51A 4GUDA 3SKXA 5KNBD 1L0BA 1YUBA 5JWHA 4O29A 1WBDA 1HDYA 2YHIA 2YWCA 2CV1A 1SBHA 1L4BA 1JLSA 3IE1A 1W0JA 3EYWA 2ZPAA 4B71A 3ECAA 2ZUBA 5K0SA 1RKQA 2B2XA 4Q1EA 4YJGB 5BNTA 4N0EA 2WWTA 3DOFA 4PSUA 1G5QA 1J2RA 1QF9A 1YBFA 3DCJA 4LG1A 4QD3A 3SEAA 4F11A 2BGLA 2UYHA 3IGFA 1W35A 3L0ZA 4BZPA 4P7FA 1IUNA 1Z36A 4CMKA 1XZDA 4UFOA 2VPPA 1CQZA 4GRIA 2OFOA 2VTBB 4RD4A 2ZS7A 3GQBB 3M6MD 4C4TA 3LUPA 1RLTA 1ZM3A 4EJ6A 3LPAA 2V6FA 3G2JA 3LO5A 4R6XA 1LSSA 3EH1A 3USCS 2HUPA 3AFGA 3UHAA 2DUJA 1FFSA 2HMTA 1KGSA 3TOZA 4B74A 3PFKA 3P9ZA 1KMCA 2ZE8A 3PGXA 2IYNA 1FJXA 5JLJA 1Z2DA 2IXDA 3ANMA 3EN0A 4LVOA 4LDRA 4X63A 2QX6A 4TLDA 1XRJA 3AV3A 3FUTA 1XWIA 4EY4A 1Z18A 1VKZA 3LCMA 3I2JA 2ZIAA 3IBGA 3GVIA 1N0IA 4I8DA 4NZZA 1S3SA 3CLUD 1HE1C 3KEOA 4O2AB 3HMQA 4NICA 4RKYA 3X1ZA 4OXIA 1WMEA 1FFXA 2IOFA 3WISA 1XCLA 4CFYA 2CCGA 2QTAA 4F6RA 1EP2B 1KBZA 3FVQA 3WZMA 2BBOA 5C37A 3T3OA 4S24A 2AEMA 2C5GA 2RGCA 2Q29A 4BMCA 8MHTA 4JVOA 4FMDB 3X1YA 3P0JA 4JJ7A 1ODFA 3CG4A 1E4OA 3R4CA 4JBNA 3UH1A 4HDCA 2JAUA 4TMXA 5CLGA 1UBUS 3T9BA 2WHYA 1YWGO 4MKZA 4NMLA 1H3NA 2EJTA 3DBVO 4CQJA 4Z0TA 4C88A 1K8ZB 1AZSC 1CZNA 2PEYA 1IEXA 5HTKA 4ARUA 1V37A 1QTQA 2SNIE 5DM1A 4G0MA 2IZ1A 3PA6A 1HWYA 4JV5B 1LNQA 2F3QA 3KEQA 3NX4A 1IY2A 3HUDA 4LXUA 5F7OA 2XBMA 4NI5A 2QM3A 1C8VB 4MP6A 4WCVA 2YQ4A 3IAXA 2JASA 5FDFA 2JZCA 2VP6A 1QIFA 4J9UE 1S2MA 4HNVA 5E0KB 2PMDA 3RVKA 1O0BA 2DPMA 2HC9A 4QBFA 5CD9A 3EFEA 2O5RA 4JEHA 2GDZA 2XYHA 4M1QA 4P4SA 1LC0A 3E5RA 2ZIFA 4GOXA 4HGYA 3TINA 2C7RA 5TF4A 4ARCA 2EX4A 1MC1A 1RXCA 2CZCA 1T26A 3BREA 1XQXA 3D6VA 1CULC 2KJQA 5AJZA 1FJHA 4YP9A 3H2ZA 4RTRA 3IILA 5EQJB 3RVMA 3DSRA 1ZIPA 4XVHA 4YK7A 5BP7A 3EQ8A 4Q34A 1JHYA 5FV4A 1FUKA 3EW7A 1YD7A 2GK6A 4MHOA 2AJDA 2CB0A 3FHJA 7MDHA 1SBIA 3ZVNA 2LE0A 1L7DA 1CE8B 2MR5A 3CNBA 3IT1A 4CLXA 2CSXA 4GR5A 1JJVA 3GAFA 4LJ9A 1JWAB 3OH8A 2J41A 1A9TA 1R6XA 4PANA 1YJCA 3PZBA 2P6UA 1FDIA 1W2WB 2M1XA 1TA0A 4GU5A 4L73A 4WFQA 4WOBA 1U9JA 2N3ZA 1UANA 3PUIA 5HUJA 5I01A 2ZYIA 3B7GA 2QZ4A 4M0UA 1NM5C 1WXWA 4DSNA 5HQ3B 4WI1A 4ZHSA 1EA5A 4JJFA 5H3LA 3UQZA 1XI2A 2PMCA 1UJBA 4DDUA 3A6PC 2P4EA 1ZH4A 2FZLA 3CRRA 1YS9A 1A72A 2FHPA 1DCKA 3AHCA 2AE1A 4YUZA 3U6BA 1PRYA 4XUGB 3OPMA 3DXFA 3RFVA 5L7TA 5JBIA 2IHTA 4C6TB 2HMUA 2VZEA 5C4GB 3B13B 4MITA 5AHWA 1XMVA 2FMUA 1QX3A 1FDTA 1OWPA 4KXWA 4YI3A 2OYRA 2C42A 4QJBA 5KOYA 3H9BA 4DG8A 3AGQA 3K9CA 1VE9A 5JYDA 7ABPA 3NR2A 1UDXA 4C7BA 3B3JA 3MWLA 4DNFA 3PEFA 5EFOA 4FHFA 4MVJH 5IXYA 3MT8A 2X86A 2BW0A 1L7BA 5F64A 4J75A 2AB0A 1XP5A 1DAFA 5J4VA 5CHEA 4LDNA 4M7WA 3Q9UA 3GJSA 4C7MA 2CV2A 3I4CA 1PEKE 5AQEA 4I6JA 4CF5A 4DCCA 1E7QA 4F5EA 5KDOA 3IPAA 3FWYA 2J7KA 4CIVA 3VU1A 3SCZA 1KORA 3KCQA 4C22A 4E6PA 3Q6NA 9ATCA 3ZS9A 4PEVA 5LUBA 2QW8A 2RGDA 5GJWC 4HPXB 3D2AA 3PEUA 5KINB 1PZXA 3WI7A 1E4EB 4EI8A 4R83A 2EL9A 3MWDA 4FLEA 4LOAA 3FVVA 2RHTA 1N2CB 3F67A 3PYXA 2NZJA 1XTSA 4KTTE 4WZZA 4H7IA 3U4HA 4TWZA 2GERA 2XLBA 2WY2D 4C2AA 5FB3A 3D5QA 5B3AA 3V4VB 5C8YA 1Z62A 3KNZA 2J08A 4MQBA 1D2NA 3O0DA 4Z2YA 2GN9A 2HA5A 1UBTS 1UJCA 2ZTMA 4IJQA 4KGZA 4N3BA 1L4NA 1DJQA 3GJ4A 1JEQB 2MINB 4RCVA 3PTAA 2I4TA 4MUAA 5LP6B 1AQUA 4CM7A 1RYEA 3PIRA 4U8HA 1IQ0A 1GN9A 3AF1A 2WTUA 4P38A 4U2BA 3B1KA 2EKDA 2NP6A 4GXRA 4ZAXA 2X8LA 4EYOA 1NVVQ 1GAXA 3O2QB 2GRUA 4M8LA 3SXPA 4NSNA 4K9PA 3INTA 1T9GR 2JFVA 3GPDG 3QE3A 3ZVKA 3GA7A 4V1CB 4LUCA 4UEOA 3K2QA 3BD8A 5JVDA 2ZRQA 4DVGA 2LTAA 2EFYA 3KJEA 4RK7A 2Z30A 3DMPA 2GZSA 3S2IA 1BEEA 3W8FA 2FQYA 1D6MA 4QU8A 2O2IA 1RHRA 3T34A 4ESHA 5IDWA 1JBQA 2QJTA 2R1ZA 1TYDE 1VXOA 3FRIA 3H65A 4IOJA 3WGOA 3LLSA 4GR9A 4IG4A 4PNHA 2GPSA 2OQ2A 3RVSA 4ATNA 2J4CA 2XGOA 4TRRA 3C85A 1JQDA 3QU5A 2FI1A 2PH7A 2Q0HA 3AP2A 2ADOA 3RBXA 3WL5A 4HZUA 1E5TA 2DBYA 2FQQA 3B9BA 3EEIA 4HPJB 5KU7A 3IIIA 1A50B 4ZRMA 1ORIA 5HF8A 5JSZA 2BBTA 2CYBA 4DDKA 3ESZA 3DFFA 4KQ6A 2QAJA 3FAZA 1EFUA 1NJ2A 1ZEMA 2IUFA 1NE2A 4AMVA 5JPDA 1UPBA 4J1SA 3H0EA 2FZWA 5CLFA 1UPFA 2JZOA 1JBKA 3WK6A 2XD9A 2FUEA 1AN0A 4A4DA 1XKXA 4CG2A 5MGNA 1P5HA 1CIPA 1YR1A 3LZCA 6Q21A 2HIGA 1M7HA 1OKKD 1BXGB 2IOQA 2ZROA 3R3JA 4NZ9A 4YLGA 3TOCA 5HZHA 1Q0LA 4UC0A 2WJ3A 3CUKA 1ZZEA 2QU8A 1MENA 5ESRA 1KS9A 4H1VA 4OXNA 5SICE 3C45A 4EJMA 2YXNA 4X66B 3CF0A 4RPLA 2QTRA 3K7EA 2GZ1A 4F3YA 4QLBA 3FHCB 4TV8B 3AVXA 4DUYB 1U4OA 2FLVA 3DC7A 2FZKA 2HGSA 3HB0A 4DHEA 1AKVA 2HDHA 3GMIA 3UMCA 2GA8A 1T35A 2HHCA 1XEFA 1PL0A 4G0QA 1KJQA 2FVYA 4RJJA 4KCGA 1DINA 2CYAA 2PBLA 3NC0C 3RJTA 4C0QC 2WMOB 4G0ZA 3IPRA 2JNWA 1X0XA 3DMHA 1AUQA 4UEKA 3IVRA 4EY5A 2C3MA 1I01A 3VO8A 2JLBA 1I6KA 2EJVA 5ARDA 5I8WA 3QUQA 4XB6B 3GJ8A 1CEYA 3VR4D 1XQVA 1NQAO 1K4KA 5AP9A 1EUQA 1HE8B 4X00A 5E3IA 2H11A 4FQ5A 1UZUA 4PNEA 4KGDA 2AV6A 6ABPA 1U3VA 1YUMA 3JYLA 3DW1X 3F49S 3RVQA 3T1OA 1IMJA 1QHSA 4DMUB 1RRVA 1I3OA 1BRMA 4PYRA 1ABBA 1IHOA 2FWBA 2YWGA 5AJWA 4ZAWA 5TV2A 3M6UA 5L3SA 4FD2A 4HGRA 1XJCA 1KVRA 3L1JA 1YI1A 4CMIA 3KHTA 3B2QA 3DAYA 4QYSA 1ZN9A 3UHJA 1OI4A 2WVJA 5MN5A 1FFYA 3NBFA 1CTQA 3DMRA 4GAEA 4PYMA 1VE7A 3E03A 4J7XA 4QHSA 1KP3A 2WJWA 3RJ9A 3DAOA 2PVPA 3I76A 3WRYC 1TQHA 2ZTLA 5P8WA 3Q3GE 5BUSA 2GAFA 4DLSA 5TMPA 4IDCA 3N2YA 1CNEA 1TEVA 3Q3EA 4YCCA 1X77A 2DR3A 4IGKA 1O5OA 3V2HA 4CEJA 1GZVA 3E84A 1CIJA 1I32A 4QVIA 3AHDA 3TW0A 4W5TA 1E2UA 2BSAA 4YAJA 5LC1A 1Q1NA 4AS3A 3ZBUA 5HEKA 1QRTA 2OLJA 1I1HA 1ZMXA 3G2PA 1HTWA 3IP7A 4MW6A 4JVSB 2HU5A 2F00A 3AYXB 4KXVA 3CPSA 2QTWB 5H8WA 2VIIA 1MV8A 4UCWA 3S1AA 3CT6A 3OIFA 2VP0A 4QO8A 3ZNOA 4N5LA 4WFKA 1KWGA 3RK1A 1V7ZA 3LXRA 5LZ2A 1VLHA 1N32B 2ZRMA 2GLUA 5DBGA 4GQAA 3IAAA 2ZB4A 4P8RA 4OHVA 2QDKA 3ZS8A 3ILVA 3ZH9B 3WDLA 2Q45A 4LZZA 3EEFA 4JHXA 2ZKLA 3KWJA 1JHAA 4LOKA 2WKQA 4JKOA 1QLHA 4WCDA 1X1AA 4RDXA 2AHOA 2C5HA 2LIVA 2QVLA 3KJIA 2C8KA 3QH4A 4NDNE 2QSJA 3TSZA 5E2BA 1YB7A 4FS8A 1JXAA 5B4VA 2BZ1A 1NWCA 3B1FA 1XCOA 3TXAA 1NUHA 3I9OA 5HKKA 2ESRA 3H4TA 4TKLA 4D99A 4TN5A 4DVJA 2JL1A 4EB8A 1G2IA 3I0NA 1KIFA 2D1RA 4L22A 2I8LA 4MW0A 2HPHA 2HL6A 1EG2A 4LHXA 1D2MA 1WUIS 3Q3VA 4ICIA 4WRRA 3L9WA 2O0LA 3IP8A 4OQMA 4C6SA 2DPHA 3JSXA 4JENA 1TO6A 7YASA 1FP4A 1XK7A 3LV8A 3OMWA 4PNPA 3OEHA 3QPVA 4QQNA 5AYVA 4Z3OA 1JKIA 5EZYF 3DVRX 3TUZC 4RY9A 4Q12A 1I94B 1EXMA 4ZZ0A 3SKYA 4MV1A 4JL5A 3AI3A 4QA9A 3HJFA 2R7KA 5EFZA 5HK9A 4PF1A 1XCMA 4ANFA 3JW8A 3GYGA 3A4LA 5BQ5A 3V55A 3G7NA 1AVTA 4D8YA 3FFXA 3QUAA 1D2GA 3ND9A 4RGYA 4MGHA 4Y2VA 1B93A 1O87A 1YULA 3COYA 1KRHA 3PV0A 4IAOA 5ALNA 4BO0A 2OCXA 5KTPA 2GESA 1F7VA 3WRYA 1JFLA 3GIDA 2C5LA 3D5EA 5B1HA 5EZ5A 3THYA 1UJ2A 3F6RA 4FD3A 1PLKA 4UREA 3ROXA 3B5JA 4W9NA 2G4VA 3UK0A 2A58A 1WPXA 1E7SA 2Z0MA 2HUNA 5IKEA 1UOEA 2NZUG 1NVDA 3DYVA 1FTYA 1T5TA 3RAJA 4OKNA 3GPBA 3H5IA 3E9MA 4NOMA 4W9MC 1DQSA 2GHQA 3WQQA 2WUFA 2WLSA 4J4HA 4Q3CA 1DWUA 1RWPA 1ENPA 4UM9B 5ESDA 2PTHA 3O0TA 1HT1E 1T5IA 1RKUA 4I1RA 4K40A 4I4TF 4N5NA 4BO9A 4C4SA 4Z7JA 4FNOA 4G5SA 5E6RB 4DV0B 4MIKA 5DX1A 4CHTA 5AK0A 2FFJA 4UDOA 1Q77A 4QJ5A 1QPZA 3EXHB 1JJIA 1U0OC 4G81A 4N82A 4OUDA 3A6KA 3HG7A 4PC1A 4QC2A 3RUCA 4Z54A 3SHVA 4Z49A 3N3BC 4C7OB 3H8JA 1OQAA 2IIBA 3Q5DA 3R6LA 3AHHA 2FRXA 1R4MA 4Y0NA 5CLLA 2OB2A 1U8FO 3RKSA 4CM4B 1WR8A 4WVLA 1NUTA 1MVNA 3FMPB 3F90A 1R5OA 1RI2A 1IONA 1LGYA 1UBRS 1M0TA 2A1IA 2VRCD 3BIXA 3E9YA 1IXYA 3O8DA 5H83A 5KCZA 3VH1A 3DM5A 4IDNA 4ENWA 2UXBB 4EYKA 1HYQA 3KK0A 3PHGA 4JMLA 5BQOA 4KO3S 1NRJB 1L7VC 4R2LA 3T1YB 2VDWB 4N1AA 5HJ2A 2FW7A 3R20A 3Q41A 1N2CE 2TSYB 3AUSA 2IHJA 2VDLB 4YRSA 3HKEB 4IPTA 1YFJA 3AMVA 4GLBA 3O2JA 4AZ0A 1YK1A 2O2YA 4EBBA 4DQ0A 3L4SO 2FZCA 2WIDA 3IAHA 4Q6WA 1XZKA 5AT1A 5KO2A 3MMNA 3DT6A 4KUEA 1PBTA 4AURA 3FMOB 3IVCA 1E5DA 4XLZA 1F3OA 1A9RA 2DBZA 1YR3A 3SBDA 2Y27A 3KV3O 2CEKA 4MKRA 5HYVA 3F8SA 1FX0A 2X5NA 3L6CA 1I36A 4S2UA 2A5DA 2EFJA 5CEJA 5IFKA 5AVJA 1Y81A 1LDYA 2JJ2D 1AM4D 2W70A 5FADA 4KL8S 3GK3A 4F3KA 2XNKA 5K2MA 1LCIA 1P1HA 1NRWA 1U0NA 2C2GA 4XIIA 1F8GA 5DV9A 3UPUA 1UBMS 2BKUA 1I7LA 4V2UA 2AW3A 1IM2A 3T99A 2YVAA 1FFHA 1WXGA 3ND8A 4OHCA 5EQDA 3SD7A 4UTXA 5GIPE 2BISA 3IA2A 4HUJA 4U6QA 3NANA 4YDSA 4BO1A 4GPAA 4E14A 1GGFA 1N8KA 4PO3X 1AOXA 1C9NA 2FPLA 5A03A 3DWFA 3GMSA 5DMHA 3GJTA 3QNWA 3CX3A 3H5VA 3WP1B 3GFTA 2GCGA 1EDDA 4IHAA 3Q7RA 5KS2A 1RQ2A 2XB4A 3EZGA 4OSEA 3KR1A 2J5BA 1H3EA 1Z0ZA 3LLUA 2E9SA 2P9QA 2BHLA 4PG5A 3A6HA 4X8MA 5TQ2A 1CCWA 2FXIA 2G1JA 5BMVF 2RHLA 3TLMA 3E70C 2WKWA 3FGOA 5GM1A 4X62B 4DR7B 4CCAA 3ZG6A 1MVLA 3HHEA 1U7OA 4MEAA 4RIIA 2Y71A 4FNGA 1JR4A 4TUYA 5D5PA 4ZHQA 5KOJA 1M2OA 4LQ4A 4KYTA 3I12A 4TYMA 3LFUA 4PLGA 4P7JA 1N6NA 4URFA 2CXOA 2OXEA 3MMZA 4FYVA 1AKEA 1AO3A 4U7TB 5FPYA 3RVPA 2GF9A 5HRCA 1XVAA 3RUDA 2PSSA 2JFFA 3DE4X 4RPHA 3WL4A 2HT1A 2ZIXA 2IXTA 1N2OA 2AEEA 2O2GA 2X3FA 2ZWOA 3CCCA 2ZB3A 3O1LA 4PRLA 4HCJA 5JAIA 5L95A 3HBAA 2O8FB 1U02A 1HR0B 3GCWA 4EFDA 2EJWA 2FEKA 1OGYA 4FI3C 4HEJA 3TK1A 1YV9A 2Y9PB 5E95A 4BE9A 4WLOA 3A37A 1IFXA 2MSEB 1K9VF 3BWMA 4Y1EA 3ZK9A 4CW7A 1GAJA 1R0XA 4A0HA 1ZH2A 4RDCA 4DNQA 2BV3A 4HDRB 4MLCA 5ITWA 5C7IO 3THXB 1I7NA 1SIBE 1QIEA 2QLJA 5JCJA 4F6LA 1DGQA 2IEGA 2ERCA 3CH4B 5DO9A 4BB9A 5I5EA 2QP3A 3OFJA 4RZIA 5ADVA 2C4VA 4NENA 1ZIDA 1DC4A 1JHOA 1FF9A 2JHFA 3QKUA 5DXAA 4BV8A 1QE5A 1GQQA 8ADHA 5DNDA 3N7TA 1PJCA 2B4TO 1S8FA 2B94A 2R9VA 3KV1A 4RKFA 3VJMA 2VNAA 1BH6A 4WXPA 4MMXB 3UKOA 5A02A 4WESA 4N4AA 3OETA 3VU8A 4MPRA 5H0IA 4BAUA 3G6KA 3PPVA 3U09A 1B14A 2FZ5A 2W8BA 3JWJA 5HCNA 3RW9A 2GB4A 3GLHB 1YJ8A 3V8QA 2BM8A 1A5SB 2XB6A 1F2UB 2XODA 3VYWA 1U2PA 2WM3A 4CIYA 5H4GA 3O8QA 5IG2A 4EG6A 1J8FA 4FP9A 3LWDA 5FWYB 2CZGA 2V9PA 2E21A 3OX4A 1RWMA 3H2HA 4HDKA 4HQ6A 3ZCPA 2I6QA 3CWZA 4ML3A 4MVJA 1CF2O 1JX6A 3MG9A 3PUYA 1ODKA 2O14A 1U8CB 4MYRA 4L78A 1IHUA 5CW2A 2NP7A 1PJRA 1L7QA 1Y4UA 1EHYA 2GJSA 1UDWA 1FRFS 3R5KA 4ZDIA 5A4JA 4JIMA 2H4HA 3AETB 2OWEA 1F2TA 2Q8NA 2QM8A 3HHPA 5CT6A 1IAQA 2E18A 4UM8B 3R7BA 3DKPA 3EIXA 3GDGA 4YC7A 5K1ZA 3ZV5A 4D25A 2H00A 1P18A 3BK1A 3TQCA 2Q9BA 3L8FA 3TF5A 2QVCA 3QY9A 4EO7A 3VR2A 3ET5A 5K3AA 2I8CA 3ZY3A 1CQXA 5J9FA 3PYMA 4MR9A 3U26A 1JZTA 2VJOA 3QKIA 3H5WA 4JCCA 4BVBA 2EWMA 2PGIA 5CYOA 4OI1A 2AFIB 2VDJA 4JYPA 4OAOA 5FO1A 2EW2A 5A0FA 4QZVA 1JQ3A 3CB4A 5EHQA 1NNEA 2WG0A 3DEZA 1MAHA 1OILA 1Y5IA 5DXJA 3HCFA 4PX5A 1Y6GA 4IIJF 2QXYA 5LA6F 3GPIA 1Z63A 1T9KA 3C6XA 1Z2OX 1ZOLA 3PC2A 4JLWA 4L0MA 3O8NA 4V0MA 4MRVA 1M1ZA 1WCYA 1HDXA 1RC0A 2ZQYA 2P9BA 4X6YA 4RTLA 1YQXA 2NZWA 3NHZA 4FFBA 4ZTZB 3LLMA 1F2VA 3SJAA 1EZ4A 1ZU4A 4MUEA 3AJEA 4K6FA 1C29B 1DEHA 2A33A 2WYIA 1VBFA 1G3UA 2FLWA 2FPPB 2PZMA 1V4BA 5BWCA 4Y1GA 3T41A 3CUYA 3TSOA 3J81A 1U5BA 1XTKA 1XEXA 2H0AA 1R18A 1KI1A 1M1YA 4RZQA 7GPBA 3DV2A 5A3RA 2HA0A 1BMDA 4Y2XA 2VPZA 4QUEA 3V7UA 1U81A 4LAFA 4H59A 1XR3A 3RRXA 1V8OA 2X3YA 3NCHA 5DYIA 1MABB 2V7VA 2B4KA 1RACA 1GAEO 1U28A 1V5EA 2XT0A 3DL7A 1M8GA 5ALPA 1EVZA 1MA0A 9MHTA 3NONA 3EYAA 2COUA 4ZJZA 3V2IA 4F5ZA 4WKBA 1UJ6A 1NPYA 4J3JA 3QUCA 2XDQB 4YRMA 3HUEA 5D3ZA 4DEVA 1U04A 3MPUA 2PT5A 4INZA 4TKMA 2FQ1A 3GYBA 1U0HC 5FBVB 2PX5A 2OG2A 3EWNA 4IDQA 5K5EA 3VJRA 3AUUA 3E0XA 1KEEA 1VCHA 3WMEA 3W6ZA 3ZU2A 1CRLA 1QFJA 1ZIXA 2Y2VA 2QTLA 1U7DA 2TECE 3SXUB 1U0SY 4TWAA 4BBZA 4G07A 2OHOA 4ZOLB 1A2KC 2C2YA 3BG5A 1D0SA 1GKYA 3R5XA 5AOCA 2ZRFA 3TSWA 4DJEC 4GX5A 4X1YA 4XQ9A 1F1JA 2YWBA 3OAAD 3T95A 2FPGB 5TX7A 1OTYA 1X7ZA 4M86A 2O3TA 4OGKA 4X61A 3RG2A 3UA4A 3VI4B 2FPKA 3VAYA 3L7JA 2BKAA 4NBUA 5LDGA 1IBLB 4CL0A 5HIIA 2QJOA 4R81A 5T6MA 5BXQC 5DCWA 3BZBA 4O02B 2P1RA 2NV6A 2ZCUA 4OQNA 5BNZA 2DULA 1PNOA 4M76B 1K6IA 3RUHA 4HRAA 2HU7A 3I37X 1UQUA 3OCZA 5THKA 1HMYA 4P83A 3WTCA 4AJHA 4ZGWA 1DP4A 1IY0A 3FX2A 1LEHA 1GUZA 3ZQ6A 1Y1PA 4H15A 1GDTA 3WSTA 4IGEA 4KQ2A 2O3UA 3MA0A 1GTZA 2FN4A 2KLHA 3FMIA 4FT2A 4J1TC 3NW9A 4R51A 3RARA 3RTEA 3VR6D 3BGIA 4LY6A 3T7EA 2E55A 2J3IA 1JHXA 3BCSA 3OZRA 3TFWA 1T2UA 4XUEA 3AOGA 4LDPA 1JQJC 1P3Y1 1RKXA 2HF2A 4Q9AA 1RQ7A 4ZAFA 4UZFA 1K6JA 1MOQA 3II6X 4ZCIA 5FP0A 3T9FA 4DSZA 4M6WA 3KXKA 4HYQA 1AUOA 3C48A 1X7YB 2NTEA 3EY9A 4RS3A 5LXTB 1LDBA 1V5WA 4LHWA 5ABPA 4M88A 1EBBA 4ZZIA 2XE6A 5D84A 4Z1MD 1MAVA 3TWOA 1IHDA 5BOSA 3CVVA 2ZIEA 4U5QA 4BMNA 1YA4A 5L45A 4IV8A 1A9XB 5B3KA 2OGSA 1A7AA 3IUJA 5TQVA 2RG7A 5IJWA 2NQ8A 1CY6A 3G8YA 1RI4A 4ZVOA 2W00A 4KN9S 4J9VA 5BNIA 3C1AA 2Q7OE 2OZLB 3OZTA 1V95A 5D87A 4IGFA 4S1WA 3ZXYA 3DTVD 3ILSA 4NV1A 2DY1A 1ZCAA 3R1IA 1XQ9A 1M6WA 2A0UA 1C4OA 2YHSA 4NOKA 4YY3B 1QKKA 3G2IA 2B1GA 4AM8A 1EVEA 5A5GA 1PWZA 2AI1A 3B82A 4GXTA 4Q19A 4I3HA 5AJVB 3SR0A 1XJWA 1PKEA 1W73A 3K53A 1O94A 4NYIR 1EAMA 4C1BA 4CUJA 2V9CA 2W7TA 5CURA 3SEQA 4F1JA 3UJHA 3HCAA 2P0AA 3O8BA 3O5AA 1TKAA 4XWYA 3CCFA 3VKUA 3W2TA 1JYEA 1CZOA 5ED0A 5HOEA 1D2RA 1Y1QA 2ZYDA 1FMFA 1Z38A 2ENWA 1CB7A 4L1KA 3ZHBA 2GFQA 4D02A 2XEXA 3H87A 4ZO4A 1N7GA 3C0KA 3DAGA 5KEIA 4CMEA 1SVUA 3Q3JB 4AMYA 1P2GA 2DQ4A 3U61B 5AVRA 2EGGA 5H70A 3RJ5A 5COQA 1B2LA 4EGCB 2E7ZA 2PS9A 2FJ0A 1E77A 4XPZA 2B69A 2B25A 1N7IA 4JODA 3H0KA 3RTBA 1JEDA 4ONEA 4U7WA 3TOVA 1W0CA 5M2QA 4DAOA 2N46A 1CR6A 3SIWA 3SJUA 4ZARA 2QMHA 5FNVB 4S3MA 3WS7A 1ECFA 3G89A 4ASUA 4XFDA 3HL4A 3LF2A 3O84A 4XCVA 1QIJA 1D2CA 3MTJA 4J1TA 4QPJC 4IG9A 4MVWA 1KY4A 3OPYA 4BMSA 4YX9A 4TV9A 1PR1A 2ZI5A 3E3LA 2J0SA 4PAOA 1HRKA 2EX1A 2XCOA 4WBNB 1EE1A 1VLJA 3L6OO 3CNQS 3LRXA 3PWTA 3QENA 3NIBA 4TMTA 1OVMA 5EKUA 1M0SA 4K9LA 1XNHA 1OU4A 3ZWYA 4B4OA 1E3WA 1K3TA 1WG8A 4M8SA 4EFMA 4PFJA 2NU8B 3CVUA 1SCUB 2B5WA 4JZYA 3W9UA 1G8KA 2IDZA 1L4HA 2VJNA 2Y1GA 2K7ZA 2Z8YM 3DOCA 4ZO9A 3DT9A 2ZZNA 2FFBA 1XC7A 4XTRA 3VRHA 2RI6A 1GWNA 3IOEA 1A95A 4YV2A 1HNWB 5B7QA 1AA9A 5EIHA 3AL2A 4GGOA 4M83A 4D4MA 3TRFA 4MYUA 2YY6A 2YY5A 4XSGA 2OUKA 1N9KA 2HD4A 2IPNA 1LW7A 3GLRA 1J97A 1MH1A 2ZJFA 4UAUA 1UPXA 4PXSA 3LPDA 4B4WA 4DR3B 5JQGF 2YDXA 1K5HA 5AOBA 3T7JA 1QHHA 2ZRCA 4TQGA 5AVQA 4I08A 3HCWA 1HE3A 1VHLA 5C5EA 1JGTA 2ANCA 2IKQA 1OXVA 3BD6A 1WPQA 1W36C 1E1CB 2A5GA 3NVDA 3RTDA 3LUDA 4JJ8A 1EK0A 4DR2B 2B8NA 3ILHA 3MWYW 4FJ2A 4L3WA 4RLSA 2J3MA 4GICA 4NYJR 2NU9B 4EO4A 1SXPA 4TX1A 1PJQA 1NRIA 2IJGX 3REQA 5DDIP 5KJ6A 3V7NA 4M0KA 3F1KA 3W4IA 1JHZA 3LK6A 4G8BA 2Q6OA 4BMDA 1MDFA 4Z4FA 4CKZA 4YXFA 5CB8A 5DNUA 4E5SA 1Z26A 4RIHA 2J67A 4IIHA 1QPGA 3EVAA 4EVSA 1TTTA 4OP2A 1PD0A 3OECA 1VGVA 3H1EA 2OO3A 4IGIA 1D2EA 1T29A 2FWIA 3LCJA 4AZVA 4FZVA 1GNLA 2PLWA 4JNCA 1JU4A 3PKJA 4GWLA 4KE8A 4CIXA 3CIFA 4F72A 4AXBA 1DKUA 1RMQA 3F47A 2H31A 3DT8A 3V4FA 4F2WA 3KB2A 2VF5X 1BA3A 3H9GA 3D1JA 4E2FA 3DD1A 5DBOA 2EQ5A 1FNNA 2P78A 1SG6A 4QNNA 2OR3A 5HFJA 3E48A 3V7FA 1FFWA 2NO7A 2W2QA 3ETLA 3HQ4O 3EPLA 1XZPA 1L8AA 3ZVMA 3GDWA 3L6RA 3L0DA 1TJ4A 3PENA 3QWBA 4AFNA 5KOHA 1VM6A 5CNKA 4JASB 1Q57A 2CVHA 2YXPX 3K0FB 5LL6P 4YWHA 1FFAA 2B0JA 2OBBA 4DWWA 5EPOA 3EBPA 2V45A 1SCDA 5A4FS 3I3OA 2YINC 5CVUA 4HFNA 6AT1A 4PWYA 4ZOBA 3HL0A 4BNDA 3HJRA 5BV1A 3HKCB 1YZUA 3RSLA 3W5AA 3MN1A 1PG2A 3VPXA 2AVDA 3FSGA 3VYRB 3LW8A 5CCEA 2ISCA 4JS0A 1R9NA 3IE2A 5IMSA 2EU8A 2KW5A 2YNMD 1E9BA 3ZHVA 2B37A 3H1TA 3T5MA 2V6BA 1J8QA 2H1SA 2JD2A 3L9XA 2JBHA 2O3SA 2OK8A 1H8ED 5JXJA 2IPMA 3E9NA 4L4XA 1RJWA 1KO8A 2QTGA 1VB5A 2M98A 5JU6A 1VBKA 3DOUA 3DZDA 5BT8A 3GDHA 4Q9IA 5AW3A 3SLKA 3D0QA 4LMPA 2XPCA 1KHHA 2XNHA 3T3PB 3EA0A 2BKEA 3AH8A 3M6IA 1H6CA 4L9AA 4IFIA 3VM6A 3O9VA 5CA0F 5FR1A 3OPXA 4B6FA 4Q4HB 1W5EA 5IFLA 1L7PA 1A3CA 2QV0A 3RSCA 5EHXA 2FCRA 2ENUA 3HU2A 2P6RA 1BS9A 3UWOA 5FOSA 2JJYA 5K0TA 1QK5A 1XPJA 4DJDC 5BUQA 3GROA 3EG9B 5DM4A 2XA1A 4ZDWA 4CEHA 1OLUA 1WOYA 2ORIA 1FJ2A 2QN9A 2MSLA 3TQSA 3VHXB 4E1VA 3UJ3X 1L6IA 1LS1A 1X1QA 2CE2X 5BQXA 2EDAA 2E6UX 2D0PB 2IXGA 5K3DA 4OJTA 4QOEA 2JCSA 1YDGA 1E6UA 4YMVA 2ODNA 1I4TD 3QEMA 3B5IA 1G8HA 3FXAA 3HGTA 5C8DA 4QVGA 3O47A 2DR0A 4YP7A 2J0EA 1V43A 1XKQA 3TLYA 2BMJA 3ZOKA 3VO1A 3EVZA 3OIDA 1F1BA 3UJNA 2INGX 3K35A 5TF0A 5ALKA 1SXHA 1A2BA 2FPWA 2FFHA 5K4AA 2FN3A 4X65B 3D0KA 2NV0A 4RACA 3D7KA 1NPTO 5JR3A 2VPWA 5EC8A 1VPLA 1HT3A 3KUDA 4RDIA 1RWNA 4DQVA 1QGED 1YDEA 4I7EA 4LGCA 3LGXA 1KEKA 2RH9B 3DFKA 2WE8A 1ZGJA 3FPEA 3D6UA 1KSGA 4BNNA 1Z35A 5TT1A 4NRDA 4DIKA 4OLAA 1VHWA 1WLYA 1DIGA 5HJ5A 5KNBH 3G2KA 1GRRA 1E9RA 1TUGA 1L5ZA 4OJYA 2FEOA 4RXTA 4LGMA 1NVAA 2L19A 1RQRA 2ORWA 5K0JA 4QGAA 1B3BA 2H5IA 4KQEA 4IO0A 1NQVA 1RD4A 3G1WA 4HMOA 2I6UA 3E9CA 1HFKA 2ABWA 3DE7X 2VI5A 2C57A 1TA4A 5EWJB 2IQ5A 3EFOA 2IU4A 2NZYA 4MQ6A 4K26A 5FV7A 3M5CA 2J4DA 4HK4A 2E4ZA 5A4IS 1QH1B 1CX9B 4NE7A 1BVHA 4DLWA 1M73E 4XDGA 6YASA 5LB4A 4L08A 1JMKC 1LW6E 3MFYA 1MG0A 4WY8A 1WZNA 5DIZA 1AV7A 2AFRA 1O5IA 5AW2A 5CDFA 1X6VA 1JKXA 1GSOA 1HKUA 2N47A 4JGIA 4GI5A 1THGA 2XE4A 3V8VA 5JQWA 3LK7A 1GAQA 1E4VA 2O1SA 4KH0A 1E6WA 2VSOA 3M9LA 2CJFA 2ZUSA 4CT5A 5I3CA 1I1QB 3CJRA 3DEHA 4F9TA 1KJZA 3M4JA 3DUFB 2DHCA 4O5AA 1RCTE 4KWEA 3R5TA 1EFVB 1QCZA 1C7EA 1CF9A 1E5QA 4WTOA 2X0JA 1D04A 2I7TA 4HLQB 5TGDA 1UXHA 2O50A 1QVAA 1LDMA 2OK7A 4K8OA 4MV8A 1CQIB 1WCIA 2F6RA 4KUHA 3Q7IA 2EYUA 3HCEA 4OH7A 1DTEA 3D7NA 4JBGA 2GWRA 4B3IA 5JCZA 4DT1B 4X8OA 4UTNA 1YI8A 2WIGA 5F1PA 3IAUA 5KNLA 1N2XA 1OZ0A 4TTVA 2P90A 1LSJA 4CLRA 3B2EA 3BIOA 3RS7A 3S2UA 3RTCA 1YF3A 2I2BA 4A82A 1K5DA 1SUEA 2L69A 3U3ZA 5A6SA 2DWQA 3DV0B 2O8EA 1MB3A 2HZ7A 3KYDB 5ALTA 4K05A 1IPHA 3B20A 4QTYA 4BNJA 1F0NA 1YR9A 3BKWA 1QC5A 2V7PA 3AFMA 3RUEA 5HG0A 1AGXA 1YS6A 2WQZA 1EVLA 3NAZA 4CKBB 5HR5A 5EE9A 2FZEA 1V9CA 4JGGA 2PK3A 3JQPA 1YKGA 4IIVA 1XFDA 5CK4A 5FOQA 2OVBA 1MN6A 4NC9A 3N2KB 4KC0A 5E1OA 2C5FA 4NDZA 3T1NA 5CT4A 1CJTC 1QO9A 3BCHA 4LDZA 3TRDA 1J9GA 2WF8A 3ASYA 1S2LA 1XAHA 1U0JA 1XWFA 3WNZA 3KXPA 4U2FA 2Z58A 1L5VA 2R8PA 3LXXA 3A4VA 3BSSA 1R6AA 2MTBA 5DTJA 2IS6A 4RWEA 3ZJ4A 3E53A 5LQRA 2QXTA 5IP5A 2NXJA 3SY8A 1M34A 3GIWA 4X1KA 1TMYA 3VKFA 3ANSA 4AROA 4EKGA 1YC5A 3SBEA 4A27A 1NLMA 1O2DA 2XHEA 2AF3C 1LNSA 4K9QA 4LE0A 4LNHA 5AK5A 1G5HA 5FLYA 5KX5F 4JJKA 1DCFA 1T2DA 4MVJG 1LQUA 4F21A 2W22A 1O58A 5I4KA 3HCDA 4JXJA 3FJ1A 3WWZA 2F48A 4PC6A 2IH2A 1KK1A 2OXIA 2QUJA 4HZGA 4Q1BA 4HQRA 3TZHA 2P2CA 1NW5A 2X5XA 3NHMA 4EPWA 5KYGA 3DFZA 1FIUA 4Y30A 2ES4A 3O4JA 2AEFA 4GX0A 4TWBA 3FTCA 4MKHA 4MGZR 1XXHE 4FINA 5FL7D 3W4KA 2HFKA 1FS6A 1DOZA 1XEWY 3MW8A 3RIHA 3WFZA 5AVUA 4AJLA 4B48A 5I9BA 2CB9A 2ZBGA 3K0HA 4J03A 1RJ9A 2EKLA 4B09A 4COOA 4ENPA 3AEUA 1T5LA 3CLRD 1WB4A 2TRSB 3JD2A 3JCZA 1YJ5A 2I6XA 5GONB 1SCKA 4H7KA 3KQPA 3BMQA 4X45A 3O4RA 4QASA 3DVAA 2JFZA 4EATA 4RWZA 1O6FA 2SKEA 5EEHA 4M89A 3V00A 2AZXA 2XCTB 1XCBA 5BSEA 4UD2A 5K05A 1QS0A 3HDYA 2IHZA 1ZNZA 3N75A 4NZPA 3PDCA 2PKCA 3DDHA 4QDKA 4GVLA 1Z2EA 1C1YA 1XELA 1GL6A 2PUHA 3F3KA 3HM9A 2G88A 3BXGA 3ZEAA 3I61A 5BVHA 2Z4SA 5ALLA 4DC0A 1ZN7A 5DASA 4E09A 3DXXA 3G3EA 3I4FA 4DB2A 5A7GA 1K86A 2NO1A 2CHVA 1E1QA 5EZSA 1F9EA 1ZY2A 2ZSHA 5JZ9A 2H4JA 1Q7TA 3WO0A 1LPBB 2H8KA 3GJRA 4GP9A 2CUTA 3GEPA 4YB8A 2O2DA 4AG3A 1G63A 1HETA 1RIIA 1PLLA 1GNTA 1VP3A 3CO5A 1N57A 4BNMA 3GP5A 4HSEA 1YVPA 1K63A 5BY2A 4DV5B 3PFWO 2YJTD 4Q21A 4WEOA 3ZNNA 1VIDA 4Q00A 4GPBA 1M6HA 2ZWPA 3ZLVA 2FR0A 3D3WA 2XGJA 1JYFA 1U8EA 2RHGB 2O0JA 1B43A 2BFBA 3D2BA 3IQFA 3OG9A 3OBBA 4MIOA 3EIWA 4W6QA 3Q72A 3UAZA 3JARA 1GG9A 1GNPA 2WIBA 4KWTA 4OI0A 3LOUA 1GRNA 1WCWA 2REBA 1OI3A 4FCWA 1C7IA 2DSNA 3LKZA 4M3NA 2CE7A 1DCTA 4HADA 3IRUA 4KV9A 3RLIA 1FYFA 3UHPA 5SYNA 3NAQA 1BDJA 1E9VA 1WW2A 4QDXA 3ZE9A 4ED9A 1M0EA 4NU5A 4B3DA 2JI7A 3KQKA 2P0EA 1UOQA 3AK4A 5AVTA 5LMNB 4RADA 2H0RA 2ZRHA 3RC2A 2P6PA 1DBQA 3ABQB 3OTHA 1VL6A 4GI3A 3C1OA 2C54A 2OORC 3TMAA 2BHNA 2P77A 4YV0A 2XZDA 4EUNA 4XB2A 4IWNA 5GGXA 1UXKA 3GY0A 4Q3LA 4GOMD 1C9EA 2WMDA 4MLPA 1Z29A 2E4XA 3BIJA 1Z9BA 4KDRA 4JBYA 4X7BA 3EF0A 3IDOA 4M38A 3ABRB 3RVBA 4C4ZA 1H85A 1V47A 4MRSA 1NVXQ 3UGJA 1WDLA 1D8AA 3HWWA 5IN5A 5BWMA 2IEDA 3HP7A 1X1CA 3WLPA 2C2OA 1JLMA 1A8IA 1RWXA 1GUFA 4R71A 1S8NA 1US8A 4CTMA 1SOVA 3QFHA 3GO4A 4WUTA 3IYLW 4XR4A 4DYHA 4EHJA 2JK1A 4C89A 1ADYA 1HOXA 4GZLA 3ZDFA 5J1SB 3KIPA 3VTFA 1M10A 3DS8A 1XLVA 2J5XA 1CS4C 2JVJA 3H75A 1HNXB 2QRGA 3OU2A 1V5GA 5K3SA 3WIBA 1N8SA 2WINI 4YR7A 3JYNA 2BM9A 4LF9B 1Q6ZA 1C2YA 4DIDA 4DQUA 1I8TA 3GEHA 2J33A 4PZUA 1A5ZA 1WZUA 2EF0A 5HDQA 3SYKA 3L05A 5DYYA 1WXIA 3V3TA 4DLXA 5CLQA 2QU7A 1CB0A 4YMSA 2Y6UA 3LXUX 1UODA 3A9RA 4KITB 4GSKA 1CHNA 5I9NA 4MW2A 4XFJA 4KGVA 1JSXA 1UT8A 2I1QA 2Y0PA 3QFSA 4JLKA 1OLXA 5CG2A 2Y1WA 3I8OA 4A5OA 3NP9A 1CQJB 3PVCA 3X1XA 3ZHRA 2IPAB 2BDEA 3KEGA 2ZK7A 1G6KA 3Q0EA 4N3GA 2XCLA 5GAJA 3E2MA 1V26A 5G0VA 4YWJA 3LNTA 4MCIA 4LOJA 2C4WA 4FCCA 3EZYA 5EXTA 1U65A 3RSOA 3VPGA 4L5IA 4HQNA 4G0OA 3NXKA 4KP7A 4WZAA 3VC1A 2WMNB 4UHCA 5C18A 5LBIA 4RFVA 1HY3A 4RV5A 2ONYA 2HDNB 3FBWA 1RHKA 1FUUA 5GP1A 3W5JA 3F9IA 3O31A 4FTWA 4Z7QB 2OMEA 4POOA 2WT8A 1GL7A 1HE5A 2A5JA 2XDAA 5I9IA 4FZ5A 1G8AA 1P9WA 3CUUA 1ST3A 1WHTB 4MKIA 3BMNB 3GNLA 1S02A 1PFKA 2JEOA 4N8DA 4WXHA 4AY5A 5BQ3A 2BJWA 2O2XA 1KL7A 3U7RA 1DFHA 4C87A 2UYCA 2CLLB 4B33A 5FWXB 2B4RO 5GTDA 1E3QA 2I2FA 1D03A 4UZSA 1X19A 2OILA 1AU9A 2FWNA 1EFHA 3AB3A 2DLDA 3CSUA 3U7QA 3VR4H 1XX6A 3N8KA 2IZ5A 2OORA 5D01A 3PRKE 1Y9EA 3WL6A 2YXBA 3NEYA 5I5GA 5HKAA 5ITZB 4NJMB 2Y1CA 1NXOA 2QD5A 5A4MS 4TROA 3QEJA 5J1TB 4EIWA 1IVYA 1WVIA 2F90A 2PAFA 2VZ8A 1JDBC 3IB6A 4H27A 3QVVA 4YGYA 2O52A 4ZREA 3ETNA 4ZALA 3J7AC 3S7TA 1B0UA 1JI3A 3K09C 5DSZA 1YKFA 2NAPA 3SKVA 5FX2A 3BF8A 1ZEJA 4MR8B 1ZK0A 3HZHA 3PKZA 5DWDA 3RRNA 3BE4A 1SQFA 4B9AA 2XZLA 3QBJA 4AP9A 3CH6A 2XW6A 4IXNA 1MP0A 1Q3HA 1PVDA 4K9KA 5CHYA 2I0FA 1C3OB 5IF9A 1RWVA 4EF6A 3BK2A 4ZO6A 4Y2TA 3RR2A 1FLVA 1XE3A 2QUBA 3NHLA 3ZW7A 3C6MA 3MXOA 1H2XA 1RQXA 3W05A 3DMTC 4MWBA 2PQ2A 4GMGA 4F3NA 5ISMA 5I7EA 5F2OA 3JYPA 5B3JC 1W75A 5TE9A 2B92A 1EDZA 3NHBA 3C3WA 2F3SA 4B5KA 3H9UA 4I4NA 2RHDA 3RC9A 1P7ZA 1UFQA 1Z16A 5JC8A 2GF2A 1B4DA 4QBGB 1U0TA 4HKTA 2GD0A 1QBKC 1PZHA 3QFTA 4I1PA 1XMQB 1KOFA 1OHHD 5KWSA 3STHA 2K2QB 3U7GA 2ZSBA 4QUGA 4N7MA 1U2DC 4NYMQ 1V1JA 5JPCA 3ZZNA 8OHMA 1KO5A 2WWYA 2C78A 3VSEA 2FP4B 3QPUA 3ZIAA 1JEYA 3BRQA 1PV1A 2B7LA 2GCEA 2AOTA 4S1NA 3PBKA 4OXYA 2Y3IA 4LOLA 1UXOA 4CM9D 1WHSA 5IDQA 5AXCA 1K98A 3WAGA 5E9QA 1H94A 5M04A 1LLDA 4TKVB 4DBVO 3AUTA 1XUOA 1BHSA 5LQAA 2IXBA 4ZK6A 3GGGA 3JYQA 4QTXA 1UBEA 1NC3A 1JIKA 5AI8A 5A9SB 2PFKA 5KYXA 3ZC3A 4M1WA 2P65A 3OEYA 4YP5A 1U63A 3MCVA 2C8VA 3PP8A 3TIIA 3V48A 1VYHA 2X7JA 2Z43A 3CBGA 4ZT6A 3QHAA 3UTCA 2H4XA 4B3FX 2RKBA 1QVZA 4TKUA 3MUEA 4PZDA 4OH1A 4K81B 3SOPA 2PNJA 4MZDA 1JLKA 1XZ8A 2GXQA 3E5HA 3M6XA 4QEZA 2PSDA 4AKEA 2H17A 3BICA 2DVMA 2FEXA 1U7HA 3BJIC 4BEJA 721PA 4WERA 1CW2B 2XF2A 3AUYA 4EPRA 2OV4A 4F93B 1RYFA 4NZYA 4FWTA 3D6JA 4M99A 3K09A 1UOPA 1Y1TA 1R2QA 3WO1A 5HIAA 1PDVA 2LCQA 1RE0A 5BSKA 2OXFA 2UYQA 2LRHA 4JAVC 2IEBA 2BY4A 2V8BA 2YRFA 4LRQA 4ND7A 1H6BA 3QKSB 1G7CA 4RD3A 4N01A 2VDNB 3Q85A 5U4QA 2FZVA 2J3EA 5K8UA 5LYJB 3BTVA 1T2EA 1YMQA 4R8LA 2XT9A 1GYQA 3O3MB 2CLDX 3H5TA 4IKPA 3CR7A 4JQYA 5D5HA 5EZYA 3NDRA 4BVGA 4ZU6X 1M2VB 2NLOA 3LCUA 4ZTBA 1Q0QA 3BFXA 3LOQA 2HJWA 3BD9A 3VAAA 1XTIA 3E9ZA 2O0MA 5GADl 3P4UA 5T8KC 4DNOA 5B3JA 4DHWA 3TZ6A 1VL2A 1Q14A 4KGXA 4B35A 3OJCA 3O4IA 1R6DA 1A5AB 2HJHA 1ULHA 3NJ4A 4JJ6A 1CR0A 4OYYA 3ZHUA 2BFDA 1FW6A 2BCEA 3ELYA 2MMGA 4PGFA 5FPQA 3TD2A 3WKBA 5JDIC 2OVFA 4HNGA 2WG2A 4LBYA 3O3NB 1J1IA 2F17A 4CMBA 1VKOA 1SHKA 2HTFA 1OBVA 1IVSA 1LH0A 3BB1A 1DV1A 1U2DA 2B1JA 3KJFA 3NEJA 4U2GA 2FEPA 3TLKA 3P0IA 5KNBA 4HUQB 2PKYX 3O1IC 1PYGA 2HIMA 4R69A 4TXNA 4QHTA 2QPOA 5IH3A 4AICA 1XQ1A 3M6AA 2G9NA 3F9CA 3DQQA 2UVPA 3EZ6A 3RNOA 4YRIA 1L5LA 4AZ3A 2GJAA 4I4TA 1E2LA 3ITEA 4DA0A 5DTMA 3FTPA 4FNAA 2G70A 2AWNA 3EAQA 1GGMA 1E0DA 3A04A 4MH0R 5FH9A 1ZR2A 2IEYA 5AHOA 4YQYA 3LRTA 3MYRA 1QVVA 3W7AA 5JEEA 2A57A 1QAMA 2A3NA 4DLRA 5C7OO 2B8EA 1PIWA 2X2PA 3AR8A 5B64A 2IBSA 1LY1A 3ZDAA 3IC5A 1JJ7A 2YC2C 3SFTA 2QY6A 1EX9A 4ZAZA 4EH1A 4KDFA 5F98A 3U0BA 1KS2A 2ERYA 2EW1A 5CVTA 2RGBA 1IN8A 3X2FA 1TJYA 3U7JA 5F52A 1DFIA 1MMFB 5E6UB 3AF5A 1SB8A 1GXSA 2VYFA 2ID8A 1ZXBA 4KXMA 5H02A 3OKPA 1FU7A 5G40A 4UUMA 3DWEX 3OT1A 2J9GA 2W6CX 3DFIA 4S35A 5LJLA 4C0XA 2VTKA 2VAMA 1Y5RA 5KB3A 2OM2A 2G71A 1U8UA 1RHUA 2GZRA 1GZ3A 1XCPA 3F3MA 2V59A 3RSQA 3PT5A 1DG9A 3PB3A 3BL6A 1JVBA 3BJMA 4CTKA 2QLNA 1DBVO 2VC2B 4M0LA 1GKUB 1XKLA 4A26A 3IBSA 4GECA 2NYAA 2Y1LA 1WZEA 3D6AA 5EMMA 2FMXA 1Q15A 3SSOA 2I6GA 3VV3A 3KG2A 4NFLA 2ZVDA 4CJXA 1T8PA 4FFMA 4OU5A 3GA5A 4QOFA 2ZTHA 3QLUC 5EI5A 4F9FA 1OD6A 4MA4A 4LYEA 5FAXA 4XARA 3P0FA 2O05A 1C1DB 1VSTA 3ANYB 3SHTA 2I3BA 3DMYA 1TOAA 2NVUB 4H7FA 4AJ1A 4M54A 4ND6A 5J5VA 5JDIA 4IIDA 1QUFA 4NXNB 1V1RB 3ER6A 1QQ6A 3F2VA 3OZCA 4CUKA 2II6A 4XWOA 4IDBA 1P7YA 5CJ2A 1FLDA 4F2PA 1K2WA 2SCUA 2QRMA 3WADA 3BFVA 1KP2A 2WWXA 3OQMA 3PC8A 1NN5A 1OVGA 5FUMA 2HIAA 3C3BA 1WKCA 1XZCA 3H1FA 5FHQA 1NF8A 4L8FA 1RLOA 2CLCX 2ZJ2A 3V8RA 1T2NA 3AYZB 3L8HA 5BMVA 3P5BA 5K3OA 1HO3A 4AY3A 3C8MA 3K5IA 3ASVA 1IY1A 2RAFA 3QVJA 4YAKA 3WK5A 1VJ5A 3FI0A 1ZJWA 3U3OA 1KF0A 2BKLA 2R25B 2VWPA 3IL2A 1GGEA 1GEGA 1R5JA 3G7UA 4MW5A 2VQ3A 4TTPA 4DLTA 1NXXA 3QW4B 4LS3A 4WPGA 4B8YA 1L5YA 4YRNA 1B23P 2Y4OA 1P9LA 3GC6A 2WJHA 4LK3A 1UMBA 1YQTA 2OBNA 2WTBA 1NW7A 4HFJA 4D57A 1SOMA 1PT5A 3QEBZ 5IS2A 2QD4A 3SJ7A 2OBMA 2WP8J 3PGJA 3T3MB 1CJVC 1V2HE 3HCBA 2NVWA 2DTXA 3JWPA 4GWKA 3NTVA 4F3RA 1WZIA 3MERA 3N1UA 4YMUA 1C7ZA 4UUQA 4ZPXA 2WJVA 4ES6A 4BZXA 4KLRA 3EGXA 3OCWA 4CV3A 1KI7A 3FYTA 1PQPA 4H77A 3HZOA 2XBUA 2D54A 3HVJA 3RAFC 1U80A 3HYRA 3EFHA 1ADFA 4BN0A 2GM3A 4KR9A 2WHQA 4GKKB 3ZE2B 3WRVA 5HVNA 3THOA 4RFSA 5ER9A 4CN9A 1UBHS 3MFQA 2X5OA 5HK8A 1Z7YA 1OC4A 1X7HA 5DTIA 2VLBA 3QLUA 2CXSA 4NWIA 4RYDA 4TL8A 4RZXA 3HI6A 6REQB 1N5KA 3FYDA 4LYYA 5ALIA 1XA4A 3GLGB 3OFKA 5LZ9A 2VWGA 4WXRA 4WNYA 5AW1A 2C7VA 2CFSA 1B0AA 2E37A 1KFKB 1XHEA 1YS4A 1C0IA 4KZKA 5TPWB 1EA7A 5IZ4A 3G0BA 3WB1A 1BO6A 4E4YA 4INJA 3G9ZA 3URKA 3N9IA 4ALLA 1BU5A 4P6VF 2FB9A 4R1TA 1DT5A 3V46A 3NDBB 1ARZA 3MRVA 2ZG6A 3TTVA 4BGUA 1EFAA 1QGUA 1VC2A 1SD1A 3ENWA 3W9SA 4IOMA 3NOQA 1T9CA 2PXCA 1VA5A 3P2OA 5B58C 2P91A 3C3CA 3KPJA 4RMJA 4TLEA 3UV3A 4QKQA 1Z0JA 3FLEA 4BRWA 4CE6A 1UMDA 3FTNA 4KWCA 3BXHA 2G76A 4D8UA 2GBLC 4ECAA 1BDHA 3HO8A 1Y89A 2O8VA 1QNFA 3ACCA 4Y18A 1A7KA 1UC9A 2GN8A 2NPIA 2VXBA 3DULA 1X92A 2GARA 3H86A 3QLTA 2FU5C 4FBMA 4RAQA 3TAHA 4H35A 2Q46A 2QK4A 1AE1A 3KPVA 1I10A 3B1WA 3TQIA 4JXXA 2ONZA 4W5WA 1YZQA 4QGGA 3IT0A 5HMLA 3LC2O 4F1KA 1E79D 1Q1QA 5BR1A 2AXNA 4M9SA 1ADJA 5IBRA 4HDOB 4CCYB 2H2DA 4AB1A 5CDSA 1AKUA 3ZX5A 1JPVA 1XXLA 4RJLA 1XN1A 3UUFA 5EXEA 2W2LD 2P2SA 3RM3A 1MB4A 2QD2A 1P4HA 4IIJA 5LA6A 3KYCB 4HLDA 3FCXA 3TAUA 5G2OA 3MMPA 4PTLA 5CPBA 4Z8YA 2VQEB 3LDFA 3C3YA 1QZ3A 1WJGA 3GPCA 4F06A 4ZYLA 4Q15A 2GEDA 4QUDA 1W52X 3DBHB 3PNSA 3AI1A 2VYQA 4FDAA 4OIFA 1TT7A 4WCFC 1VG8A 2NU6A 3HUUA 3O75A 3S8MA 3ZE6A 2BAGA 1N3BA 1O97D 1SNYA 1U7XA 1TECE 2BUBA 2GEUA 3I73A 3PGMA 4YCJA 3SJCA 1X9HA 2OD2A 2X2OA 3PFNA 4GX1A 4D3SA 1Q7RA 2IEIA 3ZCVA 3LU1A 4LC9A 2AI3A 2HQSA 2XYRA 1H23A 5DB4A 5EPUA 1UFOA 3VOTA 5A5EA 2XB2A 2WHXA 3CG0A 4DLYA 2XVMA 3JQ9C 2CJYA 1XZIA 2HPZA 1M3SA 4MI1A 3GAMA 3BSWA 3OBIA 2IHKA 2ID9A 4I1YA 4MAAA 4B6OA 5KDLA 2X5JO 3ESAA 3OZAA 1M6VB 4H4CA 1UDRA 1IDOA 1KI4A 4TTTS 1WTAA 3WGVA 5JH7B 1QANA 3UJDA 2CXPA 1HMPA 4RNCA 4I81A 1OKKA 3A25A 3HO6A 4RIFA 4YRRA 4ND4A 1HSOA 1XZLA 3I39X 3ICPA 4GF5A 4MI9A 1L5HA 1NMXA 4NNPA 5LP6C 3ODPA 3HMKA 1QGDA 3ZOZA 5DI3B 2YH2A 3AR7A 4BV3A 2ZRGA 2Q5EA 3ZGNA 1Q21A 1DBPA 3G5AA 4FC7A 3C3DA