4XWOA

Structure of get3 bound to the transmembrane domain of sec22
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
347
structure length
293
Chain Sequence
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMALADLTGSIPGIDEALSFMEVMKHIKRQETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQECKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (atcc 204508 / s288c)
total genus 101
structure length 293
sequence length 347
chains with identical sequence B, G, H, M, N, S, T
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xwoA00
1YZKA 1KI8A 3K0FB 2B7BA 2IEYA 2WJJA 5FOVA 1VIYA 4IOMA 4DLYA 1FMLA 2YZ2A 3AVTA 1S3SA 5JS8A 1Z08A 4C0AC 1NBMD 2OLJA 3REGA 3B9QA 2YOGA 2BM0A 4JKYA 3IEVA 1G41A 2ZJZA 2ZYTX 1E2KA 2QSZA 1GNRA 4M1OA 1M8PA 2MMGA 1XTJA 1GL7A 1PZNA 4MDFA 4KSBA 3TQCA 1LS6A 4PPNA 4I99A 1P61B 4DJTA 3CF2A 3GEIA 4RZ2A 4LCBA 5AJYA 2Z4RA 4NH0A 1KSFX 2AK2A 4HSEA 1HURA 1HT1E 2ZPTX 4K46A 4QL3A 2EW1A 2REXB 2JCSA 3VR2A 3ADBA 2ZETA 2CE7A 1F2TB 3VX3A 4DT1B 4D4MA 3U6BA 4LHVA 5J5CA 4F93B 2QSYA 3WY9A 4KHZA 2EQBA 3OF5A 5SZJA 4EJSA 1KI6A 5JWRA 1NN3A 4PAOA 2OEPA 4IFEA 4PHGA 5J4VA 3HU1A 5CB8A 1RW4A 1Z0AA 4M9XA 5F9FA 1VCNA 2HXSA 4HUQA 2CHVA 4PPQA 5DISB 2ZI3A 1F2UB 1E9AA 1FL9A 1XF9A 4WZBE 1IN6A 1FTNA 421PA 1XEXA 4AC9A 5BW8A 4U7DA 1XNJA 4Q02A 3U2QA 1ZM2A 4DBLC 3CW2A 3MJHA 4QGFA 2ZEJA 1RYHA 1N6RA 3CRMA 1VG0B 2JAQA 4JLAA 4KFRA 1P73A 2C96A 2RGDA 5G3YA 4X8OA 4QJ5A 2C04A 4GSYA 4JL5A 1OF1A 2DPXA 2W6IA 3KX2A 5JMTA 5B57C 3EASA 1J8MF 1G7SA 4MGIR 3ND8A 4B75A 2C9YA 1S4QA 4LUCA 2HLDD 2QT1A 3VR5A 1Q1EA 4C7OB 3AQ4A 4JLPA 4PC1A 1II9A 3K0CA 4B48A 4O2RA 2ERYA 4TLDA 3B60A 1OXXK 4PZZA 4CT5A 5FOTA 3SN6A 4IKEA 4US0R 1QF9A 1CKEA 3VU9A 3WRXC 2WMOB 4KVGA 2J46A 2PCLA 1VHTA 5EXPA 1NY6A 3QG5A 3K8YA 2D3WA 2D06A 4MKHA 3IQXA 1OFUX 5CYPA 3UWKA 3ZLJA 1A1VA 2IS4A 2YV5A 1YZQA 4RFSA 3L2OB 3TUJC 4IFBA 2P0EA 4Q9JA 2GWHA 4I1SA 3QIAA 4W5JA 4ESVA 3I4LA 3K0CC 2V7QD 4KO8A 2J7KA 1P4SA 1VPLA 3RS7A 4C2TA 2F43B 1W5TA 2QMHA 2GBLA 2CBZA 2ODWA 1W7AA 5CK4A 5BYJA 2Q3HA 1X6VA 1S8FA 3RSOA 3N2IA 1XPUA 3NBZC 1GKIA 2EFEB 4ARZA 1P6XA 2IXFA 1AGPA 1U9IA 2GEVA 2J9RA 2CHQA 3JZMA 2ZJYA 1SXJE 4CRWB 1MO3A 2GVDC 4PXAA 2JLYA 1T6NA 4GBMA 1MKYA 1QZXA 3C15C 4RCZA 5FH9A 3ECCA 4XWKA 1FNMA 4AD8A 1JPNA 1JQJC 2V55B 1ZRHA 2QA5A 2F9MA 1HA3A 1SQ5A 2ATXA 3BH7A 1DAMA 1K5DA 2GBLC 1GWNA 1Z83A 3IIJA 3TSZA 2GDJA 4O25A 1D9ZA 3W8NA 1RIFA 5GJBA 2ODNA 2OXCA 3IKJA 1C9KA 4PX9A 1DEKA 1T0HB 3SEAA 3E5HA 5AR1A 2GVZC 3WMGA 1ZYUA 1KDPA 5DO9A 3AKDA 1KK2A 1Q21A 3BFXA 4MRPA 5CJPA 1HH4A 3U7EB 3SQXA 5B30A 3KTAB 1A82A 2QAGB 4DZZA 4DLRA 4A8JB 2XEXA 1SXJB 4Z1MA 121PA 4AURA 4DLVA 1KJYA 4MQBA 1U0HC 2UZ3A 4JS0A 1G64A 1NIJA 5KNDA 4A15A 5JEEA 1KI3A 3RS2A 4E03A 4AKEA 1AK2A 3KKMA 2DFTA 2ORWA 4C0LA 4WZ6A 2PMKA 4LY6A 3WBJA 2JJ1A 3QE0A 1HT2E 1TPZA 4MITA 1OHHD 4V0OA 1TU3A 4C0SA 4ZDJA 2VSOA 2FEOA 4RKFA 3U4QB 3UK6A 4TMZA 5ELXA 2FU5C 4G01B 4M0LA 4R9UC 4JJKA 4BZXA 5JI3E 3THYB 3C5CA 4TL9A 1E96A 4MYTA 4WBSA 3W34A 4EPYA 1R2QA 1QHGA 4V0ME 2BVNA 4LJ9A 1FNNA 3PEWA 4M1SA 1EXMA 1JXOA 2WKPA 3ZVRA 5LB4A 1E9RA 3BD9A 1JAIA 1WQ1R 4TYQA 4NZYA 3VR4A 2HCBA 2KSQA 1SKQA 1UFQA 1E2LA 3DPUA 3WYAA 3KKNA 3B7GA 3HDTA 5CDFA 2QRZA 1UBCA 4QRHA 2HF9A 3U3RA 3REFA 2QM7A 1WB9A 4B35A 2HF8A 4ZIRB 3GLIE 4GMDA 2XZLA 1DAIA 2GHIA 3K0EA 3M0EA 2VIIA 2C9CA 1NF3A 1E98A 4XVQA 5C1BA 2FDCA 4NCNA 4Q00A 3Q72A 1Q57A 1JEDA 1NVUQ 2GXQA 2W6JD 4R98A 4HDCA 5BWMA 1E9SA 3BB1A 5AUOB 2X2FA 1PJRA 4WXPA 3PXGA 1ZCBA 2WSSD 2D4HA 3FE2A 2ZS8A 3IGFA 1OIWA 1WF3A 2GEUA 2ZANA 4RD0A 1CRQA 4PR0A 2AFHE 4DCNA 1ZC3A 3GFOA 1TQ2A 2W2VA 4HB3A 3SQWA 2O8EB 1R8QA 2P5TB 2FGJA 1VMAA 2JLVA 1D2NA 3FDIA 3VHXA 3L0OA 4DLTA 4NKRA 5EXXA 5FPKA 1YR8A 3WMEA 2BWJA 2CCKA 2YC4C 1Q0UA 2QEQA 4L9SA 4IDHA 3VFDA 2WAYA 4GRAA 1W0KA 4L4UA 4LJAA 1P2SA 4QGGA 1TU4A 1XTRA 2F55A 3O8DA 4XSGA 5EP1A 3KXKA 2G1JA 1Z0JA 3WYGA 3W6PA 4D0NA 3IPYA 4PAMA 3QJYA 1W36C 2WZQA 1O3YA 1OFTA 1SGWA 2E1RA 1SVOA 3TRFA 3AVWA 4K8OA 3T1TA 4O2LA 1W46A 1MO4A 4M1WA 5C2JB 2PEZA 4P4SA 1DS6A 1EK0A 3A58B 4O3MA 2O8FB 5FTJA 3SZRA 4YQFA 5L3QB 2NGRA 3LQQA 3ZZUA 4WOPA 3QQ5A 2JIZA 4PO9A 5EE5B 2IYVA 3M1IA 2A5GA 5L3SB 2ZR7A 2XAUA 3T35A 2IF0A 3U61B 2H1LA 2ODEA 3CRRA 3KKOA 2OG2A 1W0JD 3W8RA 4Q5IA 3TW4A 2XNDD 3KL4A 2GAAA 1E6CA 2QP4A 3IPXA 1LY1A 3H2YA 2DWOA 1PUIA 1G4AE 2Z0MA 1FPMA 1MT0A 2FFBA 2AD1A 4LOAA 2EWVA 1E3MA 1E79A 3HU2A 2CMKA 2CJWA 3H4MA 2A5JA 2RHMA 5FBLB 1G8PA 3NDPA 4LYFA 4Q1CA 4EDHA 4TYPA 2WWXA 2B8WA 1V5WA 1CR4A 2G1KA 3R9IA 4C3ZA 4EJSB 1S9DA 1S2MA 1GP2A 4HI0E 4P33A 1BO6A 1WP9A 3BFKA 1G6HA 4LJ5A 3B1YA 2XJ9A 4TLAA 5B64A 5KDOA 1E2GA 3DMNA 4HUQB 1OB5A 1UBFA 4GFDA 1N6IA 1JR3A 5EE3A 3RLFA 3SDZA 1A5TA 5L3VA 4LJ6A 1XEXB 2IT1A 3I92A 4V0LA 3OEED 1CJVC 4L15A 1T0JB 3SFVA 5D3QA 2AR7A 1RRFA 1H65A 1KY3A 4TYWA 2Z5FA 2H7VA 2ZJAA 4NHOA 3EWSA 4I1UA 2J87A 3RSLA 2VHCA 1CTQA 3BGWA 2J7PD 4DSOA 2QORA 3BXZA 5CK5A 5UKDA 2GCNA 4G3XA 2X8AA 2ASEA 3FKQA 4IDPA 1BYIA 4Q4AA 3MG9A 4QXAA 3FB4A 5KSPA 3QKUA 5GADl 4LHZA 1GKYA 1XZPA 3JZAA 2VP2A 1P62B 2FF7A 3GJ5A 2AX4A 1OKKA 4TMXA 1KO4A 3WXMA 1XJCA 4CYMA 1L2TA 2WM9B 4LBWA 3ZVLA 5DN6A 1PVOA 1T91A 3FHCB 1E1RA 1W1WA 4QBGB 4AKGA 5B58C 4Q1FA 3AB3A 4TMTA 3DVLA 4LDJA 3EZ2A 5C4GB 2VHTA 4KLZA 3A6PC 3AP1A 4MYUA 2IUUA 1TNDA 1Z06A 3PUWA 3CM0A 4II7A 5GJWC 2ZUDA 4F7WA 1LF0A 4CVNA 4B33A 5DI9A 1VG8A 3X1ZA 4G0NA 4TYNA 3VKGA 3CPEA 1TQDA 4GOKA 4C2UA 1SHZA 2LWIA 4Q1AA 4WA7A 2CLDX 1G7RA 4A0RA 2BMJA 1R6BX 4YXWA 3NH9A 1ZAKA 3U3JA 4HLUC 2F1JA 3A1UA 3RRZA 3K53A 4RFSB 2F7SA 3DDCA 2QUZA 2ZYUX 3AF1A 4JYBA 4LBYA 4GP6A 5H70A 3K70C 4B3GA 3T06B 5FUXA 3PITA 1AQUA 1U94A 4AI6A 2R44A 2V54A 5HTKA 1ZUIA 2BEJA 3R7WB 2HCJB 1D6JA 3C41J 3ZIAD 1HV8A 2QE7A 2N42A 3GLGE 3P32A 1COWD 4EPRA 2FSIA 2YYZA 3QVUA 1SKYB 2QMOA 4UKDA 3U7FB 3PV0A 1XX6A 3HJNA 4IVPA 1GG2A 2ZROA 2KE5A 5JEDA 4ARZB 2X77A 2ZI9A 3EWAA 4QNMA 1EG7A 3FKSA 4BWYA 2GAOA 3DL0A 4Y0AA 4F4IA 4HAYA 3KJIA 3TSWA 4Q1BA 1IHUA 3QVVA 1U0LA 4Q7KA 1BOFA 2YWFA 4M9QA 4CGZA 3BWDD 3GLHE 4TL7A 2VTKA 4B47A 3NBFA 3A8TA 1G17A 4M1MA 1GRRA 4HUTA 2NPIA 4G5QA 2RGAA 3EPJA 1IJEA 4DVGA 4OQNA 2CVFA 3PIRA 3CNNA 3X1WA 3U3MA 1NIPA 3P1JA 1IY0A 2C5LA 3NBXX 4LYAA 3BRWD 1MO6A 1EFHA 3CLVA 1JAHA 3EC1A 5FBQB 1KJZA 3DOFA 2NQ2C 4NONA 3TLXA 4DEYA 3FMIA 2JATA 1OXTA 3EPLA 2VP4A 3A1SA 3GLGB 1YRAA 2QT0A 4LBVA 3GP8A 5AUQA 4OYHA 4ACBA 1IN4A 1XPRA 2F1HA 4Z51A 2X19A 2LKCA 4NBSA 3P26A 2FSFA 1II8A 2N1BA 1W2GA 3BK7A 4ZO4A 1NG9A 2C95A 1JEEA 1E4VA 2DYKA 2PCJA 4ITRC 2J1LA 2ZRJA 4PTLA 1CLUA 3B2EA 221PA 5FTNA 4A2QA 4EKDA 1GILA 2GF9A 2P3SA 1X8JA 2IA5A 1ZINA 3OIUA 1DBSA 4XTRA 4X8MA 1KO7A 2FGKA 2XTNA 3BC1A 3PUVA 4DLUA 5JJLA 4AWXA 4PC2A 4PC3A 4QBFA 4UNNA 1U8ZA 2QAGA 1KK0A 4Q48A 1BYUA 4GZMA 2VQSA 4AYXA 2VSXA 1XEWY 4TMVA 2QU8A 3CR7A 2F6RA 3CPHA 4M9SA 4NYMQ 5DIFA 4AIIA 3RWOA 4R7ZA 2IXGA 2AWOA 3GJ7A 3G0HA 1VIAA 1H8HD 4M4SA 2OFOA 5FPSA 5FOSA 3GLFE 1C1YA 3M6AA 1WRBA 4RD1A 2F9LA 1Z3IX 5G53C 2IYXA 4FIDA 4BFVA 4CEJA 2PL3A 3I5YA 1G3QA 3RS5A 1EESA 4MKIA 1R8SA 1GRNA 4LK2A 4HAXA 3VR1A 4W9MC 4B6EA 1T4GA 4CF7A 1IN8A 1NKTA 1OXSC 4RJLA 5FOUA 1GIAA 1XDBA 2PZEA 1IM2A 5EXTA 3F3YA 5KYKA 1AKYA 4TLEA 4I81A 5DLQC 4ASUD 2Q21A 4DUGA 2W2XA 3KFXA 1AZTA 2QMUA 4B3DA 1OH5A 4LI0A 3VHLB 3DHWC 3KUCA 3VQTA 2ZR0A 4OI2A 3T34A 3WHKA 1HE8B 2R62A 2G3YA 4ZIRA 3UMSA 4LRWA 2FZLA 2GK7A 1W36B 1FMJA 2ZJ2A 1L4UA 3GLFB 3ZZTA 1US8A 2D2FA 3MD0A 5GVRA 5JRJA 5J47A 2YINC 2QRNA 2MMCA 3A37A 3LV8A 5IHPA 3L8ZA 3KQKA 3DEFA 2NTYC 3CZQA 1ZCAA 1KGDA 1X3SA 2FFAA 4D2IA 4PPFA 4U00A 1TMKA 3LVRE 2H57A 4V0MA 2GEDA 2IWHA 3MWLA 4URUR 1FZQA 4Q66C 1NSTA 2XZPA 1Z2CA 3EXAA 4TMWA 2ZS9A 4Q1EA 5JHGB 2WWHA 5GJCA 4KVAA 2IS2A 4BPBA 2EYUA 4LYJA 3AUYA 4IHQA 3EC2A 2WVJA 4LBZA 1E0KA 1SVMA 5IK2A 3OAAD 3VMFA 1SXJD 1RPZA 3LLUA 2WJHA 3A4NA 1XXHE 2A30A 2B21A 3L0SA 2AFIE 3GLIA 3ZH9B 2AK3A 3BORA 1GUAA 4A6XA 4AG5A 4ZCLA 1SZPA 1HEIA 2J5XA 2IWRA 3FMOB 2KBEA 1S3GA 1KMQA 1DG1G 4P4SB 4XVUA 4A0HA 2YNMA 4XTCS 4B3XA 5KU1A 2X1VA 3K9HA 2ZJBA 3KFVA 3LW7A 4PC7A 1P9NA 3TAUA 3V9PA 4FWIB 2NMVA 1DARA 1OYWA 1YRBA 3PJRA 1HQCA 5KHOC 1IXSB 2G0TA 3QXXA 4UJ3A 2V8OA 1ZMXA 4V0KA 4RCYA 2AL7A 4XH9B 4L8GA 1KSHA 2O8FA 5BQ5A 5KNBA 3UXMA 3ICEA 3LVQE 1OXUA 5L3QA 1Z8FA 4ZV4A 1KSJA 4BZPA 2EVWX 4JLMA 3Q8XB 5HE8A 3OIYA 1G3IA 3OEHA 4WVFA 2CJWB 4FD2A 1EFCA 4DLZA 5L3SA 3K1JA 3HPQA 1NRJB 2GCOB 1XMVA 2VH5R 1KI7A 2F1IA 1IAQA 3THWA 1OIXA 2OESA 2QL6A 3CX7A 1UKZA 1GL6A 4CT4B 3ND9A 3CR8A 3MMPA 1NL3A 3KDSE 4Z8YA 2P6UA 4B76A 3LXXA 3MSXA 3O8CA 3VTKA 4TL6A 3A4MA 2RGCA 5TY0A 3AVQA 3LXRA 1XRJA 2WWGA 1J90A 3OIWA 2BOVA 1GFIA 5G41A 1WXQA 1SVSA 3TW8B 1DO2A 1J7KA 2OXRA 2ZRCA 3TIFA 4D81A 1W48A 1LVGA 2CLSA 4RD4A 5B2ZA 5JJKA 3QG1A 1AZSC 3K0SA 2VL7A 4URXR 4PHTA 2BBWA 3UWOA 3GJ8A 1UDXA 1Q1ZA 4P0TA 2IYRA 3TH5A 1EFRD 4C0KA 2FPMA 1H8EA 2DR3A 2QGZA 3IO5A 3BOSA 1ZW6A 4NU0A 5JCPA 3TAHA 4P3YA 3UG6A 3RNLA 1ZM9A 2FV8A 4Q4AB 2ERXA 2QZ4A 4D25A 4TQUS 2KI5A 2CNWD 4JYCA 1QVRA 3ONWA 4XSHA 2FWRA 4D4LA 3AKYA 3EPHA 1SHKA 2AD5A 4HLDA 4LJYA 2GNOA 3OE7D 4Q9IA 2O0KA 4JLDA 5JWOA 4OI0A 2NZ8A 2CK3D 3H84A 2R9VA 5LB2A 1KKLA 3FPAA 1Q3HA 2B7CA 2VPPA 3NG1A 1VKJA 2R2AA 2ZREA 4TT3D 2IC5A 3T5DA 4QKQA 4TTPA 4EQ6A 3W6OA 2Q9BA 4XOIA 1N6LA 3KQHA 1RJ9A 1D2EA 4F92B 2XSZA 1ZD8A 1IY2A 3DM9B 4G5SA 4DSNA 4G5OA 2GXSA 1W49A 2ZRBA 5CITA 1NNEA 4EFNA 2NOAA 1UKEA 4NPHA 4MUAA 2EFHB 3RRNA 1ZUNB 4CEHA 4KCGA 2D7CA 1VYUA 2QM8A 3VR6A 2BJWA 2ZJ5A 3ADKA 3AVPA 3ZZ0A 1LW7A 3GFPA 2P67A 4KI0A 4HATA 4TSFA 3ZDQA 1ZD1A 4IXMA 4BASA 2RGGA 3TR5A 5AJVB 5C46F 2FFHA 2O8BB 2GRJA 3N5CA 2ZIAA 4GOJA 5FI0B 3QKRB 4BEBA 5HKKA 2YWEA 3HPRA 4OHZA 1G1MA 2ZS7A 4H1VA 4B2PA 3THOA 1L8QA 1G21E 3UPUA 4EFMA 4QGHA 5G40A 2ZE5A 2HYDA 4Y0VA 2XX3A 1Z0IA 1XD9A 1F6BA 1KMHA 3R7WA 4DLWA 4FINA 3WNDA 4WAUA 1RE0A 3BJIC 4OQXA 4DHEA 1EX6A 2KBFA 3CF6R 2ZRHA 4JSYA 4LZZA 2ZITA 1QRAA 3GQBA 1F48A 3C14C 4TZ0A 2C8VA 4RD2A 3AUXA 5CIQA 1XU4A 4U5XA 1A4RA 1RVDA 1VCMA 4UNQA 4YMVA 4HAVA 2OLKA 3DZ8A 3DOEA 821PA 4DLXA 3SYKA 5JWHA 3I72A 2VF8A 1CS4C 1T8UA 1YHNA 4LPKA 2WJIA 3WP1B 2XJ4A 2HJGA 1FOEB 2W6ID 3W90A 3JVVA 4B44A 1II8B 3IIKA 1Q12A 4EPVA 3QBTA 2RMKA 4L16A 4DB4A 2WWIA 2IYWA 4CIDA 1GL9B 3D8BA 3GLGA 5GJVC 1FQKA 1N3BA 2AWNA 4C30A 2XNSA 3QPVA 8OHMA 2ORVA 3SC3A 3B5JA 2O8CB 1X8KA 2OCPA 2JLXA 4DEXA 5BN4A 4YC7A 2C99A 3KZ1E 4GNKA 3EG5A 4E09A 3MFYA 4G5GA 3AGPA 3SHFA 2J41A 1F60A 2ZRKA 3TBKA 3RANA 1J70A 2JJ2A 2OILA 3GLHA 3AKCA 4BFWA 1OXVA 3DO6A 5JI2E 2EFCB 5FTLA 2P6NA 4LJ8A 2P6RA 1GVNB 4AYWA 4GMXA 4GPTA 5KO2A 1ETUA 2K5UA 3AKEA 1Q44A 2A9KA 4GOXA 3IIMA 1TADA 4ABYA 3V4RA 1QHSA 1WA5A 2OZEA 4POAA 1MRNA 3ZD7A 1KJWA 3NVAA 2BKUA 2FPKA 2QTVB 3TKLA 4Q18A 3TK1A 4CEJB 3NH6A 3ZD6A 1KO8A 2BV3A 3THXB 5IDVA 2ZRMA 2IL1A 1NBME 1VCIA 5EP2A 3EZ9A 1G7CA 3L0IB 4Q01A 2ZRFA 2C78A 5E3HA 1S0UA 3H1TA 2ZSFA 4LV6A 3R9XA 3CPJB 1VECA 1U8YA 5DNYB 1G8YA 2FX3A 2FOLA 4Z54A 1KYIA 2I3BA 4PQRA 4URVR 1Z28A 2IYQA 1UKYA 5KPJA 4FMCB 5LD2C 1Z29A 1RZ3A 5DGXA 1NVXQ 3HWSA 3O8RA 2PJZA 1Q3TA 3AVYA 3SR0A 1S1CA 1S9HA 4NYMR 2LKDA 3TMKA 1US8B 2NO7A 4LYHA 4PPGA 4FMDB 3MWYW 1QG2A 1IOZA 1BMFA 2DFKB 4WW0A 4BLTA 4ZI3A 4JVMA 2WKQA 4RSGA 2C9OA 1E2DA 2GETA 1E2IA 2V9PA 4JKIA 2FE4A 4FCTA 2HEIA 3TJZA 4MGZR 3OFNA 4C0JA 1UEIA 3GLFA 3T1VA 3ZGXA 4ZKDA 4KYIB 4MDEA 2YHSA 3KB2A 1G5RA 1VCOA 1P2UA 4XD7A 3SU8A 1KZ7B 4HZUA 4KFSA 4YMUA 1P3JA 2YJTD 4BQSA 1JPJA 5CLLA 4Z1MD 1AN0A 1DE0A 2WJYA 2A2ZA 5L8VA 4QM6A 1KHTA 3GLIB 1J2JA 1QHNA 3NTUA 1U98A 1JBKA 3RS4A 5P21A 2VP6A 5DI3A 5F9HA 4JSTA 3KJHA 1GOTA 2BBTA 2JJ1D 1CJMA 3WMFA 3AM1A 5DYIA 3IDQA 1G20E 2ODBA 5GVSA 1E2FA 3BB4A 1E1QA 3CWZA 4LC1A 3TUZC 5C4MA 1DAHA 1K8RA 4HDOB 3FTQA 5JFGA 2Q6TA 2JLRA 2E87A 3WNCA 4B3FX 2VHQA 4JT2A 1KO5A 4NMMA 1G19A 3QEJA 1Z0FA 1OE0A 2RGNC 5KDLA 1OFHA 4JLJA 2CLCX 4JVNA 1FP6A 1W5SA 2RHDA 4K81B 2VHUA 4W7SA 4US2R 1OB2A 1OH7A 4KODA 2BMFA 4UXHA 3U3OA 5CB6A 1DELA 2JA1A 1LS1A 3L43A 3ADCA 2SHKA 2CHGA 1P72A 3NEYA 5EZ6B 5SZIA 3GEEA 1NMZA 3THWB 3T61A 2CEAA 3CX8A 3HR7A 2JLSA 4MYHA 3ASZA 4JL6A 1G3UA 3TUIC 4DSTA 5LDDC 5G3ZA 4BRWA 3OESA 1XTQA 2VHJA 3LDAA 1G7TA 2HV8A 2OM2A 3BBPA 1YZNA 1XXHA 1Z63A 1NSFA 4XWOA 4A9AA 4D26A 2GCOA 2W83A 2PT7A 3T1OA 2ZI5A 5BN3A 2C03A 4V02A 3UMFA 1TUEA 4B2LA 1W36D 4OBEA 3SYLA 5H1YA 2RGEA 3LD9A 1UBGA 4DC9A 3U5ZB 2H5EA 1DTSA 5HZHA 3MRSA 1UAAA 5IT5A 3U60B 3QUSA 2G0NA 3U44B 1GITA 5FI1B 3VAAA 1KTVA 2OBNA 4FMBB 1W0KD 2CL7X 2GILA 2O5VA 4HLCA 3ZS8A 4ZCIA 5E7JA 1ODFA 5KSOA 3KUDA 1R0WA 2FEMA 1TEXA 1DVRA 4G5RA 3AVVA 3MUFA 1CEEA 1R10A 4PHHA 2WWWA 3MLEA 4BLSA 2JASA 4JLVA 1N5LA 1R5BA 2PLFA 2G77B 3SJCA 4B34A 4BE7B 3EZ7A 3P4XA 4LHYA 4HLUA 5DHFA 1S1MA 4RY2A 1BH2A 2PEYA 1GRQA 2NIPA 2OFXA 2ZUCA 4YDHB 3NIBA 3QKTA 4HB0A 4EQ6B 4EIWA 5BXQC 1R4AA 3DKVA 2TMKA 4LHXA 2GK6A 1RJ9B 4N1AA 2IHBA 3ZVMA 2VLIA 4NYIR 2DBYA 2MSCB 2ZSEA 5E4FA 2I1VB 2GF0A 2P5SA 1M1YE 4CEHB 2JIZD 5EUQB 5TMPA 1ELOA 1A7JA 3W6NA 3PEUA 4HLQB 2WICA 2WPDA 4A82A 3BIFA 5K8IA 5DSZA 2ECKA 5HE9A 2BM1A 3N2EA 1OV4A 2JDIA 2Q3FA 5C18A 2BEKA 2ZRPA 3J81k 2J0QA 1GDDA 2ZM5A 1DOAA 2OE2A 2QQ0A 1LF5A 1L4YA 5JZVA 1NVVR 3I8XA 1E79D 4MH0R 3QBVA 2ZJ8A 4OL0A 1XTSA 3Q9LA 2RGXA 4GT1A 5CLQA 1WBBA 2XOKA 3A4LA 1CF4A 3IEUA 2G88A 5M04A 3CNLA 1XBTA 1KMHB 4UXJA 2BC9A 3IBYA 6Q21A 1CU1A 2JJ8A 2O8BA 2ZI7A 4HYYA 1P9RA 3BH0A 2OBLA 3QKRA 2UVQA 4L5BA 1N6NA 4KBGA 4MKFA 2OBMA 1NLFA 1JR3D 2IYUA 3B1VA 3SBDA 3K0AB 3IHLA 4R71A 4JLOA 2CL6X 3I73A 1GSIA 2WOJA 2IYLD 3OZXA 5DH9A 3QXCA 2IXEA 1NKSA 1AA9A 3QI2A 2GXUA 1VTKA 4IDOA 4MRRA 3ZYCA 4BLPA 3V4FA 5KTYA 4UJ5A 5AWFC 2WIAA 4M22A 3RHFA 4Q4HB 4A2WA 1UJ2A 3CONA 4UNSA 2O52A 4D82A 2BHRA 1M7GA 3DZDA 1YJ5A 3A36A 4P32A 4M21A 2GJKA 5FPTA 1T3HA 3NC1C 4MGKR 2ZI4A 1XWIA 1CIPA 2ORIA 5FPYA 4KLNA 1YKSA 3PVSA 3QXSA 1OKKD 1U81A 3ZJYA 2FSGA 2ZRNA 5DN6D 2PZGA 3LNCA 1E1RD 2ZE8A 4YDSA 3L8YA 1CR1A 1X1RA 2FZ4A 1I4DD 4A4DA 1NVWQ 3LRPA 2Q0HA 2HUPA 3FWYA 4DDUA 4HB4A 1W2HA 1LTQA 3UANA 2IYZA 5HPYB 4C4PA 3QEOA 2XGJA 2XXAB 5HCIA 1QDEA 2NZJA 1UADA 2FPLA 2WOOA 3QXHA 1G3RA 2ZSBA 3PFIA 1MABB 2QQEA 2YVUA 1S96A 3GLHB 3IHWA 4A1FA 2D62A 2QGNA 5KSZA 2BDTA 2WV9A 4NP6A 5LD2B 1RKBA 4DCSA 2O8CA 1ANKA 2P2LA 1ZP6A 2Q9CA 4DLSA 2P65A 4ACAA 3VNVA 1IQPA 2CE2X 1PLKA 4DWJA 5F2EA 4BFYA 5KPDA 4Q7MB 4OQMA 4EPTA 3Q5DA 2RAPA 5FL7A 1MRSA 1X1SA 2MSDB 1KY2A 2DFLA 4OHXA 4GL2A 2VA8A 4QJ3A 3SFZA 1R5NA 2GXAA 4GZLA 3CZPA 4OHVA 3AEZA 4WXRA 3EPKA 3R8FA 3NHBA 2QE7D 4W5HA 3BE4A 3SBEA 1KAGA 1TF5A 4OI4A 4YMSA 2R6AA 2GESA 3RWMB 3SNHA 1U0JA 2PBRA 1R5OA 3ZQJA 1DAKA 1M7BA 4NL4H 1KK3A 4I1VA 1E2JA 2VP0A 2YWGA 1G18A 2PMDA 4IW3B 3FKSD 3LBNA 1DAEA 4CZ2A 3FMPB 2IW3A 3QY0A 3FFAA 4JBYA 1Y3AA 5FBRB 5KOYA 1W4BA 3W3AA 3THXA 3UMRA 2QN6A 4CDGA 3WYFA 2QG6A 1TQ4A 5FTMA 2Z6VA 1P7CA 4ZCMA 1T8TA 1E99A 1XB2A 1DAFA 4E07A 3QKSA 2G83A 2I4IA 1JB1A 4QJ4A 3IILA 4LC0A 1IBRA 2EFDB 4B71A 3EIQA 2WTUA 1G5PA 2ZE7A 1OJLA 5TV2A 2GJ9A 2WBLC 2EYQA 5KUTA 4KBFA 2WSMA 1ZBDA 5KDDA 1E94E 4X8LA 1M74A 1R0ZA 2GJSA 3AGQA 2Z43A 1JNYA 4NYJR 4HZUB 5AJZA 2IS1A 1E2PA 4C9BA 4DDVA 2OV2A 1FX0A 4ZPXA 4ZDKA 3EW9A 4HDQB 1L7VC 4Q47A 3UIEA 5TVKA 1YZTA 1II0A 1NBMA 3RDPA 3RC8A 4DB2A 3AH8A 2GZAA 4BFZA 1OW3B 2PX0A 1RFLA 5DI3B 1AIPA 3RVBA 3Q7PA 3LAWA 3KJGA 2J0VA 4IEEA 1IY1A 4A0GA 4DKXA 1GM5A 1TX4B 1N2CE 1HTWA 3CWQA 1JR6A 3HP1A 3R9WA 3NKVA 1A2KC 4A36A 1O87A 3PEYA 2ZXUA 3WBKA 1CR2A 1MOZA 1NMYA 2UKDA 4HB2A 1WE2A 4Q4LA 2HXYA 2V1UA 2L0XA 4M53A 3W3ZB 3LW8A 3TVDA 3B78A 3FHOA 1EWRA 2J0UA 1KIMA 2RB4A 1AGRA 2QROA 2QI9C 1N0UA 2IUTA 3K9NA 1LFDB 2C98A 1RRPA 3GFTA 1EFRA 1DAGA 1HY3A 3C16C 3U6KA 5FTKA 4Q21A 1QHXA 5D3MA 1P75A 1F3OA 4TYYA 1KO1A 3CF0A 3CUEF 5AJWA 4NTZA 2OSBA 1QHYA 4D0GA 2CNWA 4MKGA 1T5LA 4DDWA 3SYNA 1NI3A 3KB1A 1P9WA 2ZR9A 3QPUA 1N6PA 1N6HA 2BMEA 5DHAA 4DUGD 3DM5A 4Q1DA 3PCRB 4FCVA 3IO3A 2ATVA 1XXHB 1ZNWA 1IXZA 4C0BA 2JLWA 1WDTA 1CJTC 1Z6GA 1F5NA 1MR3F 1LB1B 1E2EA 2OCBA 2HLDA 1YR6A 2NG1A 3X2SA 2ONJA 1KI9A 4YONB 1GTVA 1M6NA 2JGNA 4QHYA 4XIGS 5HZKA 4KU4A 4D4KA 2QY9A 1AS2A 4TLCA 1XD2A 1KI1A 3KXLA 1XZQA 4M1TA 2F1RA 3ETLA 5BN5A 4EFLA 3Q5EA 5KNCA 1P5ZB 4AY2A 4MUBA 1Z22A 3B8HA 1N5KA 4AYTA 4NYIQ 1UPTA 1P60A 3CH5A 1XP8A 4R2HA 3T15A 3X1YA 1UKVY 2OFWA 3VNUA 4BZQA 2YC2C 1HUQA 3O8BA 2GJ8A 3UG7A 5IK2D 2G9NA 1GKUB 2JLZA 4ILEA 3MCAA 4F38A 4WZAE 2IS6A 5JJIA 4IXNA 1IONA 2ZVQX 2WAXA 4NDZA 3U44A 2YKGA 3BB3A 1WCV1 3E70C 5BYKA 3D3QA 2O0HA 4IJMA 3BS4A 1ZVQA 2I1QA 2V7QA 4PSVA 2O8DA 4PZYA 3PUXA 3K70B 2A3RA 3LLMA 4Q19A 4RZUA 2W0MA 4J0QA 4PZLA 1NVVQ 1KKMA 3PENA 4JZKA 3EX7C 1G8GA 4YMTA 4B3BA 1XPOA 1CJUC 1RRGA 4Q4JA 3SJAA 4M8NE 3AP2A 5JLJA 5HCNA 5CYOA 3EAQA 1EX7A 5A5GA 1FP7A 3CB4A 4OJKA 1OLOA 3G5UA 3X1XA 3RAPR 2PJRA 1W4CA 3Q85A 2VRWA 1AS0A 3AF4A 4Z8XA 5E7IA 2O0JA 4MRNA 621PA 3F8TA 4FN5A 3I5XA 2PT5A 3LY5A 1FTSA 3UATA 5FBWB 5IF9A 2OT3B 1SVWA 3OEHD 3E1SA 2QP9X 2DHRA 5TARA 4F4JA 2AKAB 2R6GA 3NHAA 5LBIA 1U99A 1WBDA 1G291 3NDBB 4EJSC 2QAJA 5EQTA 5J4KA 2A78A 2PX3A 4H1UA 2JLUA 2OCYC 3F0TA 3A1TA 4OHWA 1BS1A 2IYSA 4IOKA 4CEIB 1D8TA 2R6FA 3ASYA 4LV5B 1VG1A 1NN1A 1N25A 2FFQA 3UKDA 4OK6A 3MGCA 3CRVA 3Q7QA 1DO0A 1E9BA 3C8UA 4M9ZA 2YOFA 2HDNB 4HEJA 1D9XA 4JLBA 1KI2A 3D31A 5F98A 1FW6A 4LV8B 1Z6XA 4OJQA 3RC3A 3RABA 2AXPA 2QP3A 1BIFA 1H8ED 4MRSA 3FVQA 1CJKC 2NPFA 1AJEA 1IXRC 3K0AA 3B1WA 1OHHA 4IVQA 5EE9A 2ZRAA 1E9EA 4JMPA 3W5JA 3KJEA 4TQ9A 2ONKA 1IN7A 2G6BA 2YOHA 4Q4HA 4MRVA 2CCGA 2CDNA 4A0FA 1Q1QA 5JS7A 1D5CA 1E9DA 5EUMA 4FI3C 5JBQA 3LWNA 2QPOA 1Z2AA 1ZJ6A 1W4AA 4EUNA 1M7HA 1E9FA 1QVAA 3AF0A 3QOFA 4KXFB 4NCIA 2OCAA 2VP5A 4RFVA 4LJ7A 1PLLA 1TUIA 3NWJA 1A2BA 4IRUB 3S1AA 2XSZD 3RRYA 1B0UA 2REBA 3O47A 2CL0X 5J4HA 1NN0A 4JL8A 4B3CA 1NMXA 2XXAA 3IUYA 2W6JA 4TSFD 4N0DA 5J40A 4OHYA 2W2TA 1MABA 1NLZA 2DWPA 4KJZA 4PSAA 1CR0A 3ICQB 3FYHA 1DADA 4ZDWA 2WSSA 3QNUA 4B43A 1AS3A 4PHFA 1M2OB 2KJQA 4OQLA 3U3KA 1U9IC 2RGBA 3CO5A 5HKKD 2V1XA 3NXSA 3DMDA 3R20A 5K8TA 1E2MA 1OIVA 1XD8A 1GNQA 2YWHA 2AXNA 4JIMA 4Q9HA 2C2HA 4TN1A 2HYIC 2B6HA 4D80A 4KSCA 2FNAA 3QF4A 4LX0A 2D74A 1P2VA 2ZSDA 1ZNYA 4M1KA 4A92A 3QSYA 2EU8A 4KV9A 1QG4A 1V43A 3LQRA 4NYJQ 2OAP1 1XCPA 1UEJA 2BIFA 1T3LA 3BAFA 1GAJA 3RS3A 3PUYA 3QKSB 4JBWA 1ZUHA 2J45A 4OI1A 4BUJA 4UNPA 3CNOA 3TR0A 4S2EA 4HAUA 1OSNA 3C7KA 4DDTA 4MYCA 2ZRLA 3P20A 4DCTA 2GCPA 4YMWA 1JJ7A 4QG7A 1W44A 5TXGA 3TE6A 3GD7A 4RD3A 1QHHA 1KI4A 4US1R 3AF2A 2D7DA 2IHYA 5CM8B 1I4TD 1NY5A 2VBCA 5EJEA 1OT3A 3LX5A 4DRZA 1YZGA 1OH6A 1FX0B 4CW7A 4D0LB 2VF7A 5EXSA 1U90A 5FFMA 2NO1A 2A7QA 3C5HA 2GJAA 2V3CC 3IBGA 1VHLA 5L3RA 4PC6A 3GJ0A 2Z4SA 1N6KA 3HU3A 4OKSA 3FGNA 4B32A 1IN5A 4EPXA 1W0JA 3MWKA 4M2LA 1N0WA 1XJ0A 2XNDA 5FBVB 1N5IA 2RGNA 2XB4A 2XTZA 1YZLA 1QHIA 2OO7A 4XVRA 2QBYA 3K9GA 3AP3A 3EA0A 1Q20A 1OPXA 1HQYE 1Q1BA 3GJ6A 4ZKEA 721PA 4FWTA 3LO5A 3D7MA 1E69A 2JEOA 2JJ2D 3EZ6A 5JSZA 4I1OA 2AKYA 2ANCA 2ZYWX 3AVXA 4G1UC 1ESMA 1ZIPA 3D6TB 4NCHA 3B13B 1C4OA 2J0UB 3P27A 1E0AA 3GCGA 5E7MA 1K6MA 2NO6A 4AK9A 1RC8A 5HR5A 4BFSA 4C0QC 3SJBA 3BFVA 4B73A 1MH1A 1I2DA 3I3SR 3KKQA 3HYRA 2IYTA 4KFTA 1E2NA 5D3MB 4V0NA 1Z47A 1ZNXA 4I4LA 3OEEA 2R8RA 3L82B 2B92A 1KNXA 2ZRDA 3LX8A 2BCGY 2B8TA 1SVLA 1J99A 4IDQA 4JVSB 1G3MA 3KKPA 1ZC4A 2E9SA 2J7PA 1E9CA 3SHWA 1ZM7A 4B74A 1SULA 4PAQA 1Z0DA 2AHOA 3B85A 4ESHA 4QM7A 1YVDA 5DYGA 4UNRA 1ONBA 2BJVA 1E0SA 3KXIA 3VR3A 1TF7A 3HYTA 4RZXA 2BCJQ 4BECA 4PSKA 5FUWA 4BFXA 1XD2B 1BMFD 3QXJA 2HT6A 2NO9A 1CULC 1KZGB 3CBQA 3VKWA 1G8FA 1XMJA 1E0JA 2WIBA 2H16A 3NEJA 2AN9A 2VP9A 5J4YA 2V6JA 1R0XA 3OFND 2OHFA 4DCVA 2ZQ5A 4RVCA 4P4TA 2KB0A 4ZDIA 3WHLA 4F91B 4TTQA 2FSHA 4NCJA 2DB3A 4XD7D 3Q3JB 1KAOA 1VYTA 2FH5B 5CJ2A 4B2IA 3GJ3A 1Z6YA 2XITA 3K0FA 1DPFA 4QOSA 2CCJA 3R8CA 1KDRA 1U8AA 2Q3MA 3NBYC 4PO8A 1E2QA 2DFNA 5JRZA 1AQYA 2BBOA 4HAZA 4JLKA 2BMDA 2X2EA 2W0SA 2XB2A 2O8DB 2IEZA 2QPTA 4LSGA 3WNBA 3AF3A 4OQFA 3VKHA 4PQYA 3ZIAA 3G82C 1TAGA 1KI6B 1X86B 1COWA 1KK1A 3GJ4A 4BFTA 3LH5A 1WMSA 4Q4JB 2WWFA 2WMNB 4URZR 1DG3A 4QGAA 1E1QD 3B82A 3GJXC 1JALA 1W4RA 1PV4A 1QBKC 1N6OA 3RYTC 2H92A 4IOLA 4Q7JB 1Q22A 3IQWA 2Y8EA 3I1FA 4DIDA 2ZTSA 2IX3A 2MSEB 1F2TA 4R2IA 4DT1A 1P2TA 2PLRA 4IEIA 1G5TA 2ZJOA 4W5WA 2N46A 2FN4A 5FL3A 2DWQA 4TMKA 2F3TA 1D2MA 2D2EA 1YR9A 4BLRA 5FR2A 5H8WA 2JLQA 3QPWA 5FOXA 3WP0A 1SVIA 1W47A 2GA8A 1G4UR 4FMCF 1IJFA 1F2UA 4JLNA 4BRUA 5DE3A 3OHMA 1NP6A 2RCNA 1ZU5A 3MJRA 1AKEA 5E95A 5FUYA 5TB5A 1GZSA 1U2RA 1FQJA 4URYR 3BERA 5EE0A 3I62A 2OAQ1 3ZS9A 4JT4A 4YLGA 1ESNA 2XZOA 4AKIA 4Q9LA 1TL7C 4FMDF 2IF2A 4BGDA 3B1ZA 3HR8A 2ZI6A 3N70A 4TZ6A 3A1VA 1SKYE 4ON9A 3JVUA 4LJ4A 2ZE6A 4IOJA 4TQAA 4XWAA 1YE8A 2A5YB 3TGPA 4V03A 3L0PA 4WIAA 3VU9B 4JBXA 2FJUA 3ZVNA 3B6EA 1CP2A 5AUNB 1BKDR 2RH5A 4C7OA 1EWQA 3PG5A 3EA5A 5FOWA 4URWR 4M1YA 1NG1A 4EAQA 1EFUA 4CEIA 2H18A 1T9HA 4GI7A 2HJVA 2BKEA 3BH6A 2BBSA 1YZUA 1TF2A 1ZNZA 2VSFA 4X8HA 5LPNA 4O0MA 3VX4A 2WWYA 1LV7A 2ZAMA 2QPAA 4A2PA 4D6PA 2ZU6A 1KOFA 2H8KA 1CBUA 3I8SA 521PA 1Z6TA 5J4LA 3PQCA 4LHWA 4TL8A 3PUZA 4L9WA 2ANBA 5AK0A 4GDFA 5F3WB 2WJGA 1RRCA 1Z6AA 1YU9A 2Z83A 1H8HA 1EGAA 4AG6A 5KSYA 1XTIA 1SVKA 2A5DA 4PANA 2GZDA 4UXIA 3K09A 5EZ5A 4QFMA 5EP3A 2GZHA 1K5GA 3DKPA 2DY1A 5JCZA 2Q9AA 1YR7A 3K70D 1XCGB 1NN5A 4XJXA 1NJFA 1RYFA 1XFAA 1Z07A 2F43A 2PZFA 1G8HA 2RKOA 2V6IA 3A1WA 3S1AB 1OH8A 1OFIA 3SOPA 2IK8A 5TDHA 4JVLA 2QENA 4C0HA 3LA6A 1VG9B 4MGYR 2J59A 2J3EA 4ASUA 3T12A 3B1XA 5JHHB 2WPDD 2CVHA 1NJGA 3CRQA 1JECA 3FFBA 1T3SA 1XCMA 3LBHA 1B23P 2FG5A 3PEVA 1Y63A 4E5UA 2IYYA 2JDID 5FPHA 4YXWD 3U7GA 3K09C 1CRPA 2WKRA 1MO5A 4NCKA 1PUJA 2A5FA 2ZUBA 4P31A 1AM4D 2OUKA 3E2IA 1VYVA 3I32A 4Q7LA 1KNQA 1XTKA 2DCUA 2WJVA 5A4JA 4BEJA 2VYFA 1FUUA 3U7HB 4F4CA 4QC2A 2XOKD 3QF4B 3CIOA 2R6CA 3KQLA 2UZIR 5CDFE 1X8LA 2W58A 4PFSA 4KFUA 2W00A 4DCUA 2ZRGA 4JJZA 2ZRIA 3EARA 4TLBA 4AKHA 2ZU0C 3CRW1 1VDZA 3QF7A 3TNFA 4OK3A 2CXXA 4U02A 3KTAA 3EIEA 3OAAA 4FW9A 4ERNA 1J8YF 4IVRA 4A8JA 3FHTA 1SXJA 1N5JA 1YQTA 2F3RA 4BFUA 1ZD9A 4DIEA 1CXZA 5K8LA 1HYQA 1MV5A 3TVTA 3WRYC 4DXAA 3KQNA 4EPWA 3TQFA 4LWZA 1QHHB 5CM9C 5ANRB 1XJQA 1XMSA 4GP7A 1JQLB 5FR1A 2R6DA 1FUKA 3PR1A 1FFHA 4QBHA 1LNZA 3C4JA 5CIWA 3AVUA 3AV0B 4KAXA 4QBIA 4ZI2A 4HAWA 3U4QA 4Q9KA 1KSGA 1G6OA 3THYA 1N0VC 1ZU4A 4S35A 3TSOA 4D4JA 2VO1A 3OIVA 4FXPA 3SE0A 4A6PA 4RZ3A 1G16A 4H9GA 5SZKB 3MAAC 2WHXA 3RRMA 1JXMA 1ZM3A 2QAGC 4A8JC 1SXJC 4RKEA 4BLQA 1TQ6A 2IUSA 2VEDA 1M34E 4KYUA 2QBYB 3V00A 4B6FA 4RD6A 4BLOA 1Z5ZA 3ADDA 1E32A 1UM8A 3B9PA 3GPLA 2XTMA 3LBIA 4QHTA 3QENA 1TEVA 2FMXA 1XMIA 1UDWA 2IBMA 3AVOA 4OK5A 2V4ZA 3SS8A 5JSZB 3NC0C 3MWJA 4Q03A 4PO1A 1Z0KA 2LCFA 4HZIA 4NE2A 2ZYVX 3W9YA 3K9LA 1JI0A 3GMTA 2NO0A 1JJVA 5FL7D 4TTRA 2J0SA 1R7RA 1UF9A 4QNRA 1I2MA 2ZAOA 2R65A 3X1DA 3I61A 1XEWX 3GEHA 5A0FA 2QTHA 3CX6A 3H86A 4QHSA 1OYYA 5EE1A 3FMFA 3FOZA 1KDOA 1ZM4A 3SJZA 1G9XA 4DSUA 3W5IA 2C77A 3F5FA 2ZVPX 3M4YA 3ZQ6A 2QMEA 2O8EA 1E4YA 4MA4A 2REOA 3P4YA 2KWIA 3CH4B 5AJXA 5FUVA 3T1QA 4IDNA 3EZFA 1KDTA 3T5GA 4P4UA 3CKLA 1I4LD 4PQFA 3SI7A 2EWWA 1T5IA 4N0EA 1HE1C 3RS0A 2PH1A 1PLJA 5H68A 2H17A 2ZSAA 5EP4A 5K8UA 1ZIOA 1E2HA 5JECA 5AUPB 4LGMA 1NLYA 3OE7A 1EFTA 2FA9A 2CK3A 4TWZA 2EFGA 4KITB 1UBEA 2GKSA 3KQUA 2QTFA 3H0KA 1JR3E 2HT1A 4N3NA 4TT3A 4E22A 5IRCD 4UQOA 3LFUA 2GTPA 1TTTA 4FCWA 3EIHA 4LPSA 5SZHB 1R0YA 1XEFA 2QNRA 1GNPA
chains in the Genus database with same CATH superfamily
4J90A 3T4EA 1KI8A 3HSYA 4WNAB 4AW9A 4EG4A 4ZYWA 3GJZA 4V38A 4NXNB 3T4UA 5BR7A 4PE5B 3WL7A 3VPCA 1GUBA 1FMLA 3G1WA 4RH1A 1QRUA 3H9JA 4WKPA 1GPJA 2CVOA 4N5HX 2X0FA 4R2KA 1F8YA 5DNVA 3RBZA 2BM0A 2JVIA 3BGSA 3N8KA 1T2VA 2YNMC 4AY4A 1TVKB 4X9XA 4KO2S 3ZK9A 1EJ2A 2QSZA 5DLDA 1AKRA 2HNKA 3FY4A 4RO0A 3T1HB 3IP9A 3W4KA 1WXWA 1JHMA 4UBLA 4Q6WA 4O02B 1X70A 1QG0A 4KSBA 3TQCA 1WZNA 2BFBA 1SO8A 1P61B 4ZP1A 1V2GA 2HGSA 3DMHA 3GEIA 4FFSA 1O4WA 4LCBA 2X6QA 1RHUA 4AZ3B 2H07A 2AK2A 5EWLB 2O19A 1JB9A 1HURA 4K46A 2Z6AA 5IFLA 3C3YA 3NHYA 4DNFA 2JCSA 3VR2A 2CE7A 2PN1A 3VX3A 4DG9A 4DT1B 2A1TR 4YUYA 4F93B 1CIJA 2QMQA 5SZJA 3HKCA 4DSZA 4IFEA 5ALFA 4PHGA 5F1PA 5J4VA 3HDJA 1MOSA 4X6YA 5CB8A 4YH1A 4K28A 3CW8X 3GW8A 5LNK6 1VCNA 3K9FC 3QKWA 5KX5A 1SKUA 3PS9A 3LO8A 4PPQA 5DISB 1KFBB 4H7EA 1FL9A 1H3NA 5JQGA 5BW8A 1FXWF 1XUOA 2WTEA 1DJLA 3U2QA 1OGJA 5BSEA 4DBLC 3E3NA 5IVHA 4LRTB 1X80A 1N6RA 1F51E 1VG0B 2IZ0A 3CRMA 4JLAA 4KFRA 2JVKA 4EIWA 4DV1B 2C96A 2RGDA 3CT4A 4LYDA 2PMEA 2DHDA 1ES9A 1X1QA 2ZPUA 3C3XA 4X8OA 4DS3A 1NTRA 1Y4AE 4BATA 2I87A 1LW6E 3AUFA 3I52A 1OF1A 5JMTA 3COSA 3KX2A 4DJDC 5B57C 2I4RA 1LSOA 1MDBA 1ZA1A 3KTOA 3LIPA 3CS3A 4B75A 1PR4A 2BEVA 4LUCA 1U9JA 2HLDD 5HXAA 2QT1A 5LVAA 4LX8A 4Y1EA 4WOKA 3OQBA 4ZAWA 3HGQA 3B1KA 1SCIA 4PC1A 2O5EA 1T35A 5B5SA 4TLDA 1U1GA 3PWTA 1U28C 1OXXK 5KYXB 3L1IA 3ECAA 2NVBA 3G13A 3EYAA 5F1KA 4CLXA 3DJFA 5FOTA 1ULSA 5EFZA 4IKEA 1DI0A 3SN6A 1D7AA 2P30A 1QF9A 4BO8A 3PUHA 3UH0A 4KIGA 3QHPA 2CNBA 4X62B 3DBRA 2VH2A 3DOIA 4OHMA 3JU3A 1ECBA 4BVBA 4M0DA 3BILA 2D3WA 3WQRA 2GEBA 1NQWA 3W5SA 3PE6A 1MVLA 5A9SB 5CYPA 4MUHA 2P4SA 3LI2A 4FZ5A 2RKBA 1YZQA 1N9ZA 4KB5A 3JVEA 5TEWA 4ZT5A 1EU1A 2PKQP 3GZ4A 1XAHA 3VO8A 2RHLA 4BMYA 3JZFA 4ZVTA 3MNFA 4W5JA 2YN0A 4DEVA 3AUUA 1NZFA 4ZZ1A 3QVTA 2F43B 2GBLA 3P0IA 3OPMA 3QNMA 3JQ7B 1E3TA 4DRYA 1RQGA 5CK4A 1W7AA 5BYJA 5K4HA 3C7TA 2Q3HA 1X6VA 2X3UA 4JWKA 3RSOA 3N2IA 4ENWA 3ZUGA 1FRZA 2IIVA 1GKIA 4BBZA 3GJYA 2IBSA 4L9RA 2VZ0A 1Y3DE 4ENUA 2WDZA 3Q2IA 3F5QA 4WADA 1DLJA 1A71A 2I9KA 3N3BC 2CF5A 2GEVA 5BMVF 2CHQA 4CKEB 1FLVA 5I7UA 1X1AA 1AH2A 2FWJA 5I7RA 4WN9A 1WOMA 4CRWB 1H2XA 1XELA 2H7CA 1TIBA 2RH9B 1T6NA 1RXCA 3DNPA 5B1IA 1H1DA 2A9QA 3HL4A 5JYCA 1T4CA 2X0JA 4QDJA 3ECCA 2UZ1B 2VQ3A 4RZSA 3DBOB 1G2OA 1RC1A 4LZWA 4AD8A 1JPNA 2X0EA 4BFCA 1UBNA 3AJAA 3BH7A 1P6UA 3RI3A 1NBEA 1NP7A 3IIJA 4XXHA 2GDJA 4O25A 2BZGA 1FP4A 1FB5A 1VL5A 3ME5A 2HHLA 3OPNA 4EYEA 2C5BA 2EWMA 1AKTA 1K3UB 4DNPA 1USVA 2D00A 4H7DA 3DZHA 3TJMA 2AF3C 1AXRA 2QTGA 1ZYUA 2YXPX 3I76A 3TLZA 1ECCA 4O4HA 1TE2A 3LMKA 1KDPA 1J2RA 1JEAA 3WO1A 4K40A 1MJGA 1KK2A 3OZUA 4IXDA 1QJCA 3BFXA 3H9UA 5CJPA 4ALKA 4PYIA 4GLFA 5B30A 1EJBA 1A82A 3NANA 1NWHA 3AHFA 3TNDA 3EEIA 5L6LB 1BDBA 1VKHA 3UT0A 2HU7A 2PANA 3DAPA 3EWIA 1THGA 4AJHA 5HK8A 3CX4A 1T0UA 1MO2A 1NIJA 3MMXA 4NDAA 2Q4TA 4A15A 1KI3A 1T0BA 3LC2O 2V5AA 4TX1A 3RS2A 5I8PA 1CRZA 5K3OA 4AKEA 3TXYA 2Q6KA 5HDQA 3PGLA 5LZ5A 4C0LA 2XT0A 5KOHB 3QE0A 3LFTA 2Q50A 3KYBA 4C0SA 4F2HA 3DF7A 4MR7A 4A16A 4XIFA 3U4QB 3UK6A 1ZLXA 1SUSA 4R9UC 2B5VA 1X92A 3AEYA 4MYTA 3SXJA 3T95A 3W34A 2J08A 1UL1X 3A6EA 1C4XA 4KMRA 4AXBA 4RS4A 5FF9A 3A7EA 2BVNA 4AS1A 3PEWA 2BLLA 4M1SA 1O6BA 3EFOB 2PAAA 1VPEA 2A1IA 1E9VA 2DHEA 1Z4PX 4MGHA 1JXOA 1SQFA 1Y9JA 2XR1A 3FCSB 1E9RA 1JAIA 3ANMA 4IIJB 4NZYA 2C7OA 3O1JC 2KSQA 3R09A 3O3MB 2OQVA 1XTTA 1L3CA 2J9ZB 1E2LA 4JFAA 2FTKE 5M3BA 3HDTA 3BBLA 5CDFA 3ZQ4A 2GN0A 5DWQA 2HF9A 4GVXA 1RJEA 3W9SA 1G2PA 2PUEA 2ZAIA 3Q6NA 1X94A 5J5AA 4F4DA 1WMBA 3C8DA 4P3PA 4ZHQA 2PV0A 4GMDA 3BSSA 3WKCA 1TYEB 4QREA 1PFVA 3O9MA 4GQIA 2FPIB 3M0EA 5BRAA 4KWTA 1E3QA 2YMQA 3AJ9A 1C9YA 3BULA 1J5PA 3G0OA 4NCNA 1QIMA 3DUWA 3KLOA 5GQSA 3MJSA 4RPKA 1UOQA 5BWMA 5C1OA 1GTJ1 4HDCA 4TUYA 1UJ5A 4I0WB 1BKYA 1TK2A 5PNTA 1ODTC 4MO2A 4XOUA 4Y2YA 2ZS8A 2VPIA 3EHDA 1CUJA 1OIWA 2CKDA 4B4VA 2AJTA 2PMFA 4UDXX 2CV2A 4Y9DA 3ZXSA 4YMHA 1TW2A 2C3MA 2OV3A 4FJ0A 4OF4A 1ZC3A 2QS9A 1P5FA 5TPWA 2O8EB 1HTTA 5CPBA 2CL5A 4HDNB 4ESOA 3VHXA 3BTSA 4UVGA 3L0OA 3PGJA 4QU5A 1IL0A 1YONA 1EQUA 2PGXA 1H2WA 3GCXA 4KIWA 3GMIA 5EXXA 2CCKA 2FEPA 1Q0UA 2QEQA 2ZBPA 4IDHA 1DQZA 3KQYA 4Q34A 2WAYA 4ENVA 5K6AC 3EEOA 4N6GA 2QE6A 3JARB 4KKVA 4GRAA 1MTOA 1VCHA 2JGEA 4FWBA 3R0IA 1NUQA 4C3VA 5KVSA 4LJAA 1P2SA 4A8TA 4AN0A 1B3BA 2F55A 1BQEA 3NYIA 2FSSA 1N2HA 3QUQA 3KOOA 3WYGA 1XU7A 4ZO6A 4IJKA 3C5VA 2ZKIA 3ZCQA 4BLUA 3L7MA 4DV4B 3FSGA 3QJYA 4FGJA 4DDKA 2C7QA 2R0QC 5REQB 1W36C 3TR6A 2WZQA 1O3YA 3TRFA 1DC4A 1WPQA 2GYVA 2YWRA 5JRDS 1VJCA 2ZJ0A 1PSWA 3I53A 1SC4A 4LFCB 1TZMA 4O2LA 5IC4A 3PXXA 4YLEA 4Y3UA 1Q14A 2PEZA 2W2NA 4P4SA 2GPTA 1QYVA 3EW7A 3QMPA 3ZBUA 5BV7A 1WIWA 4RXTA 2W6PA 3F96A 1JG6A 3OQVA 1UWKA 4YQFA 3R24A 3W5UA 5J2TA 1FBNA 2XGGA 4YDRA 4FYJA 1IPFA 2JIZA 2VJYA 3HJFA 1WSDA 2IYVA 3M1IA 5IUJC 1M1NA 2XAUA 2JGKA 3VPAA 3HI6A 1OAAA 3T35A 1SUCA 4J75A 5BSUA 4AMBA 5JCJD 1DX6A 3M6WA 2Y1CA 3U61B 3AUKA 4PXYA 3BJZA 1NXPA 2ODEA 2JIQA 2MHCA 3UJHA 1T5SA 1W0JD 2AEMA 3BZUA 3W8RA 4C5BA 1PWYE 3PCTA 4H6PA 1RYYA 5KTMA 1FFXA 3F9IA 1Z7YA 2BFBB 2GAAA 4C22A 1JE0A 1NQAO 4PFQA 2DWOA 3OC6A 3OLZA 1RCUA 2WABA 2ZK7A 5HA5A 1MT0A 2G4LA 3LGXA 2POCA 4G0MA 3ZU5A 2FN7A 3NDPA 4LYFA 4EDHA 1QMGA 5LMUB 1V5WA 3ZWYA 2L82A 2G7ZA 4CJXA 2OXEA 2VPTA 5L53A 2ZXEA 4NEQA 2YWXA 3BFKA 3LTNC 5B64A 5KDOA 1AXEA 2R8XA 1OB5A 4QEZA 4AKSA 5KX5B 3NWBA 2PUJA 1JR3A 4MHSA 3RLFA 1TJ5A 2FEWB 2G08A 3LZCA 5L3VA 3DP9A 5JQGB 2PUAA 4NS1A 5AXCA 4ERXA 4JYPA 4V0LA 1T2CA 3RIMA 1WY7A 4LKOA 1UQTA 3UJ3X 2F90A 4BBPA 5CHYA 1EVIA 13PKA 3F2VA 3D0QA 4ZI7A 5L3ZA 2YVQA 4P08A 2O48X 5DTEA 3SFVA 1X80B 4RTNA 2YIDA 4FKZA 1RRFA 4U39A 2WP8J 3V1YA 1KY3A 3RUHA 5JNWA 2H7VA 5JVDF 3Q7SA 2ID9A 3EWSA 3LVBA 1UZMA 2J87A 4NFYA 4RABA 3BGWA 5SY4A 2J7PD 1Z5WA 2QORA 5H59A 4CMBA 3OFJA 3RVSA 5HM8A 5FCDA 2ASVA 1MENA 5JC8A 1IPEA 3DHEA 3FKQA 1BYIA 3L6RA 4KACA 4Q4AA 4QXAA 3ZGNA 4AXXA 1OZHA 1CCWA 3B2QA 1GKYA 2I4NA 4LHZA 4M0EA 4Y2JA 3DOJA 4BIMA 1NBWB 1W75A 2WJ4A 1C7RA 1GQYA 3MEQA 1E1NA 1JLMA 1DJMA 4RKRA 3H2ZA 2NT3A 1XJCA 1L2TA 4LBWA 3ZVLA 4E08A 4ZV7A 2O07A 3FHCB 4YCNA 3NWPA 4AKGA 1TYBE 2VT6A 4FCCA 1PZMA 4Q1FA 2GPBA 4LE2A 4RL4A 1HSOA 4TMTA 5C4GB 3DTYA 5JSFA 4KLZA 4D0SA 1TNDA 1VL6A 3PUWA 3LT4A 1UP4A 4PIVA 4F7WA 5TPZA 1E8NA 3CMMA 5DI9A 1VG8A 1LPAB 3DBRB 3UY4A 3KT0A 1IE3A 2O2JA 2GPWA 3CPEA 1N2IA 4GOKA 1GNLA 3P4UA 1UPUA 5ALNA 2Y67A 4YPFA 3V4VB 4CIWA 4LA4A 5EJ6A 1JJFA 1GCGA 4YXWA 1LZKA 1LH0A 1MLDA 2QLJA 3MQ2A 1YA8A 4BYMA 1K88A 1U3WA 3SVLA 2E4YA 4WZBA 5LNK1 2VJOA 3DDCA 4JYBA 1L7QA 1ZUNA 4LBYA 4RELA 4B9EA 1DJOA 3DOUA 3OSZA 2I76A 4GP6A 5G0UA 4LTDA 5H70A 3T06B 3RH0A 4MWEA 3UQYS 1R9GA 2OTCA 1KEKA 4DQLA 2R44A 1GNVA 2BEJA 2OLEA 3D3NA 3ZIAD 2Q0QA 1HV8A 3VZRA 1DXQA 4L5JA 3P32A 2R87A 1COWD 4QXRA 4XJSA 3UMCA 4DA7A 2R00A 3O2NA 1IEVA 2VNJA 4TV8F 4L75A 4V1CA 2OORA 1U4NA 2W8BA 1NRWA 4XPIB 1UWLA 2ZROA 4QX6A 5LLSA 4CNBA 4AQ7A 4P86A 2ZI9A 2YY6A 3AY6A 2VPXA 1DP4A 2ZT8A 4C4OA 5ALMA 1YK1A 3PQ8A 3Q8WA 1K5HA 5JARA 4BWYA 2GAOA 4F5DA 1D04A 1VPDA 4QUEA 2QXUA 2NV2B 3DZGA 1UC9A 4HAYA 4IIFA 3TSWA 4X92A 2W48A 1IHUA 3UC5A 3UK2A 3SKXA 4Q7KA 4PN7A 4FYIA 3ND6A 5BQXA 5BV0A 1XDSA 4IS2A 3BWDD 3H5VA 2CF6A 5AO9A 1T4CB 1DKMA 3ETEA 1X1EA 4B47A 2VYVA 1G17A 2XXAB 4M1MA 4DXHA 1RPTA 2GUGA 3AMVA 4G5QA 4P6VF 3RO7A 4HUTA 2RGAA 1N3LA 3LCMA 3LX6A 4LQLA 5B53A 4D3DA 4RHYA 2C42A 4H3VA 2ZIWB 4IH1A 3UUWA 3G0CA 3CNNA 1YDWA 1BE6A 1NAIA 5IM4A 3RV3A 3F9CA 3NBXX 3V7FA 3L02A 4U5QA 1JAHA 1KC3A 1XCJA 2NSLA 3HN7A 2NQ2C 3WLKX 1FP4B 3C5WP 3FMIA 3LRTA 2B9EA 3HZHA 3A1SA 2WM3A 1W29A 3HJTA 3ONFA 4LBVA 5G0WA 5J63A 3KEQA 4K6GA 3U31A 3WLEA 4BB6A 3DEAA 1QIGA 1CZRA 1JZTA 4O4HB 4OYHA 4HWRA 2DF8A 1OC4A 1I3KA 5DNDA 1YRLA 4C87A 1N2JA 1E7WA 1HZJA 1II8A 4CU5A 3F6YA 2UZAA 4ITRC 5H4GA 1V8FA 3JVDA 2V45A 4NESA 4NU6A 2C1EA 3H7AA 3OTIA 1HNZB 4F2WA 4A2QA 4K6HA 4ABTA 1J0DA 2GF9A 3OG9A 2HSZA 4LOLA 3ZWPA 1SBZA 1ZD4A 1KAQA 3BSWA 3D6JA 4XTRA 1WBJB 4B1FA 4ILKA 4RM3A 5B6JA 4DLUA 5JJLA 3PUVA 2IY7A 5T6MA 3LU1A 4QSMA 4A6EA 1JLKA 4MR7B 1R27A 1SBHA 4QVGA 4MVWA 5AVOA 4Q48A 1BYUA 5HDBB 2VSXA 1L7PA 1XEWY 4ZD6A 1DZ3A 4Y9UA 5M34A 3VAYA 4TMVA 1RXEA 2A67A 2CDCA 2F6RA 3JD4A 3P9RA 2O3TA 4E6PA 4JBLA 3B5EA 2HQBA 3M9WA 2IXGA 2AWOA 3VH1A 1SC6A 1E7SA 2XAAA 2NLOA 4K6OA 4PG5A 4AS2A 5DTQA 4FYHA 3O26A 1SKAA 5P8WA 4PZCA 3TVYA 4YV1A 2NACA 4W7IA 3R9KA 3PPWA 1K8YB 1ACLA 1MBZA 2F9LA 2IPMA 4RD1A 2VYND 2IZ1A 4MJ7A 1CFJA 1EWVA 1PAUA 3MAJA 3OLYA 4KQ6A 4MZXA 5TC4A 3WDMA 1NRIA 4S12A 3A11A 2Y66A 3EY4A 4X65B 1G3QA 3M1AA 1W25A 4JEIA 3L84A 1PS0A 4MKIA 4YP5A 4ZHQB 4W9MC 4B6EA 1C29B 2VK2A 1GIAA 4QYWA 4XYBA 2YZNA 1KOLA 1FVOA 1WM1A 1XDUA 2WR8A 4MWBA 3SC2A 2XKKA 3BPSA 2AMJA 1QGED 1RZVA 4I81A 3ADOA 4Q3EA 5DLQC 3U40A 4DUGA 1Y5NA 2PG3A 3WYEA 6NULA 3V4ZA 1Q95A 2LW7A 3E3MA 1UUFA 3PT5A 4LI0A 4TUYB 1OH5A 1VJTA 4NU8X 1CUZA 4CMEA 1SCJA 4RESA 3IIEA 4D6XA 5LMNB 4BHTA 3FM9A 4EHKA 1L4BA 7GPBA 2R62A 5DEOA 1A8UA 4GKJB 2Q8QA 4UCQA 1FNDA 4YT2A 2FZLA 3H05A 3PL1A 2Z2XA 2IUFA 3FN4A 1KZ4A 4FFNA 4JODA 4AB1A 3B3QA 1QQAA 1O03A 4XCQA 4BZWA 2VF5X 3MOGA 5TPWB 2D2FA 4MHTA 1YCFA 4AY5A 2HNAA 3IDSA 2I80A 3G49A 4KXNA 3VHXB 5SV2A 3KQKA 4KTTE 1R12A 1E89A 3DEFA 5ALLA 1YS7A 4I36A 1SJ9A 1ZCAA 2GLTA 3CLKA 2X9NA 3FWNA 2PGAA 3LFHA 4CM9D 1NJ1A 1DC7A 1PR1A 2VDWA 3ACCA 3H42B 2GEDA 2FI1A 2Y1XA 1JJIA 3L18A 3MWLA 2ZB8A 5B1DA 3AM3A 3BK2A 4O1MA 4G8CA 4Q66C 1JAXA 1QYDA 3M4XA 2XZPA 1XVTA 1Z2CA 3EGCA 4G5FA 1WP4A 1SXIA 1LCIA 1KJNA 2NZ2A 2AR9A 3KQMA 4RPGA 4ESEA 2EYUA 3AUYA 1JLRA 2WJ6A 3HC7A 3OAAD 5IK2A 4FU0A 4Z9FA 1K4YA 5F3DA 1RPZA 2ZDGA 2EDAA 1K86A 3NCHA 4WESA 3SC6A 2WJHA 3A4NA 3R7DA 1GQQA 3OY2A 4FFVA 4BCCA 3GLIA 2AFIE 6YASA 3ZH9B 4OQ4A 3I37X 3QU5A 2SKEA 1KMMA 2GVNA 3HB0A 3P9XA 4KJXA 4S3MA 3TQHA 1HEIA 4UD6A 4E5YA 3FMOB 3HB1A 4LRXA 5AKZA 5CCXA 2WILA 4P4SB 4A0HA 2YNMA 5T5QA 5LM3A 4RTLA 2X1VA 1Y89A 4HS4A 4AY6A 3TMYA 3OWXA 5AHOA 4ZVMA 2ZJBA 3L46A 5ESWA 3PI6A 5J2TB 1P8AA 1U5AA 2WJWA 1SURA 2HBRA 4G86A 4M6WA 4UM9D 2MSWA 2FW9A 4KDRA 1M1NB 3HWRA 4KYVA 2NMVA 3I4CA 2WIKA 1OYWA 1YRBA 2Z98A 3NBUA 4QQRA 1IXSB 2G0TA 3N28A 3QXXA 4JYMA 5ALTA 4AO7A 4V0KA 1GFZA 3JQPA 5TS3A 1ORVA 2XH8A 3A6LA 1K7FB 3R0ZA 1PJCA 1KSHA 2DFDA 2G1UA 3EDCA 4L8GA 5D3KA 5BQ5A 4L07A 4UREA 4EG3A 1XRNA 5KNBA 3ICEA 3PNOA 1GZDA 2QVLA 3WQQA 5IAOA 5L3QA 5JOQA 8MHTA 4Q3DA 1Z2PX 2H4XA 2QTRA 3Q8XB 2OXTA 4JY7A 2PUFA 1G3IA 3TLYA 1C4KA 2ZB7A 1JG4A 4WVFA 5L3SA 3HDVA 3K1JA 2FPWA 1W8DA 5IN4A 3NBQA 3CQ9A 4RL6A 3WGMA 2VH5R 5B4TA 1HDIA 1MXFA 2AE1A 2WNSA 3LBYA 3MCUA 3ST7A 4BNJA 4CT4B 1UKZA 2YBEA 1F1BA 5IEJA 3ND9A 1GA4A 3CR8A 2WG0A 5GADl 2X76A 4N6NA 3VTKA 4EUEA 2COKA 1RKVA 4R3UC 2VQDA 2WZCA 3ICWA 3OJEA 3ZBTA 2OC4A 3ZCPA 3GK3A 3MQFA 3X44A 4BQOA 3SXPA 2DECA 5PGMA 2WWGA 1J90A 4MDYA 1JEYB 5KYVA 4URFA 1GFIA 1IB0A 1WKVA 3NT4A 1BVRA 4RMNA 5G41A 1E6MA 3TTUA 3UNXA 4UOEA 4ZI7B 2JARA 3V55A 3CLRC 1ZGHA 2FWIA 1L5ZA 4YAJA 3TIFA 2IXAA 2O7NA 2OMEA 2CLSA 3OETA 5K0LA 3UAVA 4AZ0A 5HKLA 2AG6A 1CIVA 3N6RA 4OEHA 2EGGA 4PHTA 4P0TA 1SFRA 5CFOA 3I2FA 2OCIA 2VJKA 3LYHA 3IO5A 3KB8A 1QH8B 3TAHA 4ZEMA 3QPBA 2XCSB 2FV8A 1T9GS 1WABA 3MT9A 3Q3GE 2ERXA 4Q4AB 3PK0A 3QVXA 4LVNA 4H16A 3ZHQA 4TQUS 1OLSA 4ENPA 1IZYA 1H6AA 1T5HX 2CNWD 4XSHA 3JQ9C 2FWRA 1CDZA 1UDBA 2K2WA 5CTJA 3U9TA 3VOSA 5F78A 2AD5A 3P97A 4E2YA 3KHTA 3PRHA 2O0KA 1NBOA 4R51A 4JLDA 4YACA 5JWOA 1QQTA 4D9HA 1XRSB 2CK3D 3DLBA 5FIUA 4IZIA 2R9VA 2B7CA 4JR0A 5GMOA 5KTRA 1PCXA 5L45A 2GA9A 1CUYA 1U4OA 1JDNA 3T5DA 4B83A 4HXEB 1UP7A 3W6OA 1Q7EA 4WH0A 4MI1A 2Q9BA 1JEOA 1Z4JA 1N6LA 4LDNA 1GA1A 2VRCD 3H11A 3KQHA 1O77A 3I30X 3ZE9A 4P38A 1KFEB 2FR8C 3DD1A 4R9VA 2FWBA 4F92B 2XPCA 3OQIA 5BT8A 1ZD8A 1IY2A 1HTBA 3O4VA 3UJAA 4CM1A 4IM7A 2GXSA 4WDQA 9LDBA 5I01A 1FMTA 1XNQB 1XZIA 4WZBB 4K6MA 4NPHA 4MUAA 4PGMA 5FP0A 1ZUNB 3VDQA 4CMHA 4CEHA 3CVVA 2QD4A 4O0LA 3PF8A 1PT9A 2YWBA 3SZLA 1LW7A 2QJOA 4HQNA 1TDJA 1W73A 4BKPA 3KSBC 4IXMA 2IOFK 3QFTA 1CUDA 1H0SA 4ER5A 1DLIA 1NZJA 5FI0B 5AVRA 4DPMA 4V1CB 4OH7A 2W8BB 2AUTA 3FSJX 3B3JA 2JNWA 4AS3A 4JB8A 5HKKA 3SFTA 1Y6GA 1FDSA 3UPTA 5K0TA 1G1MA 2ZS7A 4PLVA 3U3ZA 4DIKA 2A1UA 3EDMA 3LE8A 1YNOA 2NNWB 5CT4A 4P82A 1WVIA 4ZC8A 5JQWA 3A3PA 3DQZA 3BSYA 2XX3A 3OZBA 3P0FA 1A96A 5F2KA 3R7WA 3UCFA 3GQVA 3W6ZA 2CFCA 2RK6A 1U5BA 3C8HA 3L6CA 4HH0A 4IIXA 3WL6A 3WNDA 5IDXA 3T9AA 1V3QE 3S1SA 1RE0A 2VWPA 3AJDA 2VZEA 1OA0A 4GKVA 1FUEA 1EX6A 1BFDA 2ZRHA 3LNTA 5KC8A 1CQJB 2Q0SA 5DX1A 1XZGA 4OMFG 3TDKA 3C3MA 3S29A 4BQPA 3CUSA 3GQBA 3FTDA 4E5SA 4EHHA 3DTVD 2C8VA 5CH3A 4RD2A 5JPDA 2ZYRA 1SCNE 2GNAA 2JHAA 1N0IA 3UBMA 2AUMA 5A5DA 4EZEA 5C1DA 3GLSA 1GO2A 4JH0A 4D9IA 4BMSA 4F6LA 3L05A 4BJ5A 3DZ8A 2CLEB 4S0XA 1AU9A 1YQXA 3TRKA 4BUZA 1TTQB 3V8EA 4PSDA 2EJCA 4DLXA 1CS4C 1EQ2A 3JD0A 2ZJ4A 3MLAA 2WJIA 3WAKA 1DFGA 1QAOA 5D85A 4ZCSA 2RH4A 1TK9A 2W6ID 3EQ6A 2P1ZA 3JVVA 1G21B 4C7MA 4B44A 1II8B 1AA6A 3A6KA 4L16A 4BAGA 1NQTA 1KXJA 2WWIA 1HDZA 4YRDA 3WLAA 2BZ1A 4EYSA 4ARAA 1SRQA 3GLGA 3NDIA 3CW9A 3JQBC 1M6VB 1ODIA 1V3UA 2AWNA 1I2CA 1VZ2A 1P0QA 1A9OA 2XNSA 4OQPA 4ZODA 3O38A 3SC3A 4D8UA 5BP7A 4MW4A 1Q17A 3BK1A 5MFZA 1BAPA 5BN4A 1QPGA 2ZIFA 3JASA 1R0LA 3H5RA 2BSQA 3EG5A 2C2WA 1W96A 3V6MA 2B2XA 4ZZ0A 1PR6A 1F60A 1KA9H 3L7IA 1JPVA 3N74A 4HFNA 4X6LA 3GLHA 3IEKA 3N2GA 1X42A 4BFWA 1J39A 4CQMA 2YDYA 4AJ2A 5JI2E 4BGIA 1WXXA 4ZQCB 1WCIB 3OIGA 4AYWA 4XUDA 3AW8A 1FTYA 5TJ9A 2C4HA 1ETUA 2HCRA 4MUJA 2DTEA 3T5BA 3NEPX 3FNQA 4CPDA 3QOXA 2ZB2A 3IIMA 4CL3A 2IIQA 1DXHA 4FYMA 2BMWA 3FZNA 4POAA 1MRNA 5IDWA 2BKUA 2FPKA 2XKAA 3QVWA 4PCUA 3I2KA 1JDUA 3BEDA 5I4KA 3N87A 3AWIA 3NH6A 3WYNA 2RONA 3G8YA 1DQPA 4DG8A 3THXB 5IDVA 2HMSA 2ZRMA 3HYNA 3OU2A 2IL1A 4NBVA 2RGUA 1VCIA 4QXMA 3RS8A 1YRQA 2XNKA 3EZ9A 1NR5A 1G7CA 1EMDA 2OD7A 2PKWA 1ZWKA 1DDGA 2X5XA 3ESCA 2CNNA 3E6AA 2AMFA 2YUIA 1WULS 3SC2B 2C78A 3G9XA 5BYAA 5J2UA 5E3HA 1S0UA 4GOOD 4D5EA 3R3XA 4RSRA 4XA8A 4AJKA 3KM0A 1VECA 1U8YA 1CUXA 3ZYZA 1QCDA 1VHDA 2FX3A 2FOLA 3BHNA 3N0WA 5K3EA 2CVZA 1KYIA 1U3GA 2FW6A 2UDPA 3QJ5A 3DWGA 3QV2A 1UKYA 1X38A 2QK4A 4JEHA 4U63A 4Z9AA 3UJ8A 3VHRA 1I7LA 1OTYA 1CQWA 3O7MA 2AVDA 5K6AA 5JR3A 4DQXA 4NC9A 5JBNA 1IM5A 2YN4A 4BMDA 2J6CA 5FFNA 2O23A 4FDTA 4K3VA 3U13A 3K1TA 3SMQA 4B3SB 5FV7A 3ZGOA 3LHFA 4LYHA 5EZYA 1CJCA 5AQEA 2NU9B 1P31A 2A9VA 1Z74A 4IICA 4GYYA 1IOZA 1BMFA 2DFKB 3ASVA 4WW0A 1QVWA 4BLTA 2C0QA 4HH4A 2P9JA 5AD1A 2MINA 4UAGA 3VDNB 2GASA 4FYPA 4LXQA 3PKJA 2VDWB 5ITSA 1Q0RA 1DHTA 4AF8A 4JKIA 4CL0A 4EB6A 3HCWA 1XU9A 3AEQA 4R01A 3T1VA 3M2TA 3E7DA 1I0ZA 4KQ1A 2YHSA 3A70A 2VJBA 4BL5A 3GFSA 3LQFA 4KFSA 1AMOA 1GZUA 3M1LA 1P3JA 4HL6A 3QFRA 1KP2A 4Z1MD 3H6KA 5IPFA 3ZD8A 4M1QA 3ZWWA 3GA5A 3UUFA 5IKMA 1UBLS 2XMGA 4NMXB 4WESB 4BGEA 5HQ3A 2AJCA 3TQSA 2WG1A 4P98A 1W94A 5KNDD 3AZPA 2DP4E 3L4BA 3GLIB 1PEDA 4PQGA 2C2MA 3D8TA 3UTCA 3FWKA 4GUAA 3MHPA 1WU8A 4OBXA 3DNMA 2PVPA 4UM5A 4DM4A 1QIJA 1GOTA 1Q3KA 2FWAA 3B36A 4WE3A 4YN3A 3HJAA 3AM1A 2RDMA 5DYIA 1M33A 3IDQA 2NZWA 3RJ5A 5CVTA 1P44A 1DAHA 1K8RA 4CQLB 3FTQA 5JFGA 1U2GA 2PS0A 3A6GA 4YFVA 3WNCA 4B3FX 3Q4GA 4HX5A 2YXEA 1DB3A 4NMMA 2C2YA 2OV6A 3L6DA 2QM3A 4RJ2A 1HOTA 4AKTA 4MCHA 1VGVA 3FZGA 1Z0FA 3QEJA 4C0WA 1N77A 4PINA 5KDLA 2WHQA 3WL8A 1AY0A 3VR4D 2Z08A 3PC3A 4JJ8A 4BX9A 1MVOA 1OH7A 4W7SA 4N54A 1OB2A 5IM4F 4LRUA 3PVCA 1IBCA 3E3AA 4W63A 1T2FA 5K3SA 3RU2A 3OM1A 5K09A 2QVYX 2HSEA 4IHKA 2A9OA 3HUUA 3RTBA 5TMDA 3ZE1B 2CHGA 4ZJUA 4RULA 5EZ6B 3ZW7A 1WEHA 1GPNA 3SE7A 3HYCA 3LPCA 4WDRA 5EEGA 3TDNA 3GLQA 1CEYA 3WGZA 4LHEA 4R1OA 2CFIA 4JL6A 4KNWA 1HKHA 3DCIA 3MTGA 3LCRA 1XTQA 1L7NA 1ULZA 2AMVA 3LDAA 2ECOA 3TCKA 2HSJA 2HV8A 4XLTA 3VO1A 5ADWA 2HA5A 1XXHA 3U1TA 1NSFA 4BJHB 4XWOA 2YXBA 3OQPA 2GCOA 2W83A 3T1OA 1DGQA 4QDXA 2H00A 2ZWAA 5BN3A 2F17A 4REOA 4MUFA 1PEAA 1KEZA 3TFWA 1TUEA 4AZ0B 2GSWA 4LXGA 1RQLA 2RGEA 2TMYA 1OR8A 3LD9A 3PNYA 1UXJA 3TCXB 3T3IA 3GUUA 3HVRA 3CVWA 5FLEX 4ER6A 1DJQA 1H42A 1GZHB 1P2FA 2I3GA 2W2PA 1GYPA 3L79A 2LRHA 4Z0PA 3AI7A 3V80A 5IT5A 2J0QA 2AI2A 3O74A 1XZBA 4R1QA 5CXSA 3VYSB 3WNVA 4B3MB 5FI1B 4DQKA 1PNTA 4WFQA 4FMBB 1BN7A 1KGSA 1OLSB 1ISPA 3T7KA 4RY8A 3ZIDA 1RXSA 1NW4A 4J07A 3ZS8A 2B94A 1R0WA 1SBNE 1TEXA 1DVRA 4ZVRA 3AVVA 3RHSA 4EY6A 3SQNA 5DEIA 1GXSA 4PHHA 2WWWA 2WF5A 1WPGA 4BLSA 2PFGA 2JASA 1TK3A 2IIPA 3DOHA 3LPDA 4JJ7A 4RV4A 4BB5A 2V0GA 4BE7B 3EGXB 3Q8MA 4Z7QB 4AO8A 2R8ZA 3V3TA 2V7BA 4Z4HA 1J07A 2D5IA 4HXYA 5DHFA 2PEYA 1ZN8A 5A4FS 1BN6A 4YDHB 5BV8A 2PUWA 3C7AA 1MB2A 1O4VA 1R4AA 2VUIB 3COZA 2TMKA 3C48A 4U7GA 3STVA 1ZCFA 4LHXA 3H11B 3QBEA 1XKQA 4KQGA 4CV1A 3H7IA 3NIGB 4ITUA 4N1AA 1EVJA 3AWDA 3FUWA 4NYIR 3K0HA 3JQGA 1Q77A 1SCDA 4AIRA 3FJYA 2I1VB 3FHJA 3NTXA 1E3DA 1QFMA 3KQWA 4PNZA 3VYVA 3NFYA 1WTCA 1M1YE 2P5SA 4CEHB 1M6EX 3S28A 3NM6B 2CXHA 1A7JA 1N92A 1WSWA 1ZOIA 1KPIA 3DLPX 2OXFA 3BRCA 3GA0A 3JQ6A 2WPDA 4HLQB 3TQIA 1E6WA 4ZEOA 3OI7A 5A6SA 1NASA 5H02A 1GCOA 3UJCA 3A4YA 1L1QA 2CZQA 1EK5A 1Y8QA 1UK9A 2JCBA 3LPAA 4O5AA 1POXA 5IJZA 1X19A 3FGOA 3ER8A 1GCAA 1L0BA 1WAMA 2JDIA 4ARVA 4ZN6A 2H2FA 4AJJA 2OY0A 4TS9A 1ITZA 3NQ41 3I2IA 2OHIA 3BXFA 4ZVKA 1U7UA 3AV3A 3QUTA 5JZVA 3GPDG 4B6QA 4KRXA 5C5IA 1XL0A 3H97A 3PD0A 3QVGB 1QYIA 5F21A 2A1UB 5C0OE 3IOCA 1YT5A 3LUBA 3Q9LA 1KYVA 1G8MA 2R6ZA 4ND8A 1RJDA 3D5EA 1WBBA 2O7VA 3A4LA 3QV1A 4HNSA 3AETA 3IEUA 1WXIA 1RI1A 1XBTA 3CNLA 2G1PA 2LDBA 2PGOA 3IBYA 1XKLA 4J1NA 1U5BB 2XUFA 3LT0A 4RTRA 2GJ4A 2O8BA 3PDHA 1DUSA 3ESZA 1QZTA 3HP7A 3FVTA 2OBLA 4LG1A 3TLKA 3Q7RA 2ZBVA 4KBGA 3WLOA 3CZCA 1ZKMA 3ZIUA 2OBMA 1UPXA 2I5PO 1P7WA 1YWGO 2FK8A 3ZDAA 4N5NA 3V8NA 2EZ8A 1VL2A 1E2UA 4RNCA 4JLOA 2CL6X 3I73A 5DH9A 4D43A 4K9QA 2IXEA 3FRHA 2QL9A 5ECDA 3ZYCA 3L3BA 3D7SA 1L5LA 3M3DA 3V4FA 4XZ3A 4Y1RA 5EKDA 2WIAA 3U48A 1W5BA 5TQJA 5F35A 4A2WA 1UJ2A 2G71A 5GIOE 2YJ6A 3NHPA 3UB3A 2FKAA 2BHRA 3KWMA 4B82A 4ZOAA 1G5IA 3HVHA 3I9NA 1NE7A 2OECA 3PQ2A 1T3HA 1BX0A 1LNSA 4P92A 1W4LA 1P1JA 1CIPA 1K7EB 2JS7A 5TGDA 2C7RA 2PIAA 2BDUA 3KZNA 1T8PA 4OGKA 3S2GA 4BKOA 2FW1A 1OKKD 4HG2A 5EPUA 4IHJB 4OXRA 4MW6A 1O6ZA 2IU4A 2LGJA 3VPHA 1E1RD 4C5AA 3T5PA 3KSMA 3ROXA