4F2GA

The crystal structure of ornithine carbamoyltransferase from burkholderia thailandensis e264
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
302
structure length
290
Chain Sequence
IRHYLQFKDFSLEDYEYVLERTGILKRKFKNYETYHPLHDRTLAMIFEKSSTRTRLSFEAGIFQLGGHAVFMSTRDTQLGRGEPVEDSAQVISRMVDIIMIRTFEQDIIQRFAENSRVPVINGLTNEYHPCQVLADIFTYYEHRGPIRGKTVAWVGDANNMLYTWIQAARILDFKLQLSTPPGYALDAKLVDAESAPFYQVFDDPNEACKGADLVTTDVWKRAFADWCVDEEMMSHANSDALFMHCLPAHRGEEVTAGVIDGPQSVVWDEAENRLHVQKALMEFLLLGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ornithine carbamoyltransferase 1
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
total genus 110
structure length 290
sequence length 302
ec nomenclature ec 2.1.3.3: Ornithine carbamoyltransferase.
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
A PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4f2gA02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Aspartate/ornithine carbamoyltransferase 4f2gA01
4KGXA 1RAFA 3D6NB 3NPMA 9ATCA 5ILQA 3L04A 1TTHA 3L05A 3UPDA 4KWTA 4FYWA 3R7DA 1D09A 5G1NA 4WTOA 3TXXA 4E2FA 4EKNB 2FG7C 1ZA1A 3AT1A 1PVVA 2G7MC 3LXMA 1NBEA 2AIRA 1RADA 2BE7A 4A8TA 1RAAA 4KH0A 4ANFA 2FZCA 1AT1A 2ATCA 4IV5A 4FYYA 4FYXA 2QGFA 1VLVA 3GD5A 1EP9A 1C9YA 4BJHB 3KZMA 1ZA2A 3M4NA 4KH1A 4EP1A 2FZKA 1DUVG 3M5DA 4FYVA 1JS1X 6AT1A 1F1BA 2QG9A 3KZKA 1R0BA 4F04A 2A0FA 1Q95A 1RACA 1ML4A 2IPOA 8ATCA 1RAGA 3Q98A 3KZNA 2FG6C 2OTCA 1RAEA 1EKXA 1EZZA 1FVOA 3CSUA 2P2GA 4JFRA 3KZCA 1TU0A 2FZGA 1AKMA 4AMUA 2EF0A 4H31A 3R7LA 1I5OA 2W37A 4OH7A 1ORTA 2HSEA 1XJWA 1SKUA 4F2GA 3TPFA 2H3EA 4AT1A 4KGZA 2I6UA 1DXHA 5G1PA 3KZOA 3SDSA 4JHXA 3L02A 2BE9A 1FB5A 5G1OA 2RGWA 4JQOA 2YFKA 1RAIA 1RAHA 3L06A 1RABA 1A1SA 5AT1A 1OTHA 4AM8A 1PG5A 3GRFA 3M4JA 3R7FA 3D7SA 8AT1A 3MPUA 1R0CA 1TUGA 4KGVA 7AT1A 4A8PA 3E2PA 3M5CA 1ACMA 4NF2A 2AT1A 4A8HA
chains in the Genus database with same CATH superfamily
4B32A 1ZH8A 2A0YA 2WA1A 1E62A 1FUYB 3MMNA 4IIJF 521PA 2QK4A 1GAJA 3WWCA 4YAIA 1S3SA 1BVYF 3OPYA 4ZQBA 2XMBA 4QM7A 1NFFA 1Y6RA 1V9SA 2NGRA 2P40A 2WSYB 2YY6A 3AB3A 4V2IA 3PUHA 3SSAA 2Z0MA 3ZXYA 2I66A 1JIQA 4QTZA 5HZMA 3U7IA 2CD9A 5CIWA 4Y2TA 1HI9A 1A5SB 1WOMA 3WGVA 4DEYA 3GWGA 2J5XA 1Q0TA 3Q5EA 4GRDA 4ZU1X 1JLSA 4UBMA 1V8OA 4CRWB 1E6EA 4EJ0A 3K8ZA 3M4XA 3LRTA 3TLJA 3UIEA 1JSZA 2CBXA 1JMVA 1CY8A 1ZK4A 4RPIA 1KYVA 4E0BA 2H4FA 4TXMA 3EGXB 1QLJA 3EB9A 4MDYA 2O14A 3O5AA 1X1QA 3WRXA 2Q8PA 3ZV6A 1VPVA 2P6UA 3TCKA 3GYBA 3TCNA 1I7PA 4QLAA 2ZUEA 1P7CA 1C8BA 1XALA 1WXIA 2CNOA 2ZXEA 1T43A 3U17A 3WKCA 3NNNA 2I7XA 5HDQA 3ZKWB 3LTEA 2DFTA 2FSGA 1AO3A 4RA6A 5JS7A 3G2PA 3HI6A 4PG7A 2H2DA 2PL9A 5IAEA 3LU1A 5CMLA 3EXFB 2A6PA 2IQIA 4UBIA 3DF7A 2I3GA 4JA2A 1EUCB 3E9CA 3IQGX 1DAHA 3B82A 1AHHA 3DXZA 3LQYA 1ABFA 3WL5A 1NFQA 2ZZKA 7REQA 3H6HA 3H19A 3OURA 4MQUA 3ROZA 1GGVA 1GR1A 2C7VA 2VS1A 3KPVA 1VFNA 1ZXBA 1IBCA 1WWKA 3W3AD 3MA0A 4Q1BA 1DUVG 1AUQA 4C4SA 3N87A 4QRHA 1TO2E 1QLHA 3KPJA 2E82A 3Q0TA 4EEKA 3DO8A 5JNTA 3WV5A 3IJEB 2VZ9A 3QTBA 1ZR2A 4YMWA 3W5BA 3GVPA 3ZV5A 4MHOA 4DDWA 3IR5A 1YB2A 2HJVA 3TDMA 1NQOA 3RYIA 2VZEA 5FUXA 5CAEA 4HT3B 1F2UA 3TOSA 4D9NA 2A84A 5ER6A 2BRUA 1GG8A 2H1IA 1KMNA 2VRWA 1F8GA 4K5QA 2NTYC 3PC4A 3ROPA 3VDXA 3DHWC 3HVRA 2JIZD 2VJAA 2VXYA 2M6LA 1WXXA 5C7IO 3WRYC 4BEWA 2PVSA 1SBIA 1GT6A 1CUDA 3BD6A 4P4UA 1TM3E 1Q1NA 3E5HA 5EPEA 1ES9A 2QTWB 3GLHB 4XXHA 1NV8A 1W9MA 1J49A 2H92A 4ZYXA 4YPVA 1JWAB 1YDMA 1BO6A 4DARA 2LWIA 5T8KA 4NAVA 2G71A 1Q77A 1HMYA 1PW7A 1UANA 1ZLYA 3B3JA 3OCJA 3PFIA 2IE8A 2MJLA 5FI1B 6NULA 2VHYA 4V2UA 4R7TA 3AGQA 3T06B 3KKEA 4JCOA 4RGQA 2R8RA 1UCFA 4EBBA 4EZBA 2DP4E 1RVDA 1PQUA 3KB8A 1AGPA 3C6ZA 4XGQA 1B14A 3CT6A 2XHZA 2CUTA 3BBPA 2AI2A 2GAFA 3FDZB 3PFWO 1JLRA 4FN5A 4RMJA 4KO1S 1W88B 1JIXA 4TOIA 3LHIA 4WKNA 2HRQA 2W6OA 5AIBA 1F6WA 1GU0A 3RYFB 3EPHA 5IH3A 3WTCA 1E5VA 4FJ0A 4DCGA 1VJTA 2VTDA 4XWAA 1RJ9A 1T5TA 2MIIA 3JQAD 3LX5A 4XTRA 4BJ5A 4D0GA 5JMTA 3ND6A 4EW2A 3VVCA 3WICA 5C4GB 4RVUA 3WYBA 3U9TA 4UAGA 5BVGA 5C46F 4BZZA 3EUWA 4G9BA 3BMCB 3RU7A 4L9SA 3AP1A 2QTBA 1SG9A 4FP9A 1MAAA 2PRJA 4GOKA 3TS1A 2QLLA 2XMRA 5J4VA 4B6FA 3PNYA 5DX0A 3LF1A 1U8XX 4ER5A 2G5PA 2FPGB 4P9NA 3LJKA 4UQOA 4ZZ0A 2IP4A 2YFQA 3DWIA 3HA7A 1GNSA 2W2VA 2GYVA 1O96B 4AJIA 5AVVA 1XQWA 3VKGA 5GM1A 2ZTMA 5DK6A 1VMEA 4KFTA 1LVUA 4RKEA 4RTSA 1CUUA 3IALA 2IXTA 3G0IA 1P7PA 1Z26A 2AVNA 1E0JA 1WVGA 1NPDA 3MF4A 5CFZA 5J5CA 4O8ZA 1WXQA 3HCBA 4AD8A 2MSWA 5EE5B 4BC1A 2WUFA 2NVWA 3AUKA 4ASUA 5BPFA 3HXOA 3K6SA 4FE4A 4O2BA 1N1EA 4GUDA 3ZWNA 2NU6B 1U7HA 4XYEA 3GLFB 2EV9A 4ZGWA 5ISMA 2OOSA 4TKLA 3H11A 3DGEC 4DQ0A 1B43A 4LAFA 2VSXA 2JEOA 2JI6A 2PSSA 3M82A 4YPFA 2DXIA 3VDQA 4CM9D 4MI9A 5HRUA 3FZNA 4JU9A 3UJNA 2OK8A 2QMUA 4GP6A 3AVYA 5MN5A 5CYGA 1P9LA 3K94A 2C96A 1VE3A 2CLKB 4EY3A 4M1MA 3IV7A 4MW4A 4MHTA 5IT9A 5FP0A 2DHRA 3VSBA 1J2YA 2O7NA 3EW9A 1WZIA 4KG7A 3RRFA 4CF3A 2VPZA 4H7HA 4BWYA 1GEEA 1SBHA 1F9AA 3HYNA 4MW2A 3WLTA 1J8QA 2I4MA 4NP6A 4OI0A 3ADKA 1XP5A 1YZVA 4C6TA 2D62A 4QGGA 4TWAA 4XWWA 3EGDB 3KKNA 4LI0A 1MUUA 4YUXA 4BNNA 5H9WA 2G8LA 2VHEA 1YU9A 4GM1A 4BNWA 1EDEA 3VH3A 3ZUGA 3VPXA 4HLDA 3ZCQA 1BVHA 4MZXA 3KQPA 2VBIA 5FAKA 4A0GA 3C5VA 5KOHA 1PK9A 3AEXA 3QNMA 5IDXA 2I67A 3KO8A 3CN7A 3U4IA 1UBRS 4H4EA 1QU3A 1ICEA 2I8LA 2IJGX 1JSCA 1H6BA 5TC4A 3STHA 3ANSA 2O50A 2POCA 3JVUA 2PUGA 2ZUVA 2AOXA 5L3ZA 1X1CA 4X1KA 2IPAB 2QMZA 2GM3A 2AG5A 4OHVA 2HNAA 2YY7A 3SIXA 1FB5A 1OSNA 2EL9A 4FLFA 4FR0A 3U3OA 4EYSA 2B35A 3EYAA 3CG4A 3RFCA 4OXIA 1UBTS 5AT1A 1R8QA 5LPNA 1WF3A 3BA1A 4LWOA 3R7FA 3VAZA 4NFSA 3M89A 3R4VA 3N0TA 2AJTA 4HPXB 5IUKC 3RJ9A 3WGYA 1YFLA 4KR6A 1DKUA 2Y1EA 3QW2A 2MMGA 1E3WA 3LUDA 4HBGA 1G17A 1ACMA 2ZB8A 2MT9A 5DGIA 5KYKA 2H1OA 3DTVA 2QZSA 3C1TA 1TJNA 1CG6A 2FY8A 2Y1OA 4FLMA 5LNK6 1D1TA 5DI9A 5CB4A 4CL8A 2I4RA 1F2DA 2Z30A 3H84A 5ALJA 5HGXA 2W0SA 3V8MA 1H2AS 1WY5A 1HGXA 4Q37A 2OXIA 4ZHSA 4J6FA 3F5FA 5C31A 2IHZA 1G5QA 3EXHA 4RV5A 4KLAA 4YRIA 1JFVA 2BF4A 2ZI7A 4UU8A 4CL2A 4JP2A 5ETJA 3R6TA 1DDOA 3FPEA 3OTHA 2J31A 4O6VA 4UM9B 1IWOA 1UXOA 3BQ9A 3ZE1B 3I1YA 1T3TA 3B1YA 3I28A 3B6ZA 4J0QA 2FX5A 1YDEA 4IXNA 3U7HB 3GPDG 1V96A 4LVUA 1R8YA 1EUDA 2O1SA 1Z47A 3BIXA 4NE2A 3UVEA 1RADA 2GN0A 2GSWA 2VRNA 2ODQA 3KPUA 4PSAA 4E2WA 3ZHXA 1IPHA 4XX1A 4B74A 3QEAZ 3C6YA 3ENQA 4LRWA 2ZBVA 5AVYA 1LSSA 4JBWA 1FBNA 2BP7B 3B2NA 3C70A 1I4EB 3LKZA 1XF9A 3WLRA 5BNIA 2DECA 1DSSG 3NIGB 1MAWA 2A9QA 3GCWA 4JEUA 1A9OA 3JQEA 4IJ5A 1NVDA 2WVAA 1C9MA 2I2XB 3PRYA 3FWZA 1JB9A 2REQA 3PU6A 3N39C 4RMNA 1YS4A 5DM0A 3CLRD 1KAHA 1SZDA 2IUTA 4UXIA 5K8JB 3ICCA 4G4IA 2L2QA 4ZO8A 4K9PA 2AOUA 4GOMD 1GUFA 1U65A 3O9MA 3H7AA 1BIFA 2B2NA 1G19A 2P3SA 1Y8CA 1A69A 2BR3A 2XE8A 3D4OA 3SICE 3X44A 1FLVA 1AQJA 3JTMA 2QIOA 4P92A 4ZYWA 3KELA 2PZKA 1KH3A 1N0WA 1POWA 4NEQA 1OPRA 2JIQA 1D2HA 1SWWA 4DWJA 1U7DA 1USWA 2JFPA 4DDKA 4FU0A 1XELA 4A2QA 3G2HA 4QYTA 5JFOA 4R2LA 4F4JA 1BXRB 2B7BA 4R9NA 5B1IA 4YRNA 2X41A 3HYTA 4IHKA 3V4OA 2HCBA 1UBNA 1P3Y1 4QO8A 4Z9BA 3ASYA 1U0NA 4DCTA 1J90A 1N1MA 5GJVC 1Z73A 4X7PA 3BXHA 3CWQA 4DMLA 1KH2A 1R0RE 1WO8A 2Q45A 2ZE6A 3MLAA 1WQ1R 5KKNB 2CCKA 3IELA 2E4VA 4W5OA 4F6CA 1I3CA 3V2IA 3SZ3A 5ERYA 2PO5A 3GFPA 3TQRA 1I2CA 2FF5A 3QLEA 2F3RA 4B3CA 4N3CA 2HBRA 4CIBA 4KP7A 1RE1A 1HY3A 2OYSA 3RYCA 1N9GA 2GWRA 2JLBA 1DBRA 2COEA 4NG4A 1OFUA 2ZSUA 4ZI2A 5EWJB 2H1RA 1LA2A 1HV8A 2DT8A 2LGJA 4CDGA 3X1MA 4AJ4A 4JWKA 4Q4AA 1SUDA 4IOJA 3RFXA 1KJNA 1K92A 1E32A 1U80A 1E9RA 1F3OA 3INGA 3NB0A 3DAYA 4MS1A 4MMYB 4ND8A 1H5UA 2KX7A 5K1ZA 1UMDB 4MLDA 2IEYA 1JHDA 2G82A 2XD9A 2PKXA 4MKHA 5LBUA 1NVEA 4BVLA 1AKUA 2ZW9A 3PNVA 1K63A 3HWRA 1NG9A 5INTA 5IKOA 3TIFA 2O2ZA 5JJCA 2WQ7A 1I6LA 1CNMA 5C1IA 3Q1LA 1LDBA 1TKCA 5D1NA 3L1HA 4BNFA 2C9BA 5LLSA 3D9QX 2XNDD 4HB2A 3SC2B 5A6SA 3P9XA 2VLIA 4TUYB 3IEMA 3QIAA 5JMWA 2FMTA 5KYVA 1HZJA 1SOWA 3DQZA 2FR8A 4PYRA 5C34B 2EJVA 1HT2E 1Z4PX 2IYLD 1C1DB 3OIVA 4CKWA 1N5JA 1ZN9A 3PHCA 2Y77A 1NL3A 3EQ2A 3EEYA 3H3XA 4IWNA 1QGOA 2C98A 2Q8QA 3FR7A 3ILXA 4OXNA 3RYHA 4FDLA 1PTJC 4URFA 1DJOA 2HSDA 5IK2D 1MO5A 4RNDB 3EQ8A 2ZRAA 1HFWA 5BWLA 4M83A 3INRA 1RNLA 3NEPX 3BKWA 4E5VA 3STVA 2GARA 4UOQA 1IHUA 2VCEA 1IATA 4B6EA 4N01A 4ME6A 3UHOA 1IOWA 1CZKA 2VNIA 1ND5A 1Q92A 3C3AA 2EVWX 2BEKA 4L5YA 4Y9RA 3OQ1A 3QXSA 5HQJA 3WYCA 2LRHA 3D8TA 3UWMA 4I4CA 2F6RA 1U1FA 1F9EA 1G291 3F6RA 5I9TA 1L1EA 5L3VA 2ZRGA 4AY6A 2P62A 3P9NA 2D2FA 3F2VA 4MPRA 2R1TB 3E58A 2SHKA 1OLUB 2QDXA 4G5OA 3ZE9A 8MHTA 3ZDAA 4IGFA 2XUIA 4MAMA 1PDOA 3WK6A 3OF3A 3L07A 4J7UA 5DEIA 4D56A 3QV1A 1UK6A 1PGJA 5FNVA 2ZUWA 4AICA 3CUWA 2AZTA 1LTKA 2E55A 1N6HA 1U0EA 4DKJA 1QXSA 4U39A 3B52X 1R00A 2V6FA 4RA9B 3CLKA 3ZD7A 2FPWA 2HYDA 5NLLA 3U3ZA 1Z7YA 3G5UA 3QUSA 2XKKA 1C30B 4LOHA 4R54A 5CA1A 1ZJWA 4PSCA 1S2GA 2A67A 5KB3A 5DNEA 5EN4A 1KP3A 2VWQA 4XI9A 3REQA 2IYUA 4NC9A 5DLYA 4L2IB 2PXCA 3F3SA 1U1GA 4S1TA 4C7MA 4KX5A 5G0SA 1GL6A 1N0IA 3IE2A 3FBTA 3HXTA 3G2LA 3SFZA 3Q88A 1OXSC 1QH8B 4DV5B 1GKIA 2VH2A 2GS9A 1DO2A 2ID8A 3KB1A 3WMWA 4AN4A 1CDZA 1SCUB 1W85A 4DREA 5I3CA 3NALA 5BMVA 3WGLA 3QEJA 1HNXB 3DUFB 4CKCA 3I30X 2HSGA 4OHWA 3SYKA 5K0GA 1MENA 2H08A 5FA5A 2GCGA 1IC6A 1ZCJA 2FX3A 1L3IA 2IPLA 2Q1TA 1ZYUA 3ZV4A 3C3EA 3PYXA 4K2HA 1TUIA 5IRCD 3BMOB 2QSZA 5AKIA 2ZB3A 2B8EA 1CQZA 1RAHA 3PPIA 5B3LA 2FK7A 1A97A 3FAKA 2Q9CA 3FMOB 1Y5MA 3GIDA 1NVWQ 4FLEA 3DYVA 3DLPX 3PITA 4JNKA 4CKEB 1MC5A 1ONBA 3NG1A 1U7TA 4HXEB 4O5OA 3STYA 4G09A 4N39A 2EARA 1FJGB 4M6WB 3H5TA 1H3NA 4LKRA 4RO0A 2ZSJA 4FEYA 1OXKB 2C4VA 2GHQA 4C29A 2E0IA 1C9DB 2O8EB 1CNEA 2QYTA 3ESZA 5BQPA 4CM5A 5B36A 4IIHA 4DMCA 3OT1B 1YZ3A 2H31A 3U9SA 1Y3IA 4LRUA 1CRPA 1E18A 1JEAA 5KQGA 1Q11A 1E64A 1EVQA 1F60A 3HABA 3IVAA 1EXVA 3JD3A 3UMVA 3U16A 3L46A 1MIHA 4ENUA 3UTDA 3O8QA 3JWPA 3ASUA 4WAUA 3KT8A 3E48A 3MM4A 1H8ED 1E3MA 1M1UA 5K3AA 3FLAA 4R7ZA 1TYBE 1XJ5A 4XCXA 5F7ZA 4FBLA 1WB6A 2W8ZA 3NLLA 1NOIA 4CNQA 3ZU5A 2QVGA 1GYRA 2BZGA 2JVIA 4DSZA 2HMAA 1XQXA 3PD1A 2O2IA 4YJGA 1SUEA 1YHZA 3JD1A 1L1FA 5IF3A 2J07A 2BMWA 3LWBA 2NV6A 1OLXA 3L7JA 5EWMA 5K3FA 4WXYB 3ELBA 4NULA 1F17A 1M2FA 4NFYA 3QJYA 4EX6A 4Q7LA 1XZEA 3PG5A 2WDZA 1OX4B 2IYSA 1ZBDA 1XBTA 3OC6A 2BMFA 3G1UA 4WH0A 4D0RA 2WB2A 4M0FA 2F8TA 2VP3A 4C7VA 1EQ2A 3OEYA 3V4RA 1JFTA 3OJXA 5C35A 5K0SA 3IIEA 4JJEA 2QLFA 2DQZA 4M0UA 1KPIA 2P9ZA 4JBNA 4RD3A 5CW2A 1WSDA 821PA 4UTNA 2O1XA 4P53A 1USIA 4C30A 4EGQA 5HX7A 1TPZA 1UFQA 2WM8A 1TYCA 3AUJB 3MTGA 3T1YB 4O33A 3W8DA 4CHGA 3PCTA 3KKOA 4JB0A 4WW0A 2A94A 3EPKA 4QU9A 3NS7A 4BXOA 2YL2A 2H2GA 4EHNA 4ZYZA 1YR8A 4FJ2A 4HBZA 4PX3A 4DCPA 2JJ2D 4LXGA 2I2AA 5IARA 4F9FA 3EHDA 5CGQB 3AV3A 1Z2CA 2FJUA 1PT6A 1X8XA 3WNDA 5GV8A 4XWTA 5KWEA 4LN1A 1L8LA 2E85A 1VGVA 2WIAA 3EAQA 3IP9A 2ZI9A 2QHXA 4HQNA 4Y0NA 1TTPB 2PAAA 2C42A 3DZIA 5B7PA 4O0MA 2HHCA 5KQRA 3KQKA 3ONDA 5DBEX 1E3TA 1FX1A 1TFRA 3QE0A 4E3WA 5C4MA 4C4AA 5JQGB 4L9RA 4ZMRA 4HQ0A 2V7UA 5JQGF 1FRNA 3OTGA 4RY8A 1L8OA 3V00A 4Q3NA 2GPBA 4QHYA 3K20A 2C2OA 3U60B 1IJKA 3ZJ5A 1WMFA 1M3SA 2PUWA 2QXTA 1RCTE 3CLHA 4PGHA 1QOQB 5CFLA 2BYTA 1WM1A 1HYBA 4I1RA 4PZDA 4CLDA 4LQCA 2B69A 1GUBA 2WUEA 4IDFA 5DGHA 4DC1A 1G64A 3CLTC 5JO9A 1WUIS 3AU8A 1RXSA 4G9GA 1EFVB 3CJRA 1WUHS 1SK8A 2F3TA 2WRZA 2G1PA 2HPAA 3DLTA 1UP6A 4OXQA 1W44A 2IYNA 3RSGA 1PNRA 3W6UA 1HQDA 4EJSC 1Y82A 3L6DA 4K03A 3P4XA 4JT4A 3ZLUA 1E3IA 1LC3A 4KJXA 1M8KA 5TIIA 4DRXB 4UTRA 3WXBA 1I4DD 4KGXA 1XZGA 3ZOZA 3OCUA 1SGWA 3SQOA 3T5DA 4D4JA 4UXJA 1SPBS 4JQCA 5GZ3A 2RHRA 5D01A 4HAVA 4R2IA 3WJ1A 1A4IA 1Z7EA 2ST1A 1XK6A 4FNAA 3X1XA 5KJFA 4FZJA 4HNQA 1NUQA 2G5TA 3BIOA 2XXJA 3H5LA 4KRXA 3AVUA 4FGJA 2PA3A 2I76A 1RKQA 2PGAA 2RGNC 2B5OA 4XUDA 3V4VB 1MKYA 4MKFA 4RTQA 1GZ5A 4OQYA 4XSGA 3IV9A 2PDAA 1MH1A 1TA0A 3NTOA 4XJSA 3RIXA 1KMIY 1LRJA 2WKSA 4CEHB 4IEIA 4G8BA 3I9KA 3S5UA 1DIOB 4P3YA 3D2BA 4D2IA 2P6OA 2HHHB 2NV2B 2TECE 5FDFA 4WERA 4XQEA 3WRWA 2HMSA 1LPNA 3P26A 2BGGA 3DHVA 5IYZA 4JBHA 1KSFX 3QHPA 4BL5A 1BDMA 3VUFA 4GZ6A 4FI3C 1PZHA 4P54A 4NBRA 3EXIB 3GGSA 2P68A 3OPVA 3ZWYA 2Q3FA 1LY1A 4BNXA 4WFQA 3KQQA 4NDNE 2DFNA 4CDMA 3OQVA 1G1AA 3EAGA 4BZQA 3V8RA 3SJAA 2IIBA 1OH5A 2ZWMA 1RBMA 2MSEB 1HFEL 4BLTA 1V4BA 1P1BA 1YQQA 2UVDA 3JATA 3R5SA 5AOBA 5JYEA 3SDBA 3L1KA 2ZWAA 4MB0A 4IDDA 3RVBA 2R25B 1MB3A 2P7HA 3RGGA 1Y9AA 2GRUA 3GFSA 3JAWA 3JQAB 2H51A 3R7WB 1BU5A 3ZY4A 5LFAA 4BIIA 4MVXA 5FQOA 1S4MA 3TSAA 3WFZA 3LQ4A 3NGMA 4AKSA 4EP1A 1RPTA 4N6NA 1BU8A 2GB4A 3FKSA 4RPHA 3RRMA 2DEUA 4JC4A 4K6KA 1IZ7A 1YKSA 2P9CA 2HRZA 3BRWD 5JLAA 5K0TA 4GLFA 2CMHA 2ZJYA 2ZRJA 3GJ5A 3HU3A 5LL6P 4IEFB 4CEJB 1V48A 1WW3A 2Y2UA 3FWKA 3NIDB 3PPVA 1U11A 1H42A 2XWQA 3GARA 4KV9A 2B9VA 3QA3E 3UBTA 3ZY3A 1LGYA 1EQAA 5KDLA 3UHPA 3NIWA 2CBZA 4MR9B 1EB9A 4DCMA 1VLJA 1R7RA 2BI7A 4ARCA 2EATA 4N76A 1KMCA 3K4PA 1UBMS 1GPBA 1PYGA 1U3DA 4ZFNA 3MC1A 4B75A 5KHLB 1JEDA 3IUNA 2CJXA 4IIYA 1VPEA 3NFRA 4QT0A 4GQAA 3GHYA 5IMBA 5C5CA 3LFTA 3OICA 4YCNA 2AN4A 2FX2A 2WMOB 1HA3A 2PBZA 2A0WA 1XL0A 1NX9A 3DC7A 3JYQA 4ROTA 4UCXA 1NW4A 3KJFA 4JI3B 4DAOA 1SZCA 1AQLA 1GFZA 2DRIA 2PY6A 4MA5A 1QE3A 2B83A 3NO4A 2PSHA 1V11B 3I05A 4BGIA 4E4YA 2VP0A 3I0ZA 3CWZA 1F2TA 1XG5A 2F1JA 2ECPA 2YVKA 3FDJA 3UJBA 5ELXA 1GYQA 1W19A 2HV9A 2Q0XA 1L7PA 2R2AA 3D0KA 3E70C 3C3CA 3ETHA 3KFXA 2WVHA 3OQIA 1D2NA 3QVGB 3TIIA 4B79A 3DMRA 4BWFB 4OJQA 1KMQA 3FOAA 4J0EA 4N65A 1RPZA 3RVPA 4CFSA 4TKUB 3RDPA 4DDHA 3PGXA 4UNSA 2WTNA 2Z83A 1S1CA 2M1ZA 1UMCB 1ESDA 3I9MA 4J2TA 1E3JA 3ZGNA 4GWLA 1UM9B 4KR0A 4B0OA 5FT9A 2EW1A 4RF5A 3CSSA 4NRDA 4B6SA 5AUOB 4G0PA 4CKYA 4DR6B 5BNTA 2PR7A 1II8B 3BMNB 3UM9A 5TR9A 5IT5A 2B6NA 2GZMA 5CRIA 3N59A 5IJWA 4NPAA 3BM5A 3FTNA 1RHQA 4KUEA 3HXMA 4O4HA 4HWGA 2P8JA 1ECBA 1N7HA 2I55A 4LE0A 2CJYA 2OHIA 3K1ZA 5ARCA 3WGNA 1J06A 1QIDA 2PFGA 2IYRA 3O03A 1E79D 4YEDA 1TQ2A 2FXVA 3S8YA 3N8KA 1QFMA 3C7TA 4U2DA 1BVRA 1AGRA 2A92A 2BOVA 3G82C 3L8HA 1NGSA 2VK1A 2FPIA 1RHKA 3MGCA 3Q7IA 4G1EB 2JBWA 4EKNB 2SBTA 2YNMD 3HKDA 4H1VA 5FL7A 2GTPA 5COBA 2DLCX 3DDWA 2BEVB 2N1MA 3F74A 3LC1O 1D2RA 3WL6A 1UPBA 4WZZA 5CH8A 3FTDA 3HPRA 2FVYA 4FGZA 5DM2A 2HQOA 2FLVA 3R1IA 1ZKMA 1XUOA 3ICWA 2YIVX 1PIWA 4LC1A 5FTKA 1F0KA 3LLCA 4YV1A 4BB5A 4P93A 2D2EA 2SKCA 2VQ6A 5DNYB 4LJ7A 5AJZA 3O1JC 1RC0A 3I37X 4LGYA 4RADA 3IDZA 1IBMB 4IZIA 3D64A 3MAGA 5FR1A 1L7AA 4WNAA 1XAGA 3SXUB 3L0BA 2F4VB 4YLEA 2RB4A 3K2IA 2G3YA 4OKIA 2ZREA 1I4LD 2EX1A 2QYSA 3EZ2A 3FOWA 3LYLA 5D7BA 2ZB2A 2ZSHA 3HCNA 1ZMTA 4ZT2A 2A9FA 2I8AA 3TFOA 4YAWA 1EYZA 1FMTA 1TKAA 4BBJA 5I7VA 3GLKA 3DLAA 3TLYA 1G55A 2ZRNA 4PAWA 3JQ9C 2D1SA 2EC5A 4QGHA 3Q3VA 1TO1E 3HXQA 4L16A 1JVBA 3VNVA 5IDYA 3IRVA 4H3KB 4Q3DA 4KI7A 5E9QA 1J21A 4PHTA 4JLNA 1LNSA 2Q3EA 4EELA 1BOOA 1TIBA 5LQSA 1VJRA 3VR2D 3STWA 4KO2S 5CG2A 1SB8A 5DGXA 2AHOA 1BMFD 2CLIB 4BAZA 3EQZA 1WUKS 2J9XB 3HEBA 4MV7A 3TD2A 1C81A 4S1PA 1LDEA 2JGJA 2XMQA 3F8SA 2PXHA 1FYVA 5IAAA 4PZAA 4AF7A 2W6MA 4ND4A 3OX2A 2JLQA 4PFKA 2QIPA 3NKLA 5BNFA 3Q8MA 1O9HA 1DKMA 2WWGA 4DLTA 1OYYA 1PJ2A 4J0CA 3D4IA 1LNZA 4GHWA 4AQDA 2W6ID 1JEQB 2CEAA 3R3HA 3WDLA 2DULA 2W6ZA 2A9RA 1T3SA 2ATEA 4I9NA 2G8NA 4X71A 2DBRA 1AH2A 3AM4A 3IGFA 1MF7A 3JYHA 3I2JA 4YUZA 3NV7A 2B3TA 2LPMA 1YQTA 4BE4A 2P0YA 4PS0A 1CQWA 1B3RA 1X38A 2DPYA 3N7UA 3R4CA 5IPFA 1R8XA 3EF0A 1M75A 4MGEA 2NX2A 1M5RA 3LBNA 4KX3A 1M72A 2HJHA 1I1HA 2XF8A 2YUTA 3AUYA 3DFIA 4P81A 3VV3A 2DHDA 3FHJA 3L8ZA 3FYUA 4ZQEA 1N2CE 4FW8A 2ZE7A 4NOKA 4A8PA 2ZE8A 3GEEA 4EJ6A 3U4MA 2I22A 2BL4A 4IIEA 3ENVA 1KVSA 4RIHA 3WIBA 4CMEA 2VDUE 3EIQA 4UM8B 4LHSA 1QHIA 2ZYGA 2ERYA 2Q3JA 3FDFA 4J91A 4DQLA 4ZCMA 3PHGA 4TROA 4LYDA 3S2SA 3TNFA 1ISSA 3WYEA 2PUCA 2QW0X 4QDKA 4F5YA 1OJ7A 4RETA 2D5LA 4XPIB 3RG2A 1K5GA 1C80A 4X92A 3UB4A 3G9TA 1GDTA 4WPGA 2UXDB 2W2LA 3M9LA 3P9CA 3GWZA 4PZCA 1D2MA 3O93A 3R7DA 4D96A 3GG9A 5D85A 4QXRA 1DOAA 1R0WA 1FVXA 1O95D 2VPIA 3JQRA 5M3BA 3RTBA 4BFCA 1V5WA 3ET5A 3KKQA 4DKXA 4EVSA 4JKOA 4LQ4A 1UPXA 1Y9ZA 3F2IA 3KYDA 4XSVA 3ORHA 4YR7A 1VDZA 2Q5LA 3C3BA 2ZJAA 1Z38A 4JQSA 3ZHSA 3JALA 2W70A 2ICAA 2Y76A 1T1IA 3ZZ1A 2CFOA 4FOTA 5LQNA 2C2XA 5CFMA 1GADO 3AP3A 4HNRA 2YZGA 2EQAA 5DX1A 2YKGA 1SA0B 1FE8A 4YV2A 4PX9A 5KKAA 4F4HA 5A4DA 4BB9A 4UDYX 3MT0A 4YFVA 4ZT7A 3OEWA 3VR4A 3AERB 1VGRA 1N2CA 3BEOA 2CHGA 1SCBA 3PUZA 4KYUA 2RBGA 3IEKA 1GPAA 3AONB 5CA0F 2QRJA 3MTJA 2O8BA 1TLFA 2AC2A 4OBWA 4W4TA 3RVRA 3TD9A 2NSHA 1G8KA 2GT1A 5LOVB 1UDWA 3A1SA 3GOHA 2I6TA 3DBHB 5T4FA 4G81A 5EERA 5LOVF 5LNK1 2VIIA 4MPPA 3EXEB 2ONZA 3A7EA 2RAVA 3TZHA 1OWOA 3LS2A 1MOQA 1THTA 1U3FA 2OT3B 2R68A 4AZVA 5IC4A 2GUGA 4KOAA 1Q95A 4RD6A 4DLSA 4L75A 2F67A 1ADJA 4ERNA 1UZLA 2IX9A 4MGYR 4M4SA 4Y2YA 3WB1A 4D5EA 5HPYB 3PK0A 2FF7A 3AR4A 1E1DA 2XZDA 4ZQIA 2P1DA 1XCMA 2P2CA 1R6AA 1CB0A 1Q0HA 1JIVA 5HRCA 5JBIA 4MIOA 4MWGA 5F4ZA 4ZVSA 3G8CA 3UYKA 2GXQA 1VJCA 4AYWA 3GHHA 4OKSA 1B6SA 3MJCA 3WO0A 3JAKB 3OU2A 4C1NA 1KWKA 4EJSB 1RBYA 3LK7A 3A2KA 3H0KA 3EZFA 2B5VA 3LY8A 4B7CA 1QV9A 1JBQA 2A1TS 5I9MA 2O0HA 4NVRA 5JNRA 2CCGA 3L1VA 4HEJA 5TXGA 4EUSA 1G9XA 5JS8A 1AO0A 1UC4B 1ZH4A 2HTEA 3RRBA 4HUTA 5CDFE 1MJFA 1NF8A 4LYFA 1BHO1 3KLBA 1KK1A 1XKLA 4UNPA 3QVOA 4XQ9A 4K6MA 4WESB 4WKBA 2ZRDA 2P3LA 5JCOA 3W9YA 4N8EA 3N3BC 4AU1A 2QX8A 4L1KA 2WT8A 3F5QA 4LSZA 1QU2A 3OLZA 2V5UA 1OC4A 1C3JA 5HIIA 3D7RA 4LYAA 1KA9H 3IS3A 3JXEA 3DMFA 1NSFA 3DV0A 5DO9A 3GJTA 4DLVA 1PBNA 4BX3A 4TL7A 1IVYA 2RAFA 3D3NA 3PUYA 4PANA 1WDKA 4YAEA 3VC1A 4F4CA 4LX0A 1DWQA 3ZWMA 5CLLA 3UT5A 3K9GA 3OZRA 1NKSA 3KDAA 2XX3A 4OAQA 4QRIA 1WPQA 4JENA 3U13A 4RD4A 3J80A 3ZGOA 3BZBA 2CNNA 3QWBA 2C94A 1W59A 2HL6A 5AP9A 1ISMA 5HILA 3SKYA 1V3QE 4D82A 1PJCA 1M5TA 4Q0MA 1QYDA 1OKKD 3VZRA 1FXUA 1RWBA 3NHKA 1KAQA 1N1DA 4NENA 3L7IA 1QO7A 1BE6A 1YRQA 1SU7A 1RXVA 3HDHA 2R97A 3SE7A 1EDDA 4UKDA 2V58A 1KGSA 4WKGA 1JUDA 4LXIA 3M83A 3W8RA 4AJHA 3MJFA 5CDFA 1U2GC 5TS3A 1EK5A 4IS3A 3TQIA 1WETA 1V8FA 5IC6A 1DBVO 4C7OB 2CVOA 3R76A 2G5GX 3WSTA 3QEBZ 1QIKA 5EVJA 4HB3A 1DU4A 2VNJA 3ANLA 2LCFA 2NPFA 3JZMA 3U37A 4ZYTA 3SJBA 4DMGA 1A50B 4BKRA 1NRXA 1X8JA 1XOIA 2QTZA 3M5WA 4JMLA 3WLEA 2YN2A 1QRDA 5K0LA 3PQEA 3WA6A 2ZYRA 2LZ0A 5EC8A 2W0MA 1DCFA 3B3GA 1TRHA 4ED9A 1E2NA 1BS1A 3V8QA 1B0AA 1FU8A 4X94A 3UKDA 4G4SP 2O05A 2NZ8A 1NJSA 4FE3A 2GA8A 4HXGA 4LQDA 4WT7A 4EHKA 5LQJA 1GPJA 1NXVA 3QVSA 4L9AA 4XGIA 4ZZ1A 4KQHA 5JY6A 4B85A 5A06A 4ZO7A 4U7WA 4J1SA 5GP1A 2V1UA 4FYMA 3IPYA 2H52A 2PUJA 3EZ9A 3I6QA 5JJBA 2XUPA 4K26A 2P65A 4L5AA 5CYPA 2ZT5A 2YW9A 2BTQA 2AN1A 4JNCA 3KHKA 3U26A 4P2BA 4YC7A 3LSTA 1YKFA 4B6OA 3K0SA 1MO6A 2CV0A 2Q2VA 5HQ3B 3RD5A 1Y33E 4FFVA 2FQYA 1VJDA 1BXGB 1IZ0A 1KDPA 2IDKA 3T5MA 5KTOA 1THGA 3SBOA 3RC9A 1VJ5A 5H70A 5KYTA 2TMDA 2WFMA 2ZAGA 4MARA 3PB3A 1CFJA 5AICA 2VXBA 4QEDA 1D6NA 4LBVA 4BQSA 4PG6A 1OZ0A 2OORA 5JS2A 1VL6A 5KQSA 2P2SA 2EJCA 4G25A 1YASA 1L5NA 2WTXA 4JAVC 1R66A 1FW8A 4IGKA 3S6JA 4EPWA 2JLSA 1AKYA 4Y2RA 1AZWA 1O94C 1DAFA 1TIPA 1CLUA 1R6VA 1MTZA 3N2EA 3FB4A 1VLZA 1XJWA 3FPLA 3TEJA 4CQLB 1K27A 4FHZA 2WJ6A 2DETA 5KYGA 1T0HB 2WJGA 2P8SA 3S2FA 3ZWXA 2IUYA 1ZGZA 4TLLB 1Y42X 2UYYA 3EG5A 1PCXA 3EGXA 2FWNA 3OBBA 4E6PA 1NBOA 5FRDA 721PA 2O0LA 5HKLA 3PE6A 2YZNA 4RBNA 1JKMA 3EWSA 5T57A 4R8KA 1A1SA 4Z4EA 2OBFA 1IEXA 2JAOA 4PSKA 3HVHA 3SS9X 4PXAA 3GLHE 2UUOA 3DYIA 2C7BA 3RWOA 3A6FA 4BQIA 3ZKWA 4EL0A 4HZUB 5IM4F 3F7MA 3FWPA 4H6WA 1P2FA 3OD5A 3AMVA 2NXNA 3C14C 4JBIA 3BXZA 1AZLA 1QCYA 5BORA 5K8TA 5KSWB 1AKWA 3EXFA 2WF7A 4YK7A 5TV2A 1A9ZA 1ODKA 1EUCA 1MNQA 4H0NA 5ALYA 5IEJA 4G5FA 1OXMA 3PRHA 1T8PA 1DCMA 1T2NA 1YULA 2XQGA 1EGHA 1O8BA 1HC7A 3BCUA 3FNGA 4HDOB 4OFWA 3OZSA 3A37A 3DTYA 3KQMA 4F3TA 2XYRA 4V0NA 5DGCA 1LV7A 2Q4RA 1WVIA 3I45A 2WQZA 1DMRA 3KUUA 3KVVA 4JBLA 4M99A 4QUIA 5L40A 3V4FA 1X3LA 1NOKA 2GX6A 5EWLB 1TMGE 3WKEA 3U3MA 4CU5A 3GJXC 4E3ZA 3A3NA 3MGGA 4Q24A 4Q7MB 2AUNA 2XE4A 3Q3GE 5EMNA 1NQTA 1U8UA 2WJJA 2JHGA 4P0TA 1OXUA 1UXKA 1K3FA 4AKGA 2R1ZA 3H9BA 3PC7A 1E77A 2XOKA 4PCAA 4W5RA 1CUWA 1DG9A 3K35A 4F9EA 1DO8A 3BWYA 1GKYA 3EE6A 4OYHA 5AW1A 5TMPA 2YC4C 5EXPA 5J40A 3B5IA 4MSUA 1F0YA 2X8WA 4FW9A 1KJ9A 2QMYA 3H99A 3PGVA 4RVNA 1H85A 1LW7A 4Y6RA 4B9AA 1NW3A 4PYIA 3MS7A 2OV8A 4E70A 2L42A 1XWWA 3GLHA 2CXUA 1RLJA 3JWGA 1TYZA 1O89A 3PENA 4CXMA 2GR9A 1ZSYA 4RFLA 3DEHA 1K0FA 1XPUA 1DKPA 1U7ZA 2R47A 3JWEA 4I7EA 3RAJA 2XPCA 4L7VA 4R1LA 4BU1A 1FYXA 1TVMA 1BYIA 4MVWA 1JR4A 2FQQA 2CE7A 3D1LA 5BR1A 1QVWA 2XT6A 4PPGA 1CDDA 1IULA 4YRJA 1OAKA 2XUZA 4MV1A 3ZWQA 4B4DA 2QUAA 5DWQA 3RBVA 4IKEA 5M7EA 3TE7A 1TC2A 1GNQA 3QVUA 4I6EA 2D2XA 5A9RA 3FDZA 1U9ZA 2YWBA 2ZSDA 3HR7A 3OU7A 2YOHA 3P7MA 4R16A 1RDFA 4Y9SA 5AOCA 1W88A 1T10A 1PGPA 3WADA 3WAGA 4D9FA 1W75A 5DCYA 3GLFE 2AYYA 3RYFA 4ER3A 5LUAA 2NN3C 3LWNA 3P45A 5T6MA 4WGGA 4PPFA 1MQ8B 2KI5A 1S8NA 4NARA 2DBZA 2G0AA 4QYIB 4H3HB 2GNPA 2HBQA 4XIYA 5ECDA 1FJ2A 3CF0A 3AF4A 1BCSA 3NH9A 2X0NA 4FDVA 1F7VA 1Z2NX 5IXJA 1FFDA 1LWOA 5FLKA 3BMCA 5A0TA 5HKKD 3TFQA 3SM3A 5TJHA 4IFEA 1PWXA 1Z29A 2F3SA 3AR9A 4H77A 4AW9A 1XZNA 4ISBA 4RLSA 4QBFA 2XJ4A 4KPFC 1E5QA 2FPGA 1CP3A 4Q7EA 4BP3A 1O96A 3IO5A 3OTQA 2WKPA 1E3LA 1JSRA 2X5XA 3ZU3A 1XNRB 1Q0SA 2ZM6B 3Q6IA 5CW1A 3Q8XB 4LRXA 2W2KB 3VPCA 5CM8B 1IZ9A 1DV1A 2ECKA 2JZCA 3RC3A 1DUIA 1GYPA 1WUJS 1R3DA 2B34A 2B1IA 2JCSA 2ZB7A 2YJ3A 3DJYA 3MTBA 2Q3BA 4LNAA 4MW6A 5DHFA 2XT9A 3BQMB 3WLSA 3O7WA 3KAJA 3NBQA 3SOZA 2JKYA 3BAFA 1XVIA 2WYHA 5I01A 4KACA 3EIUA 4DTCA 3ZCUA 4EPYA 4R05A 1JLKA 2QNBA 2NU6A 3SX2A 3W3AH 2V6MA 5M5BA 3GLFA 4OJTA 3RV3A 3FFTA 3KR9A 4KUHA 1R16A 2ZAOA 3HNOA 2J7PA 1MX5A 1RFGE 1B41A 1TTHA 2IE0A 4B47A 1KPHA 3A8TA 3F6CA 4RD2A 1JPNA 3ND5A 1QRSA 2C31A 2YXBA 2XUGA 4MQEA 4IHJB 4BUCA 1TU3A 3L1JA 4ZCPA 2EZUA 2K7ZA 4IHJF 2NVUB 1WY7A 4QPDA 3U3RA 2N3ZA 2WSBA 5FD8A 1WPRA 2FG7C 2Q2QA 3X2FA 5JZOA 3BWBA 4KREA 3H86A 5I7SA 1GPMA 2J30A 3MUOA 1GAWA 2NQTA 1XDDA 3EGDA 3G8DA 1AZTA 1Z7WA 4WMLA 1CV2A 3O4IA 3ZDRA 5DT2A 5BUZA 4AKHA 2GAJA 3PICA 4G1FA 3IUSA 4K9RA 1X3SA 1HPLA 2IPNA 1E1QD 3DZJA 1MH9A 4ZV7A 2FPKA 3CH6A 3IMKA 3NDPA 3PL5A 1L7BA 2P35A 3EXG2 3F49S 3QE3A 3QWAA 1CJSA 4GYKA 2OKGA 1U90A 4MGZR 4QOSA 4HWSA 4NL4H 3KJZA 2FZCA 2RK3A 3G2MA 1RQ2A 3IOCA 2D0OB 2ETXA 4FZ3A 4GLOA 4IUCS 1NW6A 4LHXA 2FNAA 5A3VA 3SC6A 4L8VA 3WYDA 1AKVA 1UDAA 2B0JA 4FYYA 3K8YA 3AJ8A 2WYUA 4IXMA 1TGYA 3V3TA 5KDDA 1EI9A 1GPDG 2XUFA 2QD3A 1HOTA 4GOND 4LOJA 4PS1A 5LP1A 1PLJA 2R65A 4I36A 3IL2A 3CUUA 1KWGA 1ZP6A 3EULA 4B6RA 3W5DA 4HDKB 4FYVA 4JR1A 4RUKA 4KK4A 4JC5A 1E6MA 1V6AA 2IUSA 4TLEA 4YGXB 2RG1A 3T5GA 5A4IS 3CZPA 1SCDA 2PMWB 1S7CA 2VQDA 3MOSA 4PNZA 4BNGA 5BUSA 1Q0LA 4CIYA 4N4AA 3VJMA 5BQ3A 3QOFA 4KFRA 1R37A 4G67A 4IDQA 4ND1A 1RHJA 3AF1A 1NN3A 2X3UA 4ZJPA 3PHBE 1QAOA 1OT5A 1IL0A 2L0XA 2FSSA 2PS9A 1ZNXA 2R9VA 4G86A 2ZYHA 1F6BA 1PYOA 4J16C 2CUNA 4X3PA 4WN3A 1NVVR 1NZJA 4UPDA 1Y7PA 3HGMA 1CYDA 5FA6A 2CFCA 3OLQA 5EP2A 1BCRB 2FN4A 4WCDA 1UJ5A 3DWFA 1GXSB 1B93A 3VR6D 4Z51A 2DJ5A 2AD5A 1QR2A 3TWOA 3VPDA 5ALFA 1PNTA 4AY4A 1UC8A 4R8SA 1EUQA 1KDOA 3N76A 4ID9A 4JI1B 5ILOA 2YTZA 3BSYA 1EFAA 3O8OB 2W6JD 2AW3A 1A82A 3FSRA 4AFNA 3KPWA 5G1PA 4PZPA 3EJ6A 3G0GA 4Y2GA 2YY5A 3ESDA 3PQCA 4I1SA 4JJFA 1HFJA 4FFBA 5ESRA 3SYTA 2R6GA 3AZOA 2E4UA 5FV7A 2BEJA 4QNNA 2H2FA 3A31A 4XE5A 5JARA 4XUEA 1PG5A 2N0SA 4B6JA 1J25A 1QDLB 3DVLA 3ZQKA 5E1BA 4O1MA 1VCMA 2C7QA 3IB3A 1KP2A 4ZHQB 5DHTA 1JEJA 2BP7A 3R8XA 2A8YA 3AIIA 4ZHQF 3U56A 1ELOA 3O38A 4NF2A 5B2FA 4Z0HO 3MWEB 3LUBA 2Q7OE 3USZA 4AQYB 3OJOA 4LK2A 5IWCA 1KY5A 1DRKA 1K3TA 1UKCA 3PUWA 4N12A 4D74A 5A2QA 1YMUA 3ETEA 4FIDA 3ZJYA 2HN9A 3X0DA 3V1NA 3GVIA 4AMBA 4Y3UA 4D81A 3A25A 1W0JA 1QYRA 2XXAB 3CKLA 5IULC 1OFIA 3WBKA 4FYJA 4AI6A 1TD9A 2CK3D 2HF8A 2MSKA 5EIEA 5MGBA 1QRRA 2WYOA 1TEHA 2PSFA 4YY3B 3JQBA 3PNQA 1FBTA 3TNLA 3PQ3A 1C0LA 1RTKA 2KHZA 3A14A 4GO1A 3O2JA 4M7WA 4DUZB 3WL8A 3AM1A 3O9ZA 2YHSA 2C0CA 1SQSA 2QL7A 1CEXA 1RXEA 2VYFA 3K9NA 3R5FA 1JFFB 4V3CA 5JQWA 4EG6A 1NBMD 1EEHA 4EUEA 5JZBA 2VHJA 4U0KA 1TZJA 2C3MA 4RHYA 5BV2P 3TZQA 2I1LA 2HDHA 1BXRA 1X15A 1YBMA 5DYWA 2VUUA 4L6CA 3AG5A 3A0RB 1Q12A 2WHEA 4OY3A 1ODIA 4X9XA 5AKKA 1ZD9A 3P71T 1F7UA 1TM2A 5DN6A 4G8CA 1G4HA 3U40A 5BOSA 2Z6AA 2CBGA 3ZWVA 2QG4A 3GQVA 2CVFA 4FUQA 3OQOA 3SQXA 2FUNB 3KS9A 4BVKA 5E6SB 4OI2A 1JHAA 1BMQA 5FAXA 1STOA 4NYJR 1IM5A 3FYCA 2P4SA 2ONCA 5KCMA 5BN3A 1WB5A 1FZTA 3T3PB 5KSYA 5K2OA 3WMXA 1BD3A 1UZUA 5JI2E 2B4RO 5DJ5A 1CY6A 3R3UA 1SCAA 2JHCA 1WDMA 3R5JA 2AMYA 3OQPA 5JD3A 2VNAA 3UGQA 1CC1S 3GUYA 1JMYA 1EDZA 3PF8A 3U31A 4CZ2A 3LDFA 1HYQA 1Y3BE 3EQ9A 1PJ8A 5BYBA 4M37A 5EWJA 4CNBA 1CD5A 2QTAA 4FXPA 4Z7OB 4EG8A 1G7CA 2VSFA 1J42A 4PO3X 5A4AA 2Z2KA 2GJAA 4NCJA 1FQWA 1G60A 2WU3A 1Z45A 3T4PA 4BAUA 1EWKA 3O91A 3UG7A 1UZAA 4U7DA 621PA 1ZAKA 1FYEA 4DJTA 3P0IA 2OHJA 5C5EA 3LNTA 5IHPA 2HA7A 4OQXA 1O5OA 2B6HA 1M2NA 1UMDA 2CNWA 3PNLA 4U63A 4W9NC 1I2DA 2MMCA 1FTQA 1P1KA 2C29D 2IWRA 2D54A 4L6IA 2VK8A 3P2MA 2GPTA 4MYHA 4AP5A 2GDJA 3PBKA 2GUWA 2OCPA 4F5WA 1LPAB 3ONNA 4BV3A 3SC2A 3QLVC 1V41E 1UJ2A 4TUYA 2WY2D 1E5DA 4DLZA 4TXLA 1DC3A 1P9OA 2GLUA 2NW6A 4ZJZA 5BSUA 1C50A 4J2OA 4XIFA 1WZUA 1GNVA 3ZVKA 1UAAA 1C1DA 5ALXA 3ZV3A 1N3IA 3HFJA 2DKOA 3LLMA 1YB6A 1PJQA 4QGSA 3WIOA 5EJ4A 1ZC3A 3MWYW 1Y34E 2NUTB 3PP8A 4DS3A 3AR8A 3G89A 1DI0A 1Z8HA 1TCVA 1SVOA 3MTEA 4DDMA 1AXGA 3GRRA 1GPH1 2YRXA 3Q0IA 3TLXA 1F3LA 3EEFA 4RF2A 1P9RA 1U3CA 2RGEA 2FW9A 1GV1A 4XTCS 4A9AA 3A3OA 4I6JA 3RJMA 1I33A 3KJNA 3W6NA 3B9BA 3Q0EA 1UBLS 1T15A 2ZSKA 1EK0A 1VBNA 2PLAA 1B0UA 5AK4A 3VBEA 4W1RA 4DLBA 2DFKB 3LBHA 4LGMA 1GKUB 3FUCA 3SX4A 3L7MA 4LISA 2EERA 1L4KA 5EPOA 3GZTB 3JYLA 1I80A 3HWSA 4BLQA 2R1TA 2QWXA 1M8FA 1OLUA 4MINA 4FGUA 2Y1DA 3SFTA 4GLBA 4MUMA 2ZATA 4WLFA 2IS6A 5E9JA 1I3LA 4LY9A 1X7WB 5B2ZA 3BB3A 1RSZA 1N4AA 1H66A 5JCZA 4LZWA 5AXAA 4CF6A 4FDUA 4LYHA 1FLDA 2YWDA 1EXNA 2C03A 1PNOA 5TX7A 5EJ5A 1BHSA 5CHEA 5BQ5A 1VBKA 3WK8A 3P4UA 1KYIA 4CT4B 3HBAA 4AUKA 2F3QA 5ELMA 2IBSA 4B8YA 2JRLA 3A3PA 4RA9A 5KNBD 1FNDA 1LLQA 2UYHA 1QO0A 3H1EA 4YV7A 1C30A 2G06A 5HDBB 2OR3A 1AV6A 1KC1A 3QMPA 1KXJA 3QY0A 4G5YA 4A8TA 1QPZA 1UMBB 2OB1A 1P4GA 4N5HX 4MX8A 1Z62A 4Y6GB 4L2IA 1J2JA 1YIDA 2JH3A 5A1TA 2WIBA 1NIJA 1CW2B 1Q44A 1IHDA 1DWUA 1X7GA 2FPXA 3N86A 3PC3A 3PHJA 1LEHA 3PR3A 4JR2A 2Y27A 4PFQA 4TYQA 1QH8A 1O4VA 1E59A 1G5TA 3LIPA 4IV5A 1SCUA 2CMFA 4IY1A 3ET4A 4N6GA 1U0TA 1SG0A 1OZAA 1Z0AA 2Q7XA 3DUFA 5AHKA 3SHQA 2BFMA 3T4UA 1SU6A 3EH2A 4BO0A 1GGJA 2FPPB 4GXQA 2I2WA 4BE9A 1B8NA 4F5ZA 3U44B 4P08A 3MVEA 4EATA 1O97C 2X0EA 1PGOA 1MJGA 2EIXA 3L82B 3BMOA 3RIEA 2FFBA 4RXMA 3P96A 1XTRA 3S81A 3ANNA 2QOEA 3O8BA 4GEGA 1RXYA 1ONPA 1E4YA 3RVMA 2YIDA 2UZAA 1IEQA 3CVOA 4P5EA 3NAGA 2O6LA 1K8YB 2LTAA 1KS2A 1A4UA 2WT4A 4M6WA 1TYAE 4KRGA 4TSRA 4W5TA 4X44A 4OK5A 4IVPA 4IEEA 2CMGA 5CPBA 2O8EA 1TK3A 3OJCA 2JK1A 5D6OA 1AQ6A 1DJNA 1YVUA 2Z56A 4WK6A 1XVUA 3OT1A 4JFAA 1CQPA 4Y6PA 2Z98A 3THOA 3EIOA 2BI4A 3CM0A 4FWTA 2C5HA 4JBGA 1YDGA 3MTDA 1KI7A 1UDXA 4BDTA 4WASA 3CNLA 1Z13A 4CMBA 1EFUA 1L5WA 3KKZA 3GDGA 1E2EA 4GXRA 4H31A 4M9CA 3ZS8A 4H0CA 2PRIA 4NX2A 3W2TA 4JUBA 3PE4A 1I7SB 2HLDA 3HB1A 4OQMA 5DTJA 3TPFA 3CB2A 1E66A 2P9BA 5K0EA 2Q2OA 1A8UA 1Q0PA 3AR3A 4ENWA 3DE3X 1RHRA 1YBVA 1T4DA 1K7SN 2J3EA 1P0CA 4I8IA 4LYGA 5FFFA 1J4AA 4B45A 2RGWA 1DO0A 1KJQA 1SIOA 3DOIA 4P6VF 4P80A 5MN6A 3R41A 1IUOA 1P2DA 3DBOB 2JAXA 3X1WA 2CKMA 3E53A 2E5WA 1OX4A 3DR5A 2RSLA 5FWDA 2WIJA 1WHTB 3GF4A 3FUXA 13PKA 2QRPA 2DWQA 4RKRA 4BP1A 3BWEA 1A9SA 3FR8A 1CRLA 2R4UA 2IEIA 3IBTA 3ZDFA 3MAJA 2VLBA 3ROXA 3TTSA 1HH4A 4AO8A 5HF5A 3NI2A 4JEHA 1I3MA 4BNTA 4LFBB 3T3OA 1HTWA 3NHJA 3R7SA 1ZOPA 3Q9SA 4M8SA 3FF4A 4K05A 2JGMA 2Q6OA 3LDHA 4EUHA 5EIBD 3HGQA 1HDCA 1M10A 4NE9A 4BTVA 5K3SA 1PR2A 3EHEA 1VE1A 4ZOAA 4ZAGA 3ZI7A 2HEIA 2ID9A 5CURA 2F3UA 3AEKB 4M22A 3G23A 2VP5A 4JJAA 3WMFA 2ZYVX 4UZFA 3O2NA 1MPTA 3LVBA 4MS3B 5WRFA 2VO1A 4IPTA 3KV1A 1YZTA 1PJTA 3JARB 4GYYA 1EHIA 2VR1A 4N5NA 3K0AB 4OQLA 4UEQA 3I8SA 3TE6A 4TXHA 3FRHA 4YP1A 3WOHA 1CHDA 1EPUA 3RGWS 1MQ9A 2QTCA 3ZBQA 4CG1A 2XE6A 2F1IA 3DBVO 3PUXA 4PC6A 4D26A 2ZDHA 1C3VA 1KNXA 4YX9A 3KUCA 5JQGA 3DEIA 3H2IA 5I9LA 1K08A 1OBVA 3EC1A 2YRFA 3IEVA 4JL5A 1YGPA 4M9SA 2Z5VA 4RPLA 1VA5A 1I5EA 3CX6A 4CG2A 2VNHA 2Q4BA 3D3EA 3FW1A 2OCDA 5JRJA 3RS5A 3V9PA 4AZ0B 1MDBA 1DEAA 5KU7A 3R75A 1W8DA 3NXSA 4EDFA 5ALWA 4K0RA 1WKBA 3NZEA 4X90A 1ZAYA 1I7LA 3KOZA 1JEOA 4H4CA 4OV6B 2EBWA 3JZFA 3ELDA 3V2HA 1RM3A 4Z8XA 3SPXA 1N2SA 4EA7A 4U7JA 1OQAA 4DLXA 1GG9A 3ZHRA 3ZWKA 4NYIQ 1RAGA 1NRJB 1CETA 2EWVA 1H1LB 1G5IA 1ZXLA 2G83A 2XUKA 3H4TA 1M6WA 4RXUA 4TMVA 1HE8B 4WFJA 4NIMA 1JTFA 2GFIA 3U9LA 2HBYA 2ZRQA 4DRXA 2FUEA 4KQ1A 4DIMA 1PEKE 3BB1A 4K2AA 2R44A 4EG5A 1GTRA 16PKA 4DXHA 3HLTA 4WXPA 1EA7A 3IEPA 4E1AA 4DSUA 5C37A 2II6A 2JIZA 2GFHA 3UT0A 3FOBA 5LP6F 4QEZA 4QQ8A 4US1R 3D4NA 3CO5A 4FK8A 5I7AA 4AYXA 4WL0A 3RU2A 4OHPA 3A05A 3H9JA 3DSRA 1JE1A 2O1EA 2Z5LA 4QJIA 2XQIA 2NU7B 2YCLA 3BE5A 5CT9A 5DISB 3I8OA 4F9GA 1WW8A 1Z12A 2HRRA 2WWXA 2MHCA 3K2QA 3WB0A 2C1XA 4DQVA 4NESA 2ODPA 2HT6A 2GBIA 1Z56C 1QHGA 1SKQA 4GX5A 1CRZA 1PFWA 4DT1B 2Y9PB 2R8EA 3IPCA 1YQ9A 1XLVA 4EHLA 4KLCA 1Q0QA 1K6MA 1L5VA 2AFVA 2NT4A 4JLUA 4ZI7B 5F23A 2ZUFA 1JJ7A 4CF7A 3OWOA 4ZI7F 4TV8B 1H3FA 4HTFA 4BQEA 3SM9A 4NEHB 4TV8F 1JJVA 1WW2A 2QRNA 2ZJ2A 2ZIVB 3AYZB 4BFXA 2UYQA 3NRCA 1KGDA 3EXIA 1EDBA 3GPIA 4Q4LA 3TUIC 5AUNB 3K9CA 1A72A 4O25A 3P0FA 2VHXA 1Y4UA 4FILA 3ZHTA 3UOAB 5F2KA 3TKLA 2NU8B 4CLRB 4PGGA 3UCXA 3WK9A 5HK9A 3R8FA 2GEFA 4IICA 1QHNA 3TSOA 1V6CA 5HK8A 1XTUA 2VBCA 3OLYA 5AI6A 1T1EA 1WPXA 2R6R1 4CMAA 4M86A 3JQAA 1HE4A 3R7WA 4ZZ3A 1PZNA 1COZA 3KTAB 1EFHA 1E98A 2G67A 4EM6A 3NBMA 4JZYA 4M1OA 1LBIA 4IRUB 5A6VA 1RYYA 3WSVA 3IKVA 1YUBA 5F3DA 2WQ6A 1WZ2A 2I2CA 1YUMA 1N8NA 4Q3BA 3RJZA 3K0CC 4PX2A 3VMMA 1S8AA 3RIMA 4C7JA 4I1VA 1UJNA 3P52A 1KO4A 1JQ5A 4TMKA 4I1OA 5C8XA 1TW3A 1AMUA 3Q85A 1N2BA 2RARA 4K9SA 3KFLA 4MR9A 1UKBA 3LRXA 5IVIA 2VSYA 5KPJA 2J8ZA 3SLKA 1Z7GA 2ZVDA 1MR3F 4L4UA 2IVZA 4F12A 5CT4A 2Q5QA 3DTTA 4DQKA 1XAJA 1ZINA 2EGUA 2V7TA 1VA4A 2LCQA 1XHFA 1Y5IA 5FL3A 4MDEA 3FCUB 4DA6A 1B2LA 1MGPA 1IAVA 2PBLA 3H5IA 2GM5A 2XCQA 1JA0A 1HETA 3M2PA 2Q6TA 4TMXA 4W9MC 1HL7A 2JCGA 2MSDB 5IKPA 3ANXA 4URVR 1RMQA 4Y2HA 1R0SA 4KQWA 3TEFA 4Z3OA 4M0PA 1SO8A 1V11A 4MYRA 3QFHA 4YCAA 4LDQA 4HWKA 1NYLA 1C3EA 2X5NA 4NY1A 1FP6A 2AG6A 5AKLA 2O3RA 1NF2A 3QVGA 2QQFA 1SQ0A 1G21B 1T2VA 3OY2A 4TKUA 5BW8A 1NM5C 1E2MA 3OWHA 5I9NA 4K0KB 1KVRA 3BTVA 1CR4A 1UMCA 1ZJ5A 3FGNA 2YBEA 3IQDB 2DQSA 1NNUA 4KQCA 1UM9A 2J4CA 3LKDA 1SQ6A 2NNLD 5KVCA 2NSDA 2V4ZA 1QHYA 4U2GA 3ANYB 5AKJA 5EQFA 5T4HA 4L8YA 1QORA 4W5WA 1DADA 3KOXA 4EFLA 1II8A 4BJ1A 4UTVA 3L7OA 1E8DA 3EGIA 2CVHA 1CKEA 1B76A 2PU7A 3MIZA 3GOQA 3VR5D 3KSUA 1JJAA 2RHGB 1RPJA 2XWSA 3MCUA 1TZKA 2D1RA 2IC5A 3TM5A 4YDQA 3FVVA 3NWPA 1HE3A 2YMMA 3CKMA 3K8OE 2F4NA 4JLAA 3ZNPA 2JFXA 4G5RA 4XFKA 5P21A 4WADA 1ZVMA 2OFPA 3I6BA 3GXOA 3E22B 4GXNA 2JATA 4UE3S 5FOQA 1T26A 2I6UA 1YC5A 1IPFA 2GEBA 1DLJA 2BEVA 2VZ8A 3SJZA 4UXHA 3B38A 4L73A 3ELYA 4G4GA 1DLIA 1OBOA 5B53A 4LF8B 4U2FA 2FR0A 3S2GA 4U00A 2EP7A 1PJSA 4NMLA 4WNIA 3T7IA 4BV9A 1HDYA 3OEHD 3HDQA 1T2AA 1KAEA 5F2OA 5EGSA 1SVIA 4ETNA 3PJRA 4KMRA 4C6SA 1R0CA 3VO2A 4HXFB 1YB4A 5JH7B 5MFZA 1CVIA 4TL9A 3SXUA 2H4ZA 1VM6A 4JJGA 1ZGBA 4QDTA 5H7XA 3VYVA 4ZN6A 2QZZA 4P98A 2OFFA 4M55A 2PRKA 5JANA 3SSNA 1XTPA 1Q1BA 5TGTA 3SAJA 5HSGA 4EGJA 2P90A 1TUEA 2I29A 1ESEA 4LTNA 1RI5A 1PWZA 2V8OA 1O6ZA 3TCXB 3F4KA 2IRWA 3SMQA 4GKVA 2UU9B 4G97A 3K32A 4X7MA 1PEYA 4PGMA 1IYZA 2ZR7A 9LDTA 2BM0A 3LK6A 2JPDA 3OCZA 4S3MA 2JAWA 1SVNA 4QPJC 1DKOA 4GP7A 1I30A 4CR7A 2SECE 1L0BA 1W47A 3GO4A 3TOXA 4Z3KA 1Y3DE 2VTBB 2H7VA 1Y9DA 1PG2A 4Q4DA 3CY6A 3O9VA 3RUAA 4ESOA 3Q7SA 5DBGA 3TG8A 2JI4A 4CGYA 2WJPA 3FB1A 4QG7A 1YZNA 3O75A 3QITA 4NBKA 4QGAA 1XZCA 3WL3A 1C14A 4BEVA 4M0DA 4E15A 1EM8A 2VDRB 1HE5A 2VP9A 3EC7A 1JW9B 5DW0A 5JSZB 4L74A 1IIRA 6REQB 3OAAD 1I2AA 2VCYA 3HBFA 2BY4A 1EINA 2WAYA 4XOUA 5IC5A 4A1FA 1TIKA 2YWHA 4TSFA 2UUBB 1PLKA 3A36A 3O1HB 1OYVA 1JEQA 4RTPA 3EDCA 1OH6A 1H6DA 1AG9A 1UK7A 3E3AA 2HF7A 2QF7A 3LCCA 1I6KA 3I9JA 4LE1A 4JLVA 5EQTA 1I3KA 2GHTA 2PZBA 1UDBA 2D7DA 3PHLA 4GUAA 1UXHA 2CNLA 3CUYA 1CZOA 4D0LB 1E5TA 4HGOA 5I7WA 5DM70 1Z2DA 2C3PA 1PS8A 1R74A 4I8XA 1XRMA 3AUSA 4P7BA 1JRLA 3I58A 2IH5A 5I7UA 2F8SA 5FFMA 3FN4A 2YJ5A 4PBSA 4NNJA 3GFOA 4WLNA 3TW0A 2RH9B 2QLTA 1GCUA 1ODCA 1U28C 3WJ7A 1Z4OA 4DV3B 2QG6A 3Q98A 1SUFA 3KZNA 4OK3A 3NHUA 3E0XA 3NBZC 3SGLA 1J7JA 5BRNA 4TX1A 2A4KA 4MYDA 1M1YB 4WZ6A 5AXDA 3SQWA 1UQTA 3AV0B 2D3TA 3GMSA 5FBHA 3GPLA 3DFKA 4QUAA 2Q28A 1IDN1 3LPNA 4P5PA 2EHJA 1GRRA 1IHOA 1NXQA 3FRJA 3LVQE 3T7CA 4XPIA 4A23A 5ALHA 1J5PA 3LNCA 2PL5A 4QASA 3TL6A 3LQQA 5HF8A 4K6GA 1FY2A 1HBJA 5E0OA 4OKNA 1R50A 1XQ6A 3PKJA 3HS3A 5FPTA 1KI6A 2E4AA 3AWDA 1SBCA 1B8OA 5C7OO 4IIVA 2QDKA 4I2VA 3RQSA 1UBFA 2W5UA 3L93A 4JLPA 2QXYA 2ZTUA 4QLBA 2IOFA 4BNMA 2ZOSA 3HN7A 1PZXA 121PA 2O0KA 4JJKA 4K81B 3DJFA 4UHCA 4YNBA 3RBAA 3T1HB 2H0RA 2J59A 3O4FA 4TXJA 4LBZA 4KKXB 4XGRA 3RS9A 1CWUA 4I5GA 3GRFA 2Y67A 1JDTA 4ZICA 3CCCA 2J6BA 3H87A 2IU3A 1N6RA 4FS8A 4Y2JA 5HIJA 3AERA 3PXGA 2X5KO 5CCDA 2CFRA 4INPA 1W76A 2I4OA 2XI4A 2GZAA 4HQ6A 4PYOA 4GG1A 4PV7A 4L3OA 1ISIA 3LUCA 4DABA 1DX4A 3CZMA 1QFXA 3DFFA 3FVRA 3H97A 3ZHUA 4BRUA 4EVQA 2FOLA 3BGVA 2W2OA 5LOVA 1BVUA 2ZUDA 2V9CA 3L1UA 1ECGA 1VFPA 3HA3A 3DBHA 1XNGA 2NZYA 3GIWA 4Q47A 4ZRMA 2JKZA 2V74B 2XRZA 1GPYA 4ZKEA 1U63A 4LMPA 1B8VA 2Y2VA 2PXAA 3EXEA 4NAHA 1KYXA 3BJMA 3TTYA 1QYWA 4MV4A 3PX7A 1K6EA 4JXKA 1SN7A 1QF7A 2D2VA 1P2TA 5FPQA 4YS6A 5G3ZA 2XNDA 4FSDA 4QARA 4C4ZA 4YMUA 3PLRA 3IUBA 3EIWA 1S8FA 1JDBC 5FI0B 1YZHA 3ITEA 5AK6A 3SF0A 4OFBA 4QQFA 2NZ2A 1GQRA 2FMFA 4CT5A 1W2GA 2BDTA 1USUA 1O5TA 2ZJ5A 5KYXB 5I5EA 2HXSA 3IUPA 1Z06A 3NHMA 4ND5A 3UUGA 3JAKA 4EJSA 1A7AA 1NI4B 1QGDA 2BKEA 2I3AA 3NUQA 2VRCA 3TECE 4LZJA 2OCKA 4TQAA 2PKEA 3RK1A 2XGOA 4OB7A 3UMJA 3FKJA 3KXIA 4A2CA 3SY8A 4K86A 2AL7A 4M1ZA 2E4WA 2DPHA 3GJSA 3VSCA 5A5DA 1C1YA 3GG2A 4WESA 2Z2XA 3H1GA 2D4HA 3GD5A 5A4KA 1YQWA 5LQMA 5HUQA 5AM5A 2P9QA 4MCJA 3UAYA 3U6BA 3RBXA 1TC1A 1Q22A 1QAQA 1X86B 4G2TA 4G8JA 4RZHA 3FPKA 5DOZA 3B53X 2YWXA 3QF4B 2GPNA 1U9IA 4OL9A 4E5SA 3DE1X 1VSQA 1XJCA 2BAGA 1TECE 3FYHA 4HNGA 3NDIA 4HEA6 1YFJA 4BO3A 3MCZA 4XARA 4DMMA 4P22A 3KWJA 2EDAA 4UFOA 3DMGA 1IHYA 3LIIA 4H27A 2XYHA 1QZXA 1LW6E 2QR2A 2RK6A 1PT8A 5B5SA 2A9PA 4GLLA 4YAGA 3M2TA 1E58A 3U4QB 2P6RA 1R12A 2W42A 4JLDA 2HKIA 3ROKA 3HXPA 3WYNA 1VYVA 4G8DA 1SHLA 1TU0A 3ILHA 4BMOB 3H2HA 4BO4A 3HZHA 1A3CA 2V0GA 3LX8A 4KVZA 3GX1A 3IV6A 1FX0A 1E3SA 1ENPA 1RLOA 4AYTA 5M04A 1QQBA 2W37A 5A9TA 1RP7A 2E37A 4J94A 3VNSA 5LMNB 3TOVA 3ZPXA 1QX3A 5A7GA 3V34A 1L3BA 5B7QA 2DUNA 3IR6A 2R7KA 3HUFA 3BZWA 3DVSX 2CJFA 3QIVA 1RJFA 1Y7IA 5JSHA 4C7OA 1BGWA 1NVUQ 1NQAO 3VR0A 3VO1A 1DXOA 3KEFA 3ZUPA 4UE2A 1HT1E 3G8AA 4R40A 2DSTA 5ICEA 1C4XA 4J9UE 1W7AA 2YFKA 2QV0A 3L06A 5ESWA 4DV2B 4UUNA 3ECSA 4XVQA 4ZJYA 4XIGS 4AF8A 3ADCA 2BDEA 3FGPA 5I8WA 3QI2A 1SIWA 3QJ5A 1UXIA 5C8DA 3AOEC 2RC6A 1WBJB 5FORA 2H54A 5BV8A 3K5WA 1M0SA 5HCUA 4IWYA 2QBYB 2B4YA 2ZBEA 3TB4A 4DFDA 3FNIA 3OPQA 3WGIA 4EABA 2QGZA 1L6RA 4I4IA 1E20A 1RMYA 1UK8A 4RTMA 4Z0TA 4KLZA 1OH8A 3DOHA 1HE1C 4J4BA 4A0SA 3NHZA 4YDHB 1GTZA 4ZVPA 1F0NA 2JA1A 4MHSA 4G84A 3LAWA 4AWBA 2AEJA 4JBXA 5L45A 2F8LA 4DYVA 5DM60 2BJVA 4EI7A 4ZOQI 3PFNA 1IY2A 2O54A 3CLSC 1RZRD 1U8EA 2Q5CA 1OZHA 5CBPB 5LQCA 3UPTA 5HQ3A 3ZZ0A 1VZ3A 1U1DA 1XT6A 3S8MA 5JC8A 1ZUWA 2C83A 1W4ZA 3K9FC 2EFGA 4K9LA 3CINA 1OPXA 2QTLA 2AXQA 4W7HA 4CCAA 1IAQA 3LF2A 2I1WA 1NQXA 2FWAA 4FONA 4CV3A 1WXFA 3R0ZA 2PANA 3K6RA 1SNYA 2QRHA 1QIHA 3QG5A 3UHAA 5E4TA 4POOA 3DEYX 5JYCA 4J0DA 2A1UA 4MMXB 3TW6A 4PLFA 1X0VA 3OLCX 4F2HA 5HQTA 1S2DA 1Y1PA 3UA3A 4BFLA 1YZQA 3DCIA 3IMCA 1Z37A 3AFIA 3KUKA 1O77A 4MQ6A 4OHBA 3RSCA 1RS0A 5K0NA 3ZEAA 4CQLA 3PLNA 1ANKA 2P75A 2WICA 4ZARA 1UFVA 3T3HA 3ISVA 1KJJA 1EP9A 1JT9A 2IHYA 3A1NA 5DHSA 5K0JA 4DR7B 4BB6A 4ARZB 3F6YA 4J43A 2JLXA 3EXHC 1R88A 4IDPA 4IS2A 4Y6LA 5LQAA 1KZ6A 1FC0A 4CMHA 2QL5A 2ZCJA 3OPXA 1VCIA 2WPNA 3LT5A 3OA0A 1EWRA 2PGDA 4GR4A 4GU5A 2GJ8A 5FV4A 2HJWA 3KKMA 4J75A 2JJ2A 4KRFA 1E7MA 1XXHA 4BO1A 2OQRA 6LDHA 3ESQA 5F7JA 3KTDA 3VISA 5BWOA 3AU9A 3C4VA 1N5LA 1ST3A 1T1RA 3G5MA 5REQB 5K6TA 2B3DA 1D2AA 1QGUB 3FPCA 3SZRA 5IXYA 3GUUA 3VM6A 4NJMB 1AKNA 1WCIB 3TZ6A 1WKCA 4HGQA 1ZWKA 4Y18A 4G6ZA 5D3KA 5LZ9A 4X1IB 2QT9A 4FYKA 4QDZA 1LF5A 1VCNA 3GLUA 3W3ZB 4CM6A 1IG0A 1MU0A 1K6IA 2EJBA 1RXUA 4BQRA 1KVTA 4RZUA 3W2GA 7ABPA 3LH5A 1PN3A 4OHUA 2DR2A 2EKQA 5AK0A 4NZOA 4YTEA 2PH3A 3F71A 3NJ4A 3SHVA 2OWEA 3PEVA 3VYUB 3LI2A 5EWLA 3D81A 4YIHA 4GL2A 5ES3A 4O2AB 1ZJ6A 1ABEA 4HP8A 4O59O 2Q5OA 1FP2A 4O2AF 3JQ9A 2O2XA 4BQPA 3W9SA 4OVKA 1CR0A 5LZ2A 1ZNZA 3ITDA 3E5NA 4OU5A 3U3JA 1B7GO 3RB8A 3SYLA 4YRZA 3VKVA 1NZDA 2P9TA 1UBOS 4NCBA 2TMKA 1N25A 4Q12A 2O52A 2KLHA 5IJXA 3EVGA 3D0QA 3M34A 5KDOA 4A0QA 4YXWD 4IG4A 1M7GA 1PSDA 1TF5A 5IAKA 1ID8A 1U2TA 4LNUB 2A4MA 2CL7X 2UKDA 3E9NA 2X15A 1AZSC 3IQHX 4J3FA 1Q20A 2PIDA 4DCOA 2JFZA 1MV8A 1YNOA 1VC2A 2EWWA 1GEGA 1P9NA 4JC8A 3FUVA 2J45A 3O74A 1VL2A 2ZBUA 4PGFA 2XUAA 4B82A 3OJEA 3BSFA 3VR1A 4GX0A 9ABPA 1H2XA 1ZOLA 3KJIA 1JKJB 3DVRX 3ED1A 1C3XA 4ZI5A 4PZEA 4R2HA 3OMWA 3N2IA 1Q16A 1B15A 2H1CA 2HWXA 1GILA 2ZSFA 3TXXA 3QNWA 4AQ7A 3OCXA 1NP7A 3MMPA 1PR3A 3IVGA 3CPEA 2FMUA 2D8AA 2BD0A 1OGJA 2VTVA 3FYDA 3I34X 3N8DA 2HOQA 4TT3D 3U3KA 5A5GA 4KOEC 3EIHA 1TZMA 1ZIPA 2DTDA 3GU3A 3HLYA 5CLHA 4U4AA 3C8DA 1M1NA 4FKMA 2WAOA 1DV2A 2KQUA 1T8SA 3HDVA 4KB5A 5H3LA 4C89A 3BTOA 2FZVA 3IDFA 4X0EA 2OYRA 4AUEA 1FCJA 1Q1EA 1LSJA 4C6HA 4QYIA 4V39A 3PXAA 2IXDA 5JT1A 3D4PA 3PVSA 1N2HA 4IIXA 3A27A 2Q62A 4B40A 3L0DA 4YIKA 3TMKA 3UB2A 2B1GA 3TVTA 1HLGA 4UNRA 1FL9A 5EHQA 1TEZA 1X80A 1RIFA 2XGMA 2XGSA 1P1JA 2PX4A 2PSEA 1XDWA 4N18A 1B74A 4PF1A 1Z4KA 4P0QB 4HEQA 1WDLA 1UUFA 1VLVA 3B9RA 3CUEF 2E21A 3BH6A 3PLAE 1BFKA 1EU1A 2F1HA 1B42A 3FNQA 2UZ4A 2WIGA 1J0AA 2B25A 1REQB 3IODA 1JKFA 1NVVQ 3GL9A 3K7EA 3KWLA 4NBWA 3WKBA 4R83A 4AX8A 2HADA 4QBKA 2W2KA 4S24A 3N6VA 1PD0A 5FJJA 3PXCX 4IHAA 5A9SA 1ZMRA 3KIPA 5CDGA 3M0EA 2QM0A 5HIMA 3FFWA 4XVRA 3IHWA 1A9XB 3D54D 3KQWA 5FR2A 3HB5X 1ZNQO 2FR8C 3IT2A 3TIXB 4BBPA 4D98A 2P2LA 2CHEA 3PV0A 1DL5A 1LSUA 3KQLA 1YZFA 4HDSB 4QBTA 5K4AA 5LMUB 3AP2A 4B7UA 2P4EA 4ZVOA 2QN3A 1K4YA 3AGPA 5H83A 2O5RA 3AR7A 4RS4A 2PPLA 2Y0DA 2XQFA 4ZQHA 2PCLA 4K6HA 2M2IA 2OV1A 4GLJA 4BKMA 1BKYA 2TMYA 3DE5X 3VVBA 5KSZA 1XA4A 5CX4A 3DAFA 1B6TA 1ORWA 2YHAA 3WLAA 1ISGA 1QMPA 1ZRMA 2DPGA 3HJBA 3I6ZA 3NCTA 4GT1A 4MQLA 2AMJA 4NR0A 4U3JB 3UH1A 4JIGA 2WTBA 4XDYA 4IHJA 4TVBA 1RWWA 3H18A 4IO1A 1G38A 2YINC 4U9UA 3CJTA 3V3KA 2FN8A 4EGCB 2CCJA 2AGVA 4NZNA 1N6LA 4L78A 1JQDA 1YVRA 2OBLA 3OOYA 5GVSA 1TTTA 2KBFA 1XZMA 1QR6A 3LUGA 4AN0A 1QQ6A 4OP2A 3K3PA 4H6PA 4NKRA 4DUGA 1XXLA 1XN4A 1SCQA 5KNDD 4RLFA 2J3MA 5CDHA 4RKYA 4RZXA 1SUWA 2NUAB 4DR4B 4RAQA 5EKXA 3DNPA 2C04A 4L72A 3G6WA 5ITSA 4PPYA 3GLRA 4IQ4A 3L3BA 3D1JA 2UYGA 1FU7A 1XLTA 4ZD6A 4G4JA 4Z2AA 1Z2EA 1I5RA 1BKDR 1U6JA 1YS9A 4D4MA 2JHPA 3LPLA 9MHTA 1PGQA 2GNAA 4FYWA 4YCCA 1YZYA 4HDKA 2QLBA 3IAM6 1XJ0A 2H11A 3HVIA 4GBGA 4ITUA 5GJCA 4DA0A 3ZK9A 4LZOA 1ZGCA 5H16A 2BGRA 2RMKA 5EHXA 3CEMA 1H23A 1QF9A 3SZLA 3KQHA 1GQFA 2EIHA 4ZZIA 1RBQA 5M29A 3M81A 3AY3A 4UM7A 2YNMA 3AT1A 4KQKA 3FMPB 3KPYA 4CL0A 3LXMA 3P0RA 1XK7A 1CUSA 1XIVA 2QTGA 1NBEA 3A9VA 3HB0A 4D0NA 3LUKA 3MRSA 1Z63A 3PIIA 3R23A 3EA4A 3R7NA 1KYYA 5I4CA 1FDWA 1QHSA 4HPJB 4RFSB 4WK4B 2HIHA 3I5AA 3TQTA 3BMXA 2BCGY 4ZAZA 3E7PA 3HTXA 3LCVB 3BT7A 4J0JA 4AG3A 2GZRA 2QW8A 3V33A 2XUHA 1BCRA 3CRRA 1XEWY 1GXSA 2V0CA 4HJRA 1RZ3A 3R20A 2C59A 2X58A 1LXCA 4XQCA 2IODA 1O8CA 2W6CX 2XQJA 3QELB 4YJFB 1A2OA 3K09A 3B70A 3N74A 1LLDA 2G36A 3O8OA 3NHAA 5JNVA 3FTFA 3CMCO 4QUHA 3PEYA 2AQKA 2IY7A 2X5JO 4B7AA 3M4NA 4BTLA 3ZGVA 1RIIA 2K87A 2YV4A 4N5IX 5DYYA 3WLIA 3STUA 1HQKA 3KV3O 4KN6A 1AURA 1KFBB 1L4EA 1QTRA 3VU9B 5MN4A 5L4NA 1IZZA 3R7AA 3VNAA 1U2GA 5EVCA 4FMBB 3SJCA 2IOQA 4M0KA 2I65A 2H4YA 3TM4A 4D6XA 4ZHQA 3P9PA 3BS4A 4LZNA 1XWIA 4IGAA 4PG8A 4HLUC 2FFAA 4F56A 1EFKA 5KWVA 3VR2A 1DKNA 4OSEA 2I4TA 4IQGA 4RELA 1CR6A 1NRWA 2PKRA 1O08A 2PS1A 3N5CA 4RKQA 5CBKA 2J4FA 4EG3A 221PA 2ZDQA 4P4NA 2OL4A 5BSMA 3REGA 3L7CA 4YDSA 1T8RA 3PXDA 3DDOA 2SKEA 3NOOA 4FVTA 3UOGA 4B17A 4I1IA 1OJLA 2QI9F 4JX9A 5AJTA 5J4YA 2A57A 4IG9A 2FSHA 4KO3S 4Q9NA 3YASA 4YR9A 1JG3A 2OD2A 4G0QA 4IQFA 1BG6A 2GMWA 2DY1A 2OBMA 3AY0A 2W6IA 4PM4A 5IU6A 2XMGA 5A9SB 3GH1A 2X8JB 1RYFA 1JAXA 1UAYA 1NBHA 3I2HA 4MUAA 3DLBA 4FOOA 4B3DA 2RGCA 3SK0A 2O8VA 1ZXXA 3OKFA 1JFFA 2YWEA 1HDZA 2AJ8A 4YN3A 3ND7A 4N0PA 3HB9A 2A3NA 3B6MA 4MJLA 2D00A 4H7PA 1NKVA 3M6MD 2ZTLA 3LGXA 1R5NA 2AVDA 2GN9A 2HJRA 2BUBA 1C41A 1F51E 1KZ4A 2FEKA 2H59A 2BJWA 3D7MA 3D7LA 3MT8A 4FHGA 3ZHBA 1UPUA 2BFDB 4M8LA 1EWQA 1LQ2A 3LOUA 4B46A 1D07A 2D2IA 3M5CA 4RYDA 3URMA 3FNBA 1CZUA 1OXBB 2JB9A 2RC5A 2XBLA 3NUGA 1Q6YA 1UZNA 2BUAA 1KKMA 2IYXA 4MR8B 1UPTA 5E6SA 4DILA 2G9QA 2XH8A 1MVNA 5C51B 3C5WP 3AQIA 1WCV1 1QK4A 4LXUA 5KQMA 5JZ9A 2AG1A 1K66A 4H6VA 5KJ6A 1RM0A 1QK5A 1P7ZA 4UATA 2QROA 2AR7A 4WLOA 1GUYA 4Y6SA 4JXJA 5KJEA 3RS8A 2BN4A 5L3SA 4P34A 3TFWA 1JJIA 3F8WA 1AD2A 1DC7A 2IEZA 3ZNOA 2CL5A 4AO6A 3DF9A 2I03A 4GECA 5JXHA 3AF6A 1U3UA 1NVFA 1O95A 5BR8B 3BHMA 1AHPA 5LVAA 2IXGA 4PRYA 2GBGA 4G0VA 2OESA 4MVCA 4HDMB 3RLFA 1XQ9A 2I6XA 1ZICA 2OUIA 1WU7A 4M1YA 4TYYA 5SY4A 3TLGB 3DG9A 1YJAA 3ETJA 4QD3A 3E3LA 4REMA 2WW8A 2O3SA 5DLDA 2OUKA 5EMMA 3HV2A 1VIVA 3VR6H 3W7BA 3O92A 5A5FA 4XB1A 4AS2A 5CNJA 1TE2A 4OX9Y 1D4AA 1E9EA 2FN9A 4IH9A 5CLJA 1PT9A 2CHFA 4RK5A 1DJLA 4X3CA 3C3YA 3PC6A 3QJGA 4Q4HB 5LCXA 3W78A 2HWKA 2OLKA 4PHHA 2FFHA 4RVDA 3SIPA 1MOSA 3DD1A 2AG8A 1KP9A 3OZBA 3KZVA 4IGIA 1Q7TA 2AKAB 2UZIR 3GC6A 2J48A 4L8LA 5LUBA 3CVWA 2X1HA 3RKRA 2C5SA 2ZTSA 1GM5A