1GEGA

Cryatal structure analysis of meso-2,3-butanediol dehydrogenase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
255
structure length
255
Chain Sequence
KKVALVTGAGQGIGKAIALRLVKDGFAVAIADYNDATAKAVASEINQAGGHAVAVKVDVSDRDQVFAAVEQARKTLGGFDVIVNNAGVAPSTPIESITPEIVDKVYNINVKGVIWGIQAAVEAFKKEGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGLTQTAARDLAPLGITVNGYCPGIVKTPMWAEIDRQVSEAAGKPLGYGTAEFAKRITLGRLSEPEDVAACVSYLASPDSDYMTGQSLLIDGGMVFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ACETOIN REDUCTASE
publication title Crystal structure of meso-2,3-butanediol dehydrogenase in a complex with NAD+ and inhibitor mercaptoethanol at 1.7 A resolution for understanding of chiral substrate recognition mechanisms.
pubmed rcsb
source organism Klebsiella pneumoniae
total genus 103
structure length 255
sequence length 255
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.304: Diacetyl reductase ((S)-acetoin forming).
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1gegA00
2H63A 1E7QA 5KJ6A 1P1HA 3TNLA 3FTPA 1Y7TA 1WMBA 3JQAB 4ILKA 1PJ4A 1ZSYA 2BGMA 3KYDA 1UXGA 5ILGA 5G0VA 3GVCA 4KUGA 1NR7A 3ZU2A 4C4OA 2VRBA 4PG5A 4XRRA 1C3VA 4J7UA 1B15A 4DLBA 4IS3A 1E3WA 3O4RA 1WVGA 5TS3A 4QEDA 3ENKA 4RDHA 3QW2A 3H9GA 4OSOA 5TF4A 2GCGA 2I66A 1C1DA 1SAYA 4DGSA 3MJCA 4NDNE 3IC5A 3NJ8A 3G79A 5HBRA 4HFMA 2FPPA 4BNLA 1UXKA 5JAIA 3GY0A 3RQSA 4XDZA 4BNXA 4DC0A 4MPDA 5U4QA 5JMWA 4R3WA 2G1UA 3LT2A 4E2WA 3BMOB 1Q7BA 4OXYA 1M2WA 4KTTE 4WLNA 2NUAA 2NVBA 3A4VA 1T4DA 3DQPA 1LU9A 4AJJA 2WM3A 4E5YA 1ZIDA 3TSCA 3L9WA 4E2XA 2GPTA 1MV8A 3NTRA 2X23A 1DRVA 2YV1A 4F6LA 2QZ9A 4BGVA 1PR3A 4G81A 1NQOA 5CEFA 3L07A 4B3JA 3HN2A 4LK3A 1PSDA 1SBYA 5G0UA 4E5PA 1NPTO 4FGWA 1U3TA 3F1KA 2JFHA 3MZ0A 1N7GA 4H15A 1KEPA 3S2EA 3RU9A 3RKUA 3LC2O 1I01A 1GCUA 3R3SA 3OJLA 1T2CA 3RBZA 1LLDA 3VDQA 4R69A 2PH5A 2Z5LA 4XGNA 2D8AA 5JPIA 3C1OA 2X22A 3T4XA 4Z3KA 5A03A 3G1UA 3NGLA 3HB5X 3TZKA 1E7YA 5JCJD 1JW9B 4WPGA 1Y8RA 4QO8A 4DL9A 2EKQA 2I5PO 3I83A 4M89A 1DIGA 1YWGO 4TRMA 1WMAA 4ND3A 1Y6JA 4D45A 4DQVA 4I1IA 2YHUA 4L8VA 4NFHA 1XU9A 3HUDA 4RF5A 4NPCA 4BNWA 4HFJA 4R1TA 3E5MA 3GGPA 1RKXA 4ZQFA 4KDEA 3ENNA 3GVIA 1Y81A 4DTIA 3GVPA 5FI5A 5F3RA 4BO1A 2GO1A 4BO5A 4CM4B 1U5AA 3I5MA 4AJEA 1PJQA 4OKIA 5THQA 3FF4A 4M54A 4BNZA 2PZKA 5F1KA 2AEMA 1IB6A 4A10A 5GZ1A 4KOAA 3ZHXA 1O94A 2NLOA 1CDOA 1JN0A 1N5DA 1PL8A 3PTZA 2Y0EA 4AFNA 1XA0A 5DCYA 4G5HA 2ZQZA 4B7XA 1K89A 5K0ZA 1R16A 3RI3A 1J0XO 2P2SA 4Y98A 4IDGA 4JXKA 5DBGA 3KZVA 1EUDA 5L7TA 5GY7A 3PQFA 3CZMA 2AQHA 4NMHA 4DIBA 5IXSA 4TQGA 3HFSA 3KYDB 1U8FO 4BUCA 1P31A 1KIFA 5IZ4A 3P2OA 3FN4A 3HDHA 4CMEA 3JQEA 3KB6A 1E3WB 4BS9A 5DBIA 4CV2A 3KO8A 4U6SA 2ZJ1A 1HRDA 1T2AA 3AY7A 3VPSA 1MUUA 1C1DB 1LXCA 2C2YA 1K6JA 2GLXA 3SJ7A 2VHXA 3LVFO 4W9NA 3DWFA 4I8XA 4CR8A 4RPHA 1HE5A 2Q45A 3VH2A 3OP4A 3VKUA 2HCTA 4ALLA 1P74A 1WNTA 3UGKA 3U09A 3KYBA 1KVRA 1HXHA 3KUXA 3OICA 2DBZA 2QRJA 3EVTA 5BNFA 2JAHA 2VWHA 5ER6A 2NU8A 3BMNA 4CV1A 4YT8A 5JSFA 4CQLA 4RF3A 4DYVA 2YFHA 4TWRA 3AOGA 1T4BA 4E32A 4ALKA 4KUHA 1UUFA 1KOLA 4CPDA 4B8WA 1K6XA 2YHIA 3JD3A 4OKNA 4CL8A 3PYMA 5I7VA 4P38A 1OAAA 3AU8A 4DIOA 1J6UA 1FMCA 1DC4A 1X0XA 2FR0A 1D1TA 5JO0A 4NQZA 4F46A 1DOHA 4WCFC 4GX5A 4UUNA 5EJ2A 4GGPA 1IY8A 4GAEA 1JU9A 1PJLA 2X0JA 3HDYA 5DBFA 4E5KA 1E5LA 1B14A 3Q9UA 3DO5A 3RFXA 1J5PA 4MOWA 4NR0A 5JC8A 3GLQA 1DJQA 5BT9A 2X0RA 1Y9EA 2BRUA 2H9IA 5JAMA 3F6YA 3I23A 1QLHA 4WCDA 1EE9A 1UP4A 3BA1A 3LC1O 1BDBA 2Y67A 2I99A 3SC4A 2ZYGA 1PZHA 1NFQA 2JJYA 3T7EA 2O4CA 2Y93A 1R15A 1MC4A 1ZFNA 4MVJH 4TVOA 2VOJA 3FTNA 1LJ8A 1UDCA 1Y8RB 2O3JA 5EINA 3TWOA 4ZICA 1T25A 4MIEA 4CODB 4WOKA 5KNLA 3NT5A 3ITKA 2E48A 1EUCA 3NV9A 4Q3EA 3H5NA 3ONDA 2O2SA 3GDOA 3IP3A 3U9LA 3DBLA 4AJ2A 4XYEA 2EF1A 3COSA 4RF4A 4KDFA 5ICSA 4D7AA 3GAZA 5JE8A 1UJMA 2Y0DA 3GAFA 5TRTA 4MINA 1WAMA 2CVOA 1PQWA 2PZLA 1PJCA 3KHUA 1MX3A 5G4KA 1QYVA 1E1MA 4K1LA 1NXQA 4OQYA 4LVCA 5COBA 2VWGA 1X15A 5KCZA 1XGKA 3ZV4A 3ZV5A 4BMNA 3VTFA 2FSVA 3HB4X 2D0IA 3C3XA 5FEUA 4XIYA 3LK7A 3TZQA 3DFZA 4I5DA 4Z0PA 3ZWOA 2B37A 1EE2A 3JYQA 3OM9A 4PZDA 1LSJA 4B3HA 2NM0A 5JFOA 2B5WA 2WD7B 1ZMOA 2F1KA 1ISGA 4TRRA 1Z6ZA 1N9GA 3ABIA 3WQQA 2G17A 3ICPA 4E12A 1O6ZA 4AJ4A 1YJQA 3PPIA 4KZPA 5A3JA 3WJ7A 4A03A 3ONEA 1S6YA 4J1SA 5U1PA 2DUWA 4MJLA 5EMHA 1QYXA 3A1NA 4YRDA 3PGJA 4X54A 3KOUA 4CR6A 4EUFA 3PHGA 4BKRA 1GV0A 3JYOA 2BKAA 3PDJA 4IBOA 4Z0TA 1HWYA 1V0JA 1V3VA 2Q2VA 3FNFA 3VH1A 1HT0A 3EDMA 4RVDA 1T1RA 4II2A 4PRKA 1LLUA 1Q7CA 2Q4EA 4IS2A 2Y1EA 5I9LA 3OETA 4IDDA 3CIFA 2HMTA 3L6OO 1P44A 4XYBA 2WYUA 1JA9A 3LF2A 1HYEA 2DPGA 2RIRA 1Z7BA 4NNJA 3RAJA 5EIOA 2HJSA 2Y0CA 3LF1A 3I6QA 1GY8A 5B4UA 4N18A 2VT2A 4U0JA 1Z73A 4F3YA 1E3JA 4E13A 3H6KA 4CM7A 3RD5A 4D79A 2ZATA 3C85A 3UAGA 3TFQA 4RQUA 1PS9A 3BMNB 4PG4A 3DMTA 4CQLB 1E3EA 5JC1A 3MTJA 3W1VA 1B8PA 2ZB8A 3K8ZA 4CMKA 2UYYA 4KMSA 1MG0A 1HEUA 4H7PA 2QW8A 2PTGA 1GZ4A 1VLLA 2B69A 2YHIB 3U3XA 4EZBA 3VDRA 4BNVA 2C0CA 4D42A 1RM5A 5DOZA 3TPCA 3UCEA 2Z95A 4J90A 3E1KA 4CM5A 3DONA 3AI3A 4OM8A 3RUCA 3I3OA 4ZA2A 4MVJD 2OGUA 4FJ0A 4DQXA 5F1OA 1M6WA 4BMVA 3LT4A 5EESA 1G0OA 2SCUA 3P2YA 4URFA 2E82A 1T1SA 1M75A 4ALJA 5JYDA 2C82A 5TC4A 3BHJA 1UR5A 4O6VA 2UUOA 4AJIA 1ISFA 4J4TA 1NAHA 1VJ0A 2W2LD 1DPGA 3JD0A 4CUKA 4OH1A 4L74A 3IDSA 2VUUA 1A4UA 2DBVO 4U8GA 5L40A 3GEGA 4Z9YA 3AJRA 3I9OA 1ZXLA 4OHUA 1ADFA 1PGOA 3HDJA 2YYYA 3HQ4O 4FCCA 1CQIA 1QP8A 1ISHA 3B1FA 3MJTA 2WDZA 4WLFA 1Y5MA 3DBLB 5L45A 3ZW9A 2F00A 1V35A 4K9DA 1GZ3A 1NWHA 4I5GA 3GR6A 4IZHA 1AXEA 1PQUA 3WGHA 1O5IA 4RCVA 5HM8A 1HKUA 3JQ8A 4JJGA 4BGIA 4ESOA 3JSAA 3O8QA 2VYNA 2AW5A 2IRWA 3BYZA 3KV3O 3WIEA 4EJMA 2JD1A 4U7WA 2EKPA 1XSEA 5G4KB 2BFAA 3ZH2A 3BMCA 1BG6A 1EVJA 1DDOA 4BO4A 1I30A 2IXBA 2OOSA 4FD3A 4I08A 1ONNA 5JW6A 1P77A 5JDCC 4CLOA 1XWFA 2GDZA 2WD8A 3CMMA 4J1QA 5IZCA 1N9GB 3QWIA 3DOJA 4ID9A 1LDYA 5JBIA 4WE3A 5AQ1A 2YDYA 3OMLA 4LRTB 4XKJA 3ROMA 4TRJA 5JXWA 3KEOA 2YQ5A 4BMSA 4AJHA 1DFGA 1JAXA 2EJVA 4OJNA 4UAGA 2GUGA 1PZFA 2B5VA 1TB4A 3NTOA 4DMLA 3U5TA 1YBVA 3R0IA 5TIIA 2X5OA 3ANLA 3RFTA 5FI3A 3IJRA 4MVJM 3VVBA 4R9SA 1KY4A 2B0JA 2WYVA 1V6AA 2B35A 4G65A 4MDHA 5AXCA 2P91A 2BELA 3V1TC 3ST7A 4WNIA 4IJWA 1KC1A 4Q3NA 4ALIA 1DB3A 1DBVO 1HE3A 3C1AA 2VUTA 3GFGA 1I3KA 3GDGA 1MB4A 1BMDA 3H9QA 1HYGA 4TMFA 3IOYA 2WJPA 3OHSX 2ZTUA 3JD2A 1UXJA 3MJEA 4BNHA 1TXGA 4BO3A 4BNFA 1KBZA 2PV7A 1S7CA 3PIIA 1P1KA 4NU5A 1ARZA 2V6GA 1I3LA 3QVXA 5DDIP 2VHZA 1NQTA 3H65A 4EEZA 4JCOA 3QA9A 2CF6A 3Q0EA 3QJ5A 2CUKA 2LDXA 4LGVA 4A0SA 2HK8A 5LC1A 1NTOA 4JQCA 2VN8A 3BTUA 3H9JA 4GMFA 1LC0A 2VOEA 2HMVA 5A3VA 2DLDA 3L0DA 3VZSA 1NAIA 3VC7A 1U3WA 3KTDA 2JHGA 4YRAA 4M1QA 2IE0A 2D1YA 2IYOA 3BHIA 3D0OA 4PLVA 2P5UA 3I1JA 3PHHA 3JQGA 4AICA 3FR7A 2OBNA 1ENYA 5F21A 5IF3A 5EPOA 1BRMA 3HSKA 1LRKA 1I36A 1M67A 4RORA 4J7CA 1O9BA 1TA4A 1OZAA 2HMUA 2AG5A 4MP8A 3UFXA 1XEAA 2NSDA 4ND2A 2O7QA 2PH3A 1NHWA 3VPXA 2RH8A 3FWZA 3V2GA 3EY4A 3ZW8A 3WQRA 5G0WA 4DBZA 4CUJA 2EW8A 2G0TA 2ZTVA 4NU6A 3W8FA 1I2BA 3RIHA 3JQ8B 1CERA 1H0KA 4MVJF 4XGIA 4ROSA 3DTYA 2A35A 3O8QB 5TQVA 4ZU3A 3K2BA 3GHHA 4FOOA 4GSLA 3U4CA 3M1AA 1HDYA 3EK2A 2C5AA 3LLVA 5I7EA 3BMCB 4GX1A 4NJMA 2ZJ0A 1FDUA 3W4JA 5A05A 1HSOA 1OMOA 1P1RA 3AY3A 3L6DA 1A71A 3VPGA 2VQ3A 3S55A 4CLOB 4IGEA 1JWAB 4MO2A 5AYVA 1HL3A 4O5OA 4UVIA 3ULKA 3EMKA 4XQEA 3WGIA 5J23A 4D0SA 4OOFA 1LDEA 4R5HA 3H5RA 3NX4A 3Q2IA 1FDTA 1R4MA 3K9QO 2VRCD 2P9EA 5L9AA 3QWFA 2E4AA 1T26A 3ICCA 4KQXA 3QE3A 4BNGA 5JNLA 1JVSA 3AFMA 4QECA 4WLUA 3SXPA 1DIAA 4Y8VA 1B7GO 1OI7A 3GRPA 4CLHA 2RCYA 1I8TA 2NTNA 4QTZA 2PKQO 4TKMA 4BB6A 1P1FA 2QYTA 2CVQA 2RH4A 3FBTA 4LN1A 4PLTA 3L4BC 2P5YA 1YGYA 3K31A 3ASUA 1VRWA 5C7LO 3STHA 4CLXA 3CE6A 4BNJA 1SO8A 2GZ2A 4HADA 5BSGA 2AEFA 3A28A 4YWJA 3IAHA 4CJXA 4YQYA 3UUWA 1YQXA 2PWZA 3LLSA 2J3HA 5G2OA 1BXGA 1I10A 5JCJA 3UVEA 3OJ0A 3JQ9C 3U4DA 1EQUA 3AM3A 3FNGA 1TT5A 3M1LA 4NG5A 3F47A 2ZCUA 4MKXA 4Z3DA 3ZU5A 2YQ4A 3UN1A 2H1SA 2I3AA 2RBEA 4W82A 4WUVA 3WG9A 3ZNOA 1HDGO 4IDEA 2AEJA 1B0AA 3E48A 2AQIA 3VPFA 5BSFA 3KLMX 3MWEB 3D5TA 3Q9NA 4NBWA 3R1IA 1B26A 2DFDA 2EERA 3NGXA 2XPCA 1A5ZA 2A9FA 1UXIA 3ZWBA 4Z9FA 4DIFA 1DXYA 2P4HX 1PWXA 3FR8A 1FK8A 4BO2A 3KVOA 4PCVA 3D7LA 4FFLA 2OHXA 1MGOA 4XR9A 1DHTA 5KOIA 1X1EA 2HSDA 4RVHA 4UVEA 1AUPA 3ZNNA 2NVUA 2CVZA 3DBVO 2Y1FA 3H9EO 2W2KA 1AN9A 3JCZA 2E37A 1F0YA 2B4RO 3ZHYA 1EMDA 4AJ1A 2FR8A 2C29D 2EIHA 1G6KA 1YL7A 3PJFA 1FDWA 3GN2A 4LSWA 3AFNA 1LSOA 1SNYA 3WTBA 1O95A 5COQA 3IUSA 4FIZA 4YYZA 1I5RA 4XWYA 3LU1A 1WP4A 2EKLA 2NU6A 4RPLA 1KETA 4DWVA 3TZHA 3JQGB 3LZ6A 4TZTA 4WASA 5EQDA 5DCWA 1O89A 4D43A 2EEZA 1ORRA 2VTDA 2ZK7A 2NTVA 2PGLA 2DBQA 1OC2A 4R3NA 1EVZA 1TT7A 1VL8A 3RVDA 5AXAA 1YQDA 4BO7A 3PQEA 5ENVA 1MG5A 3NDIA 1GEGA 4J7XA 3O9ZA 4PLCA 4GGOA 4I9NA 1YS4A 3ZWWA 2DTEA 4K28A 4PLHA 1PJ3A 1QXSA 3KRTA 1PR9A 5HTOA 4Q39A 3GQVA 3TFOA 4LVUA 5I7SA 2WWRA 2B4TO 5IN5A 7MDHA 1YOVA 1ZEJA 3V2UA 1BTOA 4Y67A 2YW9A 5JDIA 1AE1A 6LDHA 2AE1A 4XR4A 3N58A 5KVCA 4YAEA 1PGNA 3Q3CA 1QYDA 3JQ7A 3P5SA 3ZHZA 1NHGA 1KVUA 1P9LA 2RAFA 4NJMB 1WW8A 2XOXA 1SEPA 4JBGA 2VWPA 5L7WA 3H9UA 1UAGA 3GZ4A 4EGFA 2TMDA 3OA2A 4PLYA 3MTGA 2FOIA 4R68A 1ZUD1 3I9KA 4LISA 1C0LA 5AXBA 1NFFA 1HF3A 4TSKA 2O23A 1R4MB 4TKLA 4B4OA 4CMCA 2BGKA 4IMRA 1LC3A 2VNAA 1M76A 2W98A 3W8EA 1ISIA 1QG6A 2ZB4A 3W4IA 5CPBA 4L4XA 3GVXA 3PFFA 4QFCA 4XYGA 1YKFA 1LQUA 3LYLA 4PG8A 1B8VA 4IDAA 3ZZNA 4MP6A 2O50A 3GDFA 2YJZA 5T8KC 2HMSA 2Q49A 2DUUA 1UDBA 3L77A 5FWNA 1ULSA 5G4LA 4JBIA 1A72A 1UZNA 5FF9A 3O38A 4IZIA 3GPIA 3INGA 1L1FA 1H5QA 2XF8A 4IGFA 2FY8A 4RF2A 4LW8A 1F12A 4GKBA 3FPLA 1V8BA 1I3NA 5MDHA 4NH4A 5K6AC 5T64A 4E6PA 1BXGB 1DFHA 4WOJA 4FFPA 4GL4A 1DJNA 1X13A 4MIYA 5T67A 1TT5B 3SC6A 1D7OA 1B3RA 4E21A 1GTMA 1LDNA 1U1IA 2J5RA 3H3FA 2J3JA 1K6IA 1XDWA 3PWZA 4IJUA 4LCJA 1H6CA 2WMDA 4N7RA 4ALNA 1Z75A 4IUYA 4C7JA 3RROA 3GRKA 2FZEA 4A5OA 2HRZA 4JK3A 1P1JA 5KVVA 1N92A 1T2FA 5CPFA 5TNXA 1GAEO 3TDKA 1BHSA 1HYHA 1VJTA 2W90A 4UULA 3C7DB 5CDGA 2OXIA 1E1NA 2HQ1A 1ML3A 3MCVA 4R1SA 4UEOA 1TEHA 5T57A 2NVUB 1WDLA 1BSVA 1GD1O 1P1IA 2HRBA 2W2KB 3OBBA 1YB1A 2HK7A 1E0DA 4ND1A 2PK3A 1QYWA 4OIMA 4WLVA 2FZWA 2YUTA 2FSSA 3K5PA 4EDFA 4YAKA 3JYPA 1KY5A 2O3RA 4OYRA 5BSEA 1ADCA 4F45A 4L4SA 5GZ3A 1PEDA 2B83A 4BKPA 4AJKA 2PKQP 5KWEA 3RC9A 3ON5A 3OJOA 1F06A 4IQGA 3DZFA 3S2GA 4YAGA 3OIFA 2V6MA 1YE3A 1AGNA 1GYPA 5IAAA 4O59O 2NQ8A 4IJVA 2O3TA 2QZZA 1HLPA 5L7YA 3EW7A 2QRKA 1VM6A 1O8CA 5GMOA 3ZWNA 3WDSA 3QWHA 3TZCA 2NACA 3DBHA 3TZ6A 1T24A 4XA8A 1XYGA 1LLQA 3IJPA 4JX8A 4XQCA 1YQGA 4E31A 4AL4A 3JQBA 4NBVA 2JD0A 1N2SA 3WLFA 1PX0A 3MEQA 4PLZA 4XJTA 5C5IA 2IZ1A 1WZIA 2W8ZA 4R16A 2OL4A 1YOVB 1CQJA 3Q6IA 4BO0A 1QSGA 2NV6A 3GVHA 4JJIA 4YJFA 4EJ6A 2J3KA 2JCYA 3GGGA 4PLWA 3JQ7B 3RUFA 5IN4A 2CFCA 5I8ZA 3H7AA 4DVJA 4ALMA 3AUSA 5F1PA 4PZEA 3QVTA 3PDUA 1NWCA 1RPNA 2XAAA 3GA0A 3RUIA 1P33A 1M66A 3K96A 1X0VA 3VTZA 3FNEA 1OBFO 1BDMA 1W4ZA 1FF9A 1SOVA 4MIOA 4B4VA 1RM4A 3I6IA 2IEDA 4IY1A 3AOEA 3GNQA 3G3EA 1E5QA 1LDBA 2DAPA 4YR9A 4OGWA 4Q9NA 3DAPA 5I7FA 1VJ1A 3WIDA 2P68A 1B16A 2EW2A 2Y99A 4YDRA 1ENZA 3WGZA 5G0TA 1EVYA 1UAYA 3JQFA 3O26A 5CAEA 4WLEA 4RVSA 4MVJA 4WECA 2GSDA 4B79A 3CINA 3GF4A 1PJTA 1DRWA 4GH5A 4IQ8A 3Q11A 5A02A 4QXMA 3U49A 3SX2A 3DEYX 4RPKA 3ROPA 4E4YA 4XB1A 1R66A 1HE4A 2J6IA 2CMDA 3L9XA 3D4PA 2J5KA 3V8BA 4RO0A 4R1UA 2BHLA 1DIHA 1KVSA 4YCAA 3GUYA 4Q3AA 2CDAA 1JKJA 3WBBA 1P0FA 2JFFA 2GF2A 3F5SA 3E82A 3IUPA 1HDOA 1E7SA 3RKRA 3TRIA 1DC3A 3FCOA 3ETEA 2P4QA 4M55A 1IL0A 3G17A 1GUFA 4B8ZA 1H2BA 3GEMA 1T2DA 3KM0A 2IDZA 1X14A 3GT0A 1GUZA 2VHWA 4K6FA 3ZDFA 1KVTA 2V7PA 4JP3A 5A06A 4BNMA 3R6DA 1ADGA 3V1UA 4ZJUA 5JDIC 1RYEA 4M49A 2DTDA 3PWKA 1EBFA 3L4SO 4NZ9A 3OEYA 3ZWYA 3S8MA 3AU9A 2PFGA 4CQMA 3CKYA 1LSSA 3WNVA 2FPGA 1DAOA 2CSUA 2UV8A 3H3JA 1JKIA 1NFRA 3IMFA 1NVTA 4QQRA 3TJRA 3F4BA 2EV9A 1IYZA 1RJWA 4HNHA 5B12A 2DKNA 3DOCA 4RLSA 3WFIA 2VYVD 1I2CA 3B70A 4FSHA 4R41A 4LCEA 1XQ6A 3JV7A 1QLJA 1GYQA 4RDIA 5EQFA 1XIVA 3ITDA 1K0UA 1PGPA 4BQPA 3IKTA 3VZRA 5JAZA 1GCOA 5LDGA 4MVJP 1CJCA 2NQTA 4XB2A 3GN1A 1E6UA 2X8LA 1NX6A 3D64A 5DULA 2YZ7A 3F46A 4XJSA 2E6UX 1ENPA 2DFVA 5A4DA 4MVJG 2YV3A 4ZQBA 2DPHA 2GN4A 2C59A 2O2YA 3TN7A 1ZBQA 1E1KA 5K9ZA 5THKA 4WJZA 3RBXA 1U2GA 3BTOA 4ZRMA 3BXXA 4J16A 5F5LA 4WLOA 1NBOA 1JLLA 2Q50A 2OMEA 3B6ZA 4HBGA 5KJCA 1R0KA 3WSVA 3JYLA 4W4TA 4L0QA 1X7DA 5I9NA 5IDYA 3WNQA 1KEUA 3DR3A 1Z7EA 4CMEC 1SZJG 1LDGA 3PGXA 4JGBA 4YJFB 2YV2A 4XYLA 4NBTA 5TX7A 3PHJA 1MP0A 1SPXA 4YACA 3PXXA 4II3A 2IODA 4PGFA 4N5NA 1Q2XA 4E5MA 1CEQA 1LI4A 1Q0HA 3OA0A 3QIVA 3ZWCA 3FD8A 1GV1A 2QX7A 1A4IA 2J8ZA 3WMWA 4W9NC 5CG2A 1I33A 3PYLA 4FN4A 4QX6A 4B4WA 1X7HA 4YB8A 4RGBA 3EZLA 4CM1A 1Z82A 3FBGA 3H5AA 3IS3A 5CDYA 3M2PA 2RHRA 3Q1LA 4BL5A 4CMIA 3VHRA 2OP1A 6ADHA 2PKRA 2POQX 3RUDA 1WDMA 4Y6RA 5CP8A 5CG1A 1RWBA 4YJDA 4K6CA 2JCXA 2WE8A 3L6EA 3MOIA 1C0IA 1SB9A 3N74A 3SVTA 1H9AA 4I5FA 1A9YA 2C7GA 2Q2WA 3W8DA 4EYEA 3VZQA 4CMJA 1H9BA 4A2CA 4ZRNA 5JMPA 1EZ4A 2JFGA 3HDQA 2D2IA 2XXBA 3F3SA 4GLOA 4IM7A 2G5CA 1P45A 1PZGA 1XU7A 3VH4A 3DBRA 4KTVE 3ZWVA 3DC2A 3UXYA 2GRAA 1NQAO 4NFYA 4J2HA 4LRSB 3F1LA 2J3IA 1PJ2A 2NU7A 5AXDA 3D1LA 3PI7A 1U9JA 5CFZA 3NKLA 3ORFA 4RJTA 1PJBA 4HUJA 1LRJA 1GQQA 2X9GA 3SLKA 3SLGA 2P9CA 2PZMA 5BQFA 3E18A 3INTA 4FW8A 4CQMB 1HTBA 1IE3A 4LSMA 2BLLA 3GNSA 4RZIA 4YT2A 2G82A 4A73A 1TLTA 4ZD6A 4FJ1A 1U7TA 4EW6A 1LA2A 2H5LA 4RVUA 3QQPA 4QFDA 5HA5A 2X0IA 2BF7A 3AUAA 3D3WA 2I67A 5KJFA 3AI1A 5L4NA 1VL6A 1BW9A 1DHRA 1Y8QA 3QY9A 3AOEC 2BFOA 5B37A 3ANMA 3WQSB 3CEAA 2VZ0A 4ZGWA 4R9RA 3RC1A 2X9NA 1NVGA 1LDMA 4M86A 5H82A 4XQ9A 3W6UA 4XYMA 2VRCA 1N1EA 1CIVA 2I65A 2BFMA 2ILTA 3RJ5A 2WYWA 3A9WA 3OQBA 2CDCA 4G2NA 4EBFA 3K2EA 4QT0A 2UVDA 1ISJA 4MVJI 5TJ9A 3KSZO 5CDTA 2B4QA 5TT0A 3WGQA 2B36A 1ZO8A 3PFWO 1CF2O 4IJKA 1K3TA 2FMUA 2PR2A 3E9QA 3IIEA 2E49A 3RC2A 1E77A 2DQ4A 2X5JO 3RASA 2QIOA 2HAEA 4IIUA 3CTMA 1R4NA 3RUHA 1VPDA 2BMAA 3GOHA 4D46A 2YDXA 3AUTA 4ITUA 1ZJYA 4UVGA 1GFSA 2VTEA 5BR7A 5FFFA 3PEFA 4P4GA 2X7HA 4CM3A 5JY1A 3EHEA 3ZI0A 3WMXA 4CV0A 4D3FA 3QWBA 4MVJE 5A9RA 4IMPA 2BGLA 2GD1O 1K5HA 1ONOA 2Y1OA 3PP8A 5ER9A 4PVDA 2GN9A 1PZEA 4BHTA 3ZWAA 1HZJA 4GBJA 3TOZA 3K92A 4RPJA 3OFSA 5BSHA 4CM9D 4Q3BA 3GZNA 4JJFA 5TSDA 4UREA 4DPKA 1FJHA 4CMIB 4D44A 1SC6A 1WDKA 1VKOA 2EWMA 3DMTC 1HDXA 5KJ1A 3RJ9A 2V6FA 3W4KA 2V6BA 1ONPA 1MFZA 4EUEA 5ES3A 4NK4A 4EUHA 3AY6A 3UW3A 5EN4A 3CUKA 2PD4A 4J49A 3AK4A 5KVSA 1NPDA 1BWSA 3B1KA 3JQAD 3KEQA 2C2XA 1YO6A 2JAPA 3LDHA 4I9UA 8ADHA 4BNKA 3RWBA 1SB8A 3NDJA 2NNLD 3JQCA 5JAQA 1LNQA 1N7HA 4XDYA 3BZUA 3LT1A 4YEDA 4PLPA 2ZB3A 1KS9A 1J49A 3DBRB 3HFGA 1EQ2A 4JP2A 2O4UX 3AUUA 4OMUA 2Z1MA 3VAZA 4OO3A 1Z45A 1ZSNA 4CUZA 1GDHA 5A5FA 1NR1A 3G0OA 5H83A 1H93A 2ZYAA 1LUAA 1I2ZA 4HKTA 4CM4A 3HG7A 4FFRA 1B2LA 2DT5A 4CL3A 1E3IA 2G76A 4GLLA 3ZNPA 2NWQA 1AHIA 3LT0A 1GADO 4XZ3A 2CZCA 3OQ1A 4HV4A 1A7KA 1UDAA 4FQ8A 1E92A 4DRYA 4CMAA 1XKQA 5TT1A 1HDRA 3AM4A 4CM6A 4PG6A 4WCFA 4DC1A 3PYXA 4W99A 2X4GA 3DZIA 4UEJA 4J1TA 4GQAA 4BGUA 5HWSA 1X1TA 2XXJA 4UEKA 3KXDA 2VCYA 2C54A 2A94A 3D3WB 4PRLA 1XELA 4KQWA 2EHDA 1BW9B 1Y8QB 4J4HA 3INRA 3EVNA 5DP1A 4CM8A 3ZNQA 5JCXA 2DU8A 2R00A 2GZ3A 1NYTA 4HFNA 2Y1GA 3VVCA 2DVMA 2Q1SA 1W73A 1UZLA 2EP7A 2NTJA 2GASA 3RSHA 3A06A 3NAQA 4AJNA 1YL6A 2Q1TA 3KLPX 5IZCC 1FDSA 1YJ8A 5JYEA 4D41A 1Z74A 1NVMB 3NTQA 3WX0A 3CPSA 4WEOA 4E3ZA 2ZYDA 5IG2A 4OOEA 4AVYA 3CSDA 3HZZA 3ANNA 3JD1A 4GX2A 4PLGA 2Q2QA 4DQUA 2HO5A 1U5CA 4D3SA 3VKVA 4L76A 2JL1A 1QKIA 4CLDA 1R4NB 3B20A 3VOSA 3GFBA 3DHYA 2HK9A 3HNPA 2R2GA 3DZKA 2X86A 4HWKA 2FHSA 1GZ6A 1KC3A 4LMRA 3T4EA 2VWQA 3U62A 2FWMX 1DIBA 1GPJA 2Q99A 2BFPA 4I5EA 3OSUA 2I9PA 4IINA 3GHYA 3U4IA 5L4LA 4ZN6A 1DLJA 2EP5A 4UVHA 4GSKA 2X0NA 1DLIA 4U5QA 1H6DA 4BV9A 1WWKA 5KTKA 4ONEA 4YA6A 4WKGA 3V5NA 4YT4A 3F9IA 4YBZA 2VZ9A 4HY3A 1IHXA 3ZU3A 5JY6A 3GZNB 3QP9A 9LDTA 3N7UA 1M6HA 4OXKA 3JD4A 3WWZA 5JO9A 4R54A 4CR7A 3AI2A 3ZCXA 2UDPA 1YDWA 4YAIA 3Q2KA 3WYCA 1BXZA 4E2YA 4FBGA 4Z0HO 3IKVA 2IZ0A 3ADOA 3PRJA 3MWDB 4L4RA 4OXNA 3UKOA 4N5LA 1XHLA 5L53A 3D3EA 1H94A 4WGGA 2D3TA 4FOSA 4GVXA 4M8SA 4W6ZA 1OOEA 4L73A 5CDUA 2UUPA 2BH9A 3WR5A 3U0BA 8LDHA 3HWRA 2NADA 5C3MA 1UH5A 4AJPA 1W8DA 1BGVA 2Q4BA 5B4TA 5KKCA 1U4SA 3BAZA 3NT2A 3WYBA 5A9TA 1F8FA 5TLSA 2X6TA 1E1LA 3EYWA 3ROQA 3FRJA 2RHCA 4FS3A 4BB5A 4J9VA 1R37A 4UUPA 3PVZA 1ZK0A 2JKVA 4B3IA 3OIDA 1XG5A 3E9NA 2A92A 1YDEA 3QRWA 4YPOA 1ULUA 4XIJA 3EZYA 4P4NA 2X1HA 1UP6A 4J43A 4INAA 1C0PA 3GGOA 4BIIA 1ZXBA 2CF5A 3WXBA 5IXYA 1NQ5A 2WD7A 3S2FA 2GGSA 3PIDA 4WCFB 1LQTA 1WXDA 2O3SA 3H2ZA 1DIRA 3PWSA 2VNSA 4U0KA 4ND4A 4DXHA 5G0SA 4TVBA 4J91A 1GPDG 4YJHA 1KYQA 4J4BA 4M87A 1GUYA 5C7IO 2Y66A 3ETDA 4E2ZA 3C7CB 2IXAA 4EI2A 1MLDA 2PNFA 2I6TA 2CNBA 4CM8B 3PJDA 5KKAA 4BNUA 2PA3A 3NRCA 4IIVA 3M6IA 4MKZA 4RLHA 2FR1A 2J5QA 5IJZA 3SEFA 1GL3A 1VKNA 4ZQHA 1QRRA 1Q0QA 4DMMA 4MP3A 1DAPA 1DEHA 3GG2A 3FWNA 2ZTMA 1YB4A 3GG9A 4W7HA 3S1LA 4R1NA 3I9LA 5A9SA 4BNNA 4FFOA 2Y1CA 3QV1A 4RVFA 3DXFA 1LTHR 2C5EA 4P8RA 3EGOA 2DTXA 2Q1WA 3O03A 4J9UE 1PGQA 1PWZA 1SOWA 5TJHA 2IEBA 5I9MA 4D3DA 4PVCA 2V65A 3GK3A 4JNKA 4WK6A 1YXMA 3I4FA 3K73O 1V3UA 4R51A 1I3MA 1RM3A 2C20A 2QHXA 3ZV3A 1JAYA 1YBMA 1DO8A 1QR6A 5KJEA 3E5RA 1SMKA 3DHNA 1GR0A 4FGSA 4R5MA 1B8UA 3GMDA 3V2HA 1H6BA 1U3UA 3OECA 2PGDA 1JKFA 1QV6A 3RFVA 4BVAA 4RQTA 4DLAA 3AWDA 5COAA 2AG8A 5DT9A 4FB5A 1DFIA 1HLDA 4CMBA 4BKUA 5DCUA 5JDCA 3NEPX 1D1SA 1ZZEA 4S3MA 4L75A 3ZU4A 1K2WA 4P4LA 1GU7A 5B4VA 3B1JA 4A7PA 1YONA 1IUKA 1QV7A 4BKQA 3RBVA 3TL3A 2Q1UA 3E03A 4YQZA 1QYCA 2LDBA 3FSRA 4Y6SA 1NP3A 4Y6PA 1U8XX 2WSBA 2VT3A 1MA0A 5IFLA 1L7EA 4QUKA 5T5QA 2FP4A 1U28A 4DA9A 5L4SA 5U9CA 3EAGA 4HNGA 1Y5RA 1AHHA 3P7MA 2FRDA 4N54A 4GI2A 2R00C 3UOGA 1ZW1A 1X7GA 4PIVA 3C1TA 4NBRA 1LRLA 1E7RA 1LLCA 2VYVA 5CEEA 3IL2A 5FYDA 3RUAA 3GC6A 2BI7A 2PD6A 2YFQA 3C7AA 1PS8A 3AW9A 2C07A 1L7DA 3WGYA 2VUSA 2OORA 1D3AA 2PY6A 3JTMA 4GPD1 2GR9A 3KBOA 3QLJA 3C8MA 1P0CA 3DB2A 3PJGA 3OJFA 4BGEA 5KIAA 3M2TA 2EGHA 2BD0A 2PGJA 3ONFA 3WSWA 2AA3A 1QMGA 3BHMA 1BVRA 2HUNA 1AXGA 4QO7A 1JQBA 2VHYA 3WGOA 3LQFA 3W6ZA 2QYSA 2O7SA 2JHFA 1NASA 1KVQA 1ZK4A 1E3LA 4I9HA 5DF1A 3PHIA 3DZHA 1NNUA 4DPMA 5HRUA 3NJ4A 1G1AA 1LX6A 2GYYA 4Y9DA 3TL2A 1T2EA 5A1TA 4FFMA 3HADA 2VZ8A 3H4VA 1HSZA 2OUIA 3K30A 3D4OA 2W2LA 3RCBA 4BO9A 3KETA 3F5QA 3GPDG 1VL0A 3GMSA 1U4OA 2PZJA 4YXFA 4DREA 1DC5A 3RC7A 3MOGA 1YB5A 3ZGYA 4Q3DA 1HZZA 3GNTA 4B4UA 4KWIA 2O3QA 4BKOA 3NT4A 4BV8A 3CH6A 1PTJA 3FNHA 3G49A 4YJHB 1CETA 4FPXA 4YJGA 2EG9A 3UICA 5DOVA 2BI8A 3SJUA 4XRGA 2UAGA 3PZBA 2P9GA 4JLWA 5JLAA 1E6WA 1ZCJA 3OQ6A 4H16A 1EK6A 1PQPA 3I4CA 2FN7A 5EERA 4HX5A 4A27A 1E3SA 2EXXA 2OP0A 1IHYA 1ENOA 4FC6A 4UUMA 5H81A 4HFRA 4E33A 2WE7A 4PN3A 3IQDB 1JWBB 2D4AA 1KEVA 4YVFA 3ASVA 3MJ4A 5A5EA 5A9SB 3LC7O 3FHLA 2AE2A 3WJAA 5ITWA 3OIGA 4LMPA 2EJWA 2D59A 4IDBA 2HKIA 3E8XA 4XX0A 3CXRA 2X9VA 4HP8A 3CZRA 3DZBA 3MJVA 4RZHA 3QSGA 3X2FA 4S1VA 2Y05A 4AG3A 3D4NA 5ILOA 2OBYA 2ET6A 4FDAA 4GWGA 4Z6KA 4IPTA 5HS4A 2WEKA 4O1MA 3DOOA 1DRUA 4PZCA 4ZQGA 3UF0A 1PL6A 4R01A 3SBOA 4XGKA 1EBUA 4RL6A 5HS6A 3ZWMA 1CYDA 3DBHB 2JD2A 5A04A 2O3UA 1PJSA 2WTBA 1ZH8A 3U4HA 5AVOA 4E0BA 9LDBA 5IDQA 1XCBA 2X5KO 1ZVMA 5DP2A 1R6DA 2YY7A 3TOXA 4FFNA 3ZWPA 4JIGA 3WICA 1IPFA 1GYRA 3D5QA 3CMCO 1HDZA 5AOVA 4J0EA 1IPEA 1U3VA 5CDSA 1EVIA 2OFPA 1GEEA 1A9ZA 4KWHA 2A4KA 4BQRA 4GKVA 2D5AA 1HETA 1P3DA 4A26A 3S2IA 1Y1PA 3DZJA 3L4BA 3QVSA 1KERA 2X58A 4PLFA 3QHAA 4TROA 4GMGA 4ZHSA 3WB9A 1NM5A 5ENDA 1XQ1A 3BMQA 1D4FA 1WPQA 1EFLA 3PLRA 5DN9A 1DSSG 5BNTA 4J3FA 1GQYA 3KSUA 4H3VA 1JVBA 3PLNA 2QG4A 3PK0A 4TZKA 3HE3A 4PG7A 3WTCA 1R0LA 1O0SA 3JQ9A 1EFKA 4IQ0A 2R6JA 1F8GA 3DMYA 4CLEA 1D8AA 1SCUA 3DFUA 2GN8A 1EEHA 2AXQA 3BTSA 3H2SA 2ZCVA 1H2HA 5L51A 3DTTA 5C37A 1GQ2A 1UXHA 3JQDA 1MXFA 4CQMD 3ADPA 3G1TA 3WBFA 1ZK1A 4DBVO 3H8VA 4NJOA 4ZVVA 1C0KA 4GVLA 3GEDA 4JBHA 1U7HA 4EEXA 1YVEI 1IOLA 5MGBA 3LSYA 1YH3A 1WLYA 4OAQA 1C1XA 4KUEA 4XEHA 3DAFA 3ZN2A 3JQBC 3OF2A 1EK5A 5ITVA 4L9RA 1PS0A 3DL2A 3X2EA 1N8KA 2PLAA 3KSDO 4R4JA 2ZKLA 2Q46A 3MJSA 4P22A 5CHEA 5IDWA 3VPHA 1XR3A 5CEJA 4YJGB 3IP1A 3UHAA 2C7VA 3KYCA 5T6BA 5GZ6A 4O0LA 2OZPA 3BTVA 1I0ZA 4HXYA 2HJRA 1Y9AA 4GWKA 3EC7A 2AQKA 2ZQYA 4W7IA 4CM9A 4CMHA 4PFJA 1E7MA 3QVWA 1ZK3A 3DHEA 4NHEA 3T7CA 5ADHA 4J0FA 3OEWA 4RV9A 1TVEA 2GERA 4N5MA 1ZMTA 2GNAA 4OQZA 1LSUA 2AHRA 4CLRA 2AQ8A 4IDFA 4J1NA 1BVUA 1UZMA 1QORA 3PJEA 2Y68A 4BOYA 4DYDA 4U6QA 1HDCA 1ZEMA 3OJEA 1V9LA 4ZQEA 1BXKA 2NVWA 3WWYA 3VZPA 4DPLA 4E30A 3DAGA 5EL0A 1IULA 4XQGA 3WS7A 4CMGA 5IDXA 3JQAA 3ZHBA 5I8WA 3JQFC 2H6EA 3FI9A 4TRNA 3ZWXA 1PL7A 2I3GA 2VHVA 5TGDA 5B1YA 3DDNA 1WZEA 1ZK2A 4IXWA 4NK5A 1VSUA 2I76A 1CWUA 1YBAA 2GZ1A 3NDRA 2PD3A 1R0SA 4IDCA 1J4AA 4DUPA 1JDJA 1JTVA 3UCXA 4EITA 3A14A 5L95A 3NUGA 4YRBA 3DZGA 1E7WA 2HU2A 3NYWA 3AM5A 3GUCA 1TI7A 3WYEA 3HJAA 2VYND 1ISMA 3QWAA 1I24A 1VC2A 4OL9A 4YT5A 3I9NA 3UH1A 4JROA 4NBUA 1EDOA 1A7AA 3WFJA 5DNAA 2DC1A 2ZTLA 4JN6B 3BMOA 4B7CA 1RYDA 4XCVA 3UCFA 1C14A 4WNCA 7ADHA 2GN6A 3E9MA 1OFGA 4E5NA 4MKRA 5LCXA 2ZB7A 3RUEA 1Q1NA 2HLPA 3F4LA 4KP7A 2HMWA 5T8KA 3JYNA 1FDVA 2OO5A 3PZRA 1W0CA 1YRLA 1B3BA 4WEQA 1I32A 2NU9A 5F5NA 3BMQB 4FC7A 1ZJZA 1G0NA 4AJOA 4BNIA 5LDHA 5ICMA 2DBRA 5L3ZA 1FXSA 4D0RA 2FPIA 2IZZA 5K6AA 3WOHA 1MC5A 1PIWA 4GX0A 2CY0A 3E6AA 4ND5A 1N1GA 2DM6A 4YTEA 2QRLA 1R12A 2AMFA 3HN7A 1ZNQO 3ROKA 4Z9XA 4BO8A 1HE2A 3HHPA 4K26A 1DC6A 4Q3CA 3C24A 3R3JA 3WGGA 2CDBA 4NFSA 1LBEA 2O48X 1UP7A 1A27A 3WLEA 1H6AA 4J2OA 4XD2A 1LEHA 4IXTA 1W6UA 2D5CA 3V1YA 3TF5A 5KVQA 4DLLA 3RU7A 2Y1DA 3EUWA 4BNYA 2CD9A 1ZKMA 3ZV6A 3QVOA 3PQDA 1Q0LA 3I9JA 4FJ2A 1IZ9A 2Z1NA 1C1XB 1Q7GA 4RPGA 4YAJA 1SEVA 4J6FA 1VSVA 4AJLA 2W4QA 4UUOA 1EUZA 3TQHA 1E6EA 1PGJA 4FR5A 4BO6A 1IZ0A 1YL5A 1XLTA 5DZSA 1ID1A 3FPCA 3PHLA 2QQ5A 4OSPA 4NI5A 4CV3A 2EGGA 2Q3EA 1VI2A 3I9MA 2HDHA 5JS6A 1MXHA 1V3TA 5C7OO 3KYCB 1NPYA 1U2DA 4BNTA 3BIOA 3K6JA 1VE9A 1OC4A 1F14A 3GH3A 3OH8A 4RVGA 3JQ6A 2IYPA 4O63O 1CRWG 1F17A 4UVDA 3I52A 3VH3A 4B7UA 4EJ0A 2JCVA 2ZIZA 3WGTA 1PU2A 1MFPA 4F6CA 1ADBA 4CLRB 2TMGA 1EDZA 1ZSVA 4NIMA 5BNIA 4C7KA 3P19A 1KEWA 1RM0A 4QSMA 3ETGA
chains in the Genus database with same CATH superfamily
3LPDA 4I9GA 1FJGB 1JBQA 2H63A 2V5AA 1IRXA 1A8UA 1NW8A 1V7CA 1YNSA 2DG2A 2FPKA 3COYA 3EXEA 2A0KA 3D6HA 4F5YA 3I53A 3HTXA 5F5XA 5KSWB 1Y7TA 2VNIA 3T1OA 3FCUB 4ABTA 3N6RA 3KT3A 1PJ4A 3RHSA 4AMYA 4KXMA 3KYDA 2P2GA 2Q1XA 1UXGA 4F3NA 4LOHA 2OE2A 2QE7D 4KUGA 1JEDA 1TJNA 2PWBA 3B3AA 3GNLA 3S0JA 3SZMA 1NKSA 1NZJA 1OX4B 3P9NA 3X0DA 4C0HA 1NL3A 2I6GA 2NO0A 2FPUA 4OQDA 4UHCA 5EUBA 5FTNA 2PMEA 3CLHA 3EZFA 4HAXA 2RHTA 4FLMA 4RK5A 4ZCPA 1LZLA 3OTIA 4J76A 5LDDC 2OTCA 1ZH0A 3M4ZA 5GM2A 5JCZA 2B34A 2Q0HA 1D2EA 1YCDA 2I6XA 2ODAA 1R0WA 2A3RA 2ASEA 3DCNA 2H17A 3QW2A 1YRYE 4N47A 5C3UA 3R7NA 4BQEA 2H48A 2C9BA 3G6WA 5HBRA 1KSGA 3TSAA 1U3CA 2UZ3A 1Z8NA 4BNXA 4DC0A 3HXOA 4MPDA 3ZCTA 1JFSA 3HMQA 4WKBA 5HF8A 4R3WA 3DHWC 2VH2A 4FZJA 2BKXA 5AJYA 5D5PA 4PHGA 4QYSA 4OXYA 1M2WA 2J9XB 4OK3A 1YA6A 2NUAA 3VR3A 3TQFA 4FGJA 3LLUA 4L5CA 3DQPA 1TZ2A 1TX4B 2QTZA 3W1EA 4AJJA 3C4QA 3NLLA 1ZIDA 3TSCA 3MMNA 3HI6A 4I8IA 4Z2AA 2GPTA 3OZDA 2H4WA 5AM5A 2X5NA 5AOAA 2UU9B 2I7CA 2X23A 2XUQA 5IM4F 5IVIA 3E61A 2G1KA 3UMJA 4ER6A 1KO5A 4FSXA 2RGUA 2G72A 1XRNA 3F96A 1UWKA 1FFBA 1R8XA 2J0UB 3IMGA 1NBWB 4KE6A 2AJCA 2YJ4A 3EXG1 3UJ7A 2NO1A 3NO4A 3CIOA 3FHOA 3OO0A 4X97A 2Q0QA 2FNAA 5G0UA 5BO5A 4J7AA 1U3TA 3D6JA 3VUFA 4A1OA 1CB7A 1OZ0A 1W4CA 3RIYA 3VR6D 4NHOA 3W1WA 1KAGA 3HCNA 1KEPA 2BMDA 2FPIB 3MD0A 5FLXA 4Y30A 3VR5A 1IJBA 1SBIA 3D7NA 1PUJA 3LC2O 1YJXA 3R7FA 4D8TA 4AIIA 1K08A 2CXQA 4V03A 3OY7A 3OJLA 3R3SA 3VDQA 1XQ9A 4R69A 4EG5A 3C8HA 1BDIA 3ICQB 4M4SA 2QSJA 3KR1A 2Z5LA 1AS3A 5AW5A 1RPJA 5FBWB 5JPIA 1DX6A 4YRGA 2ZM6B 3H7IA 3C1OA 3LUPA 3T4XA 3M70A 2IFTA 1VCMA 2J59A 4KOEC 5K0BA 1JWLA 4JJ7A 3GEBA 2EDAA 4BFZA 1MOZA 2O1WA 3EA4A 4MW9A 4QO8A 1QGUA 1NI4A 4LTMA 4R2HA 4DL9A 3VSBA 3HFJA 1KWKA 1FP6A 4U63A 1RYYA 2OILA 3MRXA 1SRQA 1V39A 2F7SA 1UJ4A 3MC1A 4YAWA 1XU9A 5K8CA 2PX8A 1O96B 1NVEA 1FUYB 4NPCA 3SZGA 1Q0TA 5B64A 4URVR 4N5DA 1OI3A 1Z4PX 2AMYA 3EF1A 3TS1A 1FFYA 3DFKA 1NF9A 1KJ8A 3GGPA 1UM9A 4XFDA 4DDWA 3SFZA 5JJIA 1K5GA 1Y81A 2IUTA 4DCUA 5B6JA 3CRZA 2J08A 5GWXA 1X7YB 1WBBA 5IJAA 2A1TS 1KF0A 2BEKA 1OZHA 3FJ1A 3OD1A 3OVMA 4CM4B 1OREA 3ABOB 5D7BA 1SFRA 1IDN1 1U5AA 2HR1A 1GXSB 3EF3A 3FF4A 4M54A 2AD5A 4D3ZA 4ZEMA 3KQUA 1DXHA 1IOZA 2XE6A 4B82A 1HO3A 5GZ1A 5BYKA 1JIQA 2H5EA 2Y8EA 3DT9A 3HS3A 3R5KA 2NLOA 1JN0A 1PL8A 1CVIA 4MDYA 1XZNA 5I4KA 1ULTA 1WCYA 1G8SA 2QG9A 2Y0EA 5F35A 4ZTUB 1B23P 1EU1A 2K4MA 2O5CA 4XIGS 3THRA 5LYJA 4LJ5A 1R2QA 2VXYA 5K0ZA 1PVDA 1XC7A 3B85A 4YYEA 3RI3A 1OH8A 4NULA 2P2SA 3A2KA 1G5HA 1E6CA 1EQAA 2QD5A 3FPBA 2WUEA 4MQFA 4ZMRA 2HIAA 2B7BA 3HYSA 2MTBA 4QDKA 4U7FA 3W5JA 1EUDA 2IP2A 2VBFA 2IJGX 2YIDA 1FYEA 4DIBA 1GUAA 1YMVA 3OIWA 3PA8A 1U8FO 3QFCA 3FJOA 1KI9A 4BEVA 2W2PA 1P31A 5AVJA 5EP1A 3WLOA 4A23A 4KSCA 1JSLA 4GYWA 4PBSA 1G291 2Z5FA 1PN3A 2HSWA 3IODA 4I8DA 1NXPA 3UJBA 3JQEA 2PX2A 1VBFA 1J24A 3ABSB 4CV2A 3KO8A 5TGTA 2REOA 5DRYA 4A6XA 2HOQA 3P8ZA 1MUUA 4IFIA 4C4ZA 9GPBA 2CHVA 2GLXA 3BBLA 3LVFO 4RHUA 4JC8A 4FDLA 3NC0C 4AY5A 3D2AA 1VQ1A 3A58B 2Y92A 5T4BA 2I1LA 4Y1GA 3OMWA 3VKUA 1L4GA 3CV3A 4UJ5A 2DEUA 1YQWA 3U09A 2CKDA 2XUJA 3I6BA 1HXHA 1NDHA 2NXCA 1TU3A 1Y8ZA 3TLMA 1OLSB 4ARIA 2YJ6A 1JHVA 2JAHA 2N0SA 4L8GA 4CQLA 4TWRA 2ZSHA 4TS1A 2OD9A 4DFDA 4GD3Q 4DLYA 2N47A 3BKXA 1KO1A 1KDTA 5CB4A 2YY6A 2SECE 3LKVA 1QONA 1HMPA 2XVMA 4D9IA 5J4YA 3MB8A 3HEBA 4IH4A 4JLJA 3PYMA 1DMSA 4MR7B 1QQBA 2ONCA 3TIXB 4G37A 4V02A 5JASA 2NZJA 1A5TA 1U2PA 3LDUA 4PZYA 1J2TA 3A1FA 1D1TA 2AN5A 5DGHA 4F46A 2O8EA 2G5GX 2ZBVA 4URYR 3ETHA 4GX5A 5EJ2A 4ZVLA 4WZBB 5LFAA 3RC8A 1V8DA 2V7GA 5AJWA 2JANA 3HDYA 3QKUA 3SYRA 4TL6A 3GU3A 1G2PA 1B14A 1KKLA 2H2AA 3Q9UA 4K2HA 3TJZA 5EUQB 3A1DA 3WO0A 1YZNA 2L69A 2GN2A 1GTSA 5BT9A 1Y1RA 2OD2A 1HG0A 2X0RA 4YO8A 5C46F 2IF2A 5AJTA 2F1JA 3JRWA 4EF4A 5CD1A 1MOPA 4MGKR 4O3MA 3I23A 4WCDA 3OCYA 3GEIA 1ZVVA 1UP4A 3KLNA 3QXGA 3F5MA 3CY6A 3ZKWA 1RWPA 3NAMA 1THTA 5JI3E 1BDBA 4B32A 3O3NB 1BROA 5HR5A 2JJYA 3E23A 3E35A 2C31A 1SOUA 2O4CA 3NIFB 3T7EA 4F85A 4F8YA 3IR7A 3IA7A 3R3VA 1R15A 3V46A 1ZFNA 1KIAA 1Y8RB 4KO3S 5GV8A 2DHDA 1ISPA 4ZICA 3UWPA 4CODB 1JSXA 4JJEA 4ZGGA 4WOKA 3T3PB 5KNLA 3ITKA 4D6PA 1BX3A 3GLFB 1E9AA 2B78A 3FVRA 4M9ZA 3CCCA 1QRDA 1JQEA 1NXXA 4H4EA 1KY3A 1U0HC 2O2SA 2VVTA 3BFXA 4NBKA 1M7HA 2J7KA 3DBLA 4UNSA 3ZE0B 1RAAA 4QZVA 3OTOB 4CI0B 1PNRA 3NZEA 3M6FA 4KDFA 5AW0A 5ICSA 4DUZB 1T9DA 2G7MC 1RWKA 2I2BA 1ZOIA 1Q92A 3DOHA 4GRIA 1UJMA 2Y0DA 2FTKE 2ZRJA 3GAFA 5TRTA 4MINA 2E87A 4OFBA 2B1JA 3MFYA 3H2YA 2IU3A 1II9A 1WAMA 2H51A 1PQWA 3ESRA 4PYIA 3L7BA 4FX5A 2REXB 2YICA 4IIJA 4QGHA 4XDHA 1NXQA 3WL8A 1OH6A 1X15A 1RIFA 2AXNA 2X8JB 2ZETA 3H4IA 1S3GA 3IHKA 4JMPA 1XUOA 5JANA 3U7HB 5KDDA 4G01B 4I5DA 1J5EB 2B37A 2YMQA 4JKOA 3CKLA 1DTWA 3FI0A 2B5WA 3PQ5A 2F1KA 5EMLA 1JHQA 3AONB 3ONVA 1Z6ZA 4NS4A 2Z8XA 2G9NA 1WSAA 1BZYA 3AF2A 5JSYA 4E46A 4XVCA 3WQQA 1P4JA 1O6ZA 4ESHA 3LKDA 2UZ0A 5A3JA 1U0SY 1CF9A 1AUVA 4OUDB 2DUWA 1QUFA 2HYDA 4B6PA 3KJGA 3A1NA 2GPWA 4YRDA 1GZVA 3UMYA 3O8CA 121PA 1GV0A 2GZSA 2PMWB 2ROQA 2ZRPA 4JI3B 4DLKA 1J97A 2BKAA 4FMPA 1X7XA 2G6TA 1YZTA 3BRQA 3DBOB 3I5AA 4Z0TA 1HWYA 1EYZA 4B3SB 2QP4A 3S40A 4FYJA 1EA7A 3FHCB 3Q3IA 3NI2A 1RD4A 2CKMA 4QDOA 1Z0DA 3EDMA 2PFKA 1O6BA 1V5IA 2FQXA 5DT2A 1QQ5A 1AH2A 4OLHA 5IJ9A 4M0FA 1Q7CA 5KNCA 4RTNA 2VDLB 1K7EB 4S0ZA 4L9WA 3QXCA 4IS2A 4D5EA 1PWHA 4TZ6A 4QJ3A 4KVFA 3B6KA 5TQ2A 5ADWA 4N7BA 3L01A 1N4AA 2P1RA 1Z5OA 4YRLA 5HJ5A 3RTAA 1M2VA 4XYBA 1QO0D 3N86A 1CW2B 1P4GA 3LF2A 3V8EA 1HYEA 1NW7A 2JI6A 3NHUA 3OT1B 4D57A 4A0HA 1EFRA 5EUCA 4TSFD 4CGYA 4DG9A 3SQWA 3QOWA 4LOLA 3TE6A 3H19A 4UBNA 5KDOA 3SVZA 1FFWA 1GY8A 1P8JA 2FZ4A 4B3FX 1KBOA 1V1JA 3AHFA 4WZBE 1E3JA 2WWVD 5BMOA 4MMZB 3H6KA 3STWA 2ZATA 3EZXA 4OJKA 2V74B 3UAGA 5JPDA 1N57A 4MW4A 2NU8B 5C8ZA 2AXEA 1A2QA 1K3FA 1EINA 1Y6QA 4PG4A 2AZTA 5I5GA 3RSZA 1QNFA 3K8ZA 4LOIA 2F9FA 3TXXA 4EPWA 1P73A 2UYYA 1H85A 1K8YB 3E8SA 4IWYA 4RTQA 3UAYA 4WBNF 4Q7MB 3QUCA 1FXUA 1UADA 2B69A 3RLIA 3DL0A 3SIWA 3WK5A 3D6TB 3S2UA 3RS2A 1D6NA 4AU1A 3PIRA 4Q7JB 3LUDA 3D1VA 4F96A 2F3UA 4F1WA 5KKNB 3KJHA 2SKCA 4RK1A 3UCEA 4DLPA 2BFBB 3WLIA 2ZSUA 2CJYA 3E1KA 2NUPA 4K9QA 4EW2A 2B8TA 2CLDX 4C06A 2RGCA 4A8HA 1V26A 2ZDQA 1FUKA 2FFRA 3MTEA 5F1OA 1WNFA 3WHIA 2PKWA 1IJKA 1F2DA 1XCLA 1XZJA 3L7IA 4BMVA 2Q3MA 4RE5A 5AKEA 4W9MC 2SCUA 3SP1A 4N41A 2NZWA 2AYXA 2VF5X 2E55A 5JVDF 1U9CA 2V7WA 3DD5A 1YR1A 1M75A 1Q95A 3EF0A 3WMEA 4ZHQB 4OHMA 2P27A 1L5OA 1OV6A 1UR5A 1JPVA 1R18A 4FONA 4GI5A 4GVPA 5LZ7A 2WUFA 4OJTA 1F2UA 1R0ZA 2B7LA 2J7PD 3T34A 4J4TA 4EWLA 2W2LD 3ZI4A 1DPGA 2YJ5A 3JD0A 4XUDA 4QBTA 3B2QA 4BN0A 4REOA 1GTL1 5C9ZA 2XUAA 2QLMA 2XQVA 5DM1A 5LIRA 4U8GA 3IAS6 1A5SB 1RAFA 2R97A 2YVQA 3VMMA 3WV4A 1G3QA 1TM1E 2WVAA 1ZCBA 4PS0A 5CW2A 4Q7QA 5H3CA 5JADA 5JARA 1VE1A 2V9PA 4MCAA 1PGOA 2O0MA 3NBYC 4WY2A 3HQ4O 3EULA 4LDJA 4AJ9A 4FCCA 2X1LA 2QR3A 1QLWA 3EW9A 3GWZA 3MJTA 4ZIRA 2IPMA 1KI6B 4WLFA 4ZI3A 1BXRA 2F00A 1WETA 1GZ3A 3I37X 3NW9A 3T9DA 3ZXXA 5CVTA 1AXEA 1PQUA 3LDAA 4RCVA 3JQ8A 2CMKA 3OG9A 3SEZA 3F3YA 3CJQA 4MUEA 2J07A 2JVKA 4X41A 5LQJA 5CVEA 3BYZA 3KV3O 4EJMA 3LJKA 3G88A 2AS0A 4LV5B 1T0JB 2BFAA 3HP4A 3K35A 4JELA 3REFA 3BMCA 4A27A 1EVJA 2DBYA 2GTHA 2OCKA 3ND8A 1EA5A 5K8TA 1ZGZA 1EEXB 1J0BA 4F2GA 1P7ZA 3UG6A 3UUGA 1H1LA 3NBMA 2MU1A 4K6MA 3G85A 5JW6A 1DARA 1ZA1A 2QVLA 4I3FA 5KZMB 4UBLA 5FAKA 5IWCA 3G8DA 4F9EA 4R1PA 3H05A 1ZM9A 3CMMA 3H1AA 4FHFA 4JB0A 4M1TA 4ER0A 2WMNB 4HF7A 4UBJA 3TKAA 3FMFA 3QEMA 3TW0A 3CT6A 1LDYA 4AMBA 5AQ1A 5AVTA 5JZBA 3ZGZA 2RHWA 4E22A 5FKJA 4LRTB 5AI5A 1VP3A 4PZLA 2RH9B 4BYMA 1DV1A 5JXWA 1RZRD 3T9FA 3D8HA 3PHBE 4AKTA 2GPSA 3AZOA 4M6WB 3QFRA 4XCXA 2VAMA 3AVWA 4FBMA 2UXBB 1IUOA 2DH6A 2V3CC 2ZT7A 2CJFA 2BTQB 3EEFA 1L5YA 2CV2A 4AXXA 3GW8A 1E2BA 1XA3A 3IE1A 1JEQB 3NTOA 3DB1A 3OPNA 1O77A 1YBVA 3DTVB 2RHJA 4QG7A 1I1HA 1W30A 4R3UC 4MTLA 2X5OA 3P4UA 5MN5A 3RFTA 3G0IA 4Q1EA 4GQBA 3GLKA 4MVJM 4QBHA 4ZXFA 3ESBA 2R8RA 2IDJA 5T7BA 2WABA 1RJEA 1YVUA 4C04A 4ND6A 1ZA2A 3C15C 1ODTC 2SICE 4MDHA 4NP6A 4ACBA 4QHYA 4ZAYA 2P91A 5L3VA 1ZESA 2VFAA 2ZUTA 3TLBA 5FXMA 4CCAA 4DTCA 1ZW6A 5EXEA 5C8XA 2VUTA 4UFNA 2W58A 3LXRA 1I3KA 3UTCA 5HZGA 4G0VA 4OIFA 3ZX4A 1BMDA 1N34B 2V6IA 4DRZA 1HYGA 3WNBA 4WY5A 1ACMA 3DPSA 2JIOA 5DNUA 2WICA 2H11A 2EJBA 1EP9A 1TW2A 1N6IA 3EGXA 3GROA 3IP8A 3JD2A 4HDNA 1E5TA 3S6JA 2R1ZA 4JCCA 4XWKA 2HLDD 2PV7A 3K4HA 3MWEA 1S7CA 2BFCB 1P1KA 4NU5A 2V6GA 5AH0A 4BJ5A 1I3LA 1J7JA 2Y2VA 5DDIP 4ODIA 2VHZA 5HFNA 1W96A 4MW5A 3WKEA 1HFWA 3SNHA 1PV4A 2OT3B 2NZYA 1PJZA 3H65A 3AQ4A 3R3HA 4LRYA 4RQBA 2HJHA 3QA9A 1YULA 4BATA 2FLKA 4CIXA 2ZRMA 2CUKA 2ZS9A 1PBNA 4HRXA 1VFNA 2KE5A 2WFLA 4QPCA 2CNDA 2FUEA 1NKTA 3SYLA 4D74A 3DE4X 1TMGE 1HI9A 3PC8C 1UFVA 4MQBA 1QANA 4U9UA 5JMOA 1P91A 2VAPA 5GJCA 2XLBA 3SQOA 2VN8A 3H0EA 3HB1A 4G1FA 2ACEA 3NBQA 3H9JA 1VL2A 3RIMA 3LTEA 5K2OA 2QQGA 4WCVA 1YR7A 1PVOA 4AW9A 3L0OA 2BM8A 4QQNA 5FAXA 4TUYF 1ICEA 2QQFA 1M1NA 1DG3A 3B3FA 2AZXA 1I4DD 2D2FA 1EFVB 4DG8A 1ZICA 2XJ9A 4V24A 4FDVA 1Z6PA 4BE9A 4EJSA 1ID8A 2P5UA 1RJFA 4AC9A 1ZD4A 4AICA 1T36A 3DAHA 3BDIA 3BD6A 4BVEA 1M2EA 3QVMA 3EHDA 1M10A 1RAGA 4KLZA 4D0GA 4QTTB 3JSXA 4UU8A 3ZPXA 5FHQA 3DOEA 1M2GA 3CRQA 4X84A 3W78A 2COKA 2C8KA 4HDMA 4QUBA 3NWBA 2PL3A 5I47A 2RARA 4MUHA 4G0PA 2QI9F 2QE7A 5IUNC 3B6EA 1V2HE 4Q4JA 1FQOA 3S44A 1SU6A 3AXTA 4RACA 3C7KA 2AG5A 4UBMA 1L7XA 3C74A 3UFXA 3H3XA 4EMUA 1XEAA 1CKEA 2LTAA 1BN7A 1XRSB 4UAVA 1NHWA 4X44A 2RH8A 3HCCA 3MCTA 1BX0A 5C52B 4F7DA 2JPDA 2ZI5A 2EW8A 2ZTVA 1J2RA 4PINA 4G41A 4BBJA 1YQEA 2XCLA 5HYVA 5E7MA 1XU4A 3KS9A 3CSSA 4XGIA 4D9GA 1JDBC 3LCRA 3O8QB 3VR6H 1ZOLA 2YKGA 1NT2A 3H1EA 1HFKA 2V96A 3PPVA 1SUAA 2C03A 2E9SA 1CUUA 3ABRB 1U7DA 3AR6A 3M1AA 2BBTA 2XY4A 4Y6LA 3IUJA 3RVKA 1IHDA 1FDUA 3T5PA 2OK7A 3KJEA 4OBXA 3EIQA 3W4JA 1OMOA 1P1RA 3LA6A 1V96A 1Q5PA 4FYHA 2ZVDA 4K1XA 2Y6VA 4RIGA 4Q18A 3CKMA 3FIJA 1CY2A 3VGJA 5KTTA 3RKSA 4ZOQI 5AYVA 2Y71A 1KI7A 2QTLA 2XMZA 4XQEA 3WGIA 2FKAA 2OSVA 4GR5A 3SSMA 4D0SA 4R5HA 1G60A 4EF5A 2E5LB 4XFJA 1FNDA 3Q2IA 3P9CA 1R74A 1GGVA 3K9QO 2I1QA 3DKKA 5JI2E 5L9AA 3AT1A 1JBKA 3LUHA 3OU7A 1VLZA 3ICCA 3OZFA 3BORA 4MDEA 3QE3A 4GM0A 5JNLA 2JFPA 3AFMA 4WLUA 5KX5A 2GCPA 3LUGA 4RMIA 1OI7A 2RCYA 4D0NA 4E4TA 4AKHA 4P83A 1KP2A 1GR1A 1XJCA 4MW1A 1AKRA 4PZPA 1QOZA 4TKMA 4ZVOA 2L19A 2ZRLA 3I92A 4G26A 2GF9A 1C1HA 1HX7A 2QYTA 4KPUB 1PW7A 2RH4A 3FBTA 3VR6A 3WLJA 2GAAA 3AHIA 3BK2A 3C3DA 4X94A 3GEEA 1UJ6A 3TMAA 4RK0A 5BN1A 2JLUA 5C7LO 1OFVA 4JSYA 1UF9A 3BWEA 2UYGA 5CU7A 1ZN9A 3M1YA 3RRFA 4HADA 5AW1A 5L4SA 1D6SA 4L8YA 2HIHA 3P9RA 1K8XB 3KUCA 4V39A 1SUEA 2WC1A 1JQ3A 1VJRA 2BGNA 2YXEA 3UUWA 2XGOA 1H4VB 2FEAA 1QK3A 5E8RA 1JDNA 5EYPA 3ENZA 1EXMA 1I10A 3R4CA 4DCCA 3JQ9C 3KQTA 3U4DA 1CDDA 2KQUA 1EQUA 2ZYIA 4D82A 4BAGA 4NG5A 1TT5A 5EEGA 1UEIA 5K0JA 4BVBA 4G1BA 2GLUA 4NATA 4TMZA 3AUJB 2YQ4A 3E7DA 4HAWA 4W82A 3UEOA 3WG9A 3ZNOA 5CX1A 2YWCA 2ZRBA 2O0JA 1F38A 1JR3E 2AQIA 4DARA 3KLMX 3Q9NA 1PRYA 4B73A 1RI5A 2NZXA 3MSCA 3MMSA 3SNKA 2VYFA 1N0IA 1B0UA 2Z6QA 2HF7A 5AMXA 3JU3A 4Y6OA 1S2LA 2DFDA 1YFKA 5G53C 3S4YA 2KLHA 3NGXA 4OXQA 3ZWBA 2A9FA 4INOA 1ZNYA 3SXUB 1OGYA 3BF8A 1WXGA 1Z3IX 2D3WA 4KODA 4BO2A 4EZIA 5BUCA 3U56A 2XGGA 2EZ8A 2OHXA 5KREA 3GYBA 4UCQA 5KOIA 4D4LA 1DKRA 1SZPA 2ONYA 2XEDA 3HCOA 3R5XA 1M2OA 2HT6A 4L9SA 4UVEA 1E62A 2NYRA 2YBDA 3IOMA 4EVSA 3DBVO 2W2KA 2HEIA 3JCZA 4NDZA 3DJYA 1F0YA 1EPUA 2R44A 2C29D 16PKA 1KXJA 2IKQA 1YL7A 4X45A 2H7CA 4NBNA 3F7MA 3PJFA 1Z8HA 4BCCA 4FYWA 4LSWA 5BR4A 4Q05A 2F67A 2H8GA 2WI8A 1SNYA 3AFNA 3BXGA 3CF2A 1Z6GA 1IATA 2BEWA 3LA8A 3MPOA 2F3PA 5LZ5A 4HWSA 3BH6A 3I05A 3RTEA 5DWVA 3T5MA 4AKIA 3U1BA 1EAYA 4B9AA 4DF3A 3TZHA 1NR5A 3E9ZA 1F9AA 1YF3A 3DE2X 4W9RA 4JP1A 5ALMA 5DCWA 2OBLA 2P2DA 4F9TA 1KDRA 2EEZA 2KWIA 3MF4A 3BGWA 3QTTA 2XNJA 4R3NA 1UANA 2QK4A 3PF9A 4TMYA 4QYIA 1F5NA 1QAOA 1EVZA 2A5DA 2EBFX 1SK9A 2PZ8A 3A1VA 1ZP6A 3CEMA 3DV2A 3DW3X 4V3BA 4DMFA 1ZAKA 5HTKA 1S4MA 5KS2A 4J7XA 3O9ZA 4PLCA 4QQFA 1GDTA 1R5NA 2PAAA 4KAXA 2DTEA 3ZWWA 4JKIA 4PLHA 1QK4A 1KDYA 1PJ3A 4TL9A 1H2ZA 4RA9B 4HK4A 3Q5GA 4DG5A 3AINA 3RYFB 2I2FA 2C5LA 2WWRA 3L5KA 5IN5A 4B35A 7MDHA 4FMCF 3A0UA 2Y1XA 2I2WA 2OQVA 1BTOA 5DLYA 2JIQA 3CFYA 1AOXA 2QUHA 1HPLA 1V3QE 4I19A 3KSMA 2AE1A 1I1QB 4JLVA 4UTZA 4KQCA 5KVCA 2C04A 1KARA 2ZUBA 3DZDA 4YAEA 1D8TA 5BN3B 4EFNA 2W6ZA 4MLPA 1NJFA 4RETA 5EWLA 5EIEA 4KACA 3CPJB 3ZW7A 4EDHA 1C3JA 2RAFA 1P9LA 1XVTA 4NJMB 3G6KA 2OBXA 3LPAA 5CNKA 2IYAA 2IOHA 1TKBA 2CN1A 2XOXA 3JPWA 4JYMA 4JBGA 5J5AA 2E5FA 3OKFA 2VDQB 1CIPA 4KIUA 4GPAA 4EGFA 3OA2A 3SD7A 3IEPA 4UAJA 5LJLA 1IWPB 1NVFA 4L57A 1LBSA 1QHNA 4P58A 1ZYUA 3B6JA 2WWTA 4ZPJA 3T3MB 4DR6B 3IQWA 5C8YF 2VNAA 4YMLA 3MYYA 2RC6A 3K0CA 4M21A 3UJCA 1FTYA 3NVKI 1GZ5A 3EQ7A 4NJEA 4QFCA 2XQIA 3HUFA 1YKFA 1L8QA 1P29A 3OJWA 1LQUA 3QLVC 4RMNA 4OB8A 2C4TA 2ON6A 3LBNA 3FYUB 3NXKA 3ZZNA 5JZSA 3OFJA 3J81A 3ZQJA 4HPWA 5B3AA 3GDFA 3B1XA 2H1FA 4OHWA 4HGYA 4OD0A 1UBGA 3MXTA 2I7TA 2JFVA 2PQMA 1WB9A 3QF4B 4KVAA 3THXB 1I3CA 1FP4A 1CZLA 1ULSA 4TOIA 5FF9A 2V3VA 2IYYA 1NBEA 3INGA 1DAFA 1FVOA 2W6MA 4Q4AA 4RF2A 5EHQA 4LW8A 5I4CA 3NUZA 2C7RA 1LGYA 2ZS8A 1NN0A 3FPLA 2PSSA 3REGA 4C6TB 4IEEA 2C7QA 1AS2A 1ZJJA 3I04A 3MT7A 3Q8WA 1XMXA 4L3WA 2VJYA 4TSRA 3REQA 3VU9A 3CPEA 3TW8A 4ETIA 3CLVA 2ODEA 1CZKA 3WL4A 1P17A 1X13A 5BWMA 3M81A 4YASA 4CIWA 3EIHA 1YUMA 4MRNA 2NSJA 2WUVA 3K4PA 3PT9A 4FXPA 1YS1X 4OHKA 5TS2A 1CJTC 4EF6A 2AKYA 1A77A 1IQ0A 4JASB 5DM4A 5FH9A 3IUEA 1FFXB 4E21A 5K01A 3L4JA 2FVXA 2XI4A 6GPBA 2J5RA 2WAOA 1I4LD 2GJ4A 2J3JA 2O2CA 3H3FA 1W5EA 1C9KA 3QLTA 1G98A 1TK9A 1UJNA 3VYSB 1Y89A 1WTCA 5FIUA 3HUTA 4N7RA 3ZWDA 2JNWA 1SUBA 4IUYA 3KT6A 4N0QA 3RROA 3U2QA 3AF1A 2XNSA 4U4AA 4LY9A 3Q87B 3A9VA 2NT3A 3K0EA 1N92A 5CPFA 1UJCA 5TNXA 1GAEO 4FFWA 4B75A 2B20A 2H85A 1HYHA 1VJTA 4KQEA 4TV9F 4UULA 3C7DB 3C3EA 3FTFA 2ZRGA 3C41J 2OXIA 3FDIA 1E1NA 2V58A 2IXTA 1TEHA 3DFIA 5IKEA 1NKVA 3DH0A 4RZ3A 5HZKA 5REQA 1VZ2A 2M6LA 4GC5A 1EH5A 3BWCA 2HK7A 2V4UA 3BZWA 2G71A 4ND1A 1QYWA 4NU8X 1PX2A 2O52A 4OIMA 2V7TA 4WLVA 5KYUB 2FSSA 3FHTA 4Z8YA 4LXYA 3R5HA 3T3HA 2X8BA 2GWRA 1ISSA 2PS3A 1ADCA 3OPXA 3KXLA 1MVOA 3QJGA 1OIVA 3DULA 4F7WA 4M8NE 4AUMA 2H52A 2IHTA 5GZ3A 1S9DA 5ALTA 1OIWA 4JLKA 1QFJA 3DNMA 3ON5A 1F06A 4HCJA 4GKJB 3KKPA 1CUGA 2V6MA 3OIFA 4X7PA 4K8RB 1A96A 2JIZD 5EVJA 2X0EA 2ZYWX 2FUNB 3K9WA 1EKXA 4O59O 4EG7A 3BERA 3K8OE 2O3TA 5KSYA 5FX2A 5KPJA 1N5IA 3KKKA 4ZVMA 4MJ3A 4HS4A 3K0SA 3NM6B 1VM6A 2QAJA 2WOJA 2F3TA 3DKVA 3GRVA 2IGBA 3WDSA 2NACA 3DBHA 3H9BA 3O2SB 1U0NA 2GBGA 4UJ3A 3MB5A 1W5BA 5BMVA 1LLQA 1PFKA 2C4HA 2FW0A 1E66A 4C0SA 1YE5A 1JFVA 1E8MA 2F43B 2WYHA 3W77A 2JD0A 3WLFA 2IHJA 2ID9A 2IW3A 2P67A 3MEQA 1A8PA 2FMHA 2IZ1A 4JT2A 4PLZA 2AVDA 5GONB 4F1JA 4MX8A 2HCBA 3WI7A 2W8ZA 1TQ6A 4CDNA 1QO0A 1YOVB 1UPUA 1YRHA 2UUBB 4ZOCA 1CQJA 1MR3F 1O94D 1PFVA 4FMDF 4JJIA 2VP0A 1B6GA 4EJ6A 2J3KA 3RUFA 3W9SA 1YDGA 3LQQA 3AM1A 1XP8A 1ESEA 4V0MA 3DVAA 3WIBA 4ZPXA 2BFDA 4ALMA 5EJ9A 3QVTA 1RPNA 3GA0A 3OQMA 4YN3A 5KAPA 2VDNB 1UKEA 1X0VA 2XT0A 4RHXA 4FFBB 5EMJA 3WGLA 1I6WA 2ZI9A 2XGSA 5CURA 4DS3A 4KR3A 4X9XA 1S8OA 5LPNA 1SOVA 3CX4A 4LIPD 4IZ6A 5BOSB 1Z0IA 5AOBA 4DV2B 5C1PA 3GNQA 3G3EA 3AO0B 2DAPA 2FR8C 2YJTD 3HNRA 2BEVB 3AEUA 4Y0AA 5JCPA 2FPRA 5I7FA 4PC6A 3ZY4A 1WEKA 2YZNA 2ZSIA 1RZRA 5F3WB 3WIDA 4BVFA 2XV1A 1J1IA 2EW2A 1VA5A 2C4VA 2LGJA 4NCIA 1YE8A 2IYRA 3I1FA 2JA2A 3E9RA 5G0TA 1EVYA 5FFMA 4IOKA 4UHKA 1GGHA 2NO9A 4WLEA 1YKSA 5D84A 3V4SA 4YS6A 1E9FA 5ALGA 1ZLYA 1BIFA 2I2CA 2Z04A 4GI1A 1S1MA 3KR0A 2VPWA 2GCIA 2M9MA 3ODPA 3DEYX 3PXEA 4FNAA 1M5UA 4PSAA 3SX2A 1NNEA 3ZK7A 1EWRA 1RWOA 4XB1A 1R66A 5CFPA 1QTNA 1MQ9A 2ZP1A 3LNTA 2P9JA 1DKQA 2J32A 2Y6UA 2B4AA 3CYFA 3OQVA 4QELA 4R1UA 2AFHE 1SUPA 2IV2X 2J7PA 2AW3A 1QCYA 2QRPA 1E2UA 4ZVSA 4H6PA 4BBAA 5IK2D 4FOTA 4DRXB 2GF2A 3F5SA 3E82A 3TRIA 1DC3A 3ETEA 1IL0A 3HJUA 1DJPA 1NSFA 4UDOA 3AVXA 2GEVA 3KM0A 2NXEA 4NYMR 1X14A 3DAYA 3HKDB 4Q7KA 2BBWA 5JFTA 5LR6A 3MWLA 3EPRA 3HJCA 4Z86A 2V7PA 3ELUA 4MTCA 4WK4B 3EPLA 1ADGA 1AQYA 3EG5A 3N0RA 2A3NA 3QUAA 3AUFA 4HDRB 4HUQB 1XB2A 4HMQA 4MV5A 4RM3A 3V1UA 5JDIC 5KEIA 2IS2A 1QH1A 1R9JA 1CYEA 1EBFA 2NP7A 3L4SO 1L5WA 3AR3A 4RV5A 4MW7A 2YC2C 2HZBA 3WDMA 3CKYA 1LSSA 3E9DA 1BH2A 3NPAA 1HE8B 3RWMB 2GEKA 3QKWA 1T6BY 3A4NA 4LHSA 2K5UA 3ZDBA 2FPGA 1DAOA 1GZHB 2ZI4A 3TRDA 2PYIA 4I46A 4RHCA 3ORSA 4XPIB 2X0KA 3AR2A 2O7RA 1AURA 3LM8A 5JS8A 4HWRA 4X7BA 1ZJWA 3P9YA 1IYZA 4M0CA 1QKJA 1XFAA 3R7DA 2FMTA 3O1JC 4TV8B 2DKNA 4RLSA 4JI1B 1GRQA 3E3NA 4FSHA 1P7WA 4BO8A 1Z6XA 2ZIWB 1XKXA 3D43A 4X1IB 2KJQA 1LNSA 5BVHB 2O8BB 2ORIA 1XQ6A 2ZSDA 1RXIA 1GYQA 2PMCA 1K0UA 4BQPA 2RE8A 3DLBA 2IPXA 2OESA 1Y7IA 4HB4A 1YASA 2GEBA 1VLHA 3ASYA 3DZCA 4DMCA 1MC8A 5EHGA 4TMVA 3DEFA 4YJ3A 3D64A 4D8WA 3IILA 4A16A 1ZRNA 3IJ5A 4AKEA 1EWKA 5ICEA 4NTZA 3A9TA 1EUYA 2VXCA 2O2YA 2YXDA 1QB7A 2JLCA 4NAVA 1ZBQA 3TN7A 4ZK2A 2IZ7A 1T4MA 4G3XA 1H42A 5AM1A 1VIDA 2XWSA 4KPFC 2QVGA 1FY2A 1LF0A 1U2GA 3BTOA 2O19A 3BXXA 1IB0A 3L18A 4J16A 4XWOA 1QF9A 3NBXX 1P9NA 4ZOEA 1S1CA 5BQOA 3ZZ1A 1JLLA 3BFPA 5AUPB 4RD4A 2OMEA 3KU4A 3FMGA 5KJCA 1R0KA 3JYLA 5CIYA 1T4CA 4O1IA 5JAOA 1RVV1 10MHA 1KEUA 1TQDA 1Z7EA 3HV0A 3ET4A 1SZJG 2KW5A 3LP8A 5JNVA 5F7JA 4B47A 1JH9A 3PGXA 1L2TA 2WZBA 4LG1A 2YV2A 2RK6A 4YJFB 5BXQC 1J90A 4K6OA 4LJ8A 1SPXA 2ZRQA 4YACA 3PXXA 4AZ3A 4ARZA 4IIGA 3PDHA 2XB8A 3Q7IA 4I6EA 4MZDA 4N5NA 2FJ0A 5YASA 5K8VA 3TGPA 2HLDA 1GPUA 4EYOA 4FYIA 4OM7A 1D5WA 1WG8A 1I33A 3KQMA 5CG2A 2D06A 4MUBA 1GTJ1 2GEDA 2H06A 2WYOA 4HQKA 4YB8A 5TXGA 4JYZA 1Z82A 5DSXA 1F8UA 3ROEA 5FUQA 5CDYA 2GWHA 1FLAA 3AWIA 3M2PA 3KOYA 3RVMA 3HCAA 3WE7A 4CMIA 1DTSA 2OP1A 4DLWA 3DTVD 3OU6A 2POQX 2OFFA 3JWHA 1M8JA 3RUDA 3IQXA 5IYZB 3L8GA 3N2LA 3JVDA 3ELDA 4X20B 2GCOB 2QA5A 3R5FA 4LYHA 3V8PA 4TXNA 1VPWA 2C8JA 1IBCA 5TPWB 3OWXA 2WE8A 4K6KA 1E99A 2J9FB 1G8FA 1SB9A 2GD0A 1M6YA 4W8HA 5DGXA 2JLRA 1J8VA 1VCIA 1LVUA 3ED5A 3N8GA 4HWOA 5FA8A 2JH3A 5FUYA 3W8DA 4EYEA 3VZQA 3M7IA 1WZCA 1MTOA 2J0EA 3EEQA 1EZ4A 3GMTA 3HDQA 2DR3A 4TZ0A 4GLOA 4IM7A 3T7KA 5ALNA 4MYSA 1CJKC 1J22A 2AFIE 3B3GA 4F5EA 1XU7A 1X19A 3VH4A 4CKCA 4XVUA 1N32B 1KO7A 3Q5EA 1CUWA 4PW0A 1EXDA 4DLTA 4MRVA 1HT1E 2FJUA 3M5CA 4GQIA 4J2HA 1CJUC 4NFYA 4PV7A 4RUKA 4B4KA 5J2UF 2J3IA 1JMYA 1PJ2A 2LR0A 3B1ZA 5SY4A 2MR5A 1Z4NA 2QLLA 5CFZA 4F2DA 1VIYA 3QELA 3LBYA 4NMXB 2O8FB 2P6NA 5JEDA 4HUJA 3T35A 3NMUF 2X9GA 3AR7A 4V0SA 5E4JA 4QBKA 3SLGA 3SLKA 4D3XA 2PZMA 1JZTA 3INTA 1Y3IA 1AD2A 4EENA 2OLJA 1SXHA 3Q40A 5FOUA 1DOAA 3TQIA 1HTBA 4BLPA 2X40A 3IQGX 4YT2A 1AA9A 2FEKA 2I71A 1QHGA 1U0GA 3SHOA 1TLTA 3CW8X 2YXLA 4A73A 2Q0SA 5I9SA 2W0SA 4RD6A 5AKJA 1LBHA 3E1GA 2PBZA 3R40A 3X1KA 4AAYA 2J87A 3GLRA 2XA2A 2IOFA 4LHXA 3CLTC 3TJMA 1NATA 4V1CB 2OKGA 1A4XA 3VGPA 4F4HA 3GJTA 3AUAA 2R11A 5ES4B 1Y8QA 4LDAA 1T3ZA 3AOEC 4LZPA 3ANMA 4ENTA 4Y0VA 3RC1A 1MJHA 1LDMA 1LLFA 4HL6A 3GJSA 1GM5A 3QUTA 3W6UA 3ZBPA 3VKHA 4HYTA 5JXHA 1DXOA 2PCJA 2XX3A 5BMVF 1RRCA 5DNCA 5SZIA 5HCUA 3JYHA 3TRKA 3HVIA 2P0AA 3KJIA 3H8JA 2C88A 2PUEA 5AKKA 3A9WA 4I55A 4IIEA 2EKZA 2CDCA 3II6X 3ETCA 4BX8A 1YR2A 3Q98A 3RPEA 1E94E 1WOYA 2GK4A 2XMRA 3WGUA 1KHHA 3NEYA 2Q9UA 4B71A 2OG1A 4JUBA 5CA0A 1ZD5A 6AT1A 5FBVB 5CDTA 1Z34A 3TLEA 1PUXA 5DU2A 4LJ7A 2PE5A 2ZM5A 1TZKA 3P4XA 2O2ZA 2JK0A 1SKQA 3HU2A 5DW3A 3AR4A 1M83A 3QU9A 4QGAA 1ZM4A 1SPBS 1UBOS 2V8BA 4IIUA 4MSUA 5LJIA 1UC8A 3RUHA 1NUUA 3L8ZA 3GOHA 3HY4A 4OGGA 2ICAA 5FNVA 2YDXA 1R3DA 4RK4A 2OCAA 3LPLA 3W5UA 1GFSA 1VG0B 4R7ZA 3OZSA 4TL7A 3ROGA 2VTBB 3AZPA