1GEGA

Cryatal structure analysis of meso-2,3-butanediol dehydrogenase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
255
structure length
255
Chain Sequence
KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of meso-2,3-butanediol dehydrogenase in a complex with NAD+ and inhibitor mercaptoethanol at 1.7 A resolution for understanding of chiral substrate recognition mechanisms.
pubmed rcsb
source organism Klebsiella pneumoniae
molecule tags Oxidoreductase
molecule keywords ACETOIN REDUCTASE
total genus 103
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.304: Diacetyl reductase ((S)-acetoin forming).
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gegA00
4BNGA 4Z6KA 2HKIA 4IDAA 1HDYA 1U2DA 4PVDA 2EP5A 3DL2A 3HZZA 2I9PA 4WNCA 5DDIP 4AJ1A 4BMVA 1UXKA 4OAQA 1O8CA 4NH4A 4S1VA 1N9GB 1ZIDA 5C7LO 4QX6A 2CVQA 4WLEA 3C8MA 4RVDA 1ZK0A 2OOSA 4DIOA 4B4UA 4D42A 1U28A 1VSUA 3DMTC 3TOZA 4HP8A 3ADPA 2PGLA 3JQ9C 4DVJA 2GCGA 2UUOA 4CMAA 4KOAA 5DOZA 2D5CA 2WYWA 5JYDA 1PJ2A 3RSHA 3ZWVA 3GR6A 1ZK3A 3NV9A 1XLTA 1SO8A 3I9NA 2CF5A 1X7HA 4YACA 3W8FA 3VHRA 3ZWWA 3JQGB 1VC2A 1YKFA 3M1LA 1E5LA 5ES3A 4CMJA 3PHJA 4ESOA 3HE3A 4GWGA 3C1AA 2HJSA 4IGFA 1YONA 2ZJ0A 4E2WA 5LDGA 1EQ2A 3CTMA 2Q4EA 2VHWA 2DKNA 1Y5RA 2WYUA 1NR1A 2WD7A 3QWFA 5L51A 1XIVA 1X13A 1PGJA 1NNUA 4INAA 4LCEA 1R6DA 1I2BA 3DZHA 2VRCA 5T5QA 4DXHA 3JD4A 4BGUA 2XF8A 1B8PA 5ITVA 4DLLA 3AUTA 5JCJA 2P5UA 4XR9A 1BXKA 5EL0A 5JBIA 4R9SA 1CF2O 1Q0QA 2AQKA 2P9CA 5KVVA 1LDNA 5I9MA 3M6IA 5JC8A 1I8TA 5DN9A 1E7RA 4JQCA 5DNAA 3KZVA 4FFPA 4BO4A 1EFLA 5KIAA 4NFHA 1GTMA 4B4WA 3DTYA 4J90A 3NRCA 4C7KA 5AVOA 1C0LA 4EJMA 1NHWA 3ITDA 3NDIA 4Y67A 2VWPA 3AJRA 2OMEA 5EMHA 5T67A 3QA9A 1PU2A 2JL1A 4WJZA 2NSDA 3PDJA 2Y0CA 3PHIA 4URFA 3DONA 4NBTA 1H5QA 3ORFA 2O3RA 3PQEA 4GVLA 4E30A 4R1NA 2C2XA 1DIAA 1OZAA 5THKA 3ZDFA 4BO2A 4E2YA 3IQDB 4DPKA 1YGYA 2BKAA 4QUKA 3JQAA 1MUUA 3NJ8A 3OJ0A 1X1EA 3RC1A 1NAHA 4J43A 1D4FA 1PWXA 4YT8A 2P9EA 1ZNQO 3DBRA 1ISIA 1YBAA 2AEMA 3KLPX 5A9SB 1IPFA 2P5YA 2G76A 3EK2A 3S1LA 1NWCA 1MFZA 2D0IA 2Z1NA 2DBZA 1T1RA 4CR6A 3WIDA 3TWOA 4GLOA 3G3EA 2FPGA 3NTRA 3S2EA 1FDTA 5MDHA 1SBYA 3WOHA 4A5OA 4B4OA 4D3DA 1GYRA 4D7AA 2Y1CA 2F00A 3FBGA 1ZVMA 3DR3A 4EI2A 1XA0A 1YVEI 3WJAA 4D45A 1CJCA 3OHSX 4II2A 2NNLD 7ADHA 5JMWA 1Y9AA 3EVNA 1LDYA 1RKXA 3F5QA 1JKFA 4OIMA 4LSWA 3GMSA 3FWNA 1XYGA 4NBWA 1H2HA 1UDAA 3I9MA 2Q1TA 4P8RA 2EW8A 4E6PA 1BVRA 5CDGA 1EE9A 3TZKA 4BNJA 1DDOA 1E3WA 2R2GA 1EDZA 4E3ZA 4CR8A 4CLOA 4R5MA 3PJDA 3WLFA 1VI2A 2Q1WA 1SZJG 2DC1A 4Y6SA 2XOXA 3NKLA 5JAQA 3FTPA 4CM8A 2VZ8A 4JLWA 3DFZA 3HSKA 1Z6ZA 1YJ8A 2Q1UA 3KVOA 4L0QA 3JQCA 3VZQA 4IDFA 3TFQA 4B79A 4AJ4A 1JWAB 4EYEA 3EY4A 2WE8A 4OHUA 4EUEA 3H2SA 2GR9A 1LDMA 4A26A 2IEBA 1V6AA 2C20A 4I5FA 3K30A 2CZCA 1P1FA 1BDMA 1ONNA 2FZWA 2EERA 2D3TA 2O4UX 1FDSA 5EJ2A 2P2SA 5F1PA 1QYDA 2W8ZA 4J4BA 5FWNA 1DRWA 3ZWCA 3UHAA 5L53A 1N9GA 2BHLA 4LK3A 2QRJA 1F8GA 1KETA 2GN9A 3DBLA 3VZSA 1DEHA 2CUKA 2UYYA 3CINA 1GPDG 1U4OA 4Q3NA 1JU9A 3JTMA 1KEUA 2FPPA 4GQAA 1PQUA 1GFSA 1QYVA 1SB9A 3R0IA 5IDYA 5B12A 3ABIA 1A9ZA 3IDSA 4XYBA 5I7EA 1XKQA 2EJWA 1I2CA 4ZQFA 3MWDB 1D1TA 1T4DA 3Q2IA 3IC5A 5CDUA 3VC7A 1V35A 1Y8QA 1KVQA 4NBRA 3AU9A 4UUPA 4RVSA 5CPBA 3FR8A 2OFPA 4LRTB 1Q0LA 1QKIA 1I24A 3JQDA 5F5NA 5IN5A 2HRBA 1N1GA 2I67A 1YL7A 4JBIA 2HUNA 1HF3A 1CQJA 1GEEA 4CQLA 4RPLA 4X54A 3H9EO 4GGPA 4PZDA 2C2YA 1U9JA 3DOOA 1ORRA 5EERA 3AM5A 1QLHA 1DSSG 1W4ZA 3KYCB 3ZWYA 4FBGA 4GI2A 1W6UA 1IHYA 4BIIA 3SX2A 2DBRA 1JAXA 2AG8A 3AI1A 5T64A 5I9LA 3HDYA 1JLLA 2CDAA 4R16A 2NVWA 3ON5A 1YJQA 3B1JA 4PZEA 3EW7A 3WFIA 2G5CA 3ICCA 3OF2A 4D3FA 3VH1A 5HM8A 2V6GA 3NTOA 1EMDA 4J1TA 5COQA 2D8AA 1GL3A 4GKVA 5K9ZA 1V3UA 3EHEA 3RC9A 4R68A 4S3MA 3TZ6A 3ULKA 2Y1EA 4DQXA 5H82A 2B4RO 3OECA 4OXKA 4BMSA 3E9NA 3DWFA 2P91A 5DBFA 4DLBA 3ONFA 3JQ8B 2EXXA 3MJTA 5KKAA 4B7CA 2Q49A 4UVEA 1NQOA 4XQ9A 1E92A 3B1KA 1ISMA 3PJFA 4OQYA 4XGIA 3I9LA 3WSWA 1K5HA 2O3JA 4I9UA 1SOWA 3QIVA 3VDQA 2P4HX 2V6MA 2ZYGA 5T6BA 3CIFA 5JO0A 4CLEA 4XQEA 3ZNOA 3ZHXA 1KERA 4MPDA 3CEAA 3RROA 1GV1A 5C5IA 1Q0HA 4PLZA 2ILTA 1TT7A 3AI2A 4FFLA 2IZ1A 1BXZA 1CDOA 2D2IA 4LVCA 4NFSA 1PTJA 4BO0A 2ZTUA 4J4HA 4YXFA 1FF9A 1AN9A 3QVSA 4LISA 3TFOA 3OM9A 1W8DA 2VYVD 1N1EA 4FJ2A 1LTHR 2NVUB 1JVSA 2BFPA 3DOCA 2GLXA 3RBZA 1BTOA 2EV9A 4O63O 6LDHA 3DBLB 3K8ZA 4QSMA 3HJAA 3WGOA 4BNMA 1WDMA 3RIHA 3MJCA 1V3VA 1ENYA 2B35A 4AJPA 1E3LA 3GN2A 5JW6A 3MOGA 1NPTO 4CMCA 2WD7B 4DC1A 4NJMB 5JNLA 1EE2A 3PPIA 3RFVA 5G0UA 1MC4A 4FN4A 4IDBA 1IYZA 3E9MA 4TZTA 3QLJA 3W1VA 2GGSA 3QWHA 1H6CA 1YB4A 5IXSA 5GZ3A 4E21A 5J23A 1ZO8A 1TA4A 2R6JA 2DBQA 4CMIB 4P38A 5JDIA 4CM5A 2E49A 1XGKA 3A4VA 1HE5A 1PGOA 4MO2A 3DZGA 4IZIA 4CLHA 3ZHZA 1ENOA 4PLWA 3GRKA 4BO3A 1P3DA 1B0AA 1DXYA 1YB5A 1GY8A 2FZEA 1LBEA 3Q9NA 1U3TA 4QO8A 4BUCA 4EEXA 5CDTA 3UOGA 3VKVA 4XGKA 1HYGA 4ZVVA 2NQTA 1R15A 3OIFA 4BNYA 1KVSA 2EG9A 3ASVA 1JKJA 3AI3A 4RZHA 4W7HA 3H5RA 4E5YA 3OQBA 5HA5A 4JBHA 4BMNA 1T25A 4AL4A 2V7PA 2O7SA 4KZPA 4U8GA 2YV2A 1C1XB 5FYDA 5CDYA 4CL3A 3RWBA 1LEHA 2UUPA 2GDZA 4FJ1A 1P31A 3WGIA 4IIVA 5CEEA 4YEDA 1W73A 1AHHA 1MLDA 3HUDA 2JFGA 2ZQYA 3UCFA 4B3HA 3FR7A 1UUFA 4ZICA 1E7SA 1P1HA 1R4NA 1SC6A 2HCTA 1EDOA 1K89A 4WEOA 3GNTA 5EPOA 2PZLA 1RYEA 4R1TA 5IZ4A 1HL3A 1I32A 3PYMA 1Y6JA 5BR7A 2P4QA 1K3TA 3A06A 2OP1A 5JYEA 4LMPA 2QRLA 1GDHA 3QW2A 4Q39A 2GN6A 4OXYA 4HWKA 5LC1A 4B3IA 1U3VA 3BMNB 3PGXA 4N18A 2Z95A 1GUZA 4YWJA 2GRAA 3GGOA 2BFMA 5L7WA 2WE7A 2VUTA 4ONEA 3F1LA 4TQGA 5G0VA 1YBMA 3O26A 5TF4A 2V65A 3TSCA 1MB4A 1UZMA 1O0SA 2X7HA 4ND5A 3TZHA 4NZ9A 1NVGA 1CETA 3IKVA 2YFHA 4LGVA 3BMOB 4YJHB 5G4KA 4ALMA 1MG5A 3RVDA 4OKNA 4E2XA 4XKJA 5ITWA 1MXFA 3IAHA 3P19A 3NEPX 3QWBA 3OIDA 3GVXA 1GADO 4ND1A 2RAFA 3EDMA 2C59A 4JX8A 4CUKA 3E03A 2XXJA 4CR7A 5C37A 4IM7A 3R6DA 5JO9A 5TT1A 1DIGA 1KEVA 3F47A 1QV6A 2J5KA 2H5LA 4OGWA 1NYTA 1PR9A 4UULA 3UCXA 4NK4A 1LSSA 3UF0A 2ET6A 2ZYDA 1SB8A 4HUJA 1HT0A 4H7PA 3IL2A 4F6LA 1K6XA 1ADCA 1V8BA 1ZW1A 1B15A 1R4MB 2IODA 1GU7A 2PD6A 3COSA 1GYQA 3RBXA 3P7MA 1P77A 1VJ0A 2HMSA 4PRLA 2PTGA 5F5LA 3OEWA 1OAAA 4RQUA 4R54A 4RGBA 1E5QA 4WCFB 4K6FA 2Q4BA 4KTVE 1OMOA 4ZQGA 4BNXA 5I7FA 1NM5A 2JCYA 4NPCA 2X4GA 4BKOA 1P0FA 4GVXA 4LRSB 4J91A 4NBUA 5BSFA 1Z82A 2UAGA 1DC4A 1EVJA 1FDVA 2EGHA 2JAHA 4HFRA 4HXYA 4FFRA 2A94A 1W0CA 2PZMA 4O0LA 4FOOA 5FI5A 2E4AA 4AJEA 1DPGA 2WYVA 1OFGA 2FR8A 3CZMA 3ZHYA 2C7GA 4NU6A 3L07A 1DIRA 2NU7A 2FN7A 1N2SA 1JKIA 1H6AA 4JP3A 4P22A 2J3JA 1PL7A 3IJRA 4AICA 1IOLA 2JJYA 1Y9EA 1WVGA 2UDPA 3D3WA 1NQAO 2PY6A 4J0FA 1WNTA 1GQ2A 2RHCA 3D5QA 1H6DA 1XELA 3PJGA 5I7VA 4JCOA 2O2SA 4DTIA 3FSRA 1IHXA 1T2EA 4GX2A 3ONEA 1CYDA 5JMPA 3WQRA 1HTBA 4GBJA 4BO6A 2NU8A 5ER9A 4G2NA 3WGYA 3FNEA 1VE9A 2ZB8A 1B16A 4IJUA 1U7TA 1GYPA 3N7UA 2OORA 4PFJA 3MJSA 4BGIA 3U09A 5IDWA 3D64A 4PLVA 5DBGA 1TXGA 1M6HA 2VWGA 1P1JA 2ZCVA 2FSVA 3ICPA 1E6EA 2PKQO 3NT2A 4J2OA 1CERA 4TRRA 4CMKA 4GMGA 4BB5A 3QSGA 4Q3BA 3GVHA 4BNLA 1BXGB 4NJOA 1PL6A 3OICA 1ZEJA 2PGJA 5L3ZA 4UUOA 4K6CA 2AHRA 1PJBA 4W82A 1PS9A 4D46A 5IDXA 1SCUA 1PGNA 2F1KA 2JFHA 2O7QA 1NHGA 2DUUA 5DT9A 5KVQA 2AMFA 1WMAA 4TRNA 1QV7A 3WJ7A 4CM1A 4IDCA 1J0XO 4EEZA 3JQ8A 5KJ6A 2CVOA 3DQPA 2Y1DA 3PRJA 4BNNA 1FMCA 1DHRA 2AEFA 2Z5LA 1BRMA 3UH1A 4GX1A 4CM8B 2UV8A 2YUTA 2WWRA 3GG2A 3WWZA 3EUWA 1KS9A 2PKRA 4I9NA 1DC5A 2X8LA 2IYOA 3X2EA 1ENZA 3DTTA 1KC1A 3MJEA 4DYVA 3KYDA 3KXDA 3WGQA 1AXGA 1YQDA 2J8ZA 1P1RA 1J6UA 3BHJA 2NVBA 4PLPA 3OEYA 1YL5A 1YXMA 2GPTA 2WTBA 5FF9A 4U6SA 4AVYA 4YAIA 4O59O 3ETEA 1VPDA 2A92A 4CUJA 3F6YA 5IFLA 1RWBA 5I8ZA 4Z3KA 4AG3A 1WLYA 1EUDA 2DQ4A 3FCOA 3D4NA 2VOEA 1PIWA 5JPIA 5AXDA 8ADHA 1NVMB 3HDHA 3JQ9A 2Z1MA 2IDZA 1B8UA 1DLJA 1N7GA 2ZJ1A 3ZU2A 5H81A 1PJQA 4J7XA 4YQYA 3U4CA 3K96A 1Z75A 1PX0A 3ENKA 1ZMOA 5A5EA 1ML3A 3JYNA 4QTZA 3LT4A 1U3WA 1C0IA 1EUCA 1O5IA 4G65A 3V5NA 3LT2A 2IYPA 2VUSA 2BH9A 2J5RA 3LLSA 4PZCA 5EN4A 1FDUA 1I0ZA 1PJ3A 3INRA 3O38A 2B83A 5DBIA 4ZQBA 1FJHA 3BIOA 3HFSA 4TROA 4TKLA 5EIOA 5C7OO 3EYWA 3RKRA 4IJVA 5ILOA 4GX5A 4E5KA 4D43A 3GEDA 1B2LA 3WR5A 3KETA 4W7IA 4LCJA 1ZMTA 1E1LA 4FIZA 4YRAA 3MWEB 4XB1A 3V1YA 4DRYA 1EZ4A 2BRUA 2FSSA 1G0OA 4CM4A 3ZZNA 3RBVA 3OMLA 5A5FA 3KOUA 3W4IA 1LLUA 2Y99A 4PLYA 2C82A 4RORA 3ZU5A 1LNQA 4EITA 3ZWOA 1UXIA 1X7GA 4DWVA 1R37A 4L74A 4CQMB 2VTEA 4U7WA 1WDKA 3KM0A 3QRWA 1EBUA 3LZ6A 1T24A 1GPJA 4IUYA 1UXHA 2CY0A 4XZ3A 1NASA 2Q2VA 5TNXA 1YB1A 2X9VA 3PQFA 4XX0A 3AOEA 1LXCA 4BGEA 4ALIA 1PJTA 5A1TA 5BQFA 3GOHA 1U8FO 1P1IA 4MVJA 2W2KA 1OOEA 4QT0A 2DPHA 2DTDA 3WSVA 1IE3A 3OH8A 4R41A 1DIHA 4XYGA 1FXSA 3KSZO 2OP0A 3ASUA 1QMGA 3R3JA 4MVJE 1XU9A 3RFXA 3L6OO 2J3HA 2JCXA 4EUFA 3OIGA 4FFOA 1LSJA 4FGWA 4L4XA 1VLLA 2AEJA 3Q6IA 2ZB3A 3PGJA 4Y98A 2DLDA 5HWSA 1UP7A 3C85A 4PG6A 3LU1A 3ZH2A 1I2ZA 4CLDA 5B1YA 3MJ4A 4E5NA 1B14A 4UEKA 5TJHA 2B37A 2EKPA 4IINA 1I3NA 5KVCA 3W8DA 3RUFA 1PZEA 4M49A 1PJ4A 3AFMA 5L9AA 2DFDA 1NAIA 3C24A 4J3FA 4HFNA 3VZRA 3DEYX 2VNAA 2W2LD 4WNIA 5CEFA 4I5EA 4L8VA 3M2TA 1X1TA 2RH4A 1ONPA 3IP1A 4DIBA 4YAKA 4Z3DA 3HNPA 5KJFA 3FHLA 1HKUA 5G0WA 3KSUA 3S2FA 4C7JA 5TQVA 1E7WA 1GR0A 1CIVA 3C7CB 1F14A 2RIRA 3AUAA 3H8VA 3OFSA 4ZA2A 1H0KA 3JYPA 5AYVA 2VYND 1Q1NA 2PZKA 3E9QA 2JD0A 3GF4A 5AQ1A 2GZ2A 3GA0A 2C07A 4OH1A 4CMIA 4PLFA 3BZUA 4B3JA 5TT0A 3FBTA 3ZWMA 3DB2A 4DQUA 3SBOA 4EJ0A 5IAAA 4H16A 1A7KA 1C1DB 1SNYA 4HFJA 4O6VA 4WUVA 4YAEA 4QECA 1I36A 3A1NA 1RYDA 2BGKA 2FWMX 1PS8A 2AQ8A 4MVJI 4YJHA 3SLKA 5K6AA 3DZBA 1KEPA 4JK3A 3H9GA 1X14A 2XPCA 2YQ5A 3RAJA 1MG0A 4YYZA 4DQVA 1KC3A 2POQX 2P68A 1SOVA 4J6FA 3RUIA 2D59A 2NU6A 3R3SA 2B69A 4KQWA 4M1QA 1O9BA 1H9BA 1KBZA 3QJ5A 2EHDA 3E48A 1A27A 5F1KA 1HLDA 3T4XA 1JVBA 1R4MA 3D4OA 4F3YA 4WPGA 1C0KA 3U0BA 3IOYA 1P45A 3K2BA 2WEKA 4NDNE 3WICA 3GH3A 3A9WA 4Z0TA 4CQMA 3TN7A 1NXQA 5CG1A 5TJ9A 1YOVB 1V0JA 4MOWA 2Y1OA 3JD2A 3ZHBA 1LRKA 2J5QA 3VZPA 5EQFA 1O6ZA 3ZNPA 3PEFA 2V6BA 1HZJA 2X9NA 2EW2A 1BHSA 4NG5A 4EW6A 3MOIA 4AJ2A 3CH6A 3HADA 3TPCA 3TQHA 4RO0A 4JGBA 4AJNA 1JDJA 3HHPA 3JQEA 1GQQA 3JQBC 4MP6A 4IY1A 2GERA 2B5VA 1PGQA 1GZ3A 5GZ6A 2BF7A 2ZTVA 2IXBA 3JQBA 3WQQA 4YPOA 4N5MA 4ZHSA 5ENDA 1WZEA 2GYYA 4RPJA 1SEVA 4FC7A 4BNFA 3DZJA 4RLHA 4QEDA 4G81A 2OGUA 1NR7A 2Q2QA 5KJCA 3OQ1A 2A9FA 4CM6A 3LLVA 3E1KA 2PD3A 3LDHA 4LW8A 2IZZA 4WE3A 1Y7TA 3DXFA 2CMDA 2D5AA 1GQYA 3V1UA 4D0RA 2O3QA 2ZB7A 2PNFA 4BO1A 1HEUA 1M67A 3FRJA 3RUHA 3I1JA 3UAGA 1IL0A 1RM4A 3WYBA 2D1YA 2CD9A 4EZBA 4NIMA 1ZK4A 2VRBA 5ADHA 4RZIA 4IDEA 3U4HA 3V1TC 5I7SA 3K31A 1TI7A 1IZ0A 3QVWA 4RVHA 2WD8A 3INGA 1R16A 5DP2A 4J49A 3HB4X 5T8KC 3HN7A 4I5DA 3TNLA 3JD3A 1LUAA 2X23A 4MKZA 2ZYAA 3N74A 4L9RA 1VL6A 1JA9A 3HG7A 4XIYA 3GQVA 2PH5A 3H9UA 5CDSA 1UR5A 3NGLA 4R01A 2Q50A 2A4KA 1F12A 1G1AA 1JQBA 3BMQB 3KYDB 3H5AA 4E32A 1KY5A 4IQGA 3VAZA 4E2ZA 3W6ZA 4Z0PA 3G79A 1EK6A 4ZRMA 5F1OA 2HMTA 5DCYA 2HO5A 3B6ZA 3GNQA 3FTNA 1AHIA 3AWDA 4YR9A 5LDHA 3EGOA 4BNZA 1G0NA 3S2IA 4WECA 2NACA 1X7DA 1XSEA 4NK5A 2ZQZA 1ADFA 5IDQA 1QLJA 3RC7A 5ICMA 4A10A 2G0TA 3VPXA 3CXRA 3V8BA 1BMDA 1IPEA 1HE4A 1T1SA 4JJFA 4PGFA 2HDHA 2ZTLA 3R1IA 4A27A 5KWEA 4TWRA 5JCXA 5JAMA 3GGPA 3NJ4A 5CHEA 3FD8A 4MIYA 5AXCA 1E7QA 3RUAA 4K1LA 3DHYA 3IUSA 4UVDA 3KHUA 3Q0EA 4WGGA 4WOKA 3L77A 3H9JA 1RJWA 5TS3A 2DPGA 3WLEA 2GSDA 1QSGA 4FFMA 4FOSA 2JHFA 4CV0A 1ZSYA 4Z0HO 3VPHA 2AG5A 3VVBA 5BNTA 4BNUA 1BW9B 4NU5A 5A05A 2YHUA 4JNKA 5BT9A 4F46A 1UDBA 4QFCA 3PWKA 3ZWNA 2YYYA 3DC2A 3TDKA 2NU9A 4FPXA 4ROSA 2HJRA 4IJKA 3OETA 3I4CA 3D3EA 4GH5A 3PK0A 1X0XA 2D4AA 2Q45A 4RVFA 2X0JA 4K26A 3F9IA 3WTBA 3RUCA 1Y81A 1QORA 1O94A 3NYWA 4E33A 4NFYA 2W90A 3EZYA 2SCUA 2RCYA 2NUAA 4W9NC 3JYQA 3EZLA 3AOGA 2YFQA 4U0JA 1I33A 1EUZA 4Q3CA 4CLXA 1PQWA 2Y05A 4B7XA 2GASA 1C0PA 4R1UA 4IQ0A 1Y5MA 1Z7BA 2NM0A 3WMXA 1E77A 3FNHA 1GZ4A 3Q3CA 4CM7A 1OI7A 3JQAD 1UXGA 3QP9A 1GCUA 3SEFA 3WYEA 4OXNA 3ROQA 3GUYA 2YV1A 3VKUA 1PEDA 2Q99A 2JCVA 3GLQA 5KKCA 5JXWA 5KOIA 2NTVA 2NTJA 1RM5A 4TSKA 2I66A 3IIEA 4PG4A 3QWIA 3C7AA 3RKUA 1HSOA 5U4QA 1MC5A 2VHVA 3DZFA 4KDFA 2JD2A 3HDJA 3I4FA 4CMBA 2LDXA 4B4VA 5JY6A 1PJLA 1HDGO 4YRBA 3VDRA 4FCCA 2PFGA 4DUPA 1F0YA 3UVEA 3U5TA 3IS3A 1E6WA 1CRWG 4KDEA 4JXKA 3IP3A 4DPMA 1HZZA 4IDGA 3GHYA 2AQHA 3JQ7B 3DOJA 1HDOA 3SJUA 3U4DA 3RUEA 1I01A 1KVRA 3PQDA 4A0SA 4YTEA 5GMOA 3I3OA 4OL9A 4N7RA 4CLRA 1LC3A 2WJPA 1R0SA 2VCYA 2WSBA 2QHXA 1KOLA 3PFFA 4IS3A 4H15A 1VKNA 5COBA 4XD2A 1T2AA 4R1SA 1H9AA 4M87A 4QXMA 2WMDA 1EVYA 3ENNA 4CM9D 5JY1A 4XYEA 3BTSA 4RF4A 4ALJA 1YH3A 2HQ1A 3UGKA 5JSFA 1FK8A 2JD1A 3H65A 2GUGA 1OC4A 1JW9B 2CDBA 4BHTA 2OUIA 1AXEA 4J16A 4GWKA 3RFTA 4D41A 5DCUA 3BMNA 3BTOA 4BNTA 4Z9YA 2O48X 2I65A 3D0OA 3DBHA 5B4VA 5JS6A 4WK6A 4M89A 4HX5A 4PG7A 2DAPA 3ZWXA 1YS4A 4KP7A 3M2PA 4BS9A 4E0BA 3DZKA 5IXYA 1R0LA 2DVMA 4MKRA 4DA9A 3SJ7A 3G1UA 4EJ6A 2AE2A 1OBFO 4L4SA 3QVOA 2X6TA 4LMRA 2X86A 5DF1A 1LLCA 3VH2A 3AM3A 1PJSA 4QO7A 4TVBA 3AY7A 6ADHA 1I5RA 1HYHA 5TIIA 3JSAA 1WDLA 3Q1LA 2EP7A 4UEJA 1MFPA 2Q1SA 3UXYA 1IULA 5FEUA 3IJPA 1PWZA 4UUMA 4L73A 1C14A 2FR1A 3PI7A 4XR4A 3KYCA 3EVTA 3VTFA 2VNSA 3H7AA 3STHA 5BNIA 3RUDA 4MDHA 3A28A 5AXAA 1WZIA 3G1TA 3GN1A 4DMMA 1OC2A 5DCWA 1O95A 1T2DA 4R9RA 1E1KA 4XYMA 1GEGA 1XWFA 1KY4A 1B26A 2CFCA 4GKBA 3PWSA 4ITUA 2WDZA 3DBRB 3S55A 2IZ0A 1Y8QB 4HKTA 1ULUA 5CEJA 4WLOA 4PCVA 2J3KA 3QQPA 3H6KA 5JLAA 5T8KA 3JQAB 3B70A 1E3SA 1DRUA 3GPIA 3LVFO 4RDIA 5DZSA 1NX6A 2BMAA 3ZWBA 3NT5A 5JC1A 4WEQA 2I3AA 4L4RA 1E3EA 4E5PA 3CMMA 1ZSNA 1ZK2A 3PFWO 2JFFA 2W4QA 1R0KA 3DMTA 2TMGA 3ZN2A 1P9LA 4XA8A 1S6YA 2VN8A 4DBVO 1XR3A 3L6EA 3INTA 3ZNNA 3WG9A 3UICA 4ND3A 4HFMA 1HXHA 3KB6A 5B4TA 3F4LA 4YJGB 5KJEA 3FNGA 4WLFA 2YV3A 1X0VA 3KBOA 3KLMX 1YOVA 5C7IO 3X2FA 2IE0A 1SAYA 1D3AA 5K0ZA 2AA3A 1E0DA 1LDBA 3F46A 4HBGA 5JAZA 4I9HA 3GT0A 1DLIA 1EK5A 4O5OA 3GFGA 1ZH8A 4FGSA 3ADOA 1E7YA 4OYRA 4PLGA 3AY3A 3GVIA 1U5CA 4DL9A 4BKRA 2G1UA 4OMUA 2FP4A 2VRCD 2Q3EA 4I8XA 1LC0A 4Q3AA 3BTVA 3LC2O 4J9UE 2OL4A 1M75A 3H5NA 5ENVA 4BKPA 5TGDA 1Z45A 2OBNA 1IZ9A 1M2WA 3VH4A 2C5AA 4N5LA 4IDDA 3BYZA 3P2YA 4FR5A 3ETDA 5L4NA 1M66A 5A4DA 1L7EA 2GN4A 3DO5A 3ZGYA 4A7PA 2VHYA 3GVPA 1YDWA 3HWRA 4MVJP 3JQGA 4BO9A 4PLCA 1DBVO 4BNWA 4ALLA 2O3SA 3OJFA 2JAPA 1C3VA 1WXDA 3F4BA 3PYXA 3ITKA 1GUYA 4W9NA 3I6QA 2NADA 1WW8A 3CE6A 4YT4A 5IN4A 3JQFA 3QHAA 4J1SA 4WKGA 4II3A 1TB4A 3WTCA 1K0UA 1KVUA 1UDCA 1ZSVA 2AXQA 3JYLA 3QV1A 4DGSA 4GSLA 3GK3A 2QX7A 3K9QO 4G5HA 4J7UA 1JWBB 4RF2A 5BSGA 3ZCXA 4NNJA 1IB6A 2H63A 4IZHA 2C7VA 3DHEA 4FW8A 4YJFB 3T4EA 4JN6B 1DO8A 3GPDG 4D44A 4DLAA 1LA2A 4GPD1 1M76A 4UVGA 2CF6A 2NV6A 3LT1A 2VWHA 4A73A 4TKMA 1NFFA 4JBGA 4F45A 5MGBA 1ZJZA 2R00A 2JKVA 1G6KA 1TVEA 3VPFA 1BW9A 1Q2XA 4J4TA 1RM3A 4BNKA 3OSUA 4UUNA 4IGEA 1EEHA 3W8EA 2AW5A 5BSEA 9LDBA 4RJTA 1NBOA 1DOHA 2GZ3A 4FC6A 4BO7A 4DIFA 5L45A 3ONDA 2UVDA 3ST7A 1DRVA 4QQRA 3C1OA 4ID9A 5EESA 2OO5A 4KWHA 4XRGA 5A9SA 4DBZA 1P0CA 3MTGA 3TOXA 1TEHA 4MIOA 4FSHA 3OJLA 5I9NA 1Z7EA 1F17A 1T4BA 1LI4A 3MCVA 1UAYA 1H6BA 2Q46A 4D3SA 3RC2A 3WS7A 1VRWA 4MKXA 2XXBA 4ILKA 5A02A 1H93A 2CNBA 4F6CA 3G49A 4W4TA 2VHXA 3FPLA 2X0IA 2X5OA 4RV9A 3W6UA 1BXGA 2PV7A 5TLSA 2R00C 1YWGO 4IS2A 3H2ZA 1Z73A 4OOEA 3D4PA 1M6WA 3FNFA 3O9ZA 2I99A 5JDCC 4MVJH 3TZCA 4WLNA 4YDRA 1PZGA 3KYBA 2EKLA 2P9GA 4CM4B 4D79A 4RPKA 1HDRA 3U49A 4Y6RA 3G17A 3VTZA 1DIBA 2QRKA 3QVTA 4IMRA 3F1KA 1LRJA 3JD1A 4NHEA 4GSKA 2HAEA 4KWIA 1JTVA 1SMKA 4K28A 4OM8A 5HTOA 1EFKA 4UREA 4FQ8A 1K6JA 4U5QA 1VL8A 1Y1PA 1NQTA 1MX3A 4PLTA 1VKOA 1HWYA 4M86A 4BKUA 4LVUA 3L9XA 2YDXA 4YAJA 5A03A 3W4KA 3PJEA 2G82A 3ZI0A 4O1MA 1T2FA 1B7GO 2DUWA 3WBBA 2VWQA 3K92A 3K2EA 2PA3A 3U9LA 2J6IA 2YW9A 4A03A 3BHIA 5KCZA 3ZV3A 4IIUA 3OBBA 1KYQA 1E3JA 2GD1O 4KMSA 1YO6A 2PLAA 3UFXA 4LSMA 2HRZA 1HRDA 3EMKA 3K6JA 3O8QA 3ZV6A 4B8WA 3AY6A 4U0KA 5L4SA 1H2BA 3WFJA 2C54A 3BMQA 2VZ9A 4M8SA 3AM4A 4D0SA 1P44A 2FPIA 3N58A 5A06A 3GDOA 4DC0A 3GFBA 1DAPA 1CQIA 3TL3A 3P2OA 4OJNA 1VJ1A 3NGXA 3I6IA 2EKQA 1ZKMA 4Y6PA 1JN0A 1DFHA 1R66A 2PH3A 3GZNA 2QW8A 4R3NA 4RL6A 9LDTA 2E48A 1LLQA 1QYXA 4L75A 2BFAA 4XDZA 1L1FA 3CSDA 3Q11A 1P74A 2E82A 2NTNA 1LQUA 5KNLA 1SEPA 3RJ5A 4HY3A 1UP4A 1QP8A 3GY0A 5L40A 2O4CA 3VVCA 2OBYA 4BNHA 2H6EA 5JCJD 1Y8RB 1LLDA 2PK3A 1E7MA 3GAZA 1BDBA 3WYCA 2VQ3A 2I6TA 3WQSB 4IXTA 3NDJA 3KEQA 3I9OA 3ZU3A 3OJEA 2DFVA 5CG2A 5JDIC 2VT2A 2IRWA 3BMCB 5TRTA 1AUPA 5F21A 2YDYA 5IG2A 1NFQA 3CPSA 3LF2A 3AUSA 4JP2A 3OP4A 3LSYA 2ZK7A 1U3UA 3RCBA 3HQ4O 4IMPA 4J7CA 5ICSA 2YZ7A 2X5JO 4PG8A 4MVJF 4DYDA 1Q7BA 2BFOA 2CDCA 4BV8A 1A9YA 5H83A 2X5KO 3T7EA 4IXWA 4I1IA 4EDFA 4WCDA 1PL8A 1NVTA 1QRRA 3L9WA 1DC3A 1UZNA 2O3TA 2Y67A 3JCZA 4R5HA 5AXBA 4BVAA 3RI3A 2X22A 3ZWPA 1A71A 2B4QA 4L76A 5F3RA 1PSDA 4JROA 4ALNA 4FDAA 2C29D 1HDZA 3PYLA 4WCFC 2VTDA 3NDRA 3RU7A 2OHXA 3VPGA 5HS4A 4OO3A 4M55A 3I9KA 5L4LA 3HFGA 3Q2KA 3FF4A 1D8AA 4OQZA 1I3LA 1DFGA 5AOVA 2I3GA 1YBVA 3DAGA 3RASA 3WGGA 3U62A 3ETGA 1RPNA 3CUKA 4W99A 2FHSA 2X1HA 3I5MA 2B5WA 3DHNA 1U8XX 1JAYA 2YY7A 3ROKA 2VUUA 4HNGA 4HV4A 1HDCA 3IMFA 4RQTA 4MP3A 5DOVA 1GCOA 4RPHA 1LU9A 4KUEA 4MIEA 3O4RA 4R69A 1NFRA 2FRDA 3GEGA 3LC1O 1BGVA 4P4GA 3EC7A 3NUGA 5CPFA 3QVXA 3OJOA 2DT5A 3MZ0A 4ZD6A 4C4OA 5GZ1A 1J5PA 1VSVA 2JHGA 4CUZA 4AFNA 1UAGA 3NTQA 3D1LA 1XQ6A 1YDEA 3O8QB 3DFUA 1ZEMA 3GEMA 4FS3A 2H1SA 3D5TA 2BGMA 5L7TA 4B8ZA 1LX6A 1E3WB 2VZ0A 5T57A 4CJXA 1O89A 1L7DA 1HLPA 3VPSA 3WWYA 2DTXA 4ALKA 4BO5A 3PXXA 1EVIA 3PZBA 4YB8A 4WCFA 4XB2A 3H3JA 3EAGA 4PVCA 1Q7CA 4CMGA 3CKYA 4CV3A 2Y93A 4NI5A 3PVZA 3RJ9A 3SXPA 3F5SA 3E82A 3WX0A 1J49A 1ZJYA 1YRLA 2NVUA 5TC4A 4Z9FA 2VYVA 1WMBA 2PZJA 4BB6A 5GY7A 2CVZA 3ZWAA 4I5GA 3GZ4A 4E13A 1XCBA 1ZFNA 1RM0A 2PGDA 3F3SA 5A04A 4MJLA 4YBZA 3PDUA 2HMUA 4PLHA 2CSUA 3DMYA 1UJMA 2VOJA 3GGGA 4TRJA 4CQLB 3QE3A 3Q9UA 4Q3DA 2E6UX 4IJWA 2ZB4A 4XGNA 4CMEA 3PHLA 4NMHA 1DAOA 1YQXA 3DBHB 3C3XA 4NQZA 4YQZA 5TX7A 3WB9A 5IF3A 1MXHA 2YQ4A 4OOFA 4GLLA 2FR0A 1SPXA 1A7AA 2HK9A 3KUXA 5A9RA 2X9GA 1BSVA 3TF5A 2BLLA 1B3BA 5DULA 5IZCC 1D7OA 3ZU4A 4P4LA 4RLSA 3OA0A 1E3IA 3GDFA 1A4UA 8LDHA 3LF1A 4YA6A 1QG6A 1Q7GA 4BV9A 4UVIA 4XWYA 4PRKA 2O50A 3L4BA 1DHTA 1HETA 3KRTA 1XG5A 4TVOA 2WM3A 3E6AA 3AFNA 2RHRA 5C3MA 1R4NB 3L4BC 3GAFA 5U1PA 3UKOA 3ZW8A 2BGLA 2Y0DA 2Y0EA 2ZCUA 1ZCJA 2IEDA 2O23A 1DC6A 3E18A 3ZW9A 5G0TA 3PZRA 3I9JA 2X58A 4AJKA 2GO1A 2EGGA 2GZ1A 4CPDA 1ISFA 2GF2A 2NLOA 4ZQEA 2OZPA 2Y1GA 2QQ5A 2DU8A 2HMWA 1N5DA 1C1XA 1E1MA 1LDGA 4IPTA 4BNVA 4U6QA 4NR0A 4JJIA 2PKQP 3KSDO 2E37A 4OSOA 5G4LA 1TT5A 4J0EA 2AQIA 4PIVA 1N7HA 1T2CA 4ND4A 3ANLA 4XQCA 4YAGA 1ZUD1 3AUUA 4KQXA 3CMCO 1NWHA 1WAMA 5ILGA 2H9IA 3LC7O 4XRRA 5A3JA 3S8MA 3PHGA 4BNIA 4CLOB 4K9DA 1ZK1A 1A5ZA 3H9QA 3S2GA 4BQRA 3TZQA 4YJDA 3CZRA 3GRPA 3O03A 4FB5A 3P5SA 3PIDA 2B0JA 5ER6A 3WBFA 2BI8A 3PIIA 2TMDA 1N92A 3NX4A 3U4IA 3FN4A 3QY9A 3ZV4A 4DREA 1HDXA 3RU9A 3LT0A 3GG9A 1V9LA 4KUHA 1U7HA 1XEAA 5A3VA 1J4AA 5BNFA 5LCXA 5HBRA 1GUFA 1MV8A 3V2GA 4NJMA 4JJGA 4XDYA 4WLVA 3LK7A 3UN1A 4LN1A 2Y66A 1ISHA 4J1QA 1PGPA 5JFOA 2HK8A 4RF5A 3LQFA 5JAIA 2NWQA 3HN2A 3WDSA 1DJQA 1IUKA 3BMOA 4Q3EA 5G4KB 4CM9A 7MDHA 4RCVA 2PR2A 3WNQA 3GNSA 1PR3A 3B20A 1P33A 1GD1O 3K5PA 3BA1A 3E5RA 3ZV5A 1CEQA 3WGHA 2PD4A 4BGVA 3C7DB 4GL4A 1MGOA 1UP6A 4GX0A 1VM6A 2VT3A 2QZZA 1P1KA 3DBVO 3BXXA 1LDEA 3BMCA 3PTZA 3WMWA 1WPQA 3TL2A 1QYWA 2J3IA 4BO8A 1ONOA 3A14A 3E8XA 4UEOA 1LSOA 1IY8A 1C1DA 3BHMA 2DM6A 1NPDA 2ZATA 5B37A 5U9CA 3RD5A 4TMFA 4HADA 3TJRA 2A35A 4YT2A 5KJ1A 3PWZA 3M1AA 4HNHA 4QFDA 3WIEA 5CP8A 1ZXBA 1ARZA 3MEQA 1UXJA 2Q2WA 1GV0A 2FOIA 3KEOA 4H3VA 5I8WA 4WLUA 4Y8VA 4W6ZA 4PG5A 4E5MA 3KTDA 2QYSA 3OQ6A 3VOSA 1EQUA 1PZFA 3SLGA 3UUWA 1I3KA 4XEHA 1ID1A 4YJFA 2VHZA 3GZNB 2BELA 2LDBA 3I52A 4Y9DA 2B36A 3DAFA 4E31A 1U2GA 3MTJA 3L4SO 4N54A 2ZTMA 4UAGA 3I83A 3H3FA 3JQFC 4XJSA 3HDQA 3ANMA 4GGOA 3ZNQA 1B8VA 4DPLA 4AJLA 3W4JA 1LRLA 2W98A 3LYLA 1A4IA 3I23A 1PS0A 1TLTA 2NQ8A 5L7YA 3UCEA 4CV2A 2W2LA 4R51A 4EGFA 3WGTA 4Z9XA 1NPYA 3GC6A 5FI3A 3VH3A 2I5PO 2PWZA 1K2WA 1GZ6A 2XAAA 3ROMA 3JQ6A 3L0DA 2HU2A 3GVCA 1CWUA 3WGZA 4MVJG 2V6FA 4PN3A 3AW9A 1QR6A 3B1FA 4J2HA 3GUCA 4R4JA 4E12A 5IZCA 2O2YA 3WNVA 3DZIA 4Q9NA 1ZZEA 3PLRA 4CL8A 3FWZA 1I10A 1XQ1A 4MVJD 1F8FA 2X0RA 1DB3A 2YJZA 4ND2A 3JD0A 3UW3A 5BSHA 4BL5A 3QWAA 1ULSA 2DTEA 5K6AC 1I30A 4GMFA 1ADGA 1YL6A 3GMDA 1WWKA 2B4TO 4BQPA 4XIJA 4CLRB 2GN8A 4XQGA 4A2CA 4ZU3A 1YE3A 1U1IA 1V3TA 4IQ8A 4UVHA 4ZRNA 3IKTA 1Z74A 2Y68A 4RVGA 2I76A 3JQ7A 3K73O 4FFNA 4BOYA 2YHIA 1ADBA 4ZGWA 1U5AA 3GHHA 3FI9A 4AJIA 2FMUA 3AK4A 2RH8A 4KUGA 2EEZA 4YRDA 5DP1A 5FFFA 5G2OA 3MJVA 1XU7A 4EBFA 3ROPA 3E5MA 1DFIA 4YJGA 4XCVA 3DAPA 1HE3A 5CFZA 3JV7A 2IXAA 1T26A 3NT4A 4RVUA 3T7CA 1HSZA 2HLPA 4CQMD 2Y1FA 5EINA 2DBVO 1A72A 5A9TA 3C1TA 2YHIB 2EJVA 5CAEA 1XDWA 3NAQA 1N8KA 1ISJA 1MP0A 2ZKLA 5IJZA 1NP3A 1ZXLA 3D7LA 4DMLA 1ISGA 2QZ9A 4BKQA 1UH5A 1PZHA 4NBVA 1QXSA 5HS6A 3G0OA 2FY8A 4RPGA 1YQGA 4I08A 1AE1A 2EF1A 3JYOA 4R3WA 4GAEA 4WOJA 3DDNA 4ZN6A 1EVZA 1ZBQA 3D3WB 4CM3A 3WXBA 1X15A 3AU8A 3SVTA 1U4SA 2BD0A 3PLNA 5JDCA 4IBOA 5G0SA 1Y8RA 4XYLA 4RDHA 3HB5X 4CMHA 2EWMA 2O3UA 1EBFA 3U3XA 5KTKA 1KVTA 3GDGA 1TT5B 2C5EA 2OXIA 5HRUA 1QYCA 4J9VA 1FDWA 1MA0A 3BAZA 1BWSA 1PQPA 3ANNA 4JIGA 5EQDA 1HE2A 5JE8A 4AJJA 2RBEA 1LQTA 2GNAA 4OSPA 1DJNA 4CMEC 4YVFA 4CODB 4ZJUA 1I3MA 4YCAA 4RF3A 1S7CA 4WASA 3PP8A 2BI7A 3OA2A 4FD3A 1VJTA 2HMVA 1GAEO 1E1NA 3AOEC 3KV3O 1VL0A 4N5NA 2C0CA 5THQA 2AE1A 2QYTA 4M54A 4XJTA 4KTTE 3IUPA 1HYEA 1NQ5A 1WP4A 2G17A 5KVSA 1E6UA 1H94A 3PHHA 2X0NA 1R12A 3BTUA 3L6DA 4AJOA 4B7UA 1PJCA 3SC6A 4MINA 3H4VA 1UZLA 3SC4A 4TRMA 4TZKA 2QG4A 4YT5A 1XHLA 4FJ0A 2QIOA 1D1SA 5B4UA 1AGNA 1BG6A 2VYNA 1B3RA 1K6IA 2EIHA 2W2KB 3TRIA 4E4YA 5L95A 4MVJM 2HSDA 4CV1A 4EUHA 1F06A 1BVUA 3V2UA 1KEWA 1NTOA 3RQSA 4ZQHA 4OKIA 3KO8A 4J1NA 1LSUA 1LJ8A 5COAA 5TSDA 2ZIZA 2HK7A 3V2HA 1KIFA 3FPCA 1ENPA 4AJHA 4MP8A 4P4NA
chains in the Genus database with same CATH superfamily
4BNGA 4Z6KA 4IF4A 4LJSA 1EVEA 1U2DA 3UK2A 3F9RA 1N6KA 5DDIP 3VU1A 5HRAA 2R85A 3ED1A 3K1YA 3IVCA 4GIBA 3DFIA 4JBNA 3UGTA 1O8CA 2JK0A 5KMGA 5JNSA 1LLFA 1L5VA 3HYTA 1ZIDA 3MQ4A 4KK3A 1YE5A 2HGSA 4AN4A 5C7LO 2GHTA 3OTOB 4OB8A 4RVDA 1GGEA 3L8CA 1EIWA 1KK1A 3Q7SA 3O1JC 4ZZIA 4B4UA 1H2YA 2WWFA 2JCGA 2ZREA 3EEBA 3H5IA 1X7WB 4IWXA 3MXTA 4CEJA 4GR4A 3ADPA 2GN1A 4B2PA 2PGLA 4A5SA 4DJTA 1JGTA 1P81A 1XRSB 3DOFA 3NIWA 4B47A 2J87A 4MO9A 1ZVVA 3ZV7A 3HJRA 3UFXB 3ELBA 3AHGA 3AV0B 2D5CA 4TUYB 4A6EA 2EG5A 4JITA 5J43A 4CIWA 4HI0E 3RABA 4KQJA 5F9FA 3ZJYA 2O8DB 1X7HA 4GP9A 4JBXA 1EFPB 1M34A 3VHRA 1N0HA 1VC2A 1EWKA 5ALTA 1YKFA 9ATCA 4M9UA 2XNHA 2RBGA 4CDNA 5CB8A 1WG8A 5JXHA 1QGDA 5FDFA 3HE3A 5JLJA 1PSZA 1T5TA 2AC4A 3AC0A 4UM9D 1HT3A 3C1AA 4TYPA 2QTFA 4DN6A 1EG2A 2PGAA 3TRHA 4DDVA 4G9EA 1B4DA 4WZ6A 4LJKA 5D3MA 1M7HA 3VFDA 4E2WA 2GYVA 2P11A 1GU1A 1QHXA 2VHWA 2JRCA 3C6XA 2QQ0A 4FFBB 3QWFA 1L7MA 3IA7A 3M83A 5ALDA 4QLBA 1XIVA 1FW6A 2TRSB 1Y8AA 5TV2A 3GJ4A 2X4DA 3ORRA 3WNDA 1P9RA 1NNUA 4INAA 4M1MA 1BYUA 5E4JA 3P0HA 4I3GA 2VRCA 5ITSA 4G1MB 1ETUA 4UU1A 1EUDB 3RVJA 3D4IA 4DLLA 2PZAA 5ITVA 1BXKA 4YFVA 4HO1X 1OILA 1UKYA 4UCFA 4R9SA 2P9CA 2Y2UA 5EL0A 5JD4A 3CRZA 5J4VA 2BKLA 1P2BA 1TC1A 3R4CA 1OX4B 3C3EA 3A4YA 3TG2A 4KXFB 2CZGA 4UTRA 4WK4B 3T15A 4IIYA 2HY7A 5LQUA 3ROXA 1UBLS 1XZKA 4ZPXA 1AOXA 1GTMA 1SVKA 2ZRMA 4L0CA 4B4WA 3DTYA 4DLPA 2XUDA 5KTOA 3QTBA 2WIDA 1N6RA 1N25A 4QRHA 1GA4A 3ND5A 2VK2A 1C0LA 4YO8A 5AVOA 3TOVA 1NHWA 4EJMA 2VDWA 3G13A 3ITDA 3KXPA 3M6XA 2OK8A 3DKVA 2OXRA 3NBYC 2FLVA 1TMOA 4DJAA 4Y9RA 4FGLA 1DX6A 3F6PA 2A67A 4WJZA 4EK9A 2G77B 4P4TA 5JNWA 5EP2A 3R7AA 1XF1A 4KW7A 4NBTA 1H5QA 3ZDYB 2ZM6B 2EYQA 1MTOA 2Z2XA 1AK2A 3ZDFA 5ECYA 5THKA 5CJPA 3LWDA 2W6IA 4BO2A 3MD9A 1P4RA 4E2YA 3IQDB 2OHOA 4LS3A 1W5SA 2B1QA 4QHTA 4C3ZA 4DPKA 2J0QA 4UBKA 3TQQA 3G2MA 4D81A 5JNUA 1IEWA 3IR6A 4QUKA 9ABPA 5GOTA 4NECA 3NJ8A 1NLMA 3OJ0A 3WO1A 3E27A 3NIDB 4X94A 5DWDA 3RC1A 4ZVSA 1D4FA 1PWXA 3QYAA 2ZE6A 5F7XA 3K9LA 2FPMA 4AK9A 4E09A 4ETNA 2DCUA 3KLPX 2CJPA 2QVGA 2WJHA 1LS1A 3I53A 2P5YA 2QIPA 2ZFUA 3D02A 3QFTA 4FHGA 1K8QA 3L7BA 1H9CA 3KKMA 4MW0A 5L3VA 4CR6A 1SR8A 3CR8A 2IPLA 1RIFA 4GLOA 3RYHB 3NTRA 3S2EA 2XKJE 1FDTA 5B3JC 1SBYA 3JQRA 4D3DA 4NCHA 2CVHA 4F84A 1DCKA 3W5VA 1USWA 4D7AA 2KPOA 2PMBA 2Y1CA 3OMWA 5K4GA 5CCEA 3CG4A 2C9CA 5KQLA 1WF6A 2MYPA 4OJTA 1DADA 4N03A 2YCBA 1KH1A 2Q4OA 4X92A 4N0EA 2OPHA 4EHIA 3WJAA 1CJCA 1X39A 3HCOA 3EVNA 2P6NA 4KLCA 3C3CA 4RSMA 1SKMA 2AFHB 2L19A 4OIMA 3L0IB 3R7SA 1YS6A 4M7PA 2KLHA 3R9WA 5AUOB 5EJ7A 3I9MA 4UBIA 4P8RA 1DKQA 4E6PA 2NO5A 5JCOC 5AKHA 3JW8A 5CDGA 3PE3A 4LFBB 3TZKA 3SM3A 2VPTA 1YDFA 2I22A 3HBLA 4E51A 5LQAA 1SJ9A 2B8WA 3WLFA 3D7KA 3DYBA 1E2QA 1AK1A 1ISSA 2DC1A 3BWEA 3EVAA 3KR1A 3LQYA 3NV7A 2QRQA 2EJUA 3NKLA 4O2BB 2IPMA 1Y63A 3FTPA 1A95A 3OOWA 4V0KA 4JLWA 4X0EA 1N9ZA 5DRTA 5JAQA 4YMLA 3IKJA 1Z6ZA 3KVOA 4MGHA 2A9KA 1X1RA 3JQCA 3RT1A 1EX9A 4JC8A 3NH6A 2QVBA 3H1GA 3LFTA 1HQYE 4MLDA 1RYZA 2FP4B 4B79A 2W48A 4UM9B 1O4WA 2WE8A 2Q2NA 1GGMA 4OHUA 3MBOA 3Q6NA 5CM9C 1ECCA 5FTLA 1KSGA 1LDMA 3RRXA 4A26A 4ZMRA 1GTL1 1O6CA 2IEBA 3O7MA 3VR0A 3I45A 1LPBB 4IKPA 5TQ2A 5JECA 1P72A 2H07A 1IIRA 3FMFA 3A6HA 2QMHA 1YSCA 4HVAA 4JI1B 1JS1X 2H5EA 3K2IA 1R18A 4KH0A 4KRXA 5CR9A 4L85A 2GSWA 3G2LA 3I62A 3MWLA 4N8DA 4P32A 4TWZA 1QTNA 3VAYA 2CDRA 5ICGA 5FWNA 1U0RA 4TZ0A 1DRWA 3AR5A 3RR2A 1XMJA 3ZWCA 5L53A 4YXWA 2E3JA 3ZZUA 3SZRA 2BHLA 4KQ6A 3AYZB 2IXTA 2Q5IA 2QG6A 2W9XA 1BFDA 1F8GA 2GN9A 3BILA 3DBLA 1J21A 1X7ZB 2PAAA 3I8SA 2UYYA 4IX9A 4YMTA 1U4OA 1MOQA 4OLHA 1GL9B 1JU9A 2WG1A 3VR3D 2D5BA 3C3JA 3JTMA 2AKAB 2XJ9A 4XH9B 5KPJA 1KEUA 2FPPA 2AWNA 4GQAA 5EE9A 3LIPA 3EPJA 5AD1A 2RGYA 1GFSA 3BD6A 4QELA 3R0IA 4RIHA 4BAGA 2ANCA 5AVTA 2BZ0A 1A9ZA 2K7ZA 2D0PB 2DJ5A 3ABIA 4HNAA 1DX4A 4N82A 4ND8B 4E4RA 1SVWA 2EJWA 1RMQA 4ZQFA 2IH2A 1CRPA 3MWDB 4U39A 2PIDA 4V38A 2I78A 1AGRA 1V35A 2Z9DA 1ANKA 3G0DA 4OTZA 3HN6A 2VF2A 4UUPA 3LBAA 1QKIA 2PSDA 3D7RA 3PR2B 1YL7A 4JBIA 1CUHA 1XK7A 3ND8A 2PUEA 4M7WA 3M70A 1J8MF 3PQ3A 3KJIA 4S12A 4U9IS 3DD1A 2PX0A 1NUHA 2DR0A 3DOOA 4DGQA 2O07A 5I4KA 1J00A 4PC3A 3WLAA 3ZWYA 4F86A 1KNQA 1VCOA 4RJJA 1YQEA 4ZI2A 1E9VA 3ESQA 1JU4A 1SKYB 2AG8A 3IXLA 3MGGA 3HDYA 5B6JA 5E9QA 5I9LA 2CDAA 2NVWA 2GKSA 4HYQA 1NG1A 4IVNA 2PG3A 5H16A 4N5HX 2QPAA 2QK4A 3EDYA 4GXNA 3AV3A 5AM3A 1J8FA 2G5CA 3IR5A 3L0ZA 1CDZA 3ICCA 2IIBA 1RKUA 4ZAVA 3DXZA 4QYMA 5AIAA 3VH1A 2QN1A 2WB2A 4LJ6A 1RWPA 1ZOPA 2AR7A 5CFOA 5IVPA 4GYKA 3GLFA 2HA0A 1SQ0A 3RUCA 3NTOA 1YQWA 1SN7A 2O57A 4RL4A 4IMIB 5COQA 4Q34A 3L04A 4Y2RA 1GL3A 3ZCSA 1C8LA 1V3UA 4DLSA 1NXOA 2X2EA 3EHEA 4I50A 4NCNA 4S3MA 1G1MA 1W5EA 3ULKA 5KYXA 2Y1EA 3GRRA 4B9EA 4CN9A 2PS3A 2YWJA 3NETA 4DQXA 2B4RO 3RFFA 4JA0A 1J8VA 2ZBVA 1HC7A 2PWAA 4YO7A 3JSXA 4FOPA 2CHQA 3RRFA 1HNNA 1NJ8A 2ZJFA 4HGQA 4Q82A 3RIGA 4DLBA 3H9CA 1PV4A 1XTZA 4Y9UA 3DM9B 1V95A 4TGLA 1G8AA 2I3ZA 3B1KA 2ZRBA 3VR5A 1NW5A 3KQMA 4XGIA 2VAMA 4EW2A 3Q98A 2AOWA 3U61B 1P8AA 1RXEA 1X8LA 4LJ9A 5CXXA 5AKZA 1VZ3A 3WSWA 1K5HA 4QVKA 1VG9B 2I62A 4LHVA 2QUHA 2ZYGA 5FOXA 2CJWB 1CP2A 3CIFA 1RLTA 3OOJA 2QLJA 2VQ6A 1H69A 2YFKA 5AH0A 1KERA 5JO0A 2BI4A 2PANA 4PRYA 3IVRA 2OV3A 4TXNA 5JADA 3GT7A 5DHPA 4TL6A 2PUFA 1TT7A 3AI2A 2R6HA 3HCAA 4R0VA 1KI8A 1BXZA 2D2IA 4NFSA 4ZJZA 2XRZA 2PV0A 3QX7A 3C4JA 3VISA 3RE1A 3U7HB 5C8VA 1F8YA 1AN9A 4LISA 1DUIA 3OM9A 4G0XA 2VYVD 2GESA 4BNDA 3GLSA 5KPDA 3DL7A 4FJ2A 1LTHR 3IOCA 3PNOA 4TT8A 1JEJA 2BFPA 3ILSA 1QHEA 2GLXA 3RBZA 4DZZA 1ZC4A 4OB7A 2JZNA 3BBLA 1Y6GA 2FR8C 3K8ZA 5LXTB 3HU5A 3RIHA 3B6IA 5HUHA 1KI1A 2JIOA 2B35A 1EFHA 3GD5A 4Q9HA 3TW8B 1QU3A 3ABRB 3EEQA 1MU0A 1U2EA 3UJNA 5DGDA 4FMDF 1H2AS 1BMFA 4H27A 4WFIA 4YMSA 1G8GA 3WZLA 621PA 1MC4A 4IDBA 4WTOA 1IYZA 2VR1A 2XMPA 1VIDA 2DG2A 3QLJA 1ESZA 1JIJA 2P78A 5IXSA 2WTEA 3S7TA 4E21A 1YK1A 4AKSA 5GZ3A 2ZRQA 2R6JA 3TBKA 4Q4DA 4FYIA 4S1WA 4KV9A 4CMIB 2PMEA 2JFUA 5E3IA 1JDSA 3LQRA 4RZ3A 2K7FA 1SZPA 1CQXA 2XIQA 4LYAA 1PUIA 2QSYA 3RSGA 1NZDA 2H85A 3GA5A 3PUXA 2WUDA 3T0GA 3ZHZA 1ENOA 3ZHQA 4BO3A 4CLHA 2CJFA 2GHRA 3ABZA 2RC5A 1KRWA 1SG6A 1QOQB 4G8CA 4QOEA 5G02A 5FH9A 3Q9NA 1U3TA 4QO8A 4C7XA 2XMDA 3F3YA 3QKTA 4QU5A 3UOGA 3T3DA 2IBMA 2R8XA 3KQYA 4OHMA 1E2FA 1HYGA 1SC3A 3EZ7A 5K0LA 3I5XA 1TEXA 1IRXA 1JKJA 1XT6A 5AIBA 2IHJA 3T1NA 3HO1A 2YMQA 3UT0A 5JJIA 5JSYA 2H57A 3QPVA 4I19A 2C3OA 3OQBA 2CXNA 3FYDA 4HDRA 5DI3A 5EUBA 4AL4A 1VRVA 2LKCA 3KZ1E 3QUAA 4LDNA 2PXHA 2JEYA 4JDUA 1NNI1 1CC1S 4Y1FA 1KI6B 3RVMA 3UT6A 5CDYA 3DZCA 3TCXB 1LEHA 5GIPE 2GDZA 5LMUB 5TF0A 4ZU6X 4DT1B 2QLLA 2O8FA 4IIVA 5CEEA 1S9HA 3I05A 1W73A 1AHHA 2CN1A 1NRIA 3HUDA 2J3DA 1C9JA 1LBHA 1QFXA 2CNWA 4ZICA 3K05A 2ANBA 3PITA 3GNTA 3RSSA 2I0FA 2PZLA 3E5NA 1TW3A 1H1DA 1HL3A 2AZMA 3K6RA 4G5QA 4OL0A 3V9AA 1QRUA 5BR7A 3F74A 2WD9A 1CZOA 1XZDA 1ZIPA 2P4QA 3UA4A 1JEYB 3T99A 1WU7A 5JYEA 2BEVA 1CFJA 1YI0A 4DDHA 1Z5OA 3EFEA 4Z54A 3LYUA 2B98A 2PJUA 4HWKA 5LC1A 4XPIB 1FRNA 1M8KA 2ID7A 3CLRC 3OMXA 1JH8A 1NJ1A 2FW9A 4KN9S 3IV9A 1JEEA 4IAOA 3Q8LA 4UD6A 3FSJX 1JVNA 2WE7A 4BFCA 4TSFD 3PXGA 4TTTS 1YBMA 2ZR0A 3GCZA 3AL2A 3EDCA 3O26A 3QMWA 4PO1A 3NOXA 1BOFA 3UUFA 3TIGA 1MB4A 1UZMA 2H54A 1SHLA 2X7HA 5IC4A 4AMVA 3TZHA 1NLFA 2DRIA 3IKVA 4YJHB 3CUYA 2VPYA 1JT2A 2IU0A 3AIOA 4RY8A 3RVDA 4E2XA 1EVLA 3B8EA 4EYGA 4YQFA 2CNOA 3V4RA 3IAHA 4AYWA 4FDTA 2Q7XA 3PC6A 3F90A 3OIDA 4GT1A 2FZGA 1GADO 1E79A 2FMFA 3EXIB 2G8NA 3IE2A 1OH7A 2RGEA 2BHSA 3DE0X 3EG9A 2C59A 3W5IA 4CUKA 1UBOS 2YWDA 1E5DA 3U16A 1PDWA 2BSQA 3ES9A 5JO9A 3O74A 1TW2A 4I1RA 1O7JA 1JH9A 3EYAA 2KB0A 2J0VA 2JBAB 4OGWA 2BP7A 1PN3A 2PAFA 4UULA 1XRLA 3W34A 3RS3A 4KG7A 3WBJA 1LSSA 3BDIA 3UF0A 4DQKA 4RWEA 2D00A 3IB6A 3Q9SA 3FJYA 1GGKA 2BE9A 4RAQA 1Y48E 4L07A 1HO3A 1V8BA 2IODA 2ZWIA 4NL4H 4ZANA 1GU7A 2QNBA 3MTIA 2F59A 5DGIA 2P1ZA 3RBXA 1D8TA 4ZCRA 4ZHQF 3EZNA 3EDOA 3LJKA 2HMSA 2GJ8A 1HFJA 1TZ2A 2DSTA 3CJQA 3NTUA 4QWMA 3NDPA 1VHDA 4RKRA 5JH7B 1YR8A 4ZT2A 1PF7E 2GOYA 4RQUA 4X84A 1PT6A 1SXGA 4YUWA 2XE6A 3NHRA 4IP0A 2EBUA 2PL5A 2COEA 4GMHA 1B74A 1P2GA 4PQYA 3HY4A 3JZIA 5DIFA 5BSFA 2QM8A 4J91A 3RQIA 3BWBA 4EPRA 1EVJA 1YZNA 2C04A 3IEUA 2OBBA 1FS4A 4FFRA 4BX9A 5KQSA 2QTZA 3KKEA 3I2IA 3OU7A 1VPVA 4O0LA 4FOOA 5FI5A 5ALLA 2E4AA 3ORQA 3CVWA 4FZ3A 1WHSB 2B2CA 4F3NA 2FR8A 4G1FA 3ZHYA 2B8TA 3NB0A 1YHZA 2MMCA 4YDQA 4V1CA 2JEZA 2W4MA 1UZUA 4FMBB 4NU6A 4HBZA 2D7JA 2ILVA 2F55A 2FN7A 2IU4A 1C7RA 2O1XA 1H6AA 4EB8A 2C4VA 3AJEA 2QVYX 1GDTA 4AICA 2HF2A 3WFZA 2XNDD 1NQAO 4BPBA 2ZUVA 4RCZA 1K8YB 5I9TA 4AB1A 1E2IA 2YUIA 2GNPA 3V3KA 2IWRA 2FSGA 3I76A 1KH2A 1W36B 2DE0X 2RAUA 4Z4CA 3FSRA 1T2EA 1OLUA 2VG8A 1Z4JA 2XIJA 2ZUDA 1XRQA 3N8NA 1CYDA 1HT1E 3E0XA 3RTCA 3WQRA 5B3KA 3KFXA 3DLHA 3O0DA 1GCIA 5REQB 1B00A 4BO6A 3R6GA 4KVGA 5IKPA 4UJ3A 3MD0A 5BV2P 1JG7A 2Z8XA 4G2NA 1L5OA 3JVVA 2VTBB 2B7LA 4Z99A 2YCLA 2ZJYA 5KNDA 2BCGY 1F2TA 1U7TA 2IYNA 2FQQA 2ZRGA 5AVSA 2HA3A 4PFJA 3MJSA 4L4ZA 5IDWA 3OX1A 2V96A 5FBKA 5DBGA 2YC2C 4MK4A 3OE7A 2X7XA 4E11A 4NJEB 1RJDA 2PKQO 3I04A 1OYWA 1FSPA 3ADDA 3R5XA 1UMCA 3PXBA 1ZUHA 4GMGA 4O4IB 4E5DA 2WI8A 2OBLA 4YCBA 5EUMA 1Y8CA 1ZRHA 4NH0A 3KPVA 4MZXA 4BNLA 4KJXA 2P2ZA 3X44A 3OICA 1ZEJA 4GVPA 4K6CA 3O47A 4BP1A 2OYRA 5I01A 3QFCA 3ZE9A 4X97A 4ZYYA 4MYRA 2ZUWA 2AHOA 1IJBA 5AKJA 2XBLA 3C3BA 1ZKDA 4BJ1A 3GARA 4DWJA 5HKAA 2AMFA 5BUZA 2IL1A 2FUKA 3D8SA 4CM1A 3P20A 3JQ8A 1X9GA 5BUCA 1RE1A 3DQPA 2Y1DA 3PRJA 2HCBA 3LBHA 4CM8B 3U7QA 2SBTA 3N5CA 2WWRA 3ISTA 4IX1A 4X20B 5FTJA 2R25B 4G0WA 2QTGA 3SZGA 2GAJA 4HDKB 2Q5LA 1VA4A 1YQUA 4V3BA 1DC5A 5AK4A 5BQ5A 3ER6A 2NO4A 2PPLA 1ENZA 4Q01A 3WIBA 3UMYA 3ZJVA 1KC1A 4F3TA 1CEYA 1E6LA 5MN4A 4E08A 3KXDA 5I5GA 4I4CA 5AI0A 1ZZGA 5C32A 1UEJA 2V58A 5I45A 3AFGA 5IHPA 5IRCD 2GPTA 5EJEA 3AG5A 5DEOA 5FF9A 4U6SA 4AVYA 2GFIA 4IIFA 4UQOA 3KFLA 5FJIA 4EZEA 5JS8A 3D8RA 5ALSA 3WMFA 4CCSA 1XXHA 5EEHA 1VPDA 5JQGA 5FAKA 3O8DA 3F6YA 4KCGA 3T7AA 2QBYB 1PJZA 4G5RA 4JT2A 4KWTA 2ATIA 4DMHA 2Q0SA 3A9UA 3UAZA 2GD2A 3ZKWA 5AOCA 1W2HA 5IABA 1JHUA 2ZBUA 3FCOA 1PIWA 1RCUA 2KSQA 3B5IA 4IHAA 1QG4A 2RC6A 3A9SA 4QHSA 3H42B 3IT0A 4UTXA 2Z1MA 4JENA 3ANXA 2FOLA 4AS2A 1U2TA 3B53X 4I4TF 4L5IA 4NMLA 4G0MA 5H81A 3EW9A 4J7XA 2RHOA 3BWYA 1M2VA 1YR2A 4HRXA 4DG5A 2PUJA 3NPAA 5PNTA 4EKNB 1U7WA 2HPHA 3DKRA 3ENKA 1NURA 1VHQA 3KLBA 3OLXA 1V2GA 3HXKA 4UZEA 1ZMOA 1XTUA 1A2KC 4IWNA 3R7BA 1W2GA 3ERCA 1NUSA 4QTZA 4S05A 1J2YA 4QXAA 5FBLB 1ZAKA 4ZCQA 1NMZA 1C0IA 3ZD8A 3AVWA 2RGNC 5K8LA 1Z4NA 3A31A 3REGA 1O0BA 1G2OA 4HSEA 2YHBA 1WVMA 5AW4A 3A26A 3HKEA 5JRDS 2P77A 1FDUA 4HHEA 1E4VA 3N8GA 5JRJA 4QT4A 4O08A 3UT5A 1A9OA 3HFSA 3BIOA 2BH2A 2IOYA 5DTRA 3RKRA 2J0EA 3FF1A 1RKVA 3R9KA 1GPAA 1MVOA 3WNBA 4QXPA 3WR5A 2NAFA 3KETA 2ATCA 3HPRA 3QUBA 4RV4A 4Z9BA 4FIDA 1X8XA 3FPHA 5LYJF 1DQPA 4UEWA 2P2YA 2NZWA 1MN6A 1FNSA 2XYRA 3PQ6A 3GRYA 3HYLA 1RFLA 3CF6R 3RDPA 3U4QB 2ZE7A 1O1YA 3M6LA 5TEVA 5A5FA 2F9LA 1BCRB 3KOUA 1WJGA 4G1UC 4M83A 4MKHA 3TIVA 2Y99A 3W4IA 4RORA 1LNQA 1X7GA 2LUOA 2JIRA 1QO0A 2C2MA 3SICE 5IWAB 2IUYA 1JLRA 3FI0A 1WDKA 4G9GA 4IZOA 3V7WA 1VHTA 2F2TA 2YWCA 3HFJA 4U3JB 2AT1A 2C2KA 1COZA 2I6FA 4ZARA 2APJA 2G6TA 3T7JA 3RS5A 3SZ3A 3F6RA 2YN2A 5CMLA 3SAJA 1GQSA 3P0IA 1LXCA 2CKDA 3X3HA 5DSXA 4MR7B 4QYWA 2OCXA 4MW9A 5A1TA 3U1TA 5DM70 2NNWB 4UTZA 1NGSA 2Z4RA 4IV0A 2NUTA 3EIEA 2CV2A 4C43A 2DPHA 3K5WA 3HH8A 1Z3CA 2V9ZA 3WSVA 5AVRA 1IE3A 3TK1A 4R41A 2WHRA 3GP5A 1FXSA 1HT2E 3ASUA 4FEYA 4RU1A 2UUBB 4JC0A 4HTAA 1FTNA 4FFOA 3TVTA 4L4XA 2VJNA 5AVVA 5M04A 3K32A 5KWVA 1SQ5A 3R3XA 2ZWAA 5IDVA 4V0SA 2DLDA 5H5JA 5JTTA 3UH0A 5FA8A 1CRZA 1TOAA 1F2DA 1A5BB 3QUTA 2ZUUA 3HBNA 3ZDXB 1MHPA 3LU1A 3O0TA 3MNFA 2FGKA 2O1SA 2YRFA 2WJ6A 3QBTA 3MJ4A 4Y2VA 5AW9A 1B14A 2BR4A 4E5NA 3K8OE 3ZGLA 1I3NA 4JMPA 3HNOA 3PGA1 3N2GA 3RUFA 1PZEA 1QS0A 3PDCA 4M49A 4I9FA 2W6MA 2VK1A 4JDPA 2ZPAA 1T34A 2V9CA 3RVLA 4BMCA 2XV1A 1P18A 2ZBFA 3QU7A 3T5CA 3DS8A 5JS7A 1XZ8A 3BL5A 1NMEA 2XNJA 2IPNA 3I1YA 1V4NA 1X1TA 1UJ2A 3M2TA 4I5EA 3TI9A 4HWSA 5SY6A 1H8HA 3RYIB 1CJBA 3WYGA 4W5JA 4Z3DA 5JH7A 3HNPA 3H2HA 3ZXXA 4F8EA 2JVJA 1CS4C 1HKUA 5G0WA 3KSUA 3S2FA 2F3SA 3AQIA 3N2LA 2FFRA 1VL5A 3O2JA 3KD2A 1RIIA 3TW6A 3W05A 2DKFA 1CUAA 2FUG6 4EPXA 3DV2A 5D6NA 3FAKA 3AUAA 3H8VA 5B2ZA 1SUDA 2L69A 4JIMA 3OCYA 3T4PA 2I6XA 1R0XA 1E3MA 3EFOA 1ZR2A 3GF4A 4N7JA 1F5SA 3L0CA 1ADJA 3GA0A 3N53A 2QGZA 5FTWA 1V41E 2CLMB 4LI0A 4B3JA 4Z1MD 3R7WB 1CZNA 1KMHA 1RJ9A 1X38A 1Z35A 3VTAA 5MGNA 5IAAA 5IKXA 1TJ3A 2BFCB 2OHVA 1MNAA 3A9TA 4FTWA 4JC4A 4LE0A 4KO3S 4F38A 3N3BC 1XTQA 3C6ZA 3BJRA 4HFJA 4YAEA 1S2MA 4RDXA 4QECA 1I36A 3FOBA 1RYDA 2BGKA 2X0KA 1PS8A 4RX1A 4YJHA 4JUCA 1DAMA 3LBFA 3TR5A 3SBEA 1UKAA 1AA6A 1VE1A 2NUPB 3H9GA 2VH1A 2AEEA 1USVA 3RAJA 3RFUA 3N07A 3PBKA 1DTWB 4DQVA 1NTRA 1E1CA 2P68A 2POQX 2VVTA 1UM9B 2ZRCA 3D0KA 3QY0A 4PAOA 3WK6A 5KYYA 2JATA 4OYYA 2B69A 1H66A 3UGQA 4HMQA 5JASA 2IZOA 4K9OA 4PBRA 1H9BA 2F48A 2JLQA 2J30A 3RGGA 5JHHB 2PX4A 2XSZA 3QJ5A 5J63A 5KZMB 4GKKB 3WIUA 4DLNA 1MRZA 1Y9JA 4RETA 2WTNA 3C14C 4O1HA 2QE7D 4F3YA 3OUTA 3DTVA 3L93A 5E95A 3U0BA 4ECEA 1P45A 3GGCA 3K2BA 1L7PA 3NDBB 3GH3A 1CZRA 3L5OA 2G1JA 4Z0TA 3AKCA 4B1FA 4AAYA 1KJ9A 1V0JA 3DAOA 3WIVA 2V4UA 5EIEA 3OVMA 4HEJA 1ES9A 1A4XA 1KARA 1NVAA 1YRQA 2VDPB 3JD2A 1LRKA 1MO3A 4BC0A 2J5QA 3WKEA 3LAWA 4HWPA 5SYMA 3VZPA 2A84A 3KVVA 3ESAA 2ZM5A 3ZNPA 1DP4A 1DKPA 1WMFA 2P1DA 1HZJA 2X9NA 3KR9A 3LCRA 4LI3X 1A8HA 1U0TA 4QAQA 1P8JA 4WZBB 1U7XA 2GUWA 4DHWA 3M7IA 3MOIA 4RS4A 5H68A 4A8HA 1G42A 2C3MA 2ZJ6A 3TTUA 5B53A 3AESB 4AJNA 2ISSD 4TKUA 3HEBA 3W2TA 5KDDA 4MP6A 4IY1A 2B5VA 4B3TB 3PENA 5EJAA 2ZYVX 4EW1A 3W2FA 1SD5A 2ZTVA 2OQRA 4KR9A 1G7CA 4LAFA 3Q0IA 4N5MA 2OKGA 3GV0A 2HT1A 4G4SP 4IYRA 1CVRA 1SEVA 3L0SA 1M1YB 1LJUA 4FC7A 4BNFA 4QEDA 2DLCX 4G81A 2C4WA 2EJBA 5AW1A 1TM1E 5CRIA 1L5LA 1C30B 3H5OA 3K70C 3OQ1A 4CM6A 4HVLA 2Z30A 2J07A 2VDLB 2Y6UA 3QFRA 3LDHA 2IZZA 5JOQA 1Y7TA 2CMDA 3MWYW 2CDNA 3F9CA 2OK7A 2O3QA 4TSRA 3DVAA 3L7OA 3WJ2A 4BO1A 4D0LB 2VSQA 2EKDA 3BWXA 4LYJA 3H0CA 1J0AA 2D1YA 4NIMA 4CEIA 1ZK4A 2FEKA 2GBPA 4RZIA 3H11B 4IDEA 4WHMA 3U4HA 3V1TC 1VBFA 2GCPA 4IO0A 1JHPA 3K31A 4O4LB 1PZXA 5A71A 1KZ7B 4NPHA 3CNBA 5IM5A 4ARZA 3INGA 1CUSA 4F5EA 2DHEA 3ZDRA 3IIJA 4JLUA 1SXJC 5BR8B 4MQUA 3HB4X 4D9KA 4I5DA 2C1XA 3JD3A 5KCMA 2ODAA 1T5SA 2XA9A 2B30A 1JA0A 3N74A 1QPGA 1VL6A 3VHXB 4COOA 5JTUA 3IKMB 3H9UA 1QG2A 2PH5A 1FYXA 4UMVA 3LIIA 2R6AA 2GXSA 3NGLA 4KE6A 4E46A 2Q50A 3CH5A 3KJZA 2WAMA 3LGSA 4K2AA 1POWA 2GVZC 5HJEA 1R8XA 3TQCA 4IQGA 3VAZA 4IHKA 1F1BA 1U8EA 1YZLA 2AOTA 3U44B 8MHTA 4HDKA 3G79A 4F97A 5CYFA 1FJGB 2MR6A 3WHLA 2HO5A 3B6ZA 3GROA 5T4BA 3ZK7A 3AWDA 4S1PA 2WG0A 4IW3B 4N1AA 1V71A 4QBTA 4TV8B 3MCUA 4CEHA 4QM6A 4LHXA 3RKSA 4EL0A 2NACA 1AJEA 3N1UA 2QL5A 1HFKA 4NEQA 2N9UA 3O3CA 1ADFA 3PC8A 1QKJA 2KHZA 1QLJA 1QONA 1AMNA 2AZTA 1R5JA 4YK7A 3V8BA 1E9FA 1IPEA 1HE4A 4G0VA 3VA7A 4WXPA 4KFSA 1DQSA 1DV1A 4FXOA 5HTKA 2GHIA 4ENRA 4AKTA 3IL2A 4K6KA 2GN0A 1D6JA 2I2DA 2JPDA 3WLTA 3NJ4A 3TQTA 4XD7D 1GLNA 3A6LA 1B23P 5GONF 1E7QA 1J97A 2I54A 3F8WA 3VYWA 4K1LA 3RF7A 1FSSA 2XGJA 2YJ3A 1VSQA 3U4MA 3BF8A 3R76A 3K0FB 1EGAA 3H9JA 1JJFA 1YRBA 2KMLA 4FFMA 4DJFC 1RHUA 2DCMA 2WLSA 1ZSYA 4JVLA 2AG5A 1JZTA 5BNTA 1BW9B 1NXTA 2O2DA 5BORA 1PHRA 4JNKA 4ZI7F 1UDBA 1T5BA 2VP6A 4FR0A 1C2TA 4RKWA 5GJCA 4ZI5A 3SX4A 4KQ1A 2H3EA 3PWKA 3ZWNA 4MGIR 4AF7A 2OHJA 4G89A 3DC2A 2CXUA 4LDAA 1IDN1 2H18A 4FPXA 3TDKA 1MJGM 4IJKA 3K0SA 3OETA 2O2IA 5TMBA 2JK1A 3D3EA 3SS9X 3GJTA 3S1SA 3M81A 4HH0A 2WYHA 4XFKA 1OR8A 2HJWA 3UMCA 1UBJS 4KO4S 2X0JA 4K26A 3F9IA 4E33A 3BUSA 1KTVA 2W90A 1CHDA 4IOKA 5KUTA 2BFFB 2O1WA 2X9LA 1XMXA 2X8JA 3ACDA 3BRCA 3MILA 2BHTA 4QHYA 4AZTA 2KYRA 1KA9H 4U0JA 1N2GA 2OGWA 3GDHA 3R0ZA 1EUZA 3BQNB 5KNBH 4MQFA 2FWNA 4B3BA 4RY2A 1ZJJA 4IQ0A 4PPFA 1Y5MA 4FUQA 2II6A 1AKYA 3WMXA 1U1EA 3MT7A 1GZ4A 2G9UA 2WYOA 1NW7A 3DNPA 4WESA 3V48A 3X0DA 4LWOA 2XB6A 4OXNA 3P45A 4RFLA 3ROQA 3RSLA 3U6BA 4LZLA 1PEDA 2NQ2C 2I3DA 3QLTA 3PI6A 5JXWA 2QAIA 4Q18A 5ITZB 1CR4A 2NTJA 1RM5A 2WC1A 1UKCA 4M8NE 3ZC3A 1JIQA 5JJ5A 4PG4A 4XCQA 4ASUD 3C7AA 4EX7A 1KFEB 2ZR7A 4JJ7A 2G9ZA 2GN2A 5KSPA 3QTLA 4YWHA 2YXDA 3BC1A 4H31A 4TV9F 2YYSA 5U4QA 2RH5A 3L92A 4GMKA 3HDJA 1ZHHA 2AUNA 4KLNA 1FJ2A 4B75A 1DKUA 2MR5A 3EF0A 3TEMA 4E7PA 2FPGB 5JNRA 1XRJA 1Z8NA 2WU3A 1JNYA 7MHTA 4FCCA 2QD4A 2PFGA 4JGIA 3W7VA 2X7JA 3DO8A 3ET4A 4EGJA 3WRYC 3KQNA 1R50A 4JOQA 4DPMA 1FDOA 4PXSA 4OHBA 2I7XA 1W4AA 1GAWA 3OC0A 4A6DA 4D4GA 2GVDC 5JBQA 3Q88A 4IF6A 1FLAA 4W8GA 5D85A 4MV3A 4ZV7A 5C1DA 3O83A 1K4MA 3U4DA 2VAPA 3SX0A 5F98A 4YTEA 4ZVMA 2Z3ZA 5GMOA 4OL9A 1OH5A 1YUMA 1ZHOA 5KHLB 1LC3A 4KBFA 1R0SA 2EZUA 2Q3CA 2ZI5A 1A1VA 2KM1A 1E9CA 4LNUA 3WA6A 2FSHA 3NORA 3S0JA 1IY2A 1X1DA 3TDNA 2DT8A 3L1JA 3HA5A 4LX0A 5K8UA 2X42A 2V03A 1DL5A 4R1SA 1H9AA 1PBNA 3PUIA 2GB4A 3ENNA 3NOOA 3C6KA 4YDSA 4EG5A 1YS2X 3QX9A 2A1TS 2F3UA 2H4WA 3BTSA 4BNDB 3SIPA 1SHJA 4RF4A 2HQ1A 3CY6A 5IJ0A 4R31A 5JSFA 4OP1A 3H65A 1GXSB 3QOFA 2LIVA 3HVHA 4M7OA 2XOEA 5TQJA 4M3NA 5KC8A 1Q19A 1AB5A 1PLLA 3TFWA 4DDKA 4Z4HA 3BFJA 3FPAA 1I1NA 4YPFA 1LVUA 1T9KA 2I8AA 4BNTA 4MRNA 4K8RB 4O8CA 5F3DA 1WEHA 2PBRA 3LRXA 3JAWB 5A6SB 5U4XA 5JS6A 4MUEA 2XMQA 1XZQA 4RZXA 2DAPA 3ZWXA 1GL7A 2H0RA 4BQOA 4M1ZA 4HYEA 2Z2IA 1CJVC 3HB1A 4PYRA 4TLCA 4BS9A 2HWYA 3DZKA 5IXYA 2EJTA 3P0RA 4D26A 1R0LA 4DA9A 2HQBA 2D1SA 2JHAA 5K0JA 1Y6FA 2AE2A 2KX7A 1WXXA 2WJAA 4L27A 2HSGA 2X86A 1RLMA 3CW8X 4L4SA 1HZZC 3IBCA 4RZSA 5CNMA 5DF1A 3RK0A 2ECFA 4XM0A 5CUQA 4TVBA 2G04A 3RTDA 4WBNA 2F62A 1MMFB 1HYHA 1YK0A 2FWPA 2RGAA 2M32A 2VS1A 5DM4A 4EVIA 2O8CA 2PYIA 2XDQA 3LDFA 1JJ7A 4ACAA 2QM0A 1X3SA 2Q1SA 3UXYA 5ELMA 3ND9A 1XXHB 3G8BA 2NYAA 4FHEA 1PWZA 4DNOA 1S1MA 1YOBA 3A6KA 4UUMA 1KO4A 2QRGA 4L73A 5A5GA 4DSAA 5KQPA 3KK0A 3KYCA 3EVTA 4ACBA 1JX6A 3SR4A 4MI9A 3O1IC 1N2ZA 1VLZA 1AS0A 4DSUA 4QQFA 5D01A 2WJWA 1U6IA 3DVAB 2V5UA 3BSWA 4PV7A 5AXAA 3S27A 4DMMA 2CVFA 4PR3A 3Q8XB 4XYMA 1CE8B 3M1YA 4JYAB 2E4WA 2ZU6A 1Q6YA 3KB8A 2F4VB 2C5GA 1NY5A 2QLFA 2ZI9A 4MWSA 3PWSA 2YL2A 2WDZA 5LUAA 1S8FA 1Y8QB 4M0KA 4MMYB 4U9HS 2HHHB 1L7AA 4LY3A 2J3KA 4REMA 5JLAA 4MS3A 2HO4A 4TS3A 3W5CA 5C4GB 5BRJA 5DZSA 4Q1VA 2CL6X 1US8A 1NX6A 5EZSA 3IBGA 4L4RA 4LJ5A 5T7BA 3RAFC 3IIMA 4LXYA 1EHYA 2ABWA 4E5PA 2ZR9A 2HN9A 3FSEA 3UM9A 4W9MC 2C9ZA 1DDGA 1ZK2A 2I1VB 1NX9A 1Y1TA 2JFFA 3JX9A 4JLSA 1R0KA 1K7CA 3DMTA 4Z7JA 1LB1B 1Y6RA 3HGTA 2B2XA 1QVRA 4FZVA 4L8LA 1UWCA 1XR3A 3JZFA 4IEEA 5BVGA 1U7PA 3WG9A 1PD0A 4D3XA 5FBHA 2VDOB 3R5HA 2JF0A 1HXHA 1ZISA 2GD0A 3IAEA 2VLIA 3OP1A 3PFBA 4LHWA 2VDWB 5DTQA 4Y18A 4RIIA 1IK4A 4YJGB 1XZAA 4CTMA 3FNGA 4WLFA 4BN5A 2GEDA 3KBOA 4ZIRB 3UPTA 3U4QA 1QB7A 4I14A 1TKCA 3G8CA 2W8BB 5KU7A 4RD0A 5HIAA 2WZCA 3RIEA 1E2LA 2HIAA 4LC1A 3WV4A 1OUMA 1DKRA 3HA3A 4WBXC 4TXJA 4HBGA 5JAZA 4NQRA 4I9HA 1E0JA 4BJ5A 1EK5A 1MJGA 3BBPA 3W6OA 1QTIA 1E7YA 2GBLC 2R1VB 2WW8A 4N3BA 5BV0A 3U81A 3VOAA 4DL9A 4M53A 4OMUA 2QD5A 4QGAA 1F20A 2VRCD 2Q3EA 2JLBA 1H0HA 4FU0A 4R2KA 4HPWA 4UKDA 1WDTA 3HACA 1TK9A 3BSYA 1D0VA 5GPBA 2AOXA 2A57A 3TB4A 3OJXA 1PNTA 4ZAWA 3R5JA 1JQKA 1ZDMA 2YJ6A 2QMYA 2X14A 1YIDA 2B34A 3DV9A 3I39X 3K9BA 2ATXA 3LC2O 4HWRA 4JASB 5LMNB 4M1TA 5MFPA 2JH9A 5ENVA 3ACCA 4BKPA 1M74A 4MV6A 4HAOA 2BFCA 4GZMA 4DUGD 1M2WA 3VH4A 2C5AA 2ENUA 4QBGB 3ETDA 3HWWA 3CISA 1NYRA 3Q8WA 5FLKA 2UYQA 4QWWA 3DO5A 3OG9A 3ZGYA 4A7PA 3GVPA 2WTAA 3UV7A 4MVJP 3HWRA 2QX9A 4PLCA 2OB2A 1SUCA 2FJ0A 2QU8A 2VZEA 3FDJA 5ALJA 4JI5B 4ALLA 1PO7A 2EQAA 4RGQA 3OJFA 3ZKWB 4W6QA 5BNZA