2LPMA

Chemical shift and structure assignments for sma0114
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
123
structure length
123
Chain Sequence
GSHMTERRLRVLVVEDESMIAMLIEDTLCELGHEVAATASRMQEALDIARKGQFDIAIIDVNLDGEPSYPVADILAERNVPFIFATGYGSKGLDTRYSNIPLLTKPFLDSELEAVLVQISKEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear Magnetic Resonance Structure and Dynamics of the Response Regulator Sma0114 from Sinorhizobium meliloti.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transcription regulator
molecule keywords Two-component response regulator
total genus 19
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lpmA00
3HSYA 3RVPA 4N47A 4G0OA 4MR7B 1BDHA 1DJMA 4MRMB 3DBIA 4W5NA 2A9OA 4Q6BA 3EJWA 3QX9A 1U2QA 2WJAA 2B1JA 3EULA 4YRZA 7ABPA 3HO1A 1Z2EA 3CFYA 2JB9A 4IF4A 2PAFA 5IUNC 4NCBA 3CZ5A 5DCLA 2PL9A 3KYIB 2RGYA 4RXMA 1ISRA 5TE9A 2JVJA 3C3KA 3DGEC 4E7PA 4S04A 2LIVA 3CNBA 1ABEA 2FN8A 1U04A 4TMYA 4Z4IA 1Z15A 5BQ3A 2JRLA 2ZWMA 3GT7A 4HNSA 4HNQA 2OQRA 5JNTA 3OQOA 4FB4A 1P2FA 2JCGA 2FLWA 3IP7A 4IILA 4XARA 1HEYA 5IC5A 5B3JC 2IOYA 1M5TA 3H5OA 4LE0A 5KC9A 1GCAA 4W5OA 3A10A 1QKKA 3C3WA 3EAFA 1M2FA 3HJFA 4MR9B 3UK0A 4XXHA 4ZYLA 2E4UA 4MS1B 4Z9AA 3TD9A 1A2OA 3H1FA 5JNVA 4KQ9A 1YS7A 3SNKA 1OXBB 1YS6A 2MYUA 2OENG 2QVGA 5FWXA 2F8SA 5IULC 3VNBA 5BRAA 4WXMA 1Z12A 4D74A 4S05A 3OLWA 2QZJA 1ZH4A 4D6XA 2NZUG 3KHTA 3M9WA 1SXGA 1Z17A 2FTKE 4W5TA 1NXPA 2FMHA 3KKEA 5IUJC 5DKFA 2PE5A 3N0RA 2NT3A 3I5AA 4ZMRA 3L6UA 1M5UA 3CLKA 1LBHA 1USKA 3SY8A 1U2PA 2P4UA 3HUUA 4G86A 1BAPA 1A04A 2L19A 2PL1A 4JB0A 5D2CA 1RZRD 5KQPA 1QO0D 5JNSA 4IMIB 1PHRA 1SRRA 5T7BA 1RZRA 4EYKA 1ZAYA 1Z16A 4N0QA 4D6YA 4KVFA 3GBPA 1C4WA 1F4VA 1L5YA 1SD5A 5TQ0A 4ZMSA 1JX6A 4DQDA 1XHFA 3LOPA 4PEVA 3MYYA 2CD7A 3HM9A 3CG0A 4XAQA 4MS4B 3RVJA 1D2AA 4ETNA 4LDZA 5TPWB 4MGEA 4RKRA 1GCGA 3OQNA 3O2JA 1YIOA 2FEWB 4MAAA 2FXIA 1DRKA 2CHFA 2QR3A 2HQOA 2QW1A 1P6UA 2PUDA 4WUTA 3RVLA 3SM9A 4KK3A 5TQ2A 3IPAA 4Z4HA 3KLNA 2M98A 3MIZA 3RVSA 3T38A 2GWRA 5TQ2B 3LUHA 3SQNA 1PNTA 1ZHHA 3F6PA 5TQJA 1KMIY 1DRJA 1MVOA 3NNDA 3O2QB 5JNUA 1MB0A 3G1WA 1JWLA 1C0EA 1LK0A 2A9QA 4JOQA 2FQXA 2IDMA 2LBPA 4OTZA 2QSJA 3DLBA 2MYTA 4KV7A 2WRZA 4NCAA 5DTEA 4RK0A 4Z4EA 4RXUA 1VLZA 1L5ZA 1YTUA 6ABPA 1NXWA 3HDGA 1ZGGA 4MS3A 2FSPA 4G0XA 3MM4A 2FW0A 2JVIA 1QP4A 3MA0A 2GKGA 9ABPA 2H3HA 4EVQA 3FFXA 5FBKA 1E2BA 1E6LA 3I45A 1EWVA 3LKBA 4RY0A 4JAVC 4HYEA 2QU7A 3O1JC 3LUCA 4IGAA 4YR7A 4B09A 3ILHA 2NUBA 4JP1A 4EYQA 1DCKA 3H5WA 3SG0A 2LP4Y 4ZJPA 3EGCA 1CYEA 2IPAB 4XASA 1EWKA 3O21A 4G0QA 1U8TA 3G85A 4F8JA 3TB6A 1EHCA 2HSGA 4MR8A 3T8YA 2FVYA 3GV0A 1FFWA 3HZHA 3H5VA 1JDPA 1Z2DA 4XLTA 1GLGA 3LKVA 1ZVVA 1D1PA 4DADA 1ZESA 1NXTA 3EQZA 3JVIA 1JH9A 2PUFA 4YLEA 2NT4A 5DLEA 1DC8A 3I09A 1VPWA 3ILYA 3FDFA 3NHMA 2FQYA 3CU5A 3OMXA 1APBA 4OATA 2W42A 4EGSA 4TLMB 1BVHA 1TM2A 4TLLB 3LFTA 3ROTA 1B00A 3T6KA 2IPNA 2WMYA 4KK4A 3BRSA 4MQEA 3RVNA 3H5IA 3W9SA 3QLTA 1MAVA 1TVMA 1PUXA 4E7OA 2PLNA 1KRXA 1URPA 2QVCA 4LX8A 2JBAB 2FKAA 4H3KB 1RXIA 1K66A 3KLOA 2HQBA 1YK1A 5EWMA 3F7NA 1F51E 1NXOA 4MS4A 2H0AA 3LTEA 3O1IC 3QK7A 4RDCA 3TX6A 2VK2A 4NV3A 1QP7A 2N9UA 4RK1A 4JASB 5DGCA 1RPJA 3JPYA 2TMYA 4O1HA 4RKQA 5IEBA 4F11A 5HSGA 3JS5A 1T34A 4KQCA 4MR7A 4YO7A 3MMNA 4EYOA 3DLHA 3HDVA 2DRIA 3K9CA 3N53A 3N75A 2IKSA 2WB4A 1A0OA 1XWWA 3C6QA 1CEYA 1I3CA 2YHAA 3IP9A 4KFCA 1H9CA 1USGA 2FEKA 5IX8A 3R0JA 4LDAA 3H1EA 1JDNA 4MLCA 3RVMA 1ZN2A 4QYWA 2PUGA 3CS3A 2A9PA 1P6QA 3O1HB 3VNAA 4KPYA 1DC7A 1EAYA 1CHNA 1TLFA 3FGZA 2GBPA 4Z4GA 3N8IA 1E6KA 3TO5A 4PZ0A 4IMJB 4RSMA 1DCMA 3DGFC 3M6MD 5IBQA 4FE4A 4LE1A 1QMPA 5IUKC 1ISSA 3GL9A 3NNNA 4WXEA 1TJYA 4IRXA 3Q41A 4MR9A 1RXEA 4EVSA 3KTOA 1YMVA 3QLVA 1D4ZA 3Q9SA 3EDCA 4RZSA 5KQMA 3GWGA 3H75A 3OO0A 5FWYB 3RQIA 1ZITA 1DG9A 3CTPA 1OXKB 2WY2D 3RVQA 5FBHA 4F12A 1QQBA 5JS1A 4HNRA 1Z26A 5HKOA 4H3HB 4N76A 5C5EA 2FMKA 4G0MA 3K4HA 4N0PA 5CNMA 4PE5B 4M88A 3LUDA 2PUCA 1RNLA 3KYJB 2VUHB 3SAJA 1PEAA 5KC8A 1U0SY 3NBMA 2M1ZA 4MQFB 4KRFA 4CBVA 1USIA 2FMIA 5KWSA 3O74A 1ZDMA 2PMCA 2PUAA 2AYZA 2IYNA 2HPHA 4MYRA 3CG4A 3N6VA 5B3JA 1Z25A 2MSKA 2R4QA 3EODA 1NXXA 1YK0A 1Z18A 4UHKA 4WZZA 3N0XA 2JVKA 3LMKA 3EQ2A 5EWJA 2WWVD 3IP6A 4NICA 3QX8A 2PJUA 2E4WA 2LPMA 3OLXA 3C3MA 1XHEA 3E61A 5F64A 4RK4A 2J48A 3H6HA 1D1QA 1NTRA 3JY6A 4F3TA 4XFKA 2KYRA 1S8NA 4ML3A 1KRWA 4ETMA 1TMYA 3FFWA 3H5TA 4JB2A 1JFSA 3GYBA 4MLDA 2QXYA 2YHBA 4KNYA 1VRVA 3HK2A 3TMYA 5EWLA 3QLVC 1MIHA 5CNKA 4MPTA 3JVDA 2ZAYA 4MQEB 4G0YA 5I4CA 4MRMA 4Z99A 4OBBA 5KQGA 3IPCA 2IPLA 3JTEA 1FFGA 1KGSA 3FFTA 4QYMA 4UHJA 2MSWA 2MYNA 1JHZA 3IP5A 2CHEA 3HS3A 5E3JA 3F73A 1JF8A 3LUFA 4O5AA 1EFAA 3P9YA 3F6CA 4ETIA 4EY3A 1QO0A 5KQLA 1NXSA 4RS3A 4RK6A 4WWHA 4G97A 3HVRA 4QPJC 2WJWA 4P98A 1QP0A 2GX6A 5FWXB 4PYRA 2FLKA 4MS3B 1PNRA 4Y9TA 2R48A 2B4AA 4RWEA 2HQRA 1DBWA 3CKMA 4KZKA 2RDMA 1QQAA 3UUGA 2PUBA 1DZ3A 3N0WA 5BRJA 2PKXA 4QICA 3OLVA 1WETA 4L85A 1E6MA 4LE2A 1W25A 5GQSA 1JFVA 5JNRA 4MR8B 2L18A 4YV7A 4N03A 2HJ9A 4P1ZA 2E4ZA 4KMRA 3QEKA 4Q6WA 1R8JA 2O20A 4WT7A 4OLBA 5ED4A 5JNWA 8ABPA 2AYXA 1GUDA 3OLYA 3Q7SA 1SXHA 4YP9A 1QPZA 3A0RB 3OM1A 3T95A 3QELB 5BR1A 2NZVG 1Y1LA 4O1IA 3LUJA 4MQFA 4YCSA 2L2QA 5ABPA 3HV2A 4YGXB 3QLUA 4EVRA 3O75A 2VYCA 1MB3A 2A9RA 4N41A 4RV5A 1SXIA 3BILA 3I42A 1GUBA 4L4UA 1ZGZA 3L49A 1PEYA 5C5CA 5HQJA 1LJUA 4JA2A 5GOTA 4Z4FA 3KCNA 4OG2A 3MQ4A 1NY5A 2CWDA 1FSPA 3D02A 4Q7EA 4RK5A 1YMUA 3OM0A 2R25B 5TPWA 3JPWA 1FQWA 3BRQA 3RVRA 3M9XA 5IEJA 1JL3A 1YVUA 3KJXA 2L17A 1VKRA 4F06A 4RY9A 2XDYA 3GRCA 3HCWA 5TQ0B 2F8TA 5CNJA 4Z9BA 3RVOA 1W9HA 1QNLA 2QV0A 1M2EA 2FQWA 3GBVA 3H6GA 3IDOA 3CRNA 3A3KA 1NXVA 3HEBA 3QLUC 5CNIA 2ID9A 5EWLB 1ZY2A 6CHYA 2RJOA 2FEPA 4LRQA 5EWMB 2P9HA 2MYPA 4Z4CA 3C97A 3MF4A 4EYGA 5TPZD 4RY8A 3BREA 5KI6A 2E4VA 3LUKA 4Z0NA 3KS9A 3NHZA 3CHYA 1DCFA 3OO1A 1ABFA 1JBEA 4MS1A 5FWYA 4OLAA 4PICA 4EUKA 3H5LA 1JYEA 3UKJA 2FMFA 5JS2A 2VUIB 1UDRA 3OMWA 5HM6A 4W5RA 4KREA 1DBPA 1JYFA 2FN9A 4G0PA 1ZH2A 2R47A 1NATA 2I6FA 5T3YA 4ZPJA 1AB5A 2RJNA 3URMA 4RU1A 2Q5CA 3Q15C 2E4YA 4FE7A 3RVKA 3LUAA 2JK1A 1J56A 3E3MA 3GA5A 2GI4A 4YS6A 2X7XA 1LJLA 1DBQA 3D8UA 1D5WA 1EWTA 4G0ZA 1P8AA 1JFTA 1IIBA 3Q7TA 1DP4A 5PNTA 4NQRA 3Q7RA 4RXTA 3S99A 1BDJA 3A0UA 3OQMA 1FFSA 3DZDA 2PUEA 3ROFA 2MSLA 3B2NA 1JLKA 1AB6A 3FMVA 5TPZA 4YWHA 4LZLA 2ID7A 2IPMA 3OLZA 5EWJB 2BGGA 4GPAA 1Z13A 3BBLA 4RK7A 3CZCA 3NNSA 4H60A 4DN6A 1BDIA 4GNRA 3QEMA 4TN5A 3HXMA 1BA2A 3HUTA 2V0NA 3H1GA 5CHYA 3KG2A 3QELA 4W5QA 3QEMB 1K68A 3KSMA 1LBIA 2LUOA 2JBAA 3RH0A 3O2SB 3LUGA 2E4XA
chains in the Genus database with same CATH superfamily
3RVPA 5KWVA 4LHEA 5B7GA 4LJKA 4RA6A 1TZBA 2YW9A 2XITA 1M8FA 2A0UA 3N0VA 4YXWA 3GLGE 1CP3A 2GR9A 2O5RA 2VP9A 4P35A 4F04A 5B36A 4YR9A 1A9PA 1MIOB 2P9JA 1NE2A 1V4BA 2C99A 2QE7D 2V7QD 3WAKA 2CB9A 3C24A 1LY1A 3DE6X 2E7ZA 3PUVA 4CFZA 4DREA 1DTWB 4KQFA 3UVEA 4E5UA 1LJ8A 3NIBA 4CN9A 1KJ8A 2VOEA 4FDTA 3DW1X 4COKA 1YVEI 2XQFA 3OIVA 2JVJA 1I01A 3FXAA 1S3SA 4MIEA 3WHLA 2DZDA 2MIIA 2IVFA 1MO6A 1HG1A 3U3RA 3WJ7A 4BNWA 2H6EA 5HVNA 1YR8A 2XUFA 4MEJA 5EXDA 3THRA 3KQHA 4BXOB 4I6GA 2FPLA 2IZOA 2JRLA 4D8XA 1G3IA 1QFJA 1XZDA 4OSOA 1WU7A 3PDUA 3RUDA 3SR3A 4EABA 2W0MA 1D4FA 3AEUA 4IOKA 5AKXA 4ZTBA 5JFOA 2XJ9A 2G5GX 3IDSA 3LXUX 2IOYA 3R3HA 3H5OA 5E0KB 1GCAA 3S2IA 6REQB 5L95A 5A3JA 4EJ2A 3GJ0A 2LCIA 4DV2B 1DQNA 5KTRA 2Q1SA 1YR7A 4ER0A 3RIYA 3CVOA 1A1VA 4ZJUA 4XUGB 1J0AA 1G4UR 2FDXA 2GRJA 1EM8B 3OEYA 3WQSB 4CMBA 1UT5A 3J80A 4HGNA 4E4TA 2XJ4A 1Q7EA 2QSZA 1G38A 3C43A 3LY5A 3JQCA 3OF3A 4OQYA 3JX9A 3NXKA 3OLWA 3CZRA 4J1TA 4QJBA 2XIJA 4A2PA 1D2GA 3N2YA 4Q1FA 3JQGA 2QL5A 4R2WA 4C78A 2GPBA 3PC7A 1NXPA 3CVVA 1N2CE 1WV0A 3EFBA 2D3WA 4YMSA 1U11A 3PCTA 1HNWB 1Z73A 3PV0A 3SY8A 1W5AA 4N3AA 2GNPA 2CZGA 5DX8A 4GS5A 4MO2A 4XD7A 1AMNA 1U0LA 2B8EA 1OFUA 1YB6A 4KFUA 5LIRA 1A9QA 5E6SB 4YVFA 2QZPA 4J7AA 2BCEA 4EYKA 3DEFA 1WZCA 3MWYW 4CIAA 3ADKA 2R3SA 2FK7A 4ZMSA 1G19A 2GHTA 4HFMA 5AKZA 1XCGB 3COVA 1WDTA 2O0KA 4FFWA 1HETA 3ITEA 4Q1EA 3WGYA 2I22A 4BU0A 5KTOA 3A4YA 1YCDA 5HKKD 4B8YA 2FPRA 4MQ4A 3IP3A 5ECGC 1N32B 4GZ3A 4MCJA 3P9QA 3VNSA 1QXSA 3A6FA 4WY5A 4ZV7A 2PYZA 3QU7A 1UKVY 1U80A 3PFKA 1DRKA 3S2GA 2XUQA 3E70C 5AR1A 3VAZA 4AAYA 3IV6A 2D1QA 4CQNA 2D2XA 3QEBZ 4OP3A 5TQ2A 2J0QA 2FP4B 1C7JA 3NIGB 3G59A 2XYRA 2ICAA 2YFKA 3KLNA 1FYWA 1RAFA 4CM8A 4CV0A 3AUJB 3U6BA 4J91A 3WK4A 1YFZA 3R44A 5TQJA 1PK9A 1C0PA 5C8VA 1P7YA 3EMDA 1E77A 3ORYA 1MZVA 2OCKA 3DOCA 1V11A 1E3MA 3A4LA 1T6ZA 3WIBA 1FCJA 1IVSA 2WTXA 1RI4A 3KDSE 3T7DA 4B7CA 4TYNA 1Z35A 4QASA 1VIDA 1T5LA 2C3PA 2LBPA 4HDAA 1YOVB 4PO8A 4RZXA 4XEUA 4BLQA 1YRLA 4Z4EA 4BUCA 4RXUA 1Q50A 2ET6A 4B32A 5HZGA 1OKKD 4P93A 1UBUS 2RKWA 2NX2A 4IO1A 3PUXA 2BBSA 2I2WA 3VR4H 4J7CA 3DT9A 5CJ2A 2GKGA 4L78A 1XD2A 3EAGA 5EXPA 5L7WA 1NZDA 3LXXA 1V45E 2R751 3AQIA 1JKMA 3VHXA 3LKBA 2W2LA 1O87A 3H97A 2X0IA 2FRDA 3WGMA 1N9GB 3L7JA 3K6RA 3ZOZA 4HDNB 1UQRA 1F0YA 2WAYA 3PEVA 2GBIA 5LQMA 4UDOA 5DNYB 3KKKA 2OWDA 4OMFG 4G0QA 4DPKA 3SIRA 4EAAA 4NDAA 4NXNB 3LQ2A 2YN2A 4R8LA 1MRZA 5CRIA 3GV0A 3Q0IA 4EGJA 3L8YA 2I1VB 4KRXA 2YXBA 4JX8A 2X4DA 1YF3A 1W0JD 4D25A 1X0VA 4GGOA 4JR0A 2I9PA 4P22A 3GU3A 2OCDA 5FQOA 4B85A 5IJZA 3AVTA 1MLDA 1Y8QB 3I5XA 1BX3A 2O3RA 2B4QA 4PQEA 2XHEA 4IIUA 1KAMA 2BM0A 2OBYA 2D1FA 1E58A 3D8HA 3I09A 4JL5A 7ADHA 3PP8A 4FQ5A 2A92A 4KN6A 5TMEA 1I1QB 2GRAA 2Z5GA 3AINA 3DCNA 1OASA 4HQLA 4JLWA 3CU5A 1GTG1 3DOEA 2FXVA 3HGMA 3MHPA 5DZSA 2QHXA 4BN4A 3CR7A 4YJ2F 3W90A 4P3PA 1BVHA 4ED9A 2WF9A 4O1MA 5CFMA 1LPSA 2WWGA 3BRSA 1WQ1R 1AY0A 4XOUA 3MRVA 3W3AA 2WG0A 5ALYA 3E3NA 2AN5A 4TMFA 1ADGA 1KDTA 2M6SA 3M89A 4OHWA 2XDAA 3ZHBA 5C1IA 5DNCA 1QYCA 1ZUWA 3KLOA 1NUSA 2P68A 5CT4A 1ZUIA 4IEFB 1ESNA 1GIAA 1HOTA 3R4CA 3EX7C 1THZA 2A5DA 2JCXA 3NW9A 3PCXA 1U3FA 1MIOA 2X0NA 5I4IA 3BSWA 4BQSA 1EMDA 3M5WA 4N6GA 1FRFS 4URZR 1K4YA 5TS3A 3WDSA 3ZY3A 2BW0A 5FUWA 1O54A 3AL3A 2XHZA 4GXNA 4A8JC 1QGAA 1MC4A 4IZOA 4L5YA 1I1OA 2I7XA 2Z6VA 4LZZA 2OPBA 2Y1OA 1IPHA 1SQGA 2C9CA 4QEZA 1JIQA 1INLA 1IE3A 3TCXB 3DLPX 4G5GA 3N53A 3EEBA 4ZU1X 1PT7A 3CF4G 3C45A 4E3ZA 3C6QA 5KSZA 1CJUC 4L28A 4INAA 1YWGO 3CXUA 4AG6A 4M9XA 3FI0A 1N6IA 3H1EA 3VPHA 1R7RA 1NMEA 4MLCA 4S1PA 1FXWF 4FE3A 4KODA 3ZQ4A 3QVJA 3VNAA 1A50B 4PLPA 4YAWA 3QY9A 2ZI6A 1D4OA 1KI9A 1QDEA 2ZIAA 2ZU6A 3HLKA 4EAQA 3S0JA 4I81A 3RIEA 4IH1A 3PK0A 3KOXA 4AMBA 3K35A 4UVIA 3TAHA 3CE6A 2WHYA 2X0RA 1PDOA 2QTHA 4AL4A 3KTOA 3VX3A 4INOA 4CCYB 4EPVA 2Q3CA 3ND5A 2BGUA 4C9BA 1ODKA 4IHJF 4HJRA 4ND5A 4PGHA 5JROA 1GARA 2NO9A 5EXEA 2ZUTA 1ZJZA 5LD2B 1UBNA 1W75A 3LFUA 3EISA 4HEA1 1L6RA 1W4BA 3CBQA 4PFQA 4ESOA 3GJ7A 4BNUA 2H1OA 1VP9A 1NIPA 3TEMA 2PXHA 3A6ZA 1FNNA 1RWKA 3LUDA 3SAJA 2OHXA 5DNDA 3KV1A 3BWVA 3K0CA 3NBMA 3VJLA 4O8CA 1GGKA 2WZBA 3HVUA 4M0LA 4MTCA 5I7RA 3GPLA 4MK4A 2IV3A 3K94A 1Y8QA 3Q9LA 4DLXA 5KNBA 3HCPA 3F9RA 3FMGA 1OXVA 4D5GA 1HYBA 4GGPA 2QUZA 4CQLB 2JIDA 2VC2B 2WPDA 3QI2A 5AJXA 3VI4B 3K8YA 3QYFA 4EI2A 4DNPA 2I4MA 3JZAA 1TAUA 2QMZA 1ZRSA 2VK1A 2C98A 3BGIA 2D6FA 2PJUA 2E4WA 2VCYA 4REOA 3CB4A 3T35A 3WLRA 5F64A 3BKXA 4GKVA 1IUNA 3EZ9A 2B36A 3U7GA 2WAXA 3TZKA 2XZOA 1B0ZA 1E3JA 4EH1A 1YQEA 2QZ9A 3GIWA 3LQYA 4LI3X 4BTVA 3L82B 4GWLA 1C1XA 4F56A 2C03A 3TE6A 4ZDJA 1YJXA 2XI4A 2GZHA 3DDWA 3AFNA 3NPAA 3JVDA 2ZAYA 2DWPA 5BSHA 4B3JA 1CUXA 4YXWD 8AT1A 1KGSA 1I1NA 4QYMA 5G53C 1AS2A 1UBRS 2X0JA 2YJ4A 3QXHA 3R5KA 2QAJA 4BLRA 2JGIA 3K0AA 1RQGA 5ER6A 4EZBA 2UAGA 2IZ5A 3BB3A 1O95D 1RYMA 2H5EA 2XWPA 2D5AA 1WXXA 2IYOA 3UYKA 1AKTA 4QFDA 3V1UA 5BNTA 1L6IA 4IGEA 1IEQA 1VB5A 4KWEA 4H31A 4U3JB 2XGMA 1N2IA 1YV9A 3LWDA 4LBVA 4QYIB 4I5GA 4QXPA 5ALLA 5FF9A 5FYDA 5IZ4A 3BIOA 1F0NA 4UEQA 3OE4A 4OXQA 3VBEA 1ML3A 2A35A 1EZ4A 4K9LA 3ICQB 3AKDA 2GFQA 3CLTC 4LC1A 4QKQA 1ZWLA 3LCUA 1RTTA 4DSUA 5EYPA 3MGKA 5LNK6 1UBOS 3KWJA 3HMQA 4BNYA 2XCLA 2ZW9A 1MO3A 5IT5A 4YDHB 2FWIA 1TYZA 4FHCA 4PYKA 5KPDA 4G1MB 2H07A 1TQHA 3W5BA 3JYPA 3BA6A 5BORA 4FI3F 1E89A 1DIHA 1E6MA 4KSCA 5DGXA 3AM1A 5HCIA 3E3LA 1XNQB 1KNQA 4WQMA 4QT4A 2JHCA 1PYDA 1WB4A 3MGAA 3HMKA 1UXJA 3O4JA 2CMGA 3K0KA 4OQMA 3SGLA 3DUFA 2WVHA 1THTA 4YJ2B 5A4DA 2YMQA 3TLEA 3EAQA 2HR1A 1MXHA 4N3BA 3OZFA 4UFOA 1N2SA 4BVKA 2IA5A 1QPZA 1ZHOA 3Q3HA 3B9PA 2VRBA 4ROTA 1XZIA 4PTZA 3QU4A 1X42A 4DZRA 1TJNA 2B0CA 4A1FA 2VP0A 4M3NA 5AOCA 421PA 2W8BA 4OJNA 1XZGA 3BGOS 4BQIA 1SCUA 2BM9A 3AVWA 1N5KA 4CR8A 1N36B 1EVEA 4GR4A 2Q4EA 4ZP1A 3GRAA 5IH7A 4O4LA 4DLKA 3IAM1 1LS6A 2ISSD 2HMTA 1MTZA 2EZ9A 2HQ1A 4NCBA 4IIHA 2QX9A 2GN8A 2YWXA 2OGSA 3ZI0A 3UCFA 4C76A 4DAOA 5CBPA 4WXPA 5ALWA 4JEHA 3CUTA 1EUDA 4S35A 5GAJA 3V5NA 1LV8A 5CB0A 5GIOE 1P4RA 4JVOA 1Z8NA 5CH5A 5HK8A 3WBFA 3G13A 2QRQA 5DASA 2O54A 4FWTA 4F2WA 2W90A 4QREA 4UQPA 4EMUA 4GKBA 4YRSA 5CDFE 4HC4A 2Q07A 4BFXA 1QAMA 3IC5A 4GU5A 4PNZA 4ZAXA 4LOIA 4JLSA 4D3YA 2EFEB 2BGWA 1KMQA 1SM4A 2JHAA 3MGCA 3IBYA 4MKGA 5BP7A 1FFCA 4DLNA 1ZY2A 5LQRA 4W8OA 3WV5A 3EWNA 5BNIA 1NJ6A 3FN4A 4DMKA 1EX7A 2QTRA 2YWDA 3PZRA 1UBMS 2ACEA 3S40A 3DCJA 1LPNA 4DJJA 4PCAA 3GLRA 3GI1A 4F97A 4QUKA 3LCCA 2QM3A 3AEUB 1BVUA 1TLTA 1JU9A 4KQ1A 5CDGA 2O7SA 1XZNA 4DF3A 1NPTO 1S96A 3IV9A 2GEJA 1ZD9A 3G2JA 2B3DA 2C5BA 1U65A 2RHTA 4EUFA 5KZMB 4R1MA 4L8YA 5LXTF 3CHYA 3HJCA 4KYIB 1BMDA 2YJ5A 1ZFNA 2C4KA 3BORA 1AKRA 1CY4A 2PKWA 3TSWA 2BBTA 1QHNA 3IFSA 5I7EA 3FNRA 2VF2A 3MGGA 5AVQA 1JEDA 3GMTA 1H42A 4G0PA 4NNJA 1OVGA 2HF9A 2I7TA 5CEEA 1S2LA 3W8EA 3FMPB 5KX5F 1C81A 3OVMA 2JA2A 4LRWA 3RS2A 3I39X 1E1NA 1ENOA 2XSZA 4LF8B 1HTBA 5K7SA 3X2EA 1FNMA 1GPKA 3O8OA 2PANA 4DG8A 1TVKA 1G66A 3UUEA 5KYNA 4HNAA 2FSGA 4PNHA 2D1TA 1LJLA 1QF9A 3ZZNA 4AY5A 5CYGA 3DHVA 4K05A 3NHKA 2UYHA 1XU9A 3MCZA 4BLWA 5B6IA 2DBRA 3EA5A 3EQ6A 3F9CA 2OCPA 3OQMA 4P4GA 5JQGA 4XJVA 2ZUUA 5AESA 1SEVA 3PT5A 5HIKA 1E0KA 1JFRA 2QRKA 4KPUA 4WAUA 3L7IA 3OLZA 1DAHA 5L9AA 4ZGWA 4B44A 5C1OA 4TTVA 2WIDA 3QYJA 3CF6R 3S1AA 3ET4A 3I5YA 2IYTA 1EGMB 3GVPA 3EXFA 2J3HA 4KR0A 1FUKA 1ZOLA 1KJQA 5IM5A 3HXMA 3C0KA 2Y6VA 2P2YA 4NU0A 5KTSA 5E95A 4EFLA 5I9MA 1RC0A 4C05A 4NCJA 1N0HA 2JBAA 4XZ3A 4YCMA 3DCYA 3PQ2A 1KOFA 2IBSA 2B9VA 2P6OA 2WJHA 2AOUB 3HKBB 1A9XA 1JKXA 3UG6A 1T4GA 1SUFA 1N5IA 1YE5A 2A9OA 3TG2A 5EIBC 2JIZD 3FCYA 4DAEA 3HB7A 3IEVA 3LK7A 3CR3C 3ZHOA 1FBNA 2AS0A 4KIJA 3PTZA 5JUWA 3L8ZA 3P9ZA 5LOVF 1C3JA 1FJXA 3JZFA 1M74A 2PMKA 3GLQA 1J2YA 3NHFA 1TNDA 4K9RA 4ZZ2A 1ZZEA 1P1IA 2O57A 4HOYA 1W8DA 4F1JA 4LOKA 1LC0A 1Z15A 3FTDA 4DLUA 5F3WB 1U0JA 1CIJA 1JU3A 2G76A 2OQRA 3G5TA 3KT0A 4U2DA 5AOBA 4B4OA 4CZ2A 1IY0A 2CL0X 1H3FA 2XRFA 1SK8A 3TKAA 4C7KA 2CLOB 1CNEA 1BG6A 2X8BA 5HMLA 2VDMB 2FPGA 1GFZA 1K3UB 1IAQA 3LOUA 1MBZA 5F98A 4GWGA 1QQTA 1RKXA 4Y6QA 2X5NA 1TU3A 4ZYLA 2GEVA 4G6ZA 2IL1A 1P17A 1D2MA 3H0EA 4LSZA 1U8ZA 1OX6A 3NQ41 2IHYA 3OJ0A 3PITA 2AG8A 4N7MA 4Q3DA 1A27A 1HDGO 1IY1A 2PPLA 1FS4A 2WYOA 4HXFB 5A7GA 4CIBA 3DMFA 1CX9B 2O4UX 3ZNNA 4R1QA 4DSZA 4KFTA 2P5YA 3E6AA 4KVGA 3WL4A 3IPXA 2AH5A 3V7FA 2XUDA 3T5CA 5L3QA 2JGLA 3KFLA 4PZEA 4DV1B 5NULA 4KTVE 4C30A 4KXQA 1BA3A 5BPFA 2KS6A 2O8CA 4DWJA 1VM6A 2XMQA 2C78A 4LC9A 2VJQA 3N76A 1P3Y1 3RASA 2PE5A 4X1IA 5KKAA 4K9OA 2ECKA 4LVCA 4BLVA 1R6TA 2YXEA 1J42A 2BP7A 1Q57A 1U81A 3L0BA 2QQFA 1M0TA 3SKXA 1RZRD 3BX1A 3USES 3LT2A 4QFBA 1X0XA 1TXGA 4EHIA 2IBTA 2HCJB 1NQVA 3C16C 3NX4A 4N0QA 2BEUA 4AB1A 1ZD8A 3MYYA 2B1GA 2WTNA 4BQFA 1U4OA 3ICCA 3O4IA 1KDYA 3BZUA 1VHQA 3K8ZA 4KXVA 5LQSA 4JA0A 5A4AA 1QRAA 1E9DA 3IAUA 4YIHA 3BEOA 2FPXA 3L6DA 2QD5A 4JEMA 4UREA 2FEWB 3MPOA 5CHEA 1ZRHA 3QW4B 4CWAA 2Q4TA 3B13B 4ZI7F 2PUDA 2JAPA 4C4TA 4YCJA 4FGSA 2ZBPA 2C2OA 4L02A 3EOZA 4ZKEA 3NWPA 2XB4A 5DMXA 1L5HA 3GY0A 5GJCA 5B3AA 5I5EA 4MXDA 3SQNA 3BE5A 3DZIA 3DAFA 3SX2A 4CQMA 3GPCA 1JKFA 4BMYA 3FOWA 4INZA 1EXMA 3I8OA 1K6MA 2YFHA 2YVAA 2IDMA 4K81B 2COKA 5J23A 2QT1A 2QX8A 1YVPA 2ZTUA 4LJ8A 4RY2A 5G3ZA 3DV9A 2HCRA 3AIMA 1SIWA 2J46A 4BCBA 4OXKA 5A6SB 4KQMA 6ABPA 2NP7A 4XWYA 2IGTA 3CRW1 4K6FA 4MS3A 4YRRA 5SZHB 2FSPA 3G2QA 1U1CA 1GEGA 1TW2A 2X0FA 1O6FA 4CLDA 4M1EA 3VJRA 2W37A 4KACA 4RPGA 1W5FA 1WNFA 2UUAB 4I4TB 4IW3B 3NDPA 4I1UA 3FYHA 3BF8A 4KP7A 4RY0A 4U6QA 1FRQA 5F73A 3ZHSA 2P8SA 4HYEA 4B2YA 4XE5A 2M32A 4C3OB 3EVTA 3FHJA 4F3RA 1DEKA 1G7TA 4P80A 5AJVB 2OLEA 2R5FA 5A5DA 3M70A 3O8OB 4RTJA 3TZQA 2V5AA 5BW6B 1DIBA 3U9TA 2L0XA 4HNAB 1IAVA 4EW3A 3ZLJA 3EA4A 1ZNWA 5IK2A 4DA9A 1EWKA 3CNLA 4MWDA 2BMWA 4C6TB 4Z0HO 3GELA 4MW5A 3C15C 3L7CA 3H5VA 1SZCA 1C1HA 3RUAA 1SC1A 4EECA 1OYOA 4JJ8A 1MOZA 2Y67A 4Z49A 1QRRA 4BV3A 2Q6KA 5ICSA 2DEUA 1BXRB 5GVSA 3U26A 1SWWA 1J0BA 4FMBB 4MKRA 2PUFA 2AQKA 5A9TA 2GN9A 3CRMA 3CZPA 5BNFA 2XV1A 1GTJ1 2ABWA 5AMXA 3ACCA 3E22B 4HK4A 1GO2A 2NV6A 4K6CA 4EJ0A 5HYVA 5L4LA 2J3IA 3NHUA 1X7ZA 4U7TB 2GBGA 4ZAWA 1APBA 5LKRA 3KKPA 3TQHA 2VSFA 4PS0A 4OQQA 3IL2A 2H4WA 4I08A 1KERA 4WK2B 1IMJA 1QKJA 1KTVA 1VMEA 3JWIA 3ROTA 2GPAA 4UATA 5IZCA 5K8UA 2WMYA 4B7UA 2X8AA 4MWCA 4I55F 4OYYA 4V3BA 2IHTA 2BGKA 3ILVA 3DE3X 3RHTA 2QW8A 1QIDA 1BS2A 2KPOA 3V4RA 3IBCA 4KDRA 4HAWA 2JBAB 3BG5A 3GLTA 3HA5A 2FKAA 4IMRA 1C1XB 1PJZA 3BHJA 3S1LA 3OJFA 4NG5A 3K2BA 4AROA 4JB8A 1L1FA 1YBVA 2WFMA 4XPIB 1PWYE 3O3OB 2IOQA 4U9IS 4UD6A 5K0NA 1N9ZA 3MJCA 4PPYA 2Y76A 1TJPB 6GPBA 4PC6A 1LKZA 2IHZA 4IRUB 4KN5A 1UWCA 1Z0IA 2ZYUX 3CX8A 3PA8A 1A96A 4II7A 3V8NA 2RGRA 1Q44A 3CNOA 3RSHA 1DKNA 2OBLA 4XGIA 3K0CC 4L1KA 2QS9A 4NTZA 1R88A 3A1WA 1ACMA 2V3CC 2WHQA 4BIIA 4YAFA 4ZYYA 1V4VA 1HE8B 3HDVA 3SEZA 5EINA 2ZSBA 5AJYA 2RBKA 3LWNA 1GZSA 2XVYA 3K0FB 1I3CA 3IKLA 3ZUGA 4AP5A 2OBFA 2Q3JA 2ONCA 5F7OA 4G84A 4HYYA 5GV8A 4A73A 1H9CA 1J8QA 3HYCA 4YCDA 2R8BA 5BYBA 4B4UA 1EDZA 1G2PA 1YB2A 4AJ4A 4DLVA 2B6NA 2RB4A 5IM4A 3QU5A 4JITA 2I2AA 5F3RA 5JISA 3RUPA 3CVWA 5EVCA 1TQ2A 4QOJA 1K7FB 3ZGVA 1MVLA 2CF5A 1Q0QA 1LBSA 3IERA 3N8IA 4Q4HA 2WJ4A 4NP6A 4QOEA 4RF4A 1MQAA 4PS1A 4YREA 1GY8A 1D9XA 4L5AA 3ZDQA 3UJAA 1QMPA 1F20A 1R74A 3UIEA 5C18A 1JXAA 4ECEA 1POWA 1TCAA 1UANA 2X2PA 2F3PA 2FAXA 3Q41A 2JGAA 1J2RA 4X8OA 5LC1A 1VE5A 2HRRA 4ZT4A 1E1YA 4K6GA 1OVMA 1AD2A 2JLVA 3RVQA 4M83A 4ABYA 3QJYA 4GI3A 2AMFA 4K2AA 4MIKA 5HG0A 3U3DA 1MC5A 2GN4A 3TLAA 1E8DA 2IUFA 3CGGA 1BTOA 3ZE9A 4E11A 1OA0A 4C6TA 1WDLA 4ZVLA 3KR0A 2PUCA 5DHSA 3R9WA 4JWKA 2AZDA 4UMEA 1U7OA 4JUCA 3RNLA 3U39A 5KQRA 4OP2A 5J2UA 3JSAA 3KR1A 1J5PA 3R5XA 4N5DA 2DKNA 2PMCA 2XXBA 4KXXA 1MOQA 2XTAA 3AFIA 2DX7A 4D0RA 1QYVA 4FYJA 5FHQA 1K0UA 2BGIA 1KKUA 1SVOA 4QTXA 3RLFA 3TYXA 1HDYA 3AJ9A 3SEFA 3ZH2A 2WWVD 3S2ZA 4PC1A 5IJ0A 1U0NA 1SRQA 4XGNA 4C7XA 4QJ3A 2VHJA 1Z29A 4PZYA 4XM1A 1I9CA 1Q1NA 4MCAA 1FFXA 4D0LB 4DQKA 3RYCB 3B5JA 3C3CA 3ANMA 4I14A 3SQMA 4WE3A 4C07A 2PWZA 1KRWA 1ZICA 1WB6A 3E4CA 3W2EA 2OO3A 2HA6A 2I4RA 4JR1A 3DYIA 5G4KA 4P2GA 1WDMA 1R0BA 1C9MA 2XWJI 2JZCA 4CRWB 4EHAA 1QTQA 1WSDA 2OOSA 3HP4A 3RF7A 5KS2A 2QI9F 1Z8DA 4JUFA 5CT8A 4AIIA 5FOVA 1PG5A 4P31A 4B4VA 1NW8A 5LOVA 4EYSA 2H1CA 2IPLA 2RHBA 3IPCA 1MC8A 2VJAA 4QYXA 4WJLA 3PJDA 4N01A 2GUWA 5TV2A 4GI7A 4PC3A 1TFRA 4MGHA 3NVKI 1E4YA 3IUMA 5TB5A 1JIJA 3ON5A 4ZOLB 5JJIA 1JLSA 1E9SA 1DDGA 1U98A 4JDPA 3ZDAA 2M1XA 2OM2A 4NZOA 2FG7C 121PA 5ELLA 4BFTA 3TFQA 2HJGA 4E33A 3T5AA 3ED1A 3NALA 1ML4A 1SU8A 4PIPA 3ZE6A 4CM3A 4MHSA 5JVDB 2BIFA 3DZBA 3I5MA 5FNVA 2B34A 2R48A 4FFMA 2OO5C 4Z0TA 3KQQA 1D8TA 2P40A 2O1XA 4RWEA 1MEJA 2V55B 3CKMA 4AWAA 3B7WA 3X1YA 3PIRA 4MVWA 3BQ9A 2PUBA 3KZOA 1DNPA 2F55A 4W9NA 4X7MA 3U4MA 3VSCA 2B98A 2IZZA 5BRJA 3TKLA 4OHMA 4BTLA 4CMHA 1TVKB 2R6R1 2BI4A 3WYBA 4AJHA 4YUYA 3LOQA 5JYCA 2JLXA 1T6BY 4N5NA 3EIOA 1CPYA 2RK3A 1ULSA 4EVIA 4X63A 3ZLTA 4QUDA 4YJKA 4QTYA 3WRXA 4B3TB 2GTHA 4Q6WA 1T8YA 4XQCA 2OD2A 1CWUA 1HV8A 3FKSD 2Z57A 3CY6A 1JFLA 3KL4A 4DJ5X 3JARA 3FZGA 1UK8A 5IVPA 1C29B 3A0RB 1JG3A 2H4ZA 4R1UA 4TZKA 4LJ5A 2C20A 4NYIQ 3VPAA 1H2RS 1RJFA 2IPXA 4BQRA 1DIOB 4R68A 1MB3A 3NHAA 2ODPA 3EHEA 4G0NA 4DLRA 4CIVA 3EXHA 1A7AA 3H42B 1NBOA 4EMBA 2R6FA 4Z2AA 4Q05A 3OEWA 4X64B 4IICA 1EK6A 1FC0A 3EARA 3HVJA 4IS3A 2ENWA 3OX3A 4LRTB 2RC6A 4MOWA 3WICA 4TYQA 1ZL2A 3MVEA 4OUKX 3U80A 3UNXA 4OG2A 2PRSA 3KUDA 4EEKA 4MI9A 1EVLA 1TADA 3LQKA 1XV5A 2BHRA 2QE7A 2V7QA 3D02A 4U63A 4Y9RA 3WGQA 4EA7A 4PAWA 3CT6A 1RC1A 5GONF 4FUQA 2WYUA 4YYZA 1N5RA 1IN8A 3ORHA 3IDZA 3T99A 4U00A 3JWJA 4QDUA 1BCSA 5B1IA 2OBNA 5I9IA 3HCWA 5TQ0B 4PN3A 2QD4A 5A0TA 5EE9A 2HJWA 3L8GA 4IVRA 5KNDD 2P1DA 3GARA 4QUJA 1DJOA 3H6GA 4KU4A 4A5SA 4WLEA 3CRNA 4ZVNA 1M1YB 5GINE 3ROZA 4R0MA 4NF2A 1UAAA 4UNRA 4B3CA 1A9OA 1DC4A 4P38A 5REQB 3WNBA 1LX7A 4RIFA 2VQDA 2P4SA 2PZAA 3AOEA 3I0ZA 3P5BA 1QH0A 1XTUA 2FEPA 1E1CA 2G4LA 2UZIR 4PLFA 2V6FA 4RIIA 5ALHA 5EWMB 4ANFA 5AVZA 3PNBA 4KNVA 3VR6D 4Z4CA 2VQFB 5K03A 2HLDA 1Q11A 3OEEA 4CMIA 2Q9UA 5C8XA 4FXOA 3LX4A 3AUTA 1KFEB 1KWKA 5C7LO 3OC6A 2HHAA 2VIIA 1DCFA 4HNVA 1DX6A 3ENKA 1Y1TA 3L7BA 4PYQA 2JRCA 4PICA 4DE5A 2JLYA 3CF4A 2I7VA 2VPQA 1FSZA 3UPUA 3ZLBA 3Q9NA 4DLZA 3IMFA 2FF7A 2HSWA 1RIFA 3BK1A 1GQOA 2FN9A 5HRCA 5JQGF 1NVUQ 2XKAA 2FX5A 2CV2A 1IOLA 1ZH2A 2OVBA 1IB0A 1OT3A 1QIHA 2RCNA 1XQ6A 1J7KA 4PU0A 2D00A 5G40A 2QRJA 4GPBA 5I8ZA 5L3QB 3WXMA 2XXJA 3O3MB 1MW9X 2CLLB 1LBEA 4ZPJA 1DRUA 5GGYA 4M9CA 3FOZA 1Y98A 1Y3AA 1QNFA 4CQLA 4RPKA 5IP5A 5J4YA 3OX1A 3E3MA 3P0IA 3C87A 3CKYA 4H16A 2LRHA 3WWCA 3VKWA 1AIPA 5CTJA 3A6PC 4PRLA 2C8JA 4J49A 1NBAA 4I1VA 1V1RB 4KE9A 5A2QA 2AKAB 2ZVQX 4LSMA 1SCNE 5EIWA 4OLJA 3HFGA 2FDRA 2QNBA 3FYUA 1KAOA 1B8OA 1P74A 3H2YA 1NZFA 2BFCA 5DI3B 5AW3A 1XUOA 4F4DA 4DR4B 3W5DA 3DE7X 4DWOA 3DR3A 5EWJB 3M3DA 2BGGA 1X19A 3QYAA 4UCQA 2G77B 4PZLA 1Z13A 1NU8A 1FB5A 1HYGA 2NADA 2XVMA 1H4SA 3CCBA 1HZZA 2PZ8A 2UUPA 3KXDA 3UK1A 1USVA 4PYIA 5C9ZA 1H94A 1K4MA 3GUCA 1PJ8A 1NOJA 1NUTA 3N2LA 3Q40A 1G9TA 2VPXA 2XE6A 1JNXX 3LRPA 5CHYA 4DRZA 5LSAA 2IEBA 1GPDG 2PH3A 2WSYB 3PQ5A 3AO0B 5AO9A 3ZCXA 3K0AB 3BGVA 3KLBA 2IBMA 3FSGA 2XMZA 3FB4A 5DNAA 4CKCA 1MX3A 3FJYA 3LUGA 3ZU2A 1NBWB 2RI0A 3EVNA 2YKGA 1ACLA 1G6OA 1QJCA 1G60A 4YI3A 3M6WA 3P0FA 2V45A 4RHCA 3PA6A 2Y0CA 2CCJA 1V5WA 4E12A 4UUAA 3OZUA 5KNDH 5LUBA 1RP1A 4RLSA 4R71A 1GZHB 2YFQA 2AN1A 4C87A 1G18A 4M38A 1ZKDA 5TX7A 5K8JB 4M7OA 2JB9A 3KXLA 5TF4A 3GVCA 4E46A 5IDQA 3CZ5A 3UPDA 5G0TA 2ARKA 4MO9A 5JCJA 2HWUA 1R64A 2WU1A 3OFJA 1GU7A 1E1CB 2R96A 3GA0A 1JSXA 1W5EA 1R4NB 3OT1A 1C41A 2RAUA 3DMYA 1ZGCA 4P58A 4Q3CA 1PWXA 2Q2OA 3CNBA 4OMUA 2E21A 2FN8A 2ZANA 1FNSA 3KJEA 4X3OA 2W4QA 4YA6A 1IXSB 1WMAA 1QR6A 1X7XB 4MGZR 2F64A 4V2IA 3RSGA 2DXIA 2DAPA 1HX7A 1OR8A 1WXHA 4OAPA 4RVSA 4TQGA 2NXEA 2ZI9A 1F1JA 2FPMA 1PFGA 1FRVA 2E5FA 3GFPA 4MPDA 2ZM5A 1N34B 1DGQA 2IZ6A 3E82A 4HDNA 1D3AA 2NU6B 2V7GA 3N2IA 3OA0A 4PHCA 4B3FX 4GI1A 2FWRA 2YNMD 3IOBA 3K53A 5EGSA 5JJBA 4AKEA 4J6FA 4GPEA 4KQ9A 4JJZA 2D06A 3SNKA 4RH0A 3W34A 1AUVA 2D0PB 1BXRA 4H1TA 2F8SA 1T25A 3VNBA 4HO1X 3FOAA 4G9GA 4EA8A 1I9GA 4O0MA 5LA6B 3FWPA 3W7BA 3MHTA 1EFCA 3GB9A 3RAEC 1SMKA 1ZNQO 1FDSA 2QZJA 3HGQA 4QECA 4AMVA 5HRAA 2Y8EA 2WWWA 3D6AA 2WKQA 3CN7A 1SXGA 4GH5A 5BQFA 4IXTA 1PAUA 1Z3IX 4I0WB 1XA0A 2DTEA 1ZM7A 2PZEA 4PGMA 4B1FA 3ZX4A 3Q8LA 2CFRA 5CB4A 2AG1A 3GAZA 1OI7A 2KBFA 4F9FA 1QWOA 1O9HA 4I1IA 4UC0A 4R05A 4GM4A 1MU0A 3PNQA 1K3TA 5SYAA 3ZXXA 1SUAA 5CU7A 4RQAA 3VVMA 2Q99A 1ISMA 1PJCA 1TAQA 1X92A 2IWHA 1YAJA 5T7BA 4KPFC 2GVDC 4KO3S 4B7AA 3F4KA 3OOHA 4EBBA 3GX1A 4K9SA 2DHQA 2AD1A 2Z2JA 1KYZA 3KEMA 2POCA 3OUTA 4IV8A 1I7LA 2EBWA 4IHQA 3C48A 2IYSA 3GRPA 1EQ2A 4GM1A 2R68A 4TMVA 2H59A 4XAQA 5JYDA 2HA3A 3FIUA 3PGVA 1OLXA 4JOBA 4HDCA 3EFOB 4KW7A 1IRXA 2YJGA 1PJSA 2OZPA 2P62A 2EX4A 3EXEB 1KSFX 4L16A 3K8QA 1X8XA 5CA1B 4S12A 2HQOA 2ZB3A 3L6RA 3UJDA 1GPUA 1VJGA 1A8PA 4A8JB 1JSRA 3PGA1 3UC5A 4Z4HA 5C37A 3DWIA 2WSMA 3DVSX 3NUQA 3RRJA 3V4LA 1E0AA 1FSGA 2D2FA 1T10A 3QVWA 1KFJB 5MFZA 3F6PA 1HE3A 4J75A 2FN7A 1SUCA 3AI2A 4I1RA 4ZA2A 3Q3IA 3SE7A 4XDGA 2AGVA 3NYWA 3ZDYB 4BNZA 5E38A 1YE3A 4TLEA 4R2MA 3EVGA 3QEAZ 1KDVA 2X3UA 1VTKA 4RGQA 1A95A 1GQQA 4C4ZA 3C2QA 1MG5A 3EZFA 1V3TA 1YHNA 1O9GA 2OC4A 3EQ8A 4MUJA 5JC1A 1YI0A 3SHTA 4O4JA 2P5UA 3MTDA 5JI2E 1B4DA 3HDGA 3VGJA 1AKMA 1YZKA 1CUCA 2OQ2A 2VPZA 3OJLA 4X1YA 4NYJR 5F21A 1CUJA 4TWIA 2VNKA 4TUYF 9ABPA 2O52A 4YQYA 2PMEA 5G02A 1NF9A 1TE2A 1E2BA 1EWVA 5FNVB 3SF8A 4F2HA 1KNXA 3T3EA 3BH6A 2C77A 2WU4A 3H7IA 2KLHA 1TFUA 2LD4A 3CE9A 3EG9A 3SXPA 3S7ZA 1NP7A 3ILHA 3EDOA 2JGDB 2OGTA 3RUHA 3AUUA 1QG4A 1DCKA 4XYGA 1BHJA 4F6LA 2Z3WA 1P73A 4O59O 3O21A 2HU5A 4FONA 2GTPA 1EHCA 1TPZA 2X41A 2EIXA 1YKFA 2Z95A 4A92A 1FFEA 3G17A 4XLTA 1GLGA 3I73A 3JQ9C 3V42A 2ZRPA 3LKVA 1DPFA 4IOMA 4ARBA 4RZ2A 5B57C 2IHJA 4NZZA 3LLSA 4FDMA 1MFPA 2WSLA 1T9KA 1ZR2A 4NIMA 1MZPA 3AFHA 5I8WA 2XY4A 3DG9A 3KKZA 2A0WA 3C6KA 1OFVA 2CXTA 2C7RA 3BFKA 4Z0PA 5TMDA 1XZHA 1RI1A 1KZHA 4DC1A 3L1HA 1YJQA 2PG3A 1U3CA 3B85A 2J59A 4BO2A 1KDRA 5MFPA 3DYBA 4WGGA 5EZYB 1NBHA 2CXQA 4I1YA 3GLIA 2RI6A 3DDCA 4NX2A 4D4LA 3W9SA 4EPRA 2GM3A 1WWKA 1JAXA 3H5NA 1PUXA 1RHQA 1I0ZA 3FG9A 1SA0A 4MRPA 4LC0A 1ADCA 1UKAA 2I33A 2D8AA 3GLHE 3I8XA 2PFGA 1XL1A 5EY5B 1WSBA 1UIRA 3BHMA 3M4YA 3PUYA 1R0WA 1SCAA 5TDHA 2DBYA 4BFYA 4RVDA 3ZJ5A 1OH6A 4OAOA 3GUHA 3JR3A 1MUUA 4I50A 2I78A 2VDQB 1XSEA 2YWCA 2P7HA 4LJRA 4IZHA 1KE1A 1SPXA 4N12A 1KJNA 4DLTA 2VK2A 4DC0A 5JAOA 1OGJA 1L7PA 4NK4A 2NZ2A 4H7PA 3SYMA 2YXPX 4D4MA 5C8YA 3O90A 1SQFA 1H2XA 2VT3A 3PR3A 4UBJA 4XSHA 3VSBA 4AX8A 1EUYA 4B2IA 2G40A 1QKIA 3U7JA 1QM5A 5BO5A 3TVYA 2QA5A 3RI3A 1R6UA 2BEWA 2VWPA 2OV3A 4FDLA 2JFNA 3QE3A 4D4HA 1OE0A 1SH7A 3EIUA 1NRXA 3KKOA 1HDCA 1Y48E 1Z4QA 2ERXA 2GEBA 2OUIA 4H27A 4MP8A 5DJ5A 3CF0A 2ZVJA 3TSAA 4I4NA 3RVMA 1LD3A 3D54D 4GMDA 3G1TA 3QVMA 4A9AA 1QCZA 2R6GA 3OM9A 4CKBA 1DC7A 1EAYA 2NO5A 4K9DA 4E5VA 3TD6A 1LLDA 5KOJB 1VXOA 1G1MA 3OJOA 1OCEA 4Z4GA 3CLRC 4PZ0A 4PLTA 2VDWA 3PYMA 3NFRA 2AG6A 1GLNA 1RIIA 4TV8B 1SZDA 1OFGA 3SS9X 1IN5A 4GSYA 3MTEA 1Q92A 3I2HA 4I2VA 1TTHA 4CUJA 1NVKA 1THGA 1CEQA 5A5VA 4MR9A 3GP8A 2RH4A 4FQ8A 3I9FA 1M66A 1D4ZA 2I4NA 2ZRMA 4IFEA 4K26A 2FJ0A 4K40A 2CNWD 1IN7A 4C4YA 4C0HA 1Y3DE 1IH8A 3DBRB 3D6JA 3UHPA 1T3GA 1U1IA 2PFKA 3JQEA 3MJEA 4TYPA 4W1PA 3OQNA 1J07A 1DBSA 4AY3A 4JBIA 2FY8A 3QUBA 4R1NA 3K4HA 3TG8A 1CG6A 2VEOA 4LKRA 4EM6A 2X7JA 2WU0A 1ODIA 1YIAA 2QX6A 4DWVA 2Q1YA 3PUZA 2VHCA 5CT9A 4BBAA 4ER6A 4CGZA 1E4EA 1MQ9A 8ATCA 5JASA 3O8DA 1FP2A 1A69A 1L5MA 4ZRNA 1ORDA 4QRDA 5A7FA 4XWAA 1G7SA 5CB4F 3DEKA 3UAYA 4FNGA 2CDNA 3K09C 4QEDA 4WZZA 3RIXA 3HM2A 1Z5PA 3LUPA 5L53A 3IP6A 2PLAA 1I3LA 3QX8A 1AJEA 1LXCA 4C2BA 4URVR 5D1HA 5I7OA 2ZPUA 2GPTA 1A8UA 4RANA 5I7UA 3H1BA 3T7CA 4Q37A 1SBNE 3V1KA 3X2SA 2GT1A 3GJSA 4JI7B 1YU6A 1IHPA 2OFOA 5B1YA 1Z0SA 4YPOA 4WK4B 3V8RA 1I13A 1B8PA 3KOWA 1QK5A 1E1LA 2F1RA 2YHBA 2Z3VA 4QOIA 2BHTA 4KNYA 3QWAA 4ZVOA 1PT8A 3WGUA 2K7ZA 1A77A 1IMOA 3KHUA 1A9TA 3IPYA 1WE2A 4P82A 1HE1C 1Q0ZA 2PUWA 4V03A 5EKXA 2H4YA 1XDSA 4FYIA 1N0IA 3RTDA 3SICE 5BSFA 3WLSA 4DLWA 2C0CA 3V00A 4R8SA 1JU4A 1RBYA 2A5FA 3D8RA 1A82A 3HR8A 4G8JA 1LPPA 1KVQA 1WZEA 1Z4IA 3LP5A 3O73A 3OKPA 4E5NA 5KTYA 1K8ZB 2IHBA 3NTLA 1AO3A 5EJGA 5JSZB 1REQB 1KBQA 2OZEA 3EC1A 1HLFA 2GDJA 1HKHA 4JBHA 1KYXA 4EW2A 4BNDA 4EY3A 1Z7EA 4XH9B 5KQLA 4E2FA 3VU8A 2GF2A 1XCPA 3Q0TA 4MUBA 3MB8A 4HD8A 3M4NA 3HKDA 4FYYA 1KAHA 3GPIA 4O8ZA 1VFNA 2R2AA 3STUA 4LV5B 4D4IA 3THXB 2JGDA 3IHKA 5KYWA 3U56A 2GUGA 2JAOA 1CF9A 3NGMA 1W5SA 3F78A 3EF1A 1BYUA 3UJ8A 4ZIRB 5DLPA 2IX3A 1EUZA 4NYMR 1VSQA 2EBUA 2G82A 4NOMA 3L0CA 1XZBA 2DHRA 4DLSA 4DLBA 1Y6FA 3C1UA 3PC2A 3IB6A 4AWBA 1GZ7A 4LHVA 2UZAA 3IHWA 1K63A 2MR6A 2YQZA 4Q18A 1DKQA 2J45A 2PEYA 2BY4A 1LI4A 2PD4A 3AOEC 1J9EA 2E4ZA 2IQIA 3I0MA 4FFDA 2JJ8A 3FYUB 4EEZA 3ES9A 5LYJB 4OLBA 5ED4A 3CZ4A 2HRCA 2SHKA 5CX4A 1V3VA 3EZXA 1SXHA 3SXUA 1T2DA 1WCXA 2B37A 1BWSA 2E87A 3G89A 1PG0A 3G2HA 4NLLA 2XNHA 2Q4OA 4HFNA 3WAGA 1GM5A 3A2KA 3EXIA 3I28A 4ZAZA 1S1MA 5ABPA 3E3OA 3B3FA 4Q48A 2R0QC 5DHUA 1TD1A 4A91A 4H4DA 3SBOA 2EYQA 3T15A 2VP3A 5BR7A 2G06A 3AEZA 4PHHA 2O0JA 2PM8A 4NNPA 5CGQB 1W93A 2XYPA 4QLAA 4LZNA 3A3OA 1BKYA 2J6CA 3KZCA 3TI7A 5F1KA 1U8UA 3A6EA 4S1OA 3WL6A 5DNEA 1PJ2A 2R1TB 1DXHA 1OAOA 3GJTA 5IHPA 2JJ2A 4LKOA 3MJHA 2QDXA 1IBKB 5AVOA 4N5MA 3EVAA 1SY7A 2WJ3A 1HTTA 5K09A 1ZM3A 4ND7A 1OD6A 2VHQA 4XGKA 3PFHA 2AWNA 5FTNA 1ZIYA 4F06A 1P5HA 1X7WA 1HT0A 4KQXA 5JMOA 2QLJA 1J21A 4ABTA 3JSXA 3NYIA 1Z45A 4ZJYA 1K06A 5CVJA 2X9QA 3HLTA 1LLFA 3B51X 1MEEA 3JYNA 1Q16A 2GEDA 4P4UA 4Q1CA 1JQAA 1X1DA 2PU7A 4JSRA 3EVFA 5KYYB 2XUKA 4MPPA 2CFCA 1YHZA 2GJ4A 1UXOA 5AVTA 2OGWA 2VS1A 4LY0A 1OZGA 3ZH9B 5K3SA 4D79A 5JFTA 4WK6A 4U1RA 4C20A 4Q16A 2ZT5A 3O8BA 1ST3A 3UJ3X 3DS8A 1I80A 2YQ4A 1CUGA 1FFAA 4HRVA 1MDFA 4HDSB 1NJ2A 4P5DA 1Y42X 3QM1A 5HILA 4KN9S 2RHGB 1N8NA 1K08A 1M73E 1ENZA 4LNAA 3KZMA 5FUXA 2HMAA 4F2GA 1ZEJA 4OLAA 2ZS8A 3HSSA 1JZQA 5JXGA 1H4QA 4FXPA 5FTJA 3W1VA 1EK1A 2XGGA 5HZMA 3JTMA 2VKQA 2Z9CA 4MV3A 3D1VA 5CFZA 2QDKA 3OQ6A 5LP6F 2FG6C 2YJNA 1E0JA 1EFVA 2VNHA 2XRMA 3JQDA 1RRFA 3QJ5A 2PUVA 3SYLA 3U9LA 4A0GA 1XAJA 1P2TA 2HUPA 2WUGA 3NBZC 3OJEA 4J0GA 2JGFA 3PC8C 1GGMA 4I9NA 3TR6A 4ARVA 1PTKA 2FK8A 2B35A 3URMA 3DCIA 3A7DA 1H22A 1KAEA 5CA0F 4YAKA 5IW8A 2AN3A 4UMFA 3RSCA 1SNYA 4P3YA 1F5NA 5I9TA 4FNMA 1VCNA 2X1HA 2YIJA 2B61A 2YXLA 2V7PA 3PPIA 4GR9A 4IFTA 4BKUA 3UPTA 3LNCA 1RRKA 1TTPB 3AHCA 3FPHA 3G23A 3FZYA 1H05A 1K6EA 2K4MA 2BDTA 1GSAA 3DD5A 3PNKA 3EZ6A 3PBKA 4WJKB 5DMHA 2JLBA 1Q1ZA 1S0UA 1EXDA 4COOA 2H7YA 3UXYA 1JLKA 2W70A 3FMVA 2QG6A 1FUYB 5IKEA 1WP9A 3WWEA 1P7CA 3GLFA 1B93A 1BFKA 1I8TA 1QB7A 3IUEA 5EIAA 3QX3A 3F5SA 1FDOA 4I8IA 1N6OA 2OAP1 1M0SA 2Q0HA 2I71A 4DSOA 4MDEA 4JP5A 2JI6A 1XYVA 3ZGNA 3AB8A 4R8MA 2EHDA 2IU0A 3GDOA 1E32A 1QFSA 3U3KA 5ITWA 2PS9A 3DZ8A 4MAMA 1AO0A 2GCOA 2WFAA 2AOTA 4HGZA 1SIOA 4X62B 3JQ8A 3FPJA 2QW0X 4RKEA 4BVHA 4NBSA 3C3JA 3H9QA 1TYDE 3RYTC 4MSUA 2XBLA 3ZYZA 3ADOA 2B7BA 2BHSA 2R7MA 4RDXA 1X9GA 4ZN6A 4Q6BA 1PZGA 2LGJA 1CUAA 4N82A 5K6AA 4HEJA 1NG1A 3AHDA 2Z4SA 2MINB 3CFYA 4LXQA 1XDBA 4QUGA 2R11A 3M6IA 2N75A 3T1YB 2PUTA 1ISRA 5DEIA 5JCOA 4FS8A 3SSAA 3V1LA 1KGDA 1Y6RA 2CVHA 5BMOA 3DGEC 2VI5A 5F5NA 4E7PA 4HRXA 1G8MA 2LIVA 2ZE7A 2ZUCA 5EI5A 3UFBA 1SBHA 1E7WA 2Z43A 3D0KA 1IU9A 1OZFA 2PD6A 2XWBF 4IFIA 2ZKIA 3I1IA 4XJXA 3WGOA 1O2DA 1E9FA 1Q0SA 1Q5PA 1GZ5A 1AA9A 2FG5A 3D0OA 1P2FA 4XARA 4IILA 5ARDA 5LLDA 1HEYA 3O4VA 4GIBA 1OLSA 5DB4A 3RUCA 4L2IB 3HVKA 3BWCA 3FYSA 3OCWA 3K3PA 4W7SA 4YACA 5I6DA 4G0UA 3NHYA 3ESXA 1R0CA 2F3TA 3GUYA 2VXCA 4NBKA 1L5WA 1K3FA 2FZ4A 2ZRKA 5AVYA 3QE9Y 1T1EA 3RTEA 5CEJA 4FSHA 1RHKA 3IO3A 3OFKA 2Y9PB 3GJZA 3LAWA 3OIDA 3TVDA 3TZ6A 5BY2A 5LFAA 3MUEA 1KPHA 5KNBD 3BWYA 2VBIA 2VAMA 3QUSA 2KWIA 3ZG6A 1B0PA 1WB5A 1XFAA 2RIRA 1ZH4A 2B83A 4LAFA 1ODSA 3UAXA 1EQUA 4DFDA 4UHHA 3M9WA 1P1BA 3LA6A 1NJGA 5LJLA 4OBXA 1L4NA 3MUFA 1G5TA 5B7NA 2IZ0A 1QOPB 5C32A 1SO8A 5CYPA 3CLKA 3W9UA 5KKCA 4FJ2A 1PLLA 3CNQS 4PTYA 4WOJA 4B17A 3TOVA 2C5LA 2J41A 2L19A 3EW7A 4ZCSA 5JBNA 3PHLA 4O4IB 4KGVA 3P32A 1QO0D 1PT9A 5DSZA 5IKMA 4EA6A 1R4AA 1EFKA 1SXJD 2WVGA 3R5HA 1ZAYA 3MLBA 5FR1A 4RL6A 5H1YA 1E2NA 2IH4A 2W22A 3DFUA 2VZLA 5TQ0A 1Z4MA 2I65A 4A6DA 3IELA 5CLQA 5LLTA 2E89A 1V16B 2G67A 1HYQA 3OZIA 3SX0A 2RGXA 4IIFA 3EF0A 3KQVA 4HDKB 5LP6C 4UPDA 3BHNA 3T3GA 2BI7A 1CRQA 1P1RA 1PW5A 2H4XA 4GI5A 4LK2A 3SQOA 1Q0LA 1W46A 3AR8A 1ESDA 1U0HC 2FXIA 4GEGA 3ZE1B 2GPSA 1U2GA 3BXFA 1Y82A 1NT4A 1R8SA 2ZTHA 3O84A 3P0JA 4YRCA 1DJQA 1NW5A 1T3ZA 4HTFA 4QULA 4UUQA 3FA2A 3VV3A 1Y9EA 1OFTA 2XNSA 4HQ6A 4RD3A 4LTDA 5BR8B 3LUHA 2BELA 2H5LA 2X2FA 1WULS 3QMWA 1E2FA 3G1WA 4K6HA 1P3JA 3URKA 4TMWA 1PHPA 4ITRC 4NOLA 3RFUA 4WCFA 1TIPA 5B4UA 2QUKA 2EKBA 2X1LA 3IH5A 4OD0A 5ECWA 4FD2A 2I6QA 1ENYA 3RE1A 3CQ9A 3EPPA 3RHSA 4OI2A 1TEZA 1A9RA 1YTUA 3E8MA 3T7RA 1NXWA 1H1LB 5THQA 2Q3EA 5JXHA 3TDNA 4GGMX 1XRPA 1HDRA 4EEXA 5ISMA 1VA4A 2YUTA 3ZDCA 2WM8A 4TWAA 5F5LA 1FNDA 2O9JA 2RHMA 4YO8A 4I19A 2RBEA 3A9UA 3PFNA 4L9AA 2WT9A 3VTAA 3I2IA 4NENB 4UASA 1U0GA 5A3SA 2JKZA 5IDYA 1CFJA 1QPBA 2QU7A 1K6JA 4WCVA 3PB3A 4D41A 2ZSHA 3FGNA 4AZ3A 4B09A 4HNHA 1HSOA 3T7JA 4ZHQF 5KYKA 4EYQA 3WGGA 4UD2A 4LZPA 4DCGA 1UDXA 4O2BA 1Z4KA 4O02B 3PF8A 2FVYA 1OH5A 3WK7A 4D44A 3R8FA 3U7EB 2YW2A 1N92A 3ED5A 5JU6A 3FCOA 1WQ3A 2BUBA 5FWNA 1U2RA 4AT1A 4AS2A 1D1PA 3QPBA 3EQZA 2FSVC 5BNWA 4OI0A 4YRDA 3STTA 4YLEA 4BO6A 5BVGA 3SDBA 3PXAA 1SVMA 3AKZA 3WYEA 3WOHA 3O8NA 2AVNA 2JGNA 5FUQA 3TRHA 2BJVA 1AGPA 3FTNA 3SR4A 2H0QA 1XXHA 5COQA 2ZUBA 3B2QA 3ZTTA 4DIDA 2QOEA 4KPEC 2V6MA 3GLHB 2VSOA 5BOSB 1C1DB 1HPLA 3G88A 3BKWA 1KAQA 3KLMX 2IU4A 4JXKA 1TVMA 1OPRA 5ELMA 4BQNA 4ENUA 1URPA 5K3FB 4JJEA 5BSWA 1TCVA 2DETA 3VYWA 1ELOA 2AC4A 5K3OA 1Q12A 2H2WA 3HE3A 3F8TA 3NEYA 2GXAA 1XEFA 5AW8A 4NESA 1NXOA 1R6DA 3LTEA 2OP0A 3D3WB 1BN6A 3KTAB 2DUJA 3OZXA 4G37A 5E3IA 5I47A 2CLMB 4D99A 2BZ1A 3NT4A 1RPJA 1TU0A 2OKGA 3AR2A 4F11A 4QPPA 4P7FA 5HSGA 1I3MA 2L82A 3T5DA 5MN5A 1O89A 1VSBA 2HDWA 5KTTA 5BWMA 5MGNA 1BE8A 3PFGA 4PQYA 4NBNA 1QHEA 2O48X 3E84A 4IVNA 2B1QA 2LV8A 2WB4A 2Y2VA 4CMAA 2EW1A 2CZCA 1PR1A 3GRVA 2IS2A 3D7RA 1L3CA 4KN8A 3G9XA 2IS6A 2YNMA 2ETVA 2IW1A 4F6CA 1Z8FA 1U8AA 1T5TA 5JXJA 4QYWA 1LVGA 2FP4A 4EMTA 4CMEC 3B2EA 4F4JA 4H08A 4LRUA 1JQ3A 4XCXA 4DA6A 1QC5B 1IN4A 1V25A 3NHSA 5F23A 1YGPA 5DWDA 2FWMX 3DE1X 4Q3BA 5CH3A 1WIWA 5LBTA 2P9ZA 4PR3A 1KQFA 3LC0A 1HDOA 2IUEA 3DF9A 1I51A 3LC7O 4FGLA 4J9UE 4CL8A 1RWOA 4R1TA 5CG1A 4REQB 2XIQA 5H70A 3IQZA 4AYTA 2B69A 5LD2C 1YMVA 3PZBA 1C3OB 1L7QA 3HYTA 3NYQA 3OO0A 4ZT7A 5FUMA 4M0MA 1G5IA 1QE5A 1IXRC 1PFWA 1K92A 4RE6A 1XCMA 3VSEA 1JJVA 2OFXA 4GOKA 1TGYA 3AP2A 4Q4JB 3HY4A 3JYLA 4U7PB 3ZCQA 5AM2A 5K5EA 3SIPA 4BEWA 1L7MA 4M55A 4CHTA 1YIDA 1UWKA 2HLHA 2BR4A 2PFSA 3AEXA 4MW1A 4YRIA 1GNPA 1JQBA 1NQ5A 3AB3A 5COBA 5KTNA 3B3GA 3OP4A 4E08A 3PLAE 3LXRA 2FPSA 4HY3A 2FMIA 5I7WA 1VPDA 1SBTA 1FYVA 2W2LD 4M98A 4XB1A 3OCJA 3V2HA 4Q7KA 4MDYA 1JALA 3PRHA 2JLCA 3EF3A 4R83A 5BVGB 2ZRCA 4BZWA 2A8YA 3N6VA 1KQGA 3EODA 1U7WA 2QORA 1ZIXA 5CBKA 2VYND 3GN2A 4OGKA 2ID4A 3GNQA 4MVJA 1USWA 4DJTA 4G0WA 4NZMA 1QBKC 2FZCA 3DVRX 5HBGA 1DIGA 4TMTA 4D3SA 5JO0A 2EJUA 3HFRA 4MYUA 4QT0A 1QDUA 3Q1KA 1JP7A 4HWSA 1CJCA 3REFA 4ZVRA 3NORA 1ST2A 1DZIA 2B30A 4D9EA 5JW6A 1PGPA 2ZYVX 4L15A 3AI1A 2WJVA 3H9EO 1U3VA 1KYTA 3PQEA 4J90A 1EFRA 1M1YA 2O0HA 3HU1A 3R0IA 4UHFA 4JLUA 2OAEA 5J1SB 1MIHA 4IJ5A 1EJ6A 3UB4A 3AMVA 4PW0A 5JD6A 1HI9A 1Y4DE 3GMSA 3U1VA 1KS2A 1L8LA 1NR7A 1R9JA 2X9VA 2WDPA 5CYFA 5K0GA 5FCDA 4BRZA 1CUVA 1SEPA 1J99A 3DO6A 4LWOA 4BRSA 3IT3A 3QV2A 2CHEA 2AR0A 2WPNA 3HB1A 3L1JA 3DJFA 3FHLA 4FFBB 3RC9A 3IQIX 3UTCA 2YS7A 3PXEA 2Q5EA 4PYLA 5HHTA 1HDXA 5L4NA 4KSBA 1NP6A 3OPYB 2OAGA 4FBLA 4M1MA 2VPYA 1QJ4A 4RK6A 4R7GA 3NWOA 2BONA 3GRRA 2IF0A 2PYDA 4Z86A 5DRTA 1VHWA 1RRPA 1N2CB 1D04A 1OIVA 3KJGA 4B45A 4Y9TA 5FWXB 1PNRA 3IT2A 4AY2A 4I3FA 3T5BA 2Z98A 3TW8B 3HI4A 3AIIA 4Y3UA 4F0JA 2JLSA 3EGOA 2X14A 4L3VA 3CTMA 3WK9A 4EX6A 5HKBA 3VR4D 4UE6A 3BRWD 1YE8A 3VZSA 3TMAA 4DUGD 2P91A 2O1WA 1RKUA 2QUHA 1WETA 4IEIA 1DDOA 3PNOA 2BGLA 2HH9A 4GT1A 2ZTMA 4M4SA 3MD0A 5GQSA 4RVHA 1Z4OA 3C7KA 3FSRA 4ZAVA 3SSMA 3LO8A 5J5CA 3U9SA 3EFHA 2QV7A 2NXCA 3QKTA 2AHOA 3ZV6A 2I7DA 4KUEA 5DW0A 5K0TA 2O8DA 4Y9DA 5ILOA 2OXCA 3CLUD 3SQLA 2ZKLA 3OLCX 2REXB 2GZ2A 4FHFA 4JYPA 2CMHA 2DMRA 1TRKA 3QWHA 3TQOA 4JBGA 4URXR 2WINI 2L2QA 2F6RA 4AKIA 2P75A 3QLUA 4R8RA 5LZ8A 3F5FA 3O75A 1ZBQA 3QA3E 5EMLA 1UBSB 3WGHA 2YX1A 1JR6A 3TRJA 4PWZA 3RWBA 1NX9A 2ZJZA 3TSCA 3S1SA 3A28A 1IJEA 1ZWKA 2JBWA 2O6HA 3BXGA 3B82A 4YJ3A 2YOHA 4D9MA 1B3BA 2D5LA 3UGKA 2CD9A 3D3WA 2H1IA 3A1VA 4ISBA 3RWMB 3ZY4A 2HK8A 4C01A 2FZKA 5F4BA 4B40A 1L7NA 3HL0A 4LNHA 2NU9B 4C0JA 4RD6A 3K2QA 2WLSA 4FFNA 4HXGA 4F3KA 3KVNA 1E6UA 5AVKA 3PXBA 3JPWA 1FQWA 2OR3A 3KQMA 3M9XA 4ENQA 2VTVA 2PEZA 2IU3A 2ORED 2WD7B 1SUBA 2JJ1D 4RY9A 5AVUA 3GRCA 4ZANA 2QD2A 3FTCA 3TOXA 1GN8A 2C3UA 3NGLA 4R0VA 2JJYA 4TLCA 3QXSA 5KWEA 3ZWWA 2D5BA 2VOJA 2ZXEA 5H9VA 4AY6A 1SCDA 1A76A 3IOMA 4WDQA 1T5BA 2HDOA 2XW6A 5I4BA 1R4NA 5EFZA 3DMHA 1T2VA 3HDQA 3BJIC 3L4KA 3DWEX 1G55A 2P6UA 4YDSA 4PCLA 1Z6XA 4JHXA 2G04A 2WOOA 4RAOA 1R4ZA 2BD0A 1W581 3R0QA 5A05A 5L6MB 4RTKA 3DKIA 4DIMA 1JEYA 4O3MA 2W6ZA 1ZXXA 3KS9A 1Y7PA 3A4TA 4KXMA 1Z34A 4ZVTA 5GONA 1ABFA 3G6WA 4DCTA 1GKYA 2E49A 4K03A 3MWEA 3ZD7A 3WFIA 3IVCA 5EFOA 5DBOA 4OXRA 3A1DA 3E2IA 1T43A 3UWPA 1H2FA 2HB6A 1DBPA 3NGXA 4MUMA 2AXPA 3DBLA 3N58A 4DR1B 1ODCA 1R27A 3JAMA 1DPGA 3V6MA 1CXZA 1NATA 1NJ5A 2XMRA 4IEEA 3MAAC 3S1AB 3AWDA 4DDUA 1N8KA 3DLTA 2DLCX 4DR6B 3W5AA 4BZQA 1XVAA 3Q15C 1DARA 2C97A 5KNDA 1B26A 2H2FA 2V6BA 3LUAA 1J56A 1V2GA 1UDWA 2A94A 4AJNA 5CFQA 2UYCA 2GVNA 3QVXA 4G0ZA 3DKRA 2BKEA 3HUDA 3C3DA 1JI3A 5LA6F 4C89A 1BDJA 1T2UA 4J0DA 1T35A 1KDZA 2QJOA 3OY2A 3EWSA 3V97A 1HRKA 1TO1E 4PM4A 1GQRA 5CLHA 5TPZA 4IDOA 1WDWB 2B20A 4QQNA 1KJZA 1QLHA 3E9ZA 3HI6A 4UOQA 4DCOA 1KETA 4R3UC 1WY5A 1P4JA 3PDHA 3DE4X 5T4FA 1OSNA 2XCTB 2WC1A 3GEIA 4FHEA 2Y1LA 4NZNA 4ZREA 2GS9A 1C8KA 3QQ5A 3L4BC 5LB4A 4BX8A 5CA1A 5L51A 2F2TA 3JQBC 1U6JA 4EF6A 3VYSB 1QV6A 1K68A 3DULA 3DTYA 1XMSA 2C54A 1O5TA 4N4AA 2VDOB 1M2JA 4JD5A 3RH0A 2F1HA 1R5JA 3GLGA 2O2SA 3KETA 3IJRA 4RUKA 4Z53A 4KWCA 2IHUA 4HX2A 3V4PB 1O6CA 1UOOA 2DLNA 3T9FA 4OA5A 4O4LB 4ZICA 3FTEA 4S2EA 1DJMA 2GN0A 4D96A 4RHFA 4W5NA 4DTIA 3UCXA 4W8HA 1L5SA 3ZV7A 2F1JA 4ER3A 3W5IA 2XMSA 1JW9B 1JYSA 3BOSA 2NXJA 3PQ3A 1ADBA 2PAFA 2W48A 3R6TA 4FI3C 3RTAA 1YDEA 4BMVA 1HE2A 4N9QA 5M2QA 3QWBA 1J33A 4EWLA 4TMXA 4AY4A 1I3KA 1HEUA 3CSDA 3G6KA 4HBGA 3AM4A 3GH3A 3OTQA 3W6UA 2J6IA 3ZI4A 2Q9BA 2YVLA 2EATA 2CYCA 1W88A 1ABEA 3F7TA 3PD7A 4KVAA 1I4LD 3IVRA 4AMGA 4UFNA 2PA0A 2BKUA 4G8BA 1U7ZA 3U3JA 3H86A 1W34A 4RKWA 3UFXA 5LIPA 1VJRA 4QQ8A 4FB4A 3ZGXA 1QX3A 5EKSA 5FBLB 1XKTA 2N3ZA 3HJFA 4DDHA 1GG8A 4TX1A 3BUSA 4EB3A 4G1EB 1F8UA 2BR5A 2E4UA 3L1VA 4Y1RB 5BSUA 3SXUB 5J2TA 2WWFA 3PENA 4PLCA 1YS7A 4PG6A 1M1YE 1VBFA 1Z0JA 2AQIA 3A9VA 4Q19A 5A1JA 4DCNA 2V96A 2XMPA 2J30A 5DDIP 3WNCA 4LBZA 3N74A 1J8YF 2CVPA 5ADUS 1GPJA 1V9LA 3AU8A 1L4EA 4O2AA 1V26A 3I58A 1N9GA 3MZ0A 1KH2A 2FTKE 4CDMA 3FSEA 4EPWA 1KI1A 2A6PA 2JFBA 3SKVA 4ITVA 2O7VA 2GAOA 2RHHA 3KSDO 2JHGA 4JNKA 1JGTA 3L6UA 3HADA 5HFJA 1LBHA 5B1HA 3GCDA 4QQKA 4WBNF 4JBYA 2IHVA 3QF4A 2WQZA 2WKRA 3WRVA 1CY0A 1GCUA 1V5GA 3FWNA 4P34A 1E0DA 4W63A 4DDMA 3PE4A 3VZRA 3MMZA 1SRRA 1G8YA 4L74A 1Z16A 3FMIA 4EQ6B 2ZSKA 5AT1A 1C4WA 1SD5A 3GFOA 3IOEA 5BXYA 3LNTA 4ZVSA 2QP9X 4S05A 4UBKA 3W79A 2IS1A 2CD7A 2B6HA 4PHFA 5B2EA 1P7PA 3V4SA 3TRIA 1OF1A 1DRVA 1VE3A 3SC6A 5ALIA 2ZRJA 5EJ6A 5CITA 2VTBA 1LU9A 4AF8A 2QW1A 4EB6B 4TPKA 3MLAA 5H3CA 4B6JA 1W4CA 1Y3IA 2VNIA 1CT9A 1HM5A 1EFRD 4UNNA 3VDQA 2V7WA 1E1DA 1XF9A 1Z4LA 4IIJB 2M98A 2OG1A 3UHJA 3LVBA 3HRKA 3RCBA 2PKCA 4GDFA 1ZHHA 3TD2A 3OA2A 2JPDA 1P9LA 2PH1A 3KQPA 5DK6A 1R16A 1PD1A 1EH5A 2FSFA 2HF8A 4GG1A 4AN4A 5LMCA 3CZAA 4JOQA 4GBJA 2K2QB 2A30A 4MJXA 2IRWA 4OTZA 1Q7TA 1UXGA 5EAIA 3S81A 2J08A 5C31A 3LBIA 4OU5A 5KOJA 4Z7OB 3I23A 3QXGA 4MMXB 4TVBA 2CNWA 3RAFC 3P9KA 1JBQA 4IKOA 1F17A 1VYTA 3DB2A 1IWPB 4ZOLF 3ZHUA 3BH0A 3MM4A 1DLJA 2HM7A 3MCUA 1BW9B 4D1YA 4LHXA 4X1KA 3TLGB 1UT8A 1YZFA 2XUGA 2PKRA 3SJZA 3DNPA 2QG4A 4HHEA 3UMGA 4HAYA 3WO0A 1U8XX 2W4MA 3DFFA 1WCIB 3FNGA 1X1QA 1X7ZB 1T4CB 3M4JA 1OXUA 2FETA 4JJ6A 5AKEA 4AULA 2FSVA 3EBLA 2C00A 4YAGA 4OHYA 1FVOA 3KZXA 3SG0A 2ZETA 4DUGA 1XLVA 1AKQA 4EG7A 1WVMA 3AM3A 2OQIA 2VAPA 4XB2A 4BY9E 2CZQA 2GM5A 3HYSA 4JNCA 4DGSA 4EW6A 4G81A 1CIVA 4DZZA 3V6LA 1OHHA 1YR6A 3JQPA 5DO9A 4ZGGA 1RRMA 3OTWA 2AB0A 4XPIA 4C22A 4A2CA 2QTVA 1TO2E 1OWNA 4RLHA 4F38A 4HWGA 2QPAA 2CFIA 2CYAA 3WE7A 1LNQA 1P44A 1RYBA 2GNOA 3KRTA 1P2BA 1R10A 2IYQA 4AVYA 4BMXA 1FLAA 1JA9A 1WUKS 1QGYA 2AEJA 1IJBA 1KY3A 1UEXC 3FRHA 4OP1A 4X85A 2ZB2A 5L3ZA 1EUQA 1WD5A 2WQ6A 3IP1A 3RJTA 3TW4A 2YTZA 2JIOA 4QVKA 2A1UA 1O5IA 3RLIA 1SPBS 1QK4A 5HW0A 1G9XA 2IYFA 2X40A 3OIUA 4MUAA 1UBTS 1PR5A 4DV4B 1ZGJA 4TKVA 1SAYA 1KYIA 2VT6A 1R9NA 5JDCC 3AFGA 1HT3A 4HSEA 4YFYA 2PK3A 1SBQA 1OWOA 5JTTA 1DJNA 3EC2A 4Q3AA 1DTSA 1B1CA 4C0LA 1N8SA 2AOXA 2WD8A 5EIOA 2HYIC 4FEYA 3ZDZB 3HXOA 3H2HA 1QP7A 5ALJA 5LQDA 3MT9A 1GKUB 2QRHA 3F6EX 3VH1A 1N6LA 1WMEA 2TMYA 3C8UA 4XWWA 3IMKA 4RULA 1QH1B 4LYFA 4ZDIA 1XTBA 3GFFA 2UZ3A 3NU1A 3PQCA 4WLOA 1STOA 4NFHA 5K3CA 4MLPA 5DLDA 1IY9A 1MQSA 3AESB 1Q77A 1WKVA 1TK2A 5THKA 3U60B 4IJUA 4QXOA 2CY0A 4MDHA 5H81A 1YZLA 3MTAA 3KQWA 1J06A 2QJFA 1VI6A 2GYYA 3E7WA 2G1JA 3D8BA 4IQ4A 4CFYA 3ZJVA 3CUYA 2ZAMA 3JWEA 4X6LA 1J0CA 3CLUC 2C96A 2RG1A 3R0JA 4Q5IA 3ZLUA 4AICA 4ZMBA 5H3HA 2XYQA 1SJ9A 3Q85A 5DTIA 2NTEA 3CS3A 3F67A 4D4GA 3KTDA 3LBYA 1Z63A 3EGXB 1L5HB 3CR8A 1SB8A 1L1QA 1KY4A 1Z6GA 1L4MA 3BWXA 1N3LA 2EEZA 3O4RA 3T5GA 4UTNA 1US8B 5D87A 3AUKA 2SNIE 2GZ1A 4IL5A 3G2PA 5A71A 3WLAA 4PQFA 2VCHA 3LP6A 3GL9A 3IKJA 4ZWNA 2H2IA 4BB9A 3ZJ4A 2O8BB 1LPMA 1AS0A 1PR4A 3VR6H 4DM7A 4HTAA 2NUTB 3BXZA 3TIIA 4DR3B 3QKUA 1THMA 3H75A 4O2AB 2TS1A 1R0KA 1GT6A 1T26A 1V43A 2VDUE 3KB1A 2JDID 3PJGA 1AQNA 5L3RA 5HKOA 5JATA 1ZU4A 1XR3A 3E9MA 1ZRNA 3RV4A 3DOJA 3JQFC 3ZDBA 1UM9A 2PSSA 3ANSA 3PICA 2AJBA 2Q7OE 2GA9A 5H9WA 6ADHA 3B5IA 2A7QA 1PJTA 2WKWA 1U4NA 4B47A 1CY2A 1UOEA 3HP7A 2EKDA 2I91A 2BYTA 1BSVA 4GO1A 4R2KA 2I6SA 4WXHA 4C0XA 4F7WA 4XWKA 4OOEA 4I9FA 1AQLA 3SC2B 4XA8A 1JHXA 3QOFA 2Q7XA 3ZD8A 3DAYA 4BATA 2LPMA 1YI1A 2I99A 4RPCA 3WGIA 3LQ4A 4ZT6A 4EB6A 1X1AA 3VZDA 5E7QA 3H6HA 4V38A 4Z8YA 1LTHR 4ZOLA 1M83A 5I7FA 1Z62A 3VO2A 4ETMA 1R0SA 4ZEWA 5ICGA 1RCFA 2J6BA 1ZD5A 4RV9A 4YDQA 6LDHA 3SC4A 3WMGA 2D1SA 3BD6A 1L5OA 4YRMA 3F74A 2ZBFA 5ALNA 2R6AA 3TRKA 4L4RA 2AQ8A 3I9JA 2H48A 1OFUX 3B6EA 1CR6A 1T1SA 2ZWVA 4IYJA<