4XWOA

Structure of get3 bound to the transmembrane domain of sec22
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
347
structure length
293
Chain Sequence
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMALADLTGSIPGIDEALSFMEVMKHIKRQETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQECKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (atcc 204508 / s288c)
molecule tags Hydrolase/transport protein
molecule keywords ATPase GET3
total genus 101
structure length 293
sequence length 347
chains with identical sequence B, G, H, M, N, S, T
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xwoA00
3SFZA 4PO8A 2ASEA 3ECCA 3QI2A 5EE1A 3ZS8A 1G16A 1XB2A 2GEVA 2G1JA 3X1DA 1E9EA 4MRRA 1Q12A 5CJ2A 2CNWA 2XSZA 4BFYA 3AP1A 3U4QB 5J4HA 4ARZB 4PTLA 4Q9HA 5FOUA 4OHYA 3KQHA 3W5IA 4FINA 3KB2A 4TMXA 3OFND 1P5ZB 2IK8A 3OEED 5DN6A 4PZYA 5LBIA 3VR2A 4Z51A 3EPJA 4DCNA 2YZ2A 2OCBA 3I73A 4BZQA 4LJAA 2CLDX 3NG1A 3IIJA 4CEHB 2VP2A 2HCJB 5AJVB 5AJWA 4TSFA 2IYTA 2IYWA 1SXJE 3G82C 5CDFA 4OL0A 2FSFA 1OKKA 1BIFA 2EVWX 4ZI2A 1QVAA 1OH8A 4WZ6A 3EIHA 3NKVA 4DDUA 3FFBA 1IOZA 3ZDQA 3CX8A 1Z63A 4M1YA 5M04A 4EFNA 1D2EA 1L4UA 4KBGA 2BM0A 5DI3A 4M9ZA 5TY0A 1G18A 4TL6A 5EZ6B 2P6UA 1WP9A 3U6BA 4P33A 5JWOA 2CK3A 3W6NA 1D9XA 1YE8A 4Q5IA 4P0TA 3Q8XB 1E9BA 4JMPA 3Q5EA 3VTKA 5LDDC 3OESA 2HT6A 2LCFA 5KDLA 3QXCA 3U3JA 1XF9A 1O87A 4E5UA 2QQEA 3R8CA 4RFVA 3K0AA 3UXMA 1TU3A 1XD9A 3EIEA 3LX5A 4LX0A 4NCHA 2ZSDA 4PPGA 2IUUA 1G7SA 3GJ3A 1E79A 2ZRFA 2CLSA 1U98A 1TF2A 4YMVA 4F4CA 1NG9A 2V54A 1S96A 5DNYB 1N2CE 5FBRB 4CZ2A 1JPJA 2VHQA 4OI0A 4EUNA 3FHTA 1DELA 2BMJA 5JS7A 3CZPA 1C9KA 1NBME 2RGNC 4URVR 2DBYA 3LX8A 1CRPA 3LA6A 4TTRA 3TAUA 5KDOA 1R5NA 2WWWA 4OK5A 1NL3A 2GEUA 3NDBB 1S4QA 1E9SA 2ZUCA 4Q4AB 1D9ZA 4CF7A 3DEFA 1P72A 3VR3A 3WBKA 2QMUA 1S0UA 2FV8A 4KODA 1GZSA 1HQYE 2C8VA 3PUVA 1MABB 5EP3A 4JLDA 1XTKA 4WVFA 1OSNA 4RVCA 3REGA 3K0FB 3EC1A 2NO9A 2P5SA 1ZU5A 3EZ2A 1OH6A 2R6DA 5AK0A 5KU1A 4YXWA 1MV5A 5SZJA 4OQFA 4DHEA 5GADl 1KO8A 4FW9A 3I61A 1NN0A 1HUQA 4PSAA 5E3HA 3KTAA 3GFPA 2RHDA 1ZM9A 1CJKC 2IF2A 2C2HA 2F7SA 4ERNA 1KI3A 3IBYA 1E9AA 5SZIA 2WSMA 1NVXQ 3KKOA 3RRZA 4UNRA 2O8FA 2KI5A 2Z4RA 1OJLA 5ELXA 2ZS8A 5KYKA 1XXHB 4QJ5A 4JLJA 2CNWD 2XSZD 5BQ5A 4RD2A 4DCUA 2BCJQ 1AS2A 4PHHA 3QXXA 1E32A 4FMDB 4DLRA 4ACAA 4US1R 1II9A 2WIAA 3BH6A 3IILA 2ZIAA 2OILA 4JBYA 3U61B 3N70A 3PG5A 4XWOA 2GJAA 3DMDA 4JLKA 1UF9A 5HKKA 4DSNA 2VP6A 2QRZA 2EFCB 5GVRA 2QPTA 3K53A 4BE7B 4HB3A 4LI0A 4AIIA 4G3XA 4JL5A 4Q1BA 4OHVA 2XTNA 3BIFA 4Q1DA 1WQ1R 2ECKA 2HCBA 2G88A 3IO3A 3LQQA 2WOJA 1KI7A 2FEMA 3LLMA 3L8YA 4WBSA 1T5IA 3P26A 1TUEA 5KUTA 1G6OA 2XNSA 2ATVA 3SR0A 2AX4A 5AUQA 3U7HB 1VTKA 2FSHA 3CR8A 4PZLA 3R8FA 2IT1A 1AQUA 1AKEA 5FBLB 4K46A 5J47A 3B1VA 4C0BA 2QUZA 4RCZA 4ZI3A 1RE0A 1X8JA 1P61B 4QBGB 4Q03A 1KK3A 1KSFX 4QFMA 4DLTA 4OI2A 1J7KA 1KSGA 3IPXA 3TR0A 1P4SA 1T0HB 1VHLA 4G5QA 3AKCA 2H8KA 1XCPA 2OE2A 3DHWC 3DO6A 4HZUA 3LXRA 1XRJA 2DWQA 1YZLA 3U4QA 2NMVA 1YZKA 1EWQA 4M8NE 4PQYA 4XTRA 5H70A 1WBBA 3GJ8A 4LBVA 5CIQA 4JT2A 1G8YA 3A8TA 1DAFA 1WCV1 1DO0A 1KZ7B 3A1SA 2FFHA 5IK2A 3RC8A 5CK5A 4XOIA 3LWNA 5DGXA 4DSUA 1Q0UA 3QBVA 4G5GA 4NP6A 3W6PA 2UVQA 3QBTA 2A5DA 2JATA 2ZI5A 1G20E 2ORVA 3BD9A 4XD7D 2G1KA 4F38A 5P21A 1DE0A 1UKZA 1RW4A 2FF7A 3T1VA 5EJEA 1ANKA 2R6FA 3CB4A 2B6HA 3VU9A 1KO4A 2J45A 3A4LA 4XH9B 2GBLC 2FSIA 1W4AA 4M9SA 2GAOA 1NP6A 2I3BA 5DI3B 1P6XA 2QA5A 3RHFA 1A1VA 4D6PA 5JBQA 3U7EB 3KDSE 2C04A 4B6EA 2V1XA 1S1CA 2W0SA 1EX7A 3GJ4A 1XZPA 4HEJA 4CEIA 2BJVA 5JCZA 3MCAA 4HATA 3IO5A 2C5LA 2R8RA 4Q4HB 2QBYB 1RRPA 2OCAA 3LV8A 2QMHA 1E9CA 4LJ8A 3QKSB 5G53C 5BXQC 2ZJ5A 1G64A 2BMDA 3ASZA 1HT1E 5FR1A 1SQ5A 1YZQA 4D0NA 5B64A 3FMFA 4Q7LA 2QAGA 4RSGA 1US8B 1IN7A 1GWNA 2JGNA 2ZQ5A 1Z0FA 3MLEA 4HB0A 1NKSA 2HF9A 2QTVB 3NBYC 4B3FX 1RZ3A 3BAFA 2OBMA 1VCOA 3RLFA 1MOZA 5TB5A 2PEYA 2JLXA 3MMPA 2ZROA 2CBZA 3BE4A 3QEJA 1UJ2A 4QOSA 4QNRA 2QG6A 1G8FA 3A1WA 3GLHB 1XTQA 2KB0A 4TLAA 3SE0A 2UZ3A 2GEDA 1VMAA 2IHBA 2WWHA 3GP8A 2CJWA 3KX2A 3SDZA 3GJ5A 3WHLA 2C77A 3R9IA 3SJZA 1CJTC 1TTTA 4FD2A 1CJMA 4BASA 4DJTA 2GILA 5J4YA 5L8VA 4L9SA 5KSPA 2GJSA 1L7VC 1W5TA 5JWHA 3PIRA 1G4UR 4HAYA 2BHRA 4B76A 1X86B 4DIDA 4Q02A 4XSGA 5JWRA 2IW3A 1N6IA 3LAWA 4KHZA 5JRJA 2IYXA 4BFTA 1JEDA 5D3MB 3AVWA 1N6RA 1W36B 3VQTA 4L4UA 2F1HA 1IN4A 1F60A 4TL7A 1VCNA 2XTMA 1JJ7A 1OFTA 2RGAA 1M2OB 3S1AA 3R9WA 3LVRE 3GLGB 2GXSA 3KFVA 1XTJA 2FU5C 4X8OA 1FNMA 2QGNA 1TQ2A 1CJUC 3M0EA 1ZC3A 4NZYA 4B3XA 1UKVY 3H1TA 5G3YA 1W36D 1A2KC 2ZRHA 1GOTA 3QY0A 2W6JD 1XMIA 1ZM4A 5GJVC 5AUPB 2IYRA 2O52A 5GVSA 4PQRA 1LY1A 2B8TA 5JMTA 2DYKA 3WMFA 3EPHA 4YXWD 4JT4A 3CPEA 4DXAA 3SJBA 2NO0A 4NHOA 2AK2A 3P1JA 4LHXA 3FWYA 1G8HA 1T6NA 4IEEA 2J46A 4O25A 2ZYTX 3PUZA 4CT4B 4EJSB 1F2TB 3OAAD 2QN6A 3CX7A 2P3SA 2WVJA 3C15C 3TQFA 4PPFA 4EQ6A 4BLOA 1RIFA 1YJ5A 4RD6A 4UKDA 3RANA 1KJWA 4TMWA 3D7MA 2YOFA 3V4RA 4YC7A 2YC4C 4P3YA 1A82A 2XITA 3KB1A 5JEDA 1DO2A 2Q21A 4RCYA 4TLEA 4DEXA 4AYTA 3EZFA 3GPLA 3TRFA 5KNCA 4B3GA 5J4KA 2XAUA 2ANBA 1DAGA 1U90A 1W0JA 2J7PD 4P4SB 3UK6A 4QM6A 5EE5B 1D5CA 3A1VA 4RFSA 2JCSA 3K1JA 5JCPA 4B35A 2ZVPX 2WAYA 2GCOB 4AURA 2GKSA 4RKFA 1W2GA 3O8DA 1OLOA 2GETA 1YZUA 2ZSBA 4A15A 3QPUA 5AJYA 1GDDA 2Q9AA 1N6LA 3M4YA 1L8QA 3RYTC 1KSHA 1XCGB 2ZE7A 2ZJAA 3F0TA 3RC3A 2IEZA 4TYWA 2AWNA 2ZRNA 3C8UA 4D4KA 3QUSA 4OK6A 1NMXA 2AXNA 2RGEA 4HAXA 1T3LA 4QXAA 2JLQA 3EC2A 4DLUA 2DWOA 4R7ZA 5FUWA 3R7WB 4MA4A 2QTFA 2FX3A 3PUXA 4UJ3A 3T5GA 1XEFA 2XTZA 1XEXB 3K9GA 1SKYE 2C9CA 2N42A 4JYCA 2O8CA 1ZCAA 4EPTA 4C2UA 5TV2A 3C16C 3GLIE 3CF0A 1N6HA 5FBQB 4P31A 1ZJ6A 4HDCA 1GRNA 2XEXA 5DLQC 3L0PA 1E6CA 3IIMA 4H9GA 2FOLA 2E1RA 2XGJA 3CW2A 3DM9B 3BK7A 3VHXA 1KAGA 1KYIA 2QMEA 2XB4A 4ASUA 1U0HC 2RHMA 2ZR7A 4B2LA 4CEJA 1Z28A 4PAOA 4LJ4A 2WAXA 4LJ5A 1LF0A 3AF0A 4PR0A 4URXR 1TEVA 1DS6A 2ZRIA 3NEJA 3MGCA 4LHWA 2IBMA 4CDGA 3RVBA 3X1XA 4N3NA 3SZRA 1W7AA 2V7QA 3KQUA 1NY6A 1WB9A 5FBWB 2G3YA 1JR6A 1H8EA 1E2KA 3AH8A 3CWZA 3B1XA 2DY1A 1GG2A 4URYR 3TR5A 5K8LA 4P4UA 4KVGA 4M9XA 2QAGB 4DUGA 4HUQB 2QORA 4OYHA 5CB6A 2N1BA 4B32A 1TADA 3RSLA 1OYWA 2A7QA 4GP6A 1VECA 4JZKA 2BJWA 3MJRA 1NF3A 1W0KA 3PUYA 3E70C 3K70C 1A5TA 2ZAMA 1JXOA 1C4OA 2A78A 3FMPB 2HLDA 3ZD6A 1KO5A 3IEVA 1QDEA 3OIWA 1KMQA 4UXIA 4ESHA 2FFAA 4MRSA 2PCJA 4QHSA 2N46A 2UZIR 2KJQA 2IXGA 5KPJA 3KXKA 1XEWX 4A0HA 4OI1A 2VSOA 2Y8EA 3QOFA 4GMXA 1W4BA 4DT1A 4KFSA 4E22A 1OB2A 3FPAA 1GNPA 1DTSA 1XWIA 3NBXX 3FKQA 5HCNA 4A2QA 3VX3A 3THWA 3DZDA 1DARA 4YDHB 4LV8B 1VG1A 2QTHA 1HT2E 2NOAA 3PITA 1MT0A 3ZVMA 4MDEA 1TPZA 4MKFA 4MUAA 3X1WA 1OFUX 3FOZA 1NMYA 4HSEA 3REFA 2B7CA 4Q4LA 5HPYB 3AM1A 1DAEA 3VHLB 1GITA 1IXZA 1FTNA 4LRWA 3RRMA 3KJEA 3BB3A 2ZM5A 4I1SA 2GF0A 1KY2A 1QHHA 2PMKA 3I8SA 2YOHA 1NLZA 1Z5ZA 4YMWA 2J0SA 3LNCA 1YR7A 1WA5A 2ZI3A 3EASA 2O0KA 2G77B 1IY2A 1XEXA 2NG1A 521PA 3SBDA 2CVFA 4JSYA 1X8LA 2WJVA 3LBHA 1YZNA 3TGPA 1SVWA 3H4MA 1NIJA 4TMVA 2Z4SA 3T34A 1N5KA 1O3YA 1N6PA 5K8TA 1KNXA 1XJCA 2YWFA 2HT1A 2J59A 3MD0A 3EIQA 4KYIB 3RS5A 3UMFA 2F1RA 4MQBA 5C4GB 5KOYA 3BJIC 3OZXA 1F2UB 3MWLA 1JQLB 1PLKA 4B33A 1OIXA 3BOSA 1HA3A 3LW7A 2EQBA 1JR3D 3IUYA 1Z08A 2IL1A 5B58C 2Z83A 1EFHA 4HUTA 2I1VB 2GZDA 2IUTA 1S9DA 3BB1A 4PFSA 5TARA 2V6JA 4NL4H 2EWWA 1AZTA 3RRYA 2JA1A 1CBUA 4EKDA 4C7OB 3CF6R 1NN5A 2JLYA 2YWGA 4JYBA 4RJLA 1FMJA 2MMCA 4FCVA 4LDJA 3AVVA 4KU4A 3IEUA 4OHXA 4PHTA 3PEYA 4TZ6A 2ONKA 2W2XA 3QXHA 4WZBE 1ZD1A 2PT7A 4NTZA 2DCUA 4FN5A 2JJ8A 3TAHA 2GVZC 5FL7D 4A8JC 3BB4A 1UKYA 3PFIA 4NYIR 5CYPA 3C4JA 2W6IA 5KDDA 3EX7C 3X2SA 3TSWA 1AGRA 1VG8A 2VIIA 2XZPA 4ZDIA 1ZUNB 3VNUA 2FGKA 1KDRA 2ZREA 3Q7QA 1NVVR 3KJHA 2WMNB 1DOAA 1H65A 4W5HA 4D25A 4GI7A 2QSZA 2O0HA 2TMKA 3NXSA 4Q19A 4C0HA 2F9MA 2O8EA 4R9UC 3F5FA 4CRWB 3T12A 1G7TA 3QKUA 1P2SA 2BOVA 2ZR9A 3GLHE 2VF8A 5HZKA 3TSZA 2RCNA 1COWA 5TXGA 3QKTA 4ZDJA 3ZVRA 1Y63A 2ZI4A 5J40A 1WBDA 3IBGA 4F93B 1PJRA 3WRXC 1ZD9A 1RFLA 4XVQA 1UBCA 1XD8A 2A2ZA 4P4TA 4A4DA 1Z29A 2VTKA 1E69A 4JJZA 4V0KA 1Q57A 3MUFA 1I4DD 4LBWA 2DB3A 2PT5A 2WMOB 3CM0A 5EE0A 3VKHA 5FUYA 2IS2A 3AP3A 4HYYA 1Q44A 2QI9C 4DDWA 1T91A 5FH9A 5BW8A 3WYAA 2HYDA 4HDOB 4C0AC 2BC9A 2ZRMA 2IEYA 2WIBA 3TUIC 4KAXA 2QL6A 2OSBA 4I1VA 4WAUA 3A6PC 2QPAA 3DM5A 5BWMA 2CVHA 3RSOA 3TBKA 1T4GA 3HWSA 1WMSA 4F4IA 4GPTA 5JI2E 3K0SA 3C5HA 5AR1A 5UKDA 2Q0HA 4ESVA 4PPNA 5FOTA 4ZKDA 4RZ3A 4TZ0A 3B1ZA 1ZUHA 2FMXA 1C1YA 4NYMQ 4B34A 4JKYA 3P4YA 2GDJA 2VHUA 5KO2A 1EGAA 1JR3A 3NC1C 4G5SA 1QF9A 3JVVA 5E95A 3SNHA 2AKAB 1II0A 1XFAA 3BFKA 1DAKA 2RH5A 3NVAA 1V43A 2OT3B 1AA9A 3KFXA 3NC0C 4IOJA 2ZUDA 4B48A 5F9HA 3ZQ6A 5F2EA 5DHAA 3THXB 1T3SA 3UANA 4A6XA 2FPMA 1YZGA 2CHQA 1VYVA 2V4ZA 2O0JA 2IYLD 1J99A 3AKDA 4PAQA 5CB8A 1FW6A 2QMOA 1WE2A 3QVVA 4DSTA 1KK0A 2Q3FA 1XX6A 3KJIA 4ITRC 1HH4A 4W9MC 3AVUA 1MKYA 2HEIA 3B2EA 3B8HA 4A8JB 4B73A 3NHBA 3VMFA 1TQ4A 3UMRA 3PCRB 4RD1A 5BYJA 3TQCA 2WZQA 3TSOA 4HAZA 1X1RA 2GXQA 2JAQA 1U0JA 4MRVA 1G6HA 1VIAA 2QGZA 1Q20A 2JIZD 2DHRA 4MKHA 3N2IA 3HU3A 4B47A 1ZUIA 4X8LA 1CIPA 1TNDA 2OCPA 1U94A 1E0KA 3RWMB 3CR7A 4CW7A 1GUAA 1P2TA 2ZJOA 3V00A 3AVPA 3FKSA 2DWPA 3ND8A 3AF4A 3AVYA 3O47A 1Z2CA 4I99A 4K81B 1YQTA 2J0VA 4PC2A 1SKQA 2XXAB 4QRHA 3SN6A 1SGWA 3PQCA 1P73A 2QPOA 1W46A 3DL0A 1QVRA 3MWKA 3U44A 421PA 4TYNA 3EWAA 4TWZA 1KOFA 5J5CA 2ODEA 3LO5A 4CYMA 1XZQA 5DISB 3U3KA 4Q4AA 5LD2B 4IDNA 1LV7A 3AUXA 1PUIA 1EFTA 1L4YA 2WWGA 4A0RA 5FL7A 5IF9A 4E03A 4TYPA 4EFMA 5BN3A 2V3CC 2YWHA 2V55B 2BVNA 2ATXA 4KJZA 1N5LA 3JZAA 3OE7A 4MYCA 2RMKA 1H8ED 2VSXA 3I8XA 4O2LA 1R2QA 2BIFA 2L0XA 2B21A 5C46F 4TMZA 1HE8B 2R6AA 5AWFC 3AV0B 4AKIA 1G7RA 4ZDKA 1KMHA 4AKGA 3EWSA 4Q9IA 3EPKA 2VO1A 4B6FA 2OHFA 1Z22A 4PHGA 1G21E 4QBFA 2E9SA 3E1SA 5JJIA 3EZ6A 1GRRA 4G01B 4XWKA 4I1OA 2QM7A 3FFAA 4WXPA 1U8ZA 2A5YB 3O8BA 5EE3A 2Q3MA 2IF0A 3LY5A 4B2PA 3T35A 5E7JA 3LVQE 3BWDD 4UJ5A 4D2IA 2C78A 3FMIA 4Y0VA 3GJ7A 4XSHA 4ABYA 3QXSA 2JLWA 1FQKA 2GK6A 3Q85A 4PO1A 3ZVLA 1JB1A 1MO5A 2AN9A 1PZNA 3MJHA 1XMJA 4DZZA 1GP2A 3KKNA 4GOJA 4DDVA 2WPDD 1KKMA 1GNRA 5FTLA 3FB4A 1G7CA 1ZIPA 2ODWA 4FWIB 3KQKA 1XJ0A 3UG6A 4PSKA 3T1OA 4DIEA 2F3RA 1ESMA 3THYB 1TQDA 1SHKA 2RGBA 2WHXA 4FCWA 2P67A 3IKJA 4Q00A 1IXSB 3GJ6A 1E96A 3IDQA 3U2QA 1M7GA 3QKSA 4BUJA 2ERXA 3I62A 4Q1AA 2G9NA 4V0LA 3W3AA 4NCKA 3PEUA 4MITA 3SJCA 2ZE8A 2G83A 2JIZA 1VCMA 5F98A 2H16A 4ZO4A 1Y3AA 2RB4A 3PEVA 4QGGA 1NKTA 1T0JB 4PSVA 5KNDA 2Q6TA 1XU4A 1X6VA 3Q3JB 4NYJR 4D81A 2AWOA 2RGDA 1E1RA 1DAHA 2HV8A 2VEDA 3GQBA 5FFMA 5JI3E 1ZMXA 3R7WA 1NNEA 3BGWA 4YMTA 4RZXA 1IN5A 2R9VA 3CRQA 5CLQA 3GLGE 2D7CA 4UQOA 1OB5A 1IM2A 1OXSC 1Z0JA 3FHCB 1VHTA 1FX0A 2JASA 3I5YA 1LS6A 5FPSA 5DIFA 3AGQA 4KXFB 4JLPA 5SZKB 4D0LB 1LFDB 2ZJBA 2GZHA 1IN6A 2ZRPA 1HTWA 3E5HA 5CIWA 5EUMA 4W7SA 3EA0A 3MSXA 5L3VA 3ADBA 3RWOA 4DEYA 3EZ9A 2R2AA 2WJHA 3SS8A 1OXUA 2FDCA 4NCIA 1ONBA 4NKRA 1AKYA 2ZRDA 1PV4A 2J7KA 3OEHA 4LV6A 2YVUA 1BOFA 3UPUA 1I4TD 1MABA 2VA8A 1OH5A 1E2LA 1UFQA 3BERA 3GFOA 2FH5B 5E7IA 3VU9B 4N0DA 1IQPA 3W3ZB 5JSZA 1KMHB 4QGHA 3U7GA 1G41A 5L3SB 1UEIA 2GAAA 2ZE6A 5HKKD 2A30A 1ZIOA 2PJZA 4F7WA 2BCGY 3AQ4A 5FI1B 1Q3HA 4U00A 1ZW6A 2OBLA 4IDPA 1N5JA 2GTPA 2ZETA 4M2LA 3S1AB 1ZNXA 2A9KA 1UBFA 3CWQA 5EP2A 4BRWA 4H1UA 4M22A 2NO7A 2O8BB 2FFQA 2JDIA 2ZJZA 1D2NA 3GLFA 1E2GA 1P2UA 4NYMR 1NG1A 3HYRA 3U3OA 1AN0A 1TMKA 3KL4A 2ZS7A 1AZSC 1JECA 2I1QA 3BH0A 6Q21A 2JJ2A 2PEZA 1N6NA 1COWD 1P60A 1YU9A 1IXRC 2IHYA 1RRFA 2R62A 3JZMA 2BDTA 2WM9B 3OEHD 1T8UA 1A2BA 4XIGS 2ZU0C 4TL8A 1UBEA 1EESA 4UNSA 4MDFA 4U5XA 1GILA 1JALA 4GL2A 3KQNA 2ODNA 4TLBA 5IHPA 3FYHA 3B85A 2J0UB 1ZCBA 3HR7A 2DFNA 4BRUA 1BKDR 2GZAA 2WJJA 3G0HA 2OEPA 2DFTA 2ZAOA 1DG1G 2F43A 2C95A 2GESA 3MAAC 1ZNYA 2OXRA 1Z2AA 4KFUA 5EXXA 4O0MA 4I1UA 3IPYA 2B8WA 2WSSD 1ETUA 1KJZA 2CJWB 1VYTA 4C30A 4MUBA 1KGDA 1OHHD 4S2EA 1W36C 3ICEA 1ZM3A 3OHMA 2HF8A 4M21A 3DOEA 3NTUA 2OAP1 4FMDF 2C9OA 3KUDA 1NRJB 3SHFA 1NSFA 4DCTA 4HB2A 5FI0B 4GP7A 1E2PA 1G3UA 1QBKC 4MGYR 2QP3A 1M34E 3SJAA 2GCPA 1NVUQ 3A4NA 2WJIA 4IRUB 2D2EA 2W2VA 2YNMA 3K9LA 3OAAA 5AUNB 4JVLA 2LKDA 1CTQA 1IY0A 2H17A 3AF1A 2AK3A 4NCJA 2H92A 1R4AA 3HP1A 3QXJA 1WRBA 3VAAA 4URZR 4B74A 3CX6A 4TLDA 1SVLA 3GEEA 1R7RA 1TAGA 1UADA 3M1IA 2XNDA 4S35A 5HE9A 1DADA 3ASYA 4MGKR 3GLGA 1SVKA 2EW1A 3BORA 4LJYA 2GRJA 2WJGA 1GRQA 4TQ9A 4FMBB 1QG4A 2Z5FA 4W5WA 2CK3D 1FPMA 1Q1QA 3TVTA 3AUYA 4TN1A 1G4AE 3VFDA 1RRGA 4IOKA 4GOXA 5AJXA 4EPVA 2G0TA 3LLUA 1GFIA 2FG5A 1D6JA 1P9NA 2H57A 3K8YA 4Q47A 4NCNA 2P6RA 1AGPA 2Z43A 3HYTA 4JBXA 3HU2A 1BH2A 1WXQA 1YR9A 1Z06A 2JJ1D 4BFZA 1YHNA 3QSYA 2WOOA 4V0ME 3C5CA 1U0LA 5GJWC 3B13B 1KDOA 4TSFD 1NBMA 3HJNA 4Q48A 1XP8A 2JLRA 1TF7A 2DPXA 3IQXA 2BMEA 5IK2D 4JL8A 1SXJB 4Q1FA 3PEWA 4D82A 2RKOA 2IWHA 3CUEF 4MYTA 2AD5A 2BMFA 2AXPA 2CDNA 3AVXA 2ZR0A 1XPUA 1HY3A 1GL6A 1K8RA 3KKPA 1CJVC 4NH0A 4QNMA 2NPFA 2ZRGA 1CR1A 3RNLA 4NBSA 4NYIQ 2OFWA 4LV5B 5BN4A 3PENA 1I2MA 2F3TA 4NU0A 1GKYA 4Q4HA 2SHKA 3CH4B 1VG9B 2W58A 4JLNA 4WOPA 2D2FA 1FOEB 1EWRA 1FUUA 1II8B 2GCOA 4ZPXA 2JLSA 4PQFA 1OXVA 1Q1EA 2EU8A 3NDPA 1W0KD 2YWEA 4TTQA 4BLSA 1S8FA 1G5RA 1N6OA 3BC1A 4X8MA 4Y0AA 4LJ7A 4Q9JA 4MH0R 4LY6A 4JLAA 3EA5A 4M4SA 4DUGD 3U7FB 1M74A 4YMSA 4GZMA 1XTIA 1WDTA 2YV5A 2AKYA 4DDTA 2W83A 1JAHA 1JQJC 4R2HA 1RVDA 4XWAA 4AG6A 2HXYA 3I5XA 4JSTA 2YINC 1U81A 3B7GA 3TW8B 2ZYVX 5JJKA 4AYWA 1DAMA 1XTRA 621PA 3UWOA 1GSIA 4JLMA 2WJYA 3TUZC 3ZH9B 4JL6A 3TNFA 1CS4C 4L9WA 1K5DA 3DOFA 1CXZA 2H7VA 3Q9LA 1G8GA 2VL7A 2PL3A 4E09A 4DWJA 3MRSA 4LBYA 2A5GA 2VBCA 1AM4D 1IHUA 3J81k 1JEEA 2MSCB 1FP6A 2W0MA 3ETLA 3W6OA 3GLIA 4LHVA 4C9BA 4BFUA 4FI3C 1OIWA 1U8AA 4IDQA 4Q7JB 8OHMA 2VPPA 5F3WB 1Z6TA 1JBKA 5EE9A 4AKHA 4BGDA 2WKQA 3GCGA 4JIMA 2XX3A 5LPNA 2EFEB 5D3MA 5E7MA 3THXA 3H0KA 4C0JA 3U5ZB 2OV2A 5EXTA 3AVTA 1XDBA 4IVQA 4NMMA 4C2TA 3T61A 3ZIAA 1G17A 1F2UA 4KFRA 2D4HA 2FJUA 2ZI9A 4TL9A 5KSZA 3TKLA 2CCJA 4V0OA 5F9FA 5FOSA 1E4VA 4D4JA 2QENA 3KUCA 4A8JA 4HUQA 1I2DA 1E94E 1AS3A 2DFLA 3F3YA 3C7KA 2CE2X 3PV0A 2ERYA 3WHKA 1KI6B 3ZZUA 2CCGA 4AWXA 2CLCX 4JJKA 3QF7A 1IONA 1E2DA 2IS4A 2GVDC 1NJFA 2ZSFA 1RRCA 1UEJA 1YR8A 2NO6A 3R20A 3SC3A 4F92B 1OFIA 2X1VA 5CLLA 4K8OA 3NH6A 2FFBA 1MO3A 1CULC 4LJ9A 3TMKA 3CRVA 2HYIC 1Z0IA 4Q18A 1KDTA 3THYA 4RKEA 2WKRA 2ZYWX 3CNNA 4C0KA 4PX9A 3AEZA 2ZXUA 2QU8A 2WWXA 2R65A 4NE2A 2CL7X 1TEXA 2FPLA 1G291 1W4RA 4IKEA 4PAMA 3BXZA 3SBEA 2A5JA 2REXB 3LFUA 2K5UA 4TQUS 4Q9KA 2IYQA 4DBLC 3PXGA 3TLXA 5C1BA 3MG9A 2OLJA 3SOPA 1SHZA 2GJ9A 2IA5A 3VR5A 3WXMA 3FGNA 4QJ3A 5A4JA 4US2R 1JPNA 1IBRA 1E1QA 5K8UA 4Q01A 1FP7A 1RYFA 1LS1A 4KSBA 1XMVA 4ZIRB 1T5LA 3PR1A 1XPOA 2ZU6A 3DDCA 3TE6A 1JXMA 1E0SA 1UAAA 4B3DA 1P7CA 4A92A 3D3QA 1F3OA 2OCYC 3LQRA 2YHSA 1NIPA 2EYUA 1RPZA 3THOA 3C41J 1W49A 4IXMA 3KXLA 4GMDA 5FPTA 1LF5A 1X3SA 2C98A 2OUKA 2VP0A 4BWYA 1QHYA 3SHWA 3BS4A 4BFVA 4C0QC 2PMDA 1QRAA 1KI4A 4OHZA 4NDZA 1GL7A 4NONA 1UM8A 1NMZA 4RD0A 2O8CB 2OO7A 4KLNA 4UNNA 3CNOA 1N5IA 1W1WA 2EFDB 3W9YA 4A0FA 2R6GA 3LBNA 4LBZA 2ORWA 2PX3A 2MSEB 5FPYA 4LUCA 1SZPA 3U6KA 2FSGA 4JVNA 2LKCA 3RRNA 2D06A 3ZGXA 2PLFA 4HI0E 2PBRA 2F6RA 4Q66C 3KZ1E 5DO9A 3FDIA 2G0NA 4AI6A 1ZNWA 2OZEA 3OEEA 5A0FA 3VR6A 1OT3A 1ZC4A 1J8YF 5HR5A 3I4LA 4OQXA 3L2OB 4PC3A 1KK1A 3V9PA 1KNQA 3NIBA 3ZLJA 3X1YA 3QNUA 2VF7A 2ODBA 4MKGA 3QQ5A 3MFYA 1BS1A 4J0QA 4LHYA 4CGZA 1W4CA 1KI2A 1G9XA 4BZPA 5KHOC 1HURA 1YZTA 2PH1A 4GSYA 1QHNA 4Z1MA 1GKIA 4AK9A 4BLRA 5JJLA 1CP2A 4C0LA 2BWJA 1FMLA 2W2TA 1MO6A 5KSYA 4A2WA 1B0UA 1OV4A 1OXTA 1E1RD 3CLVA 4D0GA 4G0NA 4A9AA 4HAWA 2QM8A 3GMTA 4DC9A 5GJCA 2GCNA 1KJYA 1YRAA 1Q3TA 3QJYA 4L8GA 2Q9CA 1IJFA 2FPKA 2O8DB 2GXAA 5HZHA 4LYFA 4BLQA 4EFLA 2ZRAA 4BQSA 1XCMA 4IVPA 1IY1A 1U9IC 4TYQA 4GDFA 3T5DA 4GOKA 4HDQB 4QC2A 2CL6X 2XXAA 1NN1A 4TT3D 5HCIA 2NQ2C 2F9LA 2D7DA 1W44A 2QP4A 4A1FA 4IEIA 221PA 1XXHE 4AC9A 5L3QA 2EWVA 4ZIRA 1N6KA 2FGJA 3V4FA 5CITA 4IFBA 3K0FA 1R0ZA 3GFTA 4G1UC 3VR1A 4O3MA 5IDVA 2DR3A 3RS3A 3K0EA 3NEYA 3A1TA 3N5CA 5G41A 3WP1B 2GJ8A 3AGPA 2WTUA 1Z0AA 4LOAA 2X2FA 4BFXA 2V8OA 2GA8A 2B92A 2X19A 2HLDD 1A4RA 2BBWA 2VQSA 2ZRKA 4R2IA 3X1ZA 2GHIA 3CRW1 4GBMA 1ZU4A 2NIPA 4M1SA 1GVNB 3ZQJA 3AVQA 2NGRA 3CBQA 1OKKD 2C03A 4PO9A 4A82A 1N0WA 4OHWA 1SULA 3ADKA 1NY5A 2E87A 1AQYA 1P62B 1VCIA 2QE7D 3ZD7A 4CEJB 4FMCF 5FL3A 4GZLA 4NPHA 2JLUA 4FCTA 1ZYUA 1E3MA 1NVWQ 2RGGA 1R0XA 3GLFB 3R9XA 4OBEA 1KI6A 4HLUC 2RGNA 1E9RA 2ZVQX 3K9HA 5GJBA 1KZGB 5IT5A 3NBFA 4TLCA 4LC1A 4B3BA 121PA 3OE7D 2FN4A 4AG5A 1J90A 4URWR 1ZNZA 3D6TB 1GKUB 4DCVA 2D62A 3WP0A 3L8ZA 3TIFA 4ASUD 1MO4A 3KKMA 1AJEA 1ZAKA 1CU1A 5FOWA 2CXXA 2VYFA 1KSJA 1JNYA 4N1AA 2QBYA 3IGFA 1NLYA 3F8TA 5B30A 4U02A 2W00A 4C7OA 2G6BA 2OBNA 2J0UA 3M6AA 1K6MA 4Z8YA 5JLJA 1N0UA 1X1SA 4R98A 3QF4A 3AKYA 3RDPA 5HTKA 3L0OA 1MR3F 4G5OA 3CRMA 3VNVA 2FEOA 2VP9A 2P2LA 3QPWA 1VYUA 1KKLA 4TMKA 3JVUA 4OQNA 1IN8A 3K09C 1FQJA 3O8RA 3K9NA 3ICQB 4DT1B 1KY3A 2HUPA 2J1LA 1W2HA 2OLKA 4HZIA 1G5PA 3G5UA 4TTPA 3GJXC 1CKEA 2OFOA 2NPIA 1G3MA 4RY2A 2O8DA 4I81A 5CM9C 2JEOA 4WIAA 1KO7A 4IDOA 3LRPA 4BLTA 4MRPA 4KFTA 3EZ7A 4DCSA 4AD8A 4A6PA 1U9IA 2HJGA 3WYFA 4RD4A 2ONJA 3L0IB 2DFKB 1QHXA 2YC2C 2QAJA 3A4MA 1NJGA 1A7JA 1Q22A 3KKQA 1E2EA 4YONB 2J87A 4LCBA 2C96A 2FE4A 3W5JA 1HV8A 4ZCIA 3NHAA 1M7HA 3BBPA 2PZEA 3FVQA 1BO6A 5BN5A 3GEHA 3ADCA 3BFXA 5CYOA 3KJGA 2C9YA 3FMOB 2IWRA 2BM1A 3B60A 4FXPA 4KSCA 3RS2A 3WRYC 2QE7A 4MYUA 4IOLA 2ZRJA 1NBMD 3VKGA 2FZ4A 2OXCA 4DB4A 1ZBDA 3H84A 3NWJA 4QBHA 1E2MA 5DE3A 2BKUA 2JJ1A 4CEHA 4DLSA 4KVAA 1SKYB 4LK2A 3PUWA 3PVSA 1ZP6A 3P20A 3IIKA 5SZHB 5CDFE 5D3QA 3L43A 1J8MF 4WXRA 3OIUA 1IAQA 4HLUA 1KHTA 2WWIA 4B71A 2PZFA 3ADDA 1N0VC 1LB1B 2W6JA 5JFGA 2AL7A 5A5GA 2O8FB 4B3CA 1E99A 2IXFA 4MGIR 4EIWA 1SXJA 4QJ4A 2GF9A 1GIAA 3O8CA 4BLPA 4Q1CA 1AIPA 2ZJYA 2AFIE 2QEQA 3EAQA 5B2ZA 5EQTA 2O8BA 1RYHA 1FZQA 5G40A 1XJQA 4PXAA 1H8HD 2IXEA 4UXHA 4QGFA 3K70D 3WYGA 1E79D 1E0AA 2ZRLA 1ZRHA 1KI9A 1TQ6A 1II8A 1QHSA 1Z0DA 3L0SA 2RAPA 3WNBA 2A5FA 4PC6A 1Z3IX 1FFHA 2ZS9A 4LHZA 2QAGC 1CR4A 1RJ9A 3CKLA 2AD1A 3GLHA 4LZZA 2O8EB 4P4SA 3WMGA 4JLOA 4BFSA 1L2TA 1R0YA 1W48A 5H68A 4MYHA 2QT0A 4DRZA 3GD7A 2QRNA 1NN3A 1QHGA 4Q4JA 2VH5R 2CHVA 3OIYA 5C18A 2Q9BA 1J2JA 3WMEA 2V1UA 3UIEA 4HB4A 5C2JB 2IX3A 1CEEA 2KE5A 5EXSA 5EZ5A 1Z6YA 1YVDA 3ND9A 3GLFE 3VX4A 3U3RA 1T9HA 2GJKA 2O5VA 2W6ID 3KXIA 4KLZA 3SYNA 1ELOA 3SI7A 3W34A 4DB2A 2ZRBA 3QE0A 2GXUA 2X2EA 4HAVA 2YJTD 4WA7A 2QNRA 1TUIA 4UNQA 4ZDWA 1SVSA 1YRBA 1CR0A 4HZUB 4QHTA 3UKDA 1Z47A 1UDWA 1ESNA 1NLFA 4U7DA 3AVOA 3LW8A 4POAA 3SYKA 3ZZ0A 2R6CA 3C14C 1EFRA 4ACBA 4BEJA 2JJ2D 3H2YA 3I72A 3SEAA 2BV3A 4PHFA 3CNLA 4N0EA 3KTAB 2QP9X 1G5TA 1R0WA 3K70B 5CM8B 4ZCLA 1LVGA 1Q21A 1P9WA 3P32A 1F5NA 2WV9A 3T15A 4ARZA 2MSDB 1EG7A 1E2NA 1EX6A 5JHHB 2FZLA 3ZYCA 3SQWA 1CLUA 3EG5A 3A58B 4DLXA 5LB4A 1ZD8A 1PUJA 4HLDA 4IOMA 3QENA 1SXJD 1ODFA 3BRWD 4OI4A 2IS1A 5H1YA 1PVOA 4II7A 4JVMA 1EFUA 4EQ6B 2C99A 2ORIA 3HDTA 4D80A 4B2IA 1Z6XA 1LW7A 5FTMA 4OKSA 1SXJC 1DAIA 1VG0B 2CEAA 4WW0A 3QF4B 5FOVA 4IJMA 5KSOA 2MMGA 3D31A 1UPTA 1E2QA 1GL9B 4CEIB 4EPWA 5FUXA 4XTCS 1CF4A 1S3GA 1RC8A 3B82A 5TMPA 1YKSA 4RFSB 4NYJQ 1Q1ZA 1VKJA 1E2FA 4V02A 4KV9A 2IYUA 1Q1BA 5FR2A 1CR2A 4LSGA 5DI9A 4YMUA 1TF5A 3EW9A 3CO5A 3WNDA 4DLVA 2AHOA 4KBFA 2ZTSA 3HU1A 4URUR 4M1OA 4IFEA 5G3ZA 3TUJC 4D4LA 4TYYA 1GAJA 4EPRA 1M1YE 4FIDA 1R6BX 3A37A 3DZ8A 5HE8A 1KAOA 3K0CC 2YYZA 1LTQA 5AUOB 3WNCA 3B5JA 3RS7A 4DLWA 5FPKA 4XVUA 5L3RA 4MGZR 1Z6GA 2RGXA 4MRNA 4XJXA 2EYQA 1YR6A 2FA9A 2YOGA 2Z6VA 5FTNA 1D2MA 4PANA 3SFVA 3FHOA 1M6NA 4D26A 3QG1A 4LYHA 5DHFA 2CMKA 1HQCA 2PX0A 4E07A 5EXPA 3NBZC 3ZJYA 4LYAA 3B9QA 2BKEA 4F4JA 1OW3B 1QHHB 4IHQA 2X8AA 4M1TA 4IXNA 1CRQA 1S1MA 4QHYA 2OESA 4UXJA 1E2JA 3RAPR 2V7QD 2PZGA 5E4FA 4PZZA 4FWTA 4L16A 1ZM7A 1BYUA 2YKGA 1N3BA 1I4LD 1FTSA 4Q7MB 5JS8A 3IHWA 3HPQA 3RS4A 2FWRA 1R5BA 3DKPA 2FNAA 1HE1C 3CZQA 3QG5A 4JLVA 5DYGA 4GFDA 1V5WA 3B9PA 3KQLA 2WICA 4R71A 1KDPA 3ZVNA 3B78A 1XMSA 1G3IA 4V03A 4BEBA 2XOKA 3SQXA 2P65A 1WF3A 1UBGA 2H1LA 1FNNA 3DMNA 1TX4B 3U3MA 4DKXA 5J4LA 3CF2A 2PLRA 2NTYC 3W8RA 2ZE5A 3DKVA 5L3SA 4X8HA 3VKWA 3MWJA 3Q72A 4ON9A 1W5SA 2ZRCA 3CPJB 3RABA 4B44A 2J0QA 2A3RA 1EFCA 1XD2B 3RS0A 3P27A 3Q7PA 4OJKA 1R5OA 1U8YA 1QG2A 1R10A 5EP4A 5H8WA 2ZI6A 1VPLA 4AYXA 1E2IA 1RJ9B 5KNBA 2IYYA 1LNZA 1GTVA 4C0SA 4LJ6A 2XB2A 4RZ2A 3OF5A 1TU4A 2P5TB 1G8PA 4BPBA 4M0LA 4TMTA 3ZZTA 4M1KA 3WBJA 1OYYA 2ZUBA 4Q1EA 1P3JA 2IUSA 1XPRA 1ZVQA 4DSOA 3CRRA 4L5BA 2VLIA 1T3HA 2XZOA 5FTKA 3LD9A 4IW3B 1K5GA 1W0JD 1XTSA 2J7PA 3K0CA 1NSTA 4A36A 3B6EA 4LYJA 1U99A 3CIOA 2IYZA 3LH5A 3AF2A 3FKSD 1OH7A 2F43B 1XBTA 5C4MA 2PJRA 3H86A 2J5XA 2D74A 2IYVA 1E9FA 4ZKEA 4BECA 3WY9A 5LB2A 4DVGA 2KWIA 1E2HA 3IQWA 2OFXA 1M7BA 3CONA 3P4XA 2CL0X 2QROA 5BYKA 4IVRA 2J9RA 1Z07A 2Z0MA 3TVDA 3IHLA 2PCLA 2VHCA 1H8HA 3UATA 4UNPA 3NH9A 1E9DA 3LDAA 5J4VA 3GLIB 1NI3A 2BBTA 4C3ZA 2VRWA 2WWFA 3BFVA 4M1WA 2H18A 1N25A 2UKDA 2QZ4A 4D4MA 4AY2A 3T1QA 2XNDD 1E0JA 4Z1MD 5JSZB 2NZJA 3U60B 2VSFA 2ZSAA 1G19A 2ZPTX 2B7BA 4M9QA 4QBIA 4QM7A 4OK3A 3TH5A 1OE0A 1HYQA 2J41A 4BFWA 4EPYA 1NVVQ 2GWHA 3W8NA 1G3QA 4A2PA 2J3EA 3GJ0A 1W47A 4F91B 1XXHA 2CCKA 2IYSA 3FE2A 4Q7KA 4CVNA 4O2RA 2ZITA 4DLZA 4DLYA 1JR3E 1E4YA 1Z83A 1DPFA 1QZXA 3FTQA 3A36A 2IS6A 4KO8A 1AS0A 2ZJ8A 2P0EA 1ZM2A 2REBA 4EJSA 2ZJ2A 4B43A 1IJEA 2GBLA 1F48A 2HDNB 4LWZA 1OXXK 1EFRD 1XD2A 4YDSA 1OHHA 5EP1A 4EDHA 2ZANA 3N2EA 2WWYA 2OM2A 3UMSA 1BYIA 2ZI7A 4XVRA 1PLJA 3D8BA 4BZXA 3EARA 2WSSA 3OFNA 5DN6D 1GNQA 4ZV4A 4P32A 3T1TA 2ZYUX 2ANCA 3AB3A 3EXAA 3GEIA 1R8SA 1UKEA 1JJVA 3I32A 1OFHA 3Q5DA 3I1FA 4LGMA 2LWIA 4GRAA 4RD3A 5DH9A 2OAQ1 4YQFA 2JLVA 4CIDA 3QEOA 5JZVA 2NZ8A 1KI1A 1XEWY 5JRZA 4B75A 1US8A 2EFHB 2CE7A 2QY9A 1ZINA 3QVUA 1MRNA 4RZUA 4JBWA 1DBSA 3SYLA 3I92A 5IRCD 4Z54A 4CT5A 4A0GA 2XZLA 3K0AB 4Q21A 3EPLA 3QKRB 4GT1A 1TL7C 1P2VA 1JI0A 3B1WA 1E1QD 2CHGA 4YLGA 2KBFA 1MH1A 2JDID 1KI8A 3AP2A 4L15A 5JEEA 4OQLA 4JVSB 1HEIA 5EUQB 1S3SA 2XOKD 2NO1A 4OJQA 1KIMA 1DVRA 4US0R 2F1JA 4LC0A 5FTJA 2BBOA 4KYUA 4EJSC 1KO1A 2BBSA 2ZSEA 2QQ0A 4G5RA 3MWYW 1PLLA 4PC7A 4HLQB 1RKBA 4PPQA 3A1UA 1D8TA 4OQMA 1R8QA 1S2MA 4WZAE 1DEKA 2H5EA 3I3SR 2V6IA 3UG7A 5DSZA 1JAIA 1EXMA 4EAQA 4HAUA 4V0MA 3TW4A 3W90A 4EPXA 1OF1A 3L82B 721PA 2D3WA 1GM5A 2XJ4A 1OIVA 3CH5A 3TJZA 4KI0A 1OPXA 4AKEA 1F6BA 3PJRA 1M8PA 2AR7A 4W5JA 2WKPA 4Q9LA 4V0NA 4XD7A 5AJZA 4QKQA 1VIYA 4LPSA 5KTYA 2F55A 1BMFD 1Z8FA 1BMFA 2GK7A 5B57C 2VHTA 4JKIA 4JS0A 2VP5A 4JLBA 4C4PA 1S9HA 3BH7A 2IC5A 5K8IA 4FMCB 5KPDA 1E98A 4ILEA 3ZIAD 2V9PA 5FBVB 1U2RA 5FUVA 3QIAA 4TQAA 3QPVA 2X77A 3TK1A 1P9RA 1UDXA 2BEJA 3K09A 3CPHA 4PC1A 1VDZA 2BEKA 1Z6AA 3B1YA 3HR8A 5JECA 1MRSA 2OG2A 4HLCA 3LBIA 4H1VA 4KCGA 1F2TA 2VHJA 4LPKA 5TDHA 2KBEA 4ZCMA 1Z0KA 5JHGB 1AK2A 2P6NA 4TT3A 4IDHA 3E2IA 1DG3A 1G1MA 2XJ9A 2HXSA 3UWKA 2Q3HA 2REOA 4Q4JB 4QL3A 1T8TA 3U44B 4MKIA 4M1MA 2ZEJA 3THWB 4QGAA 1SVMA 1FL9A 2F1IA 5TVKA 1FUKA 3AKEA 1P75A 1KK2A 1KTVA 3SU8A 3ZS9A 2WBLC 1G3RA 2HJVA 5FOXA 1X8KA 1J70A 1B23P 2WPDA 2EFGA 4KITB 821PA 5DYIA 3T06B 3DPUA 4I4LA 2I4IA 1QHIA 2GNOA 5L3QB 2RGCA 3QKRA 5FPHA 3LXXA 2AFHE 3AF3A 1SVOA 2KSQA 3HPRA 3ONWA 1SVIA 1EK0A 5CJPA 4Z8XA 3OIVA 2R44A 5LD2C 3VR4A 2QT1A 4GNKA 2QSYA 3DVLA 4M53A 4QG7A 1FX0B 2JLZA 2VP4A 5ANRB 5CK4A 1XNJA
chains in the Genus database with same CATH superfamily
2JFYA 1L0BA 4JENA 3SM9A 3Q3GE 4ZYLA 4WN3A 4L5IA 3SFZA 1UMCB 3FVTA 4YLEA 1EDOA 1PYOA 3QI2A 4NG5A 4CNQA 1B42A 2WM8A 1G16A 4XPIA 2GEVA 4OXXA 2VDJA 3PGA1 1WEKA 4LMBA 1U3FA 4TXMA 4X45A 3V2UA 4ZEVA 3BVPA 2CNWA 2I4MA 1G63A 1TT7A 4ARZB 1O6ZA 5GM1A 5J4HA 2PSHA 1M6VA 4Z0TA 1KJQA 4DWVA 2B8EA 1EVKA 3A4YA 1WCXA 5EI5A 4Z3DA 3SS7X 3W6ZA 4W99A 1KVTA 3OO0A 4NWIA 5A71A 5REQB 3WRVA 2IK8A 4Z51A 5KKAA 2O9JA 5AESA 1O94D 4DHWA 3EVTA 1D8AA 4M9RA 3VU3A 2HSEA 2FZ5A 2ZTUA 3C3AA 3DTVA 5EYPB 4BZQA 3TZCA 3EQ2A 3GJYA 4KPGA 1TZKA 3NG1A 4UARA 1YTLA 1ORWA 1O94C 1QYXA 1ULHA 1XDZA 2GEKA 4X61A 2NQ8A 2ZBRA 2WY2D 3JVIA 1NOJA 1PZGA 2VJYA 4OL0A 4UTXA 3FCXA 1ZMBA 1BIFA 1FXWA 2EVWX 4KR0A 1P17A 3R9KA 2G7MC 4AZ3A 1E7MA 5HS4A 1ECGA 4FOLA 1SIBE 2O2XA 5KWSA 5AI6A 1Q5PA 3NKVA 4D9JA 4TVSA 3LS2A 3ZDQA 2R68A 4DDUA 4ZGGA 4WBNA 3BTVA 2Y1CA 1A50B 3AEKB 1ESCA 4MWTA 4MZXA 4PSCA 2EZTA 3QNWA 2R87A 2VXYA 2WD7A 3C3WA 4KBGA 4KIGA 1PCXA 3DAGA 3A70A 4M9ZA 2YHUA 1ABFA 1E7WA 5JSYA 4F45A 1JDJA 1EK2A 1ONPA 1NKVA 1PGQA 2BFOA 2P7HA 2Z5LA 1ZIXA 2NO5A 2WTAA 5JWOA 3ZK7A 2PHZA 3QV2A 3F67A 2CK3A 3L8GA 3JQGA 4TTAA 5CA1A 3BXGA 3QEMA 4Q5IA 5E1DA 2HF7A 1JU4A 1YS9A 1JI3A 4DA8A 5CEEA 4MPDA 2LVBA 4JMPA 2G40A 2YL2A 3P0IA 3DZGA 5H59A 3WS7A 1QU2A 3KYDB 2PGJA 5HKLA 1AOXA 4NEGA 3ZJ4A 1GARA 2HT6A 5KDLA 2J48A 1OTHA 2ZSKA 3OLZA 3VH1A 4E5UA 1O87A 2IYFA 2ZW9A 4P84A 3ORSA 3Q1KA 2OXTA 3UXMA 4E6EA 5A03A 1TU3A 1PNQA 3EGXB 2Z3WA 4KIJA 1X77A 1IK4A 4PPGA 2E37A 3U1VA 4QU8A 2XBMA 1RYBA 3KR2A 2WWVD 5CW1A 1U98A 3GI1A 3L8HA 1RHMA 3C8DA 2VC2B 2V54A 1JPJA 3W5UA 1ZLXA 2VHQA 3DXYA 3MQFA 1SRRA 1DELA 2BMJA 2QTLA 3CZPA 4X63A 2PTGA 5AM1A 4E1VA 2FN8A 5BOSB 5JS7A 4PNHA 1C9KA 1NBME 1QYCA 3KXPA 3MTAA 4IPTA 3TRHA 4URVR 3L7DA 1KEEB 4FVTA 3LX8A 2CF5A 3SEZA 1K3FA 1S7GA 4G81A 1IIRA 1TVCA 3UJDA 2ICAA 4O5AA 4EQZA 5IT0A 4XEHA 1LGYA 4AMVA 3TFWA 3OTWA 4BP9A 2XUFA 1D9ZA 5FD8A 4CR6A 4CF7A 3DEFA 3BMNA 4MKXA 1L4LA 2XGOA 4ZT6A 3SDBA 2I91A 3HJFA 1C29B 2PSEA 1HQYE 2V0NA 3KCQA 2G8NA 4P4LA 1IHDA 1MABB 5EP3A 2B61A 3S68A 3X3HA 3DBVO 3B89A 3I04M 5IM5A 4ESOA 1RBQA 1XTKA 1YULA 1OSNA 2QZJA 2VAXA 1MXFA 4AF8A 2NO9A 1YUBA 2JW5A 1ZU5A 1T2AA 2P5SA 3COWA 3PXAA 4PYNA 4ZZ1A 4NXNB 2IDJA 4GBED 1NVFA 5I9MA 4YXWA 3WDSA 1EZ4A 4M46A 5JCXA 2VDMB 1XNHA 3C39A 3G2PA 4XWWA 3MIZA 1U9CA 1EDBA 4E5PA 1FFXB 1HUQA 4RK5A 3CVXA 1CY8A 4D4GA 3KTAA 3BZWA 4QIHA 1A5BB 4N54A 3DKIA 3SJUA 3ZHYA 3BK2A 1RI4A 2GN9A 3JYOA 4KKVA 3IPRA 5A3RA 5SZIA 2O8FA 1OBOA 4WVLA 2WHEA 2KI5A 2VK8A 1OJLA 1SPXA 4NX2A 2ZS8A 3LX4A 3UEOA 3HY6A 1LV8A 1Z0SA 2PSDA 1H0SA 2FK8A 3LPCA 1AS2A 4C1BA 1NE7A 1QZ3A 2IUFA 3QXXA 1ZRMA 1ZVJA 2PVSA 4EECA 4FMDB 4QDJA 3YASA 4DLRA 1NVTA 2C9BA 5CA0B 3R6TA 3EGDB 2P77A 4F5DA 1VRCA 2WWTA 5L7TA 3U61B 2B82A 1CLEA 1ZI8A 2QD4A 4XWOA 2V6MA 5KNCH 2I4LA 2QTTA 1M75A 4DSNA 3NHKA 4X1IB 4LI0A 4AIIA 3PD0A 4JL5A 3ANSA 4Q1BA 5DKFA 5FDFA 3PFGA 5LXTB 1NYTA 4D6YA 2ECKA 3ZKWB 2AZXA 3JRXA 2G88A 4GKBA 2QZ9A 4YRMA 4AS1A 5DW3A 4M0KA 1DZIA 1CQJA 3BEOA 4WBSA 1A8IA 2O4UX 5DM4A 1J8QA 1PSDA 4HRXA 5B53A 1F6DA 1NSYA 2J3IA 4AJNA 3UF0A 1MZVA 1WDMA 2EP8A 3A6ZA 3SR0A 4GM0A 1N2CA 4CQMB 3KELA 3R5FA 3F73A 1L5ZA 2ZAYA 4M55A 4BNDB 4DMHA 4P58A 1NF8A 2V5UA 3HCOA 4DUYB 2IT1A 1AKEA 3JQDA 2HDHA 3N8GA 3B1VA 3I2FA 2QMYA 1RE0A 4P08A 1N33B 2VWHA 3HFRA 1H2ZA 2IEAA 1N2JA 4WBXC 3EVEA 3G8DA 4F46A 4JASB 3JD2A 4OXNA 2B0JA 3AJAA 1MLDA 1DFGA 1H5NA 1UM9B 3E9CA 2HSDA 4OI2A 1FDUA 3TR0A 3L7JA 3VNRA 2ZUWA 1XCPA 3KLMX 3NNNA 2OE2A 1QTRA 1PP4A 2XADA 1FK8A 1W581 4IDBA 2DWQA 5EMJA 5BY2A 1X3LA 4ND1A 3KEFA 4U8HA 5CIQA 1WBBA 5BRAA 2RH4A 1ODKA 1P1HA 4L51A 5HQTA 5ILGA 1WCIB 1WUTA 4XOIA 1C7EA 4DSUA 1QRUA 1AV6A 2BZSA 3EODA 1Q0UA 1SD1A 3AF5A 2UVQA 1I3NA 3DTVB 1TLLA 4ZEWA 1EP1B 3OKPA 3TCNA 2CFOA 3S1SA 1ZH8A 4G8JA 5EQJB 1ECJA 1TZ2A 2PS0A 1G20E 2ORVA 4RKWA 1PFYA 1YCFA 2DHQA 2G1KA 3FUXA 1I6KA 1RU3A 2AN1A 2NU7A 2O2GA 3I9V6 4ZAZA 3VUEA 1OI4A 3WTCA 4MEBA 4E31A 2YYSA 3T9EA 3B12A 1YVRA 2R6FA 2M2IA 2B6HA 3NHSA 4NQRA 5CDUA 2EX0A 3PRKE 2GBLC 4U7HA 4XH9B 1W4AA 4DREA 4RQBA 5ARBA 1Z4IA 4M9SA 3EEIA 5DI3B 2QA5A 4RK0A 3MT8A 1M1YA 4HNVA 5KWVA 1A1VA 1W88A 3NRJA 5JBQA 4B4KA 3KDSE 3ZU2A 1Z9BA 8AT1A 1J97A 4C7MA 3KPWA 1HL7A 4BN5A 1EX7A 1RRKA 3PNSA 3U7RA 2BJVA 1JEJA 3O74A 5JCZA 3HDJA 3MCAA 3GFRA 3L7AA 3N05A 2FN7A 2PGOA 4U5QA 1Y82A 4PLYA 1EFLA 1E9CA 5KQSA 3S28A 3T4PA 1G8KA 1G64A 1QRRA 4Z9BA 3RC9A 4DBLE 4DY4A 1HT1E 2C4NA 1SQ5A 2G04A 5C35A 4D0NA 4D96A 3O95A 1JQ3A 1URPA 4NAUA 4WCFA 3U16A 4FDLA 4KNYA 4IIVA 1IN7A 1Z0FA 2YMLA 3KM0A 3ABZA 4HB0A 5F12A 2NUBA 1DXOA 1UBUS 2QTVB 3NBYC 1PL6A 1OYVA 2ABWA 4IWNA 4B3FX 1MIOA 2ECFA 3QFCA 2QTWB 1X19A 3A26A 2OBMA 5JDIC 3CE6A 3RLFA 1DWPA 5EFZA 2CHEA 3H5NA 3G5TA 2O1SA 4G4GA 4HEA1 5AKKA 4YUVA 3QEJA 4QUEA 1WDLA 3JRNA 4BFLA 1HPLA 3ZJUA 4MUNA 2XMGA 3KCNA 1U7ZA 1Q7BA 3JYNA 4B8ZA 2EP5A 3C98A 3V8EA 2PGLA 1CDOA 4I3GA 4TLAA 3B53X 3OM9A 3L8DA 2IHBA 4KG7A 1N5DA 4PGFA 4HDMA 2ZKLA 2X4GA 5BMVF 2B7LA 3WRWA 4JN6B 2BI7A 3MMXA 3M4JA 1ZVKA 3AUJB 2W6PA 4J1TA 4A73A 4CUKA 2GILA 5J4YA 2Y0CA 1R5JA 2GLUA 2GYVA 2OR3A 2GJSA 1OVMA 4P80A 5JWHA 4BX0A 4ETNA 2DQKA 3IBSA 4REOA 3P19A 4RY8A 2R7KA 3S4YA 1JG7A 3RVQA 1AXRA 2BUAA 3D8RA 2JBAB 3KAQA 1ODCA 4PBTA 4DIDA 4FGSA 4KHZA 1LQUA 1CWUA 4JR1A 2O59A 3T3PB 1JEDA 1XVVA 3AVWA 4KB5A 1N6RA 1P6UA 4IUDS 1UAGA 4M0MA 3UXYA 1W36B 5HJ5A 5KVSA 3HY3A 1W85B 1EKXA 2F1HA 2WLTA 1VPDA 2WB4A 4O2BF 1F60A 4AY5A 4TL7A 3DD1A 1A71A 2FEXA 3V1LA 3EBOA 4GVPA 3G0BA 3L7CA 2JFXA 4NULA 2GXSA 4PY2A 1POXA 3UAGA 2HD4A 3WKDA 1N8SA 3U4AA 2B4AA 4XVHA 3INTA 3WVNA 3FGZA 1FB5A 2F3UA 1TQ2A 1CJUC 1DBWA 1NFFA 1PV2A 4NZYA 4XD2A 1SC3A 4R5MA 5K0NA 1UKVY 3H1TA 1GADO 1CUDA 3O8LA 1MP0A 2Z8ZA 3IV6A 4Y6GB 3QYFA 2W6JD 1XMIA 4MS1A 3UV3A 5AUPB 2IYRA 1RQNA 3PJGA 1GVHA 1LY1A 4N5HX 5JMTA 1SUPA 5BR4A 1CUJA 4MLDA 3O2JA 4YXWD 5EJ4A 1Z74A 3MGGA 4JT4A 4UPVA 4UM9B 3SJBA 5INTA 5CCXA 2SKCA 1G8HA 4KK4A 1AKMA 3UJ6A 4BNFA 5I45A 1AMOA 5KVCA 4O25A 4EJSB 1A9TA 2AEEA 2P3SA 4RPKA 4BNKA 4EQ6A 4LE1A 4BLOA 3ML1A 4JGBA 4JB0A 2GX6A 2R8BA 2FW7A 1LU9A 3EMDA 4G63A 3R3YA 2FOXA 3V4RA 4JI7B 3H9BA 1WZUA 4W9NC 1DKOA 4PTYA 2Q21A 3K2BA 4RCYA 3W9UA 3HSSA 4AYTA 3GPLA 2ODTX 1YB1A 1ZA1A 4WCFC 3C0KA 3TRFA 1XDSA 2AG6A 3QLVC 2Y2VA 2QG9A 1U90A 1W0JA 1P33A 3VZBA 3OJWA 1CQPA 3HZZA 5CX1A 3I6QA 3A1VA 4RFSA 1SBIA 1DJNA 3TWOA 3LECA 3LF1A 3NKFA 3BT7A 2GKSA 4RKFA 5KX5F 2BONA 2QN9A 3PNVA 4RELA 4ZOAA 4B46A 1R16A 3I5MA 2OECA 3KTDA 1L1EA 4X1YA 4PGMA 2ZE7A 3RC3A 5K0FA 5BVHA 1L5YA 3SXJA 2AWNA 4N9WA 1PJAA 1RVV1 3QUSA 4D4KA 2IIPA 3I01M 3V1MA 5JV5A 3R0ZA 1T3LA 4IV8A 1H2FA 2I1WA 4TV8F 2FUNB 1Y33E 2JLQA 2DWOA 1CR6A 3WLSA 4QFCA 5M5BA 4INZA 3H5RA 1X7ZA 3S1LA 2QTFA 4IV5A 4N5MA 2X1MA 1HLDA 3IXMA 5E3JA 1ZISA 1R64A 1JAZA 2ZB7A 3T5GA 3M83A 2VR1A 3AFNA 3IXLA 1YJAA 1XEXB 2R5NA 3JQAB 3EUEA 1I33A 1ZCAA 1G0OA 1LWOA 3JD3A 4Y7CA 4BVFA 4GKJB 3QW2A 1L8XA 1W59A 5G1OA 2QM3A 3S99A 3R5JA 1O1YA 5D5HA 3FI0A 5HM6A 1ZEMA 1BFKA 2CLKB 5KYYA 1O95A 4FJ0A 5FBQB 4WESB 4P31A 3UOAB 2WUVA 3LX6A 2QVGA 2AUTA 3GP5A 1W88B 1T3ZA 3D8SA 4DV2B 2FOLA 3DULA 4YRDA 2E1RA 3UGQA 1KIAA 2XGJA 4FGJA 2UYCA 3OT5A 1T35A 1KAGA 1R0LA 2C2MA 1YQUA 3DZKA 4BKMA 2QMEA 4ASUA 1Y6ZA 1JXAA 3FBWA 2QVBA 4Q34A 4REMA 4LJ4A 4URXR 5I6DA 1TEVA 4Y2TA 1DS6A 2Z1MA 1C0EA 2ZRIA 3L5KA 3AFMA 2VHEA 2XQFA 5KNDH 2EEPA 1L1RA 2C07A 1DFHA 3TLBA 4FHZA 3RVBA 4MR7B 3X1XA 1YJBA 4Z9XA 1W7AA 4C7BA 5FBWB 3ZWXA 2CBXA 5THQA 3CWZA 4URYR 2DY1A 1GG2A 1Y4AE 2J6CA 4OH7A 3G8AA 3OJLA 4KVGA 4P4UA 1JSCA 3JRWA 3LYLA 3VOBA 2F4VB 1KVQA 2RFLA 4TXJA 1JZSA 2VDOB 3NT2A 4E5YA 5FLEX 3MOSA 3GMSA 4ND6A 3GT7A 4B32A 3I9OA 2XKJE 3KYDA 4KWIA 4DMUB 1BDHA 2RK6A 2R7MA 3EDCA 4L0DA 3MWDA 4KQ1A 3E70C 3DBHA 1MIOB 4RLQA 3K70C 2ZQZA 4CDRA 1DNPA 2I22A 2ZAMA 4RDIA 2O07A 2A78A 5ITZA 2ZYAA 1ADYA 3HO8A 3CH7A 2UYHA 3F4LA 2VDRB 3MVEA 5IC5A 2YV2A 4M83A 1FVFA 1ETHA 2N46A 2I4NA 1XTBA 3G9UA 4NMWA 3GRUA 1YMVA 2FAXA 2WJ4A 4ZQGA 4OI1A 2VSOA 4XIIA 3BFPA 4C6TB 1OXBB 1RNLA 4HN4B 3TRIA 3WLKX 2AUNA 4E22A 1IEVA 2FF5A 4BRUA 4RTNA 1DTSA 1XWIA 5K0GA 3NBXX 2ORED 2VJKA 2WJ6A 4RHUA 4ZK2A 1PZXA 4O4LB 5CBPA 1KP9A 2B8NA 1DARA 5ICMA 4YDHB 5F73A 3VZCA 1HLPA 3MFQA 3GUUA 3NWBA 2HV9A 5EESA 1R12A 1NFRA 5D85A 3C97A 4MUAA 3W5AA 1E1LA 3GZJA 1NMYA 1Q1NA 3A3OA 4G23A 3ZE6A 4K0KB 1SCBA 1EA5A 1XVIA 1RTKA 1DAEA 3LUKA 2GTIA 4PIPA 1ND5A 3LC0A 3UKJA 3BB3A 1MJNA 1SCQA 2GF0A 1KY2A 2PMKA 1GZVA 2YOHA 1NLZA 3OF2A 5I9LA 2J0SA 4ND8B 2DGDA 3FJYA 2OBXA 1WA5A 3LMKA 1HM5A 2O0KA 4DKJA 2R86A 4UEOA 4MI1A 1GZ3A 4HY3A 1KFJB 1V8OA 1YZNA 1U2GA 2IOHA 3H4MA 3NTLA 4HFJA 3WA6A 4ZQIA 3UUFA 2O14A 1N6PA 1ZSVA 2TMGA 2J59A 1M2KA 1U4SA 3Q3HA 3ROGA 3IDOA 4TTJA 3DTYA 1DC8A 4KYIB 4UQPA 2F1RA 3WV5A 4MQBA 3UJ8A 1NF9A 2Z9DA 4N6NA 5KOYA 3RYCA 4B33A 2PJDA 3GEBA 1ZIYA 3C8ZA 3LW7A 1HA3A 3R3ZA 2EQBA 5CYGA 5ICFA 4CLEA 1QTNA 3C43A 4S1NA 1EFHA 2FPPA 2GZDA 3LQYA 3X0DA 4JQZA 1IJBA 1S9DA 3CSDA 3WWDA 1ZDMA 3RBVA 3FWHA 1YHYA 2V6JA 4NL4H 5TARA 4ENSA 1AZTA 3RRYA 3SC2B 2H1OA 1XCJA 3JU3A 3QTBA 2M6KA 3WK4A 2CDAA 2H9AA 3Q15C 4AUEA 3ME5A 4H7KA 2JLYA 4LGCA 2OQVA 13PKA 4ZFNA 3ZNQA 4HAOA 3JAWA 1WPRA 2GB4A 4G9BA 2HMAA 3OZ7A 4TZ6A 4JKOA 2P3LA 4QLBA 2R8EA 3HBJA 4WKCA 4YCBA 2PT7A 5DLEA 5EPUA 1SG6A 4FN5A 1P7YA 2JJ8A 3A4TA 5TE9A 2ZUVA 1Y1TA 3ZGZA 3D4OA 3MMNA 3ZHTA 2EKBA 4NYIR 3KFLA 3BHMA 3DE5X 5DNWA 4WERA 3HJCA 1JF8A 2AN5A 5IKXA 3OSZA 3BG5A 3GA0A 3GRPA 5F7JA 4D3DA 2UV8A 1KDRA 2ZREA 4WCFB 1ULTA 1A8HA 2WMNB 5JZBA 4D25A 1VE5A 4XGKA 4DLNA 5CFRA 2QSZA 2TMKA 3NXSA 4Q19A 2XB8A 3L93A 2F9MA 4BNVA 4F86A 4PLGA 3AESB 1Y34E 3C45A 2DP4E 1A5AB 1M6WA 3BJZA 3K7EA 4NNOA 1NJ1A 3TZ6A 3EH1A 3L0ZA 3R6LA 4DZTA 3SHTA 4AKTA 3JASB 2BFDA 1ONOA 2FMUA 4DWOA 1XCLA 3QKTA 2XF2A 1PD1A 3FSGD 3H2IA 3PXXA 1R4NB 4BGIA 4JY7A 1WBDA 3IBGA 1RAAA 3E53A 2DTDA 1ISPA 3DSRA 1UBCA 4XVQA 5DOVA 4A4DA 1PKEA 3VVBA 1L4FA 2VTKA 4JBIA 5AJUA 1E69A 4BNJA 4JJZA 1Q77A 1Q57A 4F3TA 5AK6A 2FR8C 2PT5A 3VKHA 1QFMA 3E0XA 5DTMA 3AP3A 5FUYA 1SUWA 3RJMA 2QI9C 1L1QA 4RESA 4FE3A 5HGJA 3AEQA 1XELA 1FMTA 2XUIA 1D6MA 1T91A 2AFIB 3OC6A 4ZT7A 5BW8A 4C5BA 4E88A 3T5CA 1B16A 3I4FA 3WYAA 1V95A 1G8JA 2HYDA 2IZOA 4D02A 4C0AC 2OORC 2BC9A 3D2AA 3E7DA 3OG9A 4I5IA 3IHTA 3KYCA 2QPAA 2Q41A 4UBOA 5JFOA 5K9ZA 2CVHA 4XCVA 3W05A 1U2GC 1Y81A 3HWSA 2BGLA 2GYUA 1JR4A 1WMSA 1MGPA 1P0QA 3JQBC 2JKVA 2VF5X 4HDKA 1P8JA 5UKDA 3WQSB 4CUZA 4JT8A 4ETWA 1M2HA 5FOTA 2NYUA 4RZ3A 2PUEA 1ZUHA 2X8BA 4B40A 1W85A 4NYMQ 4B34A 4I1PA 1PFQA 4RVDA 1BRMA 5L4NA 1MV8A 4IJWA 3JYQA 1AC5A 5B4VA 3WX0A 1CB7A 2GDJA 1D7AA 4ITUA 5B1HA 1DB3A 1T36B 2WYIA 4DIMA 5JYEA 1JR3A 3NC1C 3OIGA 3UAOA 2AR9A 1VL5A 3IUNA 3LDUA 3N7AA 1E59A 3QU9A 4WDQA 2J6IA 4B48A 3KFXA 3FPSA 3OQVA 3O21A 1CPYA 3ICWA 4GOMD 5DHAA 5JYBA 1T3SA 1RAGA 3CFYA 2FPMA 3UANA 8LDHA 1VLMA 2CHQA 1PNVA 2EIHA 3TL3A 2V4ZA 2BFBA 1YR2A 4NFLA 3M70A 4H0FA 4WINA 1L7XA 3VYWA 1JS1X 1J99A 3AKDA 3CZCA 3OU6A 3RHSA 4PAQA 3T5TA 1I2AA 4D1YA 5CB8A 5EJMA 3G9TA 3QVVA 4GMGA 4ARCA 1MDBA 4EG0A 3KJIA 1GUFA 4ITRC 4WV3A 1V47A 3AG6A 1SCDA 2H2HA 4O4JF 5AVSA 1MFZA 4TLLB 1EJBA 4B73A 3VMFA 4UU8A 1RM0A 4Y6LA 5BYJA 2QYOA 2O0MA 4IO1A 4X9XA 4YDRA 4CMHA 4QJIA 5DYNA 4YUWA 1X1RA 3PE4A 1U0JA 3R74A 4IF4A 1G6HA 2YN0A 3P9SA 2XZTA 3ZCXA 3DG9A 3A9UA 2JIZD 2C3PA 1PTJC 4G56A 1EVYA 5L45A 1JILA 1OAKA 4O6VA 5CVJA 4EM6A 1CIPA 1U6IA 3X1JA 4N82A 1YC5A 1WABA 2QAIA 3JZIA 3O93A 4BBJA 3GG9A 3D81A 2J8ZA 3O31A 4U2CA 4CMCA 3V00A 3FKSA 5ILOA 3NTRA 5C31A 3SG0A 3UK7A 3WIUA 4PZCA 3C48A 3U3ZA 3O47A 1Z2CA 4I99A 3ZCSA 1YQTA 4WXMA 3EHEA 1SKQA 2MJLA 4N4AA 4QRHA 1SGWA 1HYGA 2PXXA 4MUMA 3L7KA 1V8PA 2WHPB 3TTSA 3CS3A 4WMLA 3FNRA 1CVLA 4X5OA 3WDMA 1U8TA 4DQ0A 4MUYA 5CBKA 3U44A 2VJCA 1FYEA 2BY4A 2EBFX 3EWAA 3PDUA 5AXDA 1KR5A 1F14A 2HJSA 1MC4A 1MAAA 5BT8A 4GLOA 1Y37A 4IDNA 3N2KB 4G5XA 4FYXA 3K3PA 4UTZA 4B8YA 4C29A 1PUIA 4CF3A 1L4YA 2Q1XA 5E2AA 1E6LA 5FL7A 3G8BA 4Y6OA 4DQLA 5CVCA 4K6KA 1OY1A 1QTQA 5BR7A 1CY7A 2CD9A 3O3OB 3IAAA 4BJ1A 1PZMA 5D6OA 1RM3A 3KSDO 3PEFA 1X87A 4RJ2A 1CDZA 4DFDA 1B00A 3OPXA 2PRKA 2RMKA 1C9DB 2L0XA 1H1TA 3DDNA 4PBRA 4RF4A 1I9GA 1XE3A 2DWCA 3L7LA 3UK2A 3FCUB 1HE8B 2R6AA 3G85A 3AV0B 4M6WA 4ZDKA 3QBJA 1OFUA 1NTOA 4D45A 3LUPA 4Q9IA 4NJEA 3VRHA 2ZTVA 4PLWA 4IIHA 1M2VA 2VO1A 3P9CA 2OHFA 1YRHA 1Z22A 3OM0A 4PHGA 2WRZA 1SUDA 4QBFA 1JHMA 2VJDA 4CXMA 4M8IA 3B3FA 4ZHQF 4UDNA 4CMIA 3VHXB 2ZP1A 3UT6A 3SF0A 3EG9B 4NR0A 2PK3A 4WXPA 1U8ZA 5DGHA 2OYRA 2Q3MA 3LY5A 4C4YA 1S02A 2J9GA 5E7JA 1Z6PA 4NARA 5H0IA 4CKEA 5H83A 2C78A 4D2IA 1EGQA 1OFGA 3GJ7A 4XSHA 5ALOA 3QXSA 2GAFA 4ABYA 4D41A 4FYIA 1FQKA 3C6XA 2IVZA 5DHRA 3Q85A 3UM9A 3E2PA 2O19A 3I9FA 3JV7A 5HFJA 5ALNA 2QN1A 5JNVA 1W75A 3UUEA 3LO8A 1TD1A 1PZNA 1XMJA 1Z0UA 4DZZA 1GP2A 2G9VA 4DDVA 1P80A 2HQBA 3E9QA 2G36A 4V2UA 2I65A 3U0BA 4B9AA 4F1KA 3HDYA 1ZIPA 4AY6A 4WBNB 3KQKA 2EZUA 2RHHA 3SXPA 4DIEA 3ENWA 2VUTA 3FROA 3QSGA 1TQDA 1ZL0A 2EKDA 3L1HA 5HQJA 3RFFA 4FCWA 2P67A 2ZM5A 1TUBB 4ENUA 3GJ6A 4C4TA 3O75A 2BSQA 3RADC 2MTBA 2QTMA 3QKSA 2TRSB 4NMXB 1ZFNA 2ERXA 2HGSA 3GGCA 5LLDA 3S2SA 3EY9A 3NPMA 3ZWPA 4WXYB 2HBZA 1P3Y1 1IDOA 2CUNA 3A9SA 2G83A 4MITA 2JIZA 2XCLA 3QITA 3S81A 4R2KA 1YJQA 4HUJA 4M7OA 1ZOLA 1T0JB 1L5VA 3PL5A 1MD9A 3H3FA 4BNZA 3UENA 1SBTA 3DAOA 1OU4A 2AWOA 3ZHXA 1LFAA 4B7ZA 4HQOA 2XYPA 4EEZA 2FZCA 4UQLA 1DAHA 3MTQA 1F20A 1EP9A 3ZX5A 1NNEA 3BGWA 5KNCD 1XK7A 2XRFA 1ADBA 5IKEA 1VLZA 3I52A 3GLGE 3F49S 2QD1A 2HB6A 3ES9A 2HBRA 3GZNA 3WGUA 1OXSC 2J4DA 1VL1A 1Z0JA 2P2CA 3FHCB 4RKRA 1QJCA 4NMHA 2XAAA 3ABOB 3AIMA 3C74A 2F9FA 4OHFA 3JQFA 2BEVB 1LS6A 2OHVA 2WP0A 3D3WB 2OO5C 4MWEA 4Q3BA 3COSA 3VKVA 1R0BA 1U7DA 2JC3A 1LFDB 1A8UA 2ZJBA 3JAKA 4MUHA 4CCAA 1RXVA 5E6RA 1CERA 4W7SA 3HNPA 1YB7A 1ULUA 3ZJVA 4RTSA 3EZ9A 3SS8A 1Q91A 5JG7A 1MFPA 4KQMA 1BGXT 4NCIA 2R66A 4AZTA 4ETIA 1ONBA 2CDCA 1AQIA 1L4HA 5BSEA 2G67A 3NAZA 4C5CA 4BL5A 2VCYA 4ATNA 5JAPA 3TXXA 1PV4A 2V3VA 5REQA 2YVUA 1BOFA 4E4TA 4QSHA 2P75A 4P82A 3AERB 1UFQA 3BKWA 1O5TA 2FH5B 3OQIB 3U7GA 4TZKA 1C7JA 1XRQA 1LX6A 3U37A 4B80A 5C51B 4JC0A 4Z86A 1MNAA 1O96A 4Z9AA 1ZN8A 1JWLA 2O2JA 1P4HA 5C5EA 3K31A 1LEHA 1GYRA 4F8JA 2E6UX 1NUUA 4S04A 1Z7YA 3JZFA 5FIUA 4U00A 2UXCB 4X1OA 4IDPA 4XJVA 5CLJA 3RE1A 2ZETA 3PD7A 3S1AB 3QYJA 5FLYA 3D7LA 4WLOA 4YH1A 4WZAB 4H1UA 5L51A 3HJTA 1Y42X 4M22A 4D3XA 3UJNA 3KQMA 2LGJA 3MC1A 4MW1A 3VI4B 2FFQA 3KNZA 4YAFA 1RXYA 2ZJZA 5AOCA 4BX9A 4DYDA 2ZUFA 1P2UA 1NG1A 4WECA 1TMKA 2Q3JA 3IMEA 3WL6A 1NUSA 3BH0A 2RG7A 4N7MA 2HL6A 4P38A 5JISA 1N6NA 1COWD 1O6FA 2QR2A 3FUWA 4CM4A 3OQOA 2PUWA 1ZL2A 4CIXA 4RA9A 3A6LA 2RHLA 3GRVA 2R60A 3GOHA 4MCJA 4WDRA 3RIEA 1YCDA 3IFSA 3UNXA 2HWWA 2PX2A 3JZMA 2Q8QA 4MMXB 5C7LO 1GNLA 5EKSA 5LCXA 4OF4A 1MBZA 3AUUA 4FGUA 4D9HA 4MDFA 5JXWA 4N7RA 5KAMA 4KOEC 3CLSD 2BR5A 2PGNA 3BUSA 3FYHA 4JA0A 4BCCA 3H2HA 2YS7A 2DFNA 1E5DA 2WJJA 3G0HA 3L1KA 1SQSA 1WZIA 3E1KA 1K6IA 4R2XA 5T8KA 3ZOKA 9ABPA 4UMFA 2NT4A 4BO2A 3RREA 1KHHA 1ZNYA 3MAAC 1Z2AA 1VXRA 4RMHA 3IX7A 3I12A 1COZA 5FLXA 1BHJA 4M0FA 3L6EA 4HQKA 3IPYA 3QELB 3TMAA 2B8WA 2B3DA 3HP7A 5CCDA 4P2BA 3W2GA 4IXWA 4OY3A 3VDQA 3HE3A 2RHCA 1C7QA 2W6CX 5ARCA 5CCEA 2VK2A 4BV9A 2CJWB 2ZUEA 3FRIA 3L02A 4MUBA 1KGDA 4KQHA 5BUCA 2D6FA 1O57A 1D09A 5FQNA 3CUVA 3DZFA 4C3ZA 4DF3A 1GAEO 2OAP1 1L7NA 2A88A 2NU8B 3OZEA 3KUDA 4LZWA 4ND8A 5KCMA 1YASA 1A9SA 2WNHA 3NZEA 1T4CB 4BNWA 2NYVA 4BQFA 4MGYR 5CCBA 1QCZA 1VP3A 1L5LA 4MW7A 5C1IA 2W2VA 2YNMA 3F4KA 3K9LA 3WB2A 1CTQA 5F64A 1IY0A 3TFOA 1QR6A 3ZDYB 3VYVA 4NCJA 4UZFA 4WCDA 3RCBA 1ZOSA 1R4AA 2H92A 1XOIA 2JBHA 1QH8A 3DOJA 3HZRA 3KVVA 3COVA 1XTTA 3QXJA 1I13A 1MQ8B 4JEUA 3CX6A 5JH7F 4TLDA 2PANA 2YBDA 3T94A 5LP6A 2GHTA 3JPWA 1PTKA 1R7RA 3L49A 3BE5A 3M1IA 4REQB 4S35A 4D6XA 1C0LA 4MGKR 3GLGA 3CLRD 4UNIA 4RVHA 3FDZA 2QTBA 3WLJA 3UW1A 2WJGA 4P2GA 4TQ9A 5JO0A 4I1YA 2BGTA 1TVEA 4FMBB 4CN8A 5BQFA 1QH9A 1Q1QA 3AHDA 1FU4A 3M9XA 4TN1A 4LZAA 3ULKA 4L72A 4PLPA 1EVJA 4AP5A 4EPVA 3Q8MA 2SNIE 1GFIA 1L9KA 3NIGB 2ZG6A 4H35A 5ED0A 3TSOA 3N2NA 4Q47A 1HDIA 4WJKB 1NW6A 1XO1A 5AOVA 3GELA 1ISFA 2IJGX 4CM5A 1BNCA 1RI3A 2C5EA 3IAEA 5B7NA 4LK3A 5IJ9A 4HX9A 3A2MA 2V96A 4UKDA 4IIGA 4LSWA 4YJGA 4KRYA 1MB4A 1MX3A 4V0ME 1FS4A 1KDOA 2OGTA 2ZBEA 1GCGA 4I9UA 3A9WA 3KHTA 2I66A 3KC2A 4GAEA 2R3SA 4Z4FA 1VPVA 1IZ0A 2YWCA 3IQXA 4Z9FA 5IK2D 3GPBA 2QTAA 3T95A 1YUNA 3DTVD 3JWIA 4X1IA 1TC1A 2QL9A 5LZ4A 2AXPA 1XPUA 5G0WA 1V1MB 1O0CA 2WVGA 4WN9B 3AM3A 4HG2A 1CR1A 3A1DA 5AKIA 4NBSA 5I9SA 4NYIQ 3ZWAA 1RLIA 1ADJA 1GKYA 3AW9A 3CH4B 5CTAA 5D6NA 5FULA 3W5BA 4G0WA 3DEHA 4G09A 1FOEB 3G5LA 3NX4A 2P35A 2EJWA 5GV7A 4EBBA 4U2DA 1WPGA 2NSHA 4O02B 2Q3CA 2WFLA 2YWEA 5ECYA 4ZRDA 1N6OA 1DIBA 4B3TB 4JZYA 5FWAA 2HMTA 2CLOB 5IAGA 1USKA 1L5QA 4MH0R 4KR6A 4FS3A 4JLAA 3EA5A 3E81A 3HKBA 4M4SA 3UWPA 3B6KA 3U7FB 1X7YA 2P8SA 3HHPA 2YV5A 5KTSA 2KYRA 3KLOA 5DGDA 1W93A 2GERA 5CVTA 2HXYA 1YDMA 2IY8A 2YINC 3AIOA 2HREA 2CGEA 2BFNA 3B7GA 2JIMA 3H16A 4JR2A 4RVOA 3TW8B 3DLHA 2LZ0A 1B3BA 1QQ5A 3MJFA 4PRKA 3GXBA 1AE1A 3FHJA 4IR7A 3TUZC 5J2UF 2NZWA 4NLLA 5DF1A 4L9WA 1K5DA 3DOFA 1CXZA 4I9GA 4CLRB 2J9XB 1TZCA 1VBFA 2PL3A 4OTZA 4MQFA 3RVKA 1AQJA 4GI2A 1YDEA 3THSA 4DR1B 2A5GA 2I03A 3K16A 3D0OA 2GHQA 1AM4D 1IHUA 4L5JA 3UMGA 2P6OA 1AGNA 2PQ2A 2C1EA 4KXWA 1GAQA 4LE0A 3ECSA 4BNXA 4C9BA 5LQNA 4BFUA 2DFDA 1BN7A 1DAPA 1S2NA 4ARIA 2LV8A 4FGLA 1JKJB 4ZOLF 3RLIA 3CF4A 4IH9A 1FU7A 1UT6A 4F2GA 5HJ2A 4YV0A 1IFXA 5B3KA 1KGSA 2XX3A 3SOZA 2I7CA 1XAIA 3HB9A 1C81A 3G1UA 3ONEA 3U5ZB 4MIOA 3FF1A 4EMBA 4NJEB 4IVQA 5DVZA 2WABA 3T61A 1ID1A 2IQ5A 3CJTA 1ODJA 1R6AA 1XAJA 3G7NA 2NAPA 3NUGA 3NOXA 3FZGA 1EUDA 3E22A 3TDMA 4EG8A 3KXDA 4LYYA 4HWRA 1KYQA 5WRFA 1WUHS 2AUMA 3KUCA 2YFKA 2Z2JA 3U80A 2YHIA 5KKCA 3A2LA 5JNTA 4WZBA 5EJFA 3F3YA 5B4TA 4WUTA 4GG1A 2ERYA 1KI6B 1Z36A 4QUBA 4XFKA 4AWXA 3OZCA 1NQWA 4JJKA 1IONA 2XUAA 1L7EA 2B4QA 4B85A 3MQ4A 4JXXA 1C0PA 3FYDA 1UEJA 3SC3A 2XA2A 4EFDA 4K8OA 1LLQA 4AM8A 2FFBA 1MO3A 1CULC 2I80A 4K40A 5IAKA 1ZN9A 3PJDA 2PLWA 4L8YA 4R9NA 3TLJA 5F35A 1CUZA 3THYA 2X3FA 3UT5A 3M49A 3CNNA 1XV5A 2P40A 4CBVA 4LHSA 4UUMA 3AEZA