5D3QA

Dynamin 1 gtpase-bse fusion dimer complexed with gdp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
342
structure length
328
Chain Sequence
GMEDLIPLVNRLQDAFSAIGQNADLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLVLQLVNATTEYAEFLHCKGKKFTDFEEVRLEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFVTKENCLILAVSPANSDLANSDALKVAKEVDPQGQRTIGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIDGKKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPGLRNKLQSQLLSIEKEVERVDEMLRMYHALKEALSIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the GTPase domain and the bundle signalling element of dynamin in the GDP state.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Dynamin-1,Dynamin-1
total genus 117
structure length 328
sequence length 342
chains with identical sequence B
ec nomenclature ec 3.6.5.5: Dynamin GTPase.
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00350 Dynamin_N Dynamin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5d3qA00
3RRYA 4AWXA 4U5XA 5DE3A 1DEKA 1KDRA 4NZYA 2QE7A 3GLFB 2VSOA 1COWA 2XJ9A 2PLRA 4NCKA 4Q7LA 4DT1A 3MWJA 2IS6A 4URZR 2AHOA 1FX0A 1SKYB 5L3VA 1AQYA 3HPRA 2KB0A 2ZU0C 4HAUA 4Q47A 4A8JB 4QM6A 3A58B 2XXAB 5E95A 3ZVNA 4Q18A 1NNEA 3H4MA 3W6PA 4PO1A 3RRNA 3SEAA 2E87A 2A5YB 4UJ5A 2WAXA 2PCLA 1XEXB 4Q19A 3IEUA 3IILA 3U3KA 1K6MA 4F92B 1EX6A 2X2FA 4MKGA 3WMGA 4DIDA 1E2EA 1NKTA 2F9MA 5UKDA 1G20E 2F1RA 1M2OB 4J0QA 4D26A 1JQLB 4HB3A 4Q1BA 5B58C 1XEWY 1QRAA 1ZC3A 2ORWA 3LLMA 4N3NA 5GJVC 1IXSB 4MGKR 2ZUBA 1GKUB 3KKMA 5TVKA 2N42A 3NHBA 3GP8A 4KSBA 1UKZA 3EA5A 1J8YF 4V0LA 2XGJA 2PEZA 1GUAA 2HLDA 4Y0VA 3CR7A 4B71A 1Z5ZA 5DI9A 4JT4A 4NDZA 1N6RA 4G5GA 2WKRA 5FOUA 4DDVA 4PTLA 3IBGA 4X8LA 1L4UA 3THYB 1RRPA 2O8EB 3ICQB 4LBZA 4JKIA 4NYMR 2QL6A 3ZGXA 1XZQA 5F98A 1E94E 3B9QA 2REOA 1GRQA 2GZAA 4HLDA 5L3SA 2IEYA 4QM7A 2OG2A 2CVHA 2ZU6A 3ASZA 1FPMA 4FIDA 2CJWA 2G83A 4OJKA 1ANKA 4EDHA 1ZCAA 4MGIR 3M0EA 3EPHA 4UNNA 1LS1A 4NPHA 1UFQA 2FZ4A 2ZRBA 1XU4A 1BIFA 4DCSA 5AWFC 2ZJBA 3SI7A 2BKUA 4GI7A 3PXGA 5KDOA 2ORVA 4GOJA 4F4IA 3H1TA 4ZCIA 1R5BA 2QAGB 1R0WA 1Z83A 1QHHA 4H1VA 3GLFE 1YR9A 2NZJA 1OE0A 2RMKA 4BGDA 1E69A 1TF7A 4WA7A 3SYLA 2NGRA 4W5WA 2Y8EA 3B1ZA 3CNOA 1KI9A 5EJEA 4I1UA 5EE1A 3CO5A 4B6FA 4E03A 2FX3A 2PZGA 2ZI3A 5G3YA 1NG9A 1OXXK 3MWKA 1XCPA 1F6BA 3CZQA 4HDQB 1JR3A 4OI2A 4NBSA 4DC9A 2DWOA 4EQ6B 2JJ1D 2WZQA 2ZRGA 1AS3A 2XSZA 2DYKA 5CYPA 1XRJA 2VTKA 3H84A 3DZ8A 4NTZA 3KQLA 1JJVA 1LY1A 5AUPB 2VP9A 3EWAA 5B30A 4Q1FA 5JSZB 2HLDD 1MO5A 1MRSA 5G40A 4Z1MD 2IYUA 3CWQA 4XJXA 2ZRMA 3AVWA 4DXAA 1Q12A 1XCMA 1N5JA 1HEIA 2CE2X 3N2EA 4L8GA 2P6RA 4ZKDA 1SULA 4TYPA 1W48A 2AD1A 4ARZB 3LX5A 4B3DA 4RKFA 3B8HA 1NMZA 1G16A 1Z28A 3B7GA 4AKIA 4HLUA 1X86B 4QGGA 3THXB 5EXXA 4NHOA 1ONBA 1Z0IA 3VKGA 2YC2C 2OM2A 3Q8XB 1HE1C 3BIFA 1ZM7A 2JIZD 4OL0A 4FMCF 1KI4A 3LH5A 2J9RA 4MRSA 1X3SA 1ZIPA 3SYNA 2OCAA 1M7GA 1S3GA 1LB1B 5DHFA 1GILA 1E2IA 3E1SA 4TL6A 4ZCMA 2MMGA 2GK6A 2PMKA 2EFEB 2Z4RA 1TX4B 2AX4A 2ZPTX 1E9SA 1NVXQ 1WDTA 4Q5IA 2W83A 5EUQB 1A82A 1W44A 2CHQA 4UXIA 4M1KA 2R6GA 2YOFA 2ZAMA 4KHZA 2ZRFA 4PC2A 3ECCA 3U60B 1NY5A 3TUZC 1XMVA 1SHZA 4DLTA 2ZS9A 2D2EA 2IYRA 4ITRC 4PXAA 1VG8A 1N0VC 1W46A 2QMHA 2ZYUX 3NVAA 4Q00A 1S3SA 4E22A 2W2VA 3QXJA 3GFPA 1W4RA 2JLZA 3T5GA 5J40A 3GLGB 4TYYA 2Z0MA 3B1YA 4O0MA 2G0TA 3W3ZB 1E79D 4LPKA 4UNQA 1NL3A 2QI9C 3BGWA 3I5YA 5FOTA 1Z22A 1OH7A 3EXAA 2HDNB 1E0AA 3RRMA 2Q9CA 4JL8A 1U98A 3UK6A 3MWYW 4I4LA 1OXSC 1RYFA 2OILA 2HYDA 3VR4A 1RKBA 4DDWA 5A4JA 1E9BA 3VNUA 1I4LD 2A7QA 5D3QA 4FINA 1ZMXA 3NKVA 4MGZR 4V0OA 1GL7A 3EIEA 5KU1A 5JJLA 1Q3HA 1RZ3A 2DCUA 4XTCS 1EK0A 1JB1A 1VCOA 2I1VB 4A9AA 4OHVA 5AR1A 3HDTA 4BFUA 1R0XA 1VPLA 5KDLA 3MJHA 1NIPA 2H7VA 1E6CA 1HV8A 3TUIC 3KQUA 2YJTD 3B1VA 4GZMA 4WXRA 4QNMA 3PUZA 2CVFA 2ZS7A 4M1MA 4C7OB 2GCNA 2JAQA 3BE4A 3PFIA 4KVGA 521PA 2QM8A 2ZR7A 4WIAA 1NP6A 4DSNA 1F2UA 4AK9A 1XMJA 1FP7A 2A30A 2WIBA 5AJXA 2BCGY 2W58A 4CEIB 4HEJA 4GT1A 3OAAD 4PANA 5IHPA 3ZZTA 1SVWA 3CF0A 3TQCA 5JFGA 1Q1ZA 2AK3A 2JJ2A 1YZLA 1N2CE 4P33A 4M9SA 1NMXA 5IK2D 1L7VC 2RGNC 2XZOA 3UPUA 2QAGA 3NC1C 4A0FA 2WWYA 2HJVA 1KSFX 1RC8A 2HYIC 2EVWX 2ZVQX 4Q9LA 3QNUA 4Q9KA 2J46A 2YV5A 2VPPA 4HAWA 1KJZA 1S9DA 4B32A 3U4QA 3U7HB 4GRAA 4M1WA 3ZIAA 2JLSA 2ZE5A 1NG1A 1U8AA 2O0KA 4Q4JA 5FTJA 2Z5FA 3RNLA 4DCUA 3K0SA 2ZXUA 3KL4A 3LDAA 1TQ6A 4QRHA 4PPFA 1QF9A 4JLKA 4D0LB 3C15C 5FUXA 2PT7A 4CEHB 1S1CA 1NSFA 2QSYA 2Z4SA 3F5FA 2ZE6A 4DJTA 1OXUA 2N46A 1G7RA 4JKYA 3F8TA 3IQXA 5JMTA 4URUR 3A1SA 3KB1A 4LPSA 4EPYA 3THYA 2ONJA 3DHWC 2QTHA 1BO6A 1J70A 2ANBA 2ZITA 2RKOA 3EIQA 4O2RA 5FBQB 3TQFA 621PA 3BFKA 1G3RA 1ZBDA 3JZAA 1KMQA 3GLGA 2A3RA 3F3YA 4LBWA 2CLCX 3K9GA 3MLEA 4TZ0A 2A5GA 2NTYC 3U44B 3UKDA 2IEZA 4W9MC 2EFGA 2WMNB 5FBWB 3T5DA 2JLXA 1FL9A 5JCZA 3K0AB 2Q0HA 1KI2A 1RVDA 2BBWA 3HU3A 3U3MA 5E3HA 2BBOA 1R7RA 1AK2A 5E7IA 3FPAA 3GJ5A 4CT5A 4M1SA 4EPTA 2CXXA 1D9XA 2CCJA 3ZJYA 4TMZA 2FZLA 1XPUA 4JT2A 1H8ED 4URXR 5JRJA 1NBMA 1CF4A 1JPNA 4G3XA 1MT0A 5CJ2A 1OH6A 4PZLA 1SVSA 2PZEA 1JI0A 4IFEA 5JHGB 3PV0A 3AH8A 2NZ8A 2NO7A 5G53C 3HR7A 4R71A 2BJWA 4LJAA 4US1R 3J81k 3CF2A 1JR6A 4FMDF 3RS4A 4CF7A 1FNMA 3THWB 2J1LA 1EFTA 1OHHD 1E4VA 3JVVA 2BKEA 3CNLA 2H18A 1UPTA 2CE7A 3AVTA 1Z2AA 4OBEA 1R0ZA 2GILA 3Q5DA 3GMTA 1XEFA 1ZUNB 3CBQA 2QMEA 3P4YA 3EZ7A 1H8HD 1NN5A 2H92A 2PCJA 4EPRA 3GJ8A 3VFDA 4BZQA 3LLUA 2EU8A 1OF1A 4YDSA 4JYCA 4Q4LA 4Q9HA 3WYAA 3VNVA 2OSBA 4ZKEA 4RD3A 4TYNA 2GA8A 3A4NA 3HYRA 1T4GA 2XXAA 5CB6A 4TLDA 4B76A 2J41A 1I2MA 2JJ1A 1WB9A 4LC0A 1SZPA 2FNAA 2BM1A 4KODA 3RS5A 2GZDA 5JEDA 1RE0A 3BC1A 3TAUA 4UXJA 4A4DA 4YLGA 2WPDD 2V55B 5FR2A 3T35A 3VMFA 1IXZA 2IW3A 4M9QA 1II8B 2Z6VA 1W2HA 4OYHA 4OI1A 3KUCA 5HTKA 2QUZA 5FFMA 1MH1A 2WHXA 2ZRHA 1F2TA 2OESA 2ERYA 3LVQE 1LVGA 3N70A 3SJAA 4PQRA 1BOFA 1KAGA 1E9DA 2BBSA 1KYIA 3NTUA 5EP2A 2RGDA 4BE7B 3GJ0A 4OHWA 4C0SA 1KDTA 2H8KA 4BEBA 3QF7A 2QA5A 2VHJA 1T8TA 3GEEA 5TV2A 2HXYA 2YWEA 4QC2A 4ZI2A 2FFHA 1G6HA 1D2NA 2RGBA 5FUYA 4ESVA 3T1OA 3ICEA 2ZAOA 3KKPA 3LW7A 4I1SA 1XPRA 4D25A 1E2NA 2OO7A 4JLNA 4PC7A 1LV7A 1KNXA 1KDPA 2CNWD 3OEED 1TU3A 2QPAA 2IYZA 3W90A 1DAKA 2IA5A 3AF0A 3TBKA 4TMVA 3HR8A 1W2GA 4FCWA 5BYKA 2CLDX 1KNQA 2MSDB 5GADl 2CJWB 2CEAA 4A36A 2WJVA 4Q66C 1CLUA 1W5SA 2WJYA 4TZ6A 2P67A 3I32A 3O8DA 2ZSFA 1XD8A 3THXA 2XJ4A 1EG7A 3QXHA 5C4GB 5J4KA 1L8QA 1KK3A 3EW9A 1FUUA 2Q21A 1XTKA 2WKQA 4A8JA 1U0LA 5FTNA 4PZZA 4NYIQ 2IUUA 3CX8A 4C2TA 3V00A 4TN1A 1YZNA 4HLQB 4N1AA 3PEUA 4CDGA 5HCNA 4AYXA 1KJYA 1JR3D 1E9RA 2PJZA 5KSZA 1FQKA 4DLRA 3QENA 3RS7A 4LZZA 1M6NA 4Q4JB 4Q7MB 4TL8A 5L8VA 2PL3A 1LF0A 3A8TA 4B35A 4OQFA 1DADA 2EYQA 1J2JA 5HKKA 2WWGA 5CM9C 3E5HA 2ZRDA 1YZTA 2WAYA 5A5GA 1DAIA 4JL6A 5BW8A 2PJRA 2ZQ5A 4B2IA 3K9HA 1OLOA 1LNZA 2FPLA 5FL7A 2G77B 3FE2A 3MGCA 5LB4A 2ZYTX 1IAQA 2WJIA 2IYXA 1E9FA 2FFBA 2QNRA 3C4JA 3ZH9B 4AI6A 2EQBA 2IYSA 4IDPA 1G7SA 1KK2A 3LV8A 2V3CC 2R65A 4EJSA 4TLCA 1MV5A 2XEXA 5JWHA 5C1BA 4OK3A 1UDWA 5CIQA 1GVNB 3B1XA 1IQPA 4RCYA 2WMOB 1VG0B 4DLYA 3WP1B 5HPYB 4C0JA 3U3RA 3AGQA 4C0LA 1U0JA 3F0TA 4NYIR 3O8RA 1HYQA 2KJQA 2PEYA 2BMJA 3QKRB 4AURA 1P62B 3R9WA 1G8GA 3PUXA 4LRWA 5GJBA 2FSGA 2ONKA 4O3MA 2AFHE 1W0KA 2VP2A 4K46A 2ZR0A 5TARA 3AKDA 3RSLA 2KSQA 4C0QC 2VH5R 4D0NA 2GXAA 4URYR 3EPJA 3HP1A 1AZSC 4G5SA 3K9NA 2O8BA 2X77A 3FKSD 1ETUA 5BWMA 3A6PC 1XMIA 2DPXA 3VR6A 3EG5A 4OJQA 5CJPA 4EUNA 1L2TA 3L0SA 3W5JA 2QBYB 1E2KA 1SXJA 1G19A 2QPTA 3MD0A 2B8WA 1IY1A 5SZHB 1YKSA 1Z63A 2WVJA 2WJHA 4KO8A 1D2EA 3I8SA 2WTUA 1X1RA 2VLIA 1E0KA 2FGJA 1HT2E 3LBHA 4V03A 3ADBA 5CK4A 3SE0A 2DWPA 4L9SA 4C0AC 1Z0FA 2QEQA 4BEJA 1HT1E 2FU5C 1KI6A 2YZ2A 3Q7QA 3PQCA 2E1RA 2VHCA 1RFLA 4Z51A 4ZIRA 2AFIE 5J4YA 3GJXC 5KO2A 3NBFA 4FWTA 3GFTA 1ZNZA 2FV8A 2NO6A 3BB4A 2PX3A 5EE9A 5SZKB 2EFHB 3SBEA 4KITB 1SVKA 3TJZA 3TW8B 1DG1G 1NMYA 4YC7A 1FP6A 5FI0B 4X8MA 1E9CA 3LAWA 2OBMA 1TF2A 4ABYA 5AUOB 4Q9IA 4D4LA 5HZKA 1XCGB 5GVRA 2ODWA 1CJMA 1XEXA 3O47A 1M74A 3FMOB 4HZUB 4P4SB 1UEJA 3RYTC 1KSHA 1AKYA 2BEKA 5L3SB 1T91A 1ZIOA 2RGXA 1E2JA 2GJSA 4PSKA 5E7JA 3I8XA 4OI0A 1K5GA 3C14C 1XB2A 2CMKA 2QAJA 5FOWA 1DE0A 4E5UA 1MKYA 3S1AB 221PA 4QFMA 3DMDA 1GFIA 1XWIA 1N6IA 4EQ6A 3K70D 1AS2A 3LBIA 4ZCLA 1M34E 2C78A 4OHZA 3CW2A 4UJ3A 3BOSA 4NCIA 4M0LA 1XXHA 1OH8A 3O8CA 3BORA 2FEOA 3C16C 3VTKA 4UNSA 2B7CA 3AVOA 1Q1QA 2GF0A 4O25A 1TTTA 3IDQA 2Q3HA 1OFHA 4DWJA 3IHLA 3ZD7A 1LFDB 1RJ9A 2R2AA 3K0FA 3UG7A 3OESA 5LD2B 3N2IA 4KFTA 2O8DA 1ZP6A 3GLIA 2VHQA 4L16A 1ZD1A 3QUSA 1Z0AA 1OXTA 2ZRJA 4PSVA 1U9IA 1LW7A 2Q3MA 3ZQJA 3GJ6A 3WP0A 2ERXA 1DS6A 1G8YA 3E70C 4LHVA 421PA 3IPYA 5BQ5A 4I99A 4DLXA 4F93B 4IOJA 4GNKA 5CLLA 2WIAA 5B57C 1E9EA 1OJLA 2BVNA 1JAIA 4JBWA 4S35A 1DOAA 2BOVA 2BV3A 1SQ5A 1QHIA 4PR0A 1RRGA 4PC3A 5JI2E 3KTAB 1W49A 4IHQA 4UKDA 2GJ8A 3WRXC 1UADA 3IKJA 1NJGA 3RAPR 1R8SA 1A7JA 2ORIA 3LWNA 1KO8A 4M8NE 1A1VA 3K1JA 1XJ0A 3TVTA 1ZCBA 4XD7A 5CDFA 4D4JA 1A2KC 3SHFA 2CL0X 2YWFA 3IIJA 4KV9A 2BMEA 4PZYA 1FMLA 3QF4B 2ODEA 4UNRA 2FPKA 1EESA 3T34A 3NXSA 3UXMA 2C5LA 2IS1A 4Q02A 4DLZA 4M2LA 4XWOA 4JIMA 4GP6A 2O8FB 3OFNA 1AKEA 3U7GA 1LTQA 1VHLA 4Q21A 3NBXX 3MRSA 2GXSA 1FUKA 1G3IA 1AJEA 4ZIRB 3B78A 1GOTA 4KFRA 4JSYA 2XOKD 3B85A 3BWDD 3OE7D 1G1MA 4NYJR 2Z83A 2OZEA 3SBDA 4A8JC 1OHHA 2P2LA 3EASA 3B5JA 3ZVRA 3M4YA 4GZLA 1W0JD 4KAXA 4QBIA 5H1YA 3TSZA 1NVVQ 2GF9A 1X1SA 4PX9A 3AEZA 4DUGD 3I4LA 1JEDA 3BERA 2PH1A 5KPDA 4GMXA 2OUKA 2ZYWX 1G18A 4JLOA 4S2EA 3R8FA 1CR1A 1G8PA 2HCJB 1DO0A 3PENA 4NU0A 4PPNA 3HU2A 4ACAA 4B44A 3EPLA 1HUQA 1OYYA 2ZE8A 2XB2A 1DTSA 1E2MA 2VP0A 3QVVA 3WXMA 2H16A 1U94A 1KO7A 5EE5B 1UKVY 4O2LA 4RJLA 4F91B 2O0HA 4Q4HA 1OIWA 3ADDA 2VHUA 4IDQA 1CP2A 3R8CA 1OYWA 1KOFA 2F3RA 1AQUA 4C3ZA 5FTLA 4LC1A 4PO9A 1KKMA 5FI1B 1KO4A 1BMFA 2J87A 4XD7D 3W5IA 2WWWA 2ATVA 2DFKB 1C4OA 3CUEF 3GLHA 1OSNA 3GLHB 3BB3A 3FKQA 2P6NA 2DY1A 3L82B 3AVPA 1CR2A 3KQHA 3T1VA 3D6TB 3Q85A 1WP9A 3QKSA 2F43B 4QBFA 1ZVQA 2HF8A 4BLQA 1TNDA 4MRNA 2QRZA 4YMUA 3KXLA 2YVUA 1GL6A 2ZREA 4C9BA 1J90A 4LGMA 3UANA 5KTYA 4BFXA 2QE7D 2D7DA 2JLWA 1MO3A 4B47A 2CDNA 1U8YA 4IXNA 1F3OA 2GNOA 5KNBA 4QHTA 3AP2A 2IX3A 4RCZA 1YZQA 2GBLA 2X8AA 5H70A 3DPUA 4DLUA 3GPLA 1ZU5A 3FKSA 4P31A 4RVCA 3WYGA 4M53A 4OQMA 2ZRLA 4CEHA 3SQXA 1SXJB 3SN6A 1IJFA 1HTWA 4A0HA 2ZJZA 3A4LA 3UG6A 5JJIA 1JNYA 3AKYA 4BRUA 2C95A 4HYYA 2A2ZA 2ZJYA 5C2JB 1QG4A 4NP6A 1KJWA 4LHWA 4Q01A 1PLKA 3FTQA 3DMNA 2W6ID 3FWYA 5JLJA 4JS0A 2XTNA 2HJGA 5EZ6B 5JBQA 4NE2A 1JALA 4TQ9A 1E98A 3ZS8A 4Z54A 1N6KA 3A1WA 2Q9AA 4L5BA 4ERNA 3C41J 3SJCA 4LV8B 3PIRA 3X1WA 1X8JA 3KXIA 3T1QA 1DVRA 3GCGA 5DGXA 1SXJD 2YWGA 3DKPA 5DI3B 1OFTA 4NCNA 5D3MB 4M4SA 1VYTA 1NKSA 2B6HA 4BQSA 4B75A 3LX8A 2VRWA 4URWR 1XMSA 1UF9A 2CK3A 3GJ4A 3GJ7A 4HUQB 3TR5A 4DBLC 4Q1CA 2OLKA 1T0HB 4DSTA 1QHXA 4A2WA 3AKCA 4GSYA 1G6OA 3I1FA 3K9LA 4TYQA 2OBNA 2ZYVX 3RRZA 5IRCD 3SJBA 3QI2A 1DAHA 3OIVA 4G5OA 2R6DA 1E0SA 5KOYA 4Q4HB 4LUCA 2H1LA 3ZIAD 4EFLA 2JDID 4LV5B 3AF3A 3VX4A 4BFSA 2VP6A 4MQBA 2AKYA 2Q3FA 2RGNA 4DRZA 1PLJA 1HH4A 3DVLA 1NVUQ 2ZJ2A 4U02A 3QPWA 2DFTA 2HT1A 3L8YA 1ZU4A 2GCOA 3R9IA 5H68A 1UKEA 3KQKA 4R2IA 3NIBA 2IT1A 4MRPA 3CRVA 2J7PD 4V02A 5EP3A 3HPQA 1VKJA 3QPUA 4LJYA 1TL7C 2ZRCA 3ND9A 5JWRA 4TT3A 4BRWA 1P72A 2CL6X 4EJSC 1NRJB 5TMPA 3VR3A 4ASUD 4QJ4A 3RVBA 2X19A 4F4JA 1OB5A 5FTMA 4B3CA 3DM9B 2XOKA 5FTKA 4KSCA 4K81B 4DEYA 1FFHA 3MCAA 4TQAA 4LDJA 1G291 2G88A 1GRRA 1E96A 5DN6A 5CITA 1E1QA 5KSOA 1GP2A 1H8HA 1W36B 4X8OA 2RGCA 1MRNA 3WMFA 4B34A 2OV2A 1XEWX 2RGGA 1JXOA 5HZHA 1N5KA 3QF4A 3P4XA 4A2QA 3C7KA 1P61B 2I1QA 2C99A 2QP4A 4LHZA 4HAVA 3WBJA 3FMPB 4NYMQ 3TIFA 3RLFA 1E2PA 2B21A 2OEPA 2C77A 2GBLC 5KSPA 1Q22A 4AIIA 1EFUA 1QZXA 3LBNA 4D6PA 3B6EA 1J7KA 2GVDC 4KI0A 4Q4AA 4CEJB 3IGFA 2QROA 3K0CC 3Q7PA 4RKEA 1UAAA 4PAMA 5FOXA 1Q0UA 2ZSBA 3AGPA 2FWRA 1AS0A 2ANCA 1X6VA 5BN4A 3K0CA 2F55A 3K70C 4UQOA 2ZUDA 4JLBA 5AJYA 4RD6A 5B2ZA 2ZJ5A 2VF7A 3KKQA 3QBTA 4Q7KA 3TK1A 1NBMD 5EE0A 4JVNA 4PO8A 2O8EA 3EIHA 3KKNA 5FBRB 1KK1A 2VBCA 3MG9A 2BCJQ 2ZRNA 2P3SA 4JYBA 3BRWD 4Q9JA 4ZPXA 4BLOA 2LWIA 2VF8A 4N0DA 2JA1A 2RGAA 1IN5A 2ZRAA 4F4CA 3LNCA 2DR3A 2P0EA 2YHSA 1UJ2A 2CHGA 1T3SA 4LJ8A 2C96A 1BS1A 5H8WA 5ELXA 1TUIA 2ASEA 3QE0A 3TLXA 1EWRA 1XTRA 2OHFA 4LHYA 4TLAA 3SQWA 3BAFA 3U5ZB 4QJ3A 5FUWA 3AQ4A 2AXPA 1CJKC 2FF7A 3QKSB 1KI1A 3NDBB 4HLUC 1XX6A 3ETLA 3IQWA 4JVLA 1GTVA 1QVAA 4D80A 3EAQA 3ADKA 4FCTA 4U00A 4I1VA 4JBYA 4W5HA 1NN0A 4II7A 1VCMA 4TTRA 4Q03A 1ZJ6A 2OFOA 2P65A 2WKPA 4LHXA 4RY2A 1U90A 3MUFA 1WA5A 1ESMA 2H17A 2ZETA 4CEJA 1HURA 2Q9BA 3KZ1E 4GP7A 3QKTA 5TY0A 4D82A 4ZI3A 1AM4D 4YMTA 1CU1A 2OCPA 3UATA 4URVR 3KB2A 2KE5A 1QHNA 3U6BA 2ZI4A 2VSFA 1E2HA 4BFWA 5JSZA 3EX7C 4EPWA 2O8FA 1QHSA 3IIKA 4A1FA 2WJJA 4FW9A 2GJKA 3K0EA 3CNNA 4XWAA 4LI0A 1U9IC 5G3ZA 2RGEA 4W5JA 5IF9A 1PJRA 3LFUA 3UWOA 2R8RA 2O0JA 4HAXA 3VKHA 1ZYUA 2C9YA 1QHYA 2FA9A 3H0KA 5JECA 1YU9A 4Q1DA 2BMFA 4MH0R 1ZNWA 2NO0A 4NL4H 3TH5A 1J99A 4MRVA 1KAOA 4P4UA 3VR1A 2FG5A 5AJZA 3DOEA 1OFUX 3HU1A 2GEVA 2R62A 1ZM9A 1EXMA 2HT6A 4LWZA 1KI7A 1RPZA 5LDDC 4FMBB 5J4LA 3IO5A 2IHBA 1YR8A 1XDBA 1VMAA 4XH9B 2J0UA 2BC9A 2TMKA 4PQFA 2V6IA 3TSOA 2AN9A 3CX7A 4YMWA 1N0WA 2V6JA 4A0RA 1T5IA 5SZIA 3C8UA 4YQFA 1Z07A 3OE7A 4OK6A 3U7EB 4WXPA 2WJGA 2IUTA 3CM0A 3D31A 2GETA 4B2PA 1S96A 1BYUA 1QDEA 1G7TA 3UMFA 2YKGA 1E79A 3QEOA 4G01B 4TSFA 1GZSA 2KBEA 1KZ7B 2ZRIA 1G3UA 2JCSA 2R6FA 3LY5A 3OAAA 1KO1A 1WBBA 4ZV4A 2ECKA 4AYTA 4CT4B 3SFVA 1OXVA 3ZVMA 2QT1A 2MSCB 2KBFA 4F38A 3AVUA 4FMCB 4MGYR 4BLRA 2AK2A 4V0NA 2AXNA 3QVUA 1W4AA 3KTAA 3DDCA 1I2DA 3BD9A 4KJZA 3KXKA 5TB5A 1WE2A 1E4YA 2DFNA 2BM0A 4ACBA 5DO9A 3P1JA 1F48A 4GL2A 2IYQA 1VG9B 2QN6A 3TR0A 3U4QB 3PUWA 3AVXA 2OAP1 3GLIE 1JR3E 1JXMA 4DCVA 4DCNA 4OHYA 4IDHA 1TQ4A 3FDIA 5DYGA 1Z2CA 2QAGC 2G9NA 4DLSA 1D5CA 3RANA 2JJ2D 1ZM4A 3PUVA 1TAGA 2QY9A 4C30A 4ZDIA 1Q3TA 2BIFA 4V0KA 4JLPA 2XNDD 3PITA 5F2EA 2GK7A 3K0FB 1VDZA 2UKDA 1DG3A 3AUXA 4I81A 1XD2A 3RS2A 3TUJC 3R9XA 5KDDA 1X8LA 2UZIR 4HB0A 5EUMA 1C1YA 721PA 4TT3D 5EQTA 2GZHA 4AKGA 1XJCA 2VSXA 3ONWA 4QGAA 2P5SA 1NIJA 2IYYA 3BH7A 3KDSE 2ZJ8A 4IOKA 1NSTA 1F2UB 2G0NA 2RHMA 4XIGS 5CIWA 2YC4C 2W6JD 4NONA 3CRQA 5C18A 1NVWQ 1V5WA 1S8FA 1DELA 1IXRC 2PT5A 1PUJA 3KJHA 3QG1A 4AD8A 3SFZA 2OXCA 5KSYA 1TEVA 2GEDA 4JLMA 4WZ6A 4L4UA 4YMVA 4MYUA 1EFRA 3L8ZA 1GKIA 2ZANA 1Z6GA 1GRNA 1IOZA 2IXEA 4LOAA 4IEEA 5JI3E 4BZPA 3IBYA 1VCIA 2ZJAA 3HWSA 1WF3A 4KBGA 3RABA 4GOKA 3DM5A 3REFA 1F2TB 1XBTA 3LXRA 4KU4A 1GNRA 2VHTA 4TWZA 121PA 1ZAKA 2XSZD 1KHTA 3OF5A 1OH5A 1IY2A 3K09C 1XP8A 1TUEA 3TW4A 1X8KA 1KMHA 2FOLA 2DHRA 2NQ2C 1XFAA 2I3BA 2W00A 2GRJA 3B13B 1OKKA 1HQCA 5LPNA 5KYKA 3FMIA 4TMXA 4C2UA 4F7WA 4HDCA 4P32A 4CEIA 1EGAA 4KLZA 3NBYC 4NCHA 3WNCA 2OBLA 1GSIA 2D3WA 2XX3A 4XSHA 5AJVB 2A5FA 3X1YA 1M7BA 2R9VA 3LQQA 4BLPA 4ESHA 3AVYA 4WZAE 1N6OA 4FCVA 2J0SA 4WOPA 2ZS8A 1KIMA 5DHAA 1CR4A 3CB4A 5FUVA 1MR3F 1U8ZA 4L15A 2JATA 1ZNYA 2WSMA 4HDOB 2DBYA 2V54A 1TQDA 2WBLC 4N0EA 4QJ5A 2HUPA 4BLSA 4MDEA 2QMOA 3GLHE 4JLVA 1V43A 3D8BA 3SYKA 5L3QB 3SC3A 4FN5A 4P4TA 4MKFA 4NMMA 3IO3A 1IN8A 3CZPA 3P26A 4V0ME 4RD1A 4Q1EA 5FPYA 2MMCA 3WMEA 5F9HA 3I92A 2JLQA 2YNMA 3PJRA 2FJUA 2OCYC 2ZUCA 3KFVA 4PAOA 5JS7A 1GM5A 4RD4A 4IXMA 1AGPA 4BPBA 1P6XA 4POAA 2ZI9A 3AM1A 2IWHA 4DB4A 3EA0A 1P60A 1QG2A 1D9ZA 1WMSA 4BFVA 4U7DA 2W6JA 3T1TA 2GDJA 3BJIC 1JPJA 1U99A 2NO9A 5LD2C 2FFQA 4MKHA 3JZMA 4UNPA 4TQUS 3MJRA 2J59A 2A78A 3CR8A 1WXQA 2F3TA 1COWD 3KX2A 5KNDA 1WBDA 2IUSA 3I3SR 1G5RA 2G6BA 4P3YA 2JGNA 2WPDA 4YONB 3GEHA 3EC2A 1W4BA 3SJZA 3CPJB 3VU9A 3SZRA 3NEJA 4B2LA 1OT3A 4Z8XA 2VP5A 1T3HA 4B73A 1SGWA 1NLYA 5AJWA 3G0HA 1NLFA 1B0UA 1VTKA 2IS2A 1XJQA 4JLDA 5GJCA 3E2IA 1RRCA 2ZRKA 3WBKA 3AUYA 4B3BA 1NY6A 2BWJA 1GWNA 3HYTA 2FSIA 4QNRA 4TTQA 4XOIA 4FMDB 3IIMA 1Z6AA 2GTPA 4EIWA 5J4VA 5DSZA 3RDPA 4PPQA 1Z08A 2QMUA 4RZUA 4GMDA 1Q20A 4B48A 1P3JA 2NPIA 4IVRA 4RFSA 3EZ9A 3ND8A 4R9UC 2A5JA 2NOAA 3CH4B 1HE8B 3DL0A 3RS3A 3EPKA 3BK7A 4JSTA 2ZROA 4ZO4A 1SKYE 4BUJA 4CIDA 3TE6A 1R10A 2GAAA 4XWKA 3T61A 4BASA 1VG1A 1IM2A 3GLIB 3B60A 3QQ5A 4LYJA 3IHWA 3I62A 1VIYA 1AIPA 1QHGA 1Z3IX 4JLAA 2QQ0A 4RD0A 1W36D 2O8CA 2VYFA 1N0UA 3ASYA 1KI6B 4Q48A 2QU8A 5EP4A 1ESNA 1Z6TA 2CK3D 2UVQA 1YJ5A 1KY2A 4QBGB 3SHWA 3U6KA 1XNJA 1Z06A 2IHYA 3AP1A 3K09A 3NEYA 1KZGB 4RZXA 5J5CA 4LJ4A 5HE9A 3THOA 1UBEA 4MA4A 2D62A 4WZBE 5KUTA 1G5PA 3OIUA 1O3YA 3A4MA 3GJ3A 2WSSA 3KJIA 3N5CA 3BBPA 3I61A 3R20A 1KSJA 4DT1B 2FFAA 4V0MA 3NG1A 4YMSA 1N5IA 4JMPA 5FOSA 5JWOA 3QSYA 2WWIA 4H1UA 4LBYA 3WNDA 4KYUA 5FL3A 2FE4A 1ZRHA 2VIIA 2YWHA 3CWZA 3KFXA 1DAGA 1QVRA 3IEVA 2VA8A 2X2EA 2VQSA 4HSEA 4KXFB 1E0JA 2OFWA 1Q44A 4DSOA 1UDXA 5FBLB 3WY9A 5BN3A 5BXQC 3WNBA 5J47A 3EWSA 3FFBA 4FXPA 2ZM5A 4D2IA 3QG5A 4UXHA 1CRQA 4A6XA 1CULC 5K8IA 4E07A 5B64A 2FSHA 5C4MA 2QG6A 4EFMA 4B3XA 3W3AA 2QGZA 3U7FB 1UKYA 4BFYA 3QY0A 5EP1A 2B92A 2J5XA 1DO2A 5HR5A 2QSZA 3PG5A 5K8TA 3NH6A 3PEVA 3P27A 1OIXA 1P4SA 3RC3A 1I4TD 1KMHB 4TMTA 1WQ1R 1P9RA 2ZI5A 3B1WA 4GOXA 1XTQA 5BN5A 3MSXA 1JECA 2J0UB 1GAJA 5HE8A 4XVUA 2ZI6A 1TEXA 2QT0A 2EW1A 4B6EA 1S1MA 3SOPA 2IL1A 2PZFA 2GCPA 1BKDR 3MMPA 2V9PA 5SZJA 2UZ3A 3L2OB 4JZKA 3OIWA 5CYOA 4ZDKA 5JEEA 3NHAA 3VQTA 3OEHA 1A5TA 4D4KA 1MO4A 2HEIA 2ZJOA 5FPKA 4GDFA 1AZTA 2QENA 3FGNA 3U2QA 1E2FA 1G3QA 2YYZA 3PUYA 4Y0AA 4NH0A 2J7KA 3I5XA 5AUQA 1KSGA 4DCTA 2REBA 3FHCB 2GJ9A 3BB1A 1CS4C 2OFXA 5JZVA 2JASA 5IDVA 3LO5A 3FHOA 2YINC 4Q1AA 1W4CA 1FTSA 2VEDA 3QJYA 2RHDA 2D4HA 1GIAA 1Q57A 2OXRA 4FD2A 1C9KA 1S2MA 3Q72A 3GQBA 3CF6R 4GBMA 3SU8A 2QP3A 1KKLA 4D0GA 1TQ2A 1JQJC 1T5LA 5LBIA 1GDDA 3ADCA 1RIFA 3CIOA 4QKQA 4EJSB 1ZD8A 1DAMA 1PZNA 1UBFA 1YQTA 2EWVA 3QEJA 4M9XA 3ZZ0A 8OHMA 1Z0DA 2D06A 4DEXA 3QXCA 1UBGA 4TMKA 1FMJA 3NBZC 2F1HA 3V4FA 4MYHA 4D81A 3CH5A 3DOFA 1B23P 2GWHA 3GEIA 3G5UA 4AY2A 2O8DB 4YXWD 1U2RA 2AD5A 3BH6A 2WICA 4KFUA 4M21A 3GLFA 1UBCA 1P9WA 4KBFA 3FFAA 4E09A 3R7WA 4JJZA 3W9YA 5JJKA 1ZM2A 1YZUA 1IN6A 2IF2A 1G64A 1SKQA 4KLNA 2GESA 4NKRA 1IN4A 1II8A 5FPHA 4M1OA 4XTRA 4Z1MA 3LVRE 4EKDA 5CM8B 3ZVLA 3A1VA 2Q6TA 2R6CA 2H5EA 4DZZA 3MFYA 2AWNA 3W8RA 4PHHA 3NWJA 3PR1A 4WAUA 3FOZA 4DDTA 4HB2A 1MABB 2V1XA 1L4YA 2QPOA 4CRWB 1NN1A 1VYUA 3TMKA 1XZPA 1E2DA 4MYCA 2V4ZA 1G7CA 2B7BA 1R6BX 2V7QA 1N6LA 1DBSA 3CPEA 4LCBA 4RD2A 1XTJA 5HKKD 3GD7A 3LA6A 1M7HA 1VHTA 4JLJA 2IYVA 1F60A 2AR7A 3L0PA 2PLFA 4LK2A 4OKSA 4Q4AB 2QZ4A 4WBSA 1SVIA 3QIAA 1Y63A 2QGNA 3EZFA 3Q5EA 4FWIB 3B2EA 1EX7A 1IY0A 1W47A 2AL7A 2ZE7A 1CEEA 3AVVA 4B33A 1Q21A 1HA3A 1E1QD 2CLSA 4LSGA 2FGKA 2PX0A 3TAHA 3WYFA 2ZI7A 1N5LA 3CRW1 3OEHD 1XTSA 4CYMA 5FPSA 1VCNA 1XF9A 1IHUA 1TPZA 4D4MA 3AF4A 1G17A 3W34A 4LYFA 1D6JA 3U3JA 4XSGA 1D2MA 2J3EA 3TVDA 3PCRB 3VAAA 3B9PA 1N6PA 2IYLD 1P9NA 4HUQA 1P75A 2EFCB 1G9XA 3TKLA 2D2FA 3CLVA 4PSAA 2DFLA 1SXJC 2LKCA 4HZUA 1FW6A 3OEEA 4BWYA 2DB3A 2BBTA 3VU9B 1N25A 4KCGA 1ZNXA 1TU4A 1QHHB 4IFBA 3SNHA 2CCGA 4PHGA 1KGDA 4MYTA 1KI3A 3WRYC 2J0QA 4RSGA 1H65A 4US0R 3A1TA 3K8YA 5CLQA 4QG7A 1U81A 4CGZA 2FEMA 1NN3A 4M1TA 3L0IB 4R2HA 5E4FA 5GJWC 1T0JB 4WW0A 4C0HA 5AUNB 1DAFA 1R8QA 5DN6D 2GXQA 3ZLJA 3I72A 3VX3A 2CHVA 1I4DD 3OHMA 3FMFA 4BFTA 2ZRPA 4TMWA 6Q21A 1P5ZB 2WOJA 1NLZA 2FH5B 1OW3B 2WOOA 2GKSA 3KJEA 3L0OA 4TL7A 1UEIA 4OQXA 4IJMA 1E2QA 3SS8A 3D3QA 2F7SA 4G5RA 1VECA 3BS4A 3UMSA 2LCFA 2Z43A 3LW8A 1QBKC 4OI4A 1PLLA 5J4HA 4HATA 5L3QA 2CL7X 3ZYCA 1GG2A 1YRAA 2GJAA 2IK8A 1OFIA 1VIAA 2FDCA 1E1RD 2XB4A 4W7SA 4IOLA 4AG5A 4LJ9A 1Z0JA 3H2YA 4P0TA 2F6RA 1N3BA 4JJKA 4JBXA 2EFDB 1US8A 5DYIA 5F9FA 3VR5A 4JL5A 3W8NA 2REXB 4GFDA 4M1YA 2IC5A 4EFNA 4KYIB 1XXHE 1G8HA 3RSOA 1DAEA 5FOVA 4C0KA 2C8VA 2G1KA 4HAYA 5EXPA 2ZSEA 5EZ5A 1SHKA 3NC0C 5BYJA 1G41A 4ZDWA 5P21A 3RS0A 3TGPA 1P7CA 1PVOA 2ZSAA 1EFCA 1YRBA 5JCPA 4PAQA 3NDPA 4TLBA 2EYUA 2OCBA 2ZTSA 3REGA 4RZ2A 1IJEA 5CDFE 3QXSA 4OQLA 2QTFA 2B8TA 1A4RA 4M22A 3VR2A 1R0YA 2GXUA 5DNYB 2G1JA 3CRRA 4C4PA 2AWOA 1II9A 5FL7D 2NO1A 1RYHA 4C7OA 1MO6A 2VL7A 4EPVA 1YR7A 1YZGA 1K8RA 3FYHA 2J0VA 3UWKA 3RC8A 3CPHA 1BMFD 3U61B 3AB3A 3R7WB 1EFRD 4CVNA 4A15A 4YDHB 1TMKA 1Z6YA 4LJ6A 4HLCA 2KI5A 2BEJA 2RB4A 1UM8A 2W0MA 4RZ3A 2C2HA 2BJVA 2W0SA 2V7QD 2KWIA 2SHKA 2O8CB 4G5QA 4YXWA 4A82A 4ZDJA 2J7PA 1KDOA 2MSEB 3K0AA 1JJ7A 1Z47A 2OT3B 2W6IA 3D7MA 4LV6A 1E32A 3X1ZA 3QPVA 4IRUB 3U44A 3WHLA 1GITA 3GFOA 1ZINA 1NVVR 1AGRA 2OLJA 1P2VA 5JHHB 4PHTA 1XPOA 4IVPA 3DO6A 3G82C 4LBVA 4TYWA 5CK5A 4NYJQ 3M1IA 821PA 2C04A 3KQNA 4WVFA 1HQYE 3AP3A 4PFSA 4QXAA 3V4RA 4R7ZA 1ZUIA 4IW3B 3GLGE 4LX0A 1ELOA 2ATXA 2ZVPX 1KY3A 4DIEA 3P32A 2XTMA 2IS4A 4AKHA 4MRRA 1W0JA 2NG1A 2V8OA 2WV9A 1RJ9B 4G1UC 3C5CA 3V9PA 2JLYA 3CKLA 4EAQA 1H8EA 4LYAA 1NI3A 1ODFA 1WRBA 3DEFA 1ZUHA 2ZR9A 4HUTA 1XXHB 3BFXA 3DKVA 4H9GA 1IONA 2H57A 2HF9A 5AK0A 1YZKA 5JRZA 2V1UA 2XZPA 4B3GA 1YE8A 1R4AA 3T06B 1OB2A 5C46F 2JLVA 3LXXA 5HCIA 4I1OA 3WHKA 4AKEA 4A0GA 4Q7JB 3FVQA 2ZIAA 2BMDA 4IEIA 1P2SA 3CRMA 1Z0KA 1OKKD 2NIPA 3RWMB 3K70B 2ODNA 5EXSA 3EZ2A 3KJGA 2PMDA 2C9OA 4KFSA 1CIPA 1DARA 5FBVB 1E3MA 2W2TA 5KPJA 1J8MF 1D8TA 4A6PA 1DPFA 2A5DA 1U0HC 2F9LA 4DDUA 1FTNA 5D3MA 4DLVA 1M1YE 3H86A 2VP4A 4B3FX 5IT5A 2A9KA 2GCOB 3PEWA 3O8BA 4A2PA 3IUYA 2JIZA 2GHIA 2BHRA 4QL3A 2QTVB 5IK2A 1T9HA 2JLRA 2HV8A 4DLWA 2EWWA 3C5HA 2HXSA 4LY6A 4QHYA 1CJVC 4JVMA 1FOEB 5GVSA 3QKUA 3THWA 5A0FA 1SVLA 2JDIA 4X8HA 1RRFA 4ON9A 2I4IA 3A37A 5F3WB 2YOHA 4HZIA 2PBRA 4OHXA 4HI0E 1FZQA 5K8LA 1M8PA 3TNFA 4C0BA 1N6HA 4BZXA 4DHEA 5EE3A 3LD9A 1GL9B 1LF5A 2JJ8A 3ZQ6A 3TSWA 2XZLA 4CZ2A 2IYTA 4BLTA 5ANRB 2WWHA 3ZS9A 4AG6A 4GPTA 1II0A 1ZW6A 1MOZA 2LKDA 2GAOA 2IXFA 2XAUA 4MKIA 3KUDA 1ZM3A 2FN4A 1KTVA 2C9CA 2XTZA 3X1DA 4US2R 2OE2A 4MUBA 4PHFA 4QOSA 1NJFA 4IKEA 4B43A 1OV4A 4OK5A 1CJUC 1Q1EA 1W0KD 2NPFA 2DWQA 1EFHA 2OAQ1 5DLQC 1S0UA 2O5VA 3UIEA 3AVQA 3HJNA 3PEYA 4DKXA 1FQJA 1SVOA 4TTPA 4DB2A 2R6AA 2NMVA 1HY3A 1Z8FA 4IDOA 5EXTA 4ARZA 1G5TA 1E99A 4FI3C 4PC6A 1KK0A 4M9ZA 1W36C 1CXZA 1NF3A 1Q1BA 1Z29A 2QP9X 3EC1A 1YVDA 1CJTC 1CBUA 1YHNA 1PV4A 3OIYA 3JVUA 2FPMA 5KHOC 2ODBA 2W2XA 4DVGA 1JAHA 1KI8A 3BXZA 3T12A 4OQNA 5FR1A 2QBYA 1RW4A 4PQYA 2IWRA 3QXXA 1YR6A 1FX0B 1EWQA 4TLEA 3M6AA 1R5OA 2WWFA 4K8OA 2FSFA 5M04A 1BH2A 3VKWA 3MAAC 1S4QA 3PVSA 1T6NA 1NBME 3CX6A 2QM7A 3NH9A 4TL9A 3T15A 4JVSB 4B74A 1F5NA 1VYVA 4Z8YA 3X2SA 5JS8A 2E9SA 2GVZC 1CKEA 4BECA 3BH0A 4P4SA 2XNDA 4MITA 2IYWA 1T3LA 3QKRA 1PUIA 1W1WA 2FMXA 2GEUA 1BYIA 1G4UR 3IPXA 2G3YA 2YOGA 2JEOA 1FNNA 2F43A 1AA9A 1A2BA 4XVRA 1US8B 4QGHA 4LYHA 1OIVA 1XD9A 2C03A 2WWXA 4A92A 2IF0A 2IXGA 4MUAA 2J45A 3Q3JB 1XTIA 5LB2A 2QORA 1ZC4A 4QHSA 2C98A 5DISB 2HCBA 3CONA 1LS6A 1Z6XA 3QOFA 4RFSB 4AC9A 2F1IA 3W6NA 1R2QA 2P6UA 1P2UA 3L43A 3S1AA 3AF2A 1O87A 4IDNA 2RAPA 1CR0A 2D7CA 4IOMA 3P20A 3LRPA 5G41A 3DZDA 5TDHA 3LQRA 2CBZA 5L3RA 3U3OA 3X1XA 1OPXA 4PPGA 4MDFA 3EARA 4TSFD 1TADA 5KNCA 1W7AA 4HAZA 1JEEA 2X1VA 2JLUA 1IN7A 3K53A 1SVMA 3VHXA 1CTQA 2QRNA 1K5DA 1W5TA 1N6NA 1ZD9A 5DI3A 4KVAA 1AN0A 3VHLB 2ZSDA 4XVQA 2AKAB 2F1JA 1E9AA 1P2TA 3OFND 2WM9B 4CW7A 4G0NA 2RCNA 3RHFA 4PC1A 3BFVA 1Y3AA 5FH9A 1G4AE 2N1BA 3OZXA 3B82A 3FHTA 3FB4A 1SXJE 2D74A 5FPTA 1TF5A 4R98A 4ILEA 3ZZUA 4ASUA 4HB4A 4BFZA 4AYWA 2RH5A 1GKYA 4L9WA 3ZDQA 4QBHA 5TXGA 5DH9A 1GNQA 1WCV1 3TRFA 3KKOA 2P5TB 2K5UA 1CRPA 2BDTA 2CCKA 1E1RA 4NCJA 5DIFA 2L0XA 1G21E 4QGFA 1R5NA 3A1UA 1MABA 1JBKA 1E2LA 2IBMA 4LJ5A 3SDZA 2XITA 1KO5A 3W6OA 1XD2B 1G3MA 3Q9LA 1G8FA 2QQEA 2O52A 1IBRA 3RWOA 4DSUA 3QBVA 1P73A 3SR0A 3EZ6A 1GNPA 5K8UA 4DUGA 2XNSA 3UMRA 3I73A 4RFVA 2O8BB 3ZD6A 3AKEA 4IVQA 1T8UA 3A36A 2R44A 2CNWA 2ZEJA 2VO1A 4EPXA 1E2GA 5E7MA 3AF1A 5CB8A 3MWLA 4LJ7A 1S9HA 3AV0B 2WSSD
chains in the Genus database with same CATH superfamily
3QHPA 3A6GA 4QOFA 5AQ1A 4UNIA 2OZPA 2ZSJA 2QUHA 3IEKA 5PNTA 1DEKA 1KDRA 3S7ZA 4QWMA 2VSOA 4WNIA 1JEOA 2HQSA 2XJ9A 2PLRA 2RGYA 3PQEA 4TS9A 2AF4C 3RFTA 2AHOA 1PWZA 3IALA 3DL7A 2W93A 3TF5A 3IMEA 1OBHA 2QLBA 5J2TA 2Z6AA 4QM6A 3LM8A 1WD7A 3V33A 1ISGA 1EK1A 1VC2A 2W4QA 2AEMA 1QQ7A 2PSDA 3ZVNA 3FMVA 4ZWNA 3RC2A 2E87A 1EFVB 1V48A 1JDNA 2HF2A 3E53A 1ESDA 2LBPA 1XEXB 2PCLA 1IB6A 3NC4A 3IEUA 1RYBA 4Q19A 4V2UA 3T9EA 5CCEA 1MO2A 4MKGA 1DU4A 1NKTA 4H7FA 3O95A 3UTCA 4GQBA 3AI1A 4D26A 3D6JA 1JQLB 1BQ3A 2VK1A 5DM4A 3WHPA 2PBZA 2ORWA 1KZ1A 3T95A 1IXSB 1WWKA 4MGKR 1WABA 1GKUB 5TQ2B 4RHTA 5TVKA 2CKMA 4V1CB 3GMIA 5A3VA 1QCCA 4UEWA 2XD9A 3GP8A 2I66A 1UKZA 5C53B 1J8YF 5KCMA 2XGJA 1CUAA 5EIAA 4R54A 4HNUA 4AIRA 1KQ3A 4B71A 1Z5ZA 4IX9A 4HNQA 2FETA 3OOWA 4ENPA 5HIKA 1G98A 5D5PA 4D57A 4PTLA 3MAGA 3SEZA 1L4UA 4FDAA 5JS6A 2O8EB 5ALIA 3G6WA 5CEEA 4NYMR 2EL9A 4BBPA 3ZGXA 1T9DA 4N3BA 2ZWAA 3ORSA 4FSHA 1K4YA 1GRQA 2OG2A 3NI2A 3TRJA 1VL0A 2CJWA 1HDOA 2DPLA 2G83A 2NU8B 1SUIA 4F84A 4ZC1A 1YBMA 4TXJA 5AKEA 2WPNA 5HEKA 4CR6A 1Z0SA 3EPHA 4EB0A 5KYNA 2XCOA 1DC3A 3HABA 4K87A 1UFQA 4LRYA 2J5RA 5CBKA 1X8XA 5A3QA 1U1GA 1FXWF 2PVSA 1SM4A 5TQ2A 2QMYA 2EJCA 5L4LA 2ZJBA 3K72B 3MIZA 4P83A 4GI7A 4XM1A 3PXGA 4JDUA 3MJFA 5SYAA 4ZCIA 1PJ2A 4DREA 4Y2PA 1R0WA 4H1VA 3GLFE 5ARCA 2VUUA 4E5SA 3I9FA 1ML3A 1YR9A 3GPDG 2HSEA 5D1HA 2GLUA 2L69A 2RMKA 3AL3A 1PL6A 5CA1F 4BGDA 4WA7A 5TPZA 3WFJA 5BNZA 4BMOB 3KQMA 2Y8EA 3B1ZA 2G4CA 1KI9A 4OYYA 5KYUA 3HZOA 1P2BA 1SCQA 4AJ9A 5BWLA 4NVRA 1PWEA 1JFLA 3NIWA 4MV3A 5DWQA 3SVZA 3T7SA 4DNXA 5AVSA 2QTRA 3D0RA 4BNLA 1U3FA 1LX7A 3DO8A 5G3YA 3KLNA 2XAAA 1XCPA 4WXEA 3FRIA 4PGHA 1KJJA 1Q83A 1EFLA 2WZQA 2ZRGA 2W2OA 5CYPA 2XSZA 3GNTA 1NYTA 4MPPA 4P7KA 5B1YA 1EA5A 2ETXA 1CQIA 1L1RA 4NTZA 3AF6A 1AQLA 2JRCA 1Q0RA 4A5OA 2PJDA 4C78A 3TD9A 1QFZA 2H51A 2JANA 3B1FA 2VJPA 2YQ4A 5YASA 5B30A 5K03A 5K0NA 3PF8A 1TXGA 3RJZA 4Q1FA 5LZ7A 3MMNA 4ZTZB 4EY8A 5G40A 1XTTA 2YR0A 4F6RB 2V7XA 3VDXA 4BNMA 4Z1MD 2VI5A 5K0GA 2ZRMA 4FNGA 5HIMA 1Q12A 1RWKA 1PK9A 2NVUB 3O91A 4DXAA 3QX3A 1HEIA 2Y0PA 3S27A 1H2WA 3AJRA 1GFZA 1PFYA 8ATCA 1GV1A 2G6TA 4L74A 4DCOA 3OCXA 4A27A 4WVLA 2Y1DA 4IR7A 3PJEA 4CQMA 4RVOA 4JI4B 4CG2A 4RKFA 1UXOA 4L8YA 3C74A 1Z28A 3BPSA 1HFKA 3UUGA 2VYVA 2P35A 1UDRA 2VDKB 3EJWA 2W8BB 4IIDA 1KPIA 2GHTA 4REOA 2X8JA 2XE8A 2EWMA 4ALKA 4CKCB 3AUAA 1JQ5A 4R1TA 4LOKA 3KTFA 1Z0IA 1USGA 2P9HA 3Q8XB 3IQHX 3BIFA 1ZM7A 2JIZD 3PYXA 3THSA 1O6GA 2ZWPA 1VL5A 4IYJA 4CF5A 1UM9B 2H9YA 1ZOIA 4OHUA 4P08A 4RDCA 2CL5A 1JRLA 1M7GA 1S3GA 1XYVA 4MEBA 4ZVNA 3SPXA 1NQUA 1QR6A 3VHRA 1E2IA 3E1SA 4O2BB 4RKQA 4ZCMA 2ILTA 3MS7A 4FEYA 4RK6A 3RC7A 4UHBA 2GM3A 5ISMA 4BOYA 1TX4B 2WAAA 4Q5IA 4R2XA 2YWRA 1NBOA 1W44A 3FWHA 4HNVA 3KPJA 3H04A 1XTUA 2YOFA 2ZAMA 1IWPB 3E15A 4TTTS 4RDXA 3MD9A 4PC2A 2CBXA 3PICA 2QLTA 1NY5A 2I9PA 4YT2A 1YFJA 3U4HA 2IYRA 3LT5A 4ITRC 4YVFA 1ULAA 3NVAA 3K15A 1JAZA 2IEBA 3QJ5A 2W2VA 3QXJA 3GLGB 1BNCA 2Z0MA 3B1YA 1OXKB 1I8TA 4MUHA 5M29A 1THTA 3DMTA 1W6RA 1JJBA 4UNQA 4MVJE 4AJOA 1WCYA 2FYTA 3I5YA 5FOTA 5E2AA 4IICA 1Z22A 4U8GA 3TLBA 4XQCA 3WGNA 5LP6A 1NVDA 3D8HA 3EXAA 2OV1A 1A69A 2VZLA 3BEDA 3VR4D 3I0MA 2VRBA 4BVFA 1E0AA 2H5JA 3RRMA 3OF3A 2ZUSA 2M98A 3UK6A 1X7ZA 1V4BA 4I4LA 4RNCA 4KNWA 4KMOA 3CJRA 3KLMX 2HYDA 1T5TA 1K92A 3WGKA 4DLSA 1RKBA 4ENWA 5H9WA 1H1LA 4EELA 5KMGB 5LDHA 3JQ7B 3QI7A 4V0OA 1GL7A 3LHKA 3N74A 5KU1A 4UZFA 3R3VA 4GX0A 4NARA 1Z75A 2BZ0A 4XTCS 1V39A 3P96A 1EUYA 2Z30A 4E94A 5I5EA 1VJDA 1YS4A 2PO7A 2BLLA 1VPLA 2O4CA 4LVUA 1OROA 1NIPA 2H7VA 1E6CA 1KAQA 3K05A 3KDPA 1YUNA 3O4FA 3B1VA 4FHFA 3FLBA 4GPD1 2YXLA 4LJKA 1ADFA 4RQTA 5EJMA 2OA0A 4CQJA 2CZQA 1EWVA 3OQMA 2ZS7A 3P9IA 1WKCA 1N9KA 1KGSA 2JK1A 2LTAA 4M1MA 2JAQA 2JIRA 3PFIA 4IDBA 4M89A 5BRNA 4KVGA 4N3GA 3TCXB 2X40A 5HUQA 4RTOA 4EFKA 2YDXA 4BX9A 1QQBA 4AF8A 2G82A 1G2IA 1DFGA 1QIJA 2HGSA 3GH1A 4HH1A 1BX1A 4MV4A 1FP7A 1T9ZA 4B8YA 4G36A 2BCGY 4CEIB 4PBSA 2I6SA 2ODTX 1XRMA 2GERA 4P3KA 3AL0C 4C5AA 5JFGA 3EXHC 2K2QB 1PZMA 4NICA 1X7ZB 4BVEA 5HUHA 1LH0A 2OBBA 3AWIA 3L5KA 3WFZA 2AK3A 2TMYA 5ALJA 2JJ2A 3JPWA 1XLTC 1JHRA 3RU9A 4HMOA 3CVYA 1ZIXA 3ED1A 3OWXA 1D7OA 3K32A 2VWPA 1BXGA 5L53A 4OUKX 1K68A 2HWYA 3RRFA 4G41A 2JI7A 5BVHB 5LM3A 2XZOA 1V8FA 2QAGA 3OKFA 4Y6LA 1FFBA 1GN9A 3TW6A 1KSFX 1AO0A 1RC8A 4DN6A 2ZVQX 4Q9LA 3B7PA 2P7HA 5AI6A 3QNUA 2J46A 5ALVA 1XQVA 4HAWA 1PFQA 5AHWA 1S9DA 1RNLA 1D2RA 4E2YA 2OGWA 4B32A 1WCWA 4F2GA 3I5UA 1WG8A 3U7HB 3OLXA 3HBLA 2M9MA 3NIDB 2LXNA 3EGCA 1N2SA 2HJ9A 4X3PA 4ETIA 1YKGA 3TSAA 5KYXB 4OSOA 4UHHA 4BKPA 5F77A 2O0KA 1W29A 1P91A 4Q4JA 4UTPA 2PH5A 4H4EA 4NIMA 4GR9A 4FE7A 4AROA 3R7NA 1FFWA 2WFLA 4DCUA 5KVVA 2QW8A 3GB9A 2OQ2A 3S55A 4FD3A 4PPFA 1GFSA 4CG3A 1MJGM 3L3BA 4ZAZA 3FF4A 4U7JA 3P9YA 1DKRA 3N2KB 4FDTA 4CEHB 5E3JA 2QSYA 4ZAXA 2ZE6A 2WYWA 2Q1SA 4DY6A 4DG5A 1KHHA 2A9PA 1EHIA 1KJ9A 4IKOA 4WPGA 1JU4A 3THYA 3KB1A 3KOUA 4NFSA 3LPAA 1EB9A 1QGOA 4HNRA 4OXIA 1D5WA 1BO6A 3LLVA 3P2YA 2O2YA 1WF6A 1LBQA 3DL4A 5IJAA 621PA 3EIQA 5K0LA 3OUZA 3TTVA 3IXQA 3TQFA 3GAFA 3OQBA 1KMQA 1D4OA 4TXNA 3U17A 3U13A 3R09A 4N8SA 4G0PA 5CCBA 4UQPA 4HQKA 1NWHA 1C3OA 1ACJA 3OCVA 2I3GA 4RXMA 2NAFA 1AXGA 4BJ6A 4C04A 4CUKA 2IE8A 4KXMA 4W9MC 1IZZA 2EFGA 3T5DA 4QECA 1M2JA 1Z36A 2FPGA 2P9QA 1F2VA 2HBYA 3FVRA 2GN1A 2Q0HA 2VDMB 1KI2A 1RVDA 3I52A 3T7AA 3F4LA 1Y5MA 3K71B 1MAAA 3AR5A 5KQPA 3U3MA 5E3HA 4EVIA 5C5IA 4LJSA 1AK2A 3W2TA 3MTAA 3S28A 5E7IA 3UMJA 4BP9A 3G23A 3FPAA 4FDVA 9LDBA 4NZZA 2ODAA 4BLWA 4F04A 5BN3B 1WU7A 4EPTA 4DJDC 5AK3A 2CCJA 5C34B 3HXMA 2CNNA 1GCOA 4EX6A 3NT4A 5EMNA 1NBMA 4OHRA 1C7RA 1JPNA 4OF4A 4QSHA 3KR2A 3NWBA 3OTGA 4QE3A 1OCEA 4DWWA 3DLTA 1K7YA 4IHAA 1NZJA 9ABPA 4RWEA 1QRTA 4H60A 3PV0A 2PSFA 2KPOA 3ILXA 3VDRA 1ZONA 2WU0A 1WNFA 2NZ8A 2V0CA 5I9IA 2NO7A 2OVFA 4UDYX 4QPJC 2W22A 1QP0A 4OB7A 1N2CB 1XL1A 3FNHA 4US1R 5DBHX 1N8NA 1JR6A 3MQ2A 3FDZB 1XQ6A 3BXEA 3RS4A 2FKAA 3UBMA 3HB7A 1OHHD 1UINA 1E4VA 1GGJA 3JVVA 1CJBA 2H18A 1RHRA 3RE1A 4OAQA 1DHRA 3PE6A 3GMTA 2DPGA 1XEFA 1ZUNB 2G4LA 5HIAA 5LJIA 3TLZA 1NN5A 1PJTA 2CHUA 2BCEA 4UOEA 1TZJA 2EW2A 3JQ8B 4EPRA 5AOBA 2RBEA 4TV8A 3LLUA 1HE4A 2EU8A 4AT1A 2GGSA 4DJAA 1RFGE 1U7UA 1YFLA 3V2GA 1EBBA 3A4NA 4I9FA 5DGCA 4DIKA 5CB6A 2Q4TA 3U4CA 2JJ1A 1GTZA 4F3KA 1U5CA 4OAPA 2FNAA 3SLKA 2BR5A 1F20A 1EQAA 5JEDA 3HEMA 1RE0A 2EKBA 4WRRA 4JX9A 3BC1A 1M72A 3TAUA 2A33A 4A4DA 7GPBA 3VSCA 4DMGA 4XIIA 5JUWA 3PJFA 3WLHA 1GT6A 3U1VA 3ECSA 3GGOA 4OI1A 1VE6A 2IIQA 2DFVA 3B12A 3I2KA 1MH1A 2O9JA 2ZRHA 4WMLA 4QLAA 2OR3A 1C30A 1OA1A 1QV7A 2NXEA 2AQHA 2ZBVA 4KN8A 4WA8A 5AO9A 5ICFA 3P2OA 2AHRA 5AVOA 1Y3FE 3TLCA 2WU3A 4E14A 3RYCB 1SO8A 1UPFA 2BBSA 1YTUA 3GP5A 2PYDA 4HWSA 4EVSA 2RGDA 1Y5RA 3PC6A 3KUUA 4PGMA 5B4TA 2H8KA 4LAFA 3QF7A 2QA5A 2VHJA 2XPCA 3FFXA 3OX3A 3N0WA 1TIKA 1VIVA 1W35A 5TV2A 3ZDFA 4ZI2A 4UAUA 1POWA 1ZIYA 3AK4A 4JFRA 2RGBA 2WP0A 1V5IA 3T1OA 4ED9A 3ZVKA 3SZUA 2E4VA 3ICEA 2NSJA 4LECA 1TU3A 2QPAA 4YIKA 2IYZA 2XHZA 2XMCA 4BKUA 3IA2A 2QN2A 3BWYA 1T4CB 2X7XA 5K3OA 1OI3A 4FCWA 1M0WA 4LOLA 4IH4A 4OAOA 1ZK2A 5HKLA 3S7TA 4TTAA 4YCCA 3ASVA 2CLDX 3ZGLA 5KTSA 2VXOA 1BN6A 4OHFA 5AKYA 4ENVA 4N82A 2WJYA 3LXUX 3FBGA 1Z7YA 3BE6A 3IV6A 3AIIA 2ZSFA 3RPEA 3SX0A 3CE6A 2XJ4A 5A05A 1EG7A 3CTPA 5T64A 1EVJA 1EGHA 4UTRA 1KK3A 1HQKA 2WF9A 1PNOA 5EOVA 4ECAA 3L92A 3UGTA 2WKQA 1OYOA 1PEYA 4PZZA 1I30A 2VH2A 4OXYA 3CX8A 4C2TA 4OLBA 3V00A 4EHLA 3RSQA 5HGXA 1RZRA 4KVFA 4BFLA 1TD1A 3C97A 3QYPA 3BRSA 4HAOA 4JR2A 1P4HA 4NFHA 3ZWBA 4N1AA 3PEUA 1C0EA 4V38A 2FEAA 2GD6A 5HCNA 1JR3D 2PJZA 3OMXA 2XE7A 5LYYA 1FQKA 1MIHA 2WSYB 1TA0A 1Y9AA 2VNSA 3QENA 2WI8A 4ZVOA 4F3NA 2ZB3A 3QRWA 3W2EA 5E6RA 1KS9A 1T3TA 1JFFA 4AP5A 1QFJA 4YPOA 3D8TA 3HVIA 3O38A 4ZP1A 1DADA 1J2JA 2P1ZA 1P7WA 3ILYA 2Z1MA 5CGZA 2IHTA 1YZTA 4LSWA 3FDZA 1VPWA 3N8KA 4HF7A 2YX1A 4UEJA 5SY9A 3UMCA 3MGAA 2XVZA 1DXHA 4YCBA 5HW0A 1YRYE 1OLOA 1T0BA 3WGJA 4GOMD 3FTFA 1IULA 3AQIA 2OOSA 1B42A 4M0FA 4MICA 4C4TA 2G77B 3FE2A 4K05A 3A10A 1BD4A 2ZYTX 3HA3A 1JB9A 4RS4A 4AI6A 2QNRA 4HVCA 1WMBA 5LP6F 1QRUA 2GFIA 4IDPA 1GG8A 1JJFA 2B0JA 3WLJA 2V3CC 4YAJA 1QJCA 4IIGA 5ALFA 4C0WA 3PXCX 5A6VA 1EXDA 5JWHA 3PNQA 2PHZA 5C1BA 3WWDA 4FT4A 2AJLI 4G1MB 1MNQA 2AFVA 3BXXA 3MMZA 5HPYB 1R8JA 3PFBA 4O1MA 5C7LO 1M75A 3DHYA 3KJZA 1U0JA 3O8RA 1HX7A 5ALNA 4NULA 1HYQA 1PT8A 2KYRA 5B12A 3QKRB 4AURA 4WNCA 2QX9A 5D86A 3IX7A 1DL5A 1G8GA 1L7MA 3KWJA 4HNHA 4G6ZA 4LYEA 4ZODA 5TGZA 4BUZA 4O3MA 5GJBA 1NHGA 4E1AA 2VP2A 4DQLA 1KWKA 3CZAA 5TARA 3DLBA 2XQGA 2ZUVA 3OQPA 1Z39A 2OHGA 2Q45A 4D0NA 3RS8A 1DQPA 4DXHA 3NALA 4XVCA 1MENA 1I10A 2YIJA 1OMOA 1AZSC 2CF5A 2R00C 3CX3A 2DRIA 4L0CA 3VZPA 1OX4B 4QSMA 2O8BA 3I76A 1SG0A 1ZXLA 2YN2A 4L72A 2OCLA 2UZ0A 5IBCA 4G1BA 2VRNA 2DPXA 4M76B 1V11A 4G4SP 4OJQA 5I4KA 4W6ZA 4EJ6A 2C58A 2XLBA 3JVIA 1KYWA 3NHMA 5H02A 2NVOA 1G19A 1M0TA 1NYQA 2DFPA 1EK6A 3PR3A 3QVSA 4WFQA 2I1LA 2PWPA 3F47A 4CMKA 5A4FS 1B43A 1CFJA 2LE0A 3S1LA 1JSXA 1UWKA 2WJHA 5FBKA 3I8SA 5JCJA 1GUYA 4R16A 1E0KA 4V03A 1HT2E 5C5CA 1G5FA 5CK4A 4ENSA 3S2EA 3H1BA 2DWPA 1PGJA 4G5XA 1DIGA 2NUAB 4AWBA 1UJ5A 4F6LA 2FU5C 1X1AA 1DNPA 1KI6A 1U7XA 2YZ2A 1RQ7A 3Q7QA 2E1RA 1BMQA 2XUFA 3HI6A 5AHRA 1ZL0A 4MR9A 2VPTA 1PFVA 5J4YA 1LWNA 4WWHA 4DQ0A 3DJFA 3PFGA 3WADA 2PX3A 5EE9A 5SZKB 1L7EA 4RA6A 3SBEA 3DTTA 1C9NA 5DLYA 4PO3X 3C3KA 5EZYF 3H1GA 4DMRA 1OILA 3QFSA 5FI0B 4KQMA 5D5QA 4RADA 5TEVA 4FW8A 2J3LA 2OBMA 4EHHA 1TF2A 2HBQA 3WGHA 4ABYA 1RYZA 4L3WA 4XCVA 5AUOB 1C9DB 4Q9IA 5HZKA 1UXJA 1SHJA 5HJEA 4WKOA 1CJMA 1VKHA 1XEXA 3HE3A 4L7QA 3RVOA 3D8SA 4E5VA 1K7EB 4AN1A 4HZUB 3FIUA 4P4SB 2ZWVA 3IOEA 1NAIA 4NZOA 3DE2X 1CV2A 2B7LA 3TTXA 5KOHB 4XLLA 1E2JA 2CYCA 4MCIA 4CLRA 5TPZD 5DTMA 1E8MA 1IFXA 4E6PA 4BFCA 2QAJA 4DA8A 1NVMB 3JRWA 1PJ3A 1MKYA 4QFMA 4EQ6A 1OI7A 1N6IA 4DV7B 5DFAA 1PJBA 1WDMA 3LBIA 4HS4A 1VI5A 2WKSA 2R68A 4P54A 1XXHA 3ETGA 3O6VA 3ODGA 4MEJA 5MN4A 3X1DA 1QGUA 3BORA 1C2YA 3O8CA 3OOHA 3C16C 1BAPA 1XA0A 1NKVA 1Q1QA 2GF0A 3HCRA 3V8EA 5HCUA 3WGVA 2Q3HA 3G5AA 3QVTA 1ADYA 1Q74A 3MJSA 4YXFA 1LFDB 1RJ9A 4RMHA 3K0FA 1VE3A 5I7FA 1A5AB 4WLFA 5J2UF 5LD2B 2O8DA 1ZP6A 3B6ZA 1XG5A 1XFDA 2O0MA 1O94C 2VHQA 2QYHA 1ZD1A 4D0RA 1WR8A 3PUKA 4I2NA 4LQLA 5TRTA 3VYRB 1WMEA 1CUBA 4HC4A 3V1UA 1QCZA 2EKDA 4PX2A 1WXWA 4E13A 2A1IA 3E70C 4FBMA 2C2YA 4D02A 2O0LA 4MR8A 2GNPA 3AZOA 1E5QA 2VWGA 1RLUA 2FJ0A 4D9FA 2XXJA 4IAOA 1N92A 3OWOA 4EL5A 4DLKA 3DZIA 1S8NA 2D0IA 1JAIA 2QI9F 4J4TA 1GPLA 1RYDA 1NC3A 3A2LA 5A3JA 3KO8A 4NJMA 1W49A 3NX4A 3NOVA 5K01A 2O3QA 2VKQA 3DV2A 2V6BA 2Z8XA 1WOMA 1NJGA 3AR6A 5K3SA 3RAPR 3ZU6A 4DZRA 3LWNA 2HA0A 1U0TA 1UZAA 4M8NE 1MDBA 1PEAA 3UAOA 1TECE 1A1VA 1QYXA 1XJ0A 4NZMA 3PQ6A 1G9SA 1UP4A 3DMPA 3SHFA 1PIWA 2WJ4A 3RROA 2WTBA 2YWFA 3IIJA 2HX1A 1G8AA 3B48A 3QF4B 1EUCA 4GWKA 2ODEA 4V1CI 1LZLA 2BYTA 4Q3LA 1FFCA 2IQ5A 5BSKA 1JHMA 2AFIA 3NV9A 3NXSA 5K3CA 4MV5A 3B53X 3U4GA 1V25A 1ORTA 4ZJYA 2JAHA 2QTBA 5GOZA 5HP4A 2RGUA 3HXTA 3PZRA 3ETCA 4GP6A 3OFNA 2J30A 4IWYA 5DU2A 3EGWA 5DWVA 1C9EA 1Z5VA 5AXBA 3AUJB 1WQ3A 3TPCA 3ZHCA 1APBA 3U7GA 1GYPA 2VC2B 2DKFA 1Q7BA 2ZIXB 3FTCA 1R3DA 5TQ0B 4FM9A 1GOTA 4C2AA 3ND6A 1N2ZA 2PZAA 3IPCA 3T1YB 4D98A 4S04A 2MYPA 5HFJA 4UFPA 3G8YA 2Z83A 2GN9A 1Y7IA 1KIFA 2YYAA 3K6JA 4K3VA 5TQ0A 5J2TF 1GDHA 3LUAA 1EP2B 4Q3NA 3GG2A 1JI3A 5E1OA 4KAXA 1WY7A 4EY3A 2X76A 3TSZA 1AY0A 3JWPA 3OSZA 2CXSA 4KBYA 2NM0A 4HFMA 4BX2A 3AEZA 2BFMA 1VI6A 4DUGD 5JU6A 1R4MB 3AHFA 1WS6A 2XA9A 3LXMA 1JEDA 4DM7A 5FV4A 5KTRA 1J9EA 3BMQA 1SXIA 2Q3JA 2YV1A 1GZ7A 4GMXA 2OUKA 3RW9A 3VC2A 5KPDA 1W59A 3GJQA 2QN7A 3C3AA 4QUHA 4I8XA 2DLCX 2DFDA 2AUTA 3EDCA 5DCWA 4TWJA 1DO0A 2Y27A 3PA8A 3PENA 3PPVA 4JIGA 1FY2A 4PPNA 4ACAA 3X0DA 2ZE8A 2XB2A 3TIGA 3M70A 4KQHA 1CUCA 1U94A 4Z3DA 2PSEA 1KKUA 5L4NA 3NTXA 4O2LA 3EVGA 1M1NA 4XPIB 2O0HA 3TBFA 4F3TA 4BLVA 3E9RA 4PE5B 2NXWA 4HH4A 3EG9A 4EHKA 4TX1A 2VHUA 2ENWA 4QYMA 1SD2A 3R8CA 5KHAA 5LIPA 2BP7B 2F3RA 3TQSA 1AQUA 1Q95A 5FTLA 4LC1A 4HGOA 5EFZA 2W9XA 4PO9A 4R5MA 1Q0SA 1T36B 2C4UA 4JY7A 5FI1B 2BFEB 4ZI5A 4EM6A 3VSDA 3M6WA 1SAYA 2DFKB 4ZYYA 1C3VA 3CUEF 1OSNA 5CYFA 3BB3A 5AKXA 3SFZA 2P6NA 2DY1A 1V8ZA 1FMCA 2JZCA 1CR2A 4MK4A 3EYAA 5D3KA 3NAGA 4EA9A 1HOTA 3DKKA 3NHWA 2EEZA 2GA9A 4MS4A 1XGKA 3FOEC 4KGDA 2W2NA 1WHSB 1WP9A 3JV7A 4GE0A 1HE5A 3JQ9C 1QP4A 1VJ1A 1QVVA 2G0AA 4MRNA 4BLQA 4ZRDA 3H3XA 4P98A 4EOGA 3ILSA 4OQPA 4YMUA 3GFRA 2FQQA 2YVUA 4A8HA 3JQ9A 1M8GA 2XEDA 3T3PB 4J9VA 4BV9A 1C5KA 1MW9X 1UBHS 3G89A 3QOWA 1VPTA 4LGMA 4X6UA 5FWYB 4C9BA 2R6ZA 5KTYA 1AH2A 1XZIA 2QE7D 1R8YA 5HTOA 4Z4FA 2X9GA 2HN9A 3C45A 3A4IA 1GU7A 1XAJA 3PNKA 5BT8A 3OZCA 2CDNA 3S3TA 5CAEA 3MCWA 4M37A 4PCAA 1AGNA 1VSUA 4FSDA 2W11A 5KNBA 2MHCA 3PX2A 3DMFA 2IX3A 1NA5A 1TMGE 3ONFA 2GBLA 2FP3A 5IN4A 5JJ5A 2X8AA 2B4YA 2E21A 3DPUA 3OQIA 4YR7A 1CG6A 3AM3A 3HVUA 5A5FA 5F4ZA 4EITA 2CB0A 4M53A 4RIHA 1WQ4A 5KJFA 2FWIA 3SN6A 2ZJZA 3DOHA 1KQPA 3A7DA 4QPZA 2ZGVA 2GPWA 5IUJC 4N0QA 4Y2TA 3Q7IA 4CMHA 4N48A 1E4OA 1F51E 1QG4A 2VNKA 3AXTA 1U0NA 1YVUA 4QTTB 2XY4A 2Z2IA 3FTQA 3O1HB 3TN7A 5JLJA 4TV9F 3M1AA 1NF8A 3T8YA 1RM3A 1IUKA 5JATA 4LRTB 4LHEA 3K6SB 4YMHA 2CNOA 4Z54A 1N6KA 3MMXA 1H2EA 4L5BA 5T4BA 1OWNA 4D9IA 1VKOA 3L0CA 4R9NA 3T3HA 1BU5A 2FN9A 3PIRA 3G85A 4PTZA 1X8JA 3KXIA 4IL5A 3E7PA 3L0YA 1DVRA 3KSZO 4OQ4A 3LECA 5DGXA 1J2EA 4N6OA 1ZEMA 1HFEL 1WHSA 1P5FA 1OFTA 2G7MC 2FUCA 1LU9A 1BD3A 5D3MB 1RAHA 3VHXB 1NKSA 2JVJA 2B4QA 3IAHA 2VRWA 1QCYA 1DQZA 3JTMA 3Q9UA 1XMSA 3GHYA 3D3EA 3GJ4A 3GJ7A 4II3A 2BD0A 2NV6A 4RIFA 4RYDA 1JX6A 1QMGA 3NASA 4PRZA 3TR5A 4DBLC 2DY0A 1QHXA 4A2WA 3AKCA 4GSYA 4K6CA 2WZBA 2XDWA 4H08A 4NZPA 4RLHA 4W63A 2XGSA 1TJ4A 2ZYVX 1RXVA 5IRCD 1F0PA 3T3GA 4GOND 3I04A 3QI2A 1J20A 2ZYAA 2AOWA 2RHLA 2WMDA 1J0AA 4MUKA 2I6GA 5JJBA 2ONCA 3PQDA 1PS0A 2DSNA 2B4RO 1U2EA 4K1LA 1FMTA 1G5IA 1Y4UA 4LV5B 4YRTA 3B6KA 2C3OA 3VX4A 1D2AA 1YHZA 2FUEA 2IY9A 1E3SA 3LFHA 1LLDA 2RGNA 2HDWA 1E77A 2ZKIA 4HKTA 3SX2A 3L4KA 2ECQA 4NJEB 3PS9A 1UFRA 5EZYA 3ZPXA 3KZKA 1JLLA 1WUYA 4FYYA 2UZ4A 2IHKA 4CMEA 3ETDA 3R9IA 4Z2AA 3JYLA 2I4OA 4P58A 4PLPA 3QW4B 2C2XA 3I6IA 3G7UA 1G9TA 2B5WA 3PR2B 5KOIA 1ONPA 5DJ5A 2OGUA 3OQVA 3ROMA 2OXEA 5CVVA 2W43A 2WAOA 3NHLA 2B9EA 1Y3IA 3NKLA 1OFUA 4LWPA 4QJ4A 3C7AA 1UT8A 1OB5A 1YS7A 2FSVA 4YT5A 3EDQA 4B3CA 1W1IA 2NAPA 2J3MA 5IKPA 4GC5A 1WDWB 2XOKA 5EQJB 2A67A 3C3EA 1ODLA 3MCAA 2AYZA 3SY8A 1YFKA 3LCJA 1DKPA 1SCDA 1JWBB 1W76A 2WD7A 3QBDA 3D1VA 5KOHA 2WYVA 4NE9A 5A2GA 1ZD5A 2BEUB 2PH3A 2ONYA 4IIFA 1TPYA 2C2OA 1W36B 1AVTA 3JZFA 4JB3A 2RGCA 3LUPA 3MELA 4FZVA 1D1QA 1KE1A 3SK0A 4AMGA 3Q7SA 4XEHA 5AW6A 1OT5A 1IK6A 4ER6A 2JGLA 3HFJA 2PU5A 2W8ZA 3QF4A 3P4XA 1H3FA 2X8LA 1C81A 3WE7A 1P61B 2I1QA 1JKXA 1VJ5A 4MWBA 1GY8A 3RLFA 3FBWA 2XDQB 4ZXPA 5KQRA 4BNUA 4PR3A 3OZTA 1EFUA 4RA6B 4L8WB 3BE8A 3O94A 4IMRA 1HYGA 3M2TA 5JAOA 2QX4A 4KOAA 1MJNA 1J7KA 3JR3A 1JMVA 2BMWA 3N75A 4KI0A 5BN4B 2C4KA 1Z6QA 4BVBA 1M6VB 2NP7A 3K0CC 2ZT8A 4M0UA 1TTPB 4CBVA 4Z7NB 3BZUA 1Q0UA 1XZLA 2ZSBA 1QQ5A 1JLKA 2DUWA 1FU7A 3L8DA 2MR5A 2J32A 5FT9A 5BN4A 3GGSA 3LZ6A 3SZGA 3AHEA 1MG5A 3T3EA 3PPYA 5A3RA 1X9HA 2J5KA 5B2ZA 5J9FA 1TTHA 2GT1A 1WD5A 3OCWA 3TK1A 2RHCA 1L3CA 1NBMD 4TV8B 1GPMA 3ZXUB 4EHNA 2LCQA 2VBCA 3JAMA 3ZQKA 1WUTA 5C81A 3MC1A 1UPCA 2C2KA 2JI9A 2ZRNA 2P3SA 1U2GC 3SC6A 5JMPA 4ZPXA 3WTCA 4BLOA 5EHIA 1P2FA 3K5PA 3RODA 6NULA 4JUIA 1ZN2A 2VJMA 2BFOA 1QPGA 3JAWA 4D3XA 3G5LA 3OKPA 4JODA 3DKRA 5CM2Z 4YIHA 2VPIA 1USKA 3GY0A 2DR3A 2ACVA 2EATA 3ZGVA 2CHGA 2C96A 4XB6B 1I94B 3R3XA 4W82A 2WQ7A 3B51X 1PZFA 1O96A 1KFCB 1XTRA 2J5QA 4B40A 2LPMA 1J06A 4Q3EA 3SICE 1N32B 1NW9B 5HM8A 2PYIA 3FG9A 1CC1S 3QKSB 3GBVA 2LRHA 1GNSA 3BAZA 4OV6B 1THGA 5JC8A 4ZQIA 3M2PA 2X0RA 2W8BA 5B7QA 3LT4A 3AIMA 4RDIA 2ZBUA 4EHFA 4JLSA 4I1VA 5K5EA 3PB3A 1NN0A 1MQSA 2FN3A 1QWSA 3FYSA 2P65A 1EU1A 2OFOA 2WKPA 3EXHA 3F6PA 3OOYA 4AUMA 4BWFB 2VWHA 2A8YA 1VL8A 1ULSA 2ZT5A 4J3FA 3WK7A 3MUFA 1WA5A 4E5MA 2HPVA 3FCYA 5D3ZA 4GICA 5BOSB 2X23A 3S2YA 1HURA 1FYVA 1GO2A 1WULS 1VE5A 2DTEA 2OCXA 2QY6A 3FHLA 4NG4A 5TY0A 2WJ3A 2FPGB 2BEWB 4AZ3A 4ZI3A 3UYKA 1W73A 4Z9BA 2BFNA 4HR7A 2VSFA 1E2HA 1N9GA 3ILHA 1C1XB 2B20A 1QHSA 2FZKA 5CP8A 3R7FA 4ROTA 2O8FA 2VTDA 4G4GA 4RSMA 1XT6A 1MAWA 1SUPA 2RBKA 3G2HA 2HRZA 5F5LA 3A28A 4EG3A 1DIAA 3HJCA 1QHYA 2JJQA 3H0KA 4OLJA 3WGIA 5JECA 4X97A 3MINB 4CDMA 1C3XA 4MH0R 4G9BA 3UQZA 4CKEB 1ZNWA 2NO0A 3LY8A 5JXGA 3MHPA 2X4IA 4P4UA 1FXUA 2B0CA 3VVLA 4G0WA 4BO5A 3SMVA 3FFTA 3WRWA 3HU1A 2GEVA 1BMDA 1OZAA 1ZM9A 1QTIA 1ZMTA 1EXMA 2FPSA 2H06A 4LWZA 1Z7BA 4FMBB 1GNTA 4KL8S 1O08A 4Z2YA 2IHBA 2Q6IA 1DFIA 1XDBA 3A9WA 4XH9B 1RQ2A 5AKJA 2V6IA 1XZ8A 1U7OA 1ZI8A 2FMIA 3FM9A 3I45A 1IN1A 5EMLA 4PSUA 1HYEA 2VAMA 1T5IA 5SZIA 4KRGA 1U2ZA 1HR0B 1CY6A 4NCAA 3D31A 2GETA 1C8LA 3VJRA 3O7WA 1QLWA 4GLFA 5I7EA 3QEOA 1SRQA 5TNXA 4GZ6A 2ZCJA 2DHQA 5LVAA 3VNQA 1OTXA 2CFRA 3R6GA 1JEQB 2ZRIA 4KSYA 3SC4A 4FX2A 1VFPA 1MGPA 2CFTA 3WFIA 3UWPA 2M32A 3W4IA 2VDPB 3OY2A 1QIKA 4ZV4A 3SSMA 4XUEA 1H2HA 4ADSG 2AQIA 2FCAA 3A3KA 3SFVA 4RY9A 3ZVMA 5BNFA 3CA8A 3AVUA 2OV8A 3DFZA 4MI6A 2A1TR 1D1TA 3FPCA 4J0GA 4LRXA 4MGYR 3Q4GA 4C14A 3HSSA 5HUJA 2I2BA 2AK2A 4CHGA 4U6SA 1B26A 1P1CA 3QVUA 3RK1A 3RAJA 5IFLA 2CLEB 1UJBA 3KTAA 5TB5A 5C3UA 4BNTA 5F3DA 5JYEA 5FI5A 2P6OA 1SB8A 1ZEJA 4RESA 5CDYA 2BHLA 2HPHA 4WACA 5E38A 3N86A 3P1JA 4DGQA 4GL2A 4JHLA 3ZHRA 4KXQA 4ETNA 1I9GA 3TFOA 5JNRA 4UU7A 1MVNA 1RI2A 5IEJA 2QN6A 3U4QB 1NBAA 3SQMA 2OAP1 3GLIE 1JR3E 4DCVA 3G3EA 5EJ2A 5DK4A 2OHXA 3OKAA 1L5SA 1RJEA 2GDZA 1J1IA 3GFQA 2QAGC 4MKRA 1YE3A 2Y67A 3RTBA 2JJ2D 4UM8B 2XRYA 3I1YA 3MLAA 1HG1A 1MZPA 1GNLA 4GNRA 2CEKA 4ZDIA 2BIFA 1ULHA 4JI5B 3PITA 3CKKA 3FYUC 3E22A 4HWOA 1R6AA 3RS2A 5DNEA 3W4KA 5KDDA 4ZYZA 1PNVA 1RTKA 1X8LA 1YA8A 2HZBA 5ABPA 3HWX1 3LIIA 1C1YA 1KP9A 1R66A 1XKQA 2OECA 3CMCO 3D59A 4RLQA 4TT3D 2DF8A 5G0SA 3WRVA 1UIRA 2GZHA 2UUAB 1VYHA 2YQ5A 1GZHB 4QGAA 2PMWB 1NIJA 2A9FA 4NV1A 4N39A 2IYYA 3KDSE 1E5LA 1KH3A 2AZ4A 3NHJA 3NVKI 1A5ZA 1S8OA 1ZRMA 1NSTA 2G0NA 4RIEA 4ZMRA