4XWOA

Structure of get3 bound to the transmembrane domain of sec22
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
347
structure length
293
Chain Sequence
TVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTNPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMALADLTGSIPGIDEALSFMEVMKHIKRQETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQECKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATPase GET3
publication title Protein targeting. Structure of the Get3 targeting factor in complex with its membrane protein cargo.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (atcc 204508 / s288c)
molecule tags Hydrolase/transport protein
total genus 101
structure length 293
sequence length 347
chains with identical sequence B, G, H, M, N, S, T
ec nomenclature ec 3.6.-.-:
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02374 ArsA_ATPase Anion-transporting ATPase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4xwoA00
3CKLA 2FOLA 2OBNA 2WBLC 3V4RA 3HDTA 5CK5A 2J5XA 3AF3A 5DNYB 3TQFA 4D2IA 4LJ5A 3AKYA 1CTQA 1BMFA 1Q21A 3FFBA 1UKEA 3KB1A 3ZVNA 1Z06A 3D3QA 3K53A 3EASA 1ANKA 3K0AA 1QVAA 1G20E 1S3SA 1FW6A 4AKGA 1OLOA 4Q9LA 3SS8A 4OJKA 1NNEA 3THYB 2H57A 3DKVA 2V1UA 1YJ5A 3RSLA 3T34A 4DDWA 2JDIA 4C4PA 1RVDA 4M1KA 2JA1A 2NO7A 2V6JA 3SQWA 1KI6B 4LCBA 1EWQA 1OH7A 3NXSA 3TGPA 3KKQA 4IOJA 3FMOB 1T91A 1E0AA 521PA 3H86A 4C3ZA 3L8YA 3U6BA 3NBZC 4XWKA 1W47A 4M9QA 4UNPA 3GEIA 3SDZA 1NVVQ 1SHZA 4AKHA 1S1MA 4KJZA 1OFTA 4RZXA 3U7HB 4Q4HB 2H7VA 1MKYA 3W9YA 1MH1A 4QOSA 3BFKA 4PHTA 1F60A 4HLCA 1II8B 4IJMA 3SOPA 3Q9LA 2BMFA 2IA5A 3QJYA 1P2SA 4A8JA 2BBWA 5JJIA 1JEDA 2AR7A 1MT0A 4DDTA 5JS7A 1RRGA 1YZUA 4NCKA 1M7GA 4PHGA 5JHGB 4B32A 1EXMA 5G3ZA 2Z5FA 1BYIA 2FU5C 2YWFA 1OW3B 3QSYA 2OCAA 4BFUA 2NO1A 1LF5A 5KSOA 4F91B 2VSFA 2G88A 3IIKA 1RYHA 3GLIB 3KZ1E 4LYJA 1TEVA 1VG1A 2HXSA 1TUEA 4W5WA 3KQLA 1E2GA 5DH9A 3SYKA 1W1WA 1RYFA 3K0FB 1SVSA 1WBBA 4DEYA 1X8KA 2G1JA 4PC2A 4QGAA 3QF4A 3VQTA 1OKKD 2JCSA 4ZI2A 3JVUA 4XSHA 2OAQ1 3H0KA 5AR1A 3IQXA 2GJ8A 2DFLA 3DPUA 4B34A 3QE0A 1FOEB 1KK2A 4I99A 1TQ2A 3CRQA 4B3DA 5JSZA 2QTHA 4KFRA 2YYZA 2FWRA 5CDFA 2P6NA 2ORIA 3IQWA 2AKYA 1OKKA 2P6UA 1US8A 2NOAA 1UBGA 4JVSB 3FOZA 1W4BA 2IS4A 2F43A 3OZXA 5K8UA 5D3QA 2OFWA 1UM8A 3BK7A 3MWLA 1E2LA 5AWFC 5FI0B 5DIFA 1JECA 2QNRA 2DBYA 4PFSA 4OI4A 3QPWA 2RGCA 2V55B 5JBQA 2R6AA 1QVRA 2FZLA 1KO4A 2QEQA 2BM1A 3IBGA 4R98A 1FX0A 4QRHA 1KIMA 1OYYA 3C4JA 3KKMA 3I1FA 3OIYA 2OUKA 1FQKA 3DO6A 3THOA 4Q7KA 3K0SA 3SI7A 3EXAA 4DCNA 4AD8A 1GTVA 1U8YA 4AYXA 1DPFA 4A8JC 2BM0A 1E9DA 1G64A 1UJ2A 2GRJA 4Z54A 5A4JA 1H65A 1P4SA 4QGFA 3WMFA 3ZD7A 2GK7A 1FPMA 4IFEA 5E7JA 2JATA 1NF3A 5FL7D 1G7SA 2ZETA 1XD9A 3T06B 3L0OA 3A58B 3QI2A 4JKYA 1Q12A 3K09A 1DAHA 3U44B 4PTLA 1IBRA 2GZDA 3QXJA 4A0RA 3JZMA 1WP9A 2VTKA 3CBQA 4HDQB 2ZE5A 1ZM7A 2RGBA 1ZD8A 1MABB 2VO1A 4GSYA 1G8GA 3PEYA 5GADl 4A1FA 1F5NA 5FL7A 1XEXA 2A5FA 4QC2A 4TT3D 1V43A 5FOWA 3VR6A 4B6EA 4CIDA 2WKPA 3QVVA 4HI0E 3IEUA 2FZ4A 2QRNA 1KI7A 4JLOA 2OFOA 4L9SA 5LDDC 2V7QD 2C8VA 1KDOA 1JJVA 4GNKA 2ATXA 5H68A 4O0MA 1PLJA 1RJ9A 3GLFE 4RFSB 1ZUNB 2RMKA 2N46A 4GOKA 4TT3A 1XDBA 1IJFA 3RVBA 4ESVA 4KVGA 3TQCA 5EP2A 4HAUA 1A2KC 2FN4A 1OIWA 1S3GA 1XTKA 1G21E 4LSGA 2QQEA 4LV8B 3TUIC 1Z0IA 3SQXA 3CPJB 3WP0A 3U60B 1GWNA 2R6GA 1KMQA 2ZJYA 4G01B 1XWIA 4LJYA 1DG1G 4C30A 3BE4A 1BO6A 3DHWC 5CIWA 5EXTA 1ETUA 2GVZC 4MUAA 1NSFA 4WOPA 1OH8A 2PJZA 3BJIC 3ZGXA 4DC9A 3I3SR 4DLWA 4EDHA 1QHYA 2XTZA 4JLDA 5DYGA 1TUIA 3PCRB 1R6BX 2XOKD 4PZZA 3K09C 1UKYA 1X8LA 3I4LA 2Q0HA 3BERA 4G5RA 1AZTA 1SVIA 1NN0A 1CLUA 1QHHA 4Q48A 4Q4AB 3KJGA 3REGA 421PA 1PUIA 2AN9A 3DVLA 3GLHB 3BORA 1Z28A 1XX6A 2J87A 3A4LA 4NYIR 4PX9A 2ANBA 4B3CA 5H8WA 1FQJA 2XOKA 1DAIA 3SBEA 5JEEA 1E9CA 3VX3A 4BGDA 4OHVA 4D82A 1JPJA 2FV8A 4MRVA 1VCNA 3SE0A 2ZM5A 2CEAA 2QQ0A 2OV2A 2ZRDA 1P3JA 4A0GA 1OXXK 2R8RA 4E03A 2AD1A 1EGAA 1AM4D 1VYTA 2PZEA 2CCJA 1IY0A 2QPTA 1TU3A 2OEPA 1E2QA 4C2UA 4BFTA 3RRNA 3P4YA 1ZCAA 2GCOB 4IOKA 4A6PA 3CF0A 3AUYA 2C9OA 1EFUA 4GDFA 1VMAA 2ERXA 4TQAA 3UANA 3QKRA 5DSZA 1ZC3A 3B6EA 4GZLA 3EX7C 3MJRA 3HPRA 2FSIA 4WA7A 3BD9A 3W5JA 4LC1A 4JSYA 4LJ4A 4DB2A 3EPJA 4OQFA 1G3RA 5IHPA 4Y0AA 4BLOA 3THXA 3DOEA 2YJTD 4L4UA 4LHXA 1D2NA 3I73A 2C77A 4EQ6A 3VU9A 2JGNA 3B85A 5JFGA 3IDQA 1E1RD 1HYQA 4LRWA 2FNAA 3MRSA 1N0WA 4HUQB 5F98A 3BIFA 2J41A 1N2CE 3B7GA 5CITA 5EP3A 3QXCA 1ZUIA 3P20A 1U94A 2Q9BA 2AXNA 3HU1A 3TSZA 4BLSA 3NG1A 2WKQA 4URZR 1LV7A 1CBUA 4HLQB 4G5GA 3LW8A 4IDOA 2UZIR 1RC8A 4JVNA 4JL8A 3AP1A 5J4KA 1G3MA 4HEJA 3EIEA 4HYYA 1ZVQA 1DARA 2LWIA 4MGKR 2N1BA 1CRQA 4OQXA 3KQNA 3ZLJA 2H8KA 2Z4RA 2ZI5A 1TAGA 1XXHB 2V1XA 1X1SA 4IDPA 4WBSA 4MGZR 4C0SA 3R9WA 4NE2A 3C5HA 1Z2AA 1U8ZA 2CHVA 5J4VA 2PEYA 1AA9A 1XPRA 2ODBA 3KXLA 3Q3JB 1U9IA 1VG0B 2RKOA 3CW2A 5CLQA 2OM2A 1D2MA 5HCNA 2XX3A 5JLJA 4PPFA 3E70C 2YOHA 1ZU5A 4IDQA 1OH5A 3U4QA 3FE2A 4NHOA 4R71A 2ANCA 4IW3B 4XIGS 2BMJA 1VCOA 3X1ZA 2IYQA 1WCV1 3ZVMA 1AIPA 4OHZA 4C0BA 4NP6A 4OKSA 2BKUA 3Q7PA 2BCJQ 2CJWA 3AVPA 2YNMA 1NBMD 5EE9A 4LOAA 1U81A 3GLGE 2DWOA 4KHZA 2V4ZA 1GITA 3R8CA 5EZ6B 3MCAA 3I92A 1N3BA 4B33A 1OV4A 4Q1FA 5K8LA 4A15A 4Q03A 3GD7A 2ECKA 2AWNA 1EWRA 2QUZA 5B57C 1TTTA 4Q9IA 5BYJA 1XPUA 3T1VA 4HZIA 1FP7A 2GJAA 3C41J 2FX3A 2GHIA 2PMDA 1N5IA 4L8GA 4D0LB 1F6BA 1NBMA 1AS2A 3NC1C 4V0MA 4PAOA 3VMFA 4M1YA 1XCPA 2ZSEA 1E9SA 2RCNA 3SC3A 2XXAB 3CWZA 1MRNA 4DLUA 2Q9AA 2MMCA 4XVRA 2I1QA 3W8RA 3OEHD 3WNDA 1G5TA 4EFLA 5GJVC 3WHLA 3CRW1 1YZGA 2P65A 3C16C 3SYLA 4ASUD 3BAFA 1K5DA 1KHTA 4US0R 2HCBA 3NHAA 5FTLA 1TQ4A 4PAMA 1Z6GA 1DAGA 1AZSC 2QRZA 4AC9A 2DWPA 2PX3A 4Q47A 4LV5B 2A9KA 4TL9A 2HJVA 4A82A 1SKQA 4Q5IA 2IYTA 4OYHA 2GF9A 3T1OA 3OEHA 1GVNB 1G291 1QHIA 3HYRA 3TE6A 5J47A 3GLFB 4RCYA 1U8AA 1HE1C 3VR4A 4C0LA 4TL6A 3I8XA 2ZUBA 4Z8XA 2O8DB 4JL5A 1OIXA 2WJYA 4DCUA 5AJWA 4A6XA 1EX6A 2OO7A 3LX8A 3D6TB 2OCYC 3KKOA 3AKCA 2ZAMA 4FW9A 4A9AA 1NMZA 4XTCS 2PZGA 4Q00A 1TF7A 3KJIA 3CONA 2O8FB 3NVAA 2P6RA 5CB8A 2R9VA 5F9HA 4PZLA 4XD7D 1KI6A 1OIVA 2GEUA 3B1YA 1LNZA 3C8UA 4DCSA 1UKVY 3R7WA 4P0TA 2QPOA 4LDJA 2ZANA 2O8CA 4P4SA 3TIFA 4J0QA 4LPSA 2GKSA 3NC0C 4M21A 5TMPA 1CIPA 1XTQA 2EFDB 4Q19A 3E2IA 1QG4A 2WJIA 4QHYA 3B8HA 1W2HA 4Q4HA 5KU1A 1YKSA 4Q18A 4BFWA 2PX0A 2YWEA 2C95A 2J0VA 4XD7A 1II8A 2ZQ5A 2QAGA 1QZXA 2PL3A 5C1BA 2HCJB 4AURA 1XTIA 3LX5A 3TUZC 1DELA 1UADA 5FTKA 2KBFA 4CT4B 1AKEA 3QXSA 1G16A 1TMKA 5EJEA 5CLLA 3WYAA 2B7CA 1AGPA 4BRUA 1S96A 4BE7B 3OIWA 1SKYE 2WSSD 1YHNA 3SEAA 8OHMA 2UKDA 2ZRGA 3X1XA 1I4TD 4A2QA 2P3SA 121PA 2A5YB 4POAA 1QHNA 2J59A 1NLFA 1OHHD 2XZLA 1O87A 3W8NA 3GP8A 1SVLA 1DG3A 4JT2A 4DUGD 1E9EA 1N6KA 1FFHA 4BQSA 4G5QA 2WV9A 4QJ5A 5J4YA 1EFRA 1JNYA 4TMTA 5JWHA 4YXWD 2O8BB 1OJLA 3QIAA 1ELOA 5DI3A 5IF9A 2YOFA 2J0QA 4MYCA 3ZS9A 2ZU6A 5FUWA 1KK1A 4CEJB 2YINC 1ZIPA 2VSOA 4WIAA 5E3HA 4LPKA 2BDTA 3R8FA 4BECA 2PT5A 1MRSA 4R2HA 1I4LD 1ZUHA 1KSJA 1T9HA 1KNQA 4A2WA 4DUGA 4DLVA 1AJEA 2FGKA 1ZYUA 4YXWA 2WZQA 4ZCIA 3EZ6A 1LF0A 2R2AA 3UMRA 2D74A 2QT0A 1G1MA 4LJ9A 3Q72A 4CF7A 1W4CA 1WRBA 1J99A 4JL6A 3CNLA 1TQDA 3AM1A 4US1R 5LD2B 4JLPA 1GRNA 2ZYVX 4ABYA 4NCHA 2ONJA 4OL0A 5DISB 3B1XA 3FKSA 2W83A 3CNOA 5E95A 4IEIA 2FPMA 4I1SA 4P4TA 4YLGA 2W6JA 1MR3F 1QHXA 2XEXA 5LB2A 3NEJA 1LTQA 2QAGC 1T4GA 3CRRA 3VKWA 3DMNA 3M1IA 1N5JA 5M04A 2XAUA 4NZYA 3AGPA 1KO7A 3Q5DA 2IUSA 5FPSA 1NRJB 1VYUA 4FMCF 1E79D 3GJ8A 4KFUA 2ZS7A 3EWSA 4EKDA 5KPJA 1XPOA 1E4VA 4M1MA 4Q7JB 221PA 4TMXA 1MOZA 3Q85A 4BWYA 3U44A 1U98A 3LWNA 2B21A 4JLBA 5KSYA 1SGWA 1T5IA 4FCVA 4XWOA 3BC1A 3LVQE 2IT1A 3LXXA 4GFDA 2RGAA 3LBHA 2ZJOA 3I5YA 2NPIA 1XZQA 2D62A 1Q1BA 1E79A 1ZM2A 2FPLA 2YC2C 4TTPA 1IN7A 4QBFA 2HYIC 1K8RA 5TDHA 2KSQA 4FWTA 2BBOA 2VQSA 4QNMA 2HLDD 4NTZA 4XJXA 4C9BA 1II0A 1XJCA 1HY3A 2NPFA 4TMZA 3WNCA 4D81A 3B60A 3MLEA 3AF2A 2VHQA 3LBIA 5JCPA 5FH9A 1YR7A 2OILA 3GLGB 3K70B 3NIBA 4YDSA 2J0UB 3PITA 1OT3A 1GZSA 2H17A 1NJFA 4URUR 5KDOA 1X3SA 1NMYA 1RRPA 4RD1A 4RCZA 4D4JA 4EJSB 2WIAA 4TL8A 5FUYA 2SHKA 3Q7QA 4DCTA 3LQQA 4BFSA 2HLDA 5LBIA 4NYJQ 3QEOA 4W5JA 4TYQA 4P3YA 1QG2A 5EUQB 1NLZA 1TPZA 1W44A 1E0SA 3D8BA 4KCGA 5CYPA 3SYNA 3KTAA 1AS3A 1CU1A 2VHTA 1JR3D 5SZKB 2WWHA 3TVDA 4US2R 1WB9A 3T15A 4EPYA 3AP3A 5CYOA 2QP3A 1T0JB 4Q02A 2EWVA 3DOFA 2NZ8A 4FMDB 2JDID 2WOJA 4BLTA 2BVNA 4ZDWA 2QU8A 1T8UA 3QKSB 3T1QA 1CR2A 3QBTA 3GJ3A 3WRXC 3AVYA 1XTSA 4OK5A 1CJMA 3ADCA 1F3OA 2IXFA 3FPAA 1JXOA 3N70A 2YVUA 2B8TA 1M34E 1JR3A 3OF5A 2Z4SA 1KI1A 1L8QA 5KPDA 4Q4AA 2XB4A 2IHBA 1GUAA 1Z5ZA 3ZDQA 4MRPA 2I1VB 4V03A 3PUYA 1OSNA 1N5KA 721PA 2R6FA 4TYYA 2VH5R 3WYGA 2GZHA 5FPKA 1OXTA 4Z8YA 2GF0A 4RD0A 5FPHA 1DS6A 2A30A 2WJJA 1JQJC 1ZM9A 3HJNA 3KX2A 1XJ0A 2GTPA 4WXPA 3GPLA 4S2EA 4TLAA 1VIYA 2O52A 1UBEA 3CR8A 3AVVA 2ZJBA 5AJYA 1CRPA 2QL6A 4MQBA 5L8VA 2ZRKA 5K8IA 4LJ6A 4DLTA 1IN5A 1MO5A 5KHOC 3GQBA 1CS4C 4DZZA 4NBSA 3PEWA 4GL2A 3DM5A 1VTKA 4GT1A 3KXIA 3N5CA 3ETLA 4H1UA 2XB2A 4JLKA 5L3QB 1W7AA 5JMTA 5SZHB 3S1AA 1XTRA 4ARZB 4ACBA 3A1TA 1XMSA 4LBWA 4CDGA 1F2UA 4JLAA 4HAVA 1VHLA 2O0KA 2YWGA 5DYIA 3MUFA 4ZCMA 1W4RA 2GETA 3QXHA 1PUJA 1IOZA 3RANA 4CEIB 1UF9A 2RHMA 2IYUA 4PPNA 1IONA 2VLIA 3AH8A 4ZPXA 3DEFA 4H9GA 2OAP1 3LNCA 2QSZA 3TJZA 5CJPA 1QBKC 2IYWA 5GJBA 3A6PC 1P73A 2QMOA 5LPNA 1LVGA 3LAWA 3H1TA 1XMVA 1R0XA 1W0KD 3TK1A 3WXMA 4ZKEA 2VPPA 1I4DD 3LV8A 1XFAA 4M9SA 1XU4A 5DLQC 2G9NA 1G4UR 4FMCB 3M4YA 2Z0MA 2A5GA 1SKYB 3CH5A 1CEEA 1BH2A 2FFBA 5CDFE 2LKDA 4ESHA 1U99A 5FI1B 3ASYA 1MV5A 2RGDA 1ZD1A 1IXZA 2WWIA 2C9CA 4Q7MB 2YV5A 2ZRPA 5L3SA 3FGNA 2MMGA 3PV0A 5AK0A 1KYIA 3UMFA 2RH5A 1W0KA 1V5WA 1XXHA 3EC2A 4ZIRB 3QG5A 4OI1A 5D3MB 2GA8A 3HYTA 3IHWA 3H2YA 4XWAA 2OXCA 4DDVA 2ZS9A 2A7QA 3EA0A 3EZ9A 3CLVA 1OF1A 2O0JA 1Q1ZA 1ESNA 4TYNA 5FUVA 2NZJA 2VIIA 1P9NA 3SU8A 3ZQ6A 1KNXA 1TX4B 2KE5A 2F1HA 2ZPTX 3WMGA 1CXZA 1DBSA 2FSHA 3N2IA 5FOXA 5TVKA 3ADDA 2OLJA 3THWB 2BIFA 4IXMA 4UXIA 2ZVQX 4MRRA 3FHOA 2N42A 1D9ZA 1XMIA 4OJQA 1G7TA 2XITA 3B2EA 3CM0A 1Q1EA 2ORWA 5EP4A 5P21A 3FHCB 3KUCA 1Z2CA 1LFDB 4XTRA 3PVSA 1IY1A 2ZRCA 1KI9A 4IVPA 4YMVA 1W0JD 3H4MA 3K8YA 4MITA 2IX3A 3EPLA 1R5BA 1SXJB 2YC4C 4LHWA 1X8JA 2ZE6A 3QPUA 4B47A 4QJ3A 4CEHA 1YRAA 3CPEA 1XD2B 3PR1A 2QORA 2DCUA 1Y3AA 3A37A 4JS0A 4UJ5A 5J40A 2IUUA 4DWJA 2E1RA 2GJKA 2WM9B 3F8TA 4WAUA 1IHUA 2PCJA 2H16A 3CB4A 2F55A 2PBRA 4QBIA 1W0JA 3I62A 4CYMA 2XXAA 3QVUA 1T8TA 2KJQA 4Q1AA 3TMKA 4LJ8A 4JVLA 4PZYA 2WJHA 1N6IA 2ZJ5A 4Z1MD 1W49A 1RKBA 5FL3A 2QPAA 3AGQA 5HR5A 5DHFA 5B58C 3VHXA 1M1YE 2WSMA 2HF8A 3CO5A 1W36D 3TBKA 1EK0A 1M74A 1T0HB 4JLNA 4Q4JB 2Z43A 5AJVB 1JEEA 1XBTA 2QROA 3EWAA 5KSZA 2ASEA 2VP9A 1IN6A 2PJRA 1YZLA 2C5LA 1R0WA 3ZD6A 4X8HA 4NYMQ 1TF5A 5JWRA 4PSVA 4B3BA 1NMXA 3EZ2A 4DB4A 3K1JA 2WWWA 4Z1MA 5ELXA 1A7JA 1KMHB 1GKIA 4C2TA 4RZ2A 3AEZA 2O8DA 2WICA 4XOIA 3RDPA 1BOFA 4C0KA 4QFMA 4DT1A 2GVDC 2F3RA 3ASZA 4KFSA 4N0EA 5EE5B 4A4DA 4HDOB 1E0JA 1JR6A 1D8TA 5FPYA 3AP2A 4D25A 2PEZA 1Q0UA 3L8ZA 1R5OA 2RGEA 3OFND 3RS2A 2YOGA 1HH4A 1GL7A 1KJZA 2D4HA 2C78A 3BB4A 1P9RA 2ZRFA 4F4IA 1Z22A 4G5OA 2VYFA 4M1WA 3A1WA 1RIFA 2O8FA 4I1OA 3W3ZB 5FTMA 1KY2A 3RYTC 2DFTA 1X1RA 5AJZA 2EFEB 3AF4A 3ADKA 2AKAB 2J1LA 1CF4A 3GJ7A 3UWKA 4RFVA 4P32A 3OFNA 3W34A 1T3LA 5B64A 1B0UA 5K8TA 5G41A 5A0FA 2H18A 4B43A 1RRFA 4QXAA 2ZJAA 3G0HA 3K0AB 4C0HA 2IBMA 3DDCA 3W6NA 4V0NA 2AK3A 2EW1A 4JKIA 1G8YA 4M1SA 5B30A 3KUDA 2GAAA 4UQOA 4C7OA 3SR0A 1IQPA 1XB2A 4BEBA 2P2LA 1Z47A 1G3QA 2KBEA 2ZSAA 3GJ6A 1KKMA 1P2UA 1IJEA 1D5CA 2O5VA 4NCNA 5KNBA 1S1CA 4G5SA 1VPLA 1QDEA 3CZQA 4B48A 2A5JA 1FTSA 4QHSA 4OQLA 621PA 1S8FA 1T5LA 3OIUA 3RRMA 2CHQA 1VCIA 1G18A 4TSFD 2WWGA 1GNQA 2IEYA 4URXR 2NO6A 1DVRA 3NH6A 2FFAA 1NN1A 1W36C 4MDFA 1ZBDA 3K9LA 4A8JB 4EIWA 3EPKA 1XMJA 2MSDB 3QF7A 4UXHA 2WWYA 2QN6A 2Q3HA 2ZYUX 3LY5A 4IDHA 4CEJA 3P27A 5EQTA 1SVWA 3G82C 2W0MA 4MKIA 4WZAE 4BZPA 3ZZUA 2R62A 2PH1A 2IXEA 1YE8A 2WWFA 4PQFA 4TSFA 3TSOA 2ZI4A 1NKSA 4DCVA 2BCGY 1X6VA 4B2PA 3NBYC 1N6RA 4G0NA 4PQRA 3CRMA 4KXFB 1NLYA 2BMEA 2TMKA 2HEIA 1G4AE 2IL1A 3QF4B 2CNWD 5LB4A 2HF9A 4GMXA 3SJAA 3NBXX 3VX4A 4B73A 5BWMA 3V4FA 4FI3C 4PSKA 3SJCA 1KK0A 3BBPA 3WMEA 1T3SA 2F9MA 1NL3A 3UG7A 3PEUA 1NVVR 3NKVA 4IOLA 3ZH9B 4F93B 2FE4A 1FUKA 4MRNA 4TLBA 4V0LA 4DSUA 1N6HA 2KWIA 2ZRNA 1GKYA 1Z6YA 2VEDA 4FCWA 4PO9A 5JSZB 2JJ1D 4LI0A 1AN0A 1IXSB 4RJLA 4AG6A 3TAHA 1GRRA 3GJ0A 2IS1A 1VKJA 2CNWA 4AG5A 1US8B 4DIDA 4ZV4A 2ZAOA 4RY2A 2F43B 3ECCA 1I2DA 4OHWA 1SULA 4TQUS 1N0UA 2V9PA 1SVKA 3NWJA 3ZYCA 4YMUA 1P6XA 1UEJA 2VP2A 1HQCA 2G0TA 1KI3A 2F3TA 2HXYA 4DBLC 4HAYA 1N5LA 2EFHB 1E2JA 2D2EA 2JJ1A 2NQ2C 1FX0B 4BLQA 4KFTA 4BEJA 2C03A 1OYWA 1II9A 1W2GA 3BOSA 4Q9KA 2VF7A 3PFIA 2V3CC 4V02A 1JAHA 2H92A 1VHTA 2FMXA 2OCPA 2IYVA 3NDPA 2XTNA 4IHQA 5KYKA 4UNSA 1HQYE 3WP1B 3FWYA 2JLXA 1KSFX 2GEVA 2XNDD 4TMWA 4PC3A 2BOVA 5EXXA 3QKTA 1OH6A 4YMWA 1L7VC 4FXPA 2MSEB 1NBME 4NONA 2Y8EA 3L0SA 5EE1A 1Q57A 2B7BA 4V0ME 1HUQA 4G1UC 4XVQA 1EX7A 1HV8A 4TYWA 3AVTA 4AKEA 3BB3A 4RSGA 2J7PD 3H84A 2J0UA 1YZQA 4ERNA 4KITB 4E22A 5H1YA 2ZJ2A 1GIAA 5E7IA 1D9XA 2ORVA 3UATA 4XSGA 5CK4A 5JS8A 1XEXB 2ZE8A 4RKEA 5G40A 2XNDA 4KODA 1HTWA 4HAWA 4LHYA 4CW7A 1PVOA 3HR7A 4BFXA 1G41A 4R9UC 2QBYB 1S2MA 1U9IC 5FBQB 1P5ZB 4GBMA 3VR2A 1N25A 2W6IA 3EIHA 1XTJA 4OI2A 2O8EA 2AWOA 2J7PA 1Z0JA 3FDIA 4XVUA 1D2EA 1F48A 3WBKA 1GOTA 4S35A 5L3RA 2A5DA 3T35A 4HZUA 1DAEA 2BMDA 2R44A 1IN8A 4MGYR 4D80A 1JAIA 3CUEF 4KBGA 5F2EA 1ZNXA 1SHKA 3A4MA 2E87A 5JRZA 4MYTA 3DZDA 1TU4A 2OT3B 2NGRA 3QKSA 1GFIA 1J7KA 1CJUC 2IYSA 2OE2A 3IIJA 1E1QD 4O25A 1UDXA 2JLQA 2CL6X 5FOVA 3T61A 4B2LA 4JT4A 4HB2A 4DLYA 1CJKC 2QTVB 1S0UA 1Z83A 3N2EA 2YZ2A 4HLDA 5HE8A 2X2EA 3B1WA 3MWKA 4QNRA 1K6MA 1J8MF 3THYA 4DLXA 1KO8A 1U90A 1C4OA 1W48A 2EU8A 3WRYC 2VP6A 4EUNA 1Z07A 2VRWA 1OXUA 5TXGA 4Z51A 2W00A 1KI2A 1NVWQ 1E1QA 3QG1A 1GDDA 4UKDA 1XD8A 1ZIOA 3LD9A 2VHUA 2XJ9A 3O47A 4HSEA 4M9XA 1LS6A 5L3VA 3EC1A 1W46A 1XZPA 3TW8B 4DJTA 4P4UA 1K5GA 4LV6A 1QHHB 2QP4A 1R2QA 4FMBB 4B2IA 5BW8A 4M9ZA 1OE0A 3PIRA 1AQUA 2CL7X 2FJUA 5JJLA 5EE0A 4NCJA 1CULC 1CKEA 1KY3A 2J0SA 5BXQC 3PQCA 1KAGA 1HE8B 2GK6A 3C15C 3D31A 4D0GA 1EFRD 1OB2A 2C99A 2QMHA 5HTKA 5L3QA 1J90A 3PUZA 5FOSA 3RLFA 3U3KA 4MDEA 1F2TB 1AK2A 1AGRA 3CPHA 3QXXA 3KXKA 2HV8A 3K9GA 4BRWA 3HWSA 3GLIE 3GLIA 4DIEA 2XSZA 3BRWD 4W9MC 3HU3A 3SFZA 4GP7A 3K0FA 3VNVA 4QBGB 4WW0A 2ZR0A 2XNSA 3P26A 1X86B 4AKIA 2IYRA 2CMKA 3QKRB 1PV4A 4RZUA 1HT2E 3RS5A 5HZHA 3BB1A 3KQHA 5TV2A 4DHEA 2X2FA 3IO5A 1G8FA 3MD0A 4GP6A 3ZVRA 2QM8A 1CP2A 4OK3A 2B8WA 4A0FA 4ZI3A 4QHTA 2G83A 3FKSD 3KFVA 4JLMA 2ZRIA 1Z0DA 3RS3A 4BASA 2GXAA 4KLZA 3SHFA 2W6JD 3VU9B 3B82A 1WBDA 1E69A 4QG7A 2ZEJA 2V8OA 2GDJA 3MSXA 1VIAA 4FN5A 4ZIRA 1FMLA 2OXRA 5BN5A 4PPGA 3UXMA 5D3MA 1COWD 1DOAA 5UKDA 1G8HA 4KLNA 3L43A 1HEIA 2HYDA 1NN3A 5FBRB 4LHVA 1XNJA 4C0JA 1P75A 4CZ2A 3TAUA 1QF9A 2XZPA 2F1JA 4F4JA 1G3IA 1GRQA 1RFLA 4ON9A 4U00A 4DRZA 5JI3E 1WMSA 5FBLB 3L82B 3R9IA 2VP0A 1SXJD 1ESMA 3THWA 1JJ7A 2A3RA 1COWA 4LGMA 2G3YA 4OI0A 4B3FX 2H5EA 2KB0A 1EFHA 1ZU4A 4RD6A 3CF6R 1YR6A 4PSAA 2ONKA 1G9XA 3VR1A 3RNLA 1YR9A 2ZI7A 2YKGA 1L4UA 3IILA 3K0CA 1FZQA 1DTSA 2XTMA 2CK3A 4DDUA 3FMIA 3WNBA 3ZZ0A 1QHGA 5E4FA 1MABA 5B2ZA 1SXJA 4JBXA 4YONB 1G6HA 2QI9C 1KO5A 3U4QB 1N0VC 2FH5B 3AF1A 3RSOA 1E99A 2Z6VA 4DLSA 4QBHA 1XD2A 2AXPA 2CDNA 4KU4A 3VNUA 2GXQA 5F9FA 1ZCBA 2JJ2D 3DM9B 2GXSA 5DGXA 5FTJA 3GJXC 2CJWB 2CL0X 4JBYA 5KDDA 4Y0VA 1T3HA 3QNUA 5FPTA 3FHTA 2YHSA 2Q9CA 3LQRA 3LBNA 4HB3A 4W7SA 2JIZD 4KVAA 5HZKA 4W5HA 4RFSA 4B6FA 2WPDA 4E07A 3BWDD 2ZRHA 1U0JA 3KL4A 4IRUB 1N6PA 3C5CA 4GRAA 5CM9C 1IY2A 2JJ2A 4TLCA 4P31A 4NYIQ 1E2PA 3LLUA 4IKEA 4TLEA 3G5UA 3AVQA 4ZDJA 1GKUB 3VKGA 3ZS8A 3QENA 5BYKA 1Q1QA 2XJ4A 2C96A 1EFCA 2PCLA 1CJVC 1R0ZA 2JIZA 3V9PA 3IUYA 4O2LA 3PG5A 3QQ5A 1CR4A 4KBFA 5JHHB 1G7RA 4L15A 1YZKA 2VHJA 1ZW6A 3AUXA 3K0EA 3KDSE 3LH5A 4MGIR 3Q5EA 1R0YA 3CX7A 2QG6A 3BH0A 2ODEA 4ZDIA 1FNNA 2ZIAA 3VAAA 4URVR 2ZRAA 1C1YA 1HA3A 2CHGA 5CJ2A 4AYWA 1E2KA 2WAXA 5DI9A 3RS7A 5KOYA 1Z63A 3K0CC 1JR3E 1AQYA 1YRBA 4A36A 5JWOA 1ONBA 2LKCA 2ZTSA 1SXJC 3IEVA 5HKKD 3AVUA 3B1ZA 3GLHA 1R10A 3RS0A 2ZRBA 5IDVA 5JJKA 2QZ4A 4HLUA 3W5IA 1WDTA 4PO1A 4M53A 2WHXA 1FMJA 3GJ5A 4GPTA 4C0AC 4TN1A 4IVQA 4LYHA 2WOOA 3FTQA 821PA 1GILA 3L0PA 5IK2A 2QM7A 3TR5A 4UNNA 3SN6A 4NKRA 4Q1DA 3TW4A 2B92A 1P62B 4IOMA 2ZSBA 2F7SA 2OBMA 3R9XA 4GMDA 5EXSA 2QP9X 3NTUA 3SHWA 4EFNA 5HKKA 3ZVLA 3L0IB 4WZBE 1G3UA 2GCOA 2NO9A 2BJWA 5FUXA 4HDCA 1DEKA 3EZ7A 1ZINA 2ZU0C 3R7WB 2GEDA 4LUCA 2O8CB 4P4SB 2E9SA 2OESA 3AV0B 1KDPA 4E5UA 3V00A 2REXB 4ITRC 3U3RA 4DEXA 2JLRA 3QKUA 2ATVA 1NIJA 3IBYA 2G0NA 5KNCA 1DAMA 1Q22A 2JLSA 5TB5A 5IT5A 2QAGB 1G5PA 1KI4A 4Q4LA 4OBEA 1RPZA 1AS0A 3IGFA 4FIDA 1ZP6A 5J5CA 3VTKA 3GMTA 3IHLA 4HUQA 3UWOA 3CIOA 4LYAA 4UNQA 2R65A 3REFA 2BBTA 2FG5A 4LBVA 2P0EA 2EVWX 2J9RA 4D6PA 3RWOA 1GNPA 1BYUA 4LX0A 4OHXA 3I5XA 1G6OA 3KB2A 3CWQA 1VYVA 3VR5A 3DKPA 2O0HA 3NHBA 3P4XA 3HR8A 4HLUC 3SZRA 1E98A 1ZC4A 4FD2A 4JSTA 5JRJA 5G3YA 3VFDA 1U2RA 2EFCB 5DI3B 3WY9A 2VP5A 1E2FA 1WXQA 1XXHE 1RE0A 2GCNA 1E9RA 1ZNZA 2ERYA 4NPHA 1XP8A 1Y63A 2A2ZA 4PO8A 2F1RA 4V0KA 1QHSA 5KSPA 2OHFA 1P2VA 4LWZA 1KI8A 3LVRE 2WJVA 4LYFA 2D2FA 5CIQA 1Z6TA 4OK6A 3TRFA 1ZRHA 1L4YA 4KI0A 4RZ3A 2IYYA 2HDNB 4MA4A 3AQ4A 3R20A 4D0NA 3U3OA 3W3AA 4QKQA 2QGNA 1O3YA 4FCTA 1SZPA 3E5HA 2VP4A 2QMUA 4RD3A 2VSXA 4QGGA 1KZGB 3LW7A 2WVJA 1S4QA 4KV9A 4URWR 4I81A 4BPBA 2A78A 2RGXA 2BBSA 4PHHA 3GFPA 1EESA 2JJ8A 1S9HA 4AK9A 1Z0FA 3CH4B 1G7CA 4RKFA 2GJSA 1OFUX 1BKDR 2JAQA 2QMEA 1XEWY 3MWYW 3ADBA 4LHZA 3UPUA 4MYHA 1JXMA 2F1IA 2EFGA 4PPQA 3T5DA 4B71A 3IO3A 4OHYA 3FB4A 3U3JA 4JLVA 4TL7A 4D4MA 5HPYB 1L2TA 3F3YA 2J46A 2RB4A 2QT1A 1Q20A 4PXAA 4GZMA 1JPNA 2ZSDA 5FR2A 4IDNA 4MKGA 3RRYA 1E0KA 3TR0A 4Q7LA 3FYHA 3AKEA 4H1VA 2DR3A 3GEHA 5BQ5A 1KOFA 4NU0A 3BFXA 1GP2A 1Z0AA 1Z8FA 1GSIA 4KSCA 3O8CA 1GM5A 3SJBA 1PLLA 3MWJA 4GOJA 3RC8A 2ZI6A 3HU2A 3GFOA 4LBZA 4TQ9A 3UMSA 1KJYA 1E94E 4TWZA 4RVCA 3PUXA 4NL4H 4EPRA 2UVQA 2W2XA 2WMOB 4M4SA 2IYZA 4N1AA 2CLSA 2X8AA 3CNNA 2QBYA 1UKZA 1TF2A 1JBKA 4BLRA 3MJHA 1EG7A 1GAJA 1RZ3A 4F4CA 2IK8A 4WZ6A 2WMNB 4Q66C 1OFHA 4OQNA 1P61B 4HAZA 1UBFA 2ZYWX 5TY0A 3F5FA 4ZKDA 3JVVA 3GLFA 2BEJA 4L9WA 5HE9A 2IYXA 2Q3MA 2C04A 4B44A 3JZAA 3KKPA 3C7KA 1HT1E 2D7CA 4B76A 1JI0A 1B23P 2G6BA 1KTVA 2QAJA 2JLWA 1ODFA 4HB0A 2V7QA 4B35A 3AVXA 2IF2A 1A4RA 4K46A 3KTAB 1ZNYA 3EARA 3EW9A 4HUTA 1NG9A 2BHRA 2CVFA 3I32A 4EAQA 4TTQA 4JJKA 3O8RA 3ZJYA 3EZFA 1MO3A 4PC1A 3ND9A 5IRCD 2NMVA 5KO2A 5BN3A 2HT1A 3AF0A 2GZAA 4NMMA 4OQMA 4TMVA 5DN6D 2KI5A 2CE2X 3B5JA 2RHDA 4UJ3A 1A5TA 3SJZA 1P60A 4JMPA 2G77B 2FSFA 3I8SA 5A5GA 4M2LA 4B74A 4DXAA 4RD4A 5AJXA 1NJGA 1WQ1R 3KJHA 1WF3A 3U7GA 3B9PA 3SNHA 3ZQJA 5C2JB 2FGJA 2DWQA 2OG2A 2WIBA 2ZS8A 4NYJR 1AKYA 1E2IA 5DN6A 5F3WB 2IS6A 1OB5A 4U5XA 4YDHB 3A1VA 3IIMA 1XCMA 1D6JA 1Z6AA 1UDWA 2BKEA 3TH5A 1MO6A 3J81k 5C4MA 3I72A 1F2TA 1JQLB 4NCIA 2GCPA 4L16A 2AD5A 5KNDA 3OE7D 1G8PA 4JYCA 2XGJA 5EZ5A 1E3MA 4O3MA 2GILA 2IWRA 2JLVA 1P2TA 2DFKB 3EA5A 4X8MA 4TYPA 3ZIAD 3O8DA 4URYR 2ZREA 3TVTA 1ZAKA 1PLKA 3T5GA 3U5ZB 1OXSC 4O2RA 2C2HA 4F92B 3CF2A 4AI6A 2PLRA 3VHLB 1M2OB 2Z83A 2Q6TA 3PJRA 2O8BA 3K9HA 4QGHA 3LRPA 2X77A 3NDBB 1TNDA 2DY1A 2AHOA 4X8OA 3S1AB 4LC0A 4B75A 1E6CA 3OE7A 2EWWA 2X19A 1F2UB 1GL9B 2PLFA 3A1UA 4Q1BA 4EPVA 2ZROA 2EQBA 2BC9A 2ZI9A 4LBYA 5GJWC 3ZIAA 2CLDX 2IEZA 3MGCA 3OESA 3FMPB 5C46F 4MYUA 4HB4A 2FFHA 5JI2E 3W6PA 3T1TA 3CRVA 2J45A 5KTYA 2ODNA 1VG9B 3LXRA 5E7MA 1FUUA 3DMDA 2ZR9A 4DSOA 4WXRA 1GG2A 2CLCX 4TMKA 4BFYA 2DYKA 4PAQA 1E2HA 3U2QA 3GEEA 2MSCB 4NH0A 1NG1A 2QY9A 4A2PA 1KZ7B 2HUPA 3Q8XB 2J3EA 2IHYA 2EYUA 3VR3A 5AUNB 1Z3IX 2VA8A 3UK6A 4MH0R 1E1RA 3B1VA 2GJ9A 2WAYA 3IPXA 3KQKA 3U7FB 5L3SB 4M8NE 4A0HA 2RAPA 4Q1EA 1G17A 5HCIA 1IM2A 3LDAA 4YMSA 1KGDA 3PUVA 3FMFA 2VF8A 1RRCA 2PT7A 4N3NA 1E2DA 1CR1A 1R8QA 4AWXA 1DE0A 5AUPB 5FTNA 2AFHE 1DAKA 1Q3TA 1YR8A 2REOA 3U61B 1U0LA 1UEIA 1EFTA 1E9BA 2PZFA 3MAAC 2VBCA 1NI3A 4YC7A 3PEVA 5FFMA 2IF0A 2CBZA 3K70D 4B3XA 1R8SA 3P32A 4PC6A 4V0OA 4LY6A 5C4GB 2CXXA 5FBVB 4BZQA 4I1UA 5EXPA 1FNMA 2FDCA 3AKDA 2WKRA 3B9QA 3C14C 3O8BA 3U3MA 2WTUA 3FKQA 3OIVA 1TQ6A 1G19A 5FOTA 3A4NA 3AVOA 2DPXA 4PHFA 3W90A 1NN5A 1OFIA 1Q3HA 2W6ID 3GLGA 1E2NA 5CM8B 2REBA 3BH6A 3X2SA 4DSTA 1A82A 3BXZA 3QOFA 2OZEA 3CX8A 4DLZA 1CJTC 4GOXA 4EJSA 1NY6A 2NTYC 4Q9JA 4P33A 4ZDKA 2FEMA 2QGZA 1KKLA 4CEHB 5DE3A 1NSTA 3TKLA 1NP6A 1UPTA 5LD2C 1DO0A 1N6NA 1DADA 2Q21A 4D4KA 5GJCA 3LLMA 2NG1A 1YZNA 4LJAA 3MFYA 3P1JA 1IAQA 2CE7A 2WJGA 4HATA 1NKTA 1NVXQ 4LJ7A 4PQYA 5EE3A 1RJ9B 2ZJZA 3MG9A 4KO8A 1A1VA 2IS2A 2ZSFA 2XZOA 1TEXA 3TUJC 5AUOB 1DAFA 3WYFA 3T12A 2YWHA 4F38A 2DB3A 2P67A 4MKFA 1LY1A 1LW7A 1PJRA 3HP1A 2LCFA 1TADA 4IXNA 5C18A 2CCGA 5JECA 4IFBA 2IUTA 4U02A 2JLZA 4BFVA 3WBJA 1E9AA 2BJVA 1KDRA 4JBWA 3EG5A 4CVNA 4CT5A 4JVMA 2VHCA 2W58A 1VG8A 1I2MA 3PXGA 1SVOA 5GVRA 4ILEA 3LO5A 1OPXA 3AB3A 4ASUA 4DT1B 1W36B 4ZO4A 1XEWX 3U7EB 1JB1A 2FSGA 2IC5A 4DVGA 4F7WA 1C9KA 2W2TA 2IYLD 5EUMA 4A92A 4BZXA 3U6KA 2HJGA 2DHRA 2GAOA 3K70C 2RGGA 2D3WA 2PMKA 5AUQA 4MUBA 1GNRA 3UKDA 3TLXA 1NY5A 2AX4A 3LA6A 4ZCLA 1FP6A 4EJSC 2XSZD 1VECA 1J8YF 1KDTA 4C0QC 4QM6A 2QE7D 1DO2A 2ZI3A 4BUJA 2H1LA 4HAXA 3SBDA 3GFTA 4MRSA 1XF9A 2P5TB 1VCMA 5DHAA 4ARZA 1RW4A 3VKHA 4NYMR 3FVQA 3KFXA 1YVDA 2IW3A 2GBLA 3A8TA 4MKHA 2IXGA 4PR0A 4CEIA 4FMDF 3X1DA 4M1TA 2OLKA 3M6AA 3BS4A 4Q01A 2F9LA 1M6NA 1J2JA 1P7CA 1IN4A 1Q44A 2QE7A 1Z6XA 2R6DA 4AY2A 1OXVA 5SZIA 5TARA 3L2OB 1S9DA 4YMTA 3CZPA 4II7A 6Q21A 5FBWB 2I3BA 2FEOA 2OBLA 2NO0A 2ODWA 4C7OB 1UBCA 2W2VA 4EPTA 1BS1A 4I1VA 1G5RA 5FOUA 4WVFA 3ICQB 4QJ4A 1KSHA 2OCBA 3CX6A 1KSGA 4EPXA 2ZE7A 2D06A 1P72A 4KYIB 1XEFA 1VDZA 2NIPA 1WA5A 3ND8A 4M22A 3EAQA 3OHMA 3THXB 2FPKA 1PZNA 4QL3A 2F6RA 1KK3A 2ZJ8A 4EQ6B 3DZ8A 4CGZA 1ZMXA 3OEED 3D7MA 4CRWB 4KSBA 4R2IA 1W4AA 2DFNA 3IPYA 1E9FA 1R7RA 3HPQA 3UIEA 3X1YA 3RS4A 4GI7A 4TZ0A 1M7HA 4UXJA 3A1SA 1YZTA 3A36A 5J4HA 5J4LA 4L5BA 1XJQA 2WSSA 1TL7C 2EYQA 4UNRA 4AYTA 4R7ZA 5CB6A 5KUTA 5G53C 4NDZA 4TZ6A 1OHHA 2BWJA 3QBVA 1N6LA 3RRZA 1FL9A 4DKXA 3OAAD 3OEEA 5JZVA 4U7DA 1SVMA 4KYUA 4D4LA 1JALA 2RGNA 1ZJ6A 1GL6A 4QM7A 4EPWA 2CK3D 3I61A 3SFVA 2BEKA 4KAXA 3F0TA 5EP1A 4BLPA 1LS1A 1E96A 4Q9HA 1Z08A 3RC3A 3FFAA 3WHKA 5SZJA 3M0EA 3QUSA 3B78A 1SQ5A 2ZRMA 3TNFA 2GBLC 3QPVA 4YQFA 1ZM4A 2HT6A 4N0DA 2ZUCA 3NBFA 1N6OA 5ANRB 1ZNWA 2QTFA 3OAAA 3RHFA 4X8LA 2C9YA 4XH9B 2X1VA 1KJWA 5BN4A 2ZVPX 2OFXA 3W6OA 1P9WA 2ZUDA 2JEOA 2WWXA 4Q21A 1FTNA 1KAOA 1NIPA 3BFVA 4K8OA 2FF7A 1SXJE 4AIIA 2FA9A 3BH7A 1YQTA 4RD2A 4EFMA 2K5UA 2WPDD 5JEDA 2G1KA 2QSYA 2V6IA 1YU9A 1E4YA 2J7KA 1ZD9A 4PANA 4Q1CA 3NEYA 4PC7A 2Q3FA 2L0XA 1W5TA 2UZ3A 2CVHA 3AVWA 3GJ4A 1IXRC 3RAPR 2JLYA 2QENA 2GESA 4I4LA 4M1OA 3PENA 2B6HA 2ZRLA 4IEEA 4B3GA 3X1WA 3DL0A 1ZM3A 2QA5A 1QRAA 3E1SA 1CR0A 4G3XA 3ONWA 1Z29A 1UFQA 1MO4A 4JJZA 2FFQA 2W0SA 3RABA 5GVSA 4JLJA 5JCZA 1J70A 2GNOA 4E09A 3ICEA 4D26A 3B13B 3MMPA 2AL7A 1BIFA 1A2BA 2ZRJA 4Q4JA 1H8HD 4TTRA 1W5SA 3TSWA 3QEJA 5DO9A 3K9NA 1T6NA 1XRJA 1LB1B 2CCKA 4JYBA 4JZKA 1E32A 5H70A 1E2MA 1HURA 4DSNA 3KQUA 2GWHA 4TLDA 2RGNC 1M7BA 2VL7A 2JLUA 2R6CA 1KO1A 2ZITA 3KKNA 1H8ED 3PUWA 1KMHA 3BGWA 2C98A 1WE2A 3CR7A 2BV3A 4FINA 2ZXUA 3LFUA 3QY0A 1R5NA 2GXUA 4FWIB 4M0LA 4IVRA 1H8HA 1U0HC 2OSBA 3GCGA 3ZZTA 3IKJA 3RWMB 1E2EA 3EPHA 2ZYTX 2IWHA 1NVUQ 4ACAA 3EIQA 2JASA 1BMFD 2O8EB 4DLRA 5IK2D 2P5SA 4JIMA 3KJEA 2AFIE 5FR1A 2ZR7A 4LK2A 1R4AA 1XCGB 1UAAA 2D7DA 1H8EA 2V54A 4BFZA 4LZZA 4HZUB 3GLHE 3NH9A 5KDLA 3UG6A 1M8PA 1Z0KA 2AK2A 2I4IA 4K81B
chains in the Genus database with same CATH superfamily
2OBNA 2WBLC 5JD6A 2GPBA 1H2HA 4ONEA 1VA4A 2HGSA 1X77A 1G1AA 1UJ6A 3AF3A 3HBJA 3L7NA 4KQEA 5DNYB 5COBA 4Z3DA 4IL5A 1CTQA 1BMFA 1Q21A 2AYZA 1RWXA 1SUWA 2ZAGA 3BZWA 3FFBA 5LQDA 5F7ZA 3O31A 1R66A 1ECBA 1OTXA 1M1NA 2DUNA 2O2GA 3EASA 2IVFA 3K0AA 4C6HA 2VTDA 3GCWA 1EDZA 1P17A 1ZSYA 1J09A 4AS2A 2QNBA 3AR6A 3LK7A 2PLAA 2YDYA 2JDIA 4LYGA 5LXTB 1RVDA 3LNTA 1JEJA 1RM0A 1BXRB 1VDMA 3MD9A 2C4MA 4ZRNA 3K9FC 3FTFA 3IVAA 4DM3A 2H7YA 3C7CB 5HDBB 5BSKA 3F78A 3FMOB 4HWSA 3TB4A 4UREA 4IEFB 4C4ZA 1WM1A 2D0DA 1E0AA 521PA 4LF5B 3GDGA 3FCAA 3JRXA 4I2NA 1ZH8A 1W47A 3U6BA 3RAGA 3IP6A 4UNPA 5JSUA 1D1SA 3SDZA 1M6VA 1SHZA 2O3TA 3MWFA 5D6NA 4FOLA 3ZTYA 4KJZA 1UPCA 4Q4HB 4QYWA 4WXYB 3TR6A 1MIHA 1XPJA 2JIOA 4PHTA 3OKCA 4HLCA 3DTNA 4W8GA 4LOJA 1NA5A 2WZBA 1A0OA 3WAGA 2O2SA 4PLFA 2A0YA 1L7RA 4MVJM 2C2BA 2NADA 1BHQ1 1RRGA 4Z9FA 1TIPA 2Y0DA 5G3ZA 4PG4A 5ALTA 5HJEA 1YDFA 1AMNA 4TLLB 3GEDA 1CF2O 3OU2A 3LCCA 5DYWA 5A3QA 1U31A 5E1BA 2J4CA 3E58A 4E3WA 2B30A 4B40A 2OCAA 4O6VA 3HLKA 5I8WA 2HA4A 1QV7A 1N1GA 3B6ZA 3PHJA 5KYGA 3EQZA 2QNIA 4IXWA 3GLIB 3KZ1E 1VG1A 1Y33E 3ZHZA 4L8VA 5BV8A 2P41A 3I23A 1SCAA 3L93A 4QICA 5ALIA 4BCBA 4CMHA 1W1WA 3K0FB 3LMKA 4PC2A 1P1BA 3EAFA 3EH2A 1Y8QA 1NC3A 3HJBA 3CT6A 2X0DA 3ZY4A 2R8XA 3VV3A 13PKA 2WQZA 2NYUA 4CF6A 3NZEA 2R25B 2MSLA 4HK4A 3TRIA 6CHYA 4EF5A 3G7NA 3IQXA 1KJNA 2RHTA 1WPGA 3SVZA 4B34A 1U9YA 3T94A 3C3EA 1QO0D 4J7AA 1FCJA 4LWQA 4C6RA 3KB8A 4Y2UA 5A4MS 4EY6A 3K1AA 1C30B 5JSZA 2YYZA 3EBLA 3VVLA 2VH2A 5CDFA 4OHCA 1EK1A 5I7EA 2ISQA 1UQTA 3IQWA 4CL8A 4A5OA 3UJCA 3BJMA 1ZGCA 2P6UA 1T9CA 1U2DC 1US8A 2NOAA 3I04M 4IH9A 4DYVA 3OY7A 1PTJC 2Q4OA 2AQHA 2HA2A 2V4MA 2Q4RA 3JD1A 2PNFA 3Q1KA 5I4CA 1E6EA 4F2DA 5I7FA 4R69A 5FI0B 4KIFA 4IZHA 1RYZA 5TQVA 1UBNA 4OI4A 5DNUA 4JUAA 2M2IA 2KMLA 1QVRA 1H6CA 2FZLA 1J21A 3MRVA 2EFJA 1Q91A 4RV5A 5I7HA 4OMDA 1LI4A 4QRHA 2HSEA 3SS9X 1KIMA 4KQ9A 4D9EA 2BZ0A 2G5GX 3B38A 2XRFA 1RPAA 1XZLA 4OM8A 5IU6A 5EJAA 5BMOA 4AD8A 2P1ZA 2FYTA 1HFKA 1ZGJA 2BM0A 3PFHA 2VJCA 3L3BA 3ES9A 4LXXA 4ZI7A 5A4JA 1J49A 2CKMA 2QUBA 3ZD7A 3WMFA 1T9GS 3W7AA 2W8BB 2JATA 5BSFA 5CFRA 1PJBA 4Y2HA 1QORA 5DT9A 4AU1A 3RU2A 2V59A 1GGKA 2OXTA 1QKJA 4BO9A 4UQLA 4K5QA 4MVCA 5LN1A 1Q12A 2XZTA 5M2QA 4GHWA 3GH3A 5BSMA 5IJZA 1GZ4A 3EOBI 2QSUA 5AVJA 3UJ7A 1YFJA 1C8KA 2O3QA 3PQDA 1B43A 4ZVLA 2SNIE 3E05A 2BM8A 3S1SA 5K01A 2G8NA 1YQXA 1F6DA 4BKRA 4Z0NA 3AF5A 2RGBA 3KLMX 5C5CA 4CKCB 2AZMA 2O1XA 3N6RA 4A1FA 1M2KA 1BE8A 4BO3A 5ITWA 4QC2A 1YAHA 1Y7TA 3TMYA 7AT1A 5LQNA 5B36A 3AHDA 4MV0A 2BFFA 5KNLA 4CIDA 1L5QA 1W6RA 4JEMA 2QRNA 2V7UA 2CSXA 1T8YA 2O07A 2Z30A 1XDWA 4W82A 3KT3A 5LDDC 2V7QD 3GOQA 2C8VA 2Z3ZA 1KDOA 4GNKA 4MW7A 1NAIA 3CLUD 1GKLA 2OV1A 1F2VA 2IJGX 3DFUA 4YRBA 5I7WA 1YJCA 1QC5B 2N46A 4TT3A 2C3PA 4YAIA 3TZKA 3GDWA 3HKEB 3RVBA 4C0WA 3EEYA 5SYAA 4GS5A 2ROQA 1QO9A 1K66A 1VE5A 2VCEA 3M49A 1SOWA 3MB5A 4KXVA 1F8UA 1DUSA 2FN4A 1DQSA 1OIWA 2HNKA 2WW8A 5BSUA 4TVOA 3EXFB 2JHGA 2GOYA 3LP5A 1OD6A 2IYNA 1O95C 2ZJYA 4HXEB 4ZHQF 3OT1B 4AJ1A 3KWFA 3IEPA 3BE4A 3PUKA 5EXTA 2ODAA 3DLPX 4D6XA 3FDZB 4WKNA 1G98A 1Z39A 1OH8A 2PJZA 1EZ1A 3OURA 2WU3A 5JH7F 4IDEA 2HSGA 3WGGA 4DC9A 3I3SR 4DLWA 1QHYA 5CG1A 2JCVA 4JLDA 4C2AA 4JGBA 1TUIA 4DADA 4NBWA 3KJXA 3UK7A 1YS2X 1Y6QA 1NXWA 1RD4A 3U48A 3D3WA 3K09C 4JJEA 1M8GA 2C7BA 4XOUA 5HM8A 1REQA 4RH1A 2F3PA 1X8LA 1CZRA 3LRTA 2Y1WA 4G5RA 1BRTA 4QUKA 3ICCA 5U1PA 4ZJUA 2AFIB 4WBNF 3GUHA 4EKEA 3U81A 2P27A 1QHHA 1LK5A 3UXHA 4Q48A 3V4PB 7ABPA 3A0UA 1E8NA 4X24A 2FWIA 3FDJA 4Q4AB 3UN1A 4RTNA 1A5BB 3REGA 1IUNA 3S0JA 3BEOA 1E7YA 1L4EA 1AZLA 1SK8A 3HBLA 3BVPA 2PQ6A 5H8WA 5LYJF 4B2YA 1WSWA 1FQJA 1EVYA 2XOKA 3DF7A 4UBLA 5C0OE 3SBEA 5C5DA 5JEEA 1HTTA 4LF9B 1I24A 2V03A 4C1BA 3OKFA 4XQGA 4UVEA 4PLHA 2ZM5A 2AG5A 2CEAA 2QQ0A 4G4SO 4KLCA 1ISGA 3BILA 4DM7A 3OFVA 4MMYB 3UMVA 3WB0A 4E03A 3FCCA 4OFXA 1BCRA 4EO9A 5HWSA 5BSTA 1EGAA 1AM4D 3PHCA 3T9BA 4A23A 3I6ZA 4Y6LA 1S7CA 2YWCA 5DNWA 5A4DA 3E4CA 1LUAA 3L1IA 5FQOA 4EZIA 1YKFA 4FFMA 1VKNA 2QPTA 1OYVA 2OEPA 2P2DA 4BFTA 3K2IA 3RRNA 3FGPA 4PU0A 1YRWA 3PXBA 2Q2NA 1ZCAA 2VQDA 1L5HA 1FFGA 2C9OA 4D3YA 5FEUA 4GDFA 3QOXA 1CC1S 5ESWA 1U1GA 5LZ7A 5DSZA 1X7XB 4W1QA 4EYGA 1W581 4GZLA 2C5AA 4P7JA 4TS9A 1JWLA 3MJRA 2DU8A 5AVRA 1NNSA 1SCUA 2LPMA 3KL2A 4NU5A 4XLTA 5I9NA 3D9QX 3S4YA 4LC1A 1KP2A 1ZWLA 5BY2A 2X23A 3X1MA 1YUMA 2DPGA 3FJOA 1YIOA 5LKAA 4JA0A 1P33A 4CF4A 1FEZA 1QOZA 3BSFA 1DAPA 3A3PA 4J29A 3A1FA 2NTVA 1J25A 1D2NA 4L4UA 4Q1VA 3ZU3A 2W6MA 3CKKA 4PNZA 4XGKA 2GK4A 1TM5E 2C3OA 3IDQA 4ZEWA 3G1WA 4WPGA 5ABPA 2Q5HA 2FNAA 2H1VA 3PPXA 1N0WA 2P1RA 2WIFA 4V2IA 3W6ZA 2W42A 2HOQA 2G67A 5EP3A 1ZUIA 4OMUA 2PX2A 2Q9BA 2G76A 3HU1A 3NI2A 5CCDA 2AYYA 4BLSA 2GKOA 3ML1A 1CBUA 5IVDA 4G5GA 1KC3A 1A95A 1WPRA 2YRXA 3OFSA 3PUJA 4IDOA 4BATA 1RC8A 2FFJA 1WR8A 4WINA 1L4GA 1CQPA 3EIEA 1A9OA 3LUGA 3NNNA 4NV0A 4B8WA 4Y0NA 4HFRA 4R05A 1DBRA 1RCFA 3C3KA 1Q2XA 3UK1A 1MX1A 1RTTA 2J08A 2PX8A 4MGKR 3SC2B 1N4DA 2FMIA 1Y81A 2WHRA 4UMEA 1CY1A 1JJFA 3CJRA 4GI1A 3NOVA 2Z4RA 4BX3A 5YASA 3T9DA 2JFPA 1NNUA 3MCTA 2CHVA 5SYNA 2XWJI 4PR3A 1XPRA 3KXLA 4ZCTA 3VYWA 2QW8A 4IMRA 4KIWA 2RKOA 1NZDA 4F3YA 4N01A 2FTKE 2OM6A 2WTXA 2II6A 5JSKA 1JFLA 5CW2A 5HCNA 4D57A 2YNMD 2XX3A 5F78A 5ECDA 5IPFA 3L7MA 5K0ZA 5IKMA 2CXHA 4I55F 3E70C 3G6KA 3PRKE 3IVXA 4TM7A 3WLMA 1TYDE 1V11B 5IWCA 5TGZA 4E5KA 1YONA 2ASVA 4W5NA 3DVAA 1OH5A 2RGYA 4XYEA 4NHOA 3BRQA 3QVGB 4MJ7A 2ANCA 3V8MA 1V7CA 3ESAA 4Y7DA 1Y7PA 5K0BA 5EIFA 4DRXB 4DMGA 4ER7A 4FFLA 3C45A 3GEPA 4PZAA 3T7AA 4ARIA 3WLQA 5JW6A 5BOSA 4KQIA 4ALNA 2JZCA 4UULA 5CVCA 1VOTA 2PGLA 3IUPA 4P4LA 4DA4A 3MJSA 1OGIA 3C43A 3PRHA 1I5OA 4FJ1A 4GM4A 4PSUA 2G5CA 5HUJA 2V4ZA 4X71A 3ZWXA 3AHCA 3E1GA 1VPVA 2H31A 1JHPA 1K9VF 2A9OA 2H00A 4V0QA 4Q03A 3UPTA 3UBTA 4RMGA 1TYBE 1Z82A 3TGWA 3FCUB 5AKEA 5FLEX 1XPUA 4Q9IA 5BYJA 1M5TA 1LNQA 1PFGA 3KUKA 3UC5A 3B1KA 1XDUA 2MSKA 3OJXA 4HZIA 3V4LA 3C41J 5KIAA 2CDCA 2MSWA 3GJRA 5JH7B 2PMDA 1ARZA 4GNRA 2B69A 1J0EA 3Q6NA 2JGKA 1O96A 5ELMA 1NBMA 2NVUA 3C3WA 3EGIA 5B3JA 3NETA 2IZ7A 4MPTA 4DMKA 2HU8A 1GY8A 5TMBA 3VYTB 1DKQA 5D00A 2EBHX 3KSRA 4CKBB 1FJXA 1R9MA 2RCNA 3FDFA 3SFTA 1MRNA 4WLFA 1FLDA 1Y4SA 2XVXA 2RI6A 1PV1A 5BQOA 3V9AA 1H2AS 2PYZA 3H19A 3DB2A 3IRUA 5HS6A 5B4VA 1P6UA 2RG1A 4PXYA 3QEAZ 3MS2A 4RK5A 5B37A 5GJVC 3WHLA 4IGIA 2PRJA 3VR4D 8MHTA 2JHCA 3SYLA 4M1QA 3URMA 4ASUD 4IDDA 8AT1A 2IVZA 4FFPA 4N12A 4DDHA 1Z6GA 3TEMA 1ZFNA 4L22A 1B3RA 4RK4A 4BXOB 2R1VB 2ZWPA 3VC1A 4TX1A 2PAFA 1E66A 4I8XA 4E46A 3PGJA 4RE6A 1XPOA 4KYTA 1ZMOA 4QUBA 1F2DA 1PN3A 2X8JA 4OV6B 2IYTA 1SNYA 2GF9A 5FEMA 1XA0A 2D4AA 1LC3A 1G291 2I03A 3NAGA 3H4IA 4TSRA 1J0CA 4LKOA 3P9KA 4TL6A 3DLHA 2VHXA 2DR0A 2ZUBA 4WCDA 4Z8XA 2O8DB 4JL5A 1OT5A 4KWCA 5WRFA 1NRXA 1QLHA 1H6DA 4PCVA 3DHVA 2Y9PB 2R1TB 1WSDA 1Z0UA 4MAAA 4YQEA 4PNEA 4NK4A 1NBIA 1PRYA 4MUGA 4TS4A 2P75A 3PC8C 1E5TA 4DR7B 3PIDA 2ZAMA 3PX2A 4YCBA 4J3JA 2QQ5A 4DR4B 1SFRA 1XDZA 3DEHA 3KUXA 2ECFA 4XTCS 3T4UA 5C8VA 1C0KA 3CONA 3HRKA 2WWRA 5LP1A 2O8FB 2HU7A 3NVAA 4FFSA 3E3OA 4RNCA 5F9HA 1C0PA 4PLTA 2YXBA 1BXRA 2Y1KA 2GEUA 4P3PA 4MQLA 1PJAA 5HF6A 4BNLA 1Q1NA 2O8CA 3PVZA 2DPMA 1Y1PA 2QR5A 1L9KA 2WEKA 4LPSA 5CDYA 2M6SA 4B0PA 3RNOA 2Y68A 3GRFA 3AFMA 4GVLA 3VSBA 1DRUA 1EJ2A 1NUUA 2JF0A 3F73A 2EQ5A 1H5QA 4Q4HA 4S0ZA 2BUBA 1YKSA 3KWMA 4Q18A 4S1NA 2PX0A 4KLAA 1T43A 1XQ9A 2G9RA 4EY4A 1J22A 1A8IA 4XD7A 1T29A 2D7JA 2P9QA 3R3XA 1JL3A 4PWZA 1VRVA 2CF6A 4IJWA 4YECA 1AUQA 1X0XA 2PL3A 2YHIB 2HCJB 3GARA 5HF8A 5CT8A 1JI3A 4JKOA 3HNOA 3O93A 5H83A 3LF2A 3HA3A 1KU6A 3NEPX 4DY4A 2P90A 5ALVA 1IAVA 4JVOA 2G04A 3K6KA 3EGOA 1UADA 5EJEA 2KBFA 3QXSA 1NOJA 2X6RA 4ALIA 4CV0A 2PWYA 3CRNA 4V38A 2CLLB 4YRDA 3TX2A 3WYAA 1AGPA 3RYFB 1S96A 2DECA 3OIWA 1SKYE 3SEAA 4BRUA 7MDHA 2W2PA 2JAXA 1I4TD 5JE8A 4A2QA 5IYZF 1U1IA 2A5YB 2AOUA 4POAA 3CEMA 1PFQA 5BXYA 2XZLA 2P35A 4WV3A 1SVLA 1DG3A 3DB1A 3FTCA 3JQQA 2ZAIA 1N6KA 4REQA 2O0MA 4QJ5A 2WV9A 3ZDZB 1JNYA 3E3NA 4HL6A 1RYYA 4I1IA 1WJGA 1OJLA 2TMGA 1ELOA 3GPBA 3QIAA 1ATZA 2BLLA 2YOFA 3GXOA 3ZS9A 4I55B 2QJRA 1CQIB 4ZYTA 2XTJA 3E9EA 5IEBA 2HQ1A 4WIAA 2ATCA 2RGRA 2Q5OA 4LPKA 2BDTA 2GUWA 5DCUA 5IJ9B 4ZVSA 3SXJA 1DC3A 4J7UA 1T36B 1PYGA 1I4LD 1ZUHA 4MYRA 1T9HA 1DI0A 3AR7A 3E2MA 3PDJA 1HT3A 1QHEA 4DRYA 4DUGA 2X14A 3JQFA 1AJEA 1UJCA 2FGKA 2XYHA 1DO8A 1ZYUA 2KPOA 3NALA 4F4JA 4O1HA 1ZJZA 2XNCA 1LF0A 3GNTA 4BVJA 5LWQA 1JGTA 2PD3A 2X7HA 1G1MA 4MEJA 1FDVA 3GFQA 4B3TB 1N4AA 1TKCA 1JFTA 2EX1A 5GONF 1UT8A 2H4WA 2WB4A 5A3RA 3H11A 1LRLA 1GRNA 2ZYVX 3WLFA 1V3VA 2D0OB 2E4WA 2ZOSA 4NCHA 4ZICA 5A4AA 3NPAA 4GEGA 2VUHB 4MW4A 4OL0A 1PT7A 2NSYA 3FKSA 1BSVA 2WFZA 1SZJG 2J5RA 1CNMA 3ZU6A 4F5ZA 4Y3UA 2IFTA 1MR3F 2N75A 2FZ5A 3EGDB 2R85A 2XEXA 3V8VA 2Q4BA 4B4DA 3CRRA 1X38A 4IQGA 3RADC 3FUVA 4IG4A 1UKBA 4P84A 4NZNA 5M04A 4NZYA 1U8FO 2WU1A 4E2WA 3R7SA 1P0MA 2W8BA 4WXEA 1XK6A 1NVMB 3OZEA 3O2SB 1E79D 3DMRA 5CXXA 2M6KA 5HOQA 3ELDA 3GJ8A 1PJLA 2VJKA 3BWBA 5ALDA 2AOTB 1T6YA 2BFDB 1Y48E 1XKQA 1IBCA 2CUKA 1FDRA 4M1MA 4AJHA 2W5UA 3HXQA 3Q85A 4KXWA 5EI5A 5FCDA 2B21A 1ODCA 2OL4A 4QARA 5E7QA 5F7XA 3R0XA 3OZAA 1SGWA 4ISCA 5B1HA 5KSYA 3JQ6A 3AFGA 1DCMA 4D0RA 3I53A 4XWOA 3RC7A 1ZD3A 2K4MA 2MINB 3UNXA 4FWBA 1EE9A 4TWJA 1NW9B 3STHA 3LXXA 1RWMA 2BHNA 2A1TS 2UVDA 3M6LA 4GO1A 2NPIA 1PSDA 1OGJA 1FNBA 3KPJA 4HNRA 1IN7A 2BGNA 4KB5A 4EUEA 5EVJA 1IQUA 3BGDA 1K8RA 5IMSA 1IVSA 1V0JA 1SA0A 2FR8C 3GRAA 4W6ZA 3VU8A 5I01A 3D7SA 5JQGB 4FWTA 4TVKA 5F1YA 4QNMA 1GV0A 1ORIA 3PA8A 1VPDA 1XE3A 4JJ7A 2V5AA 2I9PA 4F9GA 1JHMA 3DVQX 1PR2A 3B60A 3NYRA 2EBFX 3KZVA 3LBIA 2HQRA 3TBFA 1PYDA 3GRKA 4YT8A 3GLVA 1RABA 3VJKA 3CUYA 5IP5A 1TTHA 5DK6A 1BDBA 2J0UB 1XWWA 1KP9A 1OT3A 1QYIA 2H17A 3PITA 5KDOA 4GIBA 4JYMA 5HQ3A 2ZTVA 5HGJA 4DZRA 1QC5A 1RRPA 2DKNA 2ZYRA 3R5TA 1IHPA 2WIAA 4NE9A 4EJSB 3L46A 5JDCC 3HKEA 4TL8A 5FUYA 4D3DA 3Q7QA 4DCTA 2PUBA 3LQQA 3HV0A 1CERA 3PNBA 1WL8A 4BFSA 1EAYA 4D0SA 2G8LA 4PGAA 5LBIA 4L1KA 4D4GA 3WGMA 4LZAA 5H7XA 5H3LA 1KVQA 1D04A 1FSFA 5EUQB 1NLZA 5ALFA 3EXFA 4KCGA 2J07A 5CYPA 1X7DA 4EB8A 4BNZA 1EUZA 5C7IO 1AS3A 3EVTA 2FEAA 4NENB 1ZJYA 1YCHA 3OT1A 4ID3A 2OENG 4OYRA 1E2UA 1LCIA 1W85A 3D6FA 3L7AA 1WTCA 1SELA 2EG9A 5EMHA 3TVDA 1H4SA 5CYOA 1E62A 2GZSA 2Z5GA 3GUYA 4OP3A 4Q3EA 5GAJA 5MGNA 2PO7A 1ZN9A 4EM6A 1KPHA 4JBNA 2Q5QA 1FBNA 1MW9X 2JDID 5AI4A 5FIUA 3UB2A 3LT5A 1TUGA 5JXIA 4RESA 2QU8A 2JKZA 1ESDA 4WK2B 1H6AA 3CBGA 3RLIA 4YMHA 5BSVA 2ZUSA 3FPAA 2V7TA 4ZQHA 4C3OB 1ICIA 3OMLA 1WZ2A 2YHBA 3C2QA 1JR3A 2ZBUA 4ICIA 3OF5A 4CMEA 3FHLA 1GR0A 4FUQA 2JFXA 4Q4AA 2XB4A 1DX4A 3DAFA 3ZDQA 4MRPA 2D1QA 4V03A 2X5OA 1OSNA 4E1AA 4ZGWA 5C7OO 2R6FA 3ZHSA 3D3JA 3T3IA 4LNUB 2P9JA 2VH5R 5IVIA 4C08A 4D9IA 5CDHA 2F59A 4M0UA 5AKLA 4FIZA 4F2HA 4KE9A 5FPHA 4LRSB 2A30A 1S5PA 1RKXA 3KX2A 1GXSA 4G8DA 4C89A 3IIIA 2PKRA 1HFEL 1C8BA 1LPMA 5JDIC 2JFQA 5ELLA 4QTYA 1RXVA 3TI7A 1P2BA 3NUQA 4DJAA 3MAJA 5AJYA 4ML3A 3OJWA 2QL6A 1RWWA 4IJ5A 4MQBA 5K8IA 2BT4A 2J6BA 3DKIA 4L8WB 5F1PA 1MO5A 4Y67A 2FUG6 5KHOC 3H1AA 4V3BA 1R6AA 1CS4C 3JW8A 4A03A 3PEWA 1FJGB 3DM5A 5FORA 1VTKA 3LQFA 3WKEA 3CWCA 3DMTA 3N5CA 1K68A 1X7XA 4H1UA 4J03A 2ACVA 3E9NA 1W7AA 4KACA 1VLZA 3S1AA 2YZGA 5EPOA 5HKBA 3DP9A 1WNTA 1F2UA 3D6UA 3SHVA 1TZBA 1KOGA 5DYIA 3MUFA 2ZBEA 1WX1A 3CV3A 3PNYA 2XV1A 3HA7A 4YP1A 2GETA 1PUJA 4CEIB 1MXFA 2DFVA 2RHMA 5BWCA 2UZ0A 2AI2A 2HCRA 2I4LA 1NF8A 3R7AA 3AH8A 5BRJA 3V33A 1YS7A 1FTQA 3H5NA 4OSOA 5HSGA 2GPNA 1WCWA 2QSZA 3LNCA 4Z99A 3TJZA 4AJOA 2IYWA 4DJEC 1MENA 2XW6A 5BNFA 3EZNA 5F76A 1LNSA 2ZIXB 3H1TA 3BGIA 4IGEA 4XQEA 4AULA 2VWHA 3JARA 1DC8A 4KN9S 4PYNA 3OM9A 1QZUA 1NU6A 4ZHSA 4B8ZA 1KJ9A 2G9NA 3DOHA 2VYVD 3RR2A 3OWXA 5BQ3A 1G4UR 3TXAA 1XYYA 4OHFA 2Z0MA 1ZH0A 2A5GA 1SKYB 4MOWA 1M75A 1ORRA 3CH5A 1EGMB 4EEKA 1IHOA 3KQKA 1TCBA 3IOYA 1THMA 1B41A 4U4AA 2ZWIA 4ESHA 4XDZA 3R6WA 2ISCA 4IBOA 1JUDA 1Y8AA 1ZD1A 1IXZA 1QRRA 4RCVA 2VAVA 2C2YA 5JMPA 4DG8A 2KX7A 2ZRPA 3ITDA 1R00A 1T2UA 2MMGA 2SKCA 3PV0A 4E32A 2DF8A 2AJDA 4G5YA 2CHUA 3KT8A 3DXXA 4MI1A 5JSYA 5JMOA 5E0OA 2DPYA 5AK3A 1YCDA 4OI1A 4B1FA 2GM9A 2P9TA 4IM7A 3IHWA 2NNLD 4H3SA 4UEQA 4HVLA 3EZ9A 2PBZA 2O0JA 3OX1A 4G9GA 4KI7A 1ESNA 1N0IA 1T1SA 5FUVA 4JT8A 4BP1A 2PRIA 1P9NA 3ZQ6A 2CFCA 1KNXA 3ICPA 2PXXA 4YP6A 3C7DB 2I71A 2VZEA 3KLPX 4J0KA 4BZWA 1DBSA 2IPAB 3N2IA 2YRFA 2ZSJA 3PI6A 3QVGA 1GU1A 4D79A 4IXMA 5GOZA 3WX0A 3L0YA 4L4RA 2N42A 1W52X 4YV0A 1XMIA 3R6DA 1LVHA 2XITA 3CM0A 3ONEA 3HWRA 3WWZA 4LYDA 5EP4A 5P21A 4MEAA 1Z2CA 4NAHA 3R6GA 4LXTA 3D59A 1IY1A 4RTSA 3UJ3X 3D8TA 3DOUA 4WOCA 3VI3B 4UATA 1O5OA 3VVMA 3UXEA 4YMVA 3DVSX 4QNNA 4G2TA 1EBFA 1B0ZA 2R86A 4MWGA 5CDGA 2ODPA 1SXJB 3RH0A 3PQ4A 4LHWA 3RU7A 1XIVA 3TD2A 2FKNA 4QGSA 1CK4A 2ZE6A 3I9NA 1S89A 1MJGA 3QPUA 4QJ3A 1YRAA 5FT9A 4ZN6A 2L42A 3CPEA 3KK0A 4DC0A 4MI9A 4U2FA 4JS0A 3IT1A 2BZGA 4C4AA 2H9YA 5MHTA 2E1RA 2BGRA 1VZ3A 2PCJA 1HYHA 2F55A 3DE1X 3H6GA 3QPCA 3WGHA 3WICA 1X70A 2C31A 1RXCA 5C51B 3UENA 3FZGA 2JK1A 3WE7A 1T8TA 2HMVA 4Q1AA 3SXUA 4LJ8A 4JVLA 4TV9F 1L4BA 5KKNB 3QFTA 2ZJ5A 3SVTA 1W49A 2OQIA 4CETA 2Z04A 1L5VA 5HR5A 2A9QA 3MB8A 1ZXLA 3VHXA 4R2XA 3V7WA 4FR0A 1EK0A 2UYCA 2I91A 4D99A 1FU7A 1PEKE 2Z43A 4DLSA 2Z09A 2Z5VA 5AXBA 2HA3A 2ZUUA 3AUAA 4O33A 1HLGA 2R1VA 4BXOA 3HKCA 3RVDA 5TPWA 4P3KA 1WLYA 4QQRA 2VXOA 5D85A 4WFKA 4F1JA 3N59A 1NX6A 2CVZA 4O4IF 3D3NA 4Q34A 1NMXA 1R6UA 1E3WB 1Q74A 3GNSA 4HQFA 2OD7A 3R74A 5HVNA 1A7JA 2GHTA 1KMHB 2GZMA 3OO0A 1YOBA 5T4FA 1BDIA 1ACJA 3L7LA 1MHTA 2FOXA 1NMEA 4FDUA 2QYOA 2O8DA 4R1QA 2WICA 1TO1E 5DMXA 4BQQA 4C0KA 4DT1A 3RV4A 1UDAA 4YMLA 3A6HA 2R1TA 1T4BA 5B58T 1ONNA 1DEXA 1D8TA 1XLUA 3D4PA 5P8WA 3U80A 4XCQA 1R5OA 2RGEA 3G2OA 2EF0A 3OJOA 4EKIA 5IJWA 2CV0A 1KJZA 2D4HA 3BB4A 2UZ4A 4KQ1A 1L5RA 3DKRA 4FSXA 3BFPA 4RM3A 4TKUB 1ZOIA 3UWMA 1RIFA 2O8FA 4G0PA 4GYKA 3NAMA 4WHMA 1J07A 2OYSA 1A9ZA 2E48A 3KAKA 3MRXA 5L7YA 5DGIA 1YR1A 1CIJA 1FFXB 1R0RE 1PQPA 4PBRA 5AJZA 1KAMA 1AQLA 3B12A 3EZGA 5LJIA 2GO1A 4PX5A 3ZI0A 4J43A 1L8LA 2D54A 2J1LA 2WVHA 1L5HB 4NVRA 2R4QA 1H9CA 3FPCA 2X3UA 3OFNA 5IM4A 1Y3BE 4ZVQA 1B0UA 4B43A 2H18A 1Z4IA 3C97A 1PWEA 2OHOA 1RRFA 4QXAA 4HQLA 1K86A 3Q7EA 1YOVA 4INZA 4RHCA 1KU0A 2ZLBA 3DDCA 3NHPA 4WGGA 3RRFA 1EGHA 4II3A 4C0HA 3V1TC 1VMIA 4DANA 1XT6A 3CJQA 9ATCA 5KZMB 4FEEA 4GECA 3NUZA 4D02A 1M5UA 1OTYA 2C5BA 3TL2A 4X1OA 4FR5A 1YHZA 2W11A 4NG5A 4UQOA 4DARA 3FDXA 1IQPA 3KYIB 4JOSA 5CLIA 2P2LA 4J0FA 1G8KA 4MV6A 1EUDB 1E0DA 5TR9A 5JSFA 1QBGA 4MS4B 3D2AA 1F7VA 1P2UA 3D81A 4F04A 1IJEA 5KNBA 1H0SA 1S1CA 4L51A 1VPLA 2PQMA 1D2HA 3ROTA 5JJCA 4G37A 3TXXA 4AY6A 1AKQA 3QYFA 4GOOD 1D4AA 3DZJA 5JFOA 4R8VA 3FHJA 4TSFD 2HCFA 2CLOB 4OYLA 2WWGA 3WWYA 1NXQA 2CHEA 4AUKA 3BA1A 3NH6A 3FRHA 3LXUX 4RF4A 4G24A 4JD5A 1RKUA 3HXPA 3P7MA 4B6RA 4YUAA 1C3VA 4EIWA 2HSDA 1U9ZA 2WWYA 2QAIA 1CQIA 3T6KA 1CG6A 1M2VB 1BEEA 1L7XA 1YDHA 2Q3HA 4IDHA 4QOFA 5IZCA 3F7MA 1Y1LA 4EELA 3Q87B 2W0MA 4MKIA 4WZAE 4LFAB 5KOJB 5CW1A 3R41A 5IJ9A 2RGWA 1MP0A 3OSZA 4HPXB 4Y1GA 5BO5A 1YE8A 2D1FA 4DS3A 3DLBA 2WWFA 3HY4A 4H3HB 3TSOA 3ZW7A 5FLKA 3K6SB 3D4NA 1AVTA 4DCVA 1UMKA 2WABA 4PQRA 4X60A 4ZK2A 2YJ4A 1C3EA 1C81A 2XDAA 3L8GA 4FI3F 4KXFB 2HEIA 3QF4B 3L0BA 5LB4A 2CNWD 3VX4A 2NU8B 4EZEA 1EIWA 1E3EA 2HLNA 5A5DA 5A9RA 3GZ4A 1TI7A 4PSKA 3A6FA 1KK0A 3SJCA 1UWLA 2XECA 3W9BA 2BFEB 2YDXA 3NKVA 4F93B 3PS9A 1G8AA 2WYUA 1EGVB 1Q95A 4MRNA 3JASB 3VPGA 3W06A 1IBKB 4H3VA 2ZRNA 1CD5A 3MN1A 2QZZA 3GT3A 1N2XA 1EXWA 4A0QA 1ID8A 2CJFA 3N0XA 4F9FA 3AI2A 4EG8A 3F5MA 4RJLA 4AN1A 2J09A 1GGEA 1GTZA 1MJFA 1RLTA 2Y05A 5BUQA 1CQJB 4MDYA 3ZHYA 4AFNA 2E21A 4DIDA 5HDQA 5IBQA 2D0IA 2F43B 3ANSA 3G49A 3OH8A 1J0DA 5K45A 5JVDB 5JNRA 4Q24A 3EN0A 1Y80A 3S40A 5M34A 2FSVC 1DIHA 3Q11A 5KI6A 1UEJA 2G0TA 1KI3A 4R51A 4DBLC 5ARCA 4HAYA 4MUYA 1WQ3A 5K20A 4CTKA 4UW9A 1H9BA 5CRIA 2JJ1A 2NQ2C 3ROPA 4CN9A 4HDNB 4UDYX 1JB9A 3TFOA 4K3VA 2A0WA 3M82A 2EC5A 2IV3A 2FX2A 4PSCA 3B1FA 3U9LA 5ICEA 1ZZGA 3PFIA 3PZRA 3IEMA 1L8AA 4RY9A 1TDJA 4DV5B 2NT3A 2OCPA 4BRZA 5B7GA 4QYTA 3EODA 4O4IB 2K2WA 3W5DA 4EYOA 3W5HA 3O26A 5KYKA 1NW7A 1CYDA 1GZ5A 1HQYE 3U4DA 1X9GA 3BSWA 5JQGA 2GSWA 2GEVA 1IOVA 2BOVA 1ZVJA 2AHRA 1L7VC 4FXPA 3H2SA 4ZODA 3TOCA 3MMXA 1O94A 1ECPA 2Y8EA 3L0SA 5EE1A 5K99A 2B7BA 3WA7A 3I6IA 1EFKA 4BN5A 2OY0A 1EX7A 4BFLA 2H1CA 1H4TA 5JO0A 3F8SA 3H84A 2J0UA 1QIGA 4B3JA 4E22A 3GBPA 2ZR8A 3PTZA 2EGHA 5E7IA 3COZA 2ORVA 5CK4A 1TT7A 5A6SB 3OX2A 3OKAA 1ZG3A 1P3Y1 2D5BA 5BT9A 1JAYA 3VU1A 4BFXA 2H4XA 1G41A 1SXIA 3M1AA 4B84A 1PVOA 1S2MA 3F7TA 2VHVA 1GPNA 1BWRA 4Y30A 3GLUA 1PFUA 1Y82A 4YLEA 5ES3A 1JXQA 3VR2A 1O97C 4MWSA 1N25A 2W6IA 4OI2A 1DC7A 4NENA 5LNK1 4KW7A 3LT0A 3DF9A 4PLPA 1D2EA 3WBKA 2P9EA 1GOTA 1I3LA 4UU7A 1UQRA 3RS9A 4ZRDA 5C8YF 1DAEA 2R44A 4BMYA 2VDRB 2QLBA 2C00A 1DINA 5A4KA 1JQ5A 3CUEF 1ADGA 4YPFA 5LL6P 1LPBB 1NQVA 4C4SA 2L19A 3WZ2A 1IUPA 5GZ6A 2VP3A 1TU4A 4RYDA 4DR5B 3ITNA 1GFIA 1RLMA 3M7IA 2OE2A 5HFAA 2GN2A 3H75A 5LZ4A 1GDTA 3DE5X 1MQAA 3KYDB 4F11A 1G21B 3I4CA 4JT4A 4YS6A 1JTVA 4G5FA 3RSSA 1V8PA 3DTVA 1D2GA 4J0IA 5HJ2A 1MLDA 3H9BA 3D8UA 4QVKA 2QTVB 3OM8A 3GDFA 3VYSB 2VCHA 4X1IA 3UFBA 2G70A 4DQ0A 3UMGA 3B1WA 5ALNA 3HEMA 3CN9A 3EHDA 4LDPA 5K03A 1K4MA 1IXYA 5AIAA 3PNLA 3THYA 1GN9A 3VVBA 1J9EA 4R40A 1SVNA 1U90A 2EU8A 3GDHA 2VP6A 4F21A 2H06A 2JIMA 2OV4A 4PLYA 2W00A 1P4JA 2AMVA 1RC1A 1T15A 1NVWQ 1NW3A 3DBIA 3GRPA 1GDDA 2QD3A 1AGYA 2BE7A 2B1RA 4B5KA 1UWCA 3P45A 2R6R1 2XMZA 4L4ZA 3UV7A 5L3VA 1NTRA 4GYWA 4KAFA 3EC1A 2BF7A 4LRUA 4C7BA 1CWUA 2KS6A 4L5JA 4KK4A 2EBUA 1U8EA 5F2KA 2AI1A 2I6FA 1ZQ1A 2AMLA 2B0CA 2J8ZA 2QP4A 1R2QA 3CF4G 3DMGA 3LF1A 3MVEA 3TFQA 2B37A 1A4UA 4OPMA 4I3HA 5LU9A 5JJLA 1K6XA 4JI1B 4NV1A 3HGTA 4OH7A 5F9MA 4R2LA 1EZ4A 2GK6A 4D0GA 4G25A 4KGXA 1PZFA 4ETNA 2C99A 2QMHA 2GCGA 5HTKA 4NY1A 3RGWS 4ES6A 2I99A 3CRZA 4MDEA 1WSAA 3ZZ1A 1K2VN 3G5LA 1L8OA 1SU4A 3CPHA 3QXXA 5BNIA 2HV8A 2PV7A 4I1RA 4RHXA 3HWSA 4YO8A 3S2YA 3NW9A 4DIEA 1BHSA 1J0BA 1MOQA 4NMLA 4X6LA 2QRGA 4Y2TA 5J63A 4W9MC 3HV2A 4BTLA 4FYMA 4QJIA