2LPMA

Chemical shift and structure assignments for sma0114
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
123
structure length
123
Chain Sequence
GSHMTERRLRVLVVEDESMIAMLIEDTLCELGHEVAATASRMQEALDIARKGQFDIAIIDVNLDGEPSYPVADILAERNVPFIFATGYGSKGLDTRYSNIPLLTKPFLDSELEAVLVQISKEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Two-component response regulator
publication title Nuclear Magnetic Resonance Structure and Dynamics of the Response Regulator Sma0114 from Sinorhizobium meliloti.
pubmed doi rcsb
source organism Sinorhizobium meliloti
total genus 19
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2012-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2lpmA00
4G0YA 3N0WA 1BAPA 2A9OA 4NQRA 2PUCA 4OTZA 2L19A 2XDYA 1DBPA 3FFTA 1VPWA 2H0AA 4G0QA 4H3HB 2MYUA 4LE0A 5FWXA 3RQIA 1YTUA 3NNSA 4MPTA 3L6UA 4MLCA 3NNNA 4HNQA 2QW1A 3CNBA 4Z9AA 4F12A 4Z4FA 1DZ3A 4WT7A 4L85A 3H5OA 4KQ9A 4UHKA 5EWMA 5ABPA 4NCAA 1DBWA 2FSPA 5JS2A 2AYXA 5TQ0A 2HQOA 1YVUA 1XHEA 2JBAB 3N0XA 1FFGA 3DZDA 3P9YA 3GRCA 4N41A 2IOYA 3O2JA 5BQ3A 4W5NA 1QP7A 3T95A 3JPYA 1LJLA 3B2NA 5TPZD 4EGSA 5C5CA 4JB2A 1RPJA 2GWRA 2GX6A 3FFXA 1U2QA 2FXIA 2NZVG 4MR8B 5D2CA 4W5QA 4H60A 1ABEA 3FDFA 4UHJA 4RKQA 3JVIA 5TQJA 1KGSA 2FMKA 3HUTA 3QEMB 2AYZA 2PAFA 3JTEA 3LKBA 2ZWMA 3LUGA 1QQAA 2VYCA 5FBKA 2F8SA 2QR3A 2JK1A 3RVSA 4EYKA 1JLKA 4RK7A 3ROTA 4EUKA 4OG2A 7ABPA 3UUGA 5I4CA 3QLTA 1WETA 2CD7A 1NXXA 5TPWB 2NT3A 4MAAA 3O2QB 3GYBA 2QVGA 4MYRA 3K9CA 1L5YA 4XASA 4YLEA 5IBQA 1I3CA 2TMYA 3LKVA 1DBQA 1Z12A 2V0NA 4Z99A 3H5TA 4RZSA 1P6UA 4PICA 4O1IA 1YS6A 1LK0A 5GQSA 1QP0A 3HSYA 4TMYA 3H1GA 2FMHA 3EODA 1NXWA 4W5OA 3Q7RA 2PMCA 1DRJA 2FEPA 4NV3A 4XARA 1A0OA 5KWSA 3OQNA 4RK1A 4YV7A 3BRQA 2IKSA 3KTOA 4MR8A 2O20A 5EWJB 1SRRA 4H3KB 1QMPA 2NUBA 3EULA 3HEBA 4MS4B 2Q5CA 2PUDA 1SXHA 1ISSA 2NT4A 3QEMA 6ABPA 1FSPA 5JNVA 1Z16A 2WB4A 5KQLA 2ID7A 4RXTA 5DLEA 3W9SA 1JDPA 2LPMA 2F8TA 2KYRA 2FQWA 3EDCA 3F6CA 3NHMA 3IPCA 4RK4A 1JHZA 4F8JA 2A9QA 2R48A 1RZRA 3M9WA 1QQBA 4N0QA 3EGCA 4EVSA 4M88A 1PNRA 1Z2DA 1KRWA 4XLTA 3QELB 2FN8A 1QNLA 2MYNA 4DADA 4O5AA 4EVQA 2YHAA 5GOTA 1P6QA 3D02A 4MQEA 4ZMRA 3SQNA 3JVDA 3OLZA 3I42A 4ZPJA 4Z4IA 3OQOA 3TX6A 3QLVA 1JYEA 4Q6WA 4RS3A 4MS3B 1YK1A 4RU1A 2WWVD 4JAVC 3RVQA 2E4YA 2PJUA 3URMA 2IYNA 3GWGA 3IP7A 2FQYA 5FWYA 4G97A 3NNDA 2W42A 2IPAB 4DQDA 2CHEA 5T7BA 3MYYA 3O2SB 3NBMA 1Z25A 3KYIB 3I45A 1U2PA 3OLWA 4WXMA 1Y1LA 3EJWA 1NXOA 2FLKA 3A3KA 1U8TA 2QXYA 1DG9A 1M5UA 3E3MA 5TE9A 2QZJA 2L18A 3C6QA 4PZ0A 3N53A 2PUGA 2PKXA 4RK0A 3SY8A 5IEJA 2GI4A 3IPAA 1U0SY 2E4UA 3QELA 1L5ZA 1SXIA 2IPNA 3IP6A 4TLMB 3CLKA 2PE5A 1B00A 2L17A 3KYJB 4Q6BA 3QX9A 1DC8A 2GKGA 2JVIA 5IUNC 3JPWA 1DP4A 4RXMA 2PUBA 4MS1B 3A0UA 4IRXA 4JB0A 3O75A 3CFYA 1D1PA 8ABPA 2WRZA 2YHBA 1QO0A 3LUCA 1ISRA 1QO0D 2JRLA 1P2FA 2HQBA 3CG4A 3F7NA 4KK4A 4MR9A 3KG2A 4Y9TA 4YS6A 1SD5A 2E4WA 4E7OA 3BBLA 3OLXA 3QLUA 2MYTA 4RKRA 1EWVA 1AB6A 2JCGA 3IP9A 4OLBA 1U04A 3OO1A 2CWDA 1XHFA 3H75A 4JASB 4LDAA 3VNAA 3KLOA 4LZLA 3CRNA 1KRXA 4PYRA 1RNLA 3GBPA 5KI6A 1ZY2A 4Z4HA 2WY2D 4RSMA 4DN6A 2RGYA 4RWEA 1JBEA 1C4WA 4FB4A 6CHYA 1YIOA 1P8AA 1QKKA 5FBHA 2FKAA 3RVLA 5IX8A 4IMIB 4RK5A 4MS1A 3Q7TA 1TMYA 1USGA 1ZDMA 3D8UA 2GBPA 2LBPA 3MQ4A 4QPJC 4JA2A 1GLGA 3Q9SA 3E61A 1JFTA 3KJXA 4LRQA 2PUAA 4XAQA 2NZUG 3KCNA 4PE5B 3N75A 4ML3A 3EQ2A 3H5LA 4Q7EA 5IUKC 4MRMB 1Z18A 1APBA 5IEBA 2JBAA 1NXSA 2VUIB 5DTEA 4MR7B 5B3JC 5CNKA 3IP5A 4RK6A 3ILYA 2R47A 2IDMA 4HYEA 1CYEA 1VRVA 4L4UA 1KMIY 4LX8A 1FQWA 1T34A 1ZVVA 3LUHA 3OMXA 4RY8A 4G0PA 4G0OA 3KS9A 1VLZA 4QYWA 1TVMA 3C3KA 1JH9A 4ETNA 1GCAA 3HK2A 5EWLB 4HNSA 4N03A 2IPMA 4NICA 4N47A 2MYPA 3OMWA 1JFSA 4FE7A 4KV7A 2FTKE 1SXGA 3VNBA 1E6MA 2WJAA 4Z0NA 4B09A 4KRFA 2R25B 3CS3A 3TD9A 5TQ2B 2MSLA 5ED4A 4JOQA 2L2QA 2I6FA 4MLDA 4N76A 1NATA 3O1JC 5TPWA 2VK2A 1BDIA 4KPYA 1W25A 3CG0A 4KNYA 1OXKB 5T3YA 3DLHA 3G1WA 4G0MA 2RDMA 3QX8A 3KLNA 4WZZA 1RZRD 1ZGZA 2JB9A 4MRMA 4Z4GA 3K4HA 4LE2A 5C5EA 3RVPA 3MA0A 1E6KA 3CZ5A 2E4VA 4MQFB 2LUOA 3NHZA 4RY0A 5HKOA 1Z26A 1CEYA 1Z17A 4OBBA 3I5AA 4RXUA 1JDNA 3HCWA 1DCFA 4ZMSA 1MIHA 3FMVA 2FMFA 4JP1A 4WXEA 2M98A 4TN5A 1GUBA 5BRAA 4WWHA 3H1FA 4ZJPA 4KZKA 1DJMA 3LUFA 3LOPA 3O21A 5EWJA 3HVRA 4G0XA 2PUEA 2OENG 1JYFA 3MMNA 3FGZA 1QP4A 1H9CA 1ZGGA 4MS4A 4OATA 1F4VA 1S8NA 3A0RB 3GL9A 4XXHA 3HDVA 3QK7A 4F3TA 4KREA 3FFWA 1EHCA 2QU7A 4G0ZA 3OO0A 2QV0A 4MGEA 4O1HA 5FWXB 4OLAA 3S99A 3HXMA 3O1HB 1D1QA 1NXVA 1E6LA 3HM9A 2MSWA 3G85A 4KQCA 5JS1A 3LFTA 3N0RA 5DGCA 2P4UA 4CBVA 3SG0A 1LJUA 5F64A 1YMUA 1MB0A 3CKMA 2IPLA 5BR1A 4WUTA 4NCBA 3O1IC 4ETIA 1JFVA 4ETMA 4MQFA 5EWMB 1BDHA 5HQJA 2FN9A 3HO1A 1PEAA 1IIBA 9ABPA 1M2FA 3O74A 1ABFA 3H6HA 3LUAA 4PEVA 2WJWA 3M6MD 1TJYA 3RH0A 4IMJB 2MSKA 3BRSA 4MS3A 1YS7A 3H6GA 1CHNA 1ZAYA 4Z4CA 1EFAA 3RVJA 3OQMA 1LBIA 1OXBB 3KSMA 4F11A 2CHFA 1YK0A 3ROFA 4G86A 3UK0A 3LUDA 4YO7A 5JNSA 3OLYA 1BA2A 2LP4Y 2N9UA 1MB3A 4YWHA 2X7XA 3BREA 1C0EA 2QSJA 1BVHA 1DC7A 4W5RA 1DRKA 3OLVA 5HSGA 4FE4A 3TMYA 3DGEC 4RDCA 2LIVA 3CU5A 1GUDA 1M5TA 1D2AA 5JNTA 3MM4A 4TLLB 1DCMA 1DCKA 4RV5A 1USKA 4XFKA 3RVNA 2HPHA 3GT7A 1ZH2A 2FEKA 2OQRA 1QPZA 1NXTA 5JNRA 2RJOA 1F51E 2JVKA 3C3WA 4IF4A 1JX6A 1AB5A 2R4QA 2FEWB 1ZITA 5KQMA 1YMVA 4Z4EA 4KFCA 4QYMA 1J56A 1URPA 3QEKA 3F73A 3C97A 3QLVC 5TPZA 3RVKA 1D4ZA 3H5VA 3RVRA 4EVRA 1TM2A 1D5WA 5KQGA 2FLWA 4YGXB 1NXPA 4KK3A 1FFWA 5DCLA 1K66A 4D74A 4S05A 3GBVA 4LDZA 1R8JA 2FMIA 2BGGA 2FW0A 2A9RA 5KC9A 4P1ZA 1EWTA 2HSGA 1MAVA 4YP9A 1USIA 3H1EA 4LE1A 1K68A 2PLNA 3LUKA 3OM1A 2ZAYA 3N8IA 3UKJA 3RVOA 3I09A 5PNTA 1RXIA 1GCGA 4YRZA 1LBHA 2VUHB 3HDGA 3T38A 1A04A 1ZH4A 3LTEA 5CNIA 4IGAA 2E4ZA 5IUJC 1M2EA 1BDJA 3LMKA 2H3HA 4EYGA 1NTRA 1PUXA 4KMRA 4MQEB 1MVOA 2QVCA 3M9XA 3JY6A 1PEYA 2DRIA 3DGFC 5BRJA 5HM6A 1PHRA 3F6PA 5IULC 3MF4A 2HQRA 4GNRA 4MR7A 3L49A 4YCSA 5FWYB 3A10A 3Q15C 1Z15A 4D6YA 3CZCA 2E4XA 3QLUC 1ZESA 3ILHA 2PL1A 4YR7A 1VKRA 5KC8A 1EAYA 4S04A 4KVFA 2PUFA 2P9HA 1NY5A 3EQZA 3EAFA 5CHYA 3DLBA 5CNMA 3Q7SA 4N0PA 5EWLA 4W5TA 1Z13A 2PL9A 3R0JA 2B1JA 5E3JA 1FFSA 3T8YA 4EYOA 1ZHHA 3Q41A 3T6KA 5IC5A 3LUJA 2ID9A 4D6XA 4F06A 3CHYA 5TQ2A 2A9PA 1JF8A 3HUUA 1JWLA 1W9HA 3RVMA 1E2BA 3HJFA 3SM9A 1TLFA 4EYQA 5KQPA 3DBIA 3SNKA 5JNWA 5JNUA 2JVJA 3C3MA 3BILA 1XWWA 4HNRA 3SAJA 5DKFA 3JS5A 1EWKA 4EY3A 4ZYLA 3KKEA 3CTPA 3TB6A 2RJNA 2FVYA 2M1ZA 1Z2EA 1ZN2A 3GV0A 3HV2A 2WMYA 3H5WA 3N6VA 1UDRA 4GPAA 5B3JA 2HJ9A 4MR9B 3H5IA 3IDOA 5TQ0B 4P98A 3TO5A 3HZHA 2J48A 4QICA 1HEYA 3GA5A 1A2OA 2FQXA 3MIZA 4E7PA 1RXEA 3KHTA 3HS3A 1JL3A 1PNTA 3OM0A 4IILA 4Z9BA 2B4AA 5CNJA 4RY9A
chains in the Genus database with same CATH superfamily
3ICWA 2AZTA 3C41J 4G9GA 4IYRA 4MMZB 5JWOA 1BAPA 1MPTA 1KF0A 4DLPA 2OQIA 2PH5A 3AR3A 3FSEA 3W2GA 4A03A 4BB5A 1V5GA 4ND1A 3NC0C 5FWXA 5ENZA 2Q46A 2G04A 3QNWA 1WSDA 1HV8A 3B36A 5AI9A 3ORHA 4ZXFA 1PFVA 2IZ6A 2GCPA 4EUHA 4KSCA 4UM9D 1P2TA 5HCIA 3SX0A 4O08A 5J4LA 3UMJA 3EEFA 2B30A 1TADA 4HC4A 4L85A 5KYTA 4FDLA 2HBQA 4W7IA 3L0ZA 4KHZA 3OFSA 3B3FA 5HRAA 2H57A 2Z8YM 4HJXA 1P0CA 1LK7A 3IEKA 5TQ0A 2ONKA 1NMXA 5I8WA 4P4TA 2P0YA 3J7TA 2PBZA 3NGMA 3ZS8A 1R0LA 1TF2A 1J06A 5CD1A 5ELMA 5HF6A 4OHXA 2OCLA 2QG6A 1V5FA 3OEHA 1LJLA 1JFRA 2GWRA 2IYOA 1A95A 4M9CA 4P08A 1SOUA 1P1BA 3V1UA 5LQAA 2H2AA 4AX4A 4MR8B 2AFHA 4PXSA 4IVNA 4J3FA 4QE3A 3SE0A 4YQEA 3LAWA 3FDFA 3BXGA 1ZXXA 4PX9A 5G2OA 2V54A 1XRJA 4MHTA 2YWRA 3HUTA 4I2VA 4UCQA 4C22A 4TTRA 1MZPA 4GQIA 3A9UA 2JK1A 4E6EA 2XNHA 3EA5A 4Q03A 2ZRDA 5HF5A 5I4CA 1QRSA 3JQ9A 2VOEA 2NUPB 2IQ5A 621PA 5IDXA 2QUHA 4Q1EA 4H08A 3T7SA 1QH0A 3HXPA 4ZT7A 3WGYA 2YQ5A 5IT0A 1SKQA 3D3KA 3LKVA 3BL5A 3PUJA 2IU3A 1RJGA 4O02B 4EI7A 4MVJG 5GV7A 4FMDB 3FJYA 2QL9A 3M4NA 3GLRA 4U6NA 3U13A 3VKWA 3ZDRA 4BNFA 2FFQA 1X1CA 3LY7A 4GFDA 4MQ6A 2A59A 5F9HA 1PYGA 2WWTA 2JJ2A 2CDNA 4TMYA 4OA5A 3L3BA 5KYUA 3QVKA 2EGUA 4PHGA 4L5CA 2HF8A 1KJ8A 4RABA 3GJ4A 2IX9A 4C4SA 3RV3A 2RHRA 1RPZA 1I2MA 3N1UA 7YASA 5IAGA 3RBVA 3WL4A 1KI6A 1ZRSA 2FPGB 5CAEB 4NMWA 2YVLA 1R0KA 3VISA 3R20A 4CQMA 5EIAA 1HETA 3WX0A 1E1QA 1I0LA 5KKAA 3BJMA 3RK4A 3KEFA 2P9ZA 1M2HA 3USES 1NM5C 3CLRD 4PYJA 2ID7A 1UPTA 1E94E 1A9TA 1XRRA 3EA4A 2WAMA 1JWBB 3OZEA 1GUZA 3WWOA 2AMYA 2X9NA 2FSIA 4Q05A 1E2PA 4HX5A 1PG5A 1AQUA 1Z28A 2P35A 2W4QA 3DDZX 4AN4A 1WXDA 5AJYA 2GCIA 3V32A 2HIHA 4AXXA 4YX9A 1A5ZA 2FMUA 3I9MA 2FPMA 4N40A 1FUIA 4RIGA 4ZI7A 3CUEF 1YHZA 1RACA 5K7SA 5F3DA 3EGXA 2RGEA 1H8EA 2V98A 4YRPA 4K6CA 2HN9A 1CE8B 2AXQA 1NNI1 5E8JA 3VX4A 5IT9A 1M6NA 5EJMA 1PNOA 3BDAA 1FVXA 3F78A 2BCJQ 2MMCA 3Q6IA 4XYBA 4D80A 4E5YA 3OQOA 1UJBA 2QTVB 1IVYA 2CXXA 3Q72A 5JCPA 3LQYA 3DLCA 5FORA 1KKLA 1MO5A 4M36A 3H11B 4NEGA 4TYYA 4NXNB 2IYQA 3PDHA 2OPHA 3AI7A 3WMFA 1AS2A 2CHGA 3I0MA 5HIAA 2PQ2A 1MG5A 4MMYB 5D1HA 2V7VA 3NBMA 4TVBA 1TT7A 1KH1A 4RCZA 2RHLA 1QFJA 1N0UA 1QZXA 1T0JB 1GPMA 1NFRA 3OPYI 3OOJA 4RTRA 4EJFA 5DHQA 1M5UA 2EQAA 4PYLA 2VFAA 1RQ7A 2QZJA 2RAPA 5ESDA 1UPFA 4CIYA 3JATA 5F9MA 4CETA 1VI2A 2EFCB 3IMFA 2I71A 3V46A 3ENZA 3AB3A 3RNLA 3WSWA 1K4MA 6NULA 2VUSA 5F98A 2IU4A 3OSZA 1YHYA 3DUFA 4TLMB 2FU5C 4BMSA 5A0VA 4DJFC 1S02A 2CXQA 2IZOA 3ORRA 1XEWX 2O5VA 1XO1A 4EELA 1DC8A 1K89A 3ISVA 3OCUA 3JPWA 3AEYA 2HXSA 3A0UA 1E9RA 1JIUA 4I1SA 4O33A 3TZCA 2GN2A 2V3VA 4HXGA 1W1UA 2EZ9A 3W05A 2PKQP 2VDWB 2HCFA 3BH0A 1HDYA 3WIBA 1ZP6A 2XXAB 4NARA 4CLOB 1UANA 3UJ6A 4OJTA 2JRLA 3VC1A 3KTDA 3THXB 4KW7A 1O58A 5K0BA 3RU9A 2VT6A 2YKGA 3HWWA 4X45A 2FWIA 1RLUA 1V3VA 2P7IA 2C2WA 4FYJA 1QUEA 4XQ9A 5JMWA 4ZVTA 1MDBA 2XWQA 3OC0A 3QXSA 5BVGA 3TOVA 1Z6PA 2PL3A 4XTRA 1CY6A 1ZHOA 2XQJA 1YUNA 3GJSA 5I9IA 3GOHA 3CRNA 1HE1C 1I4TD 4Q4LA 2YZMA 3L7LA 2Z2KA 3CLVA 4FZJA 1T2DA 2B5VA 4KI0A 4ZRDA 3V1YA 5IVKA 1RTTA 1WW3A 1R4MA 4B6EA 6REQB 2RGYA 3KOWA 1PD0A 3LXMA 1P8AA 2ICAA 5ALHA 3UMFA 3DMYA 2IXEA 3TF5A 1TE2A 3AONB 4PO3X 4QA9A 4F4HA 1RXYA 5IYZF 4NY1A 2OILA 5SY6A 1FZTA 4PSCA 3VZBA 3FVTA 3TG2A 4XM1A 1W47A 2DG2A 4WJLA 5F2NA 2P30A 4YFYA 4DQKA 3I0ZA 4DJEC 1FC0A 3K8OE 2O2GA 1TA0A 3KCNA 4YALA 2R5WA 1ZNQO 4Q3CA 3X1XA 4B43A 3B12A 2VUIB 3BF8A 3Q3JB 4KWHA 1CY4A 1M0WA 4OHVA 3UB2A 2A0KA 3A9RA 2NP6A 4XE5A 2QD3A 4MWZA 1I94B 4YB8A 2JJ2D 4HN4B 4RETA 1DFHA 3PIDA 4I4TF 1SXPA 1VSQA 1H93A 1BXGB 1ZH6A 3I3OA 1UPUA 3FSGA 2G63A 3F71A 4LX8A 4N39A 4PU0A 3AJ8A 5H02A 1SCAA 3VZDA 4G5QA 5DLPA 2WR8A 4IZOA 3C3KA 3UN1A 1Y42X 2D0IA 3JQQA 3AIMA 3ICEA 2G1KA 3B1KA 1WUTA 4G2NA 3F4BA 1GL7A 3LL7A 3N2KA 4GX2A 4NICA 2PX2A 5G4KA 4BAUA 4OHYA 1JHUA 2QX9A 3ZK7A 3EIEA 5LYJB 1A2QA 2H1HA 4IG9A 1QWOA 4CQMD 4QGFA 5HRUA 3ER9A 1D2NA 3AR4A 1E1QD 1VPLA 1BE0A 3GR6A 4RD1A 1E66A 3A3OA 4ZQGA 3VU3A 3DA8A 3V48A 3WGZA 3WK7A 1W5TA 1K3FA 2GYVA 5ES4B 1E5DA 1GLNA 3M34A 3NXKA 4FUQA 1ZW6A 4ARAA 3K0KA 3SCZA 3M3HA 1OFGA 4IEEA 3D8NA 3RS2A 5IAOA 1N2CB 2CFCA 1TU3A 1XOIA 2JKYA 5T3YA 3GBSA 5T41A 1RU3A 2VTKA 3BK7A 1HBJA 3G1WA 3O9MA 1R00A 4XPIA 1ZGZA 3WB1A 3OG9A 4JLDA 4Z4GA 5FL7A 4LI3X 1RHQA 1VPTA 4RJLA 1EP3B 4IDCA 5DTJA 2ZUUA 3NBXX 5BQPA 2GFHA 1H8ED 2CUKA 3B78A 3DMPA 2C4HA 1L9XA 2RG1A 1MOPA 1RJWA 1Z6GA 1MIHA 1RAHA 1T6ZA 2JJMA 1ZVKA 2ZB2A 4JP1A 1C30A 1GNLA 1S8AA 4NYIQ 4OBEA 4DYDA 5AKKA 5BW6B 1WVMA 2JD0A 3R5HA 4L3WA 3WLFA 5BRAA 2VQEB 1TAUA 1AZSC 2A1IA 5IKMA 3MRXA 1T9KA 3DL0A 1AHPA 4QWWA 1JYFA 5JRDS 1H9CA 1CDEA 1W0CA 3EBOA 3HYLA 4TLDA 4UVIA 2W2KB 5BN5A 1LF0A 2AT1A 1DNPA 3GLTA 4KO3S 3DC7A 4WOJA 3MJSA 3T5CA 5TJHA 3S5UA 3PLAE 4X1IB 4QQKA 1N2CE 1HF3A 1C9EA 1WRBA 4BZZA 4QJ4A 2WIBA 2Z5VA 4KXNA 2W93A 4QRDA 4UMEA 4BMCA 2XTAA 4HJRA 3V9PA 3MTQA 1FOEB 2MSWA 4F4CA 4KLAA 4HQ6A 3VUEA 1A82A 3VFDA 3ZNPA 4JI8B 5KYNA 3NHRA 4DR4B 2QTWB 1YMUA 3ETLA 3NBKA 4LYFA 5J2TB 1BCRA 2KLHA 5DEIA 4MQFA 4ETMA 5HKKA 3RAFC 2ZSHA 4G5YA 3P9XA 1YZ3A 2LKCA 3ZLUA 2WJJA 1DBIA 4NYIR 3HH8A 3RRZA 3U3OA 4JP8A 3ZBTA 3NC1C 1HMPA 1P4JA 2WOOA 1ZPDA 2WKRA 3SQMA 4ATNA 1WUYA 4MOWA 2H31A 1BHQ1 1TIBA 1ZK0A 2AFIB 1JLRA 1QGUB 3GLFB 1CB7A 2DKOA 2GBGA 4I5GA 5H9VA 1N0IA 3ROFA 1WQ3A 4EFDA 1KKUA 3W5SA 5LL6P 4WK4B 1PJLA 5JIBA 3LH5A 4FMDF 2ENWA 4DJJA 4O1MA 4BCBA 3ND8A 3W6PA 3AO0B 4CKWA 1XXHB 4ZT5A 3TB4A 1BJTA 5CBKA 2ZWOA 1L5WA 2A5GA 2YRXA 5LB2A 3W5HA 3LVQE 3IBSA 2IXFA 3RYIB 2YVAA 1N5JA 1T1SA 4MYUA 3QSYA 1GFSA 5DNUA 1L5HB 3PX7A 4FSDA 5IM5A 2OQRA 4JN6B 2JEZA 3SMVA 1NBMA 1B8UA 3K72B 5ITZA 2FA9A 2ATVA 4ZVUA 3SR4A 2Z6UA 1YACA 3JQ8B 3L7YA 4YYEA 5CEEA 2R8PA 4Z4EA 4AZ0A 2OHGA 4CCYA 4KQEA 2EKDA 1JVSA 2OAQ1 1WSBA 5C5IA 2WQ7A 1SKAA 1ISPA 2FSVA 2J32A 2AFIE 3VU9B 3PUWA 3GLFE 5TPZA 5LM3A 3CY6A 2PMFA 3KYDB 3ZW8A 1LLDA 3ZZUA 1F0PA 5JXWA 1DAHA 3CIFA 1ZEMA 5F51A 4S05A 3ZV6A 1PWXA 2OG1A 5DNVA 3VV3A 3ONEA 2EWMA 1OT3A 4RTKA 1WKVA 4BMXA 4U39A 1II9A 2RHCA 5BWMA 1UT6A 1KBOA 2UDPA 1R0SA 4KFTA 4RVFA 4UM8B 3G5UA 4YRTA 4P4UA 4UNSA 5BOSB 1M75A 2QAIA 3CONA 4M2LA 4LE1A 4L1KA 1O8BA 2BPOA 3V4LA 4C4AA 2GVNA 3FSGD 1TB4A 4UTOA 1MTOA 1UJ2A 5BO5A 1EQ2A 5AUNB 4CKZA 3IT1A 1X94A 3AGPA 3IMEA 4BO8A 4IXTA 1XA3A 4KDEA 1XZCA 1BOFA 3GU3A 3NDPA 3CXRA 4JGGA 2W90A 3WGOA 1OTHA 1A9XB 1EB8A 1B42A 1NKVA 1SURA 5G0VA 1NF8A 3TIXB 1GPJA 1RAIA 1L5NA 4EW1A 1D07A 1BDJA 3RTBA 5BV2P 3JQFC 4MP6A 3D6NB 1L4BA 3L2OB 4GGMX 1TKCA 2O59A 2HU7A 3Q7PA 4FD3A 1MQSA 1RYEA 1R18A 2ATEA 3HCFA 1U1EA 2P2CA 2H16A 4HATA 3ZZTA 3CTMA 4HR7A 3OJXA 2OAP1 5DOZA 1LQUA 3WL3A 5AKJA 2NU6A 4CKCA 4LVNA 1XFDA 2O1XA 2NQTA 4O4LB 3V8VA 1HTBA 3RS4A 4DC0A 4JJ6A 5MGNA 5FL7D 3RVLA 1X2EA 3LRXA 3OTIA 3WYCA 4C2UA 3RS9A 1JB9A 2HEIA 4IY1A 5CK5A 1MC1A 3R1IA 4JIMA 1UMCA 4A8JA 3QLUC 3WJ2A 1JKJA 1WQ4A 1KYWA 3ZI0A 4Q39A 2XE6A 2VDQB 3QY9A 3TCKA 3DWIA 2P9HA 1NY5A 3GG2A 1EK0A 3EQZA 1FYVA 1OH5A 1Q77A 1VECA 4MUBA 2EJVA 3UATA 2W37A 1ZVQA 1E2FA 4U3JB 3GD7A 1I1HA 4IHKA 4IP0A 5BSEA 5C53B 1G5RA 2JZOA 5LD2C 3GZJA 2DHEA 4OLHA 4M55A 4RULA 4CNBA 2XBMA 1G8FA 1V3TA 1W9HA 1TQ4A 2RHDA 2QM7A 3VHQA 3Q5DA 2VLIA 1SKBA 3IC5A 3KQLA 3GAFA 1GU1A 1YONA 3L5OA 1TUBB 4KNVA 3EQ8A 1W85B 2Q5EA 4TVOA 1MX3A 1XD2B 4XJTA 3R7NA 1E3TA 1JT2A 1N0VC 3C5CA 3CKYA 4EY3A 3AX6A 1HOXA 4O4HF 4EEZA 3AJ9A 4A0RA 5K8LA 1M7BA 1ZN2A 3D7NA 1YBMA 2XWPA 3LVBA 3PC8C 4KP7A 3LX8A 4LQ4A 3RUHA 4BTEA 3R7BA 5HKKD 1VKOA 2RAVA 3IB3A 5D5QA 1UM8A 1XAGA 3FJOA 2OWDA 3TSYA 1KP2A 1ZUIA 3HYRA 2YOHA 4YUXA 5K8JB 1E9VA 1I0IA 1RWBA 5G53C 1NJGA 3BXHA 4ZKDA 2VJOA 3I76A 4A0HA 5HYVA 1UC8A 2NQ8A 2R62A 3BFXA 4LBVA 2WAXA 1BHSA 1GXSB 3EXHB 4G8DA 3DYIA 4G0YA 3K2IA 3L8FA 1S7GA 2G67A 1FNDA 3PNOA 2O7QA 1VPVA 4HB2A 2XAAA 1CDOA 3F1KA 2FOIA 1RP1A 2C2MA 4JI1B 4WECA 1MORA 3LDUA 1FXWF 2EZ4A 4IJVA 5HBRA 3IE1A 5KVQA 3OQ6A 4GUAA 2JARA 2O0LA 3AESB 4KGZA 4LYJA 3VHRA 1B6RA 4YACA 4ZFNA 2DJIA 5K0ZA 1IB0A 3CVOA 1D0IA 2K2QB 1IPEA 2C5SA 1GPH1 3QU4A 4X6XA 3VXKA 4EMTA 1PK7A 2WB2A 2XXBA 1P7ZA 4BMNA 5CX1B 4E2WA 1L7DA 1P4RA 4CI9A 1VSVA 3QVTA 1XD8A 4R8KA 1V25A 2FQQA 1VPDA 4QEKA 3EZGA 3B8EA 3FPLA 2HTFA 2G5CA 3FKSD 1JDSA 4WESB 5AKHA 3TLJA 3ZXIA 2VDOB 1NBMD 3KQMA 3LQ4A 3M3PA 3W8FA 2EP8A 1T4CA 1U7UA 2FSPA 4DCVA 4E2XA 3GGJA 2Q8NA 5K8VA 3QNMA 3I62A 1IK4A 4G24A 5LYJF 1CEQA 1Q74A 2PYDA 2WTNA 3GF4A 1FNCA 3ORQA 2B61A 3AOGA 3Q40A 4KX3A 4O2BA 4PLHA 1JQKA 1BS2A 3RNOA 3FTDA 3SYTA 1QPGA 1XEWY 1KWKA 2CLMB 1BA3A 1NW6A 2ZSIA 5TRTA 1JR3A 5TPZD 3VAZA 5HJ7A 3QE9Y 4NYMR 2ZIGA 4TLBA 2NTEA 4UHBA 3IQEA 3VI4B 1OBFO 4PFKA 4ZCTA 3R40A 4J6EA 4S1PA 3BICA 3PF9A 2CN1A 3CM0A 1G3QA 3MWLA 3QQ5A 2DHQA 4NATA 4REOA 4ZU3A 4W5QA 2KX7A 3MAGA 3O4VA 4D9MA 1KQPA 2QTLA 2V59A 4LRXA 1AGXA 4DSTA 1BSVA 2IU6A 4Q3OA 1KFJB 3FDIA 1KGSA 3OIUA 1WVGA 4B3CA 1Y6RA 1L3CA 5ARBA 1Q16A 2VPPA 3KDPA 4CMEC 3LKZA 1X1EA 2A1TR 3KSBC 5F7JA 2WF6A 3GYBA 3A4TA 2WWWA 2QMOA 3M6VA 4K9MA 2C7OA 1CUAA 2GKSA 3GAZA 5G3YA 4OYHA 5C1OA 4I81A 1OX4A 2QRUA 2DFTA 4CF4A 4CM4B 1UC5B 4MHSA 5G41A 1U1FA 3IEIA 3T4UA 2DLCX 1N3LA 5AUOB 1H2WA 2B8WA 2FKNA 2O5CA 5DHFA 3LLCA 2E6UX 3GGOA 1VA4A 5IBPA 5L6MB 1P17A 4X54A 5LMUB 5KOJA 1AM4D 4Y2XA 3WA7A 3U56A 5ELLA 4MHOA 1O77A 2AZDA 3R0IA 5C8YB 1YQGA 4LZJA 4YLYA 3OPYB 1G9SA 4ADSG 2I7VA 1IQPA 3AR7A 4N3CA 1RZVA 3IBGA 4PLZA 5DPMA 5EXPA 4BJ3A 3IVRA 2GPBA 3I83A 1CZUA 3OZWA 4K2AA 4Q82A 1QMPA 5I45A 1XTUA 3ND5A 3V4SA 4LOKA 4IX9A 2G1AA 1L4UA 1SQ6A 3S81A 4RMJA 2RGWA 4ZCSA 1SUAA 2VK8A 5JNVA 4FMCF 4ZQEA 5DXAA 4V03A 1WUIS 1FYFA 1IG0A 3C3AA 3E0QA 4KB5A 2CLIB 3TRDA 2F9MA 3NHMA 2OHIA 3QV2A 4RPCA 2HOQA 2G9UA 4Z2AA 3UCEA 1JILA 1R64A 2O8BB 3DE3X 1N4DA 4AY2A 1DXHA 4PYQA 4RANA 4N0QA 1Y9AA 3IB6A 3K2BA 5EQJB 1NJ2A 4UTXA 5HTKA 3A27A 3PXEA 1K8XB 1KP9A 2IZ5A 3D3EA 5JSKA 4V38A 1AVTA 3DE4X 2NZ8A 3NAQA 2OGZA 3JVDA 2E4AA 4XVHA 5A06A 4G2TA 4Q7QA 5FPQA 1NBIA 3LC2O 2D0DA 4YUAA 3Q9LA 4M37A 5F76A 5B7GA 1Z06A 4RVCA 4ENUA 1J8QA 1QHYA 3WLJA 4BRWA 5JD5A 3BMOB 5EHZA 4PC3A 3MBOA 5IJWA 3AR9A 4C5AA 4LJAA 4P7FA 3QE4A 4XDGA 5CT9A 3RSLA 3A6JA 3BB3A 4IEFB 4IKEA 2OV8A 1VGRA 4QOIA 2CZCA 2J9XB 2Q3JA 2O8CA 3NASA 1BU5A 1E2DA 1Y1KE 2HFJA 2IPAB 2O50A 3M6FA 4QO7A 1M7GA 4LV6A 2QJTA 2G71A 4IO1A 1R9MA 3ES9A 5DP1A 4F5YA 4OGKA 2D1SA 3GLIA 2X6TA 3EJWA 1AK1A 2DZDA 5FTWA 2ZYSA 1U0HC 2UYOA 3U44A 2QG4A 4D8VA 2V7TA 2VTBB 4NBKA 4B3TB 1E64A 3E6AA 2AR9A 4BAZA 3VSDA 2AMFA 2IH5A 2ZTHA 4EI9A 2ADFA 4OBWA 2GXSA 1XZBA 3L5KA 1Z36A 4LYAA 4ZT4A 3U3JA 1PV1A 1Z4NA 3U5ZB 3LY9A 4QOSA 2WSSA 2BTEA 4MJ3A 4BV8A 4MXDA 4WXRA 2FPLA 3SXUA 4HQFA 1F2UA 5BY2A 2CYBA 3KOYA 4LVCA 3AQIA 4W8GA 1AU9A 3MMPA 2IEIA 4W6ZA 3EIFA 4I1VA 4NZMA 3KK0A 3OZVA 3QA9A 1AK9A 3AL2A 5ALRA 5I5GA 2ZJ6A 2ONJA 5IXYA 1JG7A 2GAOA 5JCOC 1P2GA 4EY4A 1JR4A 1I2BA 3DCIA 4G8BA 3GDWA 4R9RA 2JGDB 4IO0A 2ZETA 4CGYA 1P1JA 4B8YA 1NL3A 1KPGA 1QE5A 1AO3A 2FZLA 2QPLA 4HY3A 5L3SA 3C0KA 1JR3D 3QIAA 3JD1A 1OX6A 1E9DA 2IW3A 4ZAGA 1D6JA 1KOGA 1GTVA 3MTIA 3PPVA 3RT9A 4BO2A 1NQ5A 5F3RA 2RG7A 3EH1A 3KOXA 3MVEA 2E82A 1IZ8A 2G17A 2H07A 3LOQA 2OZLB 4QATA 2IL1A 3HABA 1NRXA 5BWLA 2WY2D 3G1TA 4CF3A 3LP8A 2ZYIA 4HL6A 2Q4BA 4O4LF 5LBTA 3VPHA 2BELA 4BKOA 3U7QB 1KVQA 4HAWA 4CM3A 4OQPA 1A69A 1R66A 3KQOA 5H83A 4BYMA 2PH7A 3CRVA 3EMKA 3IOYA 3BWMA 3L92A 4IXNA 1ZL0A 3SBXA 1ZJ5A 3VR4A 1FLVA 4UXJA 1Q7RA 1KYVA 3ZDBA 1FTGA 3HXOA 5M04A 1U5CA 3IH5A 1KI3A 4Q7MB 2R65A 2HIAA 1CUHA 2LCFA 3P0EA 3I92A 3QKUA 1BVYF 1WUKS 4PE5B 5J59A 1RMYA 1L1EA 3X3HA 4XSGA 4KPEC 1KWGA 2ZSEA 1TF5A 1GFIA 1LLQA 2F1JA 3OUTA 3DMTC 4U2BA 3WIOA 2NXNA 4MR7B 4F21A 2EX1A 4TPKA 4EG3A 1U0NA 1TTPB 1YR2A 2VPQA 4L16A 1CYEA 1FDUA 2BDEA 4K9LA 1VLMA 1DJPA 1BXZA 3PXDA 4XLZA 4BU1A 1Y37A 1SCUB 1J42A 2ALJA 4B3XA 3FPEA 1IK6A 3EUEA 3NPAA 4QYWA 3KR2A 4C7BA 2WFLA 2RGNA 1RKBA 4XZ3A 2BGRA 5FYDA 4R5HA 3EXEA 5JDIA 1V5IA 2CMHA 3G7SA 2HWYA 4DTCA 1FRZA 1PSWA 3LHSA 4K05A 1DHRA 1QHIA 2R25B 3EMBA 3A32A 4NAUA 1WPGA 2YMLA 2HZ7A 3MUOA 3KVOA 5IVPA 5ED4A 2WWIA 4AVYA 5AKZA 4GLJA 6YASA 1W581 1DOZA 2I6FA 3SIXA 3H4IA 4PYOA 4CMKA 2TECE 1S2IA 3BGVA 3ZWXA 2W6NA 2ZYDA 1BDIA 2QIPA 3ESDA 4OK6A 3CF0A 1WUJS 4D0GA 2VYVA 3UJ7A 2BKXA 1KZ6A 3KLNA 4WZZA 4PZUA 3ZU4A 2DVMA 4KLZA 4BV3A 1OLUA 1QYIA 3FUCA 3IAAA 2BE7A 3C5HA 1VLLA 3ESBA 3R6TA 2HQSA 3MUFA 4B33A 5C3MA 1D04A 5KNDH 1KY4A 3I5XA 5EJ6A 4D0NA 2JA1A 2B2CA 1NQOA 2QN2A 3KTAB 3NXSA 3WJAA 1DCFA 4UAVA 2XVXA 4ENSA 3OTOB 5E0KB 1QVRA 3C1AA 1CY7A 5B55A 1CR6A 1K6MA 4EW2A 3NBZC 2JEOA 1FPQA 5ALGA 1CEXA 1I3OA 5AKGA 1CERA 1C4OA 1RYYA 4J29A 5G0SA 4UVEA 1NBWB 1V1JA 3DO6A 4NIMA 4H7FA 1ZGGA 3I2HA 1YRAA 2J09A 1AKWA 2ZUWA 3CUKA 2I76A 3UQYS 1T35A 4A92A 1OLSB 3DZHA 3RC7A 4BO4A 4F3TA 4EJ0A 5ITVA 1MO6A 3OPQA 1PJ3A 3KPVA 3RSZA 3HXQA 3FTQA 2NV2B 1IXSB 3N07A 2GTPA 1SU7A 3QKRB 4RAQA 1OXMA 5J9FA 1J7JA 2CCGA 3GNTA 4JITA 3UAYA 2AQIA 3CZ4A 1KTVA 4BMDA 4F3YA 2F2TA 3CZPA 1PBNA 2C58A 2VBCA 3E82A 5K4HA 1IUKA 2VJMB 1KYIA 1MB0A 4EJSA 2VLBA 4FT2A 4C07A 1UBJS 1JFVA 1YRLA 4OGGA 3ID6C 2DH6A 2D06A 3QXHA 4Y2SA 5HQJA 1KL7A 3VC2A 3WRWA 3AF1A 2DT8A 9ABPA 3ROMA 5CA0A 3SYRA 5K0GA 2WSSD 3EBLA 5JYBA 1A8PA 1N0WA 3K0FB 2WJ6A 3LFUA 1T8WA 1UFRA 4NDAA 2IEGA 4IMJB 2PKCA 1ZUNA 4HAIA 4RJ2A 7REQB 4M0MA 1JAYA 1C3VA 1H4SA 3TBKA 1AT1A 2VP4A 4YJGB 1BMFA 3MFYA 1JGTA 1QHHA 1U1CA 3Q6NA 4GVXA 5CGZA 4E2ZA 1F0KA 2EBFX 3HEMA 3R0XA 5EMLA 1EFAA 2AOXA 4NR0A 3RIMA 2IP2A 2GJAA 1UMKA 1SZCA 3DEAA 4J4TA 4YO7A 1XLTA 3P97A 3PR2B 3V4OA 3RASA 1C0EA 1N2JA 4BFWA 5AHWA 3VZPA 4BASA 1PJQA 1DAFA 1Y3CE 4TTTS 3WHKA 5HSGA 1Z73A 1MNAA 4J0HA 2PYZA 1PR2A 4R3NA 4RCVA 4GMXA 2ZUCA 3TKAA 3MQ2A 2UZ3A 4TLLB 1SG0A 5AQEA 1UKBA 2GNAA 1DCKA 2ZR9A 4C4ZA 1USKA 5ENDA 3D3WB 5KOIA 3OZAA 5CVEA 1AXRA 3C70A 1P1KA 1ZWKA 4HGYA 4W7SA 1LTHR 1ZM2A 4BCCA 1X42A 3CURA 3NBYC 1INLA 1US8A 3O8CA 3DPSA 4ZYUA 2NVWA 1GDHA 1ODTC 4Q16A 1K75A 4RF3A 1JDBC 1YGYA 3AY6A 5E6UA 2BMJA 3ETJA 3VR4D 5JH7B 3KYCA 5TDHA 3TK1A 1T9HA 1AIPA 3B6ZA 3IKJA 5CCEA 1EGMB 4UAUA 3L6BA 1NAHA 3IIMA 3WGNA 3CR7A 3MWDB 1KEEA 5DCLA 3P9NA 4D74A 2X4LA 4BC1A 2F1OA 1I30A 3DVLA 5H4HA 4ABYA 3N0TA 2BKUA 1U2GA 2ZB4A 3PPIA 3S2FA 5IJ9A 3PUIA 3MCTA 4RLHA 5KBYA 2WIFA 4IIVA 3NWBA 1VL1A 2JH3A 3CLUD 1G17A 3RF7A 3WFIA 1IBMB 3T0FA 1SQGA 2C4NA 1WEKA 4O6VA 4IFTA 4JCCA 4OMCA 3O83A 5ESXA 4IIHA 2PZ8A 2DR3A 4MB6A 3UHAA 5A5DA 3QBDA 3INRA 2QXUA 2DFDA 1VJ1A 2I4OA 2HUPA 1GPWB 3DSRA 3Q0TA 3PQFA 4GWKA 4EJ6A 1BVUA 3NJ4A 3A1NA 1AE1A 3L05A 3OD5A 3TBFA 3WK5A 5AW6A 1BS1A 2VWHA 2GDZA 4BX0A 4MYDA 4R1QA 4QKQA 1Q0LA 1A04A 4L75A 4OXXA 3SHWA 3FWPA 3LTEA 2VNKA 3TQSA 4FX5A 3OFKA 4AWBA 1H2AS 5KINB 2E3JA 4X00A 2ZBDA 4EYGA 4YMHA 4CL2A 3IESA 3C45A 1XVUA 4ABTA 4X61A 4FXPA 4NP6A 1NUSA 1Q15A 3T5DA 4B47A 4WADA 1BE6A 2VKTA 4Q7KA 4EVIA 3SC2B 1LJ8A 4UPDA 1PIWA 1FLDA 4V0OA 2NU8B 3VR6A 3TQTA 2HCRA 2VYVD 5BNIA 2ZZMA 2NTVA 1OV6A 4KSBA 5HFAA 2P90A 3DBHA 4ESVA 5LWHA 5FWYB 1H1DA 4D4JA 1KI9A 1IDN1 1EINA 5T7BA 4M0FA 1ZESA 1GA1A 1YQQA 2IEAA 5LKRA 1SCJA 1Z0JA 5AM5A 4OJMX 2EATA 1GG2A 1YOVA 2CNBA 4M60A 3DT9A 4ZK2A 2PMWB 1GQ2A 4HPXB 4Y1FA 5CDUA 1R8YA 4N54A 2CC2A 5ESRA 4CIWA 1DX9A 3FNFA 3LLMA 4LJ7A 3AR8A 1NMQA 4X1KA 4YJHB 4INJA 1ZOLA 3HGQA 4P86A 2D1TA 1DG1G 4JP2A 3R3VA 2BSXA 2PWPA 3HN6A 3JAWB 4HFNA 3QYFA 1J24A 1PR3A 5IKOA 4K9OA 4PM4A 3RVMA 3PEUA 1ORHA 2C2BA 2XMBA 5KQPA 3RVBA 2COEA 1ZMXA 1TPYA 2VXCA 5CFZA 1RCUA 2AJ8A 2Q29A 1Z6QA 1OZGA 1X86B 2CSXA 1Z4MA 3RC2A 2GARA 3FD8A 4N9QA 4HNRA 1X1SA 2XZDA 1LBTA 3U4HA 4CM9A 4DBLC 2I4TA 1R5BA 1Q1NA 3CTPA 1NW8A 4FXOA 5JFTA 1IN5A 1M76A 2D3TA 3HV0A 4ZAYA 4NAVA 2AXEA 4HZUB 1NX9A 1SUWA 1T24A 2YRFA 3DMNA 3AF5A 1KY5A 1ADJA 3V4ZA 2PANA 4UZSA 3H42B 1KNQA 4JI2B 3DF7A 3MWEB 4BVKA 1EJBA 4IV5A 2GH1A 1BMFD 3DFUA 5KYYA 2VA8A 2QE6A 3O3OB 4BB6A 2FHSA 2CJWA 1NT4A 2UZ1A 4PHFA 1G6Q1 2R87A 4UFOA 1ND6A 1Z4OA 5SYNA 3FDZB 4NQRA 3AF0A 4TXMA 5DM4A 4CLXA 2YJ3A 1CFJA 1QGZA 2YZGA 4JH0A 3KB1A 3FMPB 3AP3A 2XDYA 1DBPA 3I2FA 2C3MA 4I5DA 2PZBA 3RFVA 4ZZ1A 4K9RA 3RBZA 2N46A 3EWIA 3MEQA 4LYDA 5ANRB 3A9VA 1SVSA 4HLCA 4JYPA 5CG1A 5JEEA 1O4VA 2GZAA 2OK8A 3BQNB 4QDJA 1T3ZA 2JEYA 5D3ZA 5KAMA 4BLOA 4ZXPA 4C2AA 1RQ2A 2NO6A 4HP8A 4N9WA 4PONA 5CDGA 3THWA 2W6PA 1UOPA 1XRMA 4H6PA 4NYMQ 1Z3CA 1JDZA 4F5EA 3AHDA 5EWMA 1I7LA 1L5FA 4HXYA 5ABPA 4EKEA 3OURA 1G7SA 1TCUA 1VDMA 2NOAA 3OP1A 2EFGA 3PIRA 4KH0A 2FEMA 1L7MA 1X3SA 1Q2UA 1XX6A 2PKYX 3VZSA 4BLUA 1GQSA 4WDRA 4EUFA 4AMGA 5D84A 1E2IA 3PNPA 4YGYA 5DIFA 4BN0A 1GAEO 4P8RA 1CNMA 3T3PB 3E3NA 4Q1DA 5F12A 4AJHA 2BKAA 2OCIA 1E62A 1U2QA 2ZVDA 3K73O 2FUG6 3I9NA 5D2CA 2V4MA 4CF6A 4CGZA 4AG5A 2VQSA 3P45A 5J23A 4H60A 1PDOA 2XA9A 3HKDA 1DL5A 3ZS9A 2AUTA 2ACKA 5ALSA 1E98A 1SCQA 4AJEA 2PKQO 2VP5A 5A2GA 1N2EA 3ZV7A 3ZJTA 4BKQA 2BEJA 4GI5A 1B23P 4HZIA 1WHSA 3MT9A 3W9UA 1FSFA 2R8OA 1XR3A 1Q7EA 3MLAA 4Q3EA 3RHFA 1ZGHA 3OZUA 4OG2A 3GP3A 4R1SA 3UFBA 2CZGA 1LLUA 3VOBA 3U31A 3THYA 2OCXA 3DMRA 1EEHA 1N32B 1NULA 5BMVB 4YEDA 1RCFA 2PRIA 3UHOA 4DUYB 2TMYA 1E5QA 3AV3A 4ND2A 4XWGA 3TLAA 3V33A 1TRKA 2DPYA 3H5TA 1P6UA 1XMPA 2VP2A 3L1VA 5I5EA 5TSDA 3L8HA 1YS6A 4FW9A 4MKRA 4OYYA 3K70B 1BS9A 2G72A 3FMOB 1D2EA 1KMMA 2FPWA 3GFGA 1C4KA 3HJCA 4K88A 2NSDA 3ZX4A 4EB6A 4EUSA 1MAUA 5FNVF 2FMHA 1JG4A 2FFAA 2AHOA 3DZJA 1OU0A 4JJEA 1E4VA 3OLCX 3Q7RA 1R4NA 2EL9A 4PPFA 4REQB 3EIQA 1H42A 1JTVA 4N4AA 2Y99A 3CH5A 3C7TA 4KXXA 1E9FA 4N12A 3K8YA 3FUUA 2JIPA 4BVAA 3OKPA 1DEKA 3UCFA 3USCS 2OTCA 3PRJA 4BMZA 1WZNA 4D1YA 5ICEA 3CVJA 3EMVA 4AURA 3HEBA 2O6LA 2VDNB 2ORYA 4UTZA 3FVRA 1GY8A 1R9GA 1L8QA 4UTRA 2ZBQA 3OUUA 4E08A 2HX1A 1JTEA 4LXTA 1GGMA 4ND4A 1XQXA 1P9OA 4Q4AB 2PU5A 3CH6A 2O4CA 2K5UA 3C6YA 3C7KA 1X7XA 3I23A 4NZPA 3O0TA 1V2GA 3PJGA 1QK5A 1AKNA 1D7OA 4XWWA 1CULC 5IC6A 4BQIA 2MHCA 1EHIA 4QG7A 5D01A 1QP8A 1Z5NA 3HFSA 4YUWA 1BEZA 1SCKA 4US1R 3MD0A 5GOTA 3A7EA 3BEOA 1MJNA 1K4YA 3LNTA 1VKJA 1XJWA 2ZT8A 4MW4A 5FA8A 3WE7A 4BE9A 2FETA 2NUTA 3FRHA 4CM9D 1DO2A 1U3GA 1EWRA 2Y05A 3GJYA 4TMWA 5L40A 2PJUA 2GLTA 2WU4A 3KWFA 1W4AA 3E1GA 3WG9A 1FXSA 5LZ5A 4D0RA 4ZCIA 4JKOA 3KJEA 3QEAZ 2XCSB 4Y7DA 3ZVMA 3GZNB 3WXBA 1EMDA 4CJXA 2OO5C 1SUBA 2VCEA 2PS1A 4QHYA 1KJQA 3I6ZA 1GA4A 1C3OB 3QE2A 3VV2A 4B4UA 1MC8A 1YL6A 3PDJA 4E5UA 1HLGA 1MX1A 3C2QA 1VPWA 2B94A 2OP1A 3FMIA 3WNQA 5JH7F 3U0BA 4KPUA 1HNXB 1NWCA 2I66A 1N5IA 5CXSA 3ZD7A 2AKAB 3KM0A 4J0EA 4DDHA 3OAAA 2XJ9A 3ECAA 4F46A 4JEIA 1UOEA 3W2IA 3ELUA 3C3DA 3B6IA 1Y8QB 4X7MA 4J4HA 3V3TA 2Q2QA 1HH4A 1OFUX 4P4SA 4UD6A 2WK1A 2XRYA 4ZP1A 3UWDA 5BV7A 4KAXA 4IRXA 5LBIA 3MXOA 4GGOA 5BV8A 2RI6A 4MWOA 2BM1A 4L6AA 3ZKAA 3PXGA 4ZI3A 2R5NA 2QVZX 4GAEA 2PPVA 2VSOA 5IVHA 1M8FA 4LBYA 4YXFA 4E5SA 3AG6A 1U0GA 2AK3A 3CG4A 4KK4A 3LCUA 5JPCA 5DHSA 3Q8XB 2OQVA 3H83A 3R6LA 3CVXA 3DJFA 4M1YA 4JXKA 4X94A 2D6FA 1D03A 3QOFA 2FR0A 2A84A 3ROEA 4D97A 5IAAA 4B2LA 3KBOA 1ZNYA 2EX0A 5DEOA 3MGAA 3WQBA 5FI0B 1VDZA 3HPQA 4P6VF 2PL5A 2HCBA 3VNAA 1Y34E 1Z39A 4H4CA 3UV6A 2EIHA 3ZEAA 3AKCA 4AKGA 4GQAA 4FFVA 2YDYA 1M2OA 3V4FA 2EJCA 1BZYA 2W2TA 2XXJA 1KIMA 3HHPA 3U9TA 1LTQA 2C03A 3K5PA 3N70A 4HOYA 1GPLA 2RHMA 4BMOB 4CM1A 3KETA 1ODJA 3CPEA 1GCUA 3IOCA 1EPUA 2FGJA 3D7MA 3HB0A 4IVQA 1H5QA 1UFOA 1SELA 3PE6A 3FW1A 4QXRA 5C34B 1OXUA 1G8JA 1VIDA 1H05A 4NFSA 2YN4A 1TMYA 5J4YA 3MS2A 1BFUA 2B8EA 3D8UA 2WFAA 2PVPA 4GMGA 2J9FA 1JNXX 3E61A 4G3XA 5KMGB 4IOMA 2YXLA 4I3HA 1Y33E 4INZA 3AK4A 3PDIB 4Q7EA 2R7LA 1TL7C 2ZJ0A 4MRMB 3HB7A 3DHEA 2IKQA 2JBAA 3TFOA 1C7FA 1Y1RA 3MC1A 3PFCA 4DA7A 1XFAA 1TM4E 3CLSD 1TDJA 2XT9A 3TAXA 4E4RA 4NULA 1P1IA 5FWNA 5BYKA 2C20A 3ZYZA 5DBGA 3HGTA 1KRHA 4AJ4A 4BC0A 1ZUHA 4NQZA 4Z86A 4DCCA 3E7PA 1T36B 4JLJA 3G68A 1V5WA 2A2ZA 1RWXA 2JFFA 2VG8A 3UYKA 4DPMA 2VRNA 3BXEA 2QMEA 4N5HX 1XDBA 4HNSA 4I4IA 4IDHA 2ZRIA 3GP5A 4JNCA 4WCFB 1J0CA 1P29A 1O2DA 4BGUA 2GBIA 1GPKA 2WF5A 3OMWA 4BB0A 1DTWA 4ZZ0A 4R2WA 2HKIA 3VNBA 4B83A 5CITA 1TC1A 4Q4CA 1W36B 3D5EA 4Q4HB 1BX0A 3PPWA 4BPRA 2OMKA 3F6YA 3G9ZA 3SLRA 2QIOA 3DKRA 4ED9A 1TA4A 5KKCA 4LKOA 4V24A 4L0CA 2FRVA 3Q85A 3TPFA 1NATA 2KE5A 3WV4A 1ULUA 4TM8A 3ZHRA 3TEMA 2RGBA 1W25A 3KPJA 1M0EA 3ACBA 3TEFA 2HL6A 3PEYA 1FMJA 2OHVA 1EFRA 3L7NA 2NNWB 1V39A 1AS3A 1DFGA 1BD3A 2GQ0A 1BD4A 2CL6X 2XV1A 2ZRCA 1QIIA 3NDRA 2ZI9A 4R9VA 4AY3A 1I5EA 1WULS 2CLCX 2HDNB 5AIAA 2RI1A 3KZ1E 1DJOA 3RRYA 1TYBE 5BURA 4WOCA 4DMGA 5HKOA 5EJIA 5AXCA 5JZBA 4Z8YA 2C9BA 3NT4A 2WD8A 2XOEA 3NUGA 5AJXA 3DTVB 4A82A 4J0JA 3FYUC 1K5DA 4KN5A 4RA6B 4C6SA 1O94A 4QYIB 2BFMA 2VHUA 2WSIA 2GAJA 3QBVA 4OQFA 1OC4A 1X1AA 1WWKA 4S0ZA 4D92A 2CJPA 3U49A 3UK7A 1N33B 4KZKA 2XNSA 2MWMA 2O05A 4E70A 1N2IA 4G0XA 4L5AA 1LI7A 4N6OA 4CUKA 3IODA 3ONDA 1U9JA 4MS4A 3BCHA 2NO4A 1X0XA 2C96A 1TX4B 2BV3A 3QK7A 4IQ4A 2QU7A 1ADYA 4MUFA 3WRYC 2Q5JA 3N76A 3O8OA 2BR4A 3OPVA 1MRNA 5IKPA 3P9CA 3LPMA 4FBLA 1VCMA 5L3ZA 3JQRA 2V7UA 3JD2A 4V0LA 1GQYA 1RJFA 1UIRA 1T3SA 5EUCA 1FMLA 1V9CA 3N0RA 4MZDA 5DGCA 3PGKA 3OAAD 2ZXFA 5EQDA 5A5FA 4OSEA 1DKMA 3V8PA 4ZMBA 4N65A 3CKMA 4DLBA 4JOSA 4DSUA 2QOEA 4WUTA 1I3MA 2YIVX 5T6MA 2V1UA 2GFQA 1HFJA 2OHJA 1WX1A 4OX9Y 3LY5A 4Y6GB 3ZJ4A 3FOAA 4K6MA 2GLUA 1ACLA 1Z8NA 2FK8A 2QSUA 3T9CA 3I6YA 2DE0X 2VCYA 4R8MA 1ID8A 3F4LA 4BJ5A 3F6RA 3PJRA 1SU4A 1NSYA 2GF9A 1Y8ZA 5KYGA 5LZ9A 1E0JA 2ANCA 1YC2A 3WGIA 1TUEA 1KDPA 1MGOA 2QRMA 4V0MA 3VH4A 3TX2A 4CW7A 3X2SA 3E35A 5BMVF 4YCNA 2N1BA 4Q9DA 3MNFA 3UK0A 1T1RA 5DT2A 1SBHA 5JNSA 2QMYA 2I54A 3GW8A 1TVEA 2BFNA 5HKBA 1THTA 5CW1A 4ARZB 5LQUA 1DFIA 4QLOA 1G5PA 2BJHA 2IOHA 1RLJA 3H8WA 4JJ7A 1SC6A 4IV8A 3HHEA 2GWHA 1M33A 3N2GB 1P2BA 1Z6AA 3HQ4O 3RRJA 4OA8A 4QVKA 5DM0A 4E14A 4CCWA 1JKMA 2OGUA 3A70A 2R7MA 4EHAA 3PD1A 5EXDA 3DE0X 4NG4A 4D5GA 4BNYA 2C99A 2R68A 1IEVA 4K9NA 3R2JA 2P4SA 3R6GA 3ZV3A 1U5BA 2EJTA 1U8CB 1WHTA 3QZUA 1ELOA 1XTPA 4D8YA 2EOAA 2ODWA 1HO3A 1K6EA 3CF6R 4JP5A 2AG0A 4M0PA 4V0SA 1MN6A 4LF9B 4PZLA 1HZZA 1Z4QA 4HEA6 1LPNA 4DC9A 1POWA 5KVAA 3AR5A 4WBNF 3FOEC 3VOTA 3P2KA 5BR7A 4LTMA 3H5VA 2ZG6A 5D85A 4AI6A 1SU8A 2FLWA 1RYMA 5KUTA 4KK3A 5EHQA 1FFWA 3B9PA 3EEQA 2DSNA 4OB7A 1E58A 4EKNB 5JHHB 5EZYF 5AVWA 3DZCA 1GRVA 1P18A 2QRPA 2WIDA 3SDZA 5AVXA 2XCTB 4ZANA 3FIUA 2YICA 1EE1A 1CJUC 3AR2A 4F38A 1J5PA 4I8IA 2ESRA 4AJ2A 3LHKA 4G1EB 4X91A 1N78A 1C8BA 1MIOA 1N2XA 2P79A 1PJBA 4UVGA 5B58C 2WIAA 1MVNA 3TNJA 2AR0A 2F43A 3QVMA 3G2OA 1PJ8A 4Y0VA 3OKAA 1EFCA 4U0JA 3UB3A 1UBNA 1GCGA 3DKKA 3H7AA 5ALDA 1A8QA 3QKWA 1Z2PX 4CFZA 1A2KC 4YMTA 3P2MA 1OI3A 1OWMA 1QGYA 5B1DA 1P91A 1U6KA 4NV1A 3T38A 5A3QA 3GXOA 2R66A 3H04A 1Z4LA 4D4IA 3EVDA 4Q37A 2H3HA 1XPRA 4WNIA 2H08A 1NTRA 2ISQA 2OAEA 4XB1A 4KOEC 3WMEA 4BLWA 3NEJA 5FLEX 3UV7A 4EY6A 1HYGA 2VK4A 5HJEA 3RQSA 2QUAA 3R9KA 1JHDA 4KWEA 4L15A 4YAFA 1YCDA 5BRJA 4D6PA 3OJOA 3PNVA 2CXSA 4ESHA 1K2VN 2OT3B 1EFRD 4MA0A 4LDNA 3DTTA 1AZTA 1CVRA 2VYQA 2FWNA 4ZDKA 3QWIA 2MMGA 1B0ZA 4QOJA 1W4BA 4QT4A 1F8YA 2QE7A 4O4JF 5LA6B 1M8JA 1KOJA 2GXQA 2XZLA 4KE9A 4YA6A 5KTSA 4DV1B 2PL1A 5KC8A 1NQXA 1ORTA 1CY2A 4XX0A 3CW2A 5AI5A 1V4NA 4ZOLB 4NF2A 5FUWA 2C7VA 3ZXUB 1O94D 1AKMA 3FNHA 1C1YA 3LWNA 2B8NA 1CB0A 3MAJA 1U98A 4MQ4A 1T2UA 2KW5A 1C1XB 4LMBA 2JLCA 2XMQA 2GEDA 5INTA 1SUEA 4IFEA 4ZT3A 2GZ2A 3HU5A 3OEWA 2WYHA 3QBEA 4MYHA 4Y98A 3E5NA 1JWLA 3KDAA 1QUFA 5JYCA 4EYQA 1PCXA 2OBLA 2GUWA 2IXDA 1YZQA 4C04A 3MLBA 4DYVA 4R1NA 1ZU4A 4AY5A 1YBVA 4Y2YA 3BD7A 5JD6A 2ZBFA 4NABA 2H65A 2CMGA 4BMVA 2G5GX 1AZWA 3BE4A 4IH1A 4MTCA 2CXNA 4WKPA 3W3AA 2ZAIA 3BGOS 3T54A 1JQBA 4DAOA 2FVYA 3QMPA 4J03A 4QXAA 2RCYA 4QVGA 5EG5A 3AVTA 4F8EA 4X85A 4DIFA 3V7WA 5CBPA 2O8FB 4WFKA 4V1CI 1KMCA 5FXMA 2AN9A 2ZJOA 3TW8B 2HJ9A 1LLCA 1OLXA 5AR1A 2FN4A 4PWYA 3RU7A 3UMYA 3G02A 3AFGA 4TYQA 4DUGA 3CUTA 3E8XA 2YWDA 5CT4A 3SF8B 4QAJA 3VDXA 4CWAA 4E4YA 1U3FA 1JR2A 1Y5IA 5AT1A 3HE3A 4JI5B 1HQKA 3EFHA 1ODFA 1CJKC 1XP8A 3FPSA 3IKLA 4GF5A 5CNJA 2VP9A 2VP3A 3UGJA 4D9CA 1RCTE 2CHUA 2YJ6A 1KBQA 3PQ4A 1RJ9A 1KZ9A 4MICA 4R1LA 4BX2A 3VKUA 1KQ3A 2HJGA 1Y6QA 3I9V1 3LDGA 3OZGA 4Y1EA 2J59A 1YTUA 3VTKA 5EP1A 5U4XA 3LZ6A 1F8FA 4FYMA 1IN7A 4RSRA 4RADA 2QW1A 3LBFA 1CWUA 2BAGA 3QF4B 3U3MA 3OCWA 2K4MA 4WT7A 2RH5A 4I5EA 3H5OA 2FR8C 5AJZA 5SYAA 2JG3A 3JQGA 3ND6A 2DMRA 3JWGA 4RDXA 4WNAA 1C80A 1DBWA 2VIIA 2XY4A 3JZDA 1L7AA 1NAIA 1PJTA 3K7EA 3SC6A 3VZCA 4YJ2A 2HQOA 3VSBA 1YVUA 1NSFA 1VGQA 2XMSA 4XUEA 3ZCPA 4DCPA 1P60A 3JYQA 2IY7A 5EJEA 5KTMA 3PPYA 1NJFA 1FLNA 1VMEA 5EQFA 3EEOA 1NVVQ 5FI3A 4GI3A 1WCIA 3LCCA 4RD0A 3B1XA 3A1WA 4UJ5A 4E5KA 1MO3A 3BK2A 3OMLA 3G2MA 2VPZA 4KRYA 4C6TA 4C7JA 2CXOA 3KZXA 4YASA 3GQBA 3WMRA 4EG1A 1WXHA 2XCQA 5HUHA 2W83A 5FTMA 4PWZA 5E9WA 2FR1A 1PFQA 3K4QA 1USUA 3C39A 1TQ8A 1I6MA 1P7WA 1K3UB 1JFFB 2JH9A 3DBLB 3LIPA 4J75A 4RPKA 5DDIP 5JWHA 4B3IA 9LDBA 4EJ2A 1VJ0A 2JCYA 4B2PA 4UMDA 5HK8A 4CLRB 1FQJA 1AXGA 3CRW1 1H0RA 3G9QA 3V6MA 1WETA 1KERA 3DR5A 2XGOA 2C4MA 3ZE9A 5JSYA 4F97A 4H3SA 4PHCA 2GEFA 2PUVA 3W34A 2N3ZA 2MINA 3H2IA 3F67A 2O8NA 4I1RA 3LD9A 5E1OA 3QVUA 1L8AA 4UU1A 1Z12A 4G5OA 2X8AA 3PGVA 2VHZA 4WFQA 2CV2A 4D96A 3N2EA 1SPXA 1FRFS 1LU9A 5KU7A 5LUAA 4FYWA 1FX0B 1ZHFA 2P78A 3FLAA 3G13A 1NVVR 1DIAA 3BS4A 1X77A 2H3EA 2H2IA 3PHLA 4TTJA 1B26A 2WUEA 2PMCA 3DYBA 5TY0A 3RBXA 2EF0A 4LRTB 1K7XB 3H19A 4C01A 5BVHB 3DLPX 1YB4A 4BNNA 1RKVA 4GOKA 4GX5A 3FNRA 4FNGA 1UAAA 5ALUA 3WNBA 1QH9A 2IV2X 4JMLA 3UJNA 2QE7D 1DLJA 3T5MA 4GMFA 3K2QA 3QEMA 1HDZA 3BKXA 2DU8A 2CE2X 6ABPA 4J7UA 4ND6A 1Z16A 1U2DA 1HDXA 1CC1S 2FQ1A 1P7CA 4M1MA 4YH1A 1HYEA 3W79A 5K20A 2PGLA 1NVBA 4JHXA 4YIKA 2GCOB 2QQ0A 2PMKA 5EESA 4FZVA 2PBFA 5DP2A 5DO9A 4IDOA 4HMPA 4J0IA 4KCGA 4XWKA 1G7RA 3DP9A 1RZRA 4U8HA 4KVGA 4XDHA 2O3UA 1YDGA 4BS9A 1KRWA 1J0EA 4XLTA 1AO0A 3WP0A 1G60A 1W73A 4DV7B 5DTIA 1P39A 2I78A 1P6QA 1PO7A 4EECA 3RYCB 1WB4A 2Z08A 4RZ2A 5HM8A 3DV9A 4M6WA 1E7YA 5K6TA 3MOIA 1UM9B 2K7ZA 2G9QA 3NBUA 1K7CA 2KHZA 2IHJA 2YWEA 3KHKA 3RVQA 3W3AD 4UNIA 2AGVA 4ASUA 4TQAA 3GWGA 1OBOA 2FQYA 3ABQB 4OXYA 5DRTA 2EERA 3ZD8A 2H1VA 5E4JA 3QHAA 4DQDA 3MYYA 4P3NA 3DEIA 2PUHA 1B7GO 4HS9A 1U2PA 3W5CA 4FBGA 5JAZA 4BDSA 1JMYA 1KOFA 3FGPA 4DUGD 4HGQA 1U7TA 2JGAA 1SHTX 2ECOA 4KUHA 4NNOA 2SKEA 1KJNA 2C31A 4TUYB 5CJPA 3ITKA 5KWJA 1Y6GA 2O8EB 1TYEB 1Z0DA 3K96A 1HNNA 2FW8A 1QS0A 4G1VA 3QTTA 1U0SY 5EIFA 3EG9B 3BGDA 2BRUA 3RFFA 2AN5A 2QB5A 2XUJA 3X1ZA 1I24A 5A3RA 4PG7A 5A2QA 2HSWA 4EK9A 1IY0A 1KQGA 2WU3A 3DTYA 4N5NA 1KDVA 3T35A 1U63A 5GONA 1CXZA 1S3SA 4JOCA 2AL7A 2QG9A 3KBBA 3W9YA 3ESYA 4IIYA 4CMIB 1T0UA 2IUSA 2XKJE 5MN5A 4UQLA 1XL0A 3VX3A 5JAUA 3VVBA 4IUYA 1ISRA 1KHHA 4CG1A 4LCEA 1VHDA 4ZKEA 3CZMA 1ZXBA 1CQIB 2I33A 4CM5A 2R6HA 3GLSA 4U2DA 3HJBA 4QBTA 1S2GA 1DXYA 3BBLA 1H22A 5FOWA 2F8LA 5KB3A 2ET6A 4OM8A 3E15A 1AB6A 3OVMA 4TS3A 5KTTA 1QYRA 4XJVA 4LDAA 4Q7JB 1W49A 3RUAA 3F3MA 3WJ1A 3PEEA 5IT5A 2JI8A 1CRLA 3TRKA 1J2YA 1NWHA 3ML1A 3WLTA 2HMWA 4HT3B 3B70A 3JARA 4D9NA 1J2UA 1PI3A 2X5KO 3B6MA 3LQ2A 4RV4A 4R1UA 4F6RB 3FB4A 5DWDA 4EDFA 3WWYA 2PVCA 1YJ8A 2R4TA 4WNCA 1IBLB 5LA6F 2SHKA 4ZO8A 5A1JA 2PLAA 3R4VA 4RTLA 4XKJA 4XVCA 3P5BA 4RE6A 2LBPA 5FA6A 4QPJC 4UFPA 1UXIA 2IXAA 3WO0A 2TSYB 3KJXA 1JLSA 2AF4C 1XEAA 3RJZA 2R7AA 2F1KA 1GRRA 4KIGA 2UU9B 2IUYA 3T06B 1V4VA 3DLAA 1J2RA 5L4LA 3EZ2A 1U2SA 3DEJA 3BMCB 3CR8A 4ZTBA 2ENUA 1UPXA 2YN0A 3MMSA 4WLVA 3FGOA 1CIVA 4ROSA 3TSOA 2CJXA 5M3BA 4B7ZA 3IP5A 3BIXA 2QAJA 3NGLA 3FWHA 3UXYA 2LV8A 4RMGA 4GI1A 4U7FA 4Z3KA 5JARA 3RI3A 5HKAA 1UIMA 2OY0A 2OV2A 4FEAA 4A23A 2QAGB 3PL5A 3EAGA 4BFTA 4ZJUA 2P6PA 1W2HA 3I1FA 1VLZA 3K20A 4IRUB 1GSOA 4EA8A 5L53A 2CLLB 1XALA 2H4XA 3P96A 1F1BA 3R77A 1IN1A 2F3QA 4KWIA 2WJAA 3G2PA 4P3OA 2HMAA 3B13B 5EVCA 3QW2A 1SCBA 4QEDA 4UARA 1WPQA 3KWMA 5ADWA 5JR3A 3V8MA 2C84A 5CX1A 3ZNQA 1V6SA 3MJRA 5TPWA 1T43A 2EFJA 3GXBA 4JX8A 1ZK2A 3AUYA 4NMHA 4ALIA 2WTBA 1ULZA 3AEQB 1EVQA 4IIGA 3UV3A 4IFBA 4C4TA 2Y4NA 4C88A 4NCHA 5HMLA 1GGHA 2Y76A 5D7NA 1RZRD 1ID1A 3WYGA 1YQXA 4AB1A 5BQFA 5JAIA 1F9EA 1GUYA 1VMDA 5EQTA 4JQYA 5ALEA 2QPAA 4EEKA 1XCPA 1E6UA 5F73A 4PZ9A 2REQB 4MCAA 2FMFA 3V00A 2G0NA 2KWIA 4JBWA 3K1JA 1THZA 2ZAMA 4HAVA 4HB4A 5AW7A 4FD2A 3UH0A 4ASUD 3MCZA 5EWJA 3O21A 4D82A 5K0CA 5I7WA 4G36A 2JGFA 4JFAA 4C2TA 3FGZA 3DV0A 5EXTA 1ECPA 1ONBA 3BWVA 5A6SA 3A0RB 4JYZA 3G2QA 1V6AA 1C41A 4OOEA 4S24A 2XYQA 2JLZA 3QXJA 2RB4A 3HL0A 1EK5A 3OO0A 3WNDA 2QUJA 3SEAA 2ORWA 1YKSA 3IQDB 3TZHA 1JDJA 2IW1A 1JAIA 3R3SA 2H6EA 3FBGA 4KQCA 5C4MA 5ALIA 3KZKA 3LFTA 1Z0IA 4IIXA 1GGKA 1LJUA 4WK2B 1JIJA 4A9AA 3SQDA 4QDTA 4W1PA 1DQPA 2VAVA 3PRKE 4ZZIA 1BDHA 3RTEA 1GDTA 3UMBA 1JSZA 2GNOA 2QGNA 3Q3CA 5F33A 3W7BA 5AD1A 1LI5A 3T15A 3EVBA 3H6HA 3R3UA 2WD7B 1OA0A 2BDTA 4LGMA 4XCVA 3CCBA 4F4DA 2UZ0A 4EX7A 1CIJA 1YS7A 1YB1A 5CB4A 1DC5A 1DU4A 1G21B 3OU2A 2QTFA 5A3VA 4QTXA 5AM0A 3DFFA 3DVQX 4QBGB 4DIOA 4OAPA 1O9HA 1WZCA 3OH8A 2LNDA 4F86A 5E2BA 4O2AA 2AC4A 3NHJA 1HKUA 2WF9A 5FNZA 1MABA 3H99A 3PB3A 5I9LA 1R16A 5AM1A 1D0SA 4YWHA 3BREA 3K8ZA 5A0FA 2I7CA 2VC2B 1E63A 1R6AA 4NMXB 4PV7A 1YZNA 1I3NA 2OD9A 2PX4A 1FY2A 3A4YA 2IF0A 3IRUA 2ZDGA 2XRZA 2I1VB 3HZOA 3DOCA 1FP2A 4KGXA 1E18A 4RMNA 1K6JA 2GZHA 3HADA 1DCMA 3W5DA 1REQA 4ZAZA 1GZ4A 4ZEOA 2ZYWX 1E3SA 3WKAA 4HGNA 2FWAA 5JADA 5JTTA 5IASA 2Y27A 3E22A 4QUAA 2A4KA 5KQSA 4H3VA 4PR0A 3GDOA 5LVAA 3AI2A 1KEVA 3FF4A 4ITUA 5AVVA 1G21E 4DILA 1H4TA 5AVQA 3NHFA 2GRJA 1OWOA 2UYHA 121PA 5LLSA 1RYFA 1UKCA 1XVAA 4JK3A 3V2HA 4AJKA 5BUCA 1RIIA 3GAAA 4UDYX 3RVRA 5LQRA 1PR1A 1HL7A 1LWNA 3NWJA 1JDVA 3CF2A 3WADA 1ANKA 1EYZA 3DAHA 4EPRA 2PSHA 3TZLA 1TMKA 2YHUA 3QRWA 2D74A 5E6RB 5ALOA 2QZ4A 3PXUA 3SZLA 2IPOA 2ETXA 2I87A 3CX6A 2IWRA 3SIPA 5COBA 1BKSB 3VSEA 4BNUA 3EHDA 5JRJA 3DNFA 4LFBB 1A76A 1QOPB 2GAFA 1GT6A 3QUAA 5DT9A 1RMQA 2PRKA 4ZU1X 5HTOA 2QTTA 2OFOA 2XMCA 3PFWO 4X63A 1YT5A 4UEJA 4DA6A 1P2DA 3K71B 2Y6VA 3QPCA 1NURA 4NZYA 2FSHA 4JUDX 3Q9NA 1J70A 2YV3A 3NAMA 3EGDA 3RSHA 4M1EA 4OFBA 3SICE 3G8BA 5IH7A 2FZGA 4R2JA 1JS1X 1GKYA 5HS4A 1LDYA 4YJFB 2ZW9A 3EQ6A 4IGAA 3RS3A 3LMKA 4FOSA 4UBMA 3NKLA 2CFTA 2XWJI 4MQEB 1NQUA 1P9LA 3JD0A 4WW0A 3KYBA 4GZLA 1F5SA 1G2IA 3DGFC 1BMDA 5K45A 3OEEA 4TUYF 1QR6A 1SA0B 4KRXA 2BR3A 1XCJA 4L0QA 4ZO6A 5KVCA 4C21A 2POCA 1OPXA 2QUIA 3PBKA 9MHTA 2P2SA 1JHVA 4PS1A 2ZBUA 2JLVA 1V35A 1EUCB 1TM3E 3FHLA 2BGIA 2YNMC 5A4JA 5L4SA 2E4XA 5CM9C 5KDLA 5AW5A 4WA8A 4RTOA 3LT2A 3G2JA 2CNWA 3JWPA 1EAYA 5JDCC 2W6MA 1KDTA 4KVFA 3AL0C 1DT3A 2E85A 2WJGA 2PRSA 2NU7B 4IL5A 4OGLA 4OK3A 3SHQA 5BSKA 2I99A 1UBMS 2IHUA 5AKLA 3RABA 4EZBA 3W4IA 2JKVA 2VHWA 1EM6A 3I8OA 5CPBA 1ST3A 1HG0A 2G9RA 3BMQB 3ONVA 2CDAA 2FPRA 3E58A 3R0ZA 3J81k 1W6RA 3VNVA 3TW0A 3EGWA 4YC7A 2G6TA 1P9NA 1TZMA 4R2LA 1UBLS 1DWUA 2Q1XA 4FFSA 4FYVA 3BF7A 5ALXA 1W59A 2OCAA 2Q7OE 4MTLA 1EG7A 1L4LA 1SBNE 1YULA 3B85A 1V41E 5G40A 1G16A 2ZVJA 4HDNA 4KH1A 1FUUA 2GVZC 3QFFA 1QANA 3P9PA 1P7VA 5K3EA 2VP0A 3H4MA 4PANA 3TB6A 1Z2NX 5IS2A 4KO8A 3FHCB 3FF1A 2QT1A 3DOFA 4ECAA 2BUBA 2OWEA 4ZVVA 3ADCA 3LG2A 4K0RA 2IODA 4MR9B 3U3KA 4FBMA 5TQ0B 1Q21A 2QVLA 4Q7LA 2Z2XA 4DMFA 4YXWD 3DXZA 1IMJA 5B7NA 4WXPA 4YAEA 2QW0X 2B3DA 1FQKA 1GG8A 1PFYA 1NOIA 3MB5A 3I64A 2BFFA 3SD7A 4Z9BA 3GPBA 3OE7A 1Y1SA 4HX2A 5ICMA 3FTEA 2X5NA 4TWRA 1GRCA 3CLTD 1LKZA 4HVCA 3WGGA 4BNKA 1J5EB 1H3EA 3ZR4B 2ONYA 4EG0A 2QDKA 1FL9A 4IH4A 2FP4B 2A9KA 4XSVA 4OX9B 4GH5A 1I8TA 2I8AA 4NK5A 1P73A 3G3EA 4GX0A 5H5JA 3URKA 4B6OA 2O19A 3QYPA 4XWTA 3E7DA 4L76A 4KPFC 1I2DA 1E3EA 1N7IA 1QB8A 2BFEA 2VJYA 3V55A 5BORA 3NNNA 2WINI 4HNQA 1JHPA 2QQEA 2XCRB 1HEIA 1WO8A 2W71A 1UOQA 1VE7A 3K31A 1VLVA 2P6NA 2CEAA 4HQKA 4XH9B 3CV3A 4DDKA 1FCJA 2VWGA 5DNYB 5AMXA 1TPZA 2ZRKA 1CUDA 4AJNA 2PLRA 2Z2IA 3KQYA 4AWXA 1AGRA 3IAS1 1GZHB 3G0BA 5H82A 2V6GA 4AYTA 5E3HA 1M1ZA 3CNHA 3NVKI 2IYSA 3JQ6A 5IJZA 1XMOB 1NFFA 1WXEA 3QVGB 1GNSA 2DUJA 3OTGA 1U2EA 3ED1A 1Z5GA 4WY2A 1FFGA 1YB7A 1IYZA 3KR9A 1YR9A 5SZKB 4U7TB 4DV0B 2J31A 5CA1B 4X6LA 5AVJA 1PZMA 3RW9A 3KUCA 5JD3A 3ZZ1A 4BZPA 1JEEA 1A4IA 3GCXA 1XZLA 5FP0A 4F3RA 3DDWA 1G0OA 1X70A 2AFHE 2ZPAA 1SC4A 1ZBQA 4DFDA 5BW4A 5GOZA 5JC8A 4DYHA 2V8OA 5LP6B 4HDRA 2C0PA 3A2NA 2C3OA 4LF8B 1JEQB 2A58A 3HVJA 1OASA 3G79A 2ZUTA 1ABEA 1KI6B 1CQJB 4TL9A 2CJFA 1IN6A 1SHLA 5TQJA 1JHQA 4C0XA 1LZKA 5DRYA 3KELA 1IJBA 3AFIA 2AYZA 4D7AA 4DMHA 3PXCX 3LK6A 4IS3A 1NLFA 4BO9A 3GWZA 3HDHA 4GRAA 3ROTA 2BFWA 4AKSA 4EUKA 1I9GA 1G6HA 3THSA 4NOKA 3O1LA 4ZHQA 3RRNA 4CR6A 3O2QB 3SC4A 3BE5A 3GNLA 2QVGA 4D2IA 3TLGB 1C14A 4QRHA 1YFZA 4WN9A 1IVSA 4Z99A 4I9HA 2EG5A 3DEYX 4C08A 1CZHA 4PVDA 5EJ5A 1WD5A 2HO4A 2IUTA 4DZRA 4CN9A 4DLNA 1ESZA 2YWBA 1Z74A 2XEDA 2KB0A 2H4YA 2QRQA 4F3KA 5F3WB 1IBCA 1UMDB 1G5FA 4YRFA 2OA0A 3AFNA 2Z6AA 2FFJA 2WT9A 1J8DA 5J2UA 3M9LA 1X13A 4IHJA 2DQSA 3HFJA 3TLEA 4CKYA 2V9ZA 5BWBA 1GNPA 3WSVA 2FG7C 3ANSA 3WZLA 2CVZA 2P11A 3H2SA 1NE2A 1NRIA 4P92A 2J33A 5AKIA 1KAOA 3TMAA 3FCSB 2FDXA 3HBLA 1WXQA 2Q5CA 1E6WA 2NT4A 4MW0A 3QHQA 4JBGA 2CNWD 4YLGA 2VCHA 3E9CA 1EKXA 5JVDA 5KNBA 1NHGA 5KQRA 2UVDA 1I4DD 4MAMA 3FFAA 4GOMD 1SD1A 1P33A 2PIAA 1BDMA 4AF8A 3VTFA 2C2YA 3DZGA 2PSJA 2ZTLA 3H87A 3OTHA 4DCMA 1KO4A 4LS3A 3M9WA 2PY6A 1QORA 3EUAA 3I12A 3EPRA 4GL4A 4MQMA 4X8OA 1KXZA 1Z2DA 1K08A 1GTSA 1A9SA 2FN8A 2VF2A 1O9GA 2DCUA 3H2GA 2ZRMA 5JOQA 2A7XA 1BGWA 4FC7A 3ZCXA 3UKDA 3WI7A 4A2QA 5KSPA 3CCCA 3LT0A 1PAUA 1XYYA 3U81A 1UZAA 1E3WA 1OB5A 2X2FA 4YRCA 5H4GA 2DM6A 3WL8A 4DNPA 1PX2A 4MS3B 3ONNA 2GK6A 2YXDA 1TD1A 1L4MA 1KO5A 2AD5A 3P19A 4Q9AA 4RENA 5ALQA 5E9QA 2OC9A 2V03A 4P5EA 4Y2VA 4PXAA 4P34A 2WG2A 1M74A 5AVRA 1Q7BA 1P5ZB 2C2KA 3EGIA 3L9WA 3MB8A 4YI5A 1TQ6A 5EJ2A 3EC2A 1BXRB 2PLFA 4MUYA 3O2SB 4ZEMA 2BLLA 1WV1A 1WE2A 4I19A 2F4NA 4DRXA 5HRCA 1PS0A 1OXVA 4ZICA 1S8FA 1QF7A 1X7WA 1GV0A 1AKEA 3HCPA 3WTCA 2BM0A 1DG9A 4DMKA 3FVVA 3G5MA 4LN1A 1CP3A 3DBRB 3OE7D 2F64A 1JE0A 3NQ41 4K7JA 4HUQB 2R11A 4DCNA 1PW7A 4RK0A 1K5HA 1OH7A 1KAMA 2P6MA 2QN9A 3D1JA 2W98A 4UU8A 4CFSA 1XCBA 2JGEA 1RIFA 1VA5A 3FNQA 3NBQA 4CEJA 3A3YA 2FGKA 2Z2YA 1R4MB 1J99A 2ZRQA 3S8MA 3C8MA 3QOWA 1Y9ZA 4BATA 1WKCA 3V1MA 1KYXA 2GKGA 3BL8A 5IUNC 1OBCA 1AQNA 4ZRMA 2WAAA 3C74A 2FW9A 5IVDA 1V71A 3VDQA 2W2NA 4PC1A 1G8HA 4RTNA 3CFYA 4PX2A 1Q1QA 4A6XA 3LWBA 3K0SA 8ABPA 1MDFA 2XNKA 1FE8A 1QF6A 2GBCA 4YVFA 1MOSA 2Z30A 3TKYA 1JPVA 3WK6A 5EJ9A 1P2FA 4HEJA 1B6SA 2BBTA 1NI4A 1PWYE 4BQSA 3Q1KA 3TE7A 3A1VA 1NP7A 2ZTUA 4I9NA 2NN3C 4NE9A 4TL7A 3WWEA 4HVTA 4QL3A 1QR2A 1EJ2A 4QOFA 3HKBA 5KU1A 1YFKA 1Z2AA 3PHIA 4FEEA 5ILOA 3B1VA 3CLRC 5C8ZA 3IS3A 3TPZA 2HA0A 2PTGA 2WFZA 2GBLC 5DYIA 3HDYA 3KZOA 2HD4A 3VI3B 3U61B 1H23A 3EW7A 1F2TA 2NO5A 3DE2X 2YOGA 3T52A 4DCTA 1KBZA 4FGWA 2L0XA 2G82A 2QD1A 1AA9A 1PQWA 3N2KB 4FCVA 2RGUA 4PYNA 1I7PA 3RC1A 3ZBUA 4AN1A 3K5IA 4D02A 5I4IA 3ITNA 3KUXA 1HLFA 5ECYA 5TVGA 3E48A 1P4SA 1UBSB 3K6SA 3I6QA 2DPHA 2HU8A 4Y2GA 1L4HA 3COYA 4GUDA 5HZGA 3UT5A 3DAFA 3LGAA 1IMOA 1QBKC 1SVUA 5H3LA 3NPMA 2O7NA 4RKWA 4G5GA 2PA3A 1FF9A 4MULA 3IDFA 4D8TA 3U19A 1PG0A 1FJHA 3QYAA 2WHPA 3WNZA 4A1OA 2JHCA 4DMUB 3FCCA 4JUIA 3SSMA 2H54A 1NXSA 1BG6A 1CU1A 1GYRA 3VBEA 4MW2A 3I1YA 4B44A 3X2FA 5CM8B