1GEGA

Cryatal structure analysis of meso-2,3-butanediol dehydrogenase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
255
structure length
255
Chain Sequence
KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETOIN REDUCTASE
publication title Crystal structure of meso-2,3-butanediol dehydrogenase in a complex with NAD+ and inhibitor mercaptoethanol at 1.7 A resolution for understanding of chiral substrate recognition mechanisms.
pubmed rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
total genus 103
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.304: Diacetyl reductase ((S)-acetoin forming).
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gegA00
1VJ0A 1KVSA 2DFVA 2HMSA 5EJ2A 4GKVA 5G0TA 2BFPA 4QT0A 4ALKA 4DIOA 4U0JA 1XG5A 4CMJA 3VPGA 4BNIA 1QRRA 3DHYA 1Z7EA 3AI2A 1K6JA 4PLVA 4NQZA 4L8VA 2EW2A 4FJ0A 1H5QA 3QVXA 1VJTA 1JLLA 1YB4A 2Q2WA 2GF2A 3KTDA 1Y6JA 3DFZA 1R16A 2CF6A 3Q1LA 1VPDA 3ANLA 4NFYA 3W8FA 1SB9A 1UP4A 5DCUA 4IQ8A 2DBRA 1ZJYA 2P2SA 3G1UA 3WMWA 5JAMA 5BNIA 1H6AA 1K89A 4FFPA 2BF7A 2FOIA 2VOEA 1LSUA 3PFFA 4OYRA 4TZKA 4X54A 3PDJA 1EBFA 1BTOA 1X14A 1HSOA 5TJHA 3D1LA 3ROQA 4UUNA 4RO0A 2LDXA 3CZRA 4RF2A 4UULA 2VRCD 4IQ0A 5I8ZA 3M1AA 5JDCA 4A0SA 2YZ7A 4A5OA 4BO2A 1RYDA 3L6EA 2B36A 4DLLA 4E0BA 3HFGA 3IOYA 1DRWA 3QVTA 4J6FA 2EP5A 1LDEA 4HKTA 2C20A 2YFHA 4TSKA 1Y8RA 5ENDA 1R0KA 4RPHA 5L7WA 4DPLA 1GZ3A 2BFMA 4YAEA 4DVJA 1N9GA 2VWPA 5EERA 1ZNQO 1LSSA 3EVTA 4D0SA 1J5PA 3JD1A 4AICA 1E7RA 3FWNA 5GY7A 2R00C 4E33A 4FGWA 2WTBA 2JFGA 3V2HA 3HDJA 2FMUA 4HFJA 2DT5A 2PTGA 4YT4A 4CUZA 1GYRA 2VHWA 1X1EA 3EHEA 4IDFA 3HWRA 4E12A 4EYEA 3IL2A 1GPDG 4JBHA 4D79A 9LDBA 2ZB4A 3QP9A 2G0TA 4KMSA 5G0UA 5K6AA 1T26A 5HTOA 3SLGA 5HRUA 4IJWA 2P9CA 2FR1A 3QWFA 1CWUA 4O63O 4ZQHA 1M2WA 3NGLA 1T2EA 3K92A 2NQ8A 3BTUA 4CR6A 4RPLA 2HLPA 2C5AA 4RVFA 1G0OA 1XSEA 4CPDA 1JTVA 2Q50A 3QVSA 1P3DA 2UDPA 3EGOA 5F1KA 3WGTA 5BT9A 3CEAA 1PGJA 2HMUA 3GEMA 5MDHA 3I83A 1RM0A 3Q0EA 4J49A 2BH9A 3WYEA 1DFHA 4BO6A 3U09A 4CLRB 4OXKA 2ZTVA 2VZ8A 3UF0A 4L4RA 1B15A 1N7HA 4XCVA 3ADPA 1LDNA 3KYCB 4UVGA 1HETA 5C7OO 4Q9NA 1NQOA 4DPMA 5BNTA 3DZBA 4DREA 4WOJA 5DP1A 1JWAB 3H7AA 4CUKA 3NTRA 4CQLA 3OETA 5JYDA 5JDIC 1B2LA 1I2ZA 3KO8A 3WBFA 1YDEA 1IL0A 2OHXA 2NTNA 3W4IA 1Y9EA 3WIEA 3BHMA 5IZCA 2HQ1A 3GY0A 4IPTA 4TKMA 3GNSA 2WM3A 3IAHA 3ULKA 4AJKA 4B7UA 1PEDA 3RFVA 3WBBA 2JAPA 5C37A 3TQHA 2QIOA 3GR6A 2X9NA 1GR0A 1PS8A 1C14A 3AFMA 3ZW8A 1QLJA 3JTMA 3E6AA 4M49A 3JQGA 3CH6A 2EF1A 1ONOA 4DQUA 2HK8A 5CG2A 4E13A 3PXXA 3V1YA 4KP7A 2ZIZA 4J4HA 4OOEA 3QWBA 4PG6A 1PR9A 4CODB 3B6ZA 2J5QA 1VI2A 3FTPA 2Q45A 3VH1A 4AJ2A 5JS6A 3ORFA 5JCJD 1K3TA 4EUFA 5KVSA 4JBIA 4ZN6A 1P77A 1WMAA 1QR6A 4R54A 4JN6B 4RLHA 3CMMA 4CQMA 6LDHA 4TRMA 3WTBA 4JCOA 2GDZA 4WGGA 4WNIA 1O9BA 4MVJI 1A5ZA 4D3SA 2H63A 1NHWA 4Q3CA 1GAEO 3TWOA 3E03A 3ZWAA 3PZBA 3GG2A 1PS0A 1I24A 2O3QA 3VVBA 3FBGA 2CDBA 3PDUA 1Z82A 1DRUA 2D5AA 5BSHA 2QRJA 3JYQA 4R1UA 4XA8A 1IB6A 4ZRNA 3GDOA 4B4WA 3MZ0A 5JSFA 3GFBA 4GH5A 4XQEA 3KBOA 4WOKA 4BO3A 4GWKA 3H2ZA 1Y1PA 3ABIA 1H94A 4HFRA 4A27A 3KOUA 2GPTA 1YB1A 3PI7A 3U3XA 3H4VA 1WP4A 3T4XA 3EYWA 4PGFA 3JD2A 1XYGA 3H9UA 3HB4X 2NQTA 5TT1A 4P38A 3W4KA 2PGLA 4J3FA 4E2YA 5JC8A 3HSKA 1R12A 3JQ6A 2BD0A 4OO3A 5ILGA 3JQEA 1QP8A 2C82A 3SLKA 1HE3A 3H65A 4BIIA 2VYVD 1JQBA 5B1YA 1LNQA 1UXKA 1I3KA 4DYVA 4JQCA 3ETEA 3DOJA 4R3NA 3H9GA 5JDCC 3DBHA 3ONEA 5DZSA 4BKOA 4RPJA 5CHEA 1GDHA 4IZIA 3ZU5A 4BNFA 2GNAA 2GZ1A 2DPGA 3AM4A 3ONDA 4J0FA 4PCVA 2B4TO 4HADA 4XKJA 3WQRA 1GPJA 3F4LA 1IZ0A 3U49A 2AHRA 3RIHA 3FBTA 3N74A 4ALLA 4J91A 4N54A 3AY7A 3GGOA 3S2EA 4PLWA 2VZ0A 2J3KA 1N92A 4DIFA 4IJKA 4IGFA 3AY6A 1E5QA 2J6IA 3QY9A 3ZCXA 1RM4A 1ULSA 1O5IA 2Q49A 5CDSA 4PG5A 3PWKA 1MFZA 4BNJA 3PHLA 5EMHA 5ITVA 1E7QA 2WMDA 4BO8A 1QSGA 3AM5A 2D5CA 3DR3A 5IXYA 1E3WB 1E0DA 3DDNA 5C3MA 3TL2A 1LLUA 2IZ1A 4LCJA 4WEOA 4CR8A 3PWSA 3LQFA 1ZKMA 1XR3A 4G65A 5JLAA 1F0YA 2B83A 3ZWXA 2FSVA 3L9XA 1EMDA 1P1HA 2XF8A 2WD8A 1SAYA 2QYTA 1GFSA 4IJVA 5U9CA 3ROMA 4PLHA 4WCFB 3WDSA 1SOWA 3OIGA 2X4GA 1HLPA 2UAGA 4NU5A 4MVJA 1DIAA 1PIWA 4HV4A 1Y9AA 4EDFA 4M1QA 3CIFA 4I5GA 5IXSA 4KTTE 1Y5MA 3WTCA 4HNGA 4NJMA 2JD2A 3I52A 4E5NA 1JVBA 1ORRA 1ZW1A 4A7PA 1QYVA 4YPOA 3E82A 3OICA 1Q0HA 3TFQA 3QWAA 3IS3A 3VDQA 4DA9A 4S1VA 5KIAA 3ANMA 1BDBA 5IN5A 2OGUA 1RKXA 1XLTA 4UEOA 1D1SA 1YL5A 3BIOA 3TOXA 1BXGB 4J7UA 1LLCA 4GSLA 3WFIA 1D3AA 1LTHR 4NK4A 4YAJA 3BMQA 1NBOA 3DAFA 2G1UA 2P68A 1PL8A 3AWDA 3KEQA 4RQUA 4U7WA 4E5KA 3PHGA 3MCVA 4OQYA 1O8CA 2DFDA 5T64A 5JCJA 4DL9A 2GGSA 5L4SA 1MV8A 4R5HA 1AXEA 2PK3A 2LDBA 3L07A 4HBGA 4LGVA 2HRBA 4E3ZA 4LW8A 4C7JA 1JN0A 2EG9A 3M2TA 4E31A 4BVAA 4XGKA 2Z1NA 5L4LA 5CDYA 3K31A 3IKTA 4RPKA 5IZCC 1I10A 1H0KA 1GYQA 1O0SA 5A9RA 2NLOA 1ZBQA 2HU2A 3GN1A 3JQ8B 2PFGA 3RSHA 5KKCA 4YJGB 1P31A 3MJVA 2F00A 2QHXA 3BMCB 3AI3A 5A4DA 2XOXA 3L4SO 2H5LA 2X5OA 3KRTA 5L40A 3A06A 2VZ9A 3ZN2A 1C1XB 4F6LA 1YVEI 1NVGA 2ZQZA 1EVJA 4RVGA 2VNSA 3GT0A 3LU1A 2VCYA 4N5MA 4MPDA 1YL6A 4NBRA 4KOAA 4KQWA 1GEGA 3VZQA 1HZZA 1IOLA 1N2SA 1DEHA 1PQWA 4BO5A 3RBZA 2I67A 2E4AA 2UV8A 2YHIA 4LSWA 5A9SA 3C3XA 3B1FA 4GAEA 3UGKA 1SZJG 1Z73A 3HADA 1T25A 2CVQA 2VYVA 3MJ4A 3FWZA 1FDSA 4G2NA 1X7GA 1O6ZA 2BKAA 2QZ9A 3DHNA 1KC1A 1W0CA 4WECA 3V2UA 4YT2A 5BSGA 4CLRA 5F5LA 5L9AA 3JYOA 5J23A 1U4OA 1LQUA 4E30A 4F3YA 2C59A 2BELA 3NT4A 4J2HA 1E7SA 3G1TA 1NVMB 2WWRA 3ZWCA 4Z0TA 3VVCA 1T2DA 4R1SA 3GVCA 3NDRA 5FYDA 4KWIA 3UKOA 1M6HA 1ZK3A 1AUPA 1C0LA 5COAA 1XA0A 3VAZA 1Y5RA 3JQDA 3OEWA 4EJ6A 1U3TA 5T57A 1NQ5A 3NT5A 1X15A 2FPPA 3G17A 4HFMA 1H6CA 4XRRA 3A4VA 4BKRA 3OFSA 1XEAA 3DBLB 3VOSA 4F45A 5JO0A 2EERA 1R4NB 3E9MA 1P1FA 3O26A 5BSEA 5A06A 2EKQA 2X0RA 2I65A 1WLYA 1NWCA 2XAAA 4GQAA 2WYUA 4CLHA 2FPGA 8ADHA 4IBOA 1DDOA 1U3UA 3D5QA 3GMSA 3V1UA 4H16A 2I9PA 3R1IA 3WGHA 4FC7A 4XR9A 2GN4A 3DXFA 3JQ9A 2B69A 5IFLA 2SCUA 5ICMA 2HUNA 3D64A 3MOGA 2HO5A 3UCFA 4N5NA 1TI7A 4Y8VA 1CYDA 5F1OA 5AXAA 1ZK2A 3QJ5A 3M2PA 3KVOA 3V2GA 4YQYA 1CJCA 5GZ6A 4OM8A 1ZH8A 5IG2A 2BFAA 4PVCA 3IUSA 4GVXA 1J0XO 3H9QA 3BTOA 4JK3A 1DXYA 4OAQA 3A14A 5CEEA 2JFFA 2WSBA 3EY4A 3Q3CA 4A10A 1T24A 5GZ1A 3NAQA 1P33A 5F21A 3VTFA 3U0BA 3TSCA 4FJ2A 2QZZA 1NWHA 1UXJA 2CUKA 3NEPX 4O5OA 2NNLD 1P0FA 3PFWO 4FC6A 3KV3O 2ZB8A 1GUZA 1H6DA 1EE9A 4I9HA 3TRIA 5IDWA 4J7CA 4NBVA 5FI5A 4RQTA 3JQCA 2X22A 4RF5A 1I0ZA 1LQTA 2WE8A 2FRDA 5HA5A 5I9NA 3ENNA 1W6UA 2IEDA 1EVIA 4UREA 3OBBA 2NVWA 1U5CA 1J6UA 4YRAA 3DOCA 2J5RA 4FSHA 3ENKA 4L0QA 3BZUA 3RC2A 2IRWA 1DLJA 2CVZA 3ZW9A 2AQHA 4KTVE 1NNUA 4ZJUA 2OP1A 4R9SA 1YRLA 2WDZA 4IDEA 1I32A 1H93A 1N5DA 4OXYA 3RC7A 3AOGA 1LDGA 1A71A 3I23A 2VQ3A 2Y1EA 3WGGA 3I9OA 1A7AA 4BNLA 1JAYA 1KVTA 4DC1A 4M89A 1E1MA 3AK4A 2CSUA 2PKRA 3QWIA 1E7YA 3SC4A 5TJ9A 2NUAA 4MIOA 1Q7GA 5DF1A 4B4OA 1WAMA 3KZVA 4NHEA 4NIMA 1IYZA 3GZNA 1NX6A 4MVJP 2Y1OA 1V0JA 3DC2A 2ILTA 1R4MB 4ND4A 3PWZA 2B5WA 3MJTA 1UZLA 1ENOA 1I8TA 4ND5A 2PV7A 4QSMA 5JDIA 5LDHA 2E6UX 4GGOA 4H15A 4HP8A 5G0SA 3P2OA 1EVYA 3DL2A 1VL8A 3RKRA 2OP0A 2YW9A 3LF1A 3O03A 3LT4A 4E5MA 4F46A 4WLEA 3NYWA 1E3WA 3JQAB 3KYDA 1ZCJA 3QQPA 4IMPA 3JCZA 5TSDA 1PL7A 3AUTA 2FZWA 3IP3A 3F5SA 5K6AC 3NX4A 2G5CA 1C0KA 1N1EA 4LMPA 2E37A 5KWEA 4PIVA 1BVUA 3H2SA 4N5LA 3ZGYA 4TVBA 3F46A 1VSUA 3GA0A 2P9EA 1U3WA 3GPIA 2VRBA 3LC2O 3PIIA 4UAGA 4IJUA 1GTMA 1TB4A 2NVBA 2BI8A 1HTBA 3DMTA 1JAXA 3ZWOA 4WLOA 1YOVB 2DLDA 2VOJA 4L73A 1ML3A 4W7IA 4DYDA 1T4DA 1MC5A 1NYTA 2ZTLA 3ITKA 3QIVA 1PWXA 3D3WB 3INGA 4H3VA 4PZDA 1F8GA 4CV0A 4P4LA 1NHGA 1VL6A 3DMYA 3OHSX 3DOOA 4NI5A 1ZJZA 3FRJA 2IEBA 2PA3A 1BXGA 2EV9A 3QHAA 1W4ZA 2ZCVA 4ALJA 1DC4A 4GMFA 3SXPA 3BA1A 3VH3A 3JQ7A 4PLTA 1X0XA 1ZZEA 3AM3A 3QVWA 1YWGO 2Y0EA 1P45A 4TRRA 4NBWA 1Q7CA 3GEGA 4ZRMA 1QORA 4BMSA 4UUMA 3TZQA 3OJEA 5G0VA 4J1NA 4AJIA 4NJOA 1EVZA 4NK5A 6ADHA 2W4QA 3OA0A 4U5QA 3DEYX 3DWFA 4FPXA 3WSVA 3UCEA 3WNQA 1QYCA 3QW2A 4R3WA 3JQ8A 1ISFA 4YJGA 2NVUB 5LDGA 4BMNA 2JFHA 4CM4B 5KOIA 3RI3A 5B4UA 4WJZA 4EBFA 4XQ9A 3OIFA 4LISA 4R5MA 3WX0A 1G0NA 1HDYA 1WVGA 1K6XA 2C2XA 4O1MA 2EEZA 4U6SA 2Y68A 5CFZA 3IKVA 1DB3A 3GGGA 4Y6SA 2Q2VA 1B16A 2EP7A 3RUDA 4ITUA 1UZNA 2C7VA 5ER6A 1CETA 1SPXA 4EITA 2R2GA 4YDRA 3TNLA 1DIGA 2IZZA 4Z9XA 2P9GA 1YQGA 2O48X 1LUAA 1PZGA 4PVDA 2EIHA 2VYND 1BXKA 2C7GA 1PU2A 3GVXA 1XCBA 3SX2A 3EDMA 1I3LA 3JQ9C 4R01A 3TZHA 1C1DA 8LDHA 3AJRA 1PJLA 4ONEA 1MX3A 2P91A 3WQSB 4BB6A 4MVJM 3TPCA 4CM9D 1NR1A 2X1HA 3HB5X 4RPGA 1GCOA 3U4HA 2NACA 1QV7A 1QG6A 3MTJA 4CLEA 4OGWA 3RU9A 4LRSB 4Q3NA 4ALNA 1I3MA 5A05A 1JKIA 4BMVA 4CM8A 2V6GA 4P4GA 3JQAD 4B3JA 1IUKA 2D3TA 5IDYA 2W2KB 4BGUA 5JAZA 4BNHA 2DBVO 4BO4A 1PJQA 5IDQA 1J49A 3KB6A 4IY1A 1HT0A 2P5YA 4O59O 1KEUA 1IZ9A 5JAIA 4PLZA 3OSUA 4KUGA 3ZH2A 3PTZA 3BTSA 5CDUA 5AVOA 5CPBA 3Q11A 2FP4A 3WG9A 3GAZA 2VT2A 3D4OA 3R3JA 4INAA 2CD9A 2XPCA 1XQ1A 1ZMTA 2E82A 1NPDA 1E92A 3PLRA 4RVHA 3PGXA 4BKUA 4FFOA 1R66A 4PLCA 5ITWA 4K1LA 1CERA 4OKIA 3QV1A 3W6ZA 1JA9A 2UVDA 1KETA 3NDJA 1I2CA 1NM5A 1T2FA 3NDIA 4ZQFA 3CINA 4GLLA 3BMNB 4JNKA 4YCAA 1SMKA 2UUOA 1Q1NA 4TRNA 1DPGA 4OMUA 4J4BA 4BNTA 4CMBA 1B8PA 1NAHA 3ANNA 1AGNA 2VHYA 1UR5A 2CZCA 2YV2A 2Z95A 1V3VA 2OORA 2VN8A 5CEJA 4IS2A 4J43A 4W7HA 3P19A 1QMGA 4OXNA 4J1SA 2DBQA 5IZ4A 2Y0CA 4YJDA 3SBOA 1FDWA 5CG1A 4MJLA 1YXMA 1G6KA 1H2BA 1GYPA 5FF9A 5FFFA 1CF2O 2HKIA 2EGHA 4D41A 4RGBA 4CMCA 2IZ0A 3GUCA 4LCEA 4NMHA 1HWYA 1AXGA 1ZUD1 3QA9A 5JW6A 3K73O 1WDLA 4RVUA 4YJHB 3GQVA 3DZGA 2VHZA 4BNZA 3DBRA 1DC3A 4BHTA 5A5EA 1AN9A 3ZV3A 4P22A 2FY8A 2JJYA 3RBVA 3WXBA 4Q3DA 3FN4A 1NASA 3O8QA 1ZK1A 4C7KA 1YJQA 4AJ4A 2RH8A 2O3RA 1BG6A 5CPFA 3SJUA 2A94A 4CM5A 5F5NA 3OJ0A 2RBEA 4I08A 2HMWA 3IJPA 4G5HA 3DMTC 4TZTA 1FDVA 4ILKA 1U3VA 4AJPA 3K6JA 3PJDA 1E6UA 2OOSA 2WD7B 4LVUA 3FCOA 5CAEA 1PWZA 4F6CA 1LDBA 3VHRA 1LRJA 2X0NA 1DIRA 1R15A 3UVEA 3V8BA 3GHYA 4CLDA 1HXHA 1EDOA 2OUIA 1GCUA 3MTGA 1YH3A 2H9IA 3D3EA 1P44A 4CM7A 2CF5A 4CLOB 2VRCA 1NAIA 4BV8A 5U1PA 1K5HA 1Y81A 3WGQA 3ZWBA 4W6ZA 3KLMX 4L4SA 2WYWA 5KTKA 4O0LA 4B3IA 4RF3A 5B4VA 4IDAA 2DUUA 1NFQA 2VYNA 1U7TA 2AE2A 3DONA 5G0WA 4KQXA 4D43A 2OZPA 5BQFA 4IM7A 2GASA 4R51A 4BKPA 3DHEA 2G82A 3P5SA 4L75A 4CM9A 2C29D 4IZHA 3ZWWA 1GEEA 5K0ZA 3PQFA 3N7UA 2PKQP 1Y7TA 2GUGA 5G4KB 4TKLA 2DBZA 4FB5A 4GPD1 1TVEA 3H6KA 1BDMA 2NADA 4YJFB 4BQRA 1T2AA 4GWGA 3B20A 3CSDA 4NR0A 4YXFA 1U8XX 5IJZA 2O2SA 1HEUA 5JPIA 1MB4A 2DAPA 4FD3A 4GX1A 2D1YA 1HRDA 3QSGA 2W90A 4Y67A 1GZ6A 4YT5A 3QWHA 1PJSA 3OJFA 1BMDA 3GRKA 1Q2XA 2J3IA 4DLAA 4QQRA 3TL3A 5C7LO 3H5RA 3HQ4O 1U8FO 2ZJ0A 3K96A 1H2HA 1HYHA 3CZMA 3MWDB 5KVCA 2GLXA 3L77A 5I7SA 1RPNA 1RYEA 2PLAA 3B70A 3DB2A 2CNBA 1KY5A 3HDHA 4RVSA 3E8XA 1R37A 1PJBA 3CE6A 1PL6A 3FR8A 4Q3BA 5GMOA 5HS6A 3D0OA 1HDZA 2HMTA 5EIOA 3K5PA 4XYLA 3ZHZA 3RROA 4WPGA 1B7GO 2J5KA 3GMDA 4GX2A 1IULA 1YO6A 4XYBA 2A35A 1OMOA 4EJMA 1BW9B 5JMPA 2CVOA 1KVQA 3WICA 3RBXA 5ICSA 2GD1O 4CM3A 3VPHA 2GERA 3LSYA 5EQDA 3GLQA 4W9NA 3AW9A 4CMKA 1S7CA 1I01A 2HSDA 4GX0A 2BLLA 3VH4A 1YKFA 2Q46A 2PR2A 2D2IA 2DC1A 2YV1A 3RASA 5K9ZA 1Z7BA 4OH1A 1IPFA 2AG8A 3DTTA 4WCDA 4HUJA 3I4FA 2OFPA 3O9ZA 4FDAA 3WSWA 5IN4A 2RIRA 5HWSA 3WWZA 2J3JA 4I5DA 5I7FA 2Q4EA 3GDGA 1MC4A 2D4AA 2A92A 4EUHA 2O2YA 4YEDA 5C7IO 2O4UX 4Z3DA 2PZLA 5I7VA 3ZZNA 3WMXA 1SNYA 2WYVA 4HWKA 4GX5A 1NQAO 4U0KA 4Y9DA 3U9LA 1P1JA 3OF2A 2GO1A 4DMLA 3LLVA 2C54A 1AHIA 2G17A 4XGNA 5HM8A 3PJFA 1VKNA 4ND3A 3I9LA 3LZ6A 2OO5A 3OJOA 1XKQA 3M6IA 3WLEA 4BNGA 3KETA 2A4KA 5DCWA 1YBAA 2ZQYA 2D0IA 5KVVA 1E7WA 3NRCA 1TT7A 3ASVA 4NBTA 3G79A 4I5EA 2W2KA 3DFUA 4IQGA 4B7CA 4ZVVA 1J4AA 3VPFA 2Y1GA 3GDFA 4BB5A 3H9EO 5CEFA 4BNXA 2NU8A 3K2BA 1F06A 3NT2A 4CLXA 3FR7A 3EW7A 3GUYA 4A26A 2AXQA 1LBEA 3F1KA 3A9WA 3AFNA 2WE7A 4L9RA 3DBVO 3MEQA 4AL4A 2VWGA 3EK2A 3L0DA 3PHJA 3IP1A 1E5LA 5A04A 1HYGA 1PZFA 2FWMX 5KJ6A 1DC5A 1JVSA 2H1SA 5KJ1A 5LC1A 4HX5A 3C1AA 1P1KA 2EXXA 3V5NA 4NZ9A 4BNYA 4ZA2A 2C0CA 3KM0A 5DT9A 3ETDA 1E3EA 2RHRA 3GNQA 3E48A 2HRZA 3PJEA 4CR7A 1CRWG 4DPKA 4OJNA 4J2OA 5KJCA 4CMIB 4BNUA 1N8KA 3JQBA 1LC3A 1MG0A 3EAGA 4WLNA 1A7KA 1Y8RB 5TNXA 3VZRA 3KYCA 1T4BA 2HK9A 3T7CA 3FHLA 1EUZA 3I5MA 2C5EA 5TT0A 2FHSA 1N1GA 3U4IA 1UAYA 1NPTO 2AG5A 2YQ4A 3C1OA 3PYXA 2DVMA 2JL1A 3L4BA 1ONPA 1SEVA 1JU9A 2V7PA 2PWZA 4XZ3A 2EJVA 1KEWA 1K6IA 1TT5B 1YGYA 4LRTB 2ZYDA 1A9ZA 3FNEA 1E7MA 4H7PA 4YA6A 5CDGA 1P1RA 3ONFA 2QQ5A 4UVHA 2HJSA 3I4CA 3ZU2A 1WDMA 3ZWMA 2ZB3A 4EEZA 3GRPA 4L76A 1KC3A 3M1LA 2DPHA 1WMBA 3QVOA 2ZKLA 1V35A 4FN4A 1VM6A 5DDIP 5L3ZA 4WLFA 1GADO 3S2FA 1KEVA 2Y05A 4AFNA 3OECA 3HNPA 1MA0A 1OAAA 3EUWA 4GBJA 3LT0A 4WEQA 1UP6A 3PPIA 2CY0A 2WD7A 4L4XA 4R68A 4ZU3A 4DUPA 5DULA 1FK8A 3KSDO 5EPOA 1L7EA 1OC2A 1GQQA 1W73A 2JCYA 5ES3A 5DCYA 1A4UA 3GNTA 1NPYA 2W8ZA 3KXDA 4GSKA 1ZO8A 4ESOA 2ZCUA 1B3BA 3UICA 3LT2A 4BGIA 2C07A 4JROA 2ZYGA 5DBGA 5KNLA 1NXQA 3GG9A 4PLGA 1ZSYA 2YHUA 1L7DA 1ZEJA 4CMHA 3FSRA 1ZSNA 3ICPA 2I3AA 1AHHA 1DOHA 4CL3A 4A73A 3D7LA 2Y67A 1OFGA 1FXSA 1SC6A 3ZV5A 3ZU3A 2QW8A 1UH5A 4FQ8A 3DO5A 2BHLA 3HE3A 1DAOA 4CQLB 4DLBA 3G49A 4YT8A 4E5PA 4EGFA 4XJTA 5I7EA 3COSA 2V6BA 4BNWA 4W9NC 4UVIA 2PD4A 1CQJA 1LX6A 1XGKA 2IXAA 4Z0PA 1DRVA 1BXZA 3H3JA 3X2FA 4DQXA 3UUWA 1ADFA 4BV9A 3UHAA 4YAGA 3U62A 4MVJH 1QKIA 3HFSA 2RHCA 4NNJA 1PGPA 4TVOA 5G4KA 3VKUA 1KYQA 1LSOA 1PJ3A 3JQGB 1YB5A 2JAHA 4YJFA 4MO2A 1B14A 2NU6A 5KJEA 4FFRA 3GPDG 3S8MA 4FOSA 3C8MA 4ALIA 3DZKA 4BQPA 4AJEA 3BXXA 4Q3AA 3IMFA 4AJOA 1EQUA 4OQZA 1TA4A 5A3VA 1LRKA 3O4RA 4Y6PA 2B37A 4IXWA 4NFHA 1YQXA 1B8UA 4ID9A 2I76A 4MINA 4NU6A 4MP8A 4RZIA 1JDJA 2YUTA 5FI3A 1NVTA 4WNCA 4U8GA 4JBGA 2BGLA 3LT1A 5I9MA 4KUHA 4XYGA 4PZCA 1ULUA 1DJQA 4R41A 4GGPA 1D1TA 3AOEA 3ZNNA 1E77A 2CFCA 2HMVA 3RD5A 5AXDA 2O3TA 5DN9A 5IDXA 1NFRA 3N58A 2X6TA 3PYLA 4DIBA 5A1TA 1M67A 2PY6A 1E3LA 3GHHA 1UZMA 3VPSA 5JY6A 5EINA 4CMEC 2AQIA 3OH8A 1AE1A 1D4FA 3RU7A 2FPIA 3HDQA 1QXSA 5JNLA 2IYPA 1M66A 2NU9A 5JMWA 5L53A 3LDHA 4WCFA 5ER9A 5JFOA 4AG3A 1B26A 5COBA 3UW3A 1PTJA 4D42A 7MDHA 1C3VA 2FN7A 3ZHXA 3ZWYA 4ZHSA 3WFJA 4I8XA 4J90A 3S2IA 2Y66A 4HNHA 3CMCO 4WK6A 1LA2A 4ND1A 3VZPA 3F5QA 1LI4A 2VHXA 3GK3A 4BOYA 2CMDA 3QE3A 4PG8A 4NPCA 3ZDFA 1E1LA 3LF2A 1ADGA 3HJAA 4RJTA 3PHIA 3DBHB 4IUYA 4OSOA 4J1TA 1VRWA 2Q2QA 2GCGA 2PH5A 1MFPA 4TQGA 3UAGA 3JQBC 5ENVA 1V3TA 4M86A 1QV6A 3ZU4A 1OOEA 2AMFA 4J16A 1SEPA 4QO7A 1ISJA 5ILOA 2YV3A 4FCCA 3DZIA 2I5PO 3C7DB 2O3JA 1XELA 4IDGA 4TROA 3JD3A 5CDTA 2X5KO 1UXHA 1N7GA 1SO8A 2JD0A 2PZMA 1V3UA 2X7HA 4LK3A 4LVCA 2AW5A 5T5QA 4MKRA 2GZ2A 1KERA 4TWRA 3L4BC 1EFLA 1ZIDA 4TMFA 4BNMA 4YR9A 3PVZA 2IXBA 4YAIA 2WEKA 4CUJA 1TXGA 1UDCA 4E2XA 1IPEA 4FIZA 4ZQEA 3WYBA 4EZBA 2BMAA 1LC0A 2GN9A 2QX7A 2BRUA 1PR3A 2X58A 3H5NA 3BMCA 3I9JA 4K9DA 3L6OO 4B8ZA 1ZVMA 3PLNA 1L1FA 3BHIA 1W8DA 4GL4A 2VWHA 3CPSA 4BL5A 3JYNA 3AU9A 2I6TA 1HKUA 3JQFA 4OIMA 3PQEA 1UUFA 4QXMA 3TJRA 1C1XA 4M8SA 1WZEA 4FR5A 1LEHA 3S55A 2NSDA 1C0PA 2GRAA 4CQMD 2HK7A 1JW9B 1LRLA 1A9YA 3IC5A 2VHVA 4NFSA 4NJMB 4W99A 4J7XA 4XQCA 2H6EA 4ZGWA 4O6VA 3WS7A 3A28A 3KSZO 4PG7A 5BNFA 3WR5A 3ZI0A 2EHDA 1YDWA 3Q9UA 2FR0A 5AOVA 1QYXA 4D0RA 3DZHA 4QFDA 2NTVA 5TGDA 3KLPX 4DMMA 4IGEA 1HDXA 4BKQA 2XXBA 1M6WA 1HE5A 1U9JA 1RJWA 4B8WA 3SJ7A 4FFMA 4N18A 1BSVA 1HF3A 3GVPA 4CMIA 4BO7A 5L51A 4QX6A 2FZEA 4XIYA 3EZYA 3F47A 5JO9A 3BMQB 4PN3A 2O3UA 4GMGA 3DAGA 1U28A 3H5AA 3PIDA 4QUKA 2Y1FA 2WJPA 1JKJA 3I3OA 3OIDA 4PRLA 1X1TA 4XX0A 1HDGO 3VPXA 2Q3EA 4LN1A 3T4EA 3VKVA 3DTYA 3K9QO 3RKUA 3ZHBA 4II2A 1E3IA 1PJCA 3JYPA 5KJFA 4MVJF 1SOVA 4WE3A 3D4PA 4E32A 4W4TA 1PSDA 1PGNA 3GN2A 1KY4A 1DBVO 3RUHA 3WB9A 4UEKA 3DZFA 2O23A 1NFFA 1TT5A 4PLFA 2YDYA 4Z9YA 1I30A 2RH4A 3FI9A 4Z9FA 1UXGA 3DBLA 4J1QA 4GVLA 1KVRA 1R4NA 1DJNA 3E9QA 4CV3A 1GQYA 3BMOB 2AA3A 4WLUA 3K30A 3WLFA 1PJTA 3W8DA 2ET6A 1Q0QA 3DZJA 4YVFA 1UP7A 3JSAA 2QRKA 2VTDA 4EW6A 3ZHYA 4XQGA 1EQ2A 1XDWA 3RUCA 1ZFNA 3AUAA 3NV9A 5JAQA 3Q9NA 3OM9A 3HZZA 4I9NA 1PJ2A 3SEFA 2PD3A 2X9GA 4KWHA 3PQDA 2NU7A 2YHIB 1GY8A 4YQZA 1ZSVA 3WJAA 2DU8A 5A9SB 4MKXA 4PG4A 2OXIA 4CMAA 5DNAA 2RCYA 4KZPA 2EKLA 4DWVA 3AOEC 4K26A 1XU9A 4BO9A 3G3EA 1BHSA 1NTOA 2QRLA 3E9NA 3NGXA 5DBIA 4DXHA 5TX7A 1BVRA 1ENPA 4MP3A 4IS3A 3P7MA 1KIFA 3DAPA 3GOHA 4XB2A 3UFXA 3I9MA 3PHHA 3R0IA 1ONNA 1D8AA 2C2YA 3RVDA 2VUSA 3VDRA 4FW8A 2JKVA 4FJ1A 3ZV4A 3I9NA 5IF3A 5JBIA 4RL6A 5T67A 3FPLA 2OBYA 5F3RA 3VC7A 2QYSA 2VUTA 3AI1A 3TDKA 5A3JA 4MIYA 4EJ0A 3RUIA 3AU8A 1YE3A 1WWKA 2X0JA 3RFXA 4WCFC 2YYYA 4MVJD 4JIGA 1F8FA 1HYEA 4M87A 3ITDA 1KBZA 1U2DA 2ZK7A 4EEXA 1LLQA 3WNVA 1O94A 2QG4A 4S3MA 4QTZA 4DC0A 5JY1A 3FNGA 3CUKA 2HJRA 3L6DA 1E6WA 2Q1WA 4R9RA 1A4IA 1BRMA 3W4JA 4PLYA 1DHTA 1LSJA 3OA2A 4A03A 4AVYA 1WW8A 1LXCA 3WGIA 3HG7A 1RM5A 1VL0A 3F9IA 3ZNQA 2Y1DA 3GVIA 5TC4A 4I9UA 3RUFA 2FR8A 3RJ9A 1WZIA 1KOLA 4CL8A 4IINA 1KVUA 1OI7A 1VSVA 3LLSA 4B3HA 3IIEA 2O7QA 3ST7A 3WGOA 1EDZA 3D4NA 3F6YA 2IODA 4UVEA 4IDBA 1FF9A 4XR4A 1CQIA 3BYZA 3EZLA 1PX0A 1CDOA 1YJ8A 4YTEA 2P4HX 1YS4A 3R6DA 1GL3A 4DRYA 1JKFA 5H83A 2PKQO 1R4MA 1DAPA 4MDHA 4CM1A 1HDOA 1UDBA 3QLJA 3CTMA 4N7RA 2BGKA 4AJLA 3GVHA 1Z45A 3EC7A 1IHXA 4KDEA 4B79A 1U5AA 1ZXLA 2ZTUA 1BWSA 4XWYA 3JQAA 3FF4A 2D8AA 3RC9A 3LK7A 3IDSA 2TMGA 4RLSA 1YBVA 3NUGA 4L74A 1IHYA 4NH4A 5MGBA 2I3GA 4XGIA 4ZQGA 3HN2A 4Z0HO 2F1KA 3S1LA 1FDTA 2Y0DA 3JQFC 1SCUA 1NP3A 3ICCA 5H82A 3ROPA 1P1IA 4CV1A 4JJGA 1H9AA 1VC2A 3PJGA 1SBYA 4OKNA 1EK6A 2JCXA 1DO8A 4PRKA 2GZ3A 1MXHA 1Y8QB 1X0VA 1YL7A 3FTNA 3IQDB 2VT3A 3C85A 4FBGA 2PGDA 3MJCA 3C24A 3DQPA 3CXRA 5FEUA 2CDCA 3C7AA 1YOVA 5TIIA 4B7XA 4D3DA 1I36A 3LVFO 1HE4A 3IJRA 1K2WA 5EQFA 1F14A 1I5RA 2TMDA 2EKPA 1O95A 2RAFA 3D3WA 1GD1O 4R69A 2P4QA 3HDYA 3BTVA 1M76A 1GUYA 5BR7A 2YJZA 3JV7A 3E18A 1Q0LA 2ZJ1A 3WGZA 2Q1TA 2DM6A 5DBFA 4TRJA 3RJ5A 3CKYA 2B4RO 1DC6A 1DIBA 3F4BA 1DFIA 3PK0A 5KVQA 2PH3A 1VKOA 1ZXBA 3S2GA 4E4YA 5DOVA 2VWQA 1K0UA 4W82A 3GZNB 2AEJA 2VNAA 2B0JA 2X23A 3WOHA 4PLPA 3TF5A 1Z74A 2G76A 5GZ3A 4R1NA 4BNNA 1NR7A 5KKAA 2I99A 5DP2A 3ASUA 2ZYAA 3W8EA 1EUDA 7ADHA 4I1IA 4AJNA 4ALMA 1FMCA 3JD0A 3Q6IA 4RZHA 5AYVA 1ZK0A 3TFOA 1XIVA 2OMEA 3MJEA 3EVNA 1XWFA 4OL9A 2ZATA 2DKNA 2NVUA 3KYDB 4CM6A 1NQTA 3HN7A 4CM4A 3RFTA 1R0LA 1ARZA 3OJLA 4IDCA 4K6CA 5G4LA 1LDYA 1QLHA 3VZSA 4DTIA 3I6IA 4PZEA 2PZKA 3C1TA 4OHUA 2PNFA 3U5TA 2AEMA 4LSMA 1R0SA 2OL4A 4XD2A 3OQ6A 5EN4A 1ENYA 1GV0A 1MGOA 4R16A 1B3RA 3BAZA 3INRA 1EBUA 2B5VA 4XYEA 5FWNA 2EGGA 4P8RA 4BGVA 2IYOA 4D44A 4D45A 4RDHA 9LDTA 5I8WA 2BFOA 1F17A 5JCXA 4MIEA 1E3SA 1P9LA 4EI2A 4MOWA 4RCVA 2NM0A 1U1IA 2O4CA 4Y98A 1PJ4A 5A03A 4YACA 3UOGA 4NDNE 1UJMA 1V6AA 1HLDA 5HS4A 2Y99A 2O3SA 2IDZA 1WPQA 1PQPA 4OOFA 5ADHA 3H9JA 1MXFA 1VJ1A 3ON5A 3P2YA 4JJFA 1QYWA 2YDXA 4JX8A 1TLTA 4NG5A 4QFCA 4HFNA 5G2OA 4XYMA 5AXCA 5B12A 4CMEA 4U6QA 4QECA 3UH1A 1EFKA 3JQ7B 1E6EA 2VTEA 3ETGA 4UVDA 2Q1SA 4Z6KA 1RWBA 1KS9A 4C4OA 1A72A 1F12A 2XXJA 4YBZA 1HZJA 2AQKA 1Z75A 1JWBB 2YY7A 3GH3A 1UDAA 3C7CB 2UUPA 3V1TC 5A5FA 4FFNA 1ENZA 3PZRA 4I5FA 3WQQA 1O89A 4GLOA 2EWMA 3STHA 3PP8A 3VTZA 1GQ2A 4QEDA 4IXTA 4E5YA 1OZAA 3RC1A 3ZWPA 1EEHA 1P0CA 2DTEA 5T8KA 4MVJG 3BMOA 1MLDA 3BMNA 2HAEA 1PZHA 3Q2IA 4ND2A 4JXKA 5L7TA 3JYLA 1UXIA 3SC6A 3VH2A 1LDMA 3H3FA 1X7HA 1X13A 3UN1A 4IIUA 4J4TA 5JE8A 4FS3A 1MUUA 1RM3A 2CDAA 3D5TA 2Y1CA 4GI2A 1PGQA 2DUWA 2ZB7A 4K6FA 4XB1A 4E2ZA 4AJ1A 3MWEB 1IY8A 4LMRA 4JLWA 2Z5LA 4E6PA 4YAKA 3RUAA 4Q3EA 3F1LA 1LLDA 1C1DB 2I66A 4UUOA 2GN6A 1Q7BA 1ZK4A 1N9GB 2PGJA 4BO1A 5A02A 1MP0A 4MP6A 3FNFA 4QO8A 4JJIA 5TRTA 4AJJA 2GYYA 2Q1UA 1HE2A 4BNVA 3KEOA 4JP3A 4BO0A 1E1NA 4CM8B 2J8ZA 1YQDA 4XIJA 3UXYA 3ZNOA 4YJHA 4B4VA 3GEDA 4A2CA 1GUFA 1WXDA 3RUEA 3TZ6A 4RV9A 4YYZA 3RWBA 2BGMA 3MOIA 5LCXA 4XJSA 4OSPA 2V6FA 3B1KA 1ADBA 2DTDA 4RVDA 3SVTA 4DGSA 4M55A 2JHFA 4KUEA 1IE3A 1B8VA 1C0IA 3OEYA 2E48A 4DBVO 3PYMA 3WWYA 4E21A 4ROSA 2POQX 1ADCA 2VUUA 5A9TA 3TN7A 2GR9A 4UUPA 1U7HA 1DLIA 2W2LD 3T7EA 3OP4A 2GN8A 3G0OA 3BHJA 4ZICA 2B35A 1V8BA 1HDCA 2NV6A 3X2EA 4J0EA 5C5IA 5JYEA 2PD6A 2O7SA 4J9UE 5L7YA 5JXWA 2W98A 3WGYA 4NBUA 4FGSA 4JGBA 2B4QA 2E49A 4XRGA 1KEPA 4Q39A 1YBMA 3KSUA 4K28A 3WYCA 1U4SA 3AUUA 1XHLA 5B4TA 1A27A 4EUEA 4CLOA 3ROKA 3OMLA 4UEJA 5L95A 5COQA 2JCVA 1CEQA 1D7OA 4YRDA 5THKA 3ZNPA 3ZV6A 4G81A 4WLVA 1VE9A 3PRJA 1TEHA 3KYBA 5DOZA 5AXBA 1VLLA 4B4UA 1LJ8A 3U4DA 1I3NA 1OC4A 3NKLA 3I6QA 1EE2A 5L45A 4RDIA 2GSDA 2V6MA 2A9FA 3RAJA 2JHGA 5U4QA 5I9LA 3I1JA 3GZ4A 3OQBA 2HCTA 1MG5A 1ZMOA 3GC6A 2IE0A 2R00A 1B0AA 1H6BA 1E3JA 1E1KA 1PS9A 2NTJA 3DBRB 3E5MA 3QRWA 3NTQA 4AJHA 4YB8A 2EJWA 3WJ7A 5H81A 4Z3KA 3ZWVA 4IMRA 4BGEA 1DSSG 3O8QB 4YRBA 1I2BA 4GKBA 1R6DA 2Z1MA 4XEHA 1LU9A 2NWQA 5BSFA 3PGJA 4YWJA 2EW8A 1ISHA 1I33A 4XDYA 3E5RA 3LYLA 3AY3A 3AUSA 4RF4A 2HDHA 2ZTMA 3L9WA 2AE1A 1CIVA 2X86A 5CP8A 1GV1A 2AQ8A 4IIVA 1HDRA 4MVJE 5EL0A 4DBZA 1WNTA 3RCBA 3MJSA 3HHPA 1Y8QA 5THQA 2X8LA 1PQUA 1FDUA 4P4NA 1PGOA 5TQVA 2J3HA 1XU7A 4CQMB 1T1RA 4URFA 3Q2KA 2O50A 4FFLA 3TOZA 3GAFA 4IDDA 1ISGA 3GGPA 3I9KA 4HXYA 1HSZA 2X0IA 1ISMA 4CMGA 5JC1A 3ZWNA 3PEFA 4R4JA 3H8VA 2X9VA 1Z6ZA 3K2EA 4JP2A 3TZKA 4BNKA 1QYDA 4RORA 4D3FA 2Y93A 5T6BA 1ISIA 1BGVA 3KUXA 4Y6RA 5HBRA 2JD1A 3A1NA 4M54A 4D46A 3OQ1A 3E1KA 3GFGA 3W1VA 3UCXA 3FNHA 4XDZA 1EUCA 3O38A 2FSSA 2V65A 4WKGA 3TZCA 2R6JA 1FJHA 3NJ4A 1GU7A 4CJXA 2Q4BA 3NJ8A 1T2CA 4WASA 5B37A 3B1JA 3GF4A 1HL3A 1BW9A 1PZEA 4HY3A 5EESA 4II3A 3LC7O 3HUDA 4D7AA 2Q99A 1S6YA 4WUVA 3WIDA 4R1TA 3ADOA 3JD4A 1XQ6A 3NTOA 3RQSA 4BS9A 2DQ4A 2PZJA 2D59A 4KDFA 5F1PA 2AEFA 1WDKA 1GZ4A 2YFQA 4J9VA 5TS3A 5T8KC 3INTA 2P5UA 4MKZA 1UAGA 5L4NA 1V9LA 1ID1A 1SB8A 5AQ1A 5TF4A 4BUCA 1EZ4A 1DFGA 1X7DA 1P74A 3F3SA 3FPCA 3U4CA 4ZD6A 3W6UA 4PFJA 3EMKA 2BI7A 3IUPA 1YONA 4DQVA 2DTXA 2OBNA 4CV2A 2UYYA 1DIHA 3KHUA 3LC1O 1M75A 3FD8A 1U2GA 3K8ZA 2YQ5A 3R3SA 1DHRA 1EK5A 2W2LA 1ZEMA 5TLSA 4E2WA 2X5JO 1OBFO 5IAAA 4FOOA 1H9BA 1G1AA 1T1SA 4ZQBA 5KCZA
chains in the Genus database with same CATH superfamily
2HGSA 1KVSA 2XMQA 3I4LA 3HXOA 3ZDZB 4BMYA 5G0TA 4QWMA 3GFFA 4RD6A 1XL0A 3MCWA 1A5SB 4BU1A 3F3MA 1PK8A 2HD4A 2DP4E 1U7UA 1YK0A 2R4QA 4U0JA 1XG5A 2C57A 3LUBA 4UFPA 2QLJA 1UK6A 3BL5A 4Z9BA 4D25A 3DHYA 3RDPA 1SXHA 2QZJA 4HWGA 3IE2A 1VB5A 2BKXA 4PLVA 5JSQA 1QG2A 4L8VA 2EW2A 4FJ0A 3KD2A 2WF8A 1NJGA 4JI5B 1H5QA 1VMEA 1VJTA 2JFUA 1Y5NA 3ND9A 1RQNA 2ZJOA 1Y6JA 4MYHA 3KJXA 1SVUA 5KWSA 4OYHA 1VPDA 1L0BA 2JCBA 4NFYA 4UM5A 3W8FA 3AHGA 5AK5A 1Z8FA 2B3DA 3L0CA 3NC1C 1UWKA 3R4CA 3AHIA 4NNPA 2GCOB 1CQWA 1O96B 3VMFA 4NMXB 2RJOA 3WK8A 5JAMA 2FPLA 5BNIA 1E1CB 3G0GA 3KHTA 4KK4A 4UKDA 1KA9H 2IIBA 1G8KA 1ZN8A 2WTXA 1PAUA 2VOEA 4LOJA 4NYMQ 4JC5A 3SGLA 4OYRA 4TZKA 5ALQA 3V7FA 3MS7A 3Q98A 4X00A 5GIOE 1NKVA 1X14A 4KN6A 3L82B 3RLIA 3WGJA 4WJLA 5K3OA 1P3Y1 1CIPA 5ICGA 3ROQA 3LP8A 4Z3OA 5CB4A 2X8JB 2WTNA 3N8KA 5EP4A 5FNVA 3SS9X 3WLKX 2EBUA 1TMYA 3KJEA 4HRVA 2HMYB 1OIWA 2VRCD 3KK0A 4Q4AA 4IQ0A 2B6HA 1RXIA 1RE1A 2ZJ6A 1JB9A 5DN6D 1EX6A 1JIXA 1UMCB 2C9YA 1SY7A 4X7BA 2PXXA 4BO2A 1RYDA 5AUNB 4LJYA 4L95C 3VO2A 4FWTA 5HMLA 1T9KA 3CKKA 3C45A 2A0KA 3TMKA 1DKOA 3T0GA 1O0BA 4J6FA 4FZ3A 4LDPA 4HKTA 1XTZA 2VK8A 4TSKA 2DHEA 4WXHA 1G98A 3OKCA 5JFGA 1PW5A 1VE6A 4D9CA 5HYVA 3QX8A 1FRVA 3UB2A 1J33A 4BQOA 1C3JA 1GZ3A 2BFMA 3U7EB 4AMYA 4GLFA 3UHOA 1SKYE 1LW7A 2C3UA 2OUKA 3NHUA 4DHEA 4Z51A 1J5PA 3JD1A 4HMPA 1GPKA 3WIUA 1E7RA 2P40A 4JHXA 4MQEA 2Q0SA 2R00C 4FGJA 5ALRA 1F1BA 4OAOA 4WKOA 4FGWA 2WTBA 4GZMA 1NBMD 3N2ZB 2QX9A 2PTGA 3EGIA 3SCZA 1E1DA 4CUZA 1ZUNA 5JASA 5LP6A 1L5OA 2P2DA 3C8HA 4IDFA 4TXLA 4GOKA 3BVPA 5E7JA 5DMXA 2J31A 5KNBH 2E6KA 2ETVA 5LQSA 2AOVA 1U8CB 3BL8A 5JZBA 2V0GA 5MN6A 1AZWA 1T26A 3NNDA 3GQBA 4L8FA 1VE7A 3BCSA 2ATVA 3SLGA 2C2BA 3H1FA 2IF2A 4IJWA 3A70A 2I22A 5HRUA 3TE7A 2OV8A 5C7YA 4C4PA 3QWFA 4O63O 5A0VA 3TD6A 5DM60 5M29A 3ME5A 3HPQA 4P36A 1GL6A 4F91B 3BTUA 1CNFA 1YE8A 1KOJA 3UJ9A 1XTQA 5I7RA 1NRXA 2EBHX 5KDDA 1P3DA 2UDPA 2VP3A 5F7ZA 1CUYA 3K05A 3WGTA 5FO0A 2JAWA 3I53A 2CYBA 2VXBA 3P9SA 4NZPA 3E84A 1K06A 2BFNA 1U1FA 1YVPA 4QJBA 1ZU5A 4XASA 3SBEA 2HXYA 3NEYA 2WK1A 3H9BA 2HX1A 3HFRA 5IT0A 4UZSA 3K4HA 4UZEA 3WYEA 3H42B 5KKNB 1VLHA 1DFHA 1U3FA 3R8XA 3EXHB 5EIXA 3CSSA 4CLRB 2QXYA 3PUKA 2ZTVA 3UF0A 4MHSA 2IUSA 4OG2A 2NIPA 5DBEX 3GLIE 4AAYA 2JEZA 3E58A 3KVRA 3SZ3A 1B15A 2ERXA 2D5BA 3KVYA 5CH8A 3JR3A 4M6WB 4XCVA 4ZKDA 5A3RA 5C35A 3AHFA 2OO3A 1C3XA 4Z1MD 4YJ2A 3JVEA 4Z2AA 1AMOA 3G68A 4DREA 4UBMA 2E1PA 2RHOA 1EHCA 4WOJA 5FTJA 4A23A 1QE5A 3A4LA 2X2FA 1GPMA 2XT9A 5JYDA 3AFGA 3OETA 4L2IA 1ZITA 5JDIC 4CKZA 2V1XA 3STXA 3NVKI 3Q9LA 3WBFA 1NN1A 4PPYA 5A7FA 1YDEA 1IL0A 1XTBA 2EX0A 1Z63A 2R7KA 1Y9EA 3LDUA 4RHFA 4IPTA 2JC3A 4WBSA 1JFTA 2X8WA 3EDYA 3ULKA 2O2HA 1NRIA 1PEDA 1A9XB 2W58A 3G2QA 2HW8A 3HK2A 4TZ6A 4F8EA 5CBPA 5G02A 1WKVA 3MPUA 4IEEA 4RZXA 1NV8A 4IGIA 1GR0A 1YRQA 3DXXA 3DNPA 4KO1S 4KYIB 1QLJA 1QGYA 2EKZA 4YMGA 1P7YA 3DV0A 1QOZA 4F8YA 5I4KA 3JQGA 1VKHA 4PSDA 4CHGA 1Q1EA 2Q4DA 2Y4NA 3K35A 4KGDA 1MOSA 4L78A 2XRYA 1E62A 1SBTA 4M38A 3U3ZA 1WOMA 2FE1A 1TZMA 2O7RA 4E13A 1U6JA 3KKOA 4KP7A 2ZIZA 4OOEA 2H16A 2RK3A 3D2AA 4R9VA 1S8AA 2KPOA 5CH3A 2R6HA 1F2TA 1CFJA 2J5QA 4U7GA 3R7WA 2EARA 3SNKA 2HK6A 1WCWA 3VH1A 3KR2A 2PEYA 1VBFA 3H3XA 1EDDA 4EUFA 3SY8A 3PFCA 1KDTA 3ILVA 1WMAA 2C4KA 3LD9A 4RLHA 1OT5A 3QPCA 4XFJA 3SVZA 4CQMA 2VJYA 1XZDA 4K3UA 4MV7A 4WNIA 2RGBA 2FLVA 2ICAA 1A5ZA 2QM8A 1BOFA 1ZX1A 1T9AA 4N7MA 2H63A 1EG7A 2ZE6A 2GHQA 1F2UB 1P5ZB 4HRAA 4DIEA 1PHPA 3R7SA 4X94A 5KTRA 1VMDA 1M5TA 4L6AA 5DIFA 5WRFA 3TWOA 3E03A 1CY8A 4XTCS 1RPAA 3RVPA 1D6NA 4FI3F 5DTIA 3KKLA 1GZVA 3FBGA 2CDBA 4Y2PA 4WOPA 4I1UA 5BSHA 2QRJA 4JLMA 1GCIA 4KHZA 1FTSA 5E1BA 2PLRA 5K3SA 4GH5A 1WHSB 2HI0A 4R8RA 3VX3A 2NPOA 1BXRB 3S2ZA 1GA6A 2SNIE 4RZQA 1FB5A 5D1NA 5ESXA 1WXXA 3MERA 4W8GA 1M0WA 4JYBA 2DLNA 4B09A 1QVRA 2QB5A 1HFWA 3GEEA 3DP9A 2QD3A 1YB1A 5IPFA 5FOSA 4E4RA 3BZBA 3HLTA 4AY6A 2YYZA 3BBPA 3H9UA 5TT1A 2D1RA 3RWMB 1DQNA 1KQNA 3W4KA 2PGLA 2VI5A 2WTMA 4E2YA 5JC8A 5JRDS 4CL0A 2BD0A 3OUTA 1Z25A 4LBVA 3PX2A 1ZIXA 1ZOLA 2A5GA 4LE1A 5JWOA 1QP8A 2C82A 2QRVB 2VJNA 3ETJA 3H65A 3KJIA 3UAOA 4BIIA 2ADMA 4JJ4A 1N78A 4TLAA 4AKTA 4DV3B 4FEGA 2I0FA 2I6FA 1J8FA 3ETEA 4R3NA 3EFOA 1JR3E 1JFLA 3H9GA 3MTIA 3VR4H 2CK3A 5T3UA 3JWHA 1CK4A 5K3FA 4JCCA 3FMOB 4HMOA 1IXSB 2GNAA 3ABZA 3ZU5A 4BNFA 5KUTA 3KKKA 1RIFA 4W5QA 1AZSC 2DPGA 4YAOA 5C5CA 2O52A 3COJA 2WKPA 4PCVA 5D84A 4E07A 1UAAA 1JFVA 3F4LA 1IZ0A 2WJJA 2AHRA 4H7DA 3WRXA 4P4SB 2BMFA 2CZQA 4J91A 3AY7A 2ZRJA 2G7MC 4NOMA 2J3KA 1N92A 2FETA 2WOJA 1VHDA 4DIFA 4EPYA 3H11B 5LJIA 2I2BA 2EOAA 1WMSA 2F67A 3DS8A 1IIBA 3NRJA 4R2JA 3WYGA 4YAUA 3VR6H 3DEIA 3QF4A 2JFYA 5BNZA 2CXQA 1ULSA 3HWSA 4PXAA 1Q1GA 2JGIA 1MFZA 5JS8A 2JKYA 1P0PA 2DULA 2X8AA 3SHTA 2V7XA 1KKUA 2QN3A 3C74A 4LZLA 1I5EA 1E3WB 3ORHA 3UH0A 3VA7A 3A0UA 2JA2A 3TL2A 1NUHA 2Q5HA 3IUQA 4B35A 1CUBA 1Y4SA 2JKZA 2OD9A 2YIDA 3IJ5A 3OI7A 1JQ3A 5EKSA 3SKVA 1N3IA 4B81A 1XR3A 1S3SA 1SRRA 2B83A 5CLGA 4BMDA 5K6AC 3IERA 3L9XA 1P9WA 4NTZA 2WD8A 4U7JA 1NIPA 4LY3A 1GFSA 4E1BA 2XY4A 1IBKB 1YHYA 2PMCA 4RSGA 3VGPA 4K03A 2GCOA 2XYRA 1HLPA 2UAGA 2XA1A 2Z83A 4CKYA 5CX1A 2G4CA 2R6AA 2CT8A 5IC5A 3FLMA 3FVTA 4EDFA 1JIJA 5AW5A 3O3CA 3UPUA 2B4YA 1L4LA 5A7HA 4CT5A 4KTTE 1JSRA 1Y5MA 3WTCA 4HNGA 2JD2A 3I52A 3VYWA 3HZRA 4N0EA 4L85A 1A04A 2V98A 3VYUB 4EKGA 1ZW1A 1SCNE 4A7PA 1PNTA 4KO3S 3E82A 2H11A 4DF3A 3VUEA 2Q5JA 3JVIA 3IS3A 3VDQA 1G6HA 3O3MB 2RDMA 1Z28A 3GLRA 1V11B 3AZQA 4HB0A 1NZDA 4IX9A 4P98A 1CZHA 5IN5A 4LWPA 5JCOC 3AVOA 5AKYA 3ZXYA 4EA6A 1RKXA 3GAAA 4UEOA 3LRTA 4KKXB 1D1SA 3CURA 2Z8YM 3TOXA 1LTHR 4NK4A 1O5OA 4YMIA 1M1XB 3ABQB 3BMQA 3KPVA 4MS1A 3DAFA 2G1UA 2V9ZA 3FYTA 3KEQA 4YUVA 1LTQA 2DFDA 3A6HA 3FDXA 1FFGA 5T64A 3WAJA 5JCJA 3X1ZA 4AP6A 2GGSA 2RI6A 3LAWA 3BPSA 5A5GA 3E5HA 1AXEA 4Y2SA 2LDBA 3AF0A 3ZZUA 4E3ZA 2HU5A 2SKEA 4D96A 2GF0A 1TTQB 3GBSA 3N1UA 1XF1A 1UBKS 2EG9A 1MQ9A 4P7GA 2VUHB 4UW9A 5ALGA 2BCEA 4ZAZA 5FJJA 1F1JA 1M10A 3FVVA 4GW3A 2DX7A 3KQOA 4AWAA 2P2LA 4YMWA 5A9RA 1QFSA 3B5JA 2NLOA 1ZBQA 2FDXA 2PZ8A 3RSHA 2MCFA 2QN8A 3F7MA 4YJGB 1P31A 3ROTA 4BYGA 3MJVA 1ACMA 1A8QA 5KAPA 3P0HA 3AJ9A 5BUSA 3BMCB 3PS9A 3U3JA 3SD7A 4DJFC 3NO4A 8OHMA 3KUCA 5LKAA 2H5LA 1LGYA 3ACCA 1L8QA 4M7RA 4YRRA 4D9KA 3HXLA 4ZT5A 4NOLA 4ECEA 4BB0A 2ACKA 3A06A 5HUQA 3IRUA 2AN1A 1C1XB 3CUEF 5I5GA 2P6RA 4EB6B 2VAPA 1NVGA 4RVGA 3NR2A 2IBSA 3LU1A 5AUOB 3AXSA 2GA8A 2YC2C 3QFTA 4EL5A 5H9VA 2H1OA 3QYPA 1V47A 1IOLA 4H35A 3R40A 3GUZA 3RBZA 1FNDA 4K05A 1L5MA 1WP9A 3OZEA 4V02A 5FTWA 3DZ8A 2YHIA 1SXJD 4LSWA 5BVGB 3IB3A 3D7RA 5IUKC 2XMRA 1Z73A 2IWHA 3W77A 1XALA 3NKVA 4JH0A 5JANA 4ER7A 1JG6A 3FWZA 2I2WA 2F1JA 2D0OB 2GD2A 1SU4A 2BKAA 2OCYC 3IHLA 1VIAA 5JJCA 1DAMA 3HYNA 1WBBA 4WECA 5BSGA 2P7IA 4CLRA 4RELA 3OURA 2TYSB 3JYOA 4RIFA 5AVQA 3UAZA 4F3YA 1JKJB 2CVPA 4M6WA 2JJ1A 3QG1A 1QQ7A 3MWKA 3D9QX 4US1R 1GGNA 1T2DA 4Q16A 2RARA 2XD4A 2Y6UA 4AURA 4XGQA 5JJBA 4KFSA 3T3DA 2C98A 2PTHA 4MS3A 3W6OA 4F2WA 3F97A 1T9HA 2ASEA 3C3PA 1C8LA 1C0LA 4R1QA 3ZY4A 4R0VA 4RKWA 4ZXPA 4EHIA 5T57A 4AXXA 1NQ5A 4RSRA 5EJ7A 2RHDA 3HRKA 4B4KA 3PQ5A 2BONA 4LK2A 4JFRA 5DT2A 1R6TA 4HFMA 1XP5A 1SVIA 2Q3DA 3BSYA 4JDUA 4Q9HA 4XRRA 5E95A 2AS0A 3NXSA 4BKRA 3OFSA 4ENUA 3DBLB 4YRSA 5CNKA 5AJVB 5A6SB 1R4NB 4TMYA 4D74A 4IQFA 3R77A 1Z4IA 5BSEA 1V37A 2X0RA 2I65A 2P2YA 4YCDA 3UGJA 3V7YA 2F3SA 2A1IA 1NWCA 4OFWA 1EA7A 1UMDA 2QT9A 5GJCA 3QTTA 3L7BA 1HLGA 2B7LA 1TX4B 1W6RA 5E7QA 5GOTA 3W2GA 1GL9B 3D0KA 3QTLA 3OCVA 4IBOA 4K3VA 3UHJA 3GMSA 2DHCA 4HEA1 1XZQA 2G36A 4H16A 2XIQA 2I9PA 4KJZA 3NWJA 1CUCA 2E21A 4N39A 5KTTA 4KQGA 2XTAA 2X3UA 4TTVA 1NNEA 3PLAE 3PL1A 4XR9A 5HE9A 3BIWA 2WQZA 4JENA 4BJ1A 3DMHA 1N0UA 2B69A 5C8VA 2HUNA 4B2LA 3GJ4A 3CEPB 3V1KA 1KF0A 3CM0A 1GPNA 5GVRA 2QTWB 4Y8VA 3UCFA 1PFVA 3NWBA 3GPCA 3O8NA 4J2TA 3U3DA 5KDOA 5F1OA 3TNFA 1C8KA 4Q4DA 3M2PA 4BZZA 2V3CC 1TEZA 3LTEA 1TGVA 2YRWA 2ZRBA 2BFAA 4WOBA 3VU9B 1WY5A 4EENA 2V97A 1J0XO 3EUFA 3H9QA 4JK3A 1KKMA 3DDSA 3VC3A 3SVLA 4R2HA 4TV8F 1YI1A 2HRQA 1K3FA 3A4IA 4QNNA 4G0YA 3RPEA 3EY4A 1FYEA 3PHCA 5GZ1A 3OESA 1Z16A 2FSVC 3SIXA 3VTFA 3ZHCA 4OYLA 2QVLA 3U40A 1GDDA 2W8BB 1QNFA 2QZZA 3E9YA 4HGOA 4R2WA 5EY5B 1DAHA 1D07A 4G5GA 1SU7A 1AS2A 3NEPX 1LS6A 5LXTF 2NNLD 2ZYWX 4DC9A 5E9AA 4CGYA 1XDBA 1Z5PA 5BVHA 5REQB 1LX7A 4J7CA 4URZR 5FI5A 4K9MA 3ZDEA 4IV0A 2C9BA 3JQCA 4GYKA 5LB4A 1VG9B 2IOHA 2D06A 5I9NA 4X1OA 4HBZA 1CVLA 3N2NA 3PTAA 1D0IA 3TTVA 4M0UA 1U5CA 3RSCA 1NOKA 3W6PA 1E5XA 1GL7A 1Q1BA 1RSZA 2IU4A 1GM5A 3RYIB 2ZDHA 2CVZA 5F35A 2AC7A 3PC4A 2R5FA 2OP1A 1MT0A 4ME6A 1YRLA 5HTKA 1N0HA 2ZRPA 3RTDA 1I32A 1EXDA 1TAQA 3EC1A 1N5DA 3EVAA 3RC7A 4WKBA 4X6YA 5FH9A 1A71A 3R0JA 2Y1EA 1QKKA 4YDSA 3BGVA 1LBIA 1A7AA 2GTIA 4RXTA 4TUYB 4BNLA 2XUOA 2WSLA 3JQRA 5LBIA 1L7RA 1ZM2A 4B5LA 4ENWA 3KQVA 2NXNA 1MO2A 1EAMA 3P2KA 5AVKA 2PZBA 1YRHA 5TJ9A 4GF5A 5MF6A 4Z7NB 1OWPA 4WXYB 1ODCA 2XOKA 4NIMA 1O57A 3GZNA 2EATA 1I3CA 4IIYA 1ISRA 4P4SA 4TV9B 3DPIA 4YXWD 3GWGA 3DC2A 1OHHD 3H99A 4I3HA 1X7WB 1OZHA 1SVLA 3D8BA 3OCCA 4MKIA 4OAPA 4ZIRA 5ALYA 5C4IA 1M6VB 1E9SA 4LQDA 4H27A 4OP2A 3TCKA 1P4RA 1A8HA 1AHNA 2MINB 4ND5A 3WWCA 5DTMA 2EFDB 4KXWA 2ZUFA 2E6UX 4AMZA 1Y4DE 1RZUA 4GGOA 4TTRA 1N34B 3LYAA 3P2OA 3CF6R 1XXHE 2O20A 1G5QA 2ZDGA 4MW5A 2C2OA 2NGRA 2ACEA 1KSFX 3O03A 1XLWA 3ZLTA 3N0RA 4E5MA 4F46A 1XDGA 1E3WA 2ZSAA 5EJGA 3KYDA 4IMPA 3IEVA 4TX1A 4MYSA 3LQQA 2F1IA 4ZEVA 4BFYA 5GJBA 3F5SA 3GJXC 4O1IA 1O6GA 1KRWA 1C0KA 4ZCTA 2EX4A 5KWEA 1HUQA 3WRYC 2PMKA 3BF8A 1F6BA 3OY7A 4D4GA 4NH0A 3RVSA 4TVBA 4ZMBA 4GKKB 3ZR4B 3SR3A 5ECWA 5BPHA 2FLKA 2HY7A 3IO5A 2RHLA 4Y9RA 2F6RA 2P9EA 3T3HA 1SKBA 2ZSIA 1GTMA 2HRRA 2J09A 4F3KA 4UXHA 1JAXA 2VF4X 1BS9A 3ELDA 4AMBA 1FNSA 2PJDA 5FI0B 2VOJA 2IUUA 1H8HA 4JKIA 1WMFA 3N2KB 5LLDA 3EQ7A 5EE9A 4YK7A 1N5OX 2R7LA 4FX2A 5C5EA 3D3WB 1NZJA 4H3VA 2F9LA 3TPZA 4F5ZA 3E1SA 1P18A 2CW5A 2UXDB 1IY2A 3ZS9A 2RKWA 1GNQA 4LDAA 3A6FA 1AZLA 3LA6A 5LLTA 1KWKA 4P4LA 1TMOA 1JGTA 1SUWA 4PBTA 3DMYA 1VL6A 4QNMA 3OVMA 3L6CA 2FWRA 2FQWA 2IC5A 2PL5A 2PA3A 3FFWA 4NYJQ 1ZOIA 4G9EA 3LUJA 4RTRA 1W4ZA 4IIBA 4FP9A 3A6GA 2FEWB 3L0BA 4GMFA 3SXPA 1JQDA 4UNSA 1JSCA 2Q8NA 2YZGA 3GJ8A 3QOFA 4DT1A 1AH2A 1X0XA 2WPDD 5L3RA 3AM3A 2Y0EA 1N4DA 2NT4A 5ULLA 1R3UA 3FNIA 4BX8A 3U56A 1EFUA 5A3SA 1Q7CA 3CKMA 3GEGA 4JLNA 4KCGA 4ZRMA 3TAHA 2J9XB 4LHVA 3WDKA 1KZ9A 4BMSA 4C4TA 3TZQA 1EUDB 1QG4A 3G7UA 1QF9A 1PEYA 1YQQA 4LZJA 4RD4A 2W4QA 3AC0A 4U5QA 2LVBA 3DEYX 1M6YA 4FPXA 3SX0A 1ND6A 3WSVA 3WGVA 4OQFA 3ZGZA 5FR1A 4CNQA 1NF8A 3ZDXB 2WWGA 4PR3A 4YJGA 5LDGA 5KOIA 1R5OA 2B78A 3B52X 4HAXA 4RTKA 1N8TA 3EYAA 1JBQA 3DDOA 3FHJA 1J1ZA 4I8DA 4RZUA 4YP7A 3S1SA 4RD3A 4QULA 2JIQA 1L5NA 4YO8A 1PK7A 4M9QA 3Q7TA 4N4AA 1AQIA 5HKLA 1EX9A 1GKIA 1RAEA 1G63A 2WIKA 3N8DA 3JQPA 4O1MA 2VTBB 3EVFA 1TD1A 3NONA 4N9QA 2QTCA 2Y68A 5E6UA 3O8RA 3IKVA 3PC8C 3GLFA 3KFVA 5BO5A 4WNAA 3V80A 4HPXB 1JE1A 4LZWA 1GVNB 2I3BA 2Q2VA 1XZGA 2V96A 4LCBA 5C34B 9ABPA 3BL6A 3D6UA 1WEKA 4ITUA 3RUDA 4EB6A 4TXNA 2VSOA 5KREA 2XB8A 3B85A 16PKA 2CKDA 2IZZA 1JB1A 1YQGA 1FVXA 2YZKA 1AQLA 1VZ2A 3G2IA 1FUIA 3LKVA 2VYND 5K99A 5M5BA 1D6MA 2JH9A 1PU2A 5DSXA 2YJ4A 1O4VA 2EF0A 3EDMA 2PX2A 3JQ9C 5K0GA 1RPZA 3RS0A 5LQRA 3MAAC 3R6TA 1C1DA 3EPJA 1MV5A 1MHPA 8LDHA 2ZZMA 2AG6A 4P3PA 2ZTHA 4A8JA 4EFLA 2Z3VA 1SXIA 1V7CA 4UE2A 3M3HA 4CXMA 3COVA 2A78A 2W2QA 3JATA 4MUNA 4B43A 2G8NA 2NACA 3MTJA 5LZ7A 5BV2P 2GEJA 3RU9A 2ORYA 5KNCD 5A05A 4RWZA 3DSRA 2PRIA 2JH3A 2V6GA 3L93A 4P4GA 1CLEA 4TPKA 4NCBA 4RKYA 4B3JA 2D3TA 2QLFA 4BNHA 4RZ2A 4CQJA 1P2GA 4ZT4A 5ICCA 4B9AA 1P7PA 1PJQA 4N0MA 3TD9A 3JWEA 4KRXA 5C52B 3B82A 4LF5B 3KB6A 2QNBA 1Y48E 4Y1RA 4YGXB 3PEWA 5L8VA 2GAJA 2P5YA 2VDPB 4V0NA 2WSSD 3USES 2RSLA 2GCIA 3ZH2A 4ED9A 5JCZA 1VIMA 5AVOA 3V9PA 3GLSA 5J4LA 5CPBA 2DB3A 2FP4A 4Q37A 5KHLB 1WULS 3PBKA 1HTTA 1EXMA 3GAZA 1QHGA 4EG1A 1E18A 1EI9A 1QV9A 2FRDC 3KJZA 5L3SB 1W44A 1KSHA 1ZMTA 1I2AA 4JB3A 3L46A 1E92A 4BKUA 4X6LA 4GYYA 4K1LA 4NP6A 1YDFA 2B2NA 5AESA 1JA9A 5AVYA 5CT4A 2VXYA 1JHPA 2UVDA 3KR0A 4ZQFA 5KTYA 4P0PB 4GLLA 5HP4A 3MTBA 4JZYA 4Q3OA 3G5UA 2FXIA 4N9WA 3R24A 5AVUA 3T3NA 1Q3KA 2PG3A 3GCWA 1Q6ZA 1Q1NA 4V0RA 3GIWA 1DPGA 5DTEA 2FFRA 4C0KA 1E2BA 3KZMA 3MS4A 1CUDA 3AL3A 4OMUA 2QRNA 4OV6B 4QHSA 1ZD3A 1B8PA 3G23A 4O3FA 1D04A 2EVWX 2VHYA 3NBUA 1UR5A 2QY6A 3A3YA 2H1RA 4N3AA 2OORA 4HEA6 4DSNA 3AF5A 2NSLA 4NFLA 1RTKA 4YECA 5HK8A 3A27A 4TWJA 3GJYA 3ZX4A 3U9SA 3Q88A 4B6PA 2PVPA 4K9KA 3W7VA 2C7RA 1YXMA 4PGGA 1H2BA 3FSGD 3ZWKA 1NVBA 4DJTA 2JIZD 1RCFA 3UMGA 1ZRNA 2G0AA 2WHYA 3QPUA 5ELMA 4CFSA 4EB3A 2J3MA 3H8SA 4D41A 4RGBA 5C18A 3C5VA 4RA6A 5KOJB 4GGMX 2IZ0A 2ZVDA 4C6TB 1KEEB 1DP4A 3E05A 3FETA 3H18A 1XJCA 4FNMA 4IUCS 4JVOA 1ZUD1 4WESB 4O4JF 4Q0MA 5FQOA 4JI4B 2XEDA 3BQNB 4RVUA 4E1AA 2FEMA 2J0VA 3VU9A 2PS3A 1JEQB 1UM8A 3DBRA 1DC3A 4RTJA 2DHRA 2QGZA 3TEMA 4G0PA 1F6DA 5EJIA 5EJ8A 2GBCA 3RS3A 2Y3IA 5CFRA 1DAGA 1ULZA 4G86A 5DGXA 1GRCA 1GFZA 1IXKA 3FN4A 1NASA 3O8QA 3KBBA 3N5KA 3R5TA 4IUBS 1ZK1A 4PYJA 1ZU4A 2VLBA 1LPOA 3CRQA 1UCFA 3G8YA 1G17A 1E2UA 3HYSA 3IT0A 4POAA 1YJQA 3DOIA 4TS3A 2I33A 2RH8A 3Q8MA 4RHTA 1YQ9A 1VSTA 5EJ9A 3OHMA 3NHAA 2A94A 4BEVA 4E1VA 4CM5A 3KSRA 5EXTA 5F5NA 3V55A 4EKIA 1K7CA 2BKLA 2RBEA 3DPUA 3ZDAA 5LIPA 1G8MA 3REQA 1R9JA 1U3VA 1QAMA 1V8ZA 2CLCX 2QYOA 3K6JA 4WNYA 4AJPA 5JSHA 6AT1A 1BHJA 2OOSA 1SA0B 3N7AA 4D6XA 4ESHA 4F6CA 2YN4A 1LDBA 3WQHA 3H2HA 3G8BA 3LXXA 1DIRA 3FIUA 3GHYA 4HGPA 3G89A 1HXHA 3Q6NA 2AWNA 2OSVA 3H5IA 4M37A 1B73A 1GCUA 3MTGA 1X8KA 3BSSA 3I45A 2H2AA 1N32B 2HWYA 3OZ7A 1DBRA 3EQ6A 4RQAA 4YUAA 1YF3A 4CQNA 2VRCA 2P7HA 3DAOA 4RGYA 4C0WA 4B47A 4LF4B 1VFPA 4FCWA 3U31A 5DN6A 5ITVA 2PZGA 5EMMA 4MTLA 1QDUA 3CNEA 1XHEA 2RHJA 3AR5A 4W6ZA 1JALA 1QZ3A 1TC1A 3BRWD 5HNKA 5KTKA 1MDBA 1RHMA 3GRYA 4RF3A 2F2TA 3QW4B 3THSA 3TLGA 2G25A 5HJEA 3AF1A 2AE2A 2KHZA 4TTIA 3K0HA 1T5HX 1W88B 3IO3A 4GI5A 5DHTA 2UZ4A 1TYDE 3DCNA 4I50F 3UJ7A 4D43A 3TRFA 2XT6A 3MILA 2EL9A 2GASA 3DOEA 4QNRA 4R51A 4UOZA 1IMOA 521PA 3DHEA 2KSQA 2YJ3A 3CH7A 3ZBUA 4RTSA 5KO2A 4L75A 4CM9A 2C29D 1YI8A 2Z4RA 3ZWWA 3DWGA 2AX4A 2NO9A 2HADA 1IATA 1IWBB 2FPMA 3LQ1A 3A7DA 4D8YA 2OPBA 4FYKA 3ISJA 3BXHA 4A92A 4EW3A 5LYJB 4WVLA 3E7XA 2HA6A 5K1ZA 4GZ5A 4Q03A 3UHFA 1C7RA 1EM8B 1G21B 4TKLA 5CXXA 4DANA 2FPOA 2NADA 3BUSA 2AC2A 4YJFB 5H0IA 4E51A 1TCBA 1KHTA 1W1IA 2PWAA 1QOPB 1YUMA 4M0CA 4MJXA 3M4ZA 1GTZA 4TQUS 1B4DA 1N2ZA 4NR0A 4X6XA 1ZM7A 4EX6A 4N76A 2GAFA 5IJZA 3TX6A 1RRCA 4XQ0A 1HEUA 4KNWA 4GX1A 1Z68A 2D1YA 3UWOA 5AOCA 5A62A 1OA1A 4MDFA 3DKVA 3T1YB 1T9CA 3EPKA 3VO1A 3SHVA 1PJSA 1FMFA 3MMZA 4JP1A 4QEKA 2J3IA 5FBWB 2C9MA 4QQRA 1EP3B 1DU4A 3H5RA 1RZRA 3ZGVA 5LFAA 2FQYA 3TQTA 2ZJ0A 2R65A 1WCV1 3B1ZA 3MWDB 2B8EA 2GLXA 3EIUA 4WRRA 2GRJA 1VLQA 5GTDA 4B4DA 2IVFA 1E0KA 1KIAA 4FGZA 1AVTA 3FB4A 5CT9A 1J7KA 2B92A 3A2NA 3FOAA 3FXAA 4ZRDA 5GONA 5JSZB 3FR8A 4O4HA 4Q3BA 5HS6A 1J8YF 3D0OA 1UC4B 4GL2A 3HBJA 3DXYA 5C1PA 2H2DA 2HMTA 2VP5A 3FVWA 1FNCA 1VCIA 4UBKA 3T9CA 1MF7A 1A5AB 3KJQA 3ZHZA 2PBZA 5LU9A 2QT1A 2OB2A 2PBFA 3FDFA 3G5AA 1VKJA 2W22A 4GX2A 4OBEA 4XYBA 1ZNWA 2OLEA 2VBGA 5EJ4A 1SKQA 1BW9B 3EXIB 4OUDB 4HDMA 4Z1MA 1LWOA 2YY6A 3HKCA 3AO0B 3HBLA 2A9KA 4HWPA 3WICA 1QRSA 4I0WB 2VEDA 3EOBI 4G89A 1GAXA 5JZMA 2GD1O 3PC6A 3EWSA 2GERA 1J0EA 2G28A 4Y9TA 1KJ9A 5H5JA 3LSYA 4CI0B 5K6TA 4OHZA 3RT9A 2ZRAA 4O02B 2LGJA 4W9NA 3WMFA 4H6XA 1SRQA 1I01A 1N25A 2GM9A 1JPNA 2HSDA 3DM5A 4GX0A 3KKPA 3OPXA 4ZYXA 4H6PA 2LP4Y 4CN9A 2G9ZA 5I7HA 1GZ5A 5DJ5A 1OLSB 1KBQA 1Y1TA 3RASA 4C29A 2QTFA 5EE0A 2H59A 5CNIA 2J33A 4QTXA 2F4NA 4OH1A 4QDKA 1IPFA 2AG8A 4WCDA 1R6UA 5EWJA 4P54A 3I4FA 3RSQA 1Q50A 4EATA 3WSWA 1NYLA 4EHHA 3BF7A 2J3JA 2JGDB 5EIEA 4J0IA 3OU7A 1UINA 3UYKA 3QLUA 4DV6B 5I48A 4L02A 3GDGA 1TZ2A 2CWWA 1VLJA 4LV5B 2E9SA 3BSFA 1NL3A 2OR3A 4HDKA 4ZVKA 2A92A 5DSZA 1NBEA 4ZK2A 4F3CA 5CA1B 4YEDA 1DARA 1TAHA 1H2EA 5I7VA 3KOYA 1BO6A 2OK8A 2GBLC 4EHJA 3LKZA 2AOTB 2PWPA 3TLAA 1P5FA 4UTVA 4UXJA 4GLJA 1IVSA 4GQBA 4GG1A 3VNSA 4AZ0B 2Z1DA 3WLQA 2GCPA 4F7DA 2Z9CA 2BLNA 3F7NA 2NZVG 3U9LA 2CLKB 2GO1A 2L18A 2G17A 1AHIA 2UU9B 4ZDIA 5HM8A 3IKMB 4QVGA 1VKNA 2VNIA 4NJEB 4GSYA 7REQB 3O93A 3LZ6A 3O8LA 2JLSA 4XIGS 2ZI9A 1OF1A 3KETA 2HIMA 3OX2A 4M7OA 3RAEC 1OX6A 5KVVA 3VNQA 1E7WA 1W2WB 4JVLA 4I5EA 4QDOA 2E4YA 1DG3A 5DNWA 1SU8A 2O57A 3VPFA 4S1NA 3H9EO 3T1QA 4MQ6A 1AKNA 1XN4A 2C00A 1XU4A 3U3MA 2R0QC 1F06A 1MEOA 2XOEA 2XUIA 3NT2A 3BDVA 4IXNA 4WXPA 3WKEA 4BVKA 4A26A 3HJBA 1M8FA 4ARZA 5HIMA 1RXYA 1TQDA 3C6ZA 3K2QA 3ZVMA 1GRVA 4Q7KA 3OTWA 3KCNA 4LXUA 5M34A 1YUBA 5KNDH 5DNEA 2OESA 2ZAIA 3AEYA 3AFNA 4W5HA 1BQ4A 2VWGA 4NDZA 2OV1A 4DBLC 1T5LA 4ZYWA 2F62A 3JZMA 4RADA 3BCUA 5BWOA 3KOMA 2GEDA 1JTEA 1CUGA 3RYCA 1UC9A 4RH1A 1S01A 2FWMX 4MVCA 4V0LA 5LB2A 1JVSA 5JQGF 1LD3A 1W1UA 2FFAA 3AGQA 1OV6A 4R1OA 4UPDA 5KJ1A 4JUFA 1AC5A 1MRNA 1TGYA 2EXXA 2BY4A 4NZ9A 2D2EA 4PYRA 4BNYA 2F4VB 4YP5A 3ZY3A 4HAWA 1VP9A 3RADC 1S1MA 1HX7A 1UXOA 3E48A 5CFLA 2GWHA 2CXNA 1RJ9B 1JIIA 1QGED 2QSYA 2ZSBA 4OJNA 4Z99A 3UWDA 1CUZA 1V8OA 4KYTA 4QVIA 4NCAA 4KR6A 4GOJA 4Q9IA 3IDQA 2Q4RA 4XLZA 3EAGA 3KP1A 1CDDA 3STVA 3FKSD 4RLQA 1Y8RB 5TNXA 2R1VB 2FUG1 3V4PB 4RU1A 4DSAA 3GFSA 2AI1A 4F5YA 1XOIA 2H3EA 3C8DA 4E08A 4PBRA 3T7CA 5LZ5A 2YS7A 1EUZA 3I34X 3B2NA 3DO6A 2A8YA 3I5MA 1XMJA 2C5EA 3LKDA 1C9KA 2WF9A 1P2BA 2GB4A 5TT0A 3T3MB 1N1GA 1NN3A 1T3SA 4K1XA 2IHKA 3JXEA 4UHFA 1A9TA 3AM1A 3A4YA 1I51A 3GD7A 3HR7A 3TCXB 5HR5A 1MU0A 1WQ4A 4RAQA 3NHKA 1KEEA 3PYXA 3C1OA 4WESA 4C0XA 1ONPA 1SEVA 1JU9A 5LWQA 2FN9A 1XJWA 4HNUA 1ZVQA 3NORA 1CR6A 2EJVA 3FPEA 3X44A 4MV5A 1KEWA 3AI7A 3EZ7A 1UT6A 2HQBA 4ER5A 1P2VA 4JI2B 2ZYDA 1DG9A 3M0EA 2QQ5A 4UVHA 4OJTA 3UA4A 3UMFA 4AY4A 1LK7A 2F9MA 3ZU2A 3NHPA 5FDFA 5IHXA 2PGIA 1FFBA 3IBGA 4ZANA 5KMGA 4EEZA 2ZB3A 2K4MA 4L76A 2FB9A 1KC3A 1M2OB 1RZ3A 3T38A 3EIQA 1L3IA 3FDJA 1WMBA 4AC9A 1T2UA 4MUIA 4RFVA 5AOAA 4MWTA 4WZBE 5BN5B 5L3ZA 5K0FA 1Z06A 4WK0B 4C22A 1FP6A 1Y80A 3ITEA 4FHEA 5D5PA 3VYRB 3EVEA 1YCFA 1XMVA 4F3RA 4YRNA 4QPZA 1RPJA 4M8IA 1QX4A 4EGJA 4GBJA 4QBFA 4G09A 4NF2A 4WEQA 4UBLA 2J67A 2OMKA 4Q1BA 5CCBA 1JS1X 4DYHA 4ZU3A 3DE7X 3SZRA 1Y37A 4HTFB 3AGPA 2NYAA 3G82C 4DAOA 1FK8A 4XWWA 2J6BA 2G4VA 1L7EA 1OC2A 3OU2A 4LOIA 4PC7A 2I8LA 1S4QA 4EABA 1A4UA 1FXWF 3E5NA 3GNTA 4PNPA 1A9OA 3KZNA 4PZUA 5K8TA 1ZO8A 5EPUA 4BLQA 4ESOA 2CLMB 2UYQA 4G4SO 3UICA 4D5GA 4JROA 4LDNA 1NXQA 2BSAA 4PINA 2NO4A 3KJNA 4HC4A 1LVGA 4HWSA 1AHHA 2VH2A 1EJ2A 2WU4A 4H7HA 3D7LA 4NECA 3A3KA 4Y18A 1RQLA 3DVQX 3MK31 3FFXA 3LSTA 4FQ8A 1MB3A 1W88A 1NNSA 2OQIA 3DO5A 4OJKA 3SBDA 1DAOA 4CQLB 2ECFA 4DLBA 1NBIA 3CX4A 3HVJA 4FT2A 4EELA 5C32A 5I7EA 3WYFA 2FQQA 1RRKA 3EXEB 2B1IA 2HJGA 1M1YB 2J3LA 4MXDA 5KCMA 3RYHB 4NMMA 2C77A 3MPOA 2PD4A 4G9BA 1N77A 3QKRA 3L3BA 4EMSA 2IXAA 4Z0PA 4WFKA 5CYPA 1WHTA 4M8LA 4DSUA 1BXZA 3ZGLA 2ZRQA 4J0DA 4Q7JB 4WBNF 2JG3A 5LYJA 3LY8A 3U60B 3H3JA 4HGYA 2RH9B 5DYTA 3X2FA 1VIVA 2XW6A 4BV9A 2IPXA 4UM8B 3U62A 4GDMA 1W1WA 4BXOB 1O08A 2GFHA 1GSIA 4H7KA 4EEKA 1KYQA 1LSOA 5GV8A 4MTCA 1E4OA 4MWGA 2JAHA 4ANFA 2IEIA 4YJFA 4Y2VA 5FUVA 3CYFA 2NU6A 2ZIEA 1FP4B 4RBNA 5KJEA 1Z26A 5IU6A 2NMVA 3DTVD 4ND8A 1JR4A 3C8MA 3NANA 5ALTA 4RUKA 4BQPA 4AJEA 2NP6A 3F2IA 2G6BA 4OQZA 1C50A 1NUQA 1LRKA 1V8FA 2PUVA 2R66A 3EOZA 4KRYA 5FRDA 1C4XA 5H16A 1R2QA 4C05A 1QM5A 4G0NA 4EZIA 4ID9A 4RZIA 3MYRA 4EF5A 4NXNB 1JR6A 4QTUB 1JDJA 2WSIA 1OZGA 2Z2XA 5CXQA 1NVTA 3CVOA 4YN3A 2GAAA 3ZHOA 5K09A 4U8GA 3VYTB 2BGLA 5I9MA 3HBAA 1KSGA 4KNVA 1I6LA 2ZYHA