2LPMA

Chemical shift and structure assignments for sma0114
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
123
structure length
123
Chain Sequence
b'GSHMTERRLRVLVVEDESMIAMLIEDTLCELGHEVAATASRMQEALDIARKGQFDIAIIDVNLDGEPSYPVADILAERNVPFIFATGYGSKGLDTRYSNIPLLTKPFLDSELEAVLVQISKEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Two-component response regulator
publication title Nuclear Magnetic Resonance Structure and Dynamics of the Response Regulator Sma0114 from Sinorhizobium meliloti.
pubmed doi rcsb
source organism Sinorhizobium meliloti
molecule tags Transcription regulator
total genus 19
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lpmA00
4M88A 2JB9A 3MQ4A 2IPLA 4KK4A 2HQRA 2O20A 3N75A 3D02A 1NXOA 1RPJA 1YK0A 2X7XA 1KGSA 2J48A 4IRXA 2E4WA 3HZHA 2PJUA 2CWDA 4JASB 5IUKC 4YRZA 4PZ0A 3EQZA 1U2QA 2PLNA 1D1QA 1TMYA 3I09A 3VNAA 4FE4A 4RS3A 4GPAA 4DN6A 5BRJA 5DGCA 3HM9A 4WXEA 5GOTA 4CBVA 3OQOA 4N03A 1JL3A 3JPWA 3Q7SA 2NZUG 1A0OA 2N9UA 3LUJA 2VYCA 3NNDA 3EJWA 1EWVA 1VKRA 5GQSA 1EHCA 2M98A 4JB2A 2QSJA 4MS3A 4YCSA 1FFGA 2DRIA 3JY6A 5BR1A 2IOYA 4WT7A 3ILYA 3MMNA 4EYOA 1OXBB 2GI4A 4LZLA 4RK5A 1ABEA 3CG0A 3NNSA 4XAQA 3DLHA 1FQWA 4ML3A 4RK6A 3HDGA 4YWHA 5HM6A 2GWRA 1FFWA 5TE9A 4QYMA 4H3KB 1M5UA 2A9QA 3T95A 4S05A 1M2FA 2AYZA 2LUOA 3IPCA 3RVJA 3RH0A 5IULC 1QKKA 3HCWA 2L2QA 1MB0A 2PUDA 1LBIA 4RK0A 3O1IC 2JBAB 4P98A 4JA2A 4MQEB 5ED4A 3JS5A 4NICA 2FMFA 3LMKA 3G85A 3OMWA 3R0JA 4G0XA 4ZMRA 3QEMB 3FGZA 5FWYB 2R4QA 2W42A 4JB0A 1YTUA 3QLUA 3OQNA 2GX6A 1M5TA 4OG2A 4JP1A 3Q15C 1RZRD 2VUHB 2HPHA 3HK2A 1A2OA 5T3YA 5JNUA 1JF8A 5KC9A 4G0MA 3QX8A 3JPYA 4D6YA 4WXMA 1YMUA 3KCNA 2FMHA 5FWXB 3HSYA 1CEYA 1ZN2A 3CLKA 3IPAA 1P6QA 4XASA 3L6UA 2MSWA 5EWLA 4W5OA 1QQAA 3KTOA 3GV0A 1Z18A 3KKEA 3M6MD 8ABPA 4YR7A 3T6KA 4L85A 4Z9BA 3NHMA 4EVSA 2JK1A 2QXYA 4XLTA 2FLKA 2OENG 3FFXA 3O74A 4MRMB 2JVIA 3SY8A 4OLAA 5TPZD 3QEKA 1P6UA 2WRZA 3FFTA 5KI6A 3H1FA 3LUCA 1OXKB 5TQ2A 4RY0A 2PMCA 4ZYLA 4MR8B 4Q6WA 4EYQA 4IMIB 2A9OA 5DCLA 4MYRA 3LTEA 4F3TA 3H5TA 4LE1A 5EWMA 4RK1A 1DCMA 2QU7A 2IPAB 1Y1LA 3CU5A 4G0ZA 2WMYA 3ILHA 4F11A 1KRWA 3LUDA 4KV7A 2MYNA 2WJWA 2L17A 4N41A 1L5YA 1APBA 1XWWA 5JNSA 4RV5A 3OO0A 1Z16A 4LE0A 3SG0A 2I6FA 4MS4B 4G0YA 4N76A 4KZKA 1JFTA 1BA2A 2GBPA 4RY9A 4MR9B 3KYJB 3EQ2A 1Z15A 3KHTA 5DTEA 3NHZA 3A0RB 3D8UA 3C3WA 3FDFA 1BAPA 3EDCA 4Z9AA 1BDJA 1MAVA 3P9YA 3N0WA 2NT4A 3HV2A 3RVPA 3DLBA 4O1HA 5IX8A 3OLYA 1RZRA 2V0NA 4E7OA 1JFVA 4MLCA 1A04A 3O2SB 2FN9A 2FEPA 4YO7A 3RVMA 1PNTA 3KJXA 4RXUA 1L5ZA 1YVUA 4LX8A 3I42A 2R25B 2CD7A 4Y9TA 4N47A 5KQGA 3H5OA 4G97A 3HS3A 1ZITA 3GBVA 3MYYA 4RK7A 4E7PA 5T7BA 4OBBA 2Q5CA 2YHBA 2WY2D 1EFAA 1YS6A 2NT3A 2PKXA 1WETA 1E6KA 2FMIA 1D2AA 1NTRA 1Z12A 3GRCA 4RXMA 6CHYA 2MSKA 3QLUC 4Z4IA 3JVDA 1TM2A 3BRSA 4MGEA 3TMYA 2VK2A 4YGXB 3RVLA 1D4ZA 5FBKA 3C97A 3LUFA 3O21A 3CNBA 5TPZA 1QPZA 5KQPA 4MQFB 4QYWA 3QEMA 4RSMA 4EYKA 3H6GA 3N0RA 4NCBA 1URPA 1W25A 3ROTA 3S99A 3QK7A 3OM1A 5PNTA 1MIHA 2QVGA 4ETIA 3OLZA 3E3MA 3GYBA 3GL9A 1AB5A 4Z4CA 4UHJA 6ABPA 1B00A 2H0AA 4RDCA 3K9CA 1DC7A 1GCGA 4N0QA 3K4HA 3LKBA 4FE7A 2RJNA 1NXPA 1MB3A 2IDMA 1SXHA 1ZGZA 1JDNA 2IPMA 4W5RA 1Z2EA 4RXTA 1C4WA 4QPJC 3CRNA 2LPMA 5C5CA 1DZ3A 4KPYA 2WWVD 3URMA 3O75A 4TN5A 1JLKA 1GUDA 1ZESA 3C6QA 1ZH2A 4G86A 1T34A 2H3HA 3RVOA 2FSPA 1QP7A 2MSLA 2ID9A 1PEAA 2VUIB 4MLDA 4YS6A 4S04A 3CHYA 4HNRA 3UK0A 1JDPA 1F51E 3IDOA 4ETMA 2NUBA 2AYXA 2PE5A 2FQYA 4HYEA 2PL9A 3H75A 2PAFA 1JYFA 3KSMA 2A9PA 1GLGA 1VRVA 1K68A 5F64A 5EWJB 4ZMSA 2FEWB 1FFSA 1Z25A 2FN8A 1NXSA 3IP5A 4G0OA 1U8TA 2MYPA 4DQDA 1CHNA 5D2CA 2L19A 2IYNA 2QV0A 1KRXA 1Z2DA 2CHFA 3GT7A 1NXWA 3LUAA 2CHEA 2YHAA 3LOPA 1E2BA 3BBLA 3MM4A 3QELB 1HEYA 1U0SY 4MR9A 4IILA 5KQLA 4JAVC 4RZSA 2RDMA 4MAAA 3CFYA 3H1EA 3GWGA 2E4ZA 1GCAA 4EY3A 3T38A 1PEYA 3TX6A 1Z13A 3GBPA 2JVKA 4O1IA 4Z0NA 4MPTA 5CNKA 4IMJB 2TMYA 3TD9A 3RVRA 3UKJA 3CZCA 2FTKE 5HSGA 1W9HA 5JS2A 5JNTA 2E4YA 2WB4A 4IF4A 4XXHA 4D6XA 3MA0A 5JNVA 1LJUA 3CS3A 4FB4A 4OTZA 2F8TA 5CNJA 1NXVA 1LBHA 3MIZA 3OMXA 4Z99A 1ZGGA 1NXTA 1DBPA 1USKA 2FQWA 3M9XA 3N0XA 3SNKA 4W5QA 3TO5A 3OLXA 4MS1B 5IUJC 1EWTA 5DKFA 3T8YA 1JBEA 1QO0D 3HUTA 3Q41A 4D74A 3OM0A 4YLEA 2NZVG 3H5IA 1JHZA 2B4AA 3OO1A 5JNWA 4Z4FA 3CG4A 5EWLB 4KFCA 1XHEA 2JRLA 1H9CA 2PUGA 1JWLA 1TVMA 3BRQA 3HDVA 2MYUA 3HJFA 1K66A 3Q9SA 4MQFA 3DGFC 1ZHHA 1LK0A 3A0UA 4F8JA 1YS7A 1YMVA 4TLMB 3SAJA 2LIVA 2FEKA 3F6CA 3RVSA 3CTPA 2IPNA 3JTEA 4PYRA 2RJOA 1ZDMA 2P4UA 5TQ2B 3BILA 1KMIY 2L18A 1DRJA 3QLTA 5CHYA 3KG2A 1DP4A 5TQ0B 1QNLA 5EWMB 5HQJA 3HUUA 2M1ZA 1DBQA 1USIA 1VLZA 2A9RA 2P9HA 1LJLA 4EVRA 2JVJA 1DCFA 3SM9A 3HO1A 2GKGA 5TPWB 2JBAA 4XARA 1AB6A 4PE5B 4MQEA 2FMKA 3LUKA 2ID7A 4XFKA 4F12A 1EAYA 5KWSA 1RXIA 1D5WA 3MF4A 4H60A 4WUTA 3ROFA 3C3MA 3QLVA 4NQRA 5CNMA 1RXEA 2MYTA 3DBIA 1DBWA 4LDAA 3RVNA 3KYIB 1S8NA 3B2NA 1DC8A 3I5AA 4HNSA 4WZZA 2QW1A 5FWYA 5BRAA 4Q6BA 4YV7A 1E6MA 3RQIA 4MR7B 1QP0A 4KREA 5FBHA 4HNQA 2QVCA 1USGA 3VNBA 3SQNA 1U2PA 1YK1A 5TQJA 4KRFA 4W5NA 2PUEA 2WJAA 3CZ5A 3TB6A 5B3JA 1QP4A 5ABPA 3H5LA 4RK4A 2FKAA 5FWXA 1ZVVA 3IP9A 3A10A 2PUAA 2E4XA 5CNIA 3OQMA 4LDZA 1YIOA 3E61A 5EWJA 4GNRA 1ZAYA 4Z4GA 3DGEC 3FMVA 1JH9A 1E6LA 1SRRA 2FVYA 2XDYA 3CKMA 3H5VA 5JNRA 1F4VA 2BGGA 1QO0A 1ABFA 3KLNA 4F06A 2PUFA 4MRMA 3C3KA 3RVKA 4ETNA 5E3JA 1U04A 3QELA 1FSPA 5KC8A 4PICA 3I45A 1P2FA 2R48A 3FFWA 5BQ3A 2JCGA 3H5WA 1TJYA 4DADA 1D1PA 2LP4Y 4MR8A 1C0EA 4KQCA 5HKOA 3O2QB 4LE2A 1R8JA 3F7NA 2ZAYA 4H3HB 4EGSA 4MS3B 1RNLA 3A3KA 4ZPJA 4RKQA 4UHKA 3NNNA 5IEBA 1DG9A 2PL1A 1PNRA 1BVHA 1SXGA 1ISSA 4OLBA 3EODA 3LFTA 4G0QA 9ABPA 2HQBA 1BDHA 2IKSA 2FW0A 4MS4A 1VPWA 4MS1A 1CYEA 4EYGA 5IEJA 1TLFA 4KMRA 4ZJPA 1UDRA 3O2JA 4PEVA 3W9SA 5KQMA 4YP9A 2R47A 2F8SA 1M2EA 2B1JA 3LUGA 3O1JC 3UUGA 1DJMA 1Z17A 4OATA 3EAFA 4Z4HA 1ZH4A 3L49A 1SXIA 3M9WA 1PHRA 5IBQA 1ISRA 3HEBA 3IP6A 5I4CA 1EWKA 4TLLB 5IUNC 1QQBA 1GUBA 2HQOA 1I3CA 2PUCA 1DCKA 4N0PA 3QX9A 3EULA 1XHFA 2FLWA 3EGCA 1DRKA 1QMPA 2ZWMA 3Q7RA 3H1GA 3OLVA 4Q7EA 5JS1A 3F6PA 4EUKA 4EVQA 3OLWA 4KK3A 4RU1A 5TQ0A 4Z4EA 1JYEA 2HSGA 3QLVC 4TMYA 3LKVA 4NV3A 2E4UA 4JOQA 1SD5A 4IGAA 3N53A 2FXIA 2OQRA 4KQ9A 4O5AA 7ABPA 1JFSA 1IIBA 2KYRA 3N6VA 4RWEA 5TPWA 5IC5A 3GA5A 2PUBA 3NBMA 2FQXA 1NXXA 3KLOA 4RKRA 3IP7A 1J56A 4P1ZA 4NCAA 3Q7TA 3RVQA 1PUXA 3JVIA 1JX6A 5B3JC 3H6HA 3LUHA 1MVOA 1ZY2A 4MR7A 4KVFA 4L4UA 4KNYA 2RGYA 1NATA 3KS9A 4W5TA 2QR3A 2HJ9A 3F73A 3G1WA 3N8IA 4QICA 1NY5A 5C5EA 4WWHA 4RY8A 3HVRA 2E4VA 1P8AA 5DLEA 1Z26A 3DZDA 3O1HB 3HXMA 4G0PA 3BREA 4LRQA 4B09A 2LBPA 2QZJA 1BDIA
chains in the Genus database with same CATH superfamily
4EPYA 2AG1A 3ZCXA 5JAPA 5FOSA 3MELA 2AMVA 3LXRA 3QNMA 1A4XA 3RM3A 4K1LA 1AGRA 1GG5A 4W9NA 4HNVA 2ZUDA 1RC8A 2X5OA 2HNBA 1I3LA 2XYVA 3EHEA 3G5UA 4O2LA 5A4FS 5C52B 1TA9A 1ZX1A 2GCEA 3GNQA 1J0DA 3E9NA 3MGKA 4MGHA 1QJCA 1S2OA 4EO4A 4J7AA 5ADUS 1GFIA 3HZZA 1SAYA 2ODAA 5CVTA 4L3VA 3SJUA 3OBBA 5AKZA 2R8OA 5GMOA 3P9CA 4YREA 1L5MA 2YXNA 3N87A 4B45A 3GFFA 2R86A 1OCEA 4JNCA 3R3WA 1EWVA 3U7RA 4DLVA 4JLBA 1EI9A 2DRIA 2HBYA 1ZM3A 3M4JA 4UHEA 4RH3A 5AT1A 2LR0A 3IEVA 3PUYA 3FKQA 1XDGA 3IXQA 2WWXA 4H08A 1NYRA 1XAIA 4QQRA 4RVDA 3SFTA 5AW2A 2VF8A 4XAQA 4MP3A 3GJ5A 2OY0A 3VNVA 4BKQA 4P4LA 4OI4A 3EWIA 4UTZA 3TD2A 5CXXA 1KEZA 3QKRA 3WLQA 2REBA 1FJHA 3S6JA 1XEWY 3T95A 3WIOA 1UWCA 1SRQA 3PRYA 4WEOA 5KU1A 4B5KA 2I6UA 2X13A 3LOQA 2VJYA 3HCWA 3Q7QA 4OPMA 5K8CA 5KYTA 5ISMA 1GL7A 1H4TA 1MB0A 2EZUA 4RY2A 2IV2X 3TXXA 3A26A 3C45A 5CLIA 2GB4A 3ZWKA 1HURA 2IDZA 5BR8B 3TZKA 1J8MF 2A8YA 1Z45A 1E4OA 2XTNA 3RGGA 3VKVA 3PIIA 1IZ9A 1QIDA 4KRYA 1AK9A 1B16A 4G0XA 4Q7JB 2J07A 3QEMB 4YFVA 3MJDA 3ZDQA 5CA1F 5JOQA 3THXB 5FWYB 4AMGA 1YU9A 4CHTA 3AR8A 1BG6A 4H2DA 2HRZA 3QLUA 5EYPA 4CYMA 2VKTA 4JCCA 2GAAA 2B30A 4JOSA 1JNXX 5FO0A 4AY5A 2Y0CA 1REQA 2ENWA 4JEMA 5T3YA 3EEOA 2Q07A 1EGVB 4HX9A 5K1ZA 1QFMA 2EP7A 5T67A 1PG0A 4AYXA 1SQSA 2ZRPA 3DJYA 4JXKA 3TW6A 1U28C 4WXMA 4L8YA 5A62A 3TG8A 4PNZA 2FHPA 1I32A 3C8HA 1MOZA 1PWYE 3FPFA 3HP4A 2DWOA 3LVFO 4MW2A 4PYOA 1ZN7A 1PR5A 4Y2XA 1V5EA 3KKEA 1M1XB 4L9RA 8ABPA 5I47A 1JG4A 2B8EA 4P0TA 2A5FA 3DAYA 2O14A 3AQ4A 1DTWB 1FNDA 3BD7A 5C31A 1C1YA 2X0DA 1GDTA 4ZT2A 2PGIA 3KDSE 5BQFA 2FLKA 4MW9A 2VTBB 2HCJB 4HXYA 5BY2A 1XCJA 2AG5A 3R6GA 4P3YA 5FUBA 2ZYHA 1GVHA 4UOEA 2Z9CA 3A6ZA 4FONA 4GZ3A 1QG2A 2JIZA 3S2YA 3DOCA 1AXGA 2B4YA 4EKEA 4HDOB 5CVJA 1GGFA 1H2BA 3T34A 4F5WA 2VLBA 1NBWB 1E8MA 3A1TA 2YVKA 1BS2A 1QGED 4BZQA 4U39A 4NULA 1AS3A 2PWYA 1VB3A 2GBIA 3D3QA 4XW2A 4A27A 1OX4B 2CZQA 1IY8A 3A3NA 4YRLA 2WI8A 3P9QA 3ZXUB 2A3NA 3FNRA 4KWHA 1B8OA 4QBIA 3ZGNA 1DAIA 5JSZA 5ENVA 4LJLA 1SVKA 2JIDA 3ROMA 4DMHA 3WGNA 1AZTA 2BKUA 5KNCH 3V7WA 1ZUNB 2SBTA 1YQXA 4S2EA 2JLZA 5L7YA 4IDOA 4MEBA 5CD9A 4EX6A 3NAGA 4BNGA 5TR9A 4HPXB 4LE0A 5ICCA 4ZA2A 2RHGB 4WLOA 1P9WA 1WLYA 1LW6E 2PD3A 1LRLA 1R0RE 2Q1WA 3AERB 3SIWA 2ZYTX 4MAFA 4U5XA 3L9XA 3W5AA 3GUYA 2V3VA 1YCHA 2JGKA 5ER6A 2YQZA 1EBFA 2G1UA 2Q5IA 3KAQA 3WGTA 1WAMA 2Q3LA 3CE9A 1F8FA 1HGXA 1CUXA 1D2MA 3A70A 4BV9A 1JFRA 2RH8A 1RLMA 3EEFA 4L8FA 5B7PA 5F7XA 5K05A 1QS0A 5HIAA 1M1NB 1JFVA 1DMRA 2ZPTX 2V7VA 3FDJA 3WNCA 1A04A 1D6JA 1Y1SA 3M9LA 4GICA 1JZTA 2F90A 3CVUA 3PYLA 4PYJA 3GLRA 3DBHB 5GV7A 5JTUA 3GVXA 2DFTA 5JLJA 5JISA 3N74A 2LKDA 2L0XA 2PXXA 1N0WA 4RD0A 4FDLA 5JS7A 2AKEA 1VBKA 2YXBA 2GAIA 3EOZA 2LDXA 3ACBA 2EKPA 3KHUA 4MOWA 5ITVA 3H5OA 1IHUA 4UJ5A 4DUGD 2OGZA 5GZ6A 4DF3A 4OB6A 3VYWA 1I5EA 1X7XA 3QUTA 4RDIA 2PT9A 4YAWA 4BO8A 1SG0A 4NQZA 1ABBA 1BO6A 5EJAA 1NR5A 1ZJZA 3B6IA 3VVLA 4RXMA 4ZMBA 2Q1TA 2ORYA 3ES9A 2YV4A 3ZBQA 3EASA 3IAS6 4TKVA 6Q21A 3PFFA 4FKBA 5TMEA 2C78A 3RVLA 1XP8A 4R8RA 2FZWA 1ONPA 5I7WA 4W6ZA 1H42A 3TNJA 2ZPAA 2BY4A 4PPNA 5IAOA 2IXEA 4HV4A 3PF8A 3O8OA 4WXPA 3FVVA 1J9EA 1W48A 3EZFA 3K0KA 5DP2A 2H4FA 4GYJA 2GETA 5KOJA 3S1SA 3UG6A 3CR7A 4K6FA 3MEQA 2P4QA 2Z57A 3CWCA 2H9IA 3PR3A 4JLMA 5M3BA 3LYHA 2EOAA 4GOKA 4AF7A 4D3FA 1BDMA 1CUYA 1V26A 2J0UA 2NZ2A 2QPLA 2E21A 2QVBA 3GJ7A 3I58A 4N0QA 4TSRA 5B37A 3TEFA 3VZDA 1QUFA 3WTCA 1UJ5A 3JD0A 3NDJA 4OHFA 4OHXA 1CZLA 2OGWA 3NUGA 4WTOA 3TQQA 4W5RA 3IDSA 3ELYA 5JAHA 3AF1A 3EIEA 3IQXA 3ZCSA 4QPJC 2J45A 2XNCA 2DU8A 3SM3A 4TMKA 5CDGA 3E27A 1JB9A 1XZBA 3W9UA 1E1MA 2C7PA 1L3CA 2FDXA 3TQHA 1XTZA 2GPWA 2DHCA 1RSZA 1HETA 5BPFA 5FL7A 1T34A 1BVRA 1XRPA 2CJXA 1Y1TA 2ID9A 3E23A 2QN9A 1GL3A 4Q4LA 4UCQA 4EHBA 3SKVA 4TYQA 3UK0A 4B4KA 2Z3WA 3OD5A 2O23A 1V3UA 1LPAB 3UV3A 1NF2A 4GOLD 4Y6OA 2AYXA 3WLEA 4DA7A 2FFAA 5IKEA 1XROA 3HCBA 4GECA 2HJHA 4MQMA 1J8YF 3V1TC 4GGOA 4RMNA 1SUWA 1MQ8B 3QPUA 3W4KA 2BSAA 5B5SA 1YACA 4K6MA 3JYLA 2R6HA 1JTVA 2RB4A 2O5VA 1DXOA 1RTTA 4P80A 4YV0A 3SHWA 2WHPA 3NRJA 4I55A 4AJ4A 1IJBA 1QC5B 3CNNA 2H52A 2DWQA 3D6VA 3F0TA 3KXLA 4HQNA 4XWTA 5GONF 2ECQA 1N2EA 5H9VA 1AURA 1DEOA 1PRYA 1TAQA 1Q7EA 1I30A 2R6AA 3PZBA 5C34B 5LZ7A 4QUAA 2KBFA 2P35A 3H3JA 4OH1A 5CFQA 5G0UA 4O4LB 1XPRA 4MR9A 1KK0A 1MP0A 4IMRA 2NU9B 4FCTA 4DPKA 5I45A 5H5JA 1II0A 1GNLA 4HLQB 1W35A 1ODFA 2GKOA 3DZFA 2IU4A 3DOJA 4O1IA 2PGAA 1EGHA 4XGIA 2PU7A 2IOFA 3C5VA 2QROA 1Y6ZA 2WUDA 2WSSD 4OGWA 1E99A 3I9FA 4YJDA 5JS2A 3A2NA 1FNBA 1R0XA 3SBDA 1RLUA 1EEHA 4X1OA 4IXWA 2FRXA 2UDPA 3ULKA 1CTQA 2W22A 3GLGB 4OFBA 3BWVA 3QA9A 4DR7B 2C4HA 2YMLA 2P30A 4O4IF 3VTKA 3L0SA 1QG4A 4C14A 3FBGA 1RQLA 1ZPDA 3DWGA 4RGQA 4JIMA 3DO5A 1L7NA 2NNLD 4KE6A 1QK4A 1O3YA 1TT7A 4MS1B 3GJXC 3RJZA 5HHTA 1W44A 3WIBA 2HEGA 5KNBA 3ZZMA 3UPUA 1XRMA 4KJZA 1M0SA 5BYJA 2YINC 1U8FO 1MNQA 3CSDA 2H1WA 1W75A 4JJ4A 3NI2A 4PZ9A 3FMIA 1JYSA 3PC8A 5K4AA 1PJZA 1X7WB 4M0LA 1DINA 4GKKB 4POAA 3I4CA 1RWPA 2H2WA 2WM2A 3HDVA 4KQIA 4RD1A 1LBSA 1GR1A 3TNLA 4ZO8A 1N36B 1TD9A 2W0SA 3D0QA 3QLEA 2GM5A 2ZTMA 1JSRA 1XDZA 3N59A 1YS7A 3N8KA 5DNVA 1I4EB 2H54A 1Q1EA 1T4CA 4QG7A 1Y7TA 1KQFA 3C4JA 4HF7A 3TSOA 2CVZA 1C2TA 1YRYE 2SECE 5EPOA 5KQRA 3NHRA 3TQTA 4XGRA 1H2ZA 2L18A 2CVQA 2UKDA 5KSWB 4JSRA 2XXJA 2QAJA 3AGPA 1X74A 3DMHA 3OFJA 2JVJA 3BFPA 1KQ3A 3MTBA 3JSXA 4M9QA 4XARA 4LBYA 4EQ6B 2O8DB 1P0IA 3LQRA 4IKEA 2D0PB 2QXTA 4H1UA 1D8AA 1D5WA 2HNAA 3FZEA 3OTHA 3H2HA 1IXRC 4Y1FA 5CH8A 5SY6A 5CNMA 4NDZA 1DIAA 3RVNA 5IS2A 2WU1A 3OU2A 1DC8A 4FFVA 1RFLA 1VLQA 3ZCVA 5KWVA 1K5DA 3KFLA 2NV2B 3RF7A 5TSDA 4V39A 3SMVA 1GV0A 3WB9A 4GPEA 2I33A 4DEXA 1FUIA 4S1NA 2ZGVA 4HZUA 5KTSA 3RFTA 4U0KA 1TUGA 1UBJS 1MENA 3JQBA 4BKUA 5HRAA 2X76A 4WOJA 2JJ2D 3Q9LA 1FK8A 1YULA 1FBTA 3MTEA 4IDAA 3TTVA 3F3SA 4TV8A 4RK4A 4JL8A 4WECA 4X54A 1TECE 4MQBA 5JE8A 5CAEB 3QFFA 4KQMA 4F85A 2DT8A 3A2LA 4HMPA 1HE8B 1TA0A 2C96A 2PUTA 2IEGA 4V2IA 4DUZB 1BIFA 1I51A 2EZ9A 5L4SA 4D82A 3RUDA 1U1CA 2Q8NA 1E6LA 5HBGA 4DR3B 1KYQA 2XV1A 2YV5A 3SSAA 1VE9A 1P75A 2FNAA 1W0JD 3P0RA 3GMDA 1N77A 4B71A 4FGKA 1ZC3A 4NYJQ 2GLTA 2H59A 3GLTA 1FTGA 1YNSA 3FCUB 4KP7A 2OQIA 5EJMA 2CE2X 4D8YA 4ETNA 4KTTE 1C7EA 1CUSA 4F8EA 1ZOPA 5BQ3A 4R1PA 2J7PA 3C8UA 1K7FB 4YJ2B 4G56A 3AHIA 5LZ5A 3O8DA 4OXNA 4O4JB 3L4BA 1RJFA 1TPYA 5JY1A 5FI0B 3DR3A 3SX0A 2PT7A 4RHUA 4N8DA 1TKCA 1KAMA 2BGLA 5JJCA 1ESEA 4GBED 2ZTSA 4TQ9A 1AC5A 3DBLB 3NGMA 2NV0A 2OFPA 1GYPA 2OK7A 3MXTA 1E64A 2QD5A 3WRWA 4C6RA 1BVHA 5E0KB 1G5TA 5HOEA 1U0OC 2WWHA 3PVZA 3DT9A 2FW0A 3MOSA 1RYBA 2EEZA 1RZVA 2QTRA 1P7CA 2X7HA 1XQVA 2G6BA 3Q6NA 4LOHA 2CNBA 3CLUC 1HEUA 3PNSA 2GBLC 4OQZA 4R2LA 5KJ6A 2UXBB 2MSEB 4QLAA 3DC7A 1FNMA 3LW8A 4BAUA 2ZJ5A 4RD2A 5LP6A 3WL6A 1PHRA 4K87A 5MN5A 2ZBGA 4DA6A 1Z0IA 5H7XA 3BEDA 4D5EA 5CG1A 4V1CB 1H4QA 3TQRA 1F14A 2VPQA 1RRPA 3WGLA 3AHEA 3U2QA 4WOCA 4GGMX 2EFHB 5AI0A 4AQYB 4R7TA 4WXRA 4PC6A 3PUKA 1DBIA 1YDHA 1I6MA 3LPAA 3CWZA 3UWDA 3RK1A 3BE8A 1EA7A 1J8VA 1VE3A 3MOIA 2Q8QA 1UT8A 4DYDA 3BH6A 2QM0A 4FJ2A 4MCHA 4B48A 5LD2B 1H93A 3IEMA 3BK1A 3B1VA 1J0EA 5C1DA 3EEIA 1F9AA 2WT4A 5HCUA 1W49A 1T3ZA 4HFJA 3V00A 1Q21A 1TVKA 2GPNA 3E3NA 2P41A 3BDAA 3E9CA 4MQ5A 4BNKA 4PC3A 4XA8A 2GYVA 3P32A 1THTA 1NIPA 2HM7A 3ER6A 3DDOA 1U0BB 3KLOA 4JBWA 1VCMA 2CNDA 2V65A 3MJFA 3O4HA 4YC7A 3UUFA 3UM9A 4MTLA 2BFFB 2MOKA 1PR0A 1ZM9A 3FDZB 3OECA 2G0AA 4PV7A 1E3SA 3BGIA 1PI3A 1FSSA 2CLSA 3KJIA 4MR7A 3T7KA 3DA8A 1JMYA 1RI3A 2ZVDA 3EIOA 3HKEA 3I0NA 1AMNA 2ZS9A 3OIUA 3U44A 4KXWA 1MEJA 1L4MA 4N1AA 3F73A 4HZIA 1XPUA 1MVNA 4OAOA 1VHQA 3PHCA 4EHIA 2XZDA 3ONDA 2WV7A 2G88A 2B9EA 2M9MA 2FF7A 2Y9MB 3B52X 2BHNA 3O5AA 1R15A 2O8EA 8LDHA 3RI3A 4Q4AB 1AMOA 1FTWA 4AFNA 4HNUA 2HCRA 2LIPA 2VPTA 3HCOA 3OX1A 5DH9A 1TT5B 1BDBA 1OKKD 5F4ZA 3PKIA 4M88A 3WV4A 1D7AA 3MQ4A 4PO1A 5FX2A 3WKAA 4PO8A 3IPXA 2IELA 2ZQ5A 1KR2A 3PRHA 3HO8A 6NULA 2IEYA 2B5VA 1RPJA 2ISQA 2V4MA 5TEWA 4FCVA 1L4GA 3G6KA 4IFIA 3AHGA 3LGAA 1FS4A 4IAOA 2ZRQA 2PJUA 3TZHA 3VNRA 4GYKA 3HCEA 4EKGA 4HQRA 4K6GA 1I6KA 4DA0A 1AHPA 2VHWA 3ED5A 4ZARA 3NVMB 3OIYA 2ZAIA 3GEDA 3O94A 1GT91 3WWEA 1FU7A 3K6SA 1NBME 1N32B 4S0ZA 1ZUHA 1VHDA 4MYCA 2YWBA 2Y1LA 3N2NA 4H1HA 1G0NA 4TRJA 3AR9A 3GDOA 3JPWA 3F7TA 4FDMA 4XX0A 5P8WA 4Q05A 1UXKA 3TUZC 1H3FA 1E79A 3HB1A 1ZYUA 3I39X 5FB3A 2WM9B 3QUCA 3ENWA 3AP2A 3B20A 5A9RA 2Q4DA 5AVYA 4M4SA 2FR1A 1ESCA 4DLAA 3L04A 4EF5A 2ZSJA 4HS9A 1ORWA 1Q7BA 1RJWA 2ASVA 2YJ4A 4ESEA 2EFEB 2QTLA 3CRMA 3I2YX 3O93A 2D3WA 1NJ5A 4WQMA 3EVTA 2WJVA 2V54A 7REQB 5C1IA 2QQ5A 2HL6A 2R7NA 1M2FA 2FQ1A 3B48A 3W6PA 2C82A 2GN1A 4RHEA 1E3DA 2V5VA 4HGZA 5IC6A 3V80A 4C4OA 1DXYA 1C7ZA 1XXHA 2EF0A 2PKYX 4MKGA 2PBLA 3KQHA 5CB8A 4PRLA 5FORA 3GPCA 2AZMA 1SOMA 5EJ6A 4R05A 3LUPA 1FE8A 2NSHA 2HJGA 3E03A 1EDDA 2J9XB 4LZWA 5SZHB 4ZMRA 5IXSA 1SB8A 5HKKD 2J3DA 4WY8A 2W42A 5AM2A 4L08A 2I2FA 1F3LA 2J1LA 4RZ2A 2GZ1A 1ITZA 2FW6A 1W93A 4EQZA 3K70B 3B36A 4TLEA 3U4QB 4OYHA 5C3MA 2CCGA 3OIGA 4F3YA 1GQFA 1DIRA 1RM4A 1RP1A 4HOYA 3AC0A 3OZUA 1ZD8A 1CDDA 4FD3A 4M1EA 4TTSA 2VQ6A 1Z5UA 3M6AA 3QPBA 2FMHA 1GNRA 2FSIA 4QDXA 1GTVA 1M9NA 4WLFA 4OLFA 2LCFA 2NSJA 4TPKA 3DLIA 4GOXA 5TRTA 1ZD9A 2KJQA 4RO0A 4QUGA 3NS7A 4GQIA 5CB4B 1W2WB 2AKAB 3UWKA 4J07A 1UJ6A 2JS7A 4ZDKA 1Q7GA 4XLTA 5FR2A 3RO7A 2FSVA 2D1QA 2FEAA 1D4AA 1QCCA 1ISHA 3SY8A 1ZMOA 1H6BA 5TPZD 4LYGA 1P3JA 3G2JA 4XD7D 1Y8AA 4I3FA 4IGIA 5M34A 1I9CA 1LXCA 3K9BA 4BE4A 4CCWA 2DH6A 5TQ2A 4MB2A 3ZK9A 1DBSA 3DFUA 2A0XA 4AG5A 4RFSA 1M0EA 2J6CA 4EJ2A 4CV2A 2R0QC 1TC1A 3LTEA 1F2TB 4N4AA 3KSAC 1YQ9A 3R6DA 4HLUC 3GRYA 1CDEA 3RB8A 1UZUA 5J9FA 2X8JA 1P5ZB 5CA0A 1Y1LA 4OQ4A 2G36A 1BGXT 2WA2A 3G8YA 3ILHA 5EVJA 4Q48A 3LUDA 4RHXA 5HF5A 2J33A 5KX5B 1NVEA 2HMUA 1PUIA 2UUCB 3HMKA 1NR1A 3CISA 3STHA 3ZE8A 4AJNA 1EFVA 3AKYA 4MDYA 3KOXA 2FEXA 3CX3A 3EXFB 3IXMA 1XMSA 1VYTA 4X8LA 1BNCA 5J40A 3SYNA 5EIBC 2IX9A 3EDYA 2I7CA 2YNMA 4NU6A 5A7FA 1Z15A 1OWLA 2KE5A 3A05A 4LF5B 3NHZA 5J5CA 3NIGB 1P1RA 5IJ9A 3HCCA 2QGNA 2R6R1 1IEXA 1XB2A 3GEGA 1A2KC 1JI3A 3P9RA 4G25A 5G1NA 1GKUB 5LBUA 3ZWAA 4RTKA 3FPHA 4F4UA 5K3EA 1G6Q1 1UQTA 4YXFA 3BGVA 4BU0A 3SQWA 2IXAA 2F6RA 3UOGA 1JEEA 1DAFA 1UKAA 3JZAA 3NV7A 2ZRFA 4IIEA 4ZV4A 4HH0A 4G8CA 3VH4A 4OK3A 2AZXA 5BR7A 5HGXA 1GV1A 3S1LA 2BFDB 4X94A 2VT3A 1C9EA 3AW9A 2ZKIA 4I14A 4GBJA 4DC9A 4LF9B 3PSAA 4MWEA 3JQCA 2QD1A 4KRGA 5L45A 2R25B 2O57A 2HMAA 3DTVD 3U7JA 2HJRA 1NNEA 3MYYA 3ZIAA 3U09A 4ZFNA 2CUKA 4F5YA 2AFIB 3VR6H 5BMVB 3BC1A 1DKRA 1L6IA 3KOWA 1R37A 1F38A 2CXSA 2GS9A 1GXSA 3E8XA 3GRCA 2B2NA 2WFMA 4P54A 2P69A 2MSKA 1YF3A 1VZ3A 1DHRA 1U99A 3EBLA 3PC6A 2Z1DA 4XJXA 1UBRS 1L4BA 4PGGA 2C77A 2WQ6A 1QZ3A 1NG1A 3R24A 4KOEC 4LYEA 1K5PA 4NNJA 1NAHA 1MT3A 2HWWA 1ACMA 5A0VA 4Y2YA 3QHPA 3VPAA 1QORA 1M3SA 1FJXA 4PCUA 2DPHA 2JEYA 1QCZA 4JB3A 4RJJA 4R83A 5G0VA 3JARA 3OLZA 4S1OA 3F46A 4JLDA 4BZZA 4KGXA 2BMDA 1SVWA 1KJIA 2H0AA 1JHMA 2H8KA 4OHZA 3ZWBA 3VPFA 4CL0A 5HFNA 2OORA 3ESYA 3H86A 3LC2O 3WBKA 4DA8A 5BUCA 4FFBB 3LHDA 3KL4A 3F6YA 5GVRA 4G5SA 3TW8B 1DJNA 2QL5A 2X3FA 3ROKA 1GKKA 1MB3A 3UICA 2COKA 1P5HA 2PVCA 2ZT6A 4K8OA 2GESA 2X5NA 3HP7A 4CM8B 2FFRA 1FW8A 3K9WA 4UNSA 5JLAA 1CQWA 4PINA 4UBJA 1IL0A 2Q2OA 4TN5A 4Z9YA 2IUSA 4MUFA 3ESCA 1GUDA 3OPYA 1JHXA 2XF2A 3NTLA 4MYUA 4XKJA 5E1OA 4ZCRA 3ZDAA 2UXDB 1INLA 2AQIA 2FG6C 3LXUX 3HN7A 4LHZA 4YS6A 1EK6A 2C9YA 2FG7C 1FNCA 4YPFA 1FF9A 2E3JA 4GPBA 5IFLA 2HD4A 2QZSA 3RABA 3H17A 3QG1A 2PL9A 3NVDA 4H4DA 3Q0IA 3ZGXA 5HG0A 2V6FA 4J91A 1J9ZA 4YYEA 2WF6A 5ALTA 3TOSA 5CDTA 3GZJA 5F64A 2ZIXB 3EG9A 3N2KB 5CVDA 1RM5A 1FFSA 1Z25A 3NXSA 5DYTA 5EI5A 3RYFB 1UK7A 2B37A 1I5OA 2CW5A 2W8BB 4ND8A 5CTJA 1QG6A 3HGQA 5CDSA 5LJIA 2O8VA 4L0MA 4LY3A 2OCYC 5A04A 3DLCA 4X97A 3W7VA 1XRRA 3FWNA 3V8QA 4Y2HA 3RC8A 1HYBA 1UM8A 4G07A 2EJCA 4ISCA 4NZPA 3TZBA 2QZ4A 3IVGA 4KXQA 4EY7A 4ZK6A 6PFKA 2NYUA 1E2BA 3U3XA 3O7MA 2DQSA 2BFEB 5AM4A 3CW2A 3L7NA 4DGSA 1NG9A 1BXRB 3FPJA 3KPWA 2VK8A 2CB9A 3NTVA 4X9XA 4F4DA 1EBBA 2VHVA 3Q3IA 3NWEA 2Y27A 2FH5B 3DB2A 1M6NA 1NKTA 1WO8A 3SMQA 4U2GA 4HDCA 3RK4A 3EN0A 1O97D 1R8QA 5LLTA 3JXEA 5K8LA 3GDHA 1D7OA 4EF6A 3S81A 1ZLXA 2X4LA 2EFDB 1VKZA 3PP8A 4I4TA 2Q3HA 3JYNA 2CFCA 3PTZA 3VTZA 1KI1A 3KQQA 4HB4A 3I4LA 4NONA 3OY2A 4TWJA 3VAZA 5A1TA 1SUAA 5K0FA 4E22A 1XK6A 1YZFA 2GD0A 3H1TA 4ZOCA 4ZVNA 1LTKA 4DM4A 1YR1A 2A5JA 3G0HA 2HT6A 2IW1A 4TLBA 4YBZA 1JAHA 3PCXA 3REQB 1YL7A 4Q82A 4EUSA 3DDSA 1L4UA 4R0NA 3RDPA 3BQMB 1T2UA 1EE2A 3PR1A 3KKQA 3LUBA 5TMBA 1WUHS 1CD5A 2QMEA 1RMYA 2WVAA 1QO0D 3EEYA 3R3ZA 1T0IA 3WSVA 4BATA 2QB5A 1TEZA 3V8VA 1H85A 1F6DA 3MRVA 5I8PA 2HXGA 1RWMA 2JRLA 4RH0A 5G0WA 5LA6F 1D2HA 5G4KB 1VL8A 3TK1A 1PQWA 1YJQA 1T25A 4J94A 4QPDA 4C78A 3MPUA 3KZOA 3V1MA 1J7JA 4HAYA 4URUR 4CF5A 4M54A 2GBFA 4Y2VA 3WDSA 3BS4A 3R74A 4YMUA 2LIVA 3RVSA 3K6RA 3TN7A 3QJ5A 2ZI6A 1IXYA 2PD6A 1BH2A 1SU6A 1L5LA 2NUAB 1AUPA 1EB9A 1WXDA 2FLVA 2XQGA 1SVOA 5TGTA 2O2GA 3EZLA 3PUXA 4L75A 3FPKA 4H7KA 4EKIA 4MWZA 3H83A 1CX9B 1RBMA 3V3KA 3EF3A 4K81B 4F8YA 2OVFA 1EVQA 1DLJA 1IB6A 3FSGD 4K9QA 3D4NA 3U80A 1IDOA 2I7DA 1W46A 2PXCA 3CZ9A 3U40A 4ZTBA 1DKMA 4JYAB 1AHNA 4EW6A 5IPFA 3K9GA 1WPQA 4EMSA 2VZ9A 3ZVLA 3FOFC 1PU2A 3ROFA 3WMFA 2RB5A 4TRMA 1XQXA 4HGOA 1YQGA 1OBVA 1Y9AA 3LCVB 5AP9A 1Q0RA 1K0FA 1P0QA 3DEJA 2Y4OA 3BIFA 3MUOA 5ITZA 1TJ4A 4AMZA 4ES6A 1ZKDA 3M6VA 1R6BX 4JEUA 3TLAA 1L4KA 1H1LA 1CQIB 2X0RA 2DUJA 4IHJA 1K4YA 1WW3A 1SHJA 2I7VA 2VATA 2YZKA 3RBVA 2GZHA 3ESXA 3JD3A 1TK3A 2ZIEA 3BWBA 3EYWA 3PFGA 3PXBA 2JHGA 4H7DA 4INOA 3T41A 4DT1A 4UOQA 1QANA 4LMRA 2IH4A 4C7OB 4OXXA 1P2DA 1G9SA 2HK6A 3I52A 2JGNA 1IEWA 4WD3A 3OURA 1NAIA 3ONEA 4OK5A 4K9MA 1R6TA 2BEVB 2QD4A 2QI9C 3FSEA 3KNZA 4HXGA 4LDZA 5DO9A 3UWSA 5JATA 4FP9A 1F1BA 2XQJA 1EBUA 2OUKA 3DXYA 4R5MA 4Z4GA 3ZVNA 4W8OA 2CXHA 1GEGA 3BA1A 4TS9A 2FVYA 3VC3A 4OIFA 2WUVA 1ELOA 4RAOA 3WA6A 1ZXBA 1Z6GA 4QYIB 2Q6OA 4PR0A 3KLNA 1UM9A 1VGVA 1AK1A 1Z2AA 1B2LA 2QAGA 4S24A 4V3CA 2HO4A 1WZCA 2R97A 1OH5A 3RVKA 3SI7A 4KL8S 1I7QB 2OAP1 1P1IA 3I45A 5DK4A 2AG0A 3B1XA 2XXAB 3EIQA 5FUYA 3ZHUA 1E9SA 2DQ4A 5I9TA 3EMBA 4N5LA 1Z4NA 4LKOA 4J1QA 4YQFA 2PLFA 4LRXA 3FLBA 4KQCA 3DG9A 2IZOA 3K0AB 3BZBA 2ZBQA 1BWRA 2G25A 2VEOA 3C43A 3SD7A 3UGKA 1LVGA 4R6XA 1N4DA 3AIMA 3AFIA 2CVFA 4P3PA 4E07A 2JFGA 3DMPA 4CF7A 2JFQA 4DJAA 2O07A 4Z2AA 3TOXA 3DTTA 2Z4SA 3ZCPA 1ULTA 3DDUA 3R0QA 3TI9A 1BDHA 2PZMA 1OGYA 3D5TA 3AR5A 4KKVA 2GN2A 4TV9B 3NHPA 3P94A 4QVKA 1DWPA 3OC0A 5SV2A 2PK3A 5AOAA 1XSEA 1MH9A 3PDCA 3AR4A 5J4LA 1WTAA 1FMLA 4AU1A 3KVVA 1VE1A 3NEAA 3MC1A 2OP0A 4OXYA 4J43A 4JWKA 3UJ8A 2FB9A 2VRCA 1N5IA 2WDPA 3GROA 4J16C 2GHTA 1GQRA 2IUYA 4ZV9A 5C8YA 2EX1A 3T3PB 4YPVA 1YC2A 4CKEA 4NCIA 1KI4A 2FU5C 3ORFA 3SS9X 5CU7A 5JZSA 3FD8A 3UMRA 5TMDA 4HRAA 5ALGA 2F8LA 4AUNA 1C1DB 1SHTX 4E5UA 2ZJ0A 3GRVA 3FPAA 1QIJA 4RVNA 1ZOIA 1KDTA 3Q7RA 4V2UA 3ZKWA 1ANKA 3ZYCA 1T1JA 4CUZA 3OKPA 3NAQA 3UXEA 2ZUWA 5NULA 1ZD1A 3VPHA 3ZZTA 2IOFK 4Q3BA 5JVDA 4DQUA 3B6MA 3D8RA 3RTCA 1KIFA 3C7DB 3QLVC 4QDKA 4D9FA 4Q21A 1Q0PA 2ETXA 1Q20A 3I73A 2ZB7A 3KR0A 5DNWA 3WIVA 1WMBA 3NRBA 3AM4A 4UTRA 4XYLA 3GMIA 2HF2A 3KU1A 2ZCUA 1BH6A 3N6VA 4IQ8A 2D74A 1U1IA 5TPWA 3BMQB 1SCNE 2JKVA 4D43A 3K70C 3NWJA 4IOJA 1GAEO 2IUUA 3L6OO 1Y6FA 1X7YB 2XWBF 5K8UA 5KIAA 1FRZA 4G1CA 4R16A 3BD9A 1G5RA 2GCPA 2W4IA 5GGYA 2A78A 1P18A 3DYIA 3W1VA 2RD2A 1K1EA 1QQ5A 4ZZ1A 1NATA 5IM4A 3LGXA 2GNPA 2RGAA 4E5VA 4CETA 2WAOA 4Q1BA 1EK2A 1SCQA 4M1MA 2H1SA 3T7AA 2HWXA 1GTJ1 1CB7A 4N48A 3ZN2A 2JHCA 3F8TA 3GP8A 1QBGA 3HVRA 1MOPA 3ADOA 1LI4A 3TAHA 3C3JA 3I9V6 4NKRA 3TIXB 2HMYB 2QW8A 4ZN6A 3DZDA 4Y2UA 3IAEA 2IDKA 3EB9A 2PUHA 4GR9A 4I81A 2GPTA 2EKZA 3LH5A 3M4NA 3HDYA 3N8GA 4KACA 2EKQA 2PPLA 2QZJA 4Q24A 1FB5A 3ESAA 4ZCPA 5B3LA 1QM5A 4BXOA 3HYNA 2QYOA 3ZGZA 2HQRA 1MC1A 1RVDA 1NXOA 4P2BA 5BPHA 1ZVJA 3R23A 3V4RA 1HF3A 2WKWA 2AJDA 1AU9A 3EDQA 1W1WA 4ZVUA 4JASB 2DFLA 2R4UA 4CM1A 4YRZA 2PGDA 1XZCA 2JLAA 3PPWA 4L7QA 1KE2A 1EINA 1TMYA 2IY8A 3OOJA 4IVNA 3VNAA 3ZDDA 3S1AA 4Q3OA 4GPAA 4HVTA 2PNFA 4YP1A 4K9OA 2Q3JA 3CPEA 5EAIA 1IHOA 1QX3A 2O0KA 4EKDA 2ECKA 1H69A 3R5SA 4QJBA 1IG3A 3NAMA 4D4JA 3NOVA 5GQSA 1VKRA 2BL4A 2FX3A 1FFGA 1K6IA 4LJRA 4EMUA 2Z2ZA 5GIOE 1UC5B 2FSUA 3QKIA 3FXAA 3M49A 3HUDA 1CJTC 4NE9A 2QMYA 5K5EA 3PEVA 2Q1YA 4FI3F 3NNSA 4PLYA 1ACJA 1F4PA 4PX3A 3JZDA 1ESZA 4O2RA 4BGIA 4A8HA 2OBNA 1XDDA 4H3KB 3K1ZA 1M5UA 1AXRA 3OWXA 1YR7A 2LUOA 4ACBA 2MSDB 3IODA 2EX0A 5JAIA 3EK2A 3RSGA 1V2GA 3D3WB 4WAUA 2WA1A 5IT4A 1NONA 5FUVA 3TCNA 3IUSA 2DHDA 1NRIA 1XZDA 4BNHA 2QLFA 4QNRA 3WBJA 3MMXA 5I6DA 4GL2A 2PX4A 3HWWA 1WP4A 3O4VA 4J0JA 5GGXA 5KJEA 3C14C 3NC4A 4LOKA 3EMVA 4MVJM 5T3UA 3T5CA 2CFTA 5PGMA 5TEVA 3DTNA 4ZVMA 2VJAA 1NLFA 5JALA 5IRCD 1Z0FA 2QEQA 2IP2A 4JP1A 3G0GA 3AG5A 3VUEA 1G21B 4P6VF 4TKMA 5B4UA 1E62A 2R1VA 3LHIA 4JU9A 4XSHA 3KWLA 1BMFD 3CLRC 2HTEA 5DU2A 1ZS9A 1E9AA 2CC2A 3ZGVA 1OB2A 3JPYA 5F1YA 4YP7A 3V7UA 1ND6A 3HKBB 3D81A 4ENPA 3ZJ5A 1X86B 2J67A 2ODTX 3PT5A 4GPTA 3A1SA 3AHCA 4PAGA 4WKBA 2CXPA 1XA3A 3PQ2A 1JKJA 1S2LA 621PA 2Q50A 1QQAA 2VRNA 4CQNA 2NU8B 4AKEA 2BDEA 3FE2A 2QMQA 1L7XA 3MAGA 7AT1A 3X1XA 1DADA 3BQNB 3AU8A 4UEJA 4URFA 4WVLA 3TVYA 2R85A 3IE1A 1HTWA 1KE1A 1B26A 1KVTA 1NM5C 2OL4A 4RCVA 3I9KA 3T0FA 4NRDA 3VZSA 3FFXA 2YIJA 4Q18A 1MW9X 4ZOEA 4UMFA 4O2BB 2QLTA 4FYIA 3VDRA 4E5KA 4DL9A 2XUGA 1YDWA 2PH3A 5EGNA 1G7CA 3TZLA 1MAUA 5CHEA 1GPAA 3CNEA 3S2GA 3AVVA 4G4SP 5DFAA 3LWBA 4D9EA 2UUBB 5ADVA 1DEKA 1ECFA 4PZAA 4X7MA 3SE0A 2A9JA 3SP1A 2E55A 3KB2A 3ZWDA 1QIIA 3H5TA 5EWMA 4BLWA 3CW9A 1TQ2A 2AR9A 2Y9PB 3CGWA 4BOYA 4W82A 2PWAA 4F9GA 5JY6A 4JGBA 2UVQA 3IJRA 3ZZ0A 1A77A 4IEFB 3F71A 5ES3A 2WMYA 1YOBA 4CKCA 1FUYB 1HYHA 1R10A 1Z28A 4X95A 2DTDA 1ZK2A 3U6KA 1C1XA 1IN6A 1JIUA 2WWWA 3DOOA 5CLGA 5A6SB 2K7FA 2D54A 2CDNA 2HO5A 4Q4HA 2V97A 5EXDA 4JLJA 2AX4A 3TPFA 5KKAA 2I6FA 3W06A 3FYUB 1D2NA 2O2IA 3BKWA 2B4QA 3OIWA 4RKEA 3KYJB 4X3OA 3EQ9A 4CL8A 1UKYA 2XWPA 3L4JA 3WB1A 1WSBA 4KMOA 1W0KD 1X80B 3TCXB 1L9XA 3C3WA 1KJQA 2HMVA 2X9NA 1DOZA 4NBVA 4U8GA 3ZNNA 5JH7F 1SUIA 1MLDA 1QP8A 1C8BA 2BCGY 3GPIA 1AQ6A 3Q2KA 2FN7A 5J4HA 1DC5A 3IAUA 4WACA 1RZRA 3DAGA 1T2VA 3MTAA 2B98A 3IUPA 3M6FA 4MLCA 3TRHA 2BEUB 3M8KA 4INZA 4QT4A 4KAAA 3GRRA 2W2NA 4QEKA 3CO5A 4RXUA 3A25A 4KFTA 2GFHA 3EVNA 4NABA 3LC1O 2PRKA 3HA5A 4L0CA 1YQWA 3K4QA 4KH0A 2BHLA 4G97A 2HHCA 5DULA 4RK7A 1YVDA 4BLTA 1FLDA 2H1HA 1KXZA 1X14A 4PG4A 2QKYA 4K0KB 2G7ZA 3PC2A 1SBTA 2AEMA 3BFJA 2JJQA 3IQZA 2Q7DA 1XRQA 2RE8A 2I78A 5A0TA 2VBIA 3ZU3A 1TM2A 2AFHE 1DBVO 1YR6A 2Z8XA 2YW2A 4KQKA 3KXKA 4M1SA 2W00A 2UYOA 3CNBA 1JLMA 2GUWA 1ZC4A 1ORVA 5ALIA 1TU4A 3CRVA 2G83A 3FROA 4WZBB 3MGBA 4OBXA 3AVTA 1NIJA 1UPXA 2ZRDA 1BROA 1PW7A 4MUYA 3BJIC 2C8VA 3QK7A 4IV0A 2OECA 4ZDWA 1MUUA 3QVVA 3S99A 3WI7A 3AV0B 4ETIA 3EWSA 4N40A 5FA8A 4GC9A 1Y80A 2ZYAA 1M8FA 3VYTB 3ZJ4A 3A6LA 1HL3A 3B3AA 1B43A 1HQYE 1OFUA 3O92A 5HJ5A 4CTOA 3PJRA 4LCEA 1W19A 1JW9B 1D0VA 2GUGA 3EAQA 4AMVA 4ZIRA 3EXHA 4GLOA 1A1VA 2OGTA 5JBQA 4MV8A 4RMGA 3EC1A 1RWNA 4XWWA 1NVFA 2WHYA 1W1UA 2L82A 2I4RA 3NHLA 3CF6R 1QSGA 4NSNA 1AO3A 1CEQA 2WILA 4XWYA 2NPFA 4DRXA 2YN0A 2ZRMA 2AZ4A 4KPYA 1DTEA 3ZZNA 4S1TA 3O9VA 3MXOA 1JLKA 3FLMA 4ZODA 3TJRA 1NX6A 3HI4A 3DDWA 1K86A 3S55A 1O58A 4EB6B 2V9PA 3V4VB 2JLUA 4AZ3A 1ZK3A 2CLEB 1AZSC 1XTTA 1A7UA 2NVBA 2BZSA 1OGIA 3ONWA 3OZWA 5CX1B 721PA 1NFQA 5LMUB 4OMFG 2P6OA 2VBGA 1SVLA 2GD6A 1FMJA 4HNAA 1JQ3A 2HLNA 4Q39A 4RF2A 3H4VA 1OZAA 2Q4EA 4YCDA 3N8NA 1JYFA 3KSMA 5FJJA 1SIOA 2PANA 3ZD8A 2A9PA 4EKNB 3DV0B 3JYQA 4ZAGA 3QVKA 5AUPB 1NDQA 2R65A 3ET5A 2BGIA 3REOA 5E9JA 2X19A 4QRIA 1XTRA 5B3AA 2N46A 1P31A 5BSEA 5JS6A 1GA1A 4DQDA 3L1IA 4E0BA 2Q4RA 3PNQA 2C5FA 3Q0TA 2D62A 4G5FA 3SXPA 4DXAA 3IMKA 1UC9A 2WYOA 3R0XA 4WADA 5BN5A 2A5YB 5FWXB 1SB9A 3UGTA 1QRSA 1E5TA 3IS3A 1KO4A 1FPQA 1T5IA 4GMGA 5IC4A 1SC9A 2NO7A 1BTOA 1L4EA 3PQFA 2RHMA 2GCOB 2IEDA 2P2LA 4I4NA 1XT6A 4YWJA 3T3DA 4C4ZA 1KNXA 1KYVA 1GM5A 3B7PA 4G81A 3HUEA 5KYGA 5LDHA 1IPFA 3SKXA 5BYBA 5KVCA 2G1JA 2DF8A 4HN9A 4UHCA 1TCAA 6REQA 4C7MA 3MOGA 1X1EA 2QRLA 2ATCA 5HQ3A 3KUDA 2PMFA 3AI1A 3AR7A 3UT0A 1MO2A 4QUEA 4XXHA 1BSVA 1TO2E 1LJUA 2X5XA 2CLDX 3GCZA 4Z86A 3VKUA 1ID1A 4W7HA 4BNJA 3A9UA 1PJLA 4ZRNA 4E5YA 1X42A 1V8BA 1LBHA 3EF1A 3RRZA 5CGQB 3WHLA 3DKVA 4Z99A 4H7HA 3PFBA 3MBIA 2BDTA 2CNWD 3SNKA 2CXTA 3OG9A 3VJRA 2PKCA 2WHQA 4R81A 4BECA 5DHAA 2V6IA 2QTZA 1H23A 1QCDA 2K5UA 1QRAA 3FSJX 4ZCMA 3P2OA 1QE0A 2V7EA 1ZM4A 1U9IC 2X8BA 2GRJA 4GEKA 2C8JA 3OQ1A 2WWIA 2HW8A 1H9CA 1N7JA 1VJ5A 1U0NA 3WNZA 2PKQP 4TVSA 2FUG1 1HKHA 4TKUB 3LBHA 3IRUA 3LLMA 4D9MA 4PTLA 5EJGA 2P9ZA 4OHOA 1JE0A 1JEQA 5B2ZA 4LTDA 1QJ4A 1FRVA 4XIYA 4M0DA 1N5KA 1PYOA 1R4AA 4IV5A 1ZISA 3OCCA 2OZLA 2H65A 3TRDA 4EPWA 1THMA 2IY9A 2WAAA 4OY3A 3BTVA 2FZ5A 5LXTF 3I9OA 1FTSA 3JWJA 3OFNA 2O8FB 1U6IA 1IHXA 3HKDB 4U02A 4D6PA 1I2CA 3QU9A 4HH3C 4ARVA 3K5WA 5CT4A 2D1SA 4F6RA 4EVRA 4A8TA 1FU4A 1Y4ZA 3UV6A 3K1TA 4G2TA 1DXHA 2ZS8A 4R8SA 5EXPA 3TTSA 3ZXXA 5A03A 1DO8A 4R7GA 5CTAA 3W6OA 1Z62A 2HA4A 1VHLA 5KTOA 2Q6VA 1G8HA 4DCSA 3N3BC 3DBIA 2QRJA 1EDOA 3JATB 4QDJA 1Z82A 2CFIA 5FIUA 5FWYA 3WZ2A 2YV1A 4OA5A 1HE5A 2C5BA 2JLSA 3GMSA 2HHAA 4KPGA 5IDYA 3U1TA 4D4LA 2HTFA 1U0HC 4HC4A 4PRYA 5KYYB 1WS6A 1YK1A 1MO3A 1KFEB 3C41J 2C84A 1I2DA 1OZFA 2H51A 3JZFA 1Q0ZA 2YJ6A 3EZ2A 2F9LA 3ZKAA 2J6BA 4DLYA 4O3FA 1M1YB 2J4FA 4EW3A 3A31A 5JYCA 5DGHA 4EM6A 4N82A 3TVDA 4DSTA 5AJXA 1O1YA 1U65A 1IY1A 1SUPA 2QT0A 1B0ZA 1SWWA 4CI0B 4IJMA 1IPHA 4C2UA 4KRXA 4MA0A 3DMYA 5TVKA 5BNTA 5FXMA 5JQGF 3LG2A 1UJMA 1U8CB 1DTWA 4G5GA 4MGZR 1QTRA 1OF1A 4R51A 4AJLA 4PC1A 3HBAA 5DXAA 5E7MA 1PT9A 1J0CA 1Y3CE 3J7TA 2H2HA 5IP5A 4G5YA 2NUTB 3N86A 1BVUA 4ZT6A 3SJ7A 4F1JA 2PUFA 3G2IA 3G2OA 3ZWOA 4HMQA 2JBWA 3AF3A 1P3Y1 1OX5A 2BEJA 1MV8A 5KTTA 4P31A 1N2CB 2IIPA 1J2YA 1TUEA 2DVMA 3KZCA 1R6XA 4NAHA 5AKJA 4BQOA 1D1PA 2X1VA 4CMHA 2EF1A 1B42A 3SKYA 1JAYA 1C0EA 1QQTA 2P2GA 3K72B 3LY8A 3O2QB 1N6OA 1XDBA 2HA5A 2DPGA 4IXDA 2CXUA 5HKOA 2YS6A 1RNLA 3O4FA 4OSOA 5JFGA 5JZMA 4UFOA 1HXHA 5AH0A 1Q11A 4LBVA 3NNNA 4EG4A 1LU9A 1V5WA 4B8ZA 4CIXA 1BVYF 3R5XA 4Y0NA 1RBZA 4KBYA 1B41A 2QM3A 4BDSA 3R3JA 1IOZA 3W5DA 2PXHA 3D4LA 4DJEC 3FYCA 2HRDA 3EODA 2VK4A 4PZPA 1P9OA 2IKSA 1PLJA 3WGJA 3C6ZA 4X1YB 4G9EA 2IHKA 1PX0A 3AERA 4DAEA 1UBMS 1KEUA 4PRZA 3G0DA 1QVVA 5IEJA 2XY4A 5NLLA 2C54A 3K8QA 1U8EA 4QJIA 4E2FA 3FPLA 3QFTA 3V2IA 4B34A 4BV3A 5KQMA 3NTOA 3WGOA 5JC1A 2J0VA 3SCZA 1RWWA 1ADYA 3GU3A 2J3EA 3WB2A 3SR3A 2B8TA 1A3CA 3IEXA 5EJ9A 1ENOA 5MFPA 1U9JA 3S68A 4P5PA 3ZUGA 4HWKA 1M1NA 4MYSA 2JFYA 3IQHX 1QIKA 4O4HF 4Q02A 3GJRA 4D79A 1NKVA 3WOHA 4UBKA 4V0NA 1E69A 1JQJC 1KVRA 1OROA 4Q66C 2O3RA 1H1TA 3RAPR 1TCVA 1Z2PX 1XDWA 4S1PA 4E32A 4YMGA 3F6PA 4IF6A 5K09A 4MPDA 3LECA 2QM7A 4Y6GB 3BMOB 3EX7C 4RSRA 4Z4EA 2RG7A 2HIHA 4CTMA 5CCXA 1U3FA 1U1DA 5E9WA 2XJ9A 1V5GA 3LVBA 2HWKA 4GSYA 4HGNA 3S7ZA 1TA4A 3F78A 2EHJA 2E5WA 2JZOA 2ZJ8A 4ZQBA 3DTVB 1ZUD1 4TM7A 3H0CA 5HX7A 2ZS7A 3ASVA 4QDUA 3WX0A 4TGLA 1BE1A 4CE6A 3INRA 3D6UA 3LHSA 4RDHA 3UQYS 1J56A 4LHWA 4P1ZA 4E03A 3ENNA 2ZRIA 3MGGA 3BSSA 4NEQA 2B7LA 4NBRA 5DK6A 4ZU3A 3RIMA 2IBTA 5JJLA 5ALHA 1KY5A 5B3JC 4ZVSA 4DARA 4KVFA 3GXBA 1IJFA 2XGGA 2HSWA 2DBQA 4HSGA 2PZBA 5KKNB 1RJDA 1U7ZA 4HUTA 5L53A 7GPBA 1W7AA 2WPDA 1CUGA 3F8WA 2XRMA 3C7AA 2E4VA 3QBDA 1G59A 3WV5A 1NNI1 4AROA 1IUOA 1ND5A 4GOOD 4I4IA 1CXZA 3DDCA 5TQ0A 4MJ3A 1E3JA 4YP6A 2BV3A 1J1ZA 1I4LD 3BHNA 5J4VA 3JQ8B 2V4UA 2R7KA 4IQFA 4LHXA 4S1VA 4IZHA 5TT1A 4DLLA 2Q4BA 3TSAA 2H1VA 3QXJA 3P1JA 1E1QA 4HLUA 3O8NA 1YK0A 2XX3A 1YB5A 4N18A 1ST2A 4OXIA 3TAXA 3WL5A 4YCMA 1GTMA 2VWPA 4FFRA 2BBSA 3I1YA 4TXJA 1WUTA 5H4HA 3WHIA 4LNUB 2C3UA 4X20A 2ODBA 4WN9B 4JBIA 5LN1A 5FNVF 3I09A 1D1QA 1G55A 1UEIA 4CLOB 4CW7A 4FE4A 4RS3A 5IYZF 2FEMA 2IS6A 2EEPA 1XU7A 2PA0A 2E18A 2WW8A 5F21A 3Q7SA 3WMXA 2OYCA 3WQQA 3ZWNA 3PJGA 4DIMA 1XTKA 2DKOA 5IH7A 5DOVA 5EIHA 3FMOB 4GF5A 2EJUA 4J0GA 2PBRA 3CRQA 1LSUA 3FDXA 1K8XB 4LFAB 5LYJF 5EC8A 4BMYA 1G5PA 2F4NA 1Y9ZA 3FYUC 3MMNA 1QC5A 5CA1B 1U9YA 1XL0A 1NVAA 4XGKA 4KAJA 2OHXA 4MA5A 3IP1A 3ABSB 1CFJA 2Y1GA 3GVIA 4IDNA 4X1IB 1LNSA 5TE9A 2Z5LA 3U3JA 1L7OA 3HBFA 5DYYA 1GR0A 4JX9A 1LLFA 4OP1A 4OK6A 4O4LA 2A0KA 4DEYA 1QV9A 2HXYA 2KLHA 2JIOA 2NU9A 3GJ8A 3ILXA 1QPBA 1RIIA 3ORQA 3UO8B 2PV7A 1D6SA 2R7LA 3Q72A 3SFVA 1E66A 3ZE6A 2IF2A 1JR3D 3M83A 1LBIA 4RK0A 1Z07A 2ZT5A 2J87A 2MMGA 5J5VA 3THWB 2J9YB 2PH1A 3DR5A 1M2NA 4Q00A 5FADA 1WUKS 3OZEA 4OHPA 4IIYA 4ZP1A 3WGUA 4OHUA 2P77A 4NMHA 4XFDA 3QENA 3SQDA 5GPBA 3ZZ1A 4XM0A 3GLGA 4L5IA 2X0JA 3GT4A 4IW3B 4KCGA 2O1WA 2VUTA 1TEXA 3A1EA 4X1KB 4DYHA 2QXUA 1KMQA 2W5UA 1MV5A 3KJEA 4L95C 2J08A 4RWZA 5KTYA 1P5FA 2IW3A 5K3FB 5L4NA 1SKMA 2Y71A 1X1QA 4NDAA 3UOWA 2DFPA 3R0ZA 5F7OA 2ZCJA 3UMFA 2CBGA 1GADO 1WU8A 4DR4B 2RC5A 3GCWA 2IYYA 1NLZA 5K51A 3R9XB 4HATA 1GZSA 2HSEA 3QFSA 3GEMA 4XASA 1SQFA 1YT5A 2VTEA 1OT3A 1X7WA 5J4KA 4US0R 3VVBA 4Q4JB 3V4SA 2P75A 3H87A 5JI2E 1U8UA 1HNWB 4HI0E 4L85A 1AV6A 1UJ4A 2Z09A 5DHPA 1YJBA 1UPBA 1M6HA 2WNIA 1E9EA 1I2MA 3DZIA 3PFHA 3M6XA 2FWRA 5KSZA 1PJBA 2CDRA 3RG2A 1XCOA 4E1VA 2NO5A 3GCDA 3T9AA 1E4EB 1V47A 1QIFA 3FFTA 4ZANA 1J97A 4R2JA 4BX9A 1AD2A 3VTAA 4Q3NA 1NP6A 1RHMA 1YR8A 1GJRA 4CKBB 4P7FA 5DCLA 3V8BA 4MDFA 3E8MA 4PZUA 1T29A 4PO3X 1Z5PA 2L42A 4O6VA 2QBYB 1QCYA 2GJAA 2HXSA 4IIHA 1P61B 2AVNA 2O8DA 1H3NA 1KA9H 3BXPA 4K28A 2OHOA 3W3AD 2OK8A 4BKMA 4INPA 3CJQA 3W5BA 5BN1A 1SJ9A 2XCSB 3COWA 1C0PA 4E09A 3KKMA 1ATZA 4H6WA 3WLTA 4D0RA 2CUZA 4YCCA 3HH8A 1PCXA 3WYBA 3DMRA 2NPOA 2OO3A 4NJOA 5EP1A 4MV3A 4KZKA 4A16A 2ZIAA 2V7QD 4GI5A 1W4CA 3AV3A 4C6SA 3LD9A 1KMHB 1IK6A 1KARA 1OH7A 4KXYA 4D4GA 1EXNA 4R3WA 3KZVA 4YECA 5DTEA 4JS0A 4J4BA 4DZTA 1B3BA 2JGLA 2PS9A 4NYIR 5CX4A 4JLVA 3TKYA 3V7FA 3CCCA 4BFLA 3KUKA 5F23A 4FQ8A 2C98A 4Z9AA 5I9NA 2XB4A 1COWA 4R8VA 3R7SA 1MFPA 4JWTA 1U2SA 1U5AA 3QZUA 5E7IA 2AXNA 2QORA 2W4QA 2OCGA 2VNJA 3JRXA 3R4CA 5ALRA 5FBZA 3N0VA 3KJZA 4ZREA 4EHLA 1CUCA 2IODA 1CS4C 2O4UX 4IGKA 3UJNA 3ZWXA 3QE4A 1L5ZA 1SZDA 1WNTA 4Y6PA 3D6FA 1YASA 4E51A 2B20A 1O2DA 2RG1A 4GVPA 1NZJA 3ZJVA 2ACKA 1FX0B 3KBBA 1C3OB 3NVAA 4DBLE 4NPHA 4IH9A 3K0FA 2IYUA 5U9CA 3TNDA 5EG5A 2BFNA 3ENZA 1IMOA 5F5XA 2RGUA 4UNRA 4TYNA 5U1PA 4AY4A 5BMVA 1YOVA 4YAKA 3N76A 4ZO9A 3DBRA 2YZGA 4DSNA 4TVOA 4LJAA 1AQJA 4YJ2A 3E2IA 4O4JA 4P93A 1UEJA 2IEAA 3ILSA 4LXQA 1PZEA 2I34A 1DEHA 5H8WA 1JS1X 3FFAA 4LUCA 1K06A 4Q12A 4MVJE 3Q7EA 3UKOA 1FFAA 3FPBA 1CU1A 4PYQA 4X5OA 3V2GA 1X1RA 3W9BA 1WB5A 2YV3A 4BVHA 1ST3A 1RLIA 3MFYA 5AHXA 3DOFA 3ETHA 3S8MA 2IP1A 1CR6A 1V8DA 2XWSA 4KDCA 4RJKA 2W8ZA 4EG3A 1YFLA 3I8XA 3GYBA 4HKTA 2UYYA 4W8HA 2O54A 2RAPA 4YJFB 1QOQB 3GDFA 4FILA 3RS5A 1R8SA 4UMDA 4N39A 4RDCA 3IVXA 3V1KA 4B84A 5B64A 1PJ8A 3QKTA 3RJTA 1GCGA 1XZQA 2VJKA 3ZK7A 1C8KA 1W8IA 1EZ1A 1YRLA 5IAJA 1KYIA 1ZNXA 1ZGZA 1IUPA 2Q3EA 1R9GA 3CCBA 5E7QA 3IAXA 3RSQA 3WYEA 4AO8A 2R8ZA 4QJ5A 3MD9A 4QC2A 1U7XA 4LZPA 4S1WA 1NUUA 1CUFA 2B94A 4HDRB 4DNFA 2XGJA 3ELBA 4IGFA 4UASA 3ICQB 2ZRNA 4Q5IA 1RZUA 3NYWA 3U5ZB 2C3OA 3OCJA 4MVXA 2C83A 4QT0A 4Y9UA 2YOGA 3L3BA 4G1FA 5GONB 4FZJA 1VFPA 5COBA 4PXSA 3P9IA 1ZOSA 2GN4A 3CUYA 3DWIA 2P3SA 4J3JA 3IKLA 1FZTA 4NPCA 5FFNA 2JCVA 1MVLA 3JQAD 3U4CA 4B4VA 1GUYA 2I66A 4E5PA 1D03A 4C5BA 1I4TD 1GRRA 2Z83A 4GI2A 3TR6A 3A1UA 1RYEA 2VYND 1N57A 1SKAA 2GHIA 1CUZA 3G9QA 3OZAA 1Z5NA 4UHDA 3FDIA 1UIMA 2PVSA 2G0NA 4BN5A 2C4TA 4E46A 3F3KA 1E7SA 4NZYA 1WQ3A 2LGJA 3L02A 3KDAA 5A5GA 3OIDA 3A7DA 1UMCB 2QY9A 4RHTA 3D2CA 1L5RA 1SPBS 1UJ2A 4LRWA 5CG2A 1G7SA 1L4HA 4W7IA 5KYWA 3L4SO 2I80A 1I94B 1TJ5A 1KO8A 2WTBA 3OTGA 2CJPA 1E2IA 1Z8HA 3FDZA 1BHO1 4QPZA 4RLSA 4B73A 5FPKA 4DNOA 1P1KA 3AINA 3EARA 3MM4A 1C30B 3NCHA 4PG7A 2IDJA 4HPWA 4D4KA 4QGBA 4PNHA 2WZBA 2X15A 5B7GA 4IL5A 5EJ5A 3VKHA 4EYEA 2DWCA 3EXIB 3FKSD 3TE7A 1NX9A 2JVKA 3DYVA 3T61A 1RHQA 5CNKA 4IMJB 2GYWA 1F6BA 2RHOA 3CF4G 3E22B 5AO9A 4AT1A 3D6MA 4MSUA 4EITA 2OAEA 1N1GA 4WERA 3E7WA 3MBKA 3WYCA 4Q4AA 2H2AA 4F4FA 4AC9A 2QTWB 5JNVA 1TT5A 3OH8A 1CNMA 4BRWA 1R66A 2UV8A 3LZCA 1J21A 1WXEA 1YRAA 3NAZA 1R18A 1R9JA 4B3CA 4UM7A 3KPVA 1NYQA 1NXTA 3AJDA 3DF9A 4M7PA 2GLXA 5E2BA 4WJKB 1CR1A 1NW5A 1RAFA 4Y6SA 1LNZA 3I34X 1DAEA 3IGFA 1ZOLA 3T8YA 3WNQA 4U3JB 2ZREA 2C4NA 3HUTA 1Q7TA 1RMTA 2GOYA 3H19A 1OHHD 3H5IA 3CEPB 4XWGA 4IJUA 3GLFE 5H83A 4PN7A 3CZ4A 3BE4A 3D3EA 2V8OA 3CX8A 3MUEA 1P60A 3DQQA 3LBYA 3OZFA 4YRCA 3V8MA 4A10A 3WAGA 1TVMA 2KPOA 5C5IA 1UP4A 2CLFB 1N0UA 2ODQA 3B51X 1PDVA 3HYLA 1XTVA 4J16A 4JSYA 4MQFA 4PGHA 4WLNA 3DHVA 5BV1A 2AOVA 2JH8A 4V0QA 4CMKA 1MAHA 3FTPA 2C8KA 4RNDB 2NVWA 2P9FA 4BO0A 2OCDA 3TM4A 2I4OA 3KJQA 1N2SA 3KUXA 5SICE 1E0JA 7REQA 2UYGA 2B36A 2PUWA 4A0GA 5FUMA 2NVUB 1Q0SA 1WB4A 3H6KA 2Z8YA 4JDPA 4G1EB 1ZCJA 3ACCA 2QYHA 1VLZA 1EH5A 2A9RA 1T3TA 4RJLA 5HRCA 1E1DA 3DD1A 2GKGA 4RZ3A 5LQUA 1XVLA 2FP4B 1YZUA 4ARBA 1ATIA 3OX3A 4ADSG 2PT6A 4I08A 2BLNA 1P6XA 3FIUA 5AVOA 4DUYB 3QLVA 2ZJAA 1DBWA 2JFZA 5ELLA 4HNSA 4MUEA 4FYXA 3LBAA 4YUZA 4YV7A 4W5HA 1WCV1 5FBWB 1UAGA 3DE6X 2HDOA 3RSCA 1WJGA 1ACLA 4Y1EA 5BV0A 3U4QA 4XR9A 4PC7A 4GZLA 1E6CA 1IZZA 4UULA 5B53A 4A91A 2UVPB 4K9KA 3K0SA 4HNTA 2C31A 4L2IA 4F4JA 1R0ZA 2XNJA 4WOPA 4NCKA 4CMEA 4MWSA 3HL0A 5HM8A 2Y0BA 1YIOA 4G9BA 5B6PA 4GNRA 1RWBA 2AUNA 4QQFA 4DR6B 3EISA 5HCIA 4D57A 2CEKA 1IC6A 1IMJA 3FMVA 3K15A 4Y9DA 5CB4A 4CM9D 4RPJA 5AJTA 5FHQA 1XPOA 4NCHA 3WMGA 4BQNA 1VHTA 1CZUA 4BO7A 1JPJA 3NANA 3ZLVA 3LYLA 4N5IX 1KZ6A 4M36A 221PA 4OIMA 4BBZA 5BT9A 3HA3A 3TL2A 3DBOB 4BB0A 4CDMA 4EGCB 1RQ2A 3B1FA 3IV6A 1T1EA 4PNPA 4BQIA 1LQ2A 3VR2A 1R8YA 4K40A 4WLEA 1GPDG 2B5WA 4OJQA 4Q3AA 3HMQA 2WZDA 4LI0A 5EMLA 4ZU6X 4AWAA 1F2TA 1M72A 1XZKA 1KYWA 4WK2B 4Q7LA 1PJAA 3COYA 3II6X 4B7UA 3WGMA 3QBEA 1U6JA 1XJWA 2R1UA 2UVDA 4XRRA 4J2HA 3O8BA 4RTJA 4J3FA 4JVMA 1GSOA 3EOBI 3GPLA 2I9PA 3LRXA 3Q2IA 5KX5A 4EGAA 2GSWA 1P1FA 4Y2QA 2OFXA 1AN0A 2J41A 2VJPA 3HFSA 2CZGA 1MA0A 1Z35A 4Y18A 2Y6UA 2YWJA 3EXFA 2PJZA 2NTNA 5BW8A 3WZLA 4E31A 3R7DA 4JI4B 3IKTA 4MIYA 4C2AA 2BFOA 3G9UA 2D6FA 5CW1A 3VSEA 2ZYSA 5KQSA 3C8MA 2G76A 2WIBA 5EJEA 1Z8NA 1M2EA 1JLLB 4TM8A 1ORHA 1VFNA 2CJYA 4CI9A 4TYYA 3MTJA 1R0KA 3HKCB 1PBTA 4MPJA 4ZVOA 3RS7A 1ISRA 3IP6A 1NUTA 2VJLA 2AX3A 5D86A 3ZGOA 1E94E 1U9ZA 4J8PA 4QSHA 4GE3A 1KZ1A 1K97A 2BFDA 4HLCA 5EZYF 2IIQA 2WVJA 1V6CA 2A5GA 2H1LA 1IWBB 4GX5A 3PX3A 3KXDA 1Y5RA 2NO0A 5JS1A 4DTIA 2VP2A 1MT0A 2HLDD 3MRXA 2R6JA 4BO9A 2N3ZA 1NW8A 1XZ8A 3KXIA 3X2SA 3LKVA 1HFKA 2A30A 1BN7A 2AFIA 2BF7A 3EVEA 1QFZA 1U9CA 2YX1A 3N53A 1GU0A 1ZLYA 2GEVA 3IEKA 4Q9IA 4Y2JA 2QPOA 1CG6A 3UEOA 5IT5A 2DPYA 3FZGA 1O97C 3FWPA 2W37A 3DJFA 1A96A 5GINE 1T0UA 4YROA 1G7TA 4QTTB 3IO3A 3BK2A 3EDMA 4NF2A 1CEEA 1MXHA 4EUHA 3H9GA 4M8NE 3B8HA 3W2EA 2ZXFA 1NUPA 2QVYX 5HE8A 1UFOA 1GGVA 3VOSA 2CYBA 3GJZA 4JR2A 1NM5A 1RACA 3G1WA 3N8IA 1ECPA 3NJRA 3DLAA 3SEFA 3C0KA 4FFBA 2CXRA 3V4LA 3B6EA 3EBOA 4IBOA 4JEIA 3IQDB 4QECA 5DLEA 1HZJA 1NSFA 1Z26A 3D7NA 5F76A 4AB1A 3VMMA 2H07A 1VJRA 1J5XA 5CLLA 2NO9A 4NV0A 4KITB 3ECSA 2GBCA 3QMMA 4C4RA 3CX7A 4D92A 2CN1A 2FVXA 5C53B 4YMTA 3H7AA 1T5DX 2DG2A 2JD0A 1VQ1A 3L1VA 4JVSB 2PCLA 4RQAA 5ALFA 7ADHA 4KR6A 1UXOA 2J48A 1AJEA 1VXOA 3PLRA 1JECA 1WHTB 1QFSA 4D0SA 1DLIA 1ZOOA 1S1MA 3HZHA 4A8JA 3KKNA 1E5XA 5IN4A 1TCBA 4BNUA 3CUKA 2RGXA 3OJLA 1QYWA 2H0QA 2R4TA 2XMPA 4BASA 1VRCA 1STOA 4LZNA 2Q45A 1RXVA 3LF1A 3OOHA 1NPDA 1KK3A 3NWBA 5D87A 1A88A 2DYKA 1DRUA 1ZONA 1M6EX 2NZWA 3FI9A 5LLSA 4CBVA 5J1SB 2C9MA 5TVGA 1W4ZA 3COPA 4B4UA 2IXDA 2ZDHA 3PRJA 5FL3A 1GA6A 1N1EA 1YXMA 1ZKMA 1UBCA 2H7XA 4G8BA 4JB2A 4MRNA 3DTYA 4YCSA 3FUCA 1SKYB 4BO3A 7MHTA 2JD1A 2IZ1A 1QPGA 1U8YA 2W8BA 3D8TA 4MKHA 4LDQA 2QN6A 1OXBB 1CUEA 3IT0A 2VH5R 3TLXA 4BNZA 1IH8A 4FEEA 4IHQA 2LZ0A 4PPYA 4YRJA 1G1MA 1OLSB 2J6HA 3IJ5A 4GZ5A 5DIFA 1GG2A 3EIWA 5C32A 4Q0MA 1RAGA 4HAZA 2I2CA 2CD9A 2VZ0A 1FFDA 4N0MA 1EX7A 1MOSA 3TDNA 2ZI7A 4ZWNA 5JCOC 1BXRA 3IV9A 2WJ3A 3VU9A 4OB7A 5BSGA 2XRZA 3QF4A 5EE3A 3CN9A 3O1IC 2A92A 4DDTA 2XHZA 5DLDA 1QK5A 5JCJD 5FT9A 2I5PO 3MPOA 1JR4A 1ZHOA 1KOGA 1HE1C 4B80A 2W2QA 3AOGA 2B0JA 4H77A 4CQLA 3V2UA 16PKA 2AE1A 2XB8A 3ADPA 3IR5A 3DH0A 4HDKB 4L6CA 2WNSA 3HM2A 4JB0A 3SF8B 1VSBA 4BL5A 2A59A 4BFZA 4GX1A 3G5MA 3QWAA 2ZDQA 1TADA 1TEHA 1ZIXA 2W6JA 4EARA 2PV0A 2GXUA 2P4HX 2AOUA 4JFRA 2X6RA 4MP8A 2I4MA 3REQA 3U3ZA 3WGQA 4V0OA 2LE0A 1RAHA 4NR0A 2G9NA 4D1YA 2DR2A 4BO2A 2HV8A 4E2WA 1YI8A 3D4IA 2QWXA 4B6EA 3UH0A 3PE6A 1CVRA 2EDAA 2WFLB 3DT6A 1EA5A 1Y81A 4GLFA 3BWEA 1ZRHA 2MSWA 4HUJA 2QV7A 4IP0A 4JU8A 1FVOA 4YR7A 3L05A 4JITA 5IJAA 1W8DA 2IQ5A 3GRZA 4JJAA 5G4KA 4KFUA 3G89A 1KQGA 2XOKD 3MHPA 3UHOA 3DAPA 3UJ3X 1A9RA 2F43B 3ZJTA 5FWNA 4Y9SA 2V4ZA 2V5AA 1TF5A 3IL2A 4LTMA 4EPTA 1P6UA 4NNOA 2CE7A 2OYSA 4XH9B 1KKLA 3L1JA 3QX7A 4IDGA 3EGDB 4K7JA 4BP9A 2Y67A 2GEJA 3P45A 4MEJA 1S8FA 2OG2A 2MR5A 2CMDA 2P9EA 4EYQA 4ERXA 3IBTA 1S9HA 1O6FA 2WAMA 2YXLA 4P32A 3VA7A 4WKNA 4L5AA 1GUZA 4HNHA 2PRZA 1TF7A 5A7GA 4ALMA 3ZC3A 3HVUA 2OB1A 2BM0A 3G49A 1O5OA 4PO9A 2CYCA 2GLUA 1N6NA 2YH2A 3QA3E 4RMHA 4AF8A 4DE5A 3H9EO 2ASEA 2P6NA 1OXMA 2WTAA 1B8VA 2L17A 2QG4A 3DONA 3Q0EA 1FNNA 1GEEA 1D07A 1H4VB 5CEJA 2QTBA 1EFHA 4RFLA 2F3SA 5T64A 1I13A 4BNVA 1F8YA 1MKYA 2QY6A 3HACA 1L7RA 4IGEA 3LY7A 4BNMA 1CQIA 4BJ3A 1SBZA 1M2VB 4V0RA 1TQ6A 2PX3A 2I55A 2WYIA 3EUEA 5IBPA 4DJJA 2OC4A 1A97A 3PUVA 1WZNA 3E9ZA 4W4TA 4HJRA 3KHTA 5T4HA 1L3BA 3HHPA 5M7EA 3D8UA 1O94D 3OQBA 4HBGA 1ZA1A 2A86A 1NQTA 2KBEA 4L4RA 1LLUA 4EX7A 3SYLA 4FBGA 3IX7A 4I55F 1ZWLA 4O1HA 3INGA 3Q40A 2BEVA 1E1NA 4MIEA 2F7SA 3LQ1A 3ZHQA 2IHVA 3O2SB 3SSNA 1UMDB 2Y8EA 2GHQA 5I9BA 5DPMA 4M99A 4UUNA 2PX6A 3CX4A 3GRUA 5DTQA 2MHCA 2C2HA 2IYWA 3CNOA 3ZDFA 3RAFC 4N7MA 4Y67A 4BX0A 1I01A 1C4OA 1SKUA 1CUVA 2J3JA 3KUCA 5THXA 4UTXA 4LJSA 2A7QA 4B31A 4QXOA 4E08A 4MINA 4FGJA 4MXDA 4P92A 5CLJA 3ONFA 4UHHA 2XXAA 4LYHA 4KQXA 1F2UB 1D2AA 1MAAA 2A5DA 4M46A 5FA5A 3UNXA 1J9GA 1N5MA 4CM7A 5BWBA 3WICA 4O8CA 1AY0A 2V6MA 3DKIA 3C15C 3K0AA 3V42A 3OJEA 3FCXA 3R7FA 1S3GA 3C97A 5AK5A 4J9VA 5IAKA 5C46F 2JI8A 3K8OE 4X66B 4JL6A 4ARIA 1DB3A 2FPOA 3F9CA 3OJCA 3E15A 4KQ1A 1U9IA 3VR4D 1CUWA 4QDTA 4QBTA 2HRRA 4W99A 2O2DA 4P2GA 3EDRA 3MT7A 4YRGA 4H1WA 2J5RA 2DLNA 3BJZA 4EHHA 4MHSA 1XX6A 4TV9A 3A9RA 3ABZA 2AOWA 3DVAB 2OTCA 3EAGA 4GW3A 5HF9A 3ODGA 1W6UA 2Y66A 3OCZA 5B6IA 1GQ2A 4MDEA 4MRRA 2XIJA 4A1OA 3CUVA 2DH5A 3CH6A 3QVUA 3ROPA 3IAM6 3LCUA 2O5EA 2UZ3A 2RHHA 1SXHA 1EK1A 3JZIA 3P2IA 2R6DA 3CUTA 4RF5A 4K9DA 3NVKI 2LPMA 1XCGB 1RDFA 1JZSA 2FPIB 1T0PA 3LDUA 2QRPA 1P4SA 2MTBA 3AI2A 3EGIA 3M3PA 1WSAA 3OCUA 1M34B 2IL1A 1NHWA 4G86A 1C1DA 2P6PA 3MJHA 4YASA 1SOWA 4CFZA 3IXLA 3PQ8A 4I46A 3JVVA 1N7GA 1N0VC 2EATA 3KYCA 1A9ZA 2HBQA 4FX5A 2RIPA 4HFRA 4XYGA 3RU3A 1DAMA 4DIUA 5BP7A 3UJ9A 5KVSA 4EDHA 2YDXA 4HYEA 3MQ2A 3UYKA 4UBLA 1VIVA 4JI5B