1GEGA

Cryatal structure analysis of meso-2,3-butanediol dehydrogenase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
255
structure length
255
Chain Sequence
b'KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETOIN REDUCTASE
publication title Crystal structure of meso-2,3-butanediol dehydrogenase in a complex with NAD+ and inhibitor mercaptoethanol at 1.7 A resolution for understanding of chiral substrate recognition mechanisms.
pubmed rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
total genus 103
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.304: Diacetyl reductase ((S)-acetoin forming).
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gegA00
1L7EA 4CQLB 1DO8A 2C0CA 5JAIA 2QW8A 3C7DB 2AEJA 2JCVA 4MPDA 3RD5A 5A9RA 1KY5A 3HNPA 3TL3A 4DLBA 1HZZA 1G1AA 4BQRA 3CPSA 3ZWNA 4QT0A 4Y6RA 1T2DA 4DLLA 1B15A 1XGKA 3OA0A 3H7AA 5BSHA 3AUAA 4KOAA 5EQDA 5CDUA 3QQPA 2D3TA 5U1PA 1BW9B 1H6CA 4EDFA 2AMFA 1DEHA 3DOOA 3AUUA 2WMDA 2CVQA 2NWQA 4NG5A 1PJSA 1LBEA 4MIYA 1NQOA 4OMUA 5F3RA 5JAQA 2JD2A 2I3GA 3L9XA 2ZB4A 2RBEA 5GZ1A 1E1MA 3ZDFA 1GYPA 3LLVA 3PK0A 3EW7A 3TWOA 4E12A 4GX0A 1PL8A 3GNTA 3H65A 3ZV6A 3H5RA 4PZDA 4HXYA 1VJTA 3UVEA 4FBGA 4UVIA 4DYDA 3JQAD 3D4NA 3KUXA 1DLJA 5L9AA 1Y7TA 2LDXA 2JCXA 1OC2A 1WNTA 3UKOA 4B79A 2YV1A 5CPBA 4IQGA 2VN8A 2C82A 5A04A 3L6EA 4BNIA 2Q3EA 4CPDA 2RHCA 4AJNA 5L7TA 3INGA 1MFZA 2O2SA 2PFGA 4K1LA 1ZH8A 1O89A 1P0CA 1UAYA 3TZCA 1ZKMA 4HY3A 3EZLA 3ZH2A 1PJ2A 1S7CA 1GTMA 4GBJA 1LQUA 4R9SA 1O6ZA 3RUCA 5CDYA 1T4DA 3FWNA 2WM3A 3FNGA 1OMOA 3FPCA 4IGEA 5A5FA 1HDGO 2RIRA 2CF5A 4J1TA 1BDMA 4DPLA 3A4VA 1EUZA 3PHGA 2AQKA 1ZNQO 1GUFA 3K9QO 3DAPA 4F6LA 1CERA 5C37A 1YB1A 3CTMA 1ID1A 3OFSA 5JCXA 4GPD1 5JSFA 4CLOA 1EE9A 4IDFA 3UUWA 3OQ1A 3QIVA 3O8QB 3UHAA 2HUNA 4GWGA 1ADGA 2I6TA 4L73A 4XEHA 3QVSA 3EY4A 3GLQA 3I9NA 3IMFA 4PRKA 1EMDA 2EGGA 4J0FA 2Y1OA 1ADCA 5I7FA 1PJ4A 5IJZA 4MKRA 3DQPA 1LX6A 3I9JA 3T4XA 3H6KA 3K31A 1I0ZA 3FN4A 4HKTA 4WECA 1I3LA 1QYXA 2VYNA 1EFLA 2VZ8A 5CAEA 4FOOA 1XIVA 4QXMA 2BHLA 3GEGA 3LC7O 5LCXA 4MIOA 5BNIA 3GEDA 2VWGA 5IDQA 1BDBA 3NJ8A 4L4RA 1PZGA 4AJ1A 4BO3A 5L3ZA 2W8ZA 2HK9A 2EJVA 1ZK1A 3DHEA 3AUTA 5ENDA 1JW9B 3ZWCA 2VTEA 3VZSA 1CDOA 4CV2A 3BAZA 2J6IA 1U2GA 3ZN2A 4O5OA 5G4LA 3RIHA 4CQMA 2A94A 5JBIA 3QP9A 3FPLA 1QYVA 3V2GA 3KHUA 1BMDA 5G0VA 3V1UA 2NQTA 2JD0A 4W7IA 4Y67A 4ZQGA 1NHGA 2VT2A 5T67A 5JPIA 3WSVA 2W4QA 4QO7A 4KDFA 4BNTA 4EJ0A 3KXDA 4HFRA 4W6ZA 4I5GA 5DP1A 3PP8A 1B3RA 4NZ9A 1HE3A 2Q46A 1I33A 2D8AA 2NSDA 3QY9A 3R3SA 5G0UA 4CUZA 2YZ7A 1PQUA 4M1QA 3WGZA 1U8FO 5JY1A 4DVJA 3GUCA 3GC6A 3JYLA 1U5CA 2VUUA 2AEMA 4J0EA 3DWFA 4CM9A 2Y1DA 2YHIB 4AJLA 2Y0DA 3INTA 2WSBA 5F1KA 3N7UA 5F5NA 1V3VA 2YV3A 3BXXA 2PKRA 4Z0PA 2Y66A 4P38A 3MJEA 2Y0CA 3H3JA 3MTGA 4FFRA 1HLDA 3IJRA 3BYZA 2E48A 2EKQA 2GYYA 5HS6A 3U09A 1YL5A 1X0XA 5TT1A 1EQ2A 4DIFA 3CMCO 2F00A 4DRYA 3KYCA 3CZRA 3FD8A 3RWBA 2QG4A 5DF1A 3ZV3A 5EERA 4M8SA 4MVJA 4BL5A 1P45A 4FGWA 5JO0A 4GAEA 4PLCA 3TOZA 2O3UA 1D8AA 3TZKA 5IG2A 2CUKA 4BB6A 2X0RA 1EEHA 3TDKA 4IXTA 3FHLA 1EVJA 4NBVA 1HDRA 1LUAA 3E9QA 4DBVO 1L1FA 3TFQA 5CHEA 4FPXA 1KC1A 4NQZA 4Q9NA 1HE5A 3EHEA 3ONEA 4E2YA 2D59A 3UFXA 3GN2A 3ZU3A 4CLHA 3PWSA 2WEKA 2I67A 4ID9A 3RUEA 3QWBA 1U3VA 1U5AA 2VOEA 1YBMA 1LDBA 4YT8A 4FB5A 3E8XA 3HFGA 2P5UA 3Q11A 3IS3A 1NYTA 3GDGA 1B16A 1AHIA 1VE9A 1B7GO 4E5YA 3DFUA 2C20A 3LC1O 1JN0A 4YJHA 4JLWA 4IQ0A 1ISJA 2VHVA 1I10A 1DRUA 2QZ9A 1YONA 1YS4A 1ZK4A 3D4OA 1ORRA 1JQBA 2FR0A 1C1XB 2Y1FA 4QSMA 3LT1A 1DAOA 2DFVA 4LGVA 3JD2A 3LU1A 2O7QA 1M76A 2GRAA 1KC3A 3EVTA 3GF4A 4I08A 3JD1A 2NU9A 4RPKA 2V6GA 3ITDA 1MX3A 4R51A 3JQ9C 4TSKA 2GGSA 2Q1SA 4UEJA 4L74A 2B0JA 2RAFA 5EN4A 4ZU3A 3VKVA 1YRLA 3PDJA 5A3JA 2P2SA 1NAHA 2B4TO 3ZW8A 5DULA 5JC1A 2H9IA 1DRVA 3GGGA 3B1FA 4DLAA 2ILTA 2WD7B 1FXSA 4ZRMA 5DBGA 1DJNA 2DUUA 1YL7A 3K6JA 3PWZA 3WGOA 2Z5LA 2OL4A 5LDHA 1HSOA 4PZCA 4UVHA 4K6FA 1WXDA 2DFDA 4ZQFA 4AICA 4E2WA 2NTVA 1RM4A 1KVRA 3DL2A 1R37A 3U9LA 4QX6A 2FHSA 1OFGA 4I5DA 4RF2A 4OOEA 3RFXA 3DZHA 3DAGA 1YB4A 3JQ8B 1CRWG 1DPGA 2GERA 4O63O 1XELA 2O2YA 4IMRA 2X8LA 2I99A 1NFRA 4OQZA 2ZTUA 3AWDA 4GQAA 4MOWA 3EGOA 4D45A 1V3UA 4YEDA 3TOXA 3DBRA 2AEFA 4LMRA 4BNMA 4CMEA 1LQTA 3KRTA 2DBRA 2A92A 4XWYA 1KERA 2WJPA 1XCBA 4YT5A 1GUYA 3AM4A 3JD3A 4D3FA 1N5DA 3OEYA 4LN1A 4NI5A 2Q49A 3AU8A 4WOKA 3D5TA 5A05A 1X7DA 3QRWA 1R4MB 2QZZA 2RCYA 5JCJA 4YAKA 4RF5A 3BHJA 1H2BA 1ZXLA 4O1MA 4CQLA 4NBWA 1P0FA 2CDAA 4PFJA 2BKAA 3F1LA 3GA0A 4Q3EA 8LDHA 1ENZA 2BFPA 3QA9A 3RUAA 2P4HX 3JQ6A 2X5KO 1E7QA 5FEUA 3BTSA 4WPGA 1LC0A 4LK3A 2NADA 4K28A 1WW8A 4WLFA 4INAA 3WGIA 1F17A 4XGNA 5A9TA 4MINA 4A27A 3MOGA 1TXGA 4B4UA 1BW9A 3WWYA 1EDOA 4WLVA 2EWMA 1E5LA 2NVWA 3W6UA 4PG8A 3JV7A 1F8GA 2HQ1A 2D4AA 4CLXA 3EK2A 3PRJA 2AW5A 3UICA 1E6EA 1ZJYA 2NTJA 5JFOA 2GF2A 2HSDA 2DPGA 4CLRB 2V6MA 1WDLA 1YJQA 4I9HA 3IDSA 4ND2A 5B4UA 2C7GA 3F4BA 1MXHA 4J90A 4F3YA 4CLOB 4I9NA 4IDEA 2I5PO 5ITWA 4MJLA 1AXGA 1ENYA 1GYQA 5HRUA 5F1PA 1PS9A 1IB6A 1XA0A 5DN9A 5T6BA 1T2EA 2OMEA 5HM8A 3C1TA 1NHWA 3DHYA 1PSDA 1Y5MA 3KOUA 4R16A 5JYDA 1R4NA 2SCUA 4XYBA 1MC5A 4UVGA 2O4UX 2GN6A 4YYZA 5GZ3A 1UZLA 1UXIA 1Z6ZA 1U4SA 4J1SA 3A28A 2A9FA 3RFTA 4C7KA 4UUNA 3GFGA 3PHJA 3ITKA 4IJUA 4MVJM 3RBZA 1UDCA 3OICA 4GX2A 2PR2A 2JFHA 1BVRA 1Y1PA 3W4JA 3WX0A 4E6PA 1H93A 2YY7A 3G49A 5TGDA 3C1OA 2C5EA 1JKFA 4O6VA 4RV9A 3HWRA 2EGHA 5BR7A 4UEOA 3QE3A 3QWFA 1FDUA 2ZTLA 4S1VA 2DBZA 3BMCB 4CQMB 4A73A 2QIOA 3ZZNA 2WE8A 1M2WA 3GFBA 3U0BA 5K6AA 3NUGA 1ZVMA 1PL6A 3G1TA 1KVQA 5EL0A 4CMHA 5DCWA 5BQFA 2O3JA 3LF2A 5EJ2A 4IGFA 3OQ6A 3OA2A 1ONPA 2Q1UA 4FQ8A 5I9MA 3O8QA 4IBOA 5LDGA 3DTTA 3GAFA 3OIFA 3VPHA 1DC6A 1K6XA 1ZSNA 4RDIA 4IUYA 4GLOA 2Q2WA 3ZNOA 1T1RA 2WYWA 3Q2KA 4PCVA 4E30A 1LEHA 2YDYA 4ZHSA 1ISHA 3GDFA 2VUTA 5JW6A 3BTOA 2NU6A 1PX0A 1SOWA 3UN1A 4OH1A 1SB9A 1TB4A 1D7OA 1YWGO 1H9AA 2BMAA 2XF8A 1LSUA 1PJLA 3BTVA 4YRBA 1B26A 4GSLA 3GVIA 4I5FA 3FR7A 3UCFA 1GEGA 5TIIA 2B35A 3DFZA 4MIEA 5AXCA 1GV1A 2PKQP 2WTBA 2BFAA 3KYCB 3GGPA 2HMUA 4GX1A 1YBVA 3AU9A 2ZB8A 1UP7A 1PZFA 1E7SA 4YR9A 1EE2A 2QRKA 4FFOA 4AJ4A 2R00A 3U4DA 4GL4A 2JCYA 3ADPA 4IS2A 2HRZA 1EK5A 1QLHA 4A03A 4AJOA 3STHA 2QRJA 1ADFA 4BO0A 4ESOA 5KIAA 1R0SA 2Q1WA 1UXKA 1YVEI 4QTZA 1RYDA 4DTIA 3B6ZA 1BXZA 2FR8A 2OP0A 3OIDA 3VHRA 3QVOA 4FJ0A 5ILGA 4IIUA 3ZWXA 1BRMA 1AXEA 5G4KB 4M89A 2ZCUA 5CG2A 4YB8A 5JC8A 4U6QA 3GNQA 2YHIA 2O3SA 4GVLA 4BKOA 1TI7A 2B5WA 1NPTO 4A2CA 1UP6A 1SC6A 2W90A 2PZKA 5IN5A 2IZZA 5TC4A 1AGNA 2Q2QA 2J5KA 3M1LA 4JBHA 4PLHA 1U8XX 2E49A 2DBQA 4F6CA 4MKXA 3QVTA 1ARZA 1B14A 3HHPA 4YJHB 3VVCA 1IULA 1LC3A 2Z1NA 4TQGA 1SEPA 4R01A 1ZUD1 1MLDA 2Y1GA 3AOEC 4TRMA 4YCAA 4BNUA 5IN4A 3RKRA 1SPXA 1PR9A 1YKFA 1H0KA 4RPLA 5KTKA 3PIDA 2Y67A 1U3UA 3MTJA 3PYXA 1UR5A 1KEUA 2ZYAA 3GVXA 1R6DA 2IEDA 3IP3A 3PLRA 1I3MA 3WBBA 1H6BA 3FTNA 3C3XA 4KP7A 2ZK7A 1ZCJA 4CM8A 3PI7A 4E32A 3VH2A 4RZIA 3P19A 3HQ4O 4B4VA 5DP2A 3V1TC 3SVTA 1WVGA 4DIOA 3HZZA 2TMGA 3X2EA 5JDCC 3I3OA 1E3LA 4RZHA 1GQYA 1P74A 1KVSA 3KLPX 3QHAA 4K26A 1JDJA 5A03A 3KM0A 2X58A 4UAGA 1QR6A 4J49A 3WB9A 2PH3A 2YUTA 3PHIA 3GRKA 4YJDA 1LLQA 1UP4A 3KV3O 3DZGA 4J1NA 3IUSA 2HK8A 2P4QA 8ADHA 1P44A 4JP3A 3DZJA 4Z9XA 5ICSA 4J7XA 1MXFA 3H2ZA 1V35A 1UDBA 5AXAA 3WYCA 5JDIC 3SC6A 4BQPA 1JTVA 2GN4A 4OGWA 3M6IA 4L0QA 5DZSA 1K6JA 3RBVA 4YAGA 2I3AA 3RC9A 5KJEA 4KTTE 2EG9A 3BMNB 4IJKA 5JAZA 3JSAA 1Q1NA 1N92A 1DFHA 4IDDA 2YYYA 4OSOA 4U8GA 4NJMB 4BIIA 4EEZA 2B5VA 3Q2IA 5FI5A 2ZJ0A 2POQX 2DKNA 4B3HA 5IDXA 5JS6A 1GUZA 4RQUA 1NPYA 2WD7A 2VHWA 1QP8A 5MGBA 2GPTA 1GV0A 1ISMA 3ICCA 1P33A 5A3VA 3S2FA 3TZHA 1I3NA 4YA6A 1B8PA 4H7PA 4ILKA 2NLOA 1IHXA 4PG5A 1ZXBA 3PFWO 2PK3A 2Q99A 4MP8A 4FGSA 1VI2A 3HDQA 4L4SA 4XDZA 4CM1A 2CNBA 3PLNA 1VKOA 3QWAA 4BKUA 5KKAA 2B37A 4B3IA 1UXHA 1P31A 3AFNA 1DOHA 1U1IA 2V6BA 3JQ8A 3WLFA 2R2GA 4N5NA 5TF4A 4K6CA 1ULSA 5FWNA 2IZ1A 3RKUA 2BELA 3QJ5A 2VQ3A 5JNLA 1QXSA 1KVTA 4E21A 3F9IA 2HO5A 4YQZA 5KCZA 4Y8VA 1K89A 2C59A 4IM7A 4IZIA 5F5LA 5T64A 2X9NA 1TT7A 4XGIA 3K5PA 1IOLA 4MP3A 4HBGA 2HJRA 4EUHA 1P1RA 2AQ8A 3PPIA 1QYDA 1ZSVA 4LRTB 5H82A 3JYNA 3OJLA 1M6HA 4BGIA 1NXQA 2IYPA 1LRJA 4YT4A 1A7AA 3KB6A 4OHUA 3Q3CA 2CVZA 3RSHA 4BOYA 3FNEA 1R4MA 5BNTA 3QVXA 1JAYA 4UEKA 1Q0HA 3H5NA 3MJTA 5CDGA 3NKLA 4D3DA 3SXPA 1R4NB 3D0OA 5CG1A 4M54A 3K30A 1I32A 3JTMA 4IPTA 4BO7A 1E3IA 4BV8A 2Z1MA 5GY7A 2VZ0A 3V2HA 2VYND 3WJAA 4XJSA 5L4NA 3D3WA 4KUGA 1JKJA 4P4NA 3HG7A 4OXYA 4RO0A 3RUFA 4E4YA 4OXKA 3HDHA 3DOCA 1BVUA 1EVYA 3ZGYA 1A5ZA 1LJ8A 3KZVA 2I76A 1F14A 4JJGA 3B20A 4Y98A 1HE2A 3JQ7B 4WEQA 2AG5A 2A35A 2VCYA 1CJCA 4AJ2A 4CMIB 3D1LA 3GVPA 2X23A 1N7GA 1KETA 1HDYA 4YRAA 4EBFA 1Z82A 1NASA 2ZATA 4CQMD 3GAZA 1RKXA 2VZ9A 3DTYA 4HX5A 3F4LA 1T4BA 2EKLA 4ND1A 1FK8A 4U7WA 4CLRA 4CV1A 1B8UA 1XU9A 2V7PA 4YRDA 1HLPA 4ALLA 2Q4BA 1CETA 1X13A 4CM4A 1P1HA 4E13A 3MEQA 2H5LA 3AY3A 1YJ8A 4MVJF 3WGGA 4DA9A 4BB5A 2O7SA 3MWEB 1HDZA 1V8BA 3EZYA 3C7CB 5JLAA 1VJ1A 2A4KA 2OZPA 3O9ZA 4MVJI 1HWYA 3PXXA 2UUPA 2Q50A 4PVDA 3JD0A 4XQGA 1TVEA 4OQYA 2EJWA 3MJVA 1XWFA 3GHHA 2C54A 2GZ2A 3EUWA 2CDBA 3PQDA 2BI7A 1QYWA 3U4HA 2YFHA 5HA5A 1LTHR 1YQDA 4PLPA 4FFMA 1A72A 4CM9D 2UYYA 4BKPA 1F06A 3AJRA 3AI2A 4FC7A 5THKA 3TZ6A 4GKVA 2Q2VA 2Q1TA 1K3TA 2OBNA 2C7VA 1DFIA 2VRCA 4RVGA 4ALNA 3CXRA 5BNFA 3C7AA 1NQTA 5AYVA 1J4AA 2B36A 3ONDA 4XB2A 1CYDA 3BMCA 1GAEO 3SLKA 3DEYX 4PG4A 1VM6A 4J1QA 2GN8A 3HB5X 1N1GA 2O3RA 4MVJD 3GRPA 1ZZEA 2B4QA 1XLTA 4WLEA 1T25A 4CM7A 4W9NA 4YWJA 1XQ1A 2PGJA 1FDVA 1DJQA 4GX5A 2ZCVA 1LDYA 4Q3BA 3W8FA 5A06A 2AQIA 2ZIZA 5IF3A 3FNFA 1GZ3A 2GCGA 3QV1A 3TSCA 2Q45A 1EVZA 3I9MA 1KYQA 5DDIP 4CMKA 5J23A 1T2CA 2DPHA 3PJFA 4D0RA 4MKZA 1KOLA 4D42A 5A02A 1J49A 3LLSA 4CM5A 1GL3A 4N18A 3Q9UA 1YOVB 5BT9A 4R69A 4TVOA 1RWBA 2G17A 4KMSA 4KUEA 3FSRA 2HKIA 5IDWA 4FC6A 1SAYA 4DBZA 4B7UA 3BZUA 4HNGA 4ND4A 4EZBA 4OJNA 1RM5A 2Y05A 2E6UX 4A26A 2O4CA 5CFZA 4WOJA 3AUSA 1SEVA 3I5MA 3ZWBA 2C07A 3U5TA 2ZB3A 2G5CA 4JX8A 1NX6A 4OM8A 5CEEA 3P2YA 2OGUA 4WUVA 3GNSA 2IEBA 2FR1A 4LW8A 2GLXA 2X1HA 3W8EA 4BO9A 1YB5A 5A9SA 2PTGA 1A4UA 4OKIA 3SJ7A 5JYEA 4AVYA 5DBIA 1NWHA 3H9QA 4LCJA 3AFMA 3O4RA 4NNJA 1NBOA 3OP4A 3GHYA 1CWUA 1RM0A 1EZ4A 1HE4A 4CM8B 3ETDA 1LDNA 4ZD6A 3CUKA 5I7EA 1B3BA 3NTOA 4GI2A 4ONEA 1ONOA 1U28A 3L4BC 5G4KA 3H5AA 1KEWA 4HFJA 4A7PA 1QV6A 1AN9A 2JFGA 4J43A 2YJZA 4TMFA 3EAGA 4CLEA 5KVSA 3VH3A 5KJFA 1TEHA 4FIZA 3L77A 1H6DA 2PD4A 4OAQA 4RVHA 3OSUA 5H83A 2GR9A 1PS8A 4PG6A 2X22A 3GZ4A 1NVGA 3NJ4A 1PGOA 2PD3A 4XQ9A 5DT9A 4E3ZA 4D0SA 1ZEJA 3GQVA 5KVQA 1D1SA 4BNNA 4J7CA 1HYGA 4ALJA 3WG9A 1J5PA 3K73O 1VLLA 3GEMA 4CL8A 4HV4A 3WBFA 5L53A 3OIGA 1PWXA 3H9EO 2EKPA 2W2LD 1QSGA 4E2ZA 3MJ4A 4BNJA 1DIAA 3VDRA 3TJRA 1UXGA 3PJGA 2H63A 3H4VA 3MCVA 2AA3A 1G0OA 3F6YA 4KDEA 2VHXA 2HDHA 4JJIA 4OOFA 4CMGA 1CQIA 3HN7A 4N5LA 1E1KA 2O50A 5JCJD 4Y6SA 1ZSYA 2E37A 1Y9EA 3AK4A 1MA0A 1ONNA 3JQBC 3U3XA 5I9NA 3VDQA 3ON5A 3VOSA 3G3EA 3E5MA 1DHTA 3FTPA 1OOEA 1R12A 3VZQA 3HDJA 4GGOA 3ENNA 2W2KB 2HRBA 4BKQA 2ZTVA 2LDBA 2GO1A 1SOVA 2DVMA 4GWKA 4XYLA 1YH3A 3OJOA 3PHHA 4TROA 4M86A 3D3EA 1QORA 4WJZA 4CR8A 1HDXA 1VSVA 5IDYA 1P9LA 1E5QA 3I9KA 3WOHA 4WKGA 1XKQA 4KWIA 3WQSB 4Z6KA 1R66A 4FFPA 2NV6A 4LSMA 2NUAA 1I3KA 1PGJA 2C2XA 4ND3A 4PVCA 4D46A 3F5QA 2JL1A 1P1IA 2W2LA 4UREA 1YDWA 4WCFC 1LA2A 3BMNA 4WEOA 4BS9A 3GVCA 3H9JA 4BGEA 4NJMA 4YAIA 4PGFA 2GUGA 4Z9YA 4E2XA 1DC5A 1WP4A 4R1TA 4DC1A 2BGMA 2DM6A 4FN4A 1UAGA 2CFCA 4IJWA 4D43A 1M6WA 4JP2A 2NU7A 4J2HA 4TKMA 5THQA 3E48A 1HDCA 4H3VA 5COAA 3IJPA 2PNFA 3KBOA 1DLIA 1QKIA 4TRNA 2CF6A 3OHSX 5AQ1A 1PGQA 5CDTA 9LDBA 3WIDA 2D2IA 3CEAA 5C7LO 3BHMA 3D3WB 1HEUA 4I1IA 5I7VA 4H16A 5CP8A 5BSEA 2ZQYA 1EFKA 1HXHA 5LC1A 4J91A 3UOGA 3UAGA 4RORA 3WFJA 3DDNA 3DMYA 4R41A 3GN1A 3O03A 1QV7A 1M66A 2WYVA 1NFFA 1ML3A 4FDAA 1IE3A 4FD3A 3FBTA 3H9UA 1LU9A 2B83A 1OBFO 5K0ZA 2PZJA 1DHRA 1U7TA 4W7HA 5AXDA 3JD4A 4ZA2A 1H6AA 1LSSA 4JIGA 2IDZA 3NAQA 2VYVA 3ZU2A 1PEDA 2BI8A 1NVTA 1ZBQA 2OP1A 4IY1A 4RPGA 4WASA 4CM4B 5BSFA 1BWSA 1MP0A 4XD2A 3WYBA 1DXYA 5CPFA 3HDYA 3KEOA 1X7GA 1PZHA 4AFNA 1VJ0A 5A4DA 2ZYDA 2CDCA 2EP5A 3DZIA 3NX4A 4I9UA 3I83A 2UUOA 3NDRA 2R6JA 1I5RA 5KOIA 1XYGA 3SC4A 1NTOA 2D1YA 3WGHA 3WFIA 4BVAA 1DC3A 2PWZA 3I4FA 2QYSA 1DDOA 3HN2A 4I8XA 1GU7A 4Y9DA 3PQFA 2HMSA 2X5JO 2PGLA 1PTJA 2AQHA 4R1NA 4BV9A 3JQ7A 1E3EA 2DC1A 1G6KA 4U5QA 5EQFA 4CMIA 3GK3A 3OECA 1C0LA 3FF4A 3JQAB 4NK5A 1ISGA 5IZ4A 3UF0A 1PGNA 2J3KA 4DMLA 4NH4A 4TRJA 3VKUA 5U4QA 3G0OA 1GPJA 3C1AA 4R3WA 3VZPA 1Y9AA 4U0KA 3V8BA 1Z74A 4MVJE 4XR4A 2PA3A 3VAZA 1U2DA 3D4PA 4NPCA 4OSPA 1OC4A 1U4OA 4L4XA 4PLZA 1IYZA 2Y1CA 3S8MA 4K9DA 1HYEA 3INRA 2ZYGA 3N74A 4L8VA 3HFSA 1IPEA 3FRJA 4B7CA 1O8CA 1M67A 3F5SA 5KJ1A 3DBLB 3JQGB 1CF2O 2O3QA 3F3SA 3HB4X 5I9LA 1NR1A 4J9UE 2VWHA 4YAJA 3E03A 5EESA 1HDOA 3EVNA 2V65A 1DB3A 5HBRA 3GGOA 4RCVA 3PTZA 1DFGA 1HL3A 2O23A 4FCCA 1I2ZA 3NTQA 3KTDA 1ISIA 2QX7A 4PG7A 5DBFA 5T8KC 1MUUA 3KSDO 3ROMA 1PGPA 4JQCA 1T2AA 3ZWVA 2BFMA 3AY6A 3X2FA 1X15A 3P7MA 4YQYA 4N5MA 4DMMA 1ZJZA 2HK7A 4MVJP 1V3TA 1O95A 1Q2XA 3H9GA 3C85A 3D5QA 4DQVA 1VPDA 4DGSA 1RJWA 1UZNA 2WDZA 4G65A 5L4LA 1Z73A 2DU8A 1W0CA 1N2SA 3DOJA 1PIWA 1UH5A 2VUSA 2RH4A 2VWQA 5B4TA 1WDKA 2I66A 3Q1LA 3K96A 4KUHA 3AM3A 3IAHA 3JYPA 2PGDA 5KJ6A 2FWMX 2J8ZA 3PHLA 5DOZA 2YQ4A 3CSDA 3NT5A 2CVOA 4FOSA 1ZK0A 2XAAA 5A9SB 2AHRA 3H8VA 4JCOA 5DNAA 1LDEA 3I23A 5IZCC 4ROSA 3E9NA 4UULA 2HAEA 2IRWA 1JLLA 3RC1A 2UV8A 2P91A 2BGLA 4P4LA 1NNUA 3AOGA 3KLMX 4L75A 3AW9A 4XYGA 3DMTC 4C7JA 1L7DA 2G82A 1WWKA 4DYVA 5ENVA 4BNLA 3ANLA 2FRDA 4NMHA 3WIEA 3I1JA 2NU8A 3OQBA 1NM5A 4ALMA 3PJEA 1YOVA 3EYWA 4Q39A 3WJ7A 1AE1A 5GMOA 3KSUA 3MZ0A 3ZNQA 2YW9A 2IODA 4ITUA 2EHDA 7ADHA 4YTEA 4F46A 2TMDA 5ES3A 3S2GA 1DRWA 3W4IA 1A4IA 4J4TA 4XQCA 1YXMA 1SB8A 1ZK2A 4ZGWA 3GH3A 3ZI0A 4QQRA 3RI3A 1PS0A 4RVSA 5JMWA 1XR3A 1UXJA 2Y1EA 4NFSA 1PR3A 4PLFA 4BNZA 3SX2A 4XR9A 1GQQA 1U3WA 3I52A 1MFPA 1DC4A 4DIBA 4UVEA 3COSA 3H3FA 3ROKA 2FOIA 4LRSB 3ABIA 3ZV5A 4E5MA 4BNVA 3E18A 3ZWMA 5ADHA 3GG2A 4RJTA 3SBOA 1GFSA 4EW6A 1LLCA 1LDMA 2EF1A 5B12A 5TLSA 5G0SA 1YL6A 3PGXA 3SJUA 4RF4A 2RHRA 2C29D 3DAFA 1KS9A 1R0LA 1EK6A 1O9BA 1KEVA 3DC2A 3OJEA 5FF9A 4EEXA 3S2EA 2VNSA 1J6UA 1UDAA 4BKRA 3DO5A 1I30A 3UXYA 3BHIA 1X7HA 1E3JA 4MVJG 3IQDB 3RBXA 3ZWYA 2HJSA 4LSWA 3E1KA 3ONFA 5AXBA 4BMVA 2G0TA 3GR6A 2VT3A 4KZPA 1BXGB 2GSDA 1RM3A 4BGVA 4R5HA 3P2OA 4YJGA 5F1OA 3PGJA 3FCOA 3RJ5A 1ZEMA 1Y8QB 4AJIA 1U3TA 3DBHB 1IZ9A 5G0TA 4Q3CA 1K6IA 3Q9NA 4BMNA 4CMEC 1C0KA 4CM6A 4ZJUA 3LYLA 1XG5A 3PZRA 3W4KA 1GYRA 1I36A 5A1TA 3K8ZA 4RF3A 5KJCA 5ER6A 3I9LA 3IC5A 5HWSA 3WLEA 3JQ9A 1V0JA 2AE2A 5L95A 4B3JA 4NJOA 4UUOA 1NAIA 1CIVA 4PLGA 4YDRA 2Y93A 5T5QA 1SO8A 3ETGA 3HUDA 4GH5A 3JQFC 1IHYA 3DBVO 3C8MA 2W2KA 3MJSA 4YAEA 3VPXA 3JQBA 3NDIA 2H1SA 4RVUA 4JROA 1XDWA 1MB4A 3GMSA 4IQ8A 3ST7A 2X4GA 5G0WA 4BNYA 1I24A 3VPGA 3ANMA 4J4BA 1MV8A 3BIOA 4IDGA 3OETA 4PRLA 4PZEA 1JU9A 5F21A 4UUMA 3VZRA 3GVHA 1PU2A 4E33A 5AOVA 3ASVA 1W8DA 2Q4EA 2PY6A 4EYEA 2XXJA 1PQWA 1UJMA 2GD1O 3WS7A 1XHLA 2QQ5A 2D0IA 3T4EA 4BNWA 3ICPA 2EW8A 4IIVA 4PLVA 3ZU5A 1RYEA 3LF1A 3A9WA 3K2BA 4BO6A 3U4CA 3CMMA 4Y6PA 5MDHA 5JE8A 3ZNNA 5JO9A 1HETA 4W4TA 1O94A 1IPFA 1HYHA 3MJCA 1E7YA 1DIGA 4NU6A 1NFQA 4CJXA 4JNKA 4E5NA 3JYQA 4URFA 4WCFA 3ZHZA 4XGKA 4PIVA 4DL9A 2G1UA 5TT0A 2VWPA 2VRBA 4GMGA 4UVDA 3ZHBA 1JWBB 2EXXA 3CZMA 4ZQBA 2HU2A 3WXBA 1LDGA 1X1TA 3UW3A 2J5QA 4W99A 4AJKA 1DIRA 2EV9A 4UUPA 2J3IA 4P8RA 3NT2A 2FN7A 2OXIA 1DAPA 3HJAA 4CUJA 1ZFNA 1LLDA 2JAHA 1ENPA 2PZMA 3A1NA 3QVWA 3R0IA 5TRTA 3W8DA 4YPOA 5L4SA 4FR5A 1DBVO 1EQUA 1H94A 2UDPA 3GMDA 2IZ0A 5L45A 3GDOA 1CQJA 1A71A 2VRCD 1JKIA 4MO2A 4RPHA 2OFPA 3RJ9A 1EBUA 1GQ2A 2VHZA 2F1KA 3G79A 3M2TA 4I5EA 4WNCA 3ZW9A 5KKCA 1PWZA 1WZEA 1EDZA 3WMXA 1VL8A 5ITVA 1KEPA 4BNGA 3UCEA 4NK4A 1ADBA 1YE3A 3KEQA 4WCDA 4ZQHA 3EDMA 3RFVA 3UH1A 1M75A 3K2EA 2D5CA 2XOXA 3M2PA 3RUIA 4B8WA 1N9GB 1HSZA 2EEZA 1IZ0A 1D1TA 3LDHA 3LC2O 4YXFA 1A9YA 3OF2A 3V1YA 1F0YA 1XU7A 4QEDA 1E0DA 5K6AC 3S1LA 1UUFA 3TQHA 1OAAA 1PQPA 4JK3A 4DQUA 4M55A 3GZNB 2DT5A 5AVOA 2V6FA 5TSDA 1C14A 4RGBA 3ROQA 2DAPA 1JVSA 1TT5B 2J3HA 2GASA 3ASUA 1YO6A 1KBZA 3F1KA 1A27A 2B4RO 3O38A 4A5OA 5IFLA 1C1DA 5TS3A 1U9JA 3OJFA 3WTBA 3JQAA 1Z7EA 1MGOA 2NNLD 3I6IA 4IDBA 3RAJA 5H81A 5L7YA 3WMWA 2PLAA 2EIHA 4QECA 5G2OA 1N8KA 4FJ1A 2PKQO 4FFNA 3GOHA 4RVDA 5ER9A 3ZWWA 4AG3A 3OJ0A 4TVBA 1OZAA 3ULKA 3QSGA 1EUDA 1JA9A 3DZFA 3OH8A 4P4GA 3WYEA 4J16A 4PLWA 3QLJA 1BG6A 4P22A 4A0SA 1Q7GA 2R00C 4BGUA 2FP4A 1U7HA 3DBLA 3HSKA 3JQGA 5K9ZA 3HADA 4WK6A 3M1AA 1SMKA 2IXAA 2UAGA 1A9ZA 1BSVA 4WGGA 5FYDA 4CLDA 2BGKA 1PJQA 4BNXA 1Z75A 4BHTA 1TA4A 1V6AA 1GD1O 3LT0A 3CINA 2GZ1A 1Q0QA 3BMOB 5JXWA 4AJJA 1MC4A 2VNAA 4X54A 4D79A 4FSHA 4B8ZA 1BXKA 3RU9A 4Z3KA 5TX7A 4MP6A 1FDSA 2HMWA 4XB1A 5T8KA 2JHFA 4XRGA 3U62A 1NVMB 2P5YA 4D7AA 4LCEA 3OBBA 4EUFA 3JQCA 4BO5A 1VKNA 1P1JA 3ZNPA 5DCUA 3RQSA 3A06A 5HS4A 2BFOA 3OMLA 4L76A 4XA8A 1H2HA 1LNQA 1PZEA 4R1SA 3RU7A 3E82A 4XRRA 3NV9A 1ZIDA 3PJDA 1Y8RB 4O0LA 2P9EA 4M87A 3KYDB 4HADA 1ULUA 5B1YA 4B7XA 5COBA 3JYOA 4OIMA 4IZHA 3RC2A 5T57A 3V2UA 2WWRA 5GZ6A 5U9CA 5TJ9A 3PYLA 4ZRNA 1E6WA 1FMCA 1ZO8A 6LDHA 3W6ZA 1P1KA 2WYUA 1AUPA 2PZLA 1E3WA 3RC7A 3OM9A 5IZCA 4WLOA 4JGBA 1PJ3A 3AI1A 3WNVA 2FY8A 4DPMA 4AJEA 3T7EA 4FJ2A 4H15A 3BTUA 3ZU4A 3MOIA 5EINA 1VRWA 2HLPA 4WNIA 3DMTA 3BMQB 4QFDA 5B4VA 2YFQA 3QWIA 5CDSA 4E0BA 4J6FA 5EIOA 2JJYA 4RLHA 3RUHA 4IINA 1IY8A 1HZJA 4FFLA 2FSVA 4YJFA 5B37A 5ICMA 1GEEA 4XYEA 2ZQZA 4NBUA 4CL3A 2OUIA 2H6EA 1G0NA 4OO3A 4ZN6A 1X1EA 3LSYA 4KQXA 4KWHA 1LSJA 3DZKA 3VTZA 3E6AA 4YJGB 1O0SA 4KQWA 4S3MA 2G76A 2NVUA 4Z0HO 1N7HA 2P9CA 3WTCA 1SZJG 4G5HA 3GUYA 1NP3A 1TLTA 3AOEA 3Q6IA 1JVBA 1Y81A 1ZK3A 3LT2A 4JJFA 2C5AA 3IKTA 2P68A 1SCUA 3ZHXA 1EBFA 2WD8A 1WMBA 3ROPA 2QHXA 3SLGA 3RVDA 1T24A 1GADO 2IE0A 3GY0A 4B4WA 4RDHA 4HFNA 3H2SA 4CM3A 4XIYA 1SBYA 3RROA 3TPCA 3R3JA 2AG8A 4ZICA 2IXBA 3BA1A 3O26A 3WDSA 2CY0A 4DREA 4RL6A 3AI3A 4OKNA 4ZQEA 4EJMA 1I2CA 1W4ZA 3C24A 2BRUA 1E92A 2D5AA 1J0XO 4IDCA 4Z9FA 5JDCA 1E7RA 3VVBA 1PJCA 3Q0EA 1FDTA 1R16A 2CMDA 4B4OA 4ZVVA 1BXGA 3HE3A 3L07A 3U4IA 1EVIA 1KVUA 1PJBA 1C0IA 2FPIA 3IUPA 2NM0A 1MG0A 1Y8QA 2VYVD 3DBHA 5KNLA 3S2IA 1E7WA 2VTDA 4DC0A 4R3NA 1F8FA 2DLDA 2QRLA 3DHNA 1NPDA 4TKLA 4JN6B 1X14A 2O3TA 4FS3A 1B8VA 2NVBA 5TQVA 3K92A 5JDIA 4E5PA 2X9VA 2Y0EA 4EI2A 5L7WA 4D3SA 1WLYA 2YHUA 1NWCA 3ZWOA 4QUKA 4WCFB 4J2OA 2NACA 4U6SA 4D41A 3DZBA 3EMKA 3CE6A 1C3VA 4L9RA 1LLUA 3WGYA 4R4JA 4BNHA 1P77A 4ALKA 4R9RA 1HTBA 4BMSA 2DTXA 4FW8A 1GDHA 4XX0A 4OL9A 1AHHA 3JQDA 1XQ6A 1IL0A 2X7HA 4D44A 3TRIA 4G2NA 5I8ZA 3JQFA 3ETEA 3DXFA 4AJPA 2X9GA 3DB2A 3GPDG 1XSEA 2I65A 3ANNA 3B1JA 5HTOA 1I01A 2OHXA 2B69A 1VL6A 3P5SA 4JBIA 1T1SA 1CEQA 1P3DA 2Y99A 4PLTA 3IP1A 4HFMA 1HF3A 1K2WA 4AL4A 1GY8A 1H9BA 2HMVA 3R1IA 3IL2A 3D7LA 3FNHA 3ORFA 4TWRA 1LRKA 1Z45A 2XPCA 2HMTA 2YQ5A 3KO8A 1FJHA 3WR5A 2OORA 2PH5A 4R54A 4Q3AA 4CODB 1W6UA 1WAMA 4A10A 4BUCA 5TJHA 2W98A 1Y6JA 3KYBA 3PIIA 3VC7A 1KIFA 2QYTA 4GKBA 4LVUA 3IIEA 3PZBA 2Z95A 4G81A 4NBRA 4DPKA 2DQ4A 4BO2A 5KWEA 5TNXA 6ADHA 3KETA 1Q7CA 2J3JA 1RPNA 2JFFA 5L40A 3WQRA 3PVZA 1GPDG 3TZQA 3MWDB 2CSUA 5DOVA 1C1DB 1VSUA 4TZKA 5L51A 4N54A 3DR3A 4XQEA 3TFOA 4CR7A 3GPIA 4DWVA 1PJTA 1BGVA 2IYOA 4QO8A 2BF7A 2HCTA 3F46A 3LZ6A 4Z0TA 1B2LA 1A7KA 4II3A 2YDXA 5CEJA 3ZWAA 1SNYA 3IOYA 4YBZA 4LISA 4ALIA 1N9GA 2ZB7A 3I4CA 1K5HA 4CMAA 4F45A 4R1UA 2JD1A 3PFFA 2DTEA 2EW2A 4EGFA 3NYWA 5C7OO 5JMPA 2JKVA 1P1FA 2DUWA 2RH8A 4R5MA 4YACA 3WWZA 4XDYA 4W9NC 1WPQA 4IS3A 3LVFO 4J9VA 4BNKA 3GZNA 3E5RA 4II2A 1LRLA 4GSKA 4MDHA 2JAPA 4XKJA 4NU5A 3TL2A 1VL0A 1GCUA 1E1NA 1FDWA 3RASA 3PEFA 3U49A 3ZHYA 1TT5A 5DCYA 3PYMA 2P9GA 3UGKA 4BO8A 5IXYA 1LXCA 3G17A 3JQEA 4XZ3A 4DUPA 5JY6A 4IDAA 1JAXA 1WMAA 3KVOA 1EUCA 1NR7A 4HUJA 2C2YA 4GGPA 3EC7A 5FI3A 3PWKA 7MDHA 1V9LA 4NFHA 4KTVE 2YV2A 4GLLA 2E82A 2PD6A 3ZCXA 3G1UA 2CD9A 3NEPX 4NIMA 2EP7A 3SEFA 1R15A 2NTNA 3D64A 4NBTA 4E5KA 2OO5A 3FR8A 3W1VA 4J3FA 3OEWA 5COQA 2X0JA 3NGLA 5BSGA 4OYRA 3QW2A 1UZMA 1YBAA 3B1KA 3WICA 2OOSA 2J5RA 1NQAO 1F12A 3IKVA 2E4AA 3CKYA 1R0KA 4J4HA 3VPSA 4YVFA 3WSWA 3ZV4A 4HWKA 1K0UA 1O5IA 4RLSA 2X6TA 3R6DA 3TNLA 1BTOA 1GR0A 4OXNA 2FZWA 1T2FA 4GMFA 4RVFA 4DQXA 3I6QA 4TZTA 5JAMA 3VTFA 1E3WB 4O59O 2GN9A 4GVXA 3BMOA 1BHSA 1GZ6A 3N58A 1C0PA 2X5OA 5KVCA 4XJTA 2OBYA 4AJHA 4QFCA 4IMPA 4EJ6A 3UCXA 2ZJ1A 1E7MA 1Q7BA 2DTDA 1HKUA 1W73A 1XEAA 2X86A 2AXQA 2FSSA 1I8TA 3RCBA 3TF5A 3WQQA 1ISFA 1GZ4A 4LMPA 4WLNA 3AM5A 4HP8A 4IJVA 4EUEA 3WNQA 1IUKA 1S6YA 1QG6A 1ZW1A 1ENOA 4R68A 1D3AA 1WDMA 2FPPA 1D4FA 4JXKA 4YJFB 4BNFA 1ZMOA 2FPGA 3GG9A 1WZIA 1KY4A 3VPFA 4RQTA 4Q3NA 3L6DA 4EITA 1I2BA 5FFFA 4PN3A 4N7RA 5EPOA 4LVCA 1PL7A 2GDZA 1YDEA 2FMUA 1QRRA 1Y8RA 3B70A 4BO4A 5KVVA 5C5IA 5C3MA 5CEFA 1YGYA 5C7IO 3KYDA 4WE3A 4J7UA 4XYMA 2NVUB 3WGQA 2DBVO 1HRDA 2PV7A 4CMCA 5IAAA 1B0AA 2X0NA 4M49A 1YQGA 1LSOA 1N1EA 5ILOA 1Z7BA 4Q3DA 4HNHA 3FBGA 1E1LA 2CZCA 1YQXA 3LT4A 4RPJA 4Z3DA 1LI4A 3CIFA 4NHEA 2ZTMA 4TRRA 4PLYA 2WE7A 1DIBA 3KSZO 3T7CA 4WLUA 1JWAB 1NQ5A 3FWZA 1MG5A 3L6OO 3DONA 3BMQA 3L4BA 1GCOA 2GNAA 2O48X 1HT0A 3ZWPA 3NT4A 1DIHA 3NRCA 4E31A 3TN7A 3PQEA 3FI9A 5EMHA 2BH9A 4NFYA 4NR0A 1H5QA 5A5EA 3ADOA 3NTRA 2JHGA 1QMGA 3L0DA 2AE1A 3VH1A 3NDJA 1E6UA 4U0JA 9LDTA 1E3SA 4DXHA 3WGTA 3RUDA 3CH6A 4CUKA 3NGXA 2BD0A 3V5NA 2UVDA 1Y5RA 4W82A 3A14A 1QLJA 3L9WA 4XIJA 2VHYA 1FF9A 2VOJA 5I8WA 3AY7A 3JCZA 4NDNE 3F47A 3VH4A 2XXBA 3L4SO 1T26A 1E77A 1VC2A 4ND5A 2ZKLA 3S55A 2Y68A 4C4OA 1C1XA 4JBGA 2FZEA 1DSSG 2EERA 3DBRB 4CMJA 2X0IA 4XCVA 1QYCA 3GT0A 5I7SA 2GZ3A 2ET6A 4BO1A 3LK7A 4YT2A 3E9MA 4MVJH 1ZMTA 2NQ8A 4CR6A 4CMBA 3LQFA 4IXWA 1OI7A 1X0VA 2I9PA 2BLLA 4CV0A 3PDUA 3QWHA 4CV3A 5IXSA 3ENKA 3I9OA 1Q0LA
chains in the Genus database with same CATH superfamily
2BFDB 4CE6A 1UBUS 1DO8A 2VT6A 2JAXA 1R5JA 2VP6A 3LECA 2HHLA 3JQPA 3PGKA 4MPDA 4ZCMA 2VKQA 1D1PA 4UZFA 3RD5A 3T7AA 4B82A 1KYXA 1OHHA 5DYNA 3SC2B 1HZZA 3ONVA 3OQNA 2A84A 3MWFA 4B3DA 1VCIA 3E23A 5KNBD 1G5PA 4N76A 1PKEA 1Q50A 3PX3A 2KQUA 5KUTA 1CQZA 4C6TB 2IYRA 4DLLA 5HFJA 3I45A 3BHNA 3H7AA 2IW1A 5DK6A 3WLHA 2VCEA 4FGJA 5BSHA 4RNDB 5CLJA 5KYKA 5I9SA 2OWDA 4DSZA 2WWFA 3QQPA 5D01A 1QAQA 2WFMA 2HSEA 4BECA 1AMNA 4JVNA 2FN3A 2X40A 2BISA 2CJWB 4M0EA 4CNQA 3AUUA 3KT3A 4HUQA 3PEVA 3QLTA 3N8HA 1H0HA 5U4XA 4NCAA 1E1YA 1XC7A 3KHKA 4UMVA 3IBFA 3AQIA 1J5XA 4JD5A 3QITA 1ZLYA 3WWDA 5HUQA 2CDNA 2RBEA 3ZDFA 4HTFB 1KJNA 1NXPA 1Z2CA 2PSHA 2ZRCA 2YNMA 3QVVA 4G9BA 4TV9A 2CUNA 5SICE 1RVDA 2I4MA 4PZZA 4LNUB 3ZV6A 2FV8A 3BWBA 3PC4A 4NQRA 4FBGA 4UVIA 1SJ9A 3FIUA 4NZYA 3ZE8A 3D4NA 2O8EA 1DAFA 1DLJA 1NVFA 4C3VA 1NC1A 1OC2A 5EQTA 1PTJC 1Q2UA 1WNTA 4MWDA 4B79A 4G0PA 3WJ1A 1Z5PA 1KYVA 5IAGA 4JYZA 4MITA 2HF7A 3B53X 5A04A 3L6EA 2GFHA 4BNIA 2IUUA 1DINA 1QIMA 2Q3EA 4KV9A 5IH3A 3VMMA 4MRMB 3EUFA 2QX4A 1ZH8A 1IG3A 2CLIB 2RHJA 2PFKA 3IJ5A 4KIUA 1UC5B 3TZCA 4HY3A 5ALFA 3AF6A 3EZLA 2G36A 5JSKA 1PJ2A 1EP9A 1S7CA 1XCJA 3IT0A 4GBJA 2AVNA 4HDKA 1TIKA 3QK7A 1RAFA 4GYWA 1FNBA 3ENWA 1OUMA 1F0NA 2FUNB 4XTCS 1CNMA 4JIMA 2WT8A 4IVQA 3O3MB 5HF8A 1XMQB 2JDID 4FLMA 4NNOA 4FEYA 2QTCA 2H4YA 3ONWA 1NRXA 3IO5A 3AJAA 2VLBA 4F6LA 4JMPA 5FLKA 1P2FA 5JCXA 3QKRB 1DBWA 1LBTA 2J9GA 4GPD1 1ZMBA 4MH0R 1TO2E 3CUEF 3OFKA 2Y1XA 4X8MA 2FXVA 4X1YA 5LYYA 3SDBA 1SUEA 1LW7A 4IDFA 1DCMA 4IHJA 1ZJWA 2VSQA 1YVRA 3PQ6A 4QYIB 4L73A 1EVLA 5CH8A 1RYNA 3AGPA 3DKIA 3F73A 1V7PC 3IMFA 4DZRA 2FEOA 4OK5A 4EUNA 2WPDA 4W9MC 3T9AA 3BE5A 1EHYA 2Y1OA 5I7FA 3L8YA 4MKRA 4HH1A 5CFPA 3EIHA 3N59A 3I9JA 3H6KA 2JZNA 3FN4A 1QYXA 1O5TA 2VYNA 2CXUA 4LXUA 5IM4A 4UDNA 4WKCA 4QXMA 2H7VA 4G5GA 2F6RA 3KV1A 1WXWA 1XZMA 2BMEA 5EJGA 5LCXA 5CX1A 5BNIA 1BDBA 1D0SA 1HT3A 2HD4A 2Q5JA 4L4RA 5EPEA 5F52A 2BHNA 5EL0A 2QVGA 2ZU0C 1ZK1A 3DHEA 2FZ4A 3ORSA 4FZJA 4QDXA 5ENDA 2KLHA 2A1TS 1AUOA 2ES4A 3A1SA 4E08A 1N77A 2YIDA 4HGNA 1E0AA 3AR4A 2J6IA 3L7OA 2G70A 2ZVDA 3IVGA 3QNWA 2BDEA 3QP9A 4U2BA 5F12A 3V2GA 4PANA 2A3NA 4EG7A 1BMDA 2FR8C 2NPIA 5G0VA 1C29B 2TECE 3VR0A 5GONA 4BVJA 1AZLA 2CMKA 3ESCA 4ZQGA 4CBVA 2XIQA 4R1MA 1NHGA 1N5RA 2DQKA 2VT2A 2VXYA 2XUGA 3P9RA 4Q4DA 5T67A 2XQFA 3WSVA 2VLIA 2W4QA 4QO7A 4OP1A 1LPSA 2XB2A 5BW8A 2W6NA 3TW4A 4E1AA 2BFWA 5B6PA 2A33A 1E6CA 1NI4B 2FRDC 2JBAB 3PP8A 4OVKA 4GG1A 3T5CA 4BJ5A 1TMOA 2QT1A 1NM5C 1XMIA 2DG2A 2GF9A 2RSLA 2YZ7A 3M6MD 1U1FA 1J0EA 1UEXC 1JXAA 4M1QA 5HRAA 4U7FA 2CXNA 4DVJA 3ZLUA 3ZX4A 1U3DA 1WE2A 1BE6A 4K9QA 5BV2P 5JH7B 5E0KB 4ZXFA 5EXEA 1DXHA 2FPGB 4J0EA 5JALA 5CFRA 2B9VA 1P6UA 2PMFA 3G9QA 3K8OE 2AUTA 3UIEA 4OFWA 3BXXA 2GCOB 4O2BA 4X44A 5D7NA 2OGTA 3P9IA 5DTIA 4BZWA 5KOHB 1SUBA 4FFRA 3S1AA 1ZOIA 1N6KA 4YIKA 4MJ7A 1X3LA 3DHWC 3BYZA 2E48A 3IJRA 2PCLA 3RVMA 4WBNF 5JI3E 3U09A 3HO8A 4DG9A 4ESEA 3H6HA 4PNEA 5TT1A 4ZKEA 4G0XA 3MPOA 3B1YA 2V9PA 2J3LA 5GJCA 4DEVA 1EUQA 1E1RD 2GN0A 1E6KA 1NNLA 2QG4A 2VPPA 3MB5A 4R2LA 5K03A 3OZIA 4O02B 5DF1A 1Y1KE 3D6JA 3KOMA 4D6XA 4YJ3B 4F6RA 1MO3A 1U3GA 4ERXA 3CW8X 4JX9A 2QDKA 2X8WA 1GKIA 3UHJA 2DLNA 2O8DB 4MVYA 4MKHA 2JLQA 3LUFA 5LJIA 2Q6TA 3U7FB 1G9XA 1D8AA 2Q3MA 5DIFA 1HLFA 2IYTA 2VAMA 3QH4A 4M8NE 4F11A 1OLUA 3LCCA 1JDTA 2C2WA 3TDKA 3GRFA 2Z5VA 3KEMA 2QTRA 3JASA 5KOYA 4EX6A 4ZP1A 4DBVO 5AW7A 2SECE 4MYRA 3CUVA 1FTSA 4FPXA 2Q8NA 4G2TA 4DLWA 1ECFA 1KC1A 4NQZA 4AZ3B 3LRPA 3EHEA 3HM9A 3EA5A 3D3QA 4TT3A 1C3OB 3GN2A 2ID8A 4WAUA 2VOEA 3GJYA 1GAWA 1TUGA 1YBMA 2LKDA 3I01M 4HPXB 2PSDA 3TTXA 3E8XA 5I6DA 1SBCA 2IY7A 2P5UA 2CNWD 3ZHSA 1X7YB 3U31A 3IS3A 2R6CA 1P0QA 5EP4A 5H59A 2R8BA 4IGAA 5FBLB 4Y6GB 2FFQA 2Q8QA 2ZLBA 2C20A 3UMSA 1JN0A 3SVTA 2PLWA 1RT9A 4EHBA 2FZ5A 1DRUA 2FN8A 4H1UA 5KYUA 2VTBA 2W6JD 2QDXA 1DNPA 1VA4A 1ZK4A 2GNPA 4GP9A 3ZDYB 4D81A 3THXA 5HDQA 5DLPA 1C1XB 1PN3A 2Y1FA 2QX9A 1KMCA 3N75A 3DBIA 2JFVA 5DH9A 3DD5A 1F2TB 1DX4A 1Y6ZA 2J1LA 2O7QA 2XCTB 1XQYA 4I08A 4W1PA 1SIUA 4MW7A 5J5AA 5A7FA 4X1OA 3FPFA 2HFKA 3JQ9C 1N6HA 4UEJA 4L74A 4RK4A 3IOBA 2RAFA 1JBQA 2WPNA 4H3KB 3SYLA 4R2IA 2P2SA 3VAAA 2I3DA 2H9IA 3ILXA 2ILTA 4XVHA 3EMDA 3WNBA 4FQ7A 5KMGB 1TO6A 3LFUA 3F5DA 1FXSA 5ICEA 1XKTA 4FGUA 1TIPA 4XX1A 4NY1A 1TAQA 3T3PB 3TZLA 3Q8KA 3PWZA 4H7IA 1YFZA 4B32A 2Z5LA 1T3ZA 1YULA 1L8OA 3YASA 3COJA 1GFWA 2QUHA 5BYKA 1NI5A 2QP4A 3C3YA 1L7MA 4UVHA 1WXDA 3R76A 3BC1A 4L8GA 4HNAB 3DMPA 3FNBA 1KVRA 1OLSB 1U31A 1B6GA 1R37A 2WUWE 1I13A 4G07A 5LYJF 2XECA 4B6SA 3NHZA 4BUZA 3K9NA 4RF2A 3IUEA 3Q98A 2QGNA 1CU1A 2C5FA 5TQ2A 3OZCA 3E0QA 1IXZA 4Q82A 1WS6A 1I0LA 1YJXA 2PEZA 3DEIA 3CX8A 4O63O 4NICA 4YFYA 2VAWA 2WU3A 3VR5A 1X8KA 2O2YA 1R27A 1NYLA 2A30A 4IMRA 2K87A 2V3CC 3DOEA 3OOHA 1NFRA 4TXJA 1QQTA 3ZG6A 2CV1A 3IKMB 4MOWA 4D45A 2GEDA 5A4AA 3KZCA 4QUDA 1KO7A 2VDQB 5EJ6A 1T8WA 2A92A 4I1VA 1KERA 2NSYA 1SVOA 1XCBA 3H2IA 2ZBRA 4YT5A 3W5UA 4ZVUA 3ZLVA 2PXHA 3H75A 3IP5A 4D3FA 2KWIA 5DM60 2AX4A 2LWIA 3KD2A 3UB4A 2ZVPX 3AU8A 1XZLA 1VSTA 3HR4A 4JJ7A 2I6SA 3OIUA 4ENWA 3NR2A 1MOSA 3QJGA 5A05A 4J0IA 3WK4A 1GNTA 1TMGE 2B4AA 2GCPA 3GFPA 1NRJB 3U7JA 3PHBE 1UDWA 1VG9B 1ZXLA 1E9FA 2HJVA 1C2YA 2BFDA 2QOEA 3R5FA 4BMOB 1SCIA 2VJMB 3MUOA 4MPPA 4EVSA 4ZFNA 2G09A 5AVRA 1ENZA 1BA3A 2ANBA 3RUAA 1CJTC 3R7LA 4YRNA 2X5KO 5K1ZA 3WLPA 4BVEA 1UK6A 2BGIA 1W29A 4TTRA 3PC2A 1Q3TA 3SC2A 3UPDA 2WWYA 1NMQA 2WICA 5ARDA 4LTDA 1V7QA 4KO3S 3R0VA 4E7PA 4ZK6A 1F8UA 2XRMA 1LC0A 4LK3A 4K28A 3CIOA 4K03A 2IHZA 3RIYA 4C6TA 1XKLA 4LZJA 1PR1A 4YJ2F 1F17A 1VG0B 5J2TF 5A9TA 4MQBA 3S5UA 4IIGA 3P0IA 4MINA 4UASA 4LXIA 3MOGA 1RQRA 1TXGA 4RKYA 5ETJA 1MOPA 3W5CA 2PMWB 5LXTB 4TSFD 1EM8A 2EWMA 1N0UA 1VJ5A 2YS6A 4WLVA 2CJWA 2Q9AA 3FZGA 2NVWA 3UTDA 5A62A 4EHAA 3JV7A 3EH2A 1EJ0A 1YTLA 3CB4A 4YCCA 1JG4A 4PO8A 5IVPA 2N47A 4G0OA 5DVZA 3CO5A 4D3XA 3UICA 1RYHA 5DT2A 4MYCA 2ZWIA 4CTNA 4KXFB 2BKEA 3PSHA 2AZXA 4U63A 1XPRA 3B3QA 2C3MA 1PDOA 4I9HA 4EGQA 3IDSA 2QVCA 1X2EA 3IEKA 3LX5A 1RWNA 1NF9A 2XMCA 2XV1A 3D31A 4HTFA 4J90A 3T35A 4EDHA 4CLOB 4F0JA 1EXVA 4ETIA 4G1CA 1Y4SA 1JHQA 1GYQA 2AJDA 2CXTA 3EA0A 4K0RA 4LNUA 3RFFA 3UWSA 3WKCA 4INJA 4KQ6A 2XBMA 2GD6A 3A37A 1IB6A 4QUGA 2OMEA 2FUEA 1J07A 3AMVA 4WXPA 1KDRA 2EFHB 3H1GA 5DLDA 3RVQA 3O6VA 4YJKA 4R16A 5A7HA 4PPFA 3IRVA 2NIPA 5GZ3A 3H83A 4UVGA 2O4UX 4NXMB 4EFLA 2P30A 1L5MA 3QEAZ 4EHLA 4DLRA 1S0UA 1Z6ZA 4MUMA 4FILA 5K0LA 1RJEA 3HL0A 4Y2UA 3M5WA 3RFTA 4B7AA 4C7KA 3NC0C 1N75A 3IR6A 1Y9JA 5CAEB 1A4XA 1L7QA 2AXNA 4IJUA 4MEJA 5SZJA 5BSVA 1RZ3A 3UAWA 1F7VA 3EY9A 3Q4GA 3HXKA 3S99A 4EPWA 2PR2A 1ZW6A 4E6PA 3A70A 4C7MA 1YFLA 1SUWA 1JKFA 4HN2A 3C0KA 5AK6A 3CSUA 4C2BA 4YRIA 2H00A 4D8UA 3HWWA 3WLIA 2Z5GA 1QHFA 2L2QA 4AYTA 1U8UA 2YJ6A 4J16C 1FDUA 1KMNA 4S1VA 5LQUA 3UWDA 5ADUS 1ZD3A 3EDCA 5FXMA 5BQOA 1FC0A 1JV2B 1QG4A 4I50F 1DBSA 4BTEA 4QFMA 2QIOA 4B3RB 2IU4A 1M2WA 1CJBA 2QN8A 3LKDA 1GNVA 1K06A 2QJRA 4PHHA 4L22A 3K5WA 1OX4B 1AZWA 1I3CA 3OPVA 4RQAA 2ZUTA 3NUGA 1OYYA 3QKRA 4DG5A 5K6AA 4CMHA 4RZXA 4DV5B 1P5FA 4TN1A 1CB7A 5EJ2A 2OCDA 1DTSA 2G0AA 2Q1UA 3RYCB 2XX3A 3DTTA 1D6NA 1S8AA 3AI7A 2ZXEA 3GDWA 3BF8A 1YRHA 3OIFA 2XGMA 4QYIA 5BV7A 3G1WA 5DM70 3V4ZA 2IA5A 1RU3A 3PFHA 4JCCA 4MV3A 3GRZA 4IUYA 4IJQA 2Q2WA 3ZNOA 1T1RA 4E30A 2PKEA 4PCVA 3BB4A 4C0HA 3ILVA 4DDTA 2OFWA 2G72A 3I05A 4G5YA 4WY5A 1SPBS 2XW6A 3G5LA 4JEIA 4C5BA 1PX0A 3P0FA 1KDVA 5MFZA 3DE3X 1SB9A 4IIJB 4CRWB 2YY5A 4PIMA 3IT1A 2X9LA 2GZDA 1SKYB 1Q44A 1ZG3A 4MARA 3X1MA 2TMKA 4EY4A 1LSUA 4NMLA 4YRBA 4MMZB 3DULA 4GOJA 2MYNA 1UWVA 5CYFA 2XVAA 1RADA 3UCFA 3MFYA 2CCGA 2PS9A 2ZRMA 2YOGA 3NIGB 3QFSA 1SUPA 2B35A 1JIJA 1L3BA 2FLVA 2V7EA 3DFZA 3OCYA 4O0MA 4MIEA 5EXTA 2RGNC 1GV1A 3IMKA 5AHWA 3H5VA 4EGSA 2HMUA 1RWQA 1YBVA 3KU1A 4RAQA 3TIVA 1VDZA 1IOZA 1ULTA 3VHLB 2WJGA 2MSKA 2KX7A 1U8AA 2IP4A 2R00A 1N8NA 3H2YA 3F2IA 5EI5A 4IS2A 3TQIA 2HRZA 1JEQA 3ACBA 3I2YX 2P79A 4UTOA 3W2IA 1C1HA 3STHA 1RRCA 5K99A 1R0SA 2Q1WA 1XTBA 1YVEI 3LGSA 2ZZKA 4MK4A 1RYDA 2IVFA 3DZCA 2J9YB 3HMQA 4NG4A 4BEVA 1BXZA 221PA 1NI4A 3KAJA 4U9IS 2JBAA 4AN0A 3OIDA 4FOTA 2H5JA 3RF7A 5B7NA 1M1YE 4BU1A 4EA9A 2OE2A 9ABPA 5K51A 3EZ2A 5ILGA 1MC8A 5L3SA 1XLVA 1W4RA 2FE4A 1WTAA 2WWXA 4K40A 4XOUA 5JH7A 2ZJ6A 3KPJA 3LVBA 2R4UA 1B41A 2PX4A 4YB8A 5CG2A 1CUZA 5JXGA 3RIXA 3C41J 1WMDA 4NV0A 2JJQA 4HQ6A 1YCDA 5LZ2A 3P9KA 1TI7A 4MR9A 2HHCA 1A3CA 1NPTO 4JC5A 4A2CA 3EZ7A 2GCOA 1F8YA 1E8NA 3L7CA 1SC6A 1Z25A 2F3SA 5KOHA 2W90A 3CO0S 3DKKA 2SHKA 2HPVA 1NG1A 4KK3A 2OB1A 4FCVA 3OY2A 3RSZA 2D6FA 4YH1A 3IP7A 2X3UA 1VB3A 3KG2A 3OPYA 1IMJA 4JBHA 1TECE 2QTVB 5HYVA 1BCRB 2Z6UA 3DEAA 3ZJVA 3C4QA 1G9SA 4PO9A 1GGFA 1Y3HA 4YJHB 3VVCA 1JMYA 1IULA 4I4NA 1PV1A 2R8EA 2BM0A 3UA4A 2PGNA 5BUSA 5LVAA 3C6QA 2JGFA 3BFJA 3NALA 4YJ3A 1BMFA 2P2GA 5C32A 2EEPA 5IN4A 2JLUA 3DFMA 3TAHA 2O8DA 1YKFA 4URYR 1RLIA 2QQFA 5DTRA 1XTRA 3ES9A 4G84A 4LHEA 3S2UA 3V9AA 4CHTA 1ZAYA 4B3MB 1UR5A 1M8KA 2ZYAA 3IP3A 1AQUA 2WD9A 4V2IA 3WBBA 1I3MA 5JQGF 3PUXA 3L93A 5FT9A 1J7JA 2ODNA 4KXUA 4UM9D 4NX2A 2M6KA 1YFJA 1WV1A 2J87A 2J09A 4MO9A 4ZXPA 3ZK8A 4KP7A 4QBKA 2YIMA 4QWWA 2DJIA 4C06A 2BFFB 4CM8A 1GJRA 2A5GA 3PI7A 2OA0A 2NO9A 4E32A 3VH2A 4DMHA 4AN4A 4AZ3A 2H52A 1BS9A 3HDVA 3HQ4O 5DP2A 2PGXA 4YRGA 4GECA 1T0IA 4MRVA 2IUFA 5DWVA 1C3OA 3HSSA 5FTLA 5E95A 3R24A 1NI3A 2VC2B 5JDCC 3I3OA 4KHZA 4RZHA 2BIFA 1OHHD 1CUEA 2PUBA 4NV1A 4K9LA 1ZS9A 2HV8A 1KVSA 1YIAA 3HI6A 2EJTA 1FYFA 4E88A 4QOGA 3CPEA 2ZKIA 1AKRA 1K0FA 2G4VA 1X7YA 1L5FA 3V1NA 1XZEA 3WB9A 3KVVA 1U0BB 3T1QA 1USIA 4REQB 3OTGA 2C2ZA 1B43A 3AV0B 3BCUA 2H7XA 3PS9A 3QJYA 4J1NA 5CJJA 4N40A 1JHOA 4AP6A 2CYBA 1P4HA 2D0OB 2R44A 2IU3A 3UG6A 3ECSA 4FI3F 3WSTA 4MPRA 1NQVA 4OHRA 4Z9XA 5B4TA 4J7XA 3WYCA 3QLUC 2XWSA 4DILA 1ZRNA 4OHMA 1WUKS 1VBFA 2OEPA 2PSJA 2RI1A 3GJ6A 3SC6A 1F2TA 1JTVA 2GN4A 2VQDA 3CR3C 3M6IA 1SGWA 1XRLA 1ZA1A 3M4NA 1P2UA 1D2EA 5AJYA 4KTTE 2AJCA 1QWSA 2HBYA 3P0JA 4N9WA 3RC9A 2XJ4A 1Z6GA 1SUDA 1DFHA 1PL0A 2YYYA 5DE3A 1QO0A 3TMYA 3EEQA 4Q9KA 2ZJ0A 4P3OA 5BSWA 5JS6A 1GUZA 2FFHA 1BVHA 5I7HA 4G8DA 3II6X 5KMGA 1QP8A 4GLBA 3K9FC 4UHFA 1L5QA 1BS1A 5TPZA 5C5CA 1ZOSA 5AM2A 1ZRSA 1I3NA 4NARA 2YFKA 4H7PA 2RC6A 2NU7B 1OB5A 2BKLA 1AKEA 1LF5A 2RHDA 2ZB2A 5B58T 4JVSB 4EJ0A 1ZXBA 1UKYA 5LMZA 2FA9A 1Z15A 2X14A 4HNAA 1OLSA 1ODJA 4RMGA 3HDQA 5HQ3B 2HQRA 4OD0A 2QVLA 4IH1A 4JJ8A 4YMSA 4KR6A 5LLSA 1K98A 5EZYB 1N6NA 4I9GA 1VKOA 4J0CA 3GLFE 5FOXA 4B3IA 1U1IA 2FSHA 2V6BA 1YS6A 3COYA 1Z17A 5CDFA 4K6CA 5HIAA 3RKUA 2R96A 5LQJA 1U81A 3WGTA 4ZDIA 5AM3A 1C41A 1HC7A 4GGMX 5JNLA 3RTBA 3I5AA 4QQ8A 3AHJA 3F9IA 4ZVTA 3LYAA 1QRAA 1JUDA 3OZXA 5CYOA 3GO4A 3N8DA 2P9BA 3NP9A 3QVUA 4IZIA 2ZIEA 1CRLA 2X9NA 4XGIA 3K5PA 4NABA 1T0PA 3NIBA 2R5FA 4LXYA 3ZK7A 1G21B 2C83A 4FB4A 4UNRA 2Z98A 3VA7A 2D5IA 3GLSA 4JYBA 2XT9A 3JYNA 3OJLA 1M6HA 4JDPA 5B7QA 1DI0A 3RVBA 1A7AA 1I4EB 3ZJ4A 3HCNA 4OHUA 5K8JB 1NUQA 3FPKA 2IYUA 3HCOA 3TQSA 2D1FA 1L1EA 1XJ5A 3SJZA 4LJRA 4I6JA 4CDNA 5L8VA 1FP1D 4HAVA 4PX3A 5AW9A 3BFVA 3KQMA 2XA2A 1TW2A 3QBTA 2WPDD 5J1TB 2Y2UA 3N0VA 3JZMA 2VJMA 3HLTA 4N47A 1AQYA 5CG1A 1ECCA 1G4UR 1OWLA 2LD4A 3TRHA 2WF5A 4OI0A 4AF8A 2ZBQA 1X1SA 4BV8A 4ZEOA 3VVLA 2VYND 5L4NA 4JWKA 1T6YA 4GZ5A 4Y9TA 1OWMA 1Z3IX 3VPBA 1O87A 2NW6A 5BMOA 3PXAA 1F6WA 3K70D 2H65A 2P0AA 1SWWA 2QF7A 3D2CA 2H4JA 2GAAA 2A35A 2VCYA 3LLMA 5LXTA 4AJ2A 1BU8A 2VDWB 2ZI4A 2X23A 4X20A 3W2FA 3MUNA 4QTTB 4KGVA 4YRZA 4YRAA 2QD4A 1Z82A 4EBFA 5LZ4A 2VTBB 3SLRA 4Q1DA 1TC2A 1Z2EA 4U02A 1WX1A 4BATA 4RY2A 1UPBA 3DTYA 4HX5A 4WFKA 3F4LA 2PUEA 4U7WA 1FK8A 2XUOA 3NBQA 4CV1A 2BR4A 3OHPA 1M2OB 4M7PA 4PNPA 4YRDA 1XEXB 4JUAA 4DR5B 1SA0B 1ZQ1A 3RTAA 3K1AA 3MEQA 3WGGA 2J33A 3LDFA 4DA9A 2R68A 2V7WA 2O7SA 1JZQA 3EZYA 4U7GA 3WYFA 1DEXA 4C0LA 4JMLA 4F92B 3GD7A 1Q84A 1D1QA 4LE1A 2WF8A 5KX5A 1SCNE 4Z99A 3Q3IA 2RJ3A 5DGXA 4JGIA 1HQKA 3AEXA 4AQ7A 2IHNA 2VVTA 1TJ5A 1U2TA 4PTZA 1NDUA 3E61A 3MJVA 1ZN7A 2BVNA 5F7OA 1TEXA 4AO8A 5GPBA 3PQDA 2BI7A 1A2KC 1NVBA 2I8CA 2XUFA 2YFHA 1H8EA 1LTHR 1YQDA 1U8TA 2ZT8A 1BQ3A 3BA6A 3M6LA 4FFMA 4AM8A 1O0BA 3GZTB 1E9VA 2UYYA 3FFTA 2C2OA 3PXCX 3ZLJA 5ILQA 2XJ9A 3KZXA 1ZJ4A 1WZUA 3TZ6A 4QIHA 2ZYUX 3DXZA 3I2KA 3KKKA 1DFIA 4RY8A 4X00A 2H54A 4UU7A 2A5DA 2ON6A 3UMGA 3NP7A 5C8YF 1YOBA 2MDTA 5BNFA 3B12A 3AEKB 4I99A 2G1PA 3A6FA 1Z5ZA 2J41A 4YCLA 2QA5A 3L82B 4XB2A 3OI7A 4AUMA 4MV8A 5HGJA 4C4RA 2FN9A 3SLKA 4Z4GA 2FSIA 2IHUA 4EPVA 1Y9DA 1Q0PA 2GN8A 1L7BA 4DCNA 3ZVLA 2F7SA 1RLOA 2B4QA 3EEFA 1AQNA 5KDOA 1Y5LA 2YVAA 3BXOA 4CM7A 4YWJA 3MW8A 1XQ1A 2PGJA 5TF0A 5KQGA 1DJQA 1ADYA 1ZCFA 3TH5A 1QGZA 1T1JA 1OR8A 3G5AA 3NGMA 2V9CA 3RYCA 4HMOA 3BSSA 5BV0A 4Q3BA 2OV3A 2W6ZA 5A06A 2AQIA 3DTVA 1RCTE 4IDPA 5ALPA 1V6CA 4ALKA 1Y1SA 2GCGA 3QV1A 3SIWA 1X74A 1UL1X 3FMOB 1EVZA 2VA9A 4GC5A 2FP3A 2LXNA 5LR6A 1SUSA 3I9MA 4K88A 3DLHA 2ERCA 2IQIA 2CJPA 5CXSA 4CKEB 2I6UA 3G0BA 3V7UA 3PJFA 2Z04A 5KSPA 3PNOA 4F2HA 5AVWA 4D42A 5A02A 1G3RA 3R5XA 3LLSA 1J2RA 1RMQA 1DVRA 1GL3A 4FHCA 5BYBA 3Q9UA 1YOVB 4R69A 4M4SA 4TVOA 2QVBA 4KB5A 4QQNA 4YRPA 1IY0A 1G7CA 2ZSUA 2HKIA 3Q9LA 4KUEA 4OP3A 1IRIA 5FRDA 5LA6F 3WK6A 1DRKA 2QJWA 4B7UA 4KOEC 4UARA 4HNGA 3X1JA 2YASA 3D6FA 4R2KA 3MS7A 4FMCB 4OJNA 4B48A 2E6UX 4NBNA 4A26A 1Y4DE 3AUSA 2E5LB 1A8HA 2HA2A 1BHQ1 4NMMA 3T54A 2WQZA 3I39X 4JX8A 4BXOB 1AF7A 3EE6A 5C51B 2CXRA 3A1CA 1CJMA 1TQ6A 4FLFA 4WUVA 4Y1GA 4WCVA 1TEVA 2NZ8A 3IEUA 4P7GA 3D7SA 1FY2A 2FGJA 4R8SA 1CULC 3RTDA 5AVVA 4LTNA 1CUAA 1XXHE 1XVUA 1VI5A 3CG4A 3MS4A 4M60A 3VO1A 1FDIA 1VPWA 2GETA 1E3DA 4ZOAA 3EGVA 2I1VB 3O4RA 5JATA 3B6MA 3UT5A 4BRZA 4JOCA 1CWUA 1RM0A 3MF4A 1EZ4A 1J70A 1EX7A 3LWNA 1NT2A 3OT1B 4RA9B 5H7XA 4ASUD 2V59A 3ETDA 3AVTA 4EP1A 4DB2A 4ONEA 2AG6A 1L4NA 2IVZA 3HYSA 4G8JA 2RJOA 3STVA 3L4BC 3HZOA 4RVCA 3RPEA 4B80A 5FH9A 3IKJA 2ZSAA 3IURA 3MERA 4J43A 1M73E 1YIOA 1ZU4A 2VNKA 4TMFA 3X1YA 3ZLBA 4AZTA 3OX1A 4OGFA 4CT0A 2HBZA 3VH3A 4NXNB 2F9MA 4N39A 4BFCA 2AWOA 3M4ZA 5EE5B 4FIZA 4FHZA 1EVEA 4M1SA 4P83A 3H99A 3MXOA 2PRKA 5CVVA 4IZOA 1RPTA 2PD4A 1X6VA 4OAQA 3KTOA 5BSTA 1W0KA 2GCIA 2PVSA 2VF7A 3ICVA 2II6A 3BULA 2P1DA 2O0HA 3L05A 4PG6A 1F60A 5EP1A 3GZ4A 2A9JA 2QTVA 4FDUA 1PGOA 4JDUA 1BCRA 4E3ZA 4EHFA 7ABPA 5H0IA 4D0SA 3FFAA 2OV1A 3GQVA 4MYTA 4NBKA 2VR1A 3C3KA 2ZXFA 1N2EA 1ZONA 2WIAA 2OBXA 4J94A 3VR5D 1Q0ZA 3WG9A 1SC4A 4LJSA 1HG1A 1YBHA 2H2IA 4GI7A 3ZQJA 5AVYA 4H1VA 5GTDA 2EOAA 1RZVA 1IM2A 5DNUA 2ID7A 2B25A 4PZ0A 4RBNA 3OIGA 3O83A 2FH5B 2Y0BA 1H1LB 2W2LD 1ESCA 4E2ZA 1D5CA 2VHUA 1IQ0A 1NQXA 1P2BA 3IP8A 3MJ4A 4I4TB 4BNJA 1Y8CA 3FTDA 5K8LA 5T7BA 1K5PA 1SG9A 2H63A 3F3KA 4CQNA 5CB4F 2VHXA 2CBXA 2HDHA 4XIGS 5I01A 2BFFA 4JOQA 1NW5A 4BQOA 1WSBA 2O50A 1G8YA 4QDKA 1ZSYA 2O52A 1H4SA 3NHKA 3KPWA 2E37A 1L7NA 2XDQB 1MA0A 1ONNA 3JQBC 3RSCA 3U3XA 2QWXA 4OXQA 5JIBA 1U63A 1PVOA 3FKSA 4DUYB 2YZMA 2PWBA 4JI1B 2XDWA 1CY4A 1JDSA 3M9WA 3FTPA 3G2IA 5DHRA 1S2DA 2HRDA 4GGOA 1QAMA 1SUAA 3R75A 2B9EA 1RAAA 3VX3A 5B1DA 5JSYA 6PFKA 2OESA 4PV7A 4G89A 5HSGA 2QGZA 5JI2E 1SOVA 4ND6A 3QU2A 3COWA 1J1IA 3LA8A 1VCHA 4REQA 4M86A 3D3EA 5JAPA 2XB8A 2PR7A 4NE2A 2AFIB 2CT8A 1HZZC 2MMCA 2YJ5A 1J22A 3DE1X 3Q88A 1P9LA 3SF0A 4DZTA 5LQDA 3CVYA 1TEZA 4KIFA 1E5QA 3ZI7A 2FKAA 2RH5A 3X3HA 1MQSA 2B1GA 2MJLA 3UYKA 3DD1A 1XKQA 4B3FX 4Z6KA 3NATA 3HA3A 1KDOA 3EIWA 1WXXA 1PGJA 2C2XA 3IIKA 4L0DA 4ND3A 4PVCA 5EIBD 1Y6GA 4PW0A 2JL1A 1NW7A 1P1IA 4MCIA 3TNDA 4CIVA 4EL5A 3Q5DA 4RH1A 4WERA 4Y2SA 4DV7B 4CXMA 3FAKA 4YAOA 1TVKA 5EIAA 5BOVA 4CIXA 1NXSA 3RLIA 1U5BB 4ZEVA 2K4MA 5K3CA 5JADA 3UWMA 3DA8A 2J3QA 1RW4A 1U94A 1DC5A 3CUWA 4UCXA 4ER3A 5B36A 4V39A 4TYWA 3TOSA 2P4UA 4FN4A 4PRYA 2H08A 2JFXA 4ECEA 4K2AA 4D43A 1M6WA 3WDLA 2IYZA 2D00A 2C1XA 1V71A 2NU7A 2YNMC 3PKIA 4J2HA 4KX3A 1HDCA 2JIOA 4H3VA 2Q5FA 4Q24A 3IJPA 5COAA 2X0KA 3WRXA 1M6VB 3KBOA 4JFRA 1MO4A 5F3DA 4B6OA 2I7TA 4TRNA 3OHSX 1QH0A 5EAIA 3PI6A 1ZKDA 2WUFA 3WIDA 3WRVA 4BFSA 5HQ3A 3CEAA 1TTQB 3SR4A 3R9XA 1HEUA 4TMZA 4I1IA 3GH1A 3PPVA 5EZYA 3X1DA 2A86A 1Q57A 2J07A 3N5CA 1KO8A 1ZC3A 3TQFA 1FYXA 3A6KA 2WTXA 4GYKA 4R41A 3GN1A 4TTIA 1QV7A 5FPPA 1RLTA 3WHKA 3GEIA 2DQSA 3AILA 3MJFA 2F55A 5F7ZA 1ML3A 4RGVA 4DCGA 2V7GA 4P3XA 4LOIA 4FD3A 1YCHA 3CLUC 3M5PA 1MEEA 4L50A 4GPZA 3EJ6A 4C30A 2IW3A 3F74A 3IBGA 3IELA 3KB8A 5HE8A 2JLXA 3A7DA 2AOTB 4N3GA 4ZA2A 1H6AA 4B87A 5H70A 3VGJA 2AZTA 1XMJA 1G21A 3M0EA 5CT6A 1PEDA 3ZU2A 1V11B 4GBGA 5E1OA 1ZBQA 2X4DA 5BSFA 4WASA 1UFRA 5JNRA 1BWSA 1DXYA 1VCMA 3HJGA 1YJBA 2CLDX 1E9EA 2QP3A 3HDYA 5HVNA 3EGCA 4EPXA 1PZHA 4AFNA 1TTPB 2J59A 1CJKC 1RRFA 3L2OB 4KNYA 5A4DA 3GWGA 1JJVA 3MD0A 4CIWA 4HLDA 1TDJA 2GS9A 3L8ZA 4GT1A 2CZGA 3DZIA 1FUUA 2C77A 3I09A 4BWGA 5J63A 4I9UA 1ETUA 3GFOA 3NDRA 2R6JA 2WF7A 3BAFA 4H18A 1NTOA 2D1YA 4DDMA 5KX5B 2XR1A 3I4FA 2QYSA 1XLUA 2VJPA 4R2WA 2J9RA 3TOCA 1N0HA 1QFSA 3HN2A 3QE4A 1KPGA 5J4HA 2HMSA 3QSYA 2X5JO 2V6IA 2PGLA 5EVJA 1TNDA 2NUPB 2XD9A 4R1NA 1C9YA 5ALRA 4N8EA 1TQ8A 1WR8A 3ESYA 1A9OA 4W9RA 1JR4A 1TK2A 4I2NA 4XM0A 3S28A 5IAJA 4QVGA 3GMIA 4CTJA 2XHZA 1U1EA 1G6KA 2VDWA 1ZVVA 4NE7A 3VYVA 2PDAA 3JQAB 5G53C 3SJUA 3UF0A 3COZA 4F1JA 2P1RA 1MA3A 2ZR0A 3AW8A 4FDMA 4NH4A 3VKUA 1GPJA 4IJ5A 1MJFA 3VZPA 5LYJA 2P5SA 1I5OA 3V8BA 4ZCLA 3U9TA 4OMDA 4KC0A 2PA3A 5DLEA 1M2OA 4OSPA 4JXXA 1XEXA 1JF8A 1ZESA 5FUBA 4X3PA 4AUKA 4L4XA 1SA0A 1T3HA 1IYZA 2Y1CA 3T5MA 4KVFA 5JEDA 1EUDB 3M49A 3R5TA 3KELA 3INRA 4DTCA 2PXCA 2ZYGA 1GPLA 3N74A 5HKAA 4L8VA 5GIOE 1K8QA 4X9XA 5FWYB 3EXHA 3X43A 3AJ9A 1U8CB 5KJ1A 2W42A 4JSTA 3DBLB 2O3QA 3QEMB 3PC8A 4G25A 1ZGBA 4XUGB 2GYWA 1QFZA 4NBSA 3E03A 1HDOA 2V65A 2W2NA 4WZAB 5LU9A 1NBMA 4JKOA 4NEQA 8ATCA 1TK3A 2PLRA 2JRCA 4Q4JA 1RJ9A 3PTZA 4E2YA 2P2LA 3K1JA 1I2ZA 1YAJA 1Z36A 1ISIA 2AFHA 3U13A 3ROMA 3TBHA 1MT0A 3WLMA 1B1AA 4JQCA 2ZUSA 3WQBA 3WLSA 1T2AA 2C98A 2DOKA 1T2VA 3AY6A 5CNIA 3X2FA 3P7MA 5EQJB 4N5MA 4WH0A 3L6BA 2HK7A 5FQNA 1ZCAA 5B2ZA 3C85A 5PNTA 3OTOB 4D9EA 1RI3A 4BQNA 2HNKA 4DGSA 1RJWA 1UZNA 3GJ0A 3CRW1 3MLEA 4G65A 3VO8A 1QIEA 2P7HA 3AEKA 1E9CA 2H92A 1ZCZA 1W0CA 4FLEA 1L4YA 1N2SA 3RAFC 4MJ3A 3DOJA 4B17A 1PIWA 1UH5A 4RE5A 2V0NA 2NP7A 4FHDA 1WDKA 3L0ZA 3Q1LA 4MDYA 3PFIA 1BMFD 1PVVA 2H3HA 1W5BA 3K96A 4L3VA 1IN7A 1D4AA 2PGDA 3C16C 2JASA 3L4KA 2BM1A 2OKGA 3G9XA 4W5TA 3FTEA 5K3OA 4D4HA 3CSDA 4G1BA 1IONA 3NT5A 2WHYA 3H7IA 2AR0A 4AWBA 2AGVA 2QTAA 2AHRA 2PBZA 4KE6A 1D7AA 1CS4C 3GLTA 5DNAA 1N2ZA 1LDEA 4QTUB 4CFZA 1TVCA 4ROSA 5JSQA 2ZROA 4FTWA 4UULA 5GADl 5T3UA 2RHMA 4E14A 4O1HA 2C78A 4DWOA 4DA7A 6AT1A 4P4LA 3BGSA 1C9KA 4L75A 4V1CA 3AW9A 5AKGA 1ZIPA 3UAXA 3WFZA 2WLTA 4C7JA 1L7DA 4XPIB 4DYVA 1PWEA 1VHQA 2JGAA 4NMHA 4A91A 3QXSA 3ZJTA 3OESA 4KPGA 2NU8A 1UK7A 1IFXA 3AHGA 3PDCA 4FUQA 1YOVA 3LP8A 4YCDA 5IAKA 3WJ7A 1AE1A 3AQ4A 3RS4A 4QSHA 3WIUA 3KZKA 3FKJA 1KTVA 4KVGA 4L5YA 5BOSB 1OF1A 2OY0A 4MUBA 3PHCA 1A5SB 4TWAA 5E9JA 3L46A 2FZGA 2MR6A 3DLBA 3EFBA 4D4MA 1VRVA 3SMVA 3TNJA 4AO7A 2GVNA 4F46A 4BBAA 2UVPB 4QRHA 2OFXA 1Q22A 2FQQA 2TMDA 5ES3A 3S2GA 3UJ7A 5JANA 1P60A 3DGEC 3AY0A 4NAVA 4EG4A 4WKNA 1A4IA 4BXOA 1Z4JA 2BCGY 4EHHA 4C0BA 3ZI0A 4Q4CA 2QN1A 3I4LA 1WNFA 2IZ7A 4UNQA 3RI3A 1PS0A 2BHTA 1A50B 4RVSA 3VMFA 4BN5A 2V1UA 2PJUA 1XHFA 1XR3A 4JY7A 4MUGA 2AI2A 1MOQA 2Y1EA 1PR3A 2O06A 4KNVA 3OUZA 4DNOA 1GQQA 1U3WA 3KVNA 1M6EX 1EZ1A 3LUGA 1MFPA 3AERA 5I3CA 2I29A 1YDMA 1N78A 1JR2A 3M6AA 3OT1A 1TZBA 4RA9A 4YDHB 2IE8A 3NIWA 3JS5A 4LJ8A 4E5MA 4BEWA 3E18A 4L8LA 1GGNA 5TPZD 4E1BA 1CRPA 4MUAA 3HJRA 3AEYA 3CBGA 3DXYA 1XN1A 4ZRDA 5B12A 2XZOA 4LF8B 5TLSA 1QHYA 1V37A 3ZY3A 3ROZA