5D3QA

Dynamin 1 gtpase-bse fusion dimer complexed with gdp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
342
structure length
328
Chain Sequence
GMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVERVDEMLRMYHALKEALSIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dynamin-1,Dynamin-1
publication title Crystal structure of the GTPase domain and the bundle signalling element of dynamin in the GDP state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 117
structure length 328
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5d3qA00
1Z5ZA 1KZ7B 2ORVA 1SXJE 4MH0R 2XSZD 2YJTD 4LHZA 2G0TA 1GNQA 2J0QA 2WIBA 3K9GA 4OHWA 1R10A 2AKYA 4MGYR 2BC9A 1F2UB 2B8WA 3QXXA 4Q7KA 4XVQA 2GF0A 4JLKA 2AK3A 2JDIA 2P67A 3AVPA 3K0CC 1FUUA 5FOWA 5L3VA 1CXZA 2E9SA 2O8CA 4G3XA 2DWOA 1VHLA 3CR8A 3AEZA 3NVAA 2R65A 4MRRA 2IYVA 2ZS8A 3W5JA 1OXUA 3K0SA 2NMVA 1E94E 2QN6A 4YONB 1XCGB 3T1OA 1F5NA 1W1WA 3DVLA 4KU4A 3K0AB 3SN6A 5J4KA 1EFUA 2GZAA 1P9NA 1G3RA 5JI3E 4D0NA 5M04A 4X8HA 1KY2A 4BEBA 4CEHB 1NMYA 1G8YA 1Z47A 2C77A 4PHTA 1SKYB 5KYKA 3PFIA 4EKDA 1I2MA 1EG7A 2XJ9A 1KDPA 1MKYA 1ONBA 2QENA 2DBYA 3ZS9A 3QBTA 4OHYA 5B2ZA 1GKIA 4B3FX 3ZYCA 2ZRIA 2ZYTX 4PHGA 1SULA 3QG5A 1L4YA 2BBOA 1EK0A 2MMGA 4LPSA 1K8RA 3EWSA 4M0LA 1KO5A 2PX0A 4TYYA 2X2FA 4TLAA 2VHCA 3BOSA 4RVCA 1QRAA 2IUSA 4RKEA 2IWHA 4FD2A 4XTRA 2FPLA 5IDVA 5KDLA 5FL3A 1ZNWA 1ZM4A 3LLUA 1E2DA 4EJSA 3KQKA 2JJ8A 1UPTA 2IYQA 3GPLA 1OPXA 2NOAA 1C9KA 3NDBB 4OI4A 1NBMA 1GZSA 2XZPA 4TL8A 4WAUA 4EIWA 2J59A 2VSFA 3QF7A 5E7MA 4FIDA 4MRNA 2IK8A 2WKPA 4DUGA 3ADCA 4PO9A 3SI7A 3AVWA 2PLFA 4JL5A 2XOKA 1KIMA 1G291 1JPJA 1J70A 1WRBA 1X1RA 2NO9A 3VR6A 2HLDA 1G5PA 1QVRA 1E99A 3LBHA 4XOIA 4TZ6A 3D6TB 3AF0A 4KVAA 3OIWA 5CM8B 2VF7A 4L4UA 4QBFA 4TMWA 2PZEA 4LJ8A 3U61B 1H8HD 2V1UA 4JVMA 4YXWA 3W6NA 5A5GA 2IF2A 2VP9A 4LOAA 4QHSA 5EP2A 4PSVA 1Q12A 3U3RA 4W5HA 4B6FA 1YKSA 4NU0A 4EPWA 1S3SA 1YQTA 3P4YA 1DADA 5JLJA 2GETA 3AF1A 4I1OA 5JMTA 2OBLA 3VFDA 5FTKA 3EC2A 2GZHA 1E96A 4R71A 1NKSA 1W49A 1TQDA 4ACBA 4W5JA 1E9FA 4GRAA 3JVUA 1SVLA 1KJWA 4XWOA 3UIEA 2ODBA 4BGDA 4RZXA 2PEYA 2I1QA 4Q1DA 2NZJA 1GL6A 5CYOA 4A2WA 1XB2A 2R6DA 2R6AA 2HXYA 3L8ZA 3GLHB 1KSGA 5JHHB 1L8QA 3LO5A 3HR8A 3W6OA 3MLEA 4B3XA 2G9NA 3X2SA 2WWIA 4F91B 2BVNA 2IYRA 4AK9A 1S2MA 3KXIA 5J4LA 2IL1A 2CNWA 1U2RA 5DN6A 4WVFA 3FE2A 4OBEA 5BQ5A 4HDOB 2CL7X 4M9SA 4TTPA 4B3DA 1JBKA 1WF3A 1U81A 2CXXA 2Q9CA 3IIJA 2XTNA 3HYTA 3T35A 1N0WA 3HU1A 3L82B 2QT0A 4QJ3A 3RS0A 4QC2A 2A5FA 2YWEA 3GQBA 4Q1EA 3AGQA 3F0TA 4QM7A 2JLUA 3U7HB 1SVKA 1XCMA 4IXNA 4OJQA 1E2EA 2F6RA 2V3CC 4AI6A 2VLIA 1CRQA 3O8CA 5CDFE 2GNOA 3B9QA 2OAQ1 5EXSA 1RRFA 4RFVA 2IWRA 5FFMA 2JLWA 5G3YA 4GL2A 4AYWA 4FMCB 2REXB 1NG1A 2Z6VA 4Z1MA 2JA1A 2WJGA 5FPKA 3A1SA 4CEHA 5JECA 2NG1A 4Q7MB 2XTMA 1Q21A 4RSGA 3CO5A 4TYQA 2GXQA 1VYTA 5P21A 3K0FB 4AYXA 1DG3A 1G3IA 2XZOA 2B92A 1RYHA 4JZKA 3MAAC 5E7JA 3PVSA 3I62A 4LDJA 3EPKA 3FKSD 1CJKC 1OFHA 1YJ5A 2RAPA 3B60A 1NMZA 2ZS7A 4I1VA 1HYQA 4P3YA 1ZAKA 3WHLA 5CK4A 2VRWA 4C0QC 2O0JA 1DBSA 2EFHB 2DY1A 1Q0UA 2Q6TA 2RGAA 2R6FA 2ZJZA 1N25A 4FCWA 5FPTA 3TE6A 3TVDA 1R8QA 1VMAA 1T3LA 5FOSA 4YDHB 4POAA 4DWJA 4JLOA 3OE7A 3MRSA 2VHJA 2JLRA 3EZ7A 2OAP1 2DFLA 3GFOA 4DCNA 3TLXA 1LTQA 3F5FA 3DM9B 2AFIE 2EU8A 1GG2A 5EP1A 2V9PA 4HI0E 3AF3A 3UMRA 1Z0AA 4ESVA 3DOFA 2FEOA 2FJUA 2ZJYA 5G40A 4HAYA 1XNJA 2QAJA 1S8FA 3FWYA 1GRNA 1NP6A 3T5DA 3LQRA 2YINC 3PR1A 3AGPA 2F1JA 1P7CA 2RKOA 3M0EA 3Q7PA 3KJHA 3QUSA 5L3SA 4JVSB 3QIAA 4Q19A 4PHHA 2GEUA 3KKOA 2HXSA 2CHGA 2XXAB 2BIFA 1AZSC 2J45A 3AM1A 3QF4B 4HZUB 1KAOA 2QROA 5TARA 3SYLA 2ZVPX 3P26A 4H1VA 1B23P 3KFVA 1ZC4A 3CF0A 2R6GA 3PUZA 3TSWA 2VL7A 4P4UA 2C5LA 2X1VA 3ZGXA 3QVVA 1YR7A 2BBTA 5TXGA 1EFRD 5BW8A 1KKLA 4PX9A 3UATA 2F1IA 1NVUQ 1XEWX 3PG5A 4RD4A 5FL7D 4A8JB 3KQUA 2I4IA 5G3ZA 3A6PC 2IS4A 2O8EB 2GWHA 5L8VA 3KDSE 3LWNA 3GLHA 3VAAA 2R8RA 1D2NA 2IS1A 2ZRPA 2BKUA 1AS2A 4FINA 2ZTSA 1DVRA 2ZRKA 3B8HA 4GNKA 4EFNA 4QXAA 1RFLA 1TF5A 2X8AA 3MG9A 1SVIA 3MGCA 4TMVA 1M2OB 3BERA 3HU2A 4UNRA 2D7DA 4DLZA 2O8FB 2QSZA 3HU3A 1G7SA 4M1KA 2VH5R 4YMUA 1P5ZB 3TGPA 2IF0A 1JR3A 4AKHA 3WRYC 3S1AA 1DPFA 2JLSA 3TSZA 3K70D 5JJKA 3Q9LA 2ORWA 2N46A 1Y63A 3FHOA 2P0EA 2ZR7A 3I3SR 4RD2A 4LYAA 4PR0A 3ZDQA 3AVXA 2O52A 4U5XA 1OYYA 3RS2A 1TQ6A 1H8ED 4CYMA 3LXRA 1KI6B 3B13B 2QGNA 3KFXA 3RLFA 5EXPA 1RE0A 4WOPA 4IOJA 1OFIA 1P2UA 1W46A 4EPTA 1M34E 3QKSB 3AH8A 3EZ2A 3ZVNA 3N2IA 4EQ6B 2GVZC 1JEDA 1KI8A 2F55A 3EWAA 2IYSA 3K0FA 4HDCA 1SGWA 3QEOA 4RJLA 1W4RA 1W0KD 1II0A 3B85A 3QNUA 3KZ1E 2AN9A 2GA8A 3KJGA 1M7HA 2QBYA 1VG8A 2HT1A 1N6LA 4TQ9A 4NKRA 1C4OA 2WAXA 3CZQA 2DWQA 4XD7D 4XH9B 4Q4AB 2ZJBA 4US0R 2ONKA 4IVPA 1Z2CA 4KV9A 1P9RA 4HLDA 4JJZA 5KDOA 3SQXA 2BWJA 1X8KA 1JEEA 1G16A 2JIZD 2QRZA 3NDPA 4LJ6A 4R2IA 3E70C 5H68A 4AURA 3WRXC 4FWTA 1TAGA 1TF2A 2IYZA 2IXEA 2ZSDA 4DVGA 4OK6A 3SQWA 3L0SA 4PC6A 4HEJA 4PPNA 4Q1BA 2FDCA 1W2GA 2RGXA 1S1CA 2A3RA 2PJZA 5TVKA 3N2EA 1KAGA 2ZSAA 4Q7JB 3PJRA 1HE8B 1YR8A 2XB2A 2Q0HA 4QNRA 4PHFA 4URVR 1OXTA 1L2TA 2QQ0A 1G9XA 3FVQA 1RYFA 2W6JA 2XAUA 1UADA 4XSGA 4GMXA 5IF9A 5JJIA 4Q01A 3NBZC 4Q18A 3GEIA 4JKYA 2CCKA 5EP4A 2OV2A 1QHSA 1Q20A 1BYIA 1Q1BA 2D62A 3U60B 2AWNA 3K1JA 4B34A 1U0LA 2W2VA 3QF4A 4HZUA 4AYTA 4C0KA 4UXIA 5JWRA 1NLYA 1U99A 3TW8B 4AD8A 1AGPA 4NYIQ 3TBKA 2BBWA 1U9IA 4NE2A 1A2BA 4UKDA 2JDID 3AF4A 3RS3A 2NPIA 2W0SA 1G5RA 3KXKA 4M9ZA 3QPVA 1Q22A 1G8FA 1F48A 4AG6A 4S35A 4A1FA 2FN4A 2Z4SA 3H1TA 4A8JA 3OIVA 2GILA 5HCIA 5E7IA 4DSUA 2FMXA 3QKTA 3GJ5A 2VSOA 2OEPA 4MITA 2R6CA 4MUBA 2N1BA 3MCAA 4LBVA 4Q9JA 1HQCA 2FOLA 3R9XA 2JLQA 4JLJA 5FPSA 5JS8A 2V54A 1Z83A 4W7SA 3EIEA 2RGNA 4KO8A 4ASUD 4NYJQ 5F9FA 2QM7A 4TL6A 1MOZA 4CGZA 2BHRA 3K70B 5EE1A 1XZQA 2O8FA 1ZVQA 3F3YA 1GKUB 5B64A 5CITA 2ZAMA 4Q5IA 1Q3HA 2IXFA 1UEIA 3CZPA 4QKQA 1IXSB 1ESMA 3RC3A 1OW3B 3SJAA 4A82A 2ZANA 2AL7A 1E9CA 1UKVY 3VMFA 4DLRA 2GBLC 4GOXA 3ZJYA 4OI1A 3BH7A 1W44A 1NVXQ 3MSXA 1XTKA 2YZ2A 3BFXA 2C03A 4LUCA 5D3QA 4IVRA 2EVWX 5GJWC 2Z83A 2GJKA 5JEDA 2VEDA 1VTKA 4LK2A 3CX6A 1E9BA 4XVUA 1QHXA 1NBMD 4V0MA 5AJXA 5FR1A 1NVVQ 1P6XA 2PH1A 3GP8A 1LV7A 3QKSA 3FKSA 3JVVA 4EQ6A 2AFHE 4CRWB 2CE2X 4HB0A 3X1WA 4LYHA 2XOKD 3QE0A 1Z0IA 2PT7A 2HLDD 4AG5A 3CPJB 5FTLA 1KO1A 1HT1E 1OSNA 1GL9B 5AUOB 5JBQA 3GCGA 3NEJA 1N5KA 1P9WA 3RDPA 2ZR9A 4PPQA 5TDHA 4YXWD 2F43B 3FKQA 3LNCA 3TR5A 5FH9A 2ODWA 5GVRA 3U5ZB 1DAMA 1AN0A 5EZ6B 4Z54A 4P32A 4XSHA 4EFLA 2X2EA 1AIPA 2F1RA 2KBEA 3NC0C 4A36A 1OH7A 5HKKD 1XEXB 1LW7A 3T1QA 4XWAA 5H8WA 5HE8A 5EP3A 4PZYA 1G7TA 1YRAA 2DCUA 2RGDA 4G0NA 1E2MA 4LJ7A 1A7JA 3IQWA 3DDCA 2ATXA 3Q5EA 4HLUA 1FP6A 2ZE8A 5DGXA 1KI1A 3SBEA 3IO3A 5K8UA 2QU8A 2OFXA 2WJVA 4TZ0A 5DE3A 2QNRA 3CKLA 3U3OA 3U7FB 3K09A 3HYRA 3THXA 2XJ4A 1E0SA 3T5GA 2ZVQX 4Q4LA 4JL8A 2OFWA 1W5SA 1XP8A 2CNWD 3BB3A 4OQMA 3B5JA 1ZM3A 4DSTA 4UNPA 1AKYA 1UFQA 2D2FA 3SEAA 1LS6A 2ZRDA 4LYJA 1HQYE 2ERYA 3MMPA 1UBFA 1Z08A 2QP9X 2JLXA 2HUPA 4JLDA 3MWLA 3VHLB 3R9WA 3QG1A 3AVVA 2CLDX 1U8YA 3QENA 1RZ3A 4N1AA 4DCSA 4N0DA 2OXRA 1WDTA 1XMJA 4PANA 1R0XA 4KCGA 3I92A 5EJEA 3CR7A 2C98A 2JJ1A 3L0OA 3X1DA 1W36B 3QJYA 1TUIA 1JQLB 1WBBA 2OFOA 5FUVA 3PUYA 2ANBA 2ZRHA 3HP1A 1SQ5A 2C96A 4B44A 1TMKA 4LCBA 4D2IA 1E0AA 4Z1MD 2KE5A 1TL7C 2YC4C 3BFKA 3I72A 4GT1A 2V6IA 4JS0A 4XJXA 4NPHA 4M4SA 2V7QA 2NPFA 2GJ8A 2WZQA 1NF3A 2CL6X 4BWYA 1AQUA 2QT1A 2G1JA 2I3BA 1KOFA 2NO1A 1OIXA 2VA8A 1SXJB 2VQSA 4G5QA 2IT1A 1SHZA 3HJNA 2ZR0A 1JR6A 5SZKB 4A6XA 1UDXA 1NJFA 2C95A 1FZQA 4A0GA 1VDZA 2ORIA 4LHXA 5GJVC 5FPYA 1VYUA 4W5WA 2V6JA 3SYKA 5DNYB 1J7KA 4M21A 3OE7D 3SOPA 1D6JA 2YVUA 1JECA 3I8SA 2WM9B 3B82A 2LCFA 4LPKA 4L5BA 4F4CA 5IT5A 1QG4A 1AGRA 3KKPA 2G0NA 4KYUA 1W7AA 2GCNA 3NHAA 4X8MA 4QJ4A 2QMUA 3B6EA 4NL4H 3ZZ0A 4OQXA 1KYIA 1S0UA 3A36A 1YVDA 3HPQA 4DCVA 5KUTA 2FSHA 2QSYA 2XEXA 4B35A 3B1YA 1ZUIA 2FH5B 5E4FA 3TQFA 3U7EB 2ZREA 4JBXA 1NY5A 3R9IA 3SS8A 1CJTC 4HYYA 1IJEA 3L2OB 3QPUA 1DEKA 4LYFA 2FEMA 3UXMA 3VNUA 2C04A 5GADl 1P3JA 2WMNB 1XEWY 2QMHA 3X1XA 1II9A 4TMXA 3GLIE 2JJ2A 2MMCA 4OHZA 1TF7A 4LHVA 1XEXA 5FI1B 3E2IA 4TQAA 1JQJC 2D2EA 3ASYA 4IW3B 4F93B 3I5YA 1XPOA 4AC9A 3CX8A 4N0EA 4PQYA 4WW0A 3NH6A 4BFYA 4BZQA 4LGMA 3V4RA 5HZKA 2F1HA 4HZIA 4LV6A 1E2QA 1DOAA 1XTIA 2F3RA 1E9SA 1K5DA 4K8OA 4D25A 1T4GA 2VBCA 3PQCA 3UKDA 2HT6A 2ZYUX 1KO8A 1DO0A 5LD2C 4LJ4A 1DAGA 1AQYA 2QEQA 3LRPA 3UMSA 3E1SA 1MH1A 2FE4A 1Z28A 1KHTA 4I1SA 1ZBDA 2V4ZA 2GVDC 5KSPA 3H0KA 3BK7A 3MFYA 4MYHA 1WXQA 2ZI7A 1N5LA 2ZRMA 1XU4A 1G5TA 3NTUA 2CLCX 4MRPA 4YMTA 1JR3D 3SFZA 1E79A 4E22A 1OT3A 1UBGA 1GUAA 3BE4A 3QXJA 2F7SA 3OEED 4TN1A 2FA9A 1Z0FA 1FX0B 4C2UA 3NKVA 5KHOC 1PV4A 2ZXUA 4A0HA 1XRJA 2YWFA 4LBYA 4ASUA 4CVNA 1PUIA 2WSMA 4LJ5A 5FI0B 5DLQC 5G41A 3QI2A 1RPZA 1T3HA 4KJZA 2LKCA 4RCYA 1QDEA 1S1MA 1VCNA 2BMDA 5EUQB 4QGHA 3W3AA 4Q66C 2W0MA 4LZZA 4M9QA 2QG6A 5JRJA 4OHXA 2IW3A 2GAOA 2DHRA 2HDNB 5CK5A 3VKGA 2HF8A 5JJLA 4A6PA 4TLEA 2OBMA 3FHCB 2GCPA 2CMKA 4LV5B 3SDZA 1SXJA 1RRCA 5JWOA 5IRCD 2GK6A 2NO7A 4UJ5A 2DYKA 3D31A 5AJZA 4PQFA 4D4LA 4EPRA 5JHGB 1PVOA 2GK7A 3Q85A 4TYWA 4HB3A 2OCBA 4NYMQ 4UXHA 3TK1A 4BFZA 4B47A 3RSLA 3W5IA 1DTSA 2VP4A 3BWDD 4IXMA 421PA 4DXAA 2AWOA 1XPUA 3CH4B 1W0JA 4ILEA 1ZINA 2PBRA 1KNXA 4Q9LA 3GFTA 4E09A 1J8YF 1QF9A 3BJIC 4DC9A 2Z43A 3CWQA 1BYUA 3A1UA 3FMPB 2GJSA 4XTCS 1Z63A 2J46A 4U02A 5L3SB 1KSHA 2P6UA 3REFA 2JAQA 3U6KA 1KDRA 3B1XA 4P4SB 4RFSB 4LBZA 1OXXK 3I4LA 2GJAA 4U00A 3UG7A 2RH5A 2W6JD 2ZQ5A 3C7KA 3WBJA 2HYIC 3NWJA 4WIAA 2QPOA 4YC7A 1NNEA 2Y8EA 2C8VA 5FBQB 4CIDA 1YZUA 4A9AA 2ZI5A 3X1ZA 4ERNA 5FBLB 5HKKA 3T12A 1SVMA 2GTPA 2IHBA 3CWZA 3GJ6A 5C2JB 3THYB 3EASA 1VHTA 4L9WA 4JYBA 4OQLA 1Q1EA 2RHDA 4V0LA 3L43A 4CW7A 1IN5A 3K9HA 3FYHA 3T61A 1U8ZA 2X19A 4AKIA 4RY2A 4MGKR 4DIEA 1HT2E 2WWGA 4OQFA 1KTVA 4S2EA 4NCHA 4JT4A 1WMSA 3GLFE 3PUXA 4PTLA 1CJUC 4CT5A 3A8TA 3GFPA 3RNLA 4TTQA 4DZZA 2DWPA 3FFBA 1QHIA 1GP2A 2BKEA 3EZFA 1R7RA 4MKGA 4OYHA 2ATVA 1FQKA 4B33A 5TV2A 4GMDA 3S1AB 4F4JA 1OE0A 1ZM2A 3LY5A 3VR3A 1E69A 4MQBA 3V00A 1ANKA 3GEEA 5C46F 3LX5A 1R0ZA 4Y0VA 1XTRA 5JWHA 1N6HA 1P4SA 4M1TA 2J7KA 4P0TA 5KSOA 2WWHA 4BECA 3QXSA 4I81A 1ZNXA 3NBFA 4Q00A 1FX0A 1J99A 3IEVA 1UKYA 3W3ZB 1UJ2A 1PUJA 4DSOA 4BRWA 1YZKA 3FB4A 2WSSA 3HDTA 5KO2A 3TQCA 2ONJA 1IN8A 2H16A 1J90A 1DAIA 2PZGA 2G77B 2XNDA 2QBYB 1DAEA 1MO6A 3PV0A 4TLCA 5JCZA 1OXVA 3CNOA 4EDHA 3NEYA 1DAFA 3OFNA 2QZ4A 1FOEB 1XX6A 4C3ZA 3IHWA 4EJSC 5K8LA 2O0KA 4M1MA 1YRBA 2BDTA 2ODEA 3EARA 1ZU4A 1N0VC 1W5TA 3K53A 1JXMA 5DIFA 1RRGA 3FFAA 2P2LA 1VG1A 1VCMA 3FMIA 1X8JA 5CYPA 3ZQ6A 4OJKA 5KDDA 2QMEA 3ND9A 4PAQA 4ZDWA 5KOYA 5BN5A 5EE9A 1A2KC 1ZCBA 2WIAA 1U94A 1XTQA 3KQLA 1CRPA 5CLQA 1KI2A 1S4QA 2EFGA 2FWRA 2GAAA 3P4XA 3QPWA 2ZETA 3J81k 4OI0A 1W4BA 2PZFA 3IKJA 5CDFA 1W48A 1FMLA 1FNNA 4EPVA 1PZNA 3VR5A 1G18A 1XD8A 1MRSA 4LRWA 1N6OA 1DG1G 4DT1B 1OV4A 1W47A 4P4SA 3C8UA 2QE7D 2P65A 4JLPA 4RFSA 3SBDA 4D81A 2HCBA 2PT5A 4TMZA 1NN0A 2FZ4A 2KB0A 4NYIR 4LHWA 4C4PA 1KI4A 5J47A 4WXPA 3OEHA 1GKYA 5FBVB 1KY3A 1WCV1 3MD0A 1KGDA 2UZIR 3THOA 2HV8A 2CEAA 1GFIA 3TMKA 1US8A 2EFEB 3THYA 2QTVB 4C0JA 3QY0A 1AS0A 2A2ZA 3T1TA 1Z8FA 2OCPA 1HE1C 2VSXA 4YMVA 2H17A 4ZCIA 2F9LA 4TLDA 1BKDR 2TMKA 3DHWC 4QFMA 2CLSA 3VQTA 2J7PA 4DHEA 1YE8A 5C1BA 1DAHA 2AR7A 4NYJR 1G6OA 2G88A 1GDDA 1XXHE 2FPMA 2JJ1D 2RCNA 2X77A 4JSTA 5IK2A 4KFTA 2ASEA 5H1YA 3KQNA 3A4MA 1PLLA 3LAWA 3FMFA 4FXPA 2CCJA 3QBVA 3UMFA 2XGJA 3CRW1 3HR7A 3ICQB 2J9RA 5F2EA 5A4JA 3NBXX 4Q47A 4YMWA 4G5GA 1XEFA 1HTWA 4LY6A 3GJ3A 821PA 2V8OA 4H1UA 4B3CA 2V7QD 2B6HA 2W58A 1HY3A 1A1VA 1O3YA 3OEEA 2IXGA 4DEYA 4O2LA 5AUNB 1Z0KA 4HAZA 3ZZTA 3A1WA 1JB1A 1R5OA 4KSCA 4DJTA 1EGAA 3ZZUA 4GBMA 2GCOB 2DR3A 1XJQA 1BH2A 1KK3A 2A5DA 1NVVR 4B2IA 5AWFC 2BJWA 3KKQA 2C9OA 4HATA 2PJRA 1UKZA 2BMFA 5AJVB 1Q1QA 4JVLA 2KBFA 2ZS9A 3KTAA 4LJYA 2QP3A 3VTKA 1E2GA 3ECCA 4Q21A 1B0UA 4NMMA 3T34A 4D6PA 1ZJ6A 3KQHA 1KI9A 3LD9A 4PXAA 5H70A 1EWQA 1U8AA 2ZRNA 3WNBA 2GBLA 2B8TA 4O2RA 2ZEJA 3WNCA 3EA5A 1OH6A 1G8GA 1BS1A 1IM2A 2P5SA 5C4MA 4GFDA 5HZHA 3CW2A 3BFVA 3C4JA 4IDPA 2MSEB 3R20A 3FGNA 4KXFB 1OJLA 4PO1A 4ZDKA 3D7MA 3ICEA 1ESNA 1IN7A 3IBGA 2WBLC 2WJIA 3IEUA 1BMFD 2I1VB 4JIMA 3TUIC 1WBDA 3AP3A 2YOGA 3KB1A 1G19A 1IY1A 3FMOB 2ZE7A 3KJEA 3CRQA 4MUAA 2ZSFA 1NLZA 1TADA 2JJ2D 4O3MA 4M8NE 2DPXA 1EESA 3B78A 1TPZA 4IJMA 4MYCA 1XJCA 2CDNA 2REOA 1G8HA 2H92A 3AP1A 3Q72A 4B2PA 1Z07A 4PZLA 5FBRB 1RJ9B 5FTMA 3LW7A 3TSOA 4JL6A 3THXB 4AWXA 1U90A 4DT1A 3IHLA 2XITA 1C1YA 5AR1A 1T5LA 3SNHA 1JXOA 2WICA 1TX4B 2PEZA 2A78A 3TJZA 2OESA 4BLTA 4J0QA 2IYXA 1E2JA 1GNRA 2IYLD 3G0HA 4D0LB 3KJIA 4C0SA 3GJXC 2YOFA 1G4UR 3EC1A 1ETUA 2RGGA 3QSYA 2JEOA 4OK3A 2C99A 3PEUA 1ZP6A 1I4LD 1P2VA 3KUCA 4WXRA 3RWOA 1I4TD 4URXR 3CPHA 4KAXA 1E79D 4QBHA 1FNMA 4GP6A 4ZI3A 2Q3MA 3LH5A 5CJ2A 2SHKA 2V55B 5BXQC 1IQPA 1JPNA 3WHKA 2OO7A 1XCPA 1DAKA 3C16C 1FQJA 4MA4A 4DIDA 1UBCA 3TW4A 1W36D 1Y3AA 1OH8A 2JATA 1QG2A 3PXGA 3TAHA 4DEXA 1DE0A 3G5UA 3UANA 3RRZA 1N6NA 4MGIR 2ZJ5A 3TUJC 1UAAA 1D5CA 1KDTA 2AD1A 4HUQB 1UM8A 4ZI2A 4CF7A 3B1WA 1G3QA 1P62B 5IHPA 4RZ2A 1CR0A 4YMSA 2W6IA 3C14C 3LW8A 4L15A 4PFSA 3VR4A 4BZXA 1OXSC 2J0UB 3Q3JB 3EZ9A 2PLRA 3ZLJA 1CF4A 2EW1A 3BBPA 5EXTA 3VR2A 2O8BB 5J4VA 1SXJD 2D4HA 4C7OA 4A2PA 2QTFA 4FCTA 4C9BA 1G1MA 2WWXA 4P4TA 1GVNB 1ZU5A 2GCOA 3CRRA 3CX7A 1M74A 3EZ6A 4RD1A 2AX4A 3KB2A 3UWOA 1OKKA 5CIWA 3SE0A 3KL4A 1MR3F 5DI9A 2P3SA 2OSBA 4GP7A 4DLXA 4NCKA 2W2TA 3T06B 1N3BA 1W0JD 2CL0X 3EIQA 1L4UA 2Q3HA 4QHTA 4ZCLA 1ZUHA 2VHTA 4A2QA 2CK3D 1SZPA 1COWA 4RKFA 2XZLA 3OAAD 4AIIA 1JI0A 1I2DA 4LWZA 1SVOA 3QOFA 4E07A 4DDWA 3KUDA 5EE5B 1N5IA 2NQ2C 1CIPA 2F9MA 3CF6R 1OHHD 2EQBA 2HJGA 3MWYW 4V0OA 3QKRB 1W4AA 2H7VA 3TAUA 2OCAA 1XWIA 2BM1A 4GZLA 1D9XA 1NL3A 3U3JA 1IY0A 1GSIA 4Q9KA 3ZVLA 2VHUA 1CULC 1R8SA 4Q48A 1NSTA 4ZKDA 2BBSA 3RWMB 3WNDA 1GAJA 1ZIPA 3GD7A 4M22A 5B57C 1R0YA 1CU1A 3LLMA 4LV8B 1XMVA 3IPYA 2QE7A 5AJWA 4ARZB 1G6HA 4JLBA 1RJ9A 2O8DB 3RAPR 3WP0A 3BC1A 5AJYA 1TTTA 3FTQA 1Z6YA 4US1R 4DLYA 4KHZA 1NN5A 2O5VA 3GLGE 4B71A 1KMQA 3I5XA 3TKLA 4LHYA 2RB4A 4WZAE 4JYCA 1SVWA 4G01B 4CEJB 4KLZA 1ZC3A 4A8JC 3THWB 2G83A 3D8BA 1R6BX 3EPLA 1G3MA 1BIFA 5AK0A 1GL7A 2WVJA 2ZRAA 3AF2A 4GOKA 4JLMA 1VPLA 4Z8XA 1T9HA 2CHVA 2H1LA 1ZD9A 5HR5A 1T0HB 2RGNC 3GLIB 1GIAA 4LC1A 4ZCMA 4AKEA 3I8XA 2KJQA 2AHOA 2NO6A 3OESA 5AUPB 2OLJA 4Q03A 4NBSA 3K0CA 2RMKA 2BV3A 3MWJA 4DDTA 2WSSD 5CM9C 1IAQA 6Q21A 4UQOA 4GZMA 4US2R 4HUQA 3A4LA 1QHGA 2GESA 1G17A 2XNDD 3EG5A 3IDQA 4Q4JB 2EYQA 4QGFA 1KSJA 2EYUA 2J0UA 4IDOA 5KNCA 2DFTA 3OFND 4WZ6A 5D3MA 1GNPA 4NYMR 3ZS8A 1KZGB 1U98A 2GF9A 1NLFA 2YNMA 1HURA 1TEXA 2ANCA 5DHAA 1TQ4A 2J0VA 2IUTA 2PMDA 2O8BA 2FGJA 4CDGA 4C2TA 1KSFX 4RD0A 3RS5A 2D7CA 1MO3A 1D9ZA 3QKUA 4DCUA 4IEEA 2WPDA 4D26A 2B7CA 2Q9BA 3DM5A 4IHQA 1W4CA 3PEWA 1P2SA 4IVQA 3VNVA 2YKGA 2IEZA 3UPUA 2ZI4A 4OK5A 4A92A 3BB4A 4Q1CA 1YZQA 5JCPA 4FMDB 3K9NA 2ZIAA 2GRJA 3EPHA 3CIOA 3Q8XB 3UK6A 1M1YE 4I4LA 4LC0A 1OIVA 4MKFA 3SFVA 2FSGA 1P2TA 4QL3A 3WMGA 1II8B 4W9MC 3LQQA 1ZD1A 4PSKA 4ABYA 4HSEA 4KYIB 4BLOA 1OB5A 1N2CE 1MT0A 2B21A 4JMPA 1CTQA 1IXZA 1MO5A 4BFSA 3EA0A 2ZE6A 4TSFA 1AS3A 3ZVRA 1BMFA 2WOOA 3PUWA 4JLNA 2EFDB 1QZXA 3OEHD 1CR1A 4KVGA 4RZ3A 1T8UA 2QM8A 4CT4B 1O87A 2R44A 3QKRA 3CRVA 3B2EA 1Z2AA 4A4DA 3LA6A 4BFXA 1Z29A 4KSBA 4B74A 4KLNA 4FN5A 3DOEA 3RVBA 4HLUC 1M6NA 3LBIA 1ODFA 1G21E 4OL0A 4B3GA 1IY2A 3REGA 3RHFA 1JJ7A 1FTSA 4HLQB 5FOUA 4OQNA 4ARZA 4P33A 5KSYA 1Q1ZA 1OF1A 3CNLA 3RRYA 2J7PD 3ADDA 1Z0JA 5GJCA 4NH0A 4BLPA 1LB1B 2O8DA 1IN4A 5KU1A 2QMOA 5IK2D 221PA 3LX8A 3RRMA 3U6BA 3Q5DA 1ZM7A 3BXZA 5C4GB 1F6BA 1KK2A 1KO7A 1AM4D 2ZU0C 3IO5A 4TLBA 1T5IA 2QUZA 1S96A 3SJZA 1IBRA 4EPXA 2L0XA 4B76A 1ZUNB 2XTZA 4LX0A 4XWKA 1P73A 4CEJA 1JNYA 2WWWA 1XMSA 4GOJA 3IILA 4DLVA 1V43A 5J40A 2VO1A 4DSNA 4II7A 4M9XA 3THWA 1CKEA 4DCTA 5DHFA 3VX3A 1R2QA 4QBIA 5JFGA 3DMNA 4D82A 1E3MA 1E9DA 2A9KA 3H84A 4HAUA 1I4DD 4LJAA 2QP4A 5ELXA 1NBME 2FZLA 3GLIA 3U3KA 1XPRA 4A15A 1UBEA 1FPMA 1N6PA 4Q4HB 3DPUA 2IX3A 3WY9A 1G7CA 4ZDIA 1CP2A 1M8PA 3K70C 4KODA 2IYUA 1RC8A 1E2LA 3C5CA 2NZ8A 1IN6A 4FWIB 5JSZA 3AVQA 1AJEA 621PA 1G4AE 2OHFA 1OFUX 5DYIA 5CB6A 4LSGA 1FTNA 4TL9A 1N5JA 4D0GA 4U7DA 3GLFB 4Q4JA 5JI2E 4JBYA 3WMFA 4P31A 3ADBA 5TB5A 3IPXA 3MJRA 3DZDA 5J4YA 1A5TA 1GRRA 3IGFA 1OIWA 1GITA 1T3SA 4IKEA 2QAGC 4L9SA 2IYYA 4K46A 5JRZA 2KWIA 3BS4A 1VG9B 1E6CA 5GJBA 4Z51A 4G5OA 2P5TB 4B2LA 1W2HA 4IRUB 1ZMXA 5K8TA 2Q9AA 3DMDA 4JBWA 2WWFA 5K8IA 5HCNA 2H5EA 1X1SA 4CEIB 1YZNA 1QHHA 2CK3A 4XVRA 3RS7A 3PITA 5BN3A 2ZM5A 3SC3A 2JLVA 4IFEA 4O25A 4UNSA 3OAAA 3K9LA 721PA 3ZD6A 3BORA 1EX6A 1PJRA 4QBGB 2YOHA 1DELA 1R5BA 2Z0MA 3ZIAA 3R7WA 4A0RA 1II8A 4KITB 1TUEA 4BEJA 2HF9A 3PENA 4KBFA 1NN1A 1CBUA 3AKEA 4F4IA 2ZYVX 1G8PA 3PEYA 1OHHA 3BAFA 4BASA 4D80A 4LJ9A 4QNMA 2ZI3A 5CJPA 3I61A 4TYPA 1US8B 3L0IB 1N0UA 1FL9A 5L3RA 4FCVA 1KK1A 4ZKEA 4ACAA 4BFWA 2CVHA 1AK2A 4B6EA 2GEVA 3B1VA 3BRWD 2QI9C 2XX3A 1UF9A 2PCLA 2FSIA 3F8TA 1S9DA 2ZRCA 2QL6A 4ZIRB 2BCGY 1J2JA 2NGRA 1MABA 4WA7A 3KXLA 2Q3FA 1FP7A 4B73A 1BOFA 3AVUA 2P6RA 1FMJA 2A30A 2H8KA 4X8LA 3CBQA 3A1TA 1RKBA 3QXHA 3TH5A 4B48A 1CS4C 4G1UC 1NSFA 1EXMA 1P61B 3E5HA 1S3GA 2A5YB 2AD5A 2ZUDA 4NZYA 3QXCA 3ONWA 1SKYE 4D4MA 4FMCF 1IHUA 3KKNA 4JSYA 4PAMA 2VP2A 3C15C 1ZD8A 2FFQA 2WKQA 2ZE5A 2ZU6A 4NCNA 5L3QB 4RD3A 3A37A 2OXCA 2FFHA 3MJHA 2G1KA 2OBNA 5EZ5A 3BIFA 3AKCA 2W6ID 1RVDA 2IHYA 4ZPXA 1KKMA 4M1SA 3SHWA 4QGAA 1W36C 5CLLA 1CR2A 2VPPA 2LKDA 4HAWA 1NIJA 3IIMA 2ZRLA 1LY1A 1F2TB 4HDQB 3NXSA 1F2UA 1LVGA 3KTAB 2GZDA 2ERXA 3BGWA 5EUMA 3AVYA 1X6VA 1KK0A 1GOTA 3IUYA 3JZAA 4Q4HA 1ZCAA 1OKKD 1WQ1R 5DSZA 1D8TA 3L8YA 2HEIA 1QHNA 4QGGA 4FW9A 1CEEA 4OI2A 4DB2A 2W00A 1E1QD 1X86B 2ZRJA 1XXHB 2J5XA 2IS6A 1J8MF 1F3OA 1RRPA 1SXJC 1T91A 3BH6A 4ZDJA 3K0AA 1E1RA 1N6KA 2DFNA 3GLFA 4YLGA 1COWD 4ZO4A 2BEJA 4FI3C 1G41A 1VCIA 2J3EA 1R5NA 2JLZA 1KDOA 1TEVA 4NCJA 2ZJ2A 4Q1FA 3LDAA 1UEJA 1TNDA 1GWNA 4BLSA 3DEFA 5HE9A 1NN3A 3CRMA 1Z6XA 4RD6A 2B7BA 2BMEA 2AKAB 4KI0A 3EPJA 4BUJA 2GXSA 3QVUA 1ZNYA 4DDVA 3G82C 3FOZA 2GDJA 2H18A 3NG1A 5FR2A 5E95A 3SHFA 3WYGA 2GEDA 4Q9HA 2WAYA 1E9RA 3EIHA 3H86A 3W34A 4CEIA 1M7BA 2A5JA 4FMBB 4LBWA 3ZVMA 4TT3A 3GLHE 3EAQA 4GI7A 4OHVA 2NIPA 4ESHA 1D2EA 1HA3A 1S9HA 1T6NA 5UKDA 2GHIA 4B3BA 3AQ4A 4NHOA 1X8LA 1SHKA 2CE7A 2VP5A 3FPAA 3TUZC 2WWYA 1OYWA 4WBSA 2ZJ8A 4URWR 1V5WA 2Z5FA 5E3HA 2FSFA 3EXAA 1YHNA 1QVAA 2UZ3A 2GXUA 1JALA 3NHBA 2G6BA 4PC3A 3U3MA 1P60A 1T0JB 2JASA 3PCRB 1UDWA 4BFVA 1JR3E 2C78A 3RABA 1YR6A 5FOTA 1Z6GA 1WB9A 1VCOA 2BOVA 2YWHA 2ZJOA 2UVQA 3MUFA 3NBYC 5SZHB 2N42A 4ZIRA 4NCIA 4LI0A 4MKHA 4PSAA 1IOZA 4PPFA 5HPYB 4B32A 4BZPA 3T1VA 5ANRB 5AUQA 4MDFA 2LWIA 3WBKA 4URUR 2ZUBA 4GPTA 3U7GA 5F98A 1E2FA 2IS2A 1A82A 4MYUA 4HB4A 2FGKA 4JT2A 3CB4A 3CH5A 2FFAA 1JAHA 1KJZA 5SZIA 2R2AA 1QHYA 2FX3A 4HUTA 1EWRA 3TNFA 1G7RA 4F38A 2H57A 1H65A 2AXPA 3WMEA 3ZH9B 3D3QA 1M7GA 2R9VA 3OZXA 3NH9A 4G5RA 4GSYA 1EFTA 5L3QA 3U4QB 1YZTA 1NIPA 1XD2B 4M53A 2XSZA 4DLUA 3O8BA 2CJWB 4O0MA 5JEEA 4C0AC 4QOSA 1IXRC 4I99A 4C7OB 3R8FA 1CR4A 4IDHA 2IBMA 3V4FA 2ZAOA 1VECA 4N3NA 1Z6AA 4TWZA 5BN4A 2ZSEA 1F2TA 3JZMA 3ADKA 3GJ7A 4MGZR 2O0HA 1F60A 2DB3A 2WPDD 1K6MA 4IFBA 4NONA 2ZI6A 3DL0A 4G5SA 2AXNA 3GJ8A 3WYAA 1MV5A 5KNBA 4F92B 1G64A 2QY9A 2C9CA 2NTYC 3O47A 2J87A 4V0NA 521PA 5KNDA 3K8YA 121PA 2WV9A 4BLRA 1HH4A 2BMJA 4CZ2A 1XXHA 1DO2A 3TRFA 2QRNA 1GILA 2QPTA 4TYNA 2RGCA 3NC1C 2P6NA 5LBIA 3C5HA 4JLAA 4PAOA 2W2XA 1XFAA 1ZRHA 5LPNA 1XTJA 3OF5A 2K5UA 3W6PA 3UG6A 3U44B 1SKQA 3M1IA 5J4HA 3DKPA 3SJCA 3K0EA 1E2HA 1FFHA 1YR9A 4TSFD 1P75A 3EW9A 1HUQA 1YU9A 3HWSA 2C9YA 1XBTA 2KI5A 3SU8A 3LFUA 2BJVA 4UNNA 4X8OA 2D74A 5FUXA 3B7GA 3OHMA 3BH0A 4Q1AA 2GXAA 5HTKA 1E4VA 2ZUCA 1WE2A 3GMTA 4ZV4A 2XB4A 1EX7A 1KO4A 1E32A 2YWGA 1NI3A 3AUYA 3W8NA 5JS7A 8OHMA 3H4MA 1E2PA 3ZD7A 5DYGA 3OIYA 4M2LA 1E9AA 2PX3A 1E2IA 2FNAA 1MRNA 1CLUA 4JJKA 1XTSA 4ON9A 2YHSA 2VTKA 2WHXA 2ZROA 2J41A 1MO4A 1AZTA 4Z8YA 4YDSA 2QPAA 1E4YA 1AKEA 4M1WA 1XF9A 1G20E 1ZW6A 3C41J 1FUKA 5B30A 5CIQA 3O8DA 4MRVA 3WYFA 1HEIA 1TQ2A 4PO8A 1Z22A 2IC5A 1H8HA 2QORA 2ZSBA 4AY2A 4IOMA 5DI3B 1QBKC 1N6RA 1Q3TA 2XXAA 4E03A 5LD2B 3ND8A 1WP9A 3PIRA 4QM6A 2QA5A 1LNZA 3DKVA 4C0BA 4V02A 2OG2A 4PC2A 2W83A 5F9HA 3P27A 2BCJQ 2G3YA 4V0ME 4F7WA 3MWKA 3OIUA 3V9PA 3CPEA 2JLYA 3AUXA 2VF8A 4KFRA 4TMKA 2O8EA 2JGNA 3LXXA 5DH9A 5DISB 3A4NA 5CB8A 3LVRE 2KSQA 5D3MB 3W90A 3U4QA 3AKDA 1IJFA 1XD2A 4JLVA 4AKGA 2CJWA 2VP0A 2OLKA 1LFDB 3PEVA 2AK2A 2MSDB 3AKYA 3N70A 3CLVA 3GLGB 5F3WB 4M1YA 4MDEA 2OZEA 1NVWQ 3H2YA 4XIGS 4MKIA 2RGBA 4C0LA 3O8RA 4NDZA 2GJ9A 5TMPA 1ZIOA 3CF2A 2VYFA 3BB1A 4H9GA 1VYVA 4BE7B 2EWVA 4IOLA 1OFTA 1IONA 2DFKB 1E1QA 2A7QA 1N6IA 3UWKA 3WP1B 1KMHB 1ZM9A 5FBWB 5BYKA 1PLKA 1ELOA 1LS1A 2CCGA 2WMOB 5LB2A 2WJYA 4JVNA 2FF7A 4MYTA 4B43A 3AP2A 2Z4RA 3SYNA 2QAGB 1E0KA 1LF0A 1KI6A 3W9YA 3ZIAD 2J0SA 2Q21A 1XMIA 4UNQA 4QHYA 1E2KA 3LBNA 1VIAA 2IUUA 5LDDC 2A5GA 5EE3A 4DUGD 4TMTA 3U44A 2YYZA 4TTRA 4IEIA 5BYJA 1KI7A 1UKEA 4A0FA 2FPKA 3CONA 1K5GA 4HAXA 3LVQE 3TR0A 1DS6A 2YV5A 4RZUA 5GVSA 3M4YA 2V1XA 4PC1A 5SZJA 4UJ3A 2WKRA 4V0KA 3VU9B 4Q9IA 2WJJA 4Q4AA 1OH5A 4EPYA 4B75A 1RIFA 4BFTA 1VG0B 1XJ0A 4Y0AA 3GEHA 3LV8A 3P1JA 4KBGA 4BQSA 1KNQA 1EFCA 3TIFA 2OILA 1E9EA 4GDFA 4R7ZA 1Z0DA 3AV0B 4D4KA 4UXJA 3I32A 2BEKA 3QQ5A 4QRHA 1T8TA 3SZRA 4EUNA 4TL7A 3CUEF 1PLJA 2HJVA 2VIIA 1SVSA 2ZRBA 1U9IC 5J5CA 1E98A 2VP6A 4R98A 5FUYA 4HB2A 3NIBA 3U2QA 1NJGA 4R2HA 5C18A 3A1VA 1P72A 2GKSA 2OT3B 4IDQA 4BFUA 2WJHA 3KX2A 5LB4A 1VKJA 1LF5A 1Z06A 5DI3A 4URZR 3M6AA 2UKDA 1Z3IX 2XNSA 4DRZA 5FPHA 3RRNA 5KSZA 2J1LA 4ITRC 4HAVA 4RCZA 2JCSA 4C30A 5DN6D 2FV8A 1DARA 1NY6A 2E1RA 2OM2A 2ZRGA 3QEJA 4L16A 1EFRA 3VR1A 4EAQA 1BO6A 4PZZA 2O8CB 4BLQA 2REBA 2NO0A 3GJ4A 4M1OA 2ZPTX 2OUKA 5FL7A 1GTVA 1U0JA 4C0HA 4MRSA 4URYR 1L7VC 4QG7A 5JSZB 3IQXA 3PUVA 5FUWA 1NMXA 1VIYA 5FTJA 4DLWA 2IA5A 4PQRA 2C2HA 5EE0A 1KJYA 1R4AA 4PPGA 3FHTA 2QQEA 3ETLA 1ZYUA 2IYTA 4L8GA 3DO6A 2RGEA 5EXXA 4FMDF 2D3WA 1XZPA 4Q02A 2RHMA 2ZI9A 1CJMA 2EFCB 4DB4A 5FOXA 1E1RD 5EQTA 5B58C 5DO9A 4K81B 2FU5C 1NRJB 3B1ZA 3L0PA 3WXMA 2EWWA 3SR0A 3GLGA 3P32A 4DBLC 2ECKA 1X3SA 1NG9A 2PMKA 5JZVA 4PC7A 3W8RA 3IBYA 1E2NA 2HYDA 4EFMA 1XDBA 1Q57A 2QTHA 1FW6A 1OLOA 1JAIA 4Q7LA 3AVOA 1YZGA 2IYWA 3RS4A 2HCJB 1XD9A 5G53C 1QHHB 3CM0A 4EJSB 2ODNA 4TQUS 3KKMA 3T15A 1G3UA 1GM5A 1ZNZA 1H8EA 4DDUA 5KTYA 4BRUA 5TY0A 1KMHA 4DLSA 3VKHA 1OB2A 3R7WB 1RW4A 3ASZA 3IIKA 2PL3A 3FDIA 1R0WA 3VKWA 2FG5A 2ZJAA 5KPDA 2MSCB 2QAGA 3VX4A 4QJ5A 3RC8A 4OKSA 4TT3D 3DZ8A 2ZYWX 4V03A 3RANA 1TU4A 2D06A 5KPJA 1W0KA 2CHQA 3A58B 3R8CA 2BM0A 2E87A 4IOKA 1KI3A 3TVTA 4BPBA 3Q7QA 5FOVA 3HPRA 3X1YA 1NKTA 2CBZA 3EX7C 2PCJA 2R62A 3P20A 1HV8A 4XD7A 4WZBE 3ZQJA 4NP6A 4DKXA 2WOJA 2FFBA 1GRQA 4DLTA 3AVTA 5FTNA 4HLCA 4D4JA 2QGZA 1JJVA 1AA9A 2JIZA 3VU9A 5BWMA 1YZLA 1A4RA 1D2MA 4E5UA 1MABB 4NTZA 4KFSA 4KFUA 3I73A 3K09C 1U0HC 2VHQA 2ZRFA 2F43A 1CJVC 2OCYC 3GJ0A 3RSOA 4IDNA 4R9UC 1Q44A 3SJBA 1EFHA 3N5CA 2IEYA 3I1FA 1Z6TA 4YQFA 2ZITA 2OE2A 1E0JA 2CVFA 3CNNA 3RYTC 3VHXA 2YC2C 2F3TA 3B9PA 1TU3A 4JKIA 4I1UA 5A0FA 2WTUA 3BD9A 1WA5A 3AB3A
chains in the Genus database with same CATH superfamily
3J7AC 3GLQA 4W7IA 3T5BA 2ZSHA 5KYGA 3G5TA 4M0KA 1FMFA 2J0QA 1TOAA 2WIBA 4KGZA 4RADA 3AR6A 2W98A 3D7LA 4U2KA 1YE3A 3ZIDA 5JXHA 2AKYA 1KIFA 2BC9A 3QXXA 3OCXA 4Q7KA 3K94A 5LKRA 1MQAA 1F38A 3BCUA 2AK3A 2JDIA 3O2QB 2J48A 2Q8NA 3AVPA 3K0CC 3MB5A 4XIYA 3EJ6A 4GUAA 4J3NA 2H4XA 3UA4A 3X44A 1Z16A 3L7MA 5BVHA 3EGXB 3O1IC 1U1EA 2QZZA 2WLSA 5CNJA 3E18A 2Z1NA 3HCPA 2QJWA 2H9IA 4LDQA 3W5JA 3TL6A 3WADA 1OXUA 5JAMA 4DLAA 1G21A 3HCBA 4YONB 3OQ1A 2PBLA 2PUHA 4OKIA 3N3BC 5D01A 1W1WA 2H3HA 4N47A 3K0AB 1EFUA 4IG4A 1SXPA 3PUIA 1DHTA 4LYEA 1R64A 5G1OA 5BWCA 4K03A 4ZVQA 1M2NA 2WUDA 5DF1A 4WY5A 2NP7A 4CEHB 1NMYA 4G0XA 4AZVA 1SKYB 4DAEA 2C57A 2X5JO 3I1IA 4C5BA 1EG7A 2XJ9A 2QVGA 5ALJA 5LZ2A 1KDPA 1ONBA 1JHQA 4BXOA 1PQ4A 1MOPA 4AUKA 2DBYA 4OHYA 4XYGA 5HIJA 2AN4A 3U81A 1N34B 2IEAA 4XUDA 2Z57A 1LH0A 3L93A 5BSRA 4JENA 2JHGA 2MMGA 1K8RA 2JFXA 3PWTA 2PX0A 5CB4A 3QU2A 2PX6A 5CT9A 3BOSA 2IUSA 2ZVJA 3QELB 5EMJA 2FN3A 2CJYA 4FD2A 4AO7A 1IZYA 4RHTA 4GPBA 2W6OA 3N2NA 3E03A 4EJSA 2JI6A 1K7CA 1KQ3A 1LQTA 1UUFA 5MHTA 3GRRA 2OGZA 3Q3GE 2PRZA 3AIMA 3GPLA 2NOAA 4OI4A 2R97A 1PL6A 3KVRA 1E5DA 4ZN6A 4H35A 3B70A 4LIPD 4YT8A 2OYSA 5AHWA 1AXRA 1M3SA 1VL8A 3H5LA 3I6MA 1YQXA 2JAPA 4KQCA 4MRNA 2IK8A 4OP3A 3ADCA 4BVHA 1NPYA 3SI7A 3R0IA 3LCUA 4AICA 3BEDA 1YA6A 3KL2A 4JL5A 3G9UA 3WLQA 1KIMA 5H3CA 3WWEA 5EJ8A 1WRBA 2GPYA 1JG6A 3BKXA 1X1RA 2NO9A 2YCBA 4O3FA 4XGRA 1KWKA 4H3HB 1G5PA 2G8NA 1JLHA 1CQIB 2VEOA 1UXKA 4I46A 2QX7A 3WQSB 3VKVA 1TM2A 3ASUA 4P9NA 3O4RA 3GPCA 4YI3A 4YCJA 1QXSA 3ZQUA 4ZOBA 5FBHA 3LSTA 3ND7A 3LA8A 2IHKA 4MWZA 2PZEA 2XUDA 4M38A 1DTWA 1LWOA 4QQFA 4TMWA 3RADC 1H8HD 1KIAA 2J9ZB 4JVMA 3ESYA 2V1UA 3T3OA 5A5GA 4MGHA 1GAXA 1KZ1A 4J7UA 1JSZA 1EGHA 3V3KA 4MQEA 4UD6A 2PA3A 4YVFA 5IZ4A 4EPWA 4Q37A 1C2TA 1YQTA 2FMHA 3P4YA 4I1OA 1H9CA 1A5ZA 5AKGA 2OBLA 3CMMA 2IWHA 1GPLA 1HQKA 3HJBA 2BGNA 1NKSA 4FX2A 1VLQA 1MGOA 2WM8A 1KJWA 3GAMA 4K9RA 1O95A 1JVSA 2ODBA 3I39X 3UF0A 3JD1A 4JU9A 2GHTA 4BNUA 2I1QA 4EI8A 2CMGA 1GL6A 1XB2A 2R6DA 3ND6A 1KFBB 4L27A 1L8QA 5JHHB 4B3XA 3HR8A 3W6OA 3X2SA 5DTQA 2WWIA 3DZJA 3ZLBA 5EYPA 1UANA 3LTEA 1U3TA 4DMLA 4GS5A 3O84A 4AZSA 1S2MA 2J8ZA 2O14A 3KXIA 4JD5A 3W04A 1U2RA 4TZKA 4ENRA 5J4LA 1XZEA 4OBEA 2A0UA 2RC6A 3FRHA 3I0MA 2CL7X 3A6DA 4PYRA 3U31A 1ND5A 2GAJA 4B3DA 4M1EA 1N5MA 1R3UA 2CDRA 4CDNA 1IM8A 5CTAA 1PGJA 2WMDA 3EVCA 3LT1A 3PDIB 1SFRA 2A9FA 2CXXA 2RG7A 4E94A 4HWKA 2BKXA 2C92A 3L82B 2AFVA 3AOEC 4I6JA 4EB6A 3M70A 4DV4B 5EG5A 2OP0A 4QVGA 3F0TA 1RXUA 3H4IA 4ATNA 4QM7A 1OA0A 1XCMA 4E21A 1E2EA 2VPZA 2QL5A 2PXXA 3UJHA 5KVAA 2W2LD 1ZK4A 5CDFE 3B9QA 2OAQ1 2EJCA 1KOLA 3ZE8A 1B8OA 4RFVA 4JJ4A 1OBCA 3LQKA 4J91A 3AINA 2JLWA 3ZEAA 3HO1A 1C41A 4OJYA 5AK5A 4K87A 4Z1MA 2Z6VA 3R75A 3VPCA 5FPKA 2Q9UA 4EELA 3G7NA 4EJ2A 5JECA 2XTMA 1Q21A 4AJ2A 5JSHA 3AUTA 3K0FB 3A7EA 4L9AA 3RUHA 4KXUA 4BQPA 2QLNA 3QWAA 3W1WA 1W5EA 1BNCA 3RR2A 3PVSA 1Z0SA 3AEXA 3E4DA 1MNQA 3OX2A 2D2IA 2G6TA 1CJKC 1OFHA 4FT2A 3SEZA 3D54D 3N6XA 3QE9Y 2YZNA 3B60A 4LFBB 4P3YA 3KYJB 4PIMA 5CVCA 5DJ5A 5CK4A 2OYCA 2GPTA 4GPD1 3RS9A 4EY4A 5CFOA 3OPXA 4D7AA 1E62A 3QZUA 1UBSB 1Q0UA 1SQ6A 2RGAA 2R6FA 2OHOA 4NBWA 2A3NA 1JG7A 3EEOA 1VMDA 3QE4A 5GV8A 3IQDB 3S1LA 1PU2A 1FEZA 5FWDA 3BCRA 5A4DA 3BDVA 4R4JA 2JLRA 3EZ7A 4R31A 2DFLA 2OHGA 4EITA 1C4WA 1NPTO 1VIVA 4AY5A 1O03A 2EU8A 3IX7A 1GG2A 1QFYA 1TTQB 2JAHA 4JAVC 2FAXA 3AF3A 3QFSA 1BWPA 3UMRA 4A03A 4ESVA 5IJXA 1OBVA 2X40A 3WGOA 3M6FA 5IWCA 5CW1A 1USVA 1Y8ZA 1XNJA 5AVZA 1ZHOA 2VT3A 4QT0A 2A14A 3K1AA 2PNFA 4H2DA 1LK0A 3PR1A 1L5KA 3KC2A 3IT3A 3VI3B 4BNJA 4D5EA 2RKOA 3U7QB 2DJ5A 3GDOA 1RCTE 3ZE1B 3WGYA 1EBBA 3LFTA 1UT5A 3QIAA 3O73A 3ZGLA 1L3CA 3KQOA 2XXAB 1N2SA 1U1DA 3IVXA 3QXGA 1GADO 1AZSC 1V26A 1K0UA 5KHLB 2H7CA 3PZBA 5MN6A 4QDTA 5EJ2A 3QF4B 4P83A 5TARA 1OWMA 1M8KA 3SYLA 1DEOA 2DETA 3EHEA 1B23P 3OD1A 4PNHA 3HB7A 3CF0A 3AW8A 2JI7A 3PUZA 5AM4A 4MMYB 4WCFA 4EJ0A 1TM5E 2C5LA 1UZAA 3ZGXA 3DHVA 1TRHA 3QVVA 2PXCA 2BBTA 5BW8A 5ITWA 1MUUA 1QYDA 3STHA 1KKLA 1USKA 2P9JA 3MWEB 5FULA 4LE2A 3WWOA 4BAUA 4RK7A 1XEWX 2W2KA 5FL7D 3KQUA 3KJQA 1WY7A 2I4IA 5CGZA 5G3ZA 2C0CA 5DFAA 1EEXB 4I5DA 2GWHA 2X5OA 3MQ2A 3WB1A 1JN0A 3O4FA 3LWNA 5K3CA 1QTRA 5T57A 1I3KA 1SIBE 3GLHA 4GLJA 5GGYA 3V33A 1D2NA 2HRCA 3M4JA 5EXDA 5F23A 1E1CA 3QVXA 2BR4A 2W4MA 1DVRA 3O6VA 4ZMSA 5LJLA 4G81A 4GNKA 4EFNA 4QXAA 4R2WA 1GGVA 4IGIA 1OROA 1VKRA 2X8AA 3TFOA 3ZY4A 3Q0TA 3BE8A 5DEOA 2VCEA 2D7DA 4C06A 2QSZA 3C3KA 2O8FB 1G7SA 5IABA 2PRKA 2P90A 4IZHA 4M1KA 1ENZA 1QYRA 1J8VA 1X7HA 2EGUA 1F8XA 2VH5R 5EZYB 4BNXA 4YMUA 2FWIA 2BKAA 2RHCA 3AL2A 1DPFA 4CKWB 2PZAA 3AFIA 4QARA 3DBIA 2BHLA 4FKMA 3H2JA 3UWSA 2N46A 1RFGE 4AZ3A 1Y63A 1V7PC 2EZ8A 3AQIA 1RJDA 2P0EA 4NF2A 3BMOB 3WJ1A 1F7UA 4GIBA 2ZT5A 2Z2KA 3GG2A 1Y1RA 3ZDQA 1YKFA 1TU0A 2O52A 3HO8A 4MUJA 3FWKA 2A9JA 1H8ED 2CNOA 2YDYA 2DMRA 3LXRA 3B13B 3L8EA 2I4TA 2DJIA 4FYIA 3EUAA 4X64B 4W5TA 1XTTA 1XZKA 3C8DA 1FDSA 1OFIA 1P2UA 1W46A 4C4ZA 4DA6A 3VUEA 3AH8A 4BO3A 4EJFA 4GLFA 3ZVNA 3W8EA 3PNLA 1DV2A 5DULA 3FYUB 2F3PA 3EOBI 4HH4A 4R6XA 3EWAA 4HVAA 4PSDA 1AH2A 4GR4A 1Q7GA 1SGWA 3V32A 3RLIA 4HGRA 1LJ8A 1Z5GA 4RJLA 3KKKA 2V3VA 2NXNA 4ND6A 4LDAA 4PEVA 4ZCSA 1YCFA 3FMVA 3KJGA 4PV7A 4QO8A 4UM7A 1YB6A 2QBYA 2HT1A 4TQ9A 5K6AC 2WI8A 2F62A 2WAXA 2OHIA 4JKOA 4XD7D 4XH9B 4B45A 1B0ZA 4CN9A 4Q4AB 1Y6RA 4KQXA 4US0R 4QDOA 2EG9A 3U80A 4DG8A 2QZ9A 4P7JA 4XX0B 4RF5A 1P9RA 2ZUVA 1YL6A 4KQ6A 5CTJA 1A9PA 4YASA 2IHVA 2JFHA 3IUBA 4JVOA 5EJMA 1JEEA 4AURA 1ZGAA 1TF2A 2Q07A 4DVGA 1JYSA 3L0SA 3PFKA 1YSCA 5L6LB 1W2GA 4D8YA 2DLNA 3BHJA 1M2WA 1ULBA 1G8JA 2A3RA 4RQAA 1M76A 4FUQA 4EABA 1K4YA 4OAOA 5TVKA 4CMBA 3W2HA 4IMRA 4ZQBA 2ZSAA 4Q7JB 2XMCA 3X0DA 2CHEA 2V6FA 2VQDA 1QGDA 2Q0HA 2YXPX 4QNRA 4RK5A 5DRYA 4PHFA 1QGED 2G06A 3RK0A 1KMIY 2AC7A 4BTEA 1FNCA 2FSVC 4YJHA 1IHDA 4XSGA 1UADA 3FCUB 2C7GA 3HXLA 3MS4A 1QG6A 2XB9A 3CCBA 1WXGA 4KQWA 3TX6A 3ZR4B 3GEIA 1XRNA 2OV2A 1QHSA 1Q20A 3T7KA 2IW1A 3JD0A 1I7LA 5JIBA 1Q1BA 2D62A 1JEAA 2PX8A 1L5FA 1XVUA 2WINI 2AWNA 3K1JA 3IDAA 5DBFA 4AYTA 1K2VN 3N58A 3MMSA 2CYAA 4RVUA 4BVJA 1GR1A 5HBGA 1NLYA 3JD2A 3TW8B 3UB4A 3WLLA 3WZLA 4NYIQ 1AXGA 2PFGA 3D7RA 1NQWA 3MK31 2HIHA 1PJBA 3FPGA 5T3YA 3QVSA 3L07A 5IFLA 4DBLE 4F3TA 4EH1A 3QBDA 2QTZA 5EIFA 2XUGA 1EP9A 4YGYA 3QPVA 1G8FA 3OIVA 4MVWA 2J33A 1VI6A 3RM3A 2C2WA 3CLTC 3GJ5A 2OEPA 3UC9A 5HUHA 2R6CA 1IEQA 3KB8A 1FA9A 2N1BA 1QH9A 3SVLA 4OLAA 4K86A 4F9GA 1I32A 1U3UA 2A59A 1CZUA 3ZHOA 1Z83A 5TE9A 1REQB 1I6KA 4Y7CA 2O23A 1L7DA 1Z75A 3D4PA 3QMMA 4TL6A 4P2GA 4QREA 1M2OA 2A0WA 4CG2A 1YDEA 1ZGGA 4L5AA 5B64A 2ZAMA 1HLGA 1NE7A 2DLDA 2QRMA 2BF7A 4MWGA 4NV1A 1UMKA 3RC3A 1DQYA 2ZANA 4TTAA 4FLFA 4MSUA 3ZJYA 1JDZA 1AZLA 1WXDA 4KZKA 3JQFC 1P0CA 1NZDA 1NBWB 3H75A 2P2CA 4CI9A 3AO0B 4IHJB 5L45A 1G8KA 5D3QA 2Q6IA 2C9DA 2EVWX 5GJWC 1PNTA 3BIXA 1NOKA 4EB8A 1VTKA 4LK2A 1WR8A 3UHAA 3OX4A 3WNZA 2OB2A 2YY5A 4XEUA 4V0MA 4YRJA 2R7NA 2YV3A 4DRYA 2Y27A 1S01A 1Y8RB 3FKSA 4ZEWA 4ZT5A 1C9DB 1JDBC 2Q49A 1M6WA 1H0SA 3ZD6A 4MLCA 2B83A 1C1DA 4BFLA 4LYHA 2QT9A 2XOKD 3ER8A 1RBQA 3P0IA 3KYCA 2YFKA 1AY0A 1ECCA 2PT7A 1EKXA 2V6BA 4QPZA 3T94A 4AG5A 5LMNB 5MFZA 3N86A 1QYXA 1P91A 5FJIA 1C7RA 4GQAA 2D7JA 5DBGA 3VAYA 4RMIA 3ROPA 4QZVA 1JPUA 2ODQA 3NEJA 1N5KA 4OB7A 1RC1A 3D7NA 4E4RA 2ZR9A 1AQLA 4PPQA 4HAIA 3B7WA 5TDHA 2X0JA 4EW1A 3R5FA 5CT4A 1IRXA 1A8IA 3D3JA 4G0ZA 4YXWD 5JC1A 2F43B 3FKQA 5FH9A 4RPGA 3EXIA 3WMRA 4GX5A 4XR9A 3BXEA 1DAMA 3NHLA 2GBIA 4II2A 2NXEA 1PBNA 2XB8A 2WWVD 3NC0C 2BFOA 2F1RA 3QV1A 2W70A 1RP7A 3G85A 4NBTA 5HKKD 5KOJB 2ECPA 2JI8A 3Q9SA 3L02A 3VBCA 1DC7A 1PK8A 2P11A 2H2DA 3IUJA 4MVCA 3ROZA 1JI3A 3T1QA 5H8WA 4EJSC 4G0NA 2DCUA 3WLEA 1B93A 4G4IA 3TGLA 4KPGA 2JKZA 2EJTA 5F4BA 2NVOA 5G4LA 4FB5A 5EN4A 4GZ5A 1N2CB 3LC1O 3S55A 3SBEA 3NJRA 1ZHHA 2OFXA 3NOXA 4HFMA 1E8NA 5DE3A 4ZCRA 5JZSA 3U3OA 3QEBZ 4KPYA 1BHQ1 3CT4A 3K09A 2C4TA 4II3A 2ZVQX 3R3UA 5FD8A 4Q4LA 3TF5A 3D3KA 4AUNA 4EYGA 1OLXB 4JL8A 3E2MA 2OFWA 4OP1A 2QE6A 4X63A 2CNWD 3BB3A 3NZEA 1FSSA 4OL9A 4OQMA 1FFDA 1GZVA 1XK7A 2VWGA 4ISBA 1N8NA 1E5LA 3NUQA 3PHCA 3CURA 1NVMB 4LE1A 4BWVA 4LYJA 1BQ4A 1HQYE 1ODKA 3D8HA 4RZHA 4TVKA 1UBFA 4B0OA 3GGDA 2JH3A 2JLXA 2HUPA 4JLDA 3RRBA 4MPRA 1NATA 3VJRA 1RZ3A 2V7UA 1ZGBA 3KCQA 3L9WA 1JTVA 2WHQA 3B51X 3FCSB 4YMLA 3PDCA 3EDQA 1N33B 5EJEA 1WU7A 1FS5A 4L57A 4MUGA 1QKIA 3WDKA 1JQLB 2OFOA 2X23A 2ZBRA 2ANBA 2VJLA 1WEKA 3DS8A 3ZLTA 4LCBA 3OQNA 3ILHA 1R37A 1DBPA 3KSDO 4I9NA 1CZKA 1WXXA 1RQNA 2H00A 1P0FA 2SKEA 4YECA 4JS0A 4BMVA 4IQFA 1H5QA 4NPHA 1H2HA 3MTGA 2IGTA 4KOEC 3VPFA 4D92A 2QT1A 3QRWA 1A9XA 4BO4A 1HFWA 2HSWA 1MJ5A 2OHJA 3CEJA 1KOFA 4GWGA 2VQSA 2WJZB 3COSA 3RUIA 1XDGA 2VJPA 3MC1A 4G09A 1Z4IA 3PR3A 4UU0A 5JAZA 4PVDA 1NJFA 2C95A 3ICOA 4JDPA 3CTMA 4OJTA 4ZV7A 2ORIA 1JEQB 1D4AA 4K6OA 4KQHA 4LHXA 3UW3A 2AOXA 2O2GA 4V0QA 3N2GA 3TWOA 1VYUA 2VUIB 5AW8A 4O1HA 1BDHA 5LYJA 4M21A 1TGVA 3BICA 1QH1B 4L2IA 4PXYA 3GT4A 3I8SA 1JECA 1L5HA 3ZHQA 4RZSA 3GF4A 3NKFA 1O89A 3B82A 4H7JA 4HN2A 2CFOA 3QTTA 3ROFA 4ALIA 2X8JA 1N0HA 1HYHA 1QIMA 2D8MA 1PE0A 5ECYA 4F4CA 3WTCA 3TZBA 1FC0A 1I33A 2CXHA 1AGRA 1Y3FE 5I5GA 4EBBA 2P40A 1R18A 4KYUA 4X60A 2IV3A 4CUKA 4E88A 1BVHA 5E9WA 1YZ3A 2XQFA 4WV3A 3ROXA 3ZE9A 5B4TA 5M7EA 3LTNC 4J0DA 5BOVA 4W6ZA 2HFKA 1YVDA 2GPNA 5KUTA 4JGBA 4TSKA 4YXFA 1KTIA 4UE6A 2XEXA 5JYDA 1D4FA 2HA4A 5CXXA 5JOQA 3T7CA 4FFOA 3EQ7A 3TS1A 1FUYB 2FP3A 4ZT4A 3IAS1 1Q5PA 3QUCA 2ISCA 1Y5LA 5T4HA 1EVLA 3SS8A 2VNHA 1EH5A 3DVQX 3I2JA 4L5YA 4HEA1 1Y3DE 1KERA 4GPAA 1CJTC 3NNNA 1IJEA 1DEKA 2FEMA 2C04A 3C6ZA 3EEQA 1XEWY 2C0QA 4ARUA 2AE1A 2HA2A 1FNSA 3QYFA 5HGJA 2QG9A 2JJ2A 2OYRA 1TF7A 4DNOA 2DXIA 1XEXA 3PXEA 2AJLI 4EECA 1ZG3A 2DWCA 3DMFA 4W4TA 4TQAA 1JQJC 4F93B 2ZUUA 3AM5A 4IW3B 3IT2A 5F1KA 4AC9A 4BIMA 4MVJG 1QFSA 4N0EA 3CE9A 3NH6A 1AF4A 1G4HA 1JZTA 1FP2A 5SYMA 3TXYA 2F1HA 4HZIA 2X86A 4LV6A 5JS2A 5HZKA 4BL5A 2BTEA 2M9MA 3FVWA 2WB2A 3SZGA 4MUFA 3CUVA 1FW8A 4S05A 3EQ8A 3IH5A 5T41A 2PX4A 4CCSA 5EKXA 1Q1GA 3ZWYA 5K4GA 2SCUB 1BDMA 2HT6A 1OFGA 2ZYUX 5DLYA 3SBOA 5LD2C 1D7OA 2ECQA 2VVTA 4LJ4A 4WXHA 1AQYA 2DBVO 3AOGA 3LRPA 4ZVOA 4DW8A 1MH1A 5BP7A 3N87A 2ILTA 5ESXA 4RY0A 1V0JA 1NR1A 4AVYA 1Z4QA 1ZBDA 1RD4A 3FB1A 3PKZA 3B3QA 4OGFA 4OIMA 4CNQA 1YFJA 4KR6A 4EYQA 5ALGA 2Y6VA 2YMPA 2DUUA 3H0KA 3RVPA 3MFYA 2ZI7A 4YAFA 5KQMA 2VUUA 4AY6A 2O2ZA 3BIJA 4PLTA 3PD1A 4IDAA 1BXGB 3RW9A 3SFZA 1YB5A 2IEDA 1U1CA 2DQYA 3ESCA 2BW0A 3IP7A 1OT3A 5ELLA 4E22A 4E5YA 3PX2A 4IUYA 3ABSB 2TYSB 2VBIA 3F6YA 4F86A 2VT2A 3D4BA 2FA9A 4HK4A 1BHJA 5DLDA 1Q7RA 1FX0B 3EPPA 1VKOA 3SSMA 2QZPA 4WESA 4RAOA 3V8QA 4M0FA 4C22A 1MW9X 2TSYB 4R2KA 5JFTA 1PV4A 3T5PA 3K35A 3O4HA 4QYIB 2ZXUA 4DDMA 1ZXBA 2NUAB 3BQMB 1FYDA 3OMXA 1C50A 1C3EA 2JBWA 4TTVA 5DNEA 1SCDA 4LVCA 5DLQC 3QI2A 5FI0B 1T3HA 4KJZA 4RGQA 5G41A 6ABPA 2HDHA 5ALOA 1Z4MA 2VI5A 3CUYA 4U2CA 1GZHB 3L46A 3KWFA 3ZDFA 5U9CA 3VYRB 1WEHA 1HFEL 4KN9S 4BYGA 3CV3A 5JRJA 1OXKB 1W52X 2IW3A 3B36A 4KN6A 2Q5JA 4JP3A 2OV8A 4F2HA 2X6TA 4V39A 3INGA 4OCZA 3L7NA 4AUMA 1RXWA 1P1FA 4XIJA 3FHCB 1EXVA 4G5YA 2ODTX 1J1ZA 4LV5B 3SDZA 5TT1A 1SXJA 2C0PA 1IBMB 5TIIA 3DCYA 1R4ZA 4C2UA 2NO7A 2PX5A 1U4NA 2D59A 2C88A 2R7LA 3EF0A 2R4UA 4TWRA 4ZWNA 4JI5B 2AUNA 2VHZA 1U11A 4N82A 1G5HA 4PQFA 1A4XA 4IJUA 2R6R1 1G6Q1 1TYAE 4FGJA 5KOHB 5BN5B 4JITA 4TYWA 3ZPXA 1YQEA 2OCBA 3O3NB 4NYMQ 4UVGA 2VOJA 1M5RA 3NS7A 4L72A 4L85A 2P78A 3GRZA 4IJ6A 1EUZA 1RACA 2Y0PA 4IXMA 4DXAA 3RSCA 4QU0A 3CH4B 1Y8AA 4ILEA 1PNQA 4Q9LA 1XQ9A 3KOZA 1D07A 3R7FA 1MQ8B 4X65B 1ZN9A 3COZA 2PYZA 4Q3LA 2HMUA 4MQMA 1C0LA 3REFA 2CUZA 4X85A 2JAQA 3MJCA 3LQ2A 2JAUA 2WJ6A 2WNSA 1RMQA 5CLJA 1KDRA 3B1XA 3EK2A 4PZ0A 4WECA 2JBHA 1L7PA 3O0DA 1YS6A 1UXOA 4GZ6A 4RFSB 3KAKA 4UM5A 3I4LA 2GJAA 1G2OA 1C9EA 1M9NA 2ZQ5A 3ZYZA 5H83A 2R11A 5DNUA 2NAFA 3OZBA 1S3IA 3PNSA 4WIAA 2H54A 2QPOA 1EYZA 4OH1A 1QE3A 4PN7A 1NNEA 1NW3A 3AR7A 3HADA 1KZ4A 2XD4A 1R88A 1VJ5A 1YZUA 3HNRA 1D2GA 1V1MB 3X1ZA 1C8BA 1DBWA 3RUFA 4BHTA 4D74A 5FTWA 1KBOA 2VT7A 1LBIA 2GTPA 3T12A 4J94A 1P1BA 1WLSA 5B7PA 4BVFA 1XMXA 5BVGB 5KTNA 1LWNA 1OOEA 2I2BA 2X41A 3VO8A 1W85A 2XUHA 2OBFA 3WRWA 2O3UA 4JYBA 4AO8A 4IIYA 3LL4A 1VRCA 5JJCA 1U4OA 3L43A 1UT8A 4LKRA 4MQ4A 3FW1A 2EBHX 1LZKA 3B3AA 4NVRA 1T2NA 4KWCA 1Y81A 1B8PA 1J6UA 2AFIB 1UM9A 1WZNA 2WDPA 4F5DA 1DWUA 1BGWA 1HMPA 2CD7A 2WWGA 4D8TA 3EVNA 1XVLA 2FLVA 1ES9A 4J2HA 3AJ9A 2FKNA 3CINA 1CJUC 1MT3A 2QW8A 2DWPA 4HWOA 1FFAA 1P18A 2BKEA 3GYBA 3VPGA 3ZTWA 5JZ9A 3REQB 4I19A 2ATVA 2R7MA 4HJRA 3AW9A 4FKZA 1FQKA 1NRXA 2HL6A 4IDFA 3UAYA 3ZUGA 2AI1A 1M8JA 3PQ3A 4M6WB 5TV2A 3QU7A 4H6PA 2PQ6A 2V0NA 2EIXA 4CF6A 3LY5A 4KRGA 1SHTX 4NEGA 1ANKA 4X94A 2B37A 3OM8A 1J0BA 1ZUNA 2GI4A 4Y0VA 3G1TA 3DLBA 1N6HA 2OMKA 4PLPA 4B8YA 5ECGC 4P0TA 4E4YA 5KSOA 4BLUA 4EG8A 4JR0A 3PDUA 1ZCJA 1AO0A 1ABBA 5IG2A 2FQ1A 4GE0A 4FQ5A 4ZZIA 1GNSA 4CKBB 1ABFA 2WQZA 4HGYA 1QQBA 1UJ2A 2HWWA 3B6IA 3LUKA 4G67A 2P7HA 4KIJA 2OBXA 1DKRA 1YI0A 1U0BB 3FB4A 4F45A 1ZDMA 2V58A 3M34A 1MIOA 5FX2A 2FG6C 3TLAA 2ONJA 2C3OA 1DAIA 1R6UA 3FTNA 1NAHA 3DHNA 3SHTA 2VDQB 1W93A 4FSHA 1XSEA 5MGBA 4ARIA 4LCJA 3O3OB 3GA5A 2UDPA 3CNOA 4R2JA 4TV9B 4GBED 4A73A 2L18A 4RTJA 1DAFA 3CEAA 3RBVA 1XKLA 3OFNA 2QZ4A 4NARA 3CJRA 3GMDA 3ILXA 2ZDGA 1YHZA 4G41A 4NENA 4EHIA 2ODEA 2OG1A 5FPQA 5ALEA 3EXG1 2QD5A 3K53A 5JPCA 4RAQA 3FFXA 1G9SA 2G67A 4QJBA 5FAXA 3ML1A 3EGVA 5HRCA 4LNUB 3OIDA 2ZZMA 3ZQ6A 5KDDA 2QMEA 3GI1A 5F1OA 3O4GA 4EGSA 3KXPA 2LE0A 3MJVA 1NOIA 1A2KC 2H1CA 5KYYB 2WIAA 1C0PA 3LQYA 1OGIA 5TQ0B 1VKZA 1N2ZA 4ZRMA 2ET6A 3UOAB 1XVVA 5CLQA 2EFGA 5HKOA 1JKIA 2OB1A 3G2MA 3P4XA 3QPWA 4BCBA 3DEAA 8LDHA 3FR7A 4WBNB 1M0SA 4HDKA 3II6X 4G0PA 2JC3A 1GUDA 5K4HA 1XR3A 3NTOA 5HNKA 1PZNA 3VR5A 4HP8A 3EN0A 4Z7JA 4G0UA 2HY7A 3WR5A 1WHSB 4C78A 4H27A 1BWRA 1M34B 1SQGA 4P4SA 2QE7D 1ML3A 4QAQA 2OCLA 4TLMB 4JLPA 4YROA 3TEFA 5E6RA 1SCBA 2HCBA 3SBDA 3WLOA 4ZCPA 2J32A 2KB0A 2PGIA 5L51A 4CTJA 2VQ3A 3AU8A 5J47A 3B1KA 4LYDA 2VSYA 4TVOA 1VI5A 2A57A 1KY3A 2I2CA 3ZGNA 4HNTA 1KGDA 4QELA 4KAAA 5LA6F 2J9YB 4J4HA 3U56A 1DWPA 3IELA 2ID7A 5A4KA 2OO5A 4H0CA 3EZXA 5D5QA 1K3UB 4HNQA 2OQVA 2I22A 4HDRB 1L9XA 2OZKA 4C0JA 1DAOA 2A2ZA 4UPDA 4ZQIA 4Q3AA 3IAHA 4UTOA 4X61A 1Z8FA 3V1KA 3WTBA 2I99A 2ZATA 3HJRA 3PFWO 2XRMA 1U2GA 5DBEX 1NAIA 1XDUA 2M6LA 4EGFA 4GU5A 2JVJA 3MT9A 1Q0QA 2HLHA 3CH7A 4WUTA 1GEEA 2CLHB 2F9LA 3I09A 2XKBA 1BKDR 2TMKA 4TLDA 3UTDA 4QFMA 3JQ8A 2CLSA 1NRIA 1N1DA 2P8SA 1B1AA 2HSDA 2AR7A 3AC0A 2IZ7A 1PP4A 2FPMA 1U31A 1M6EX 1JB9A 3D8NA 2GD2A 3OWXA 1K7YA 2WFLB 3MT8A 2ASEA 4ISCA 4KFTA 2X1LA 4XWTA 3FOWA 4FXPA 1K9VF 3BGVA 2BFBB 1DLJA 2CSXA 4RE6A 3NC4A 4INJA 5C8YA 3VZSA 5ICCA 1O9HA 1EDDA 4ETMA 1NQOA 5F2EA 3C1TA 4Q47A 3T4PA 2OUIA 1K6XA 1RXSA 4AWBA 6NULA 3SQLA 1JHUA 3FLMA 1ZXLA 1WHTA 2IUYA 1WPQA 3HVRA 1AKMA 1O3YA 4OMFG 4O29A 2C8JA 4Q1VA 4DZTA 3OEEA 3GPDG 4DEYA 3SS9X 2MJLA 1DEAA 3DMHA 1R5OA 3F6CA 4LA4A 4DJTA 1GG9A 3GA7A 2CVPA 4M7PA 3JQCA 4BB0A 4NXMB 2FG7C 1XJQA 1KK3A 3KZVA 1NVVR 1JA1A 1EBUA 4PYKA 1LNSA 5IUJC 4M0CA 1GDHA 4U8HA 1JLLA 5EIOA 4YCLA 2BE9A 5BY2A 2PJRA 3AL0C 1XV5A 3EHDA 2CHUA 3IAUA 3K0KA 5LXTF 3NBMA 1U4SA 2KBFA 2ZS9A 2WQ7A 4ZI7F 1H6BA 1D03A 2NSHA 4JEIA 4KXMA 2VDNB 3VSDA 3T34A 1C8LA 5IWAB 2QLJA 1KI9A 4PXAA 4OX9B 1EWQA 3ZV7A 2GFQA 2YJZA 1C80A 1U8AA 2IU4A 2ZRNA 3UHOA 3WNBA 4YCNA 5BNIA 2G7ZA 2ZEJA 1IQ0A 1X19A 3GUHA 3VR5H 3EA5A 4B5KA 1GFZA 2G40A 1IBLB 2O2EA 1E6KA 1BS1A 1HE4A 2FUG6 2FPPB 1ENYA 3P0HA 1RBZA 2EEPA 5IBQA 1JHDA 5AXBA 3RFCA 4N12A 1NM5C 3RJTA 3LVBA 3E23A 2AVDA 3F9RA 1XFDA 2W22A 3FGNA 4KXFB 1JU3A 1JVBA 2Y1KA 3CSDA 4PO1A 5JVDA 3MMZA 1BAPA 3K0HA 4IICA 1IN7A 2WJIA 2H2WA 1BMFD 1T6XA 1ZH8A 2W2PA 2X6RA 3ITNA 3N7UA 1YRWA 3R23A 2JZNA 4JIMA 4MP6A 2E2WA 1IY1A 3FMOB 4XSVA 3KJEA 2QTCA 3M6LA 3V7WA 3NP7A 2HRRA 3CRQA 1NLZA 1TADA 3IBTA 1WLYA 3ILSA 4JI1B 3NFYA 1UBNA 2WD9A 1EESA 1M83A 2IHJA 1XRQA 2REOA 1G8HA 2V0CA 2FEXA 3KDAA 3M83A 3Q72A 4P92A 3AUAA 5ALWA 4B2PA 5KWSA 3RU2A 5I9LA 4RLFA 1XHEA 4UEKA 5FTMA 1Z39A 3TSOA 4JL6A 5C8DA 2D3TA 1CUIA 3FIJA 5KQSA 4UQLA 1Q92A 4BLWA 1TEZA 5AR1A 1C3OB 1R6AA 1DIOB 1URPA 1W6RA 5A4IS 2W6QA 8ADHA 2OESA 2DPMA 2JGDB 3PWSA 4F2WA 4R05A 4PSUA 3W7BA 1E2JA 1GNRA 2PK3A 3VUFA 4HCJA 2QN1A 3BXPA 4XM0A 2D5IA 4D0LB 4LF9B 1GN9A 1SCIA 1QGUB 2AMJA 3NFRA 2VJDA 1C7IA 5F5XA 2RGGA 3SQDA 3ZZMA 3QSYA 2QTVA 1PQWA 2O57A 3NVDA 3GFSA 2R5NA 1B74A 4CTMA 2Q4BA 4Z99A 5LLDA 1I4LD 3I42A 1SBNE 1I4TD 2ZYGA 3OCUA 2YS7A 5JDIC 3O82A 2A5LA 3T9AA 2Q3MA 3QMPA 5CJ2A 3G17A 1A7UA 4JFAA 1W9MA 3SHVA 1A8SA 1Q7CA 2PQMA 2OO7A 2NXCA 1JLSA 2RJ3A 1XCPA 5JNWA 2RHJA 5AJTA 3WFJA 4RTRA 4Y9RA 4DIDA 1L6IA 4YRLA 1PX0A 1W36D 1JZQA 2DR0A 3CT6A 1IOWA 1N75A 2JATA 1QG2A 5B55A 5JCOC 4LF4B 3UANA 2WYIA 5CFMA 1S6YA 3LHKA 4M9RA 1YJ8A 3B1JA 2ZJ5A 2GGSA 3TUJC 1OU0A 4QOEA 5CFLA 1UAAA 1KDTA 4HUQB 4ZI2A 2FJPA 4HNGA 1G3QA 3OC0A 2ACVA 4CG0A 4HXEB 2QUAA 4GH5A 2H9YA 3A3OA 3LW8A 3QUBA 1MJGM 4MI1A 2CMDA 1OXSC 3U4AA 1AV7A 3Q3JB 1OLUA 4CG1A 3BWBA 3RTAA 3TDKA 4DV0B 1T9KA 5HK9A 1NC1A 2HU5A 3ZLJA 3I6BA 3MUEA 4S1VA 1K7XB 3MUOA 1V5EA 5ETJA 2EFJA 1QMGA 3VR2A 1YIOA 2D4HA 3M4XA 1UWKA 2ZQZA 1B41A 3ECAA 1G1MA 2WF7A 4G4SP 4LZOA 4P5EA 3T1HB 1ISGA 3I2IA 1M74A 3ONFA 3L01A 4Z7NB 1HWYA 3KB2A 4HRVA 1UMCB 3JYLA 2CFSA 1OI2A 4E32A 2YWCA 4RKWA 5C80A 3IE1A 3A6KA 2AOTB 3KL4A 1MR3F 1QFXA 3DC7A 3H1EA 4RF3A 2C1XA 2P3SA 4YP9A 4ALNA 4C4XA 5I45A 1TGYA 3PUHA 1TVKA 3A70A 3BK2A 1W0JD 2CL0X 4GRDA 4ERNA 1JAZA 5A62A 4BNDA 2VHTA 1RQ2A 1TE2A 3DAGA 3B7PA 4AF8A 1W88B 1BWSA 3H17A 3OAAD 1V4NA 3JQ7B 5KQPA 1I2DA 4L02A 2E4YA 4YUAA 3QOFA 1H5UA 4E07A 4DDWA 3WMWA 5DM2A 2C8LA 3VVCA 4XPIB 2H1WA 4AN1A 1Z15A 1MU0A 1GD1O 1N5IA 1VLHA 3OZ7A 2F9MA 4L0DA 3KSAC 4B7ZA 3GCXA 1OHHD 3VU1A 1GNTA 2B5VA 4V0OA 3VZCA 2FW1A 4QASA 5JXIA 3TAUA 5LQUA 2YXEA 4GZLA 5KYVA 2VJMB 1NL3A 4Q9KA 4MV3A 1YQ9A 3AEKB 2ZVDA 3DF7A 4CI0B 2RH9B 3TKAA 1E7MA 3O31A 3TLKA 1NSTA 5B57C 3WNDA 3H6GA 1GAJA 1P3DA 4ARSA 2Y1OA 2XE7A 4LDNA 4YT5A 4FOTA 4ARZB 5AJWA 3W6UA 5JALA 3M1YA 3MGGA 4MMZB