1V5WA

Crystal structure of the human dmc1 protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
239
Chain Sequence
PGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords Meiotic recombination protein DMC1/LIM15 homolog
publication title Structural basis for octameric ring formation and DNA interaction of the human homologous-pairing protein dmc1
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 239
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1v5wA00
3QNUA 1P9RA 5KSYA 4B74A 2VA8A 3NH9A 5JSZB 5KDDA 3K70B 1SVLA 1JB1A 4Y0VA 1CS4C 1P60A 4AG5A 3CRRA 3NBYC 4BZQA 3AKCA 3R8CA 1SXJE 3TSWA 2CDNA 3K09A 3BERA 5HPYB 1KKLA 2GCPA 5JS7A 2O8BA 3B1WA 4HUTA 3G5UA 1KJZA 1NI3A 1OYYA 1Z83A 2ZRHA 2F1HA 2DFKB 3GLHB 4G5RA 2JLSA 5FOWA 5G3YA 3RS2A 3T35A 4DSOA 1NKSA 4DLYA 4WZBE 2AK2A 4R2IA 1GL9B 1W2HA 3JZAA 1U94A 3Q9LA 3ZZ0A 1D9ZA 1GZSA 1T4GA 5TVKA 1PUJA 4I1VA 3WXMA 1P6XA 4B3CA 3ZVRA 1EG7A 1O3YA 4GNKA 1HY3A 1NVVR 3QVUA 5K8IA 1XPUA 4GL2A 4JLNA 2X2EA 3U3RA 4BEBA 3CONA 1E9SA 4ZCLA 2J0QA 3HR7A 5KNDA 5JECA 2QY9A 2WBLC 1XTRA 5FPKA 1DAKA 4CEJB 1R5BA 3VU9B 1NG1A 3L82B 4Q7JB 5EUMA 1E2IA 2W6ID 2JLUA 2QBYB 2ODEA 221PA 1E9AA 1UBCA 1E96A 2GCNA 2RGBA 1VPLA 3BXZA 4EPXA 5LBIA 3ZIAD 2LKCA 3HPRA 5IHPA 3EARA 4FXPA 4TYQA 2ZTSA 4E22A 1NLYA 5DI3B 3P26A 4OQNA 1NMXA 3AB3A 3HYTA 4TLBA 1ZUHA 5EXSA 2GESA 4MUAA 4IDNA 4OYHA 3VHLB 2BC9A 3KKQA 4HAVA 5H1YA 4HB3A 1N5LA 5CM9C 5BN3A 4RD0A 4TMXA 3RRNA 4P0TA 1D2MA 1SGWA 4O2RA 4DUGD 5L3VA 1WF3A 3EXAA 2Q3MA 3WP0A 2R65A 1L4UA 2VQSA 4PC1A 1ZD8A 3AVYA 1YRAA 2ZS8A 1FMLA 4RFSA 3PXGA 3K0AA 2W6JA 4GI7A 1KI6A 1ZM4A 2CHGA 2ZSAA 3TBKA 1SKYB 1ZVQA 1XJCA 2B8WA 1W36D 1KOFA 1XEFA 1R0ZA 5DSZA 4MA4A 1J99A 3AVWA 1IHUA 1IBRA 1T8UA 1ZD1A 3PR1A 3TW4A 1QHYA 2IHYA 1UF9A 2YC2C 3ONWA 3AF1A 5AUPB 2CBZA 5L3QB 3O8CA 3T15A 4A0RA 5HR5A 1UPTA 3F0TA 2UZIR 1X3SA 2VSOA 4HYYA 4LV5B 1XTIA 2ZR9A 1L7VC 4NCHA 3WRXC 3T61A 1G8HA 3TIFA 3UG6A 4HAXA 3RABA 1W47A 2XTNA 4HZUA 1KHTA 1KI4A 3ZJYA 1AQYA 3GFTA 1IN5A 1VCNA 2CVHA 3AVPA 3BJIC 3ND8A 4ERNA 4LRWA 3CF2A 1MO5A 1J8YF 3LQRA 1ZM3A 4JL8A 4MQBA 4JKIA 3SS8A 5FR2A 1Q1QA 2ZANA 4BZPA 2G0NA 1AK2A 3HP1A 5CB6A 2WWIA 3TKLA 4BLOA 3AH8A 4ABYA 4IVRA 2O8CB 2YWEA 1VYUA 4UJ5A 1CF4A 2IYQA 1HTWA 2CK3D 3GFOA 3L43A 2NPIA 2ZSEA 3NH6A 1P2UA 5FI1B 1ZM7A 4KYIB 3KXLA 1N3BA 4B76A 2BM0A 2RGEA 4OK5A 1GOTA 5DN6A 2REBA 4ZV4A 1XF9A 2IW3A 4OQMA 1OFHA 5F2EA 5KYKA 1GAJA 5GJBA 2B7CA 2R6CA 1XD9A 4HATA 5KU1A 5KTYA 5DISB 3VX3A 1XRJA 2ZYWX 1CR1A 1IN8A 5JWOA 2J0VA 4A6XA 1YZLA 4BUJA 2V8OA 2GXAA 1GFIA 4L9SA 2DY1A 1Q21A 3TSZA 5DIFA 4W9MC 3V4FA 1W4BA 2J7KA 4YXWD 1E9DA 2W6IA 3CX7A 1XX6A 1T5LA 4G1UC 4F4CA 5IT5A 1DBSA 3JVVA 5AUQA 4BPBA 4CEHB 1SXJC 2BCJQ 3L0IB 2DFTA 1OIWA 4PSVA 3QKTA 1XPRA 4DDVA 1JI0A 1S2MA 4B71A 1V5WA 4P4SB 1DPFA 4A2QA 4PQYA 2FSGA 3K09C 1QZXA 1S1MA 3B1YA 4Q47A 4QM7A 1QG2A 1XEWY 4KSBA 4TYYA 1R7RA 3LW7A 3SI7A 3RS5A 3ADDA 1ZNYA 4PC7A 4E09A 1U99A 2WWHA 3GCGA 1LV7A 1NF3A 3IILA 1T5IA 2VP6A 1CJTC 2QTVB 2ZUCA 2ZRCA 4ESVA 1DARA 1XTJA 3CH5A 3ICEA 4Q4AA 1KI2A 1UADA 2ZJOA 4Q19A 5AK0A 2YC4C 2KB0A 2G1JA 3IUYA 4RD2A 4DUGA 4O3MA 1YZQA 4BRWA 1Z29A 1TU3A 2VIIA 4XWAA 1H65A 4C0BA 1P73A 4D80A 5D3MA 3KKNA 2JA1A 2W0MA 3LDAA 2JJ1A 4FIDA 4UNQA 2V1XA 1GRNA 1FP6A 5L3SB 2WSSD 3SE0A 4RZ3A 1HURA 4BLQA 1KAGA 2QAGB 4AURA 1SVIA 2FN4A 4KYUA 4OQLA 5E7MA 2IYUA 4A82A 4FW9A 4YMUA 4H1UA 4YONB 4LJ6A 4B2IA 3NBXX 2O8BB 2D2FA 3EZ7A 1O87A 2DBYA 3HDTA 3KUDA 4D26A 2XX3A 4KITB 4LBYA 4B6FA 2V7QD 2GNOA 2PLRA 1W4CA 1RPZA 2AFHE 2Z4RA 2J0UA 1VHLA 4HUQA 2QGZA 5EP3A 1NG9A 2VP0A 2RMKA 4TN1A 4Q1AA 3AKDA 3QEJA 4EQ6A 1TQ4A 3CPJB 2DFLA 1Z0KA 3K53A 2ZI3A 1E2DA 2GZDA 3QIAA 1H8HD 2XZPA 3W5IA 2V3CC 1R8QA 1U98A 3OE7D 5HZKA 1PLJA 4JLVA 3X1DA 1I4TD 1YVDA 2FFQA 2ZSBA 3AVQA 2VF7A 2G3YA 4PO8A 3KKMA 2FMXA 2G1KA 1M7BA 1ZC3A 2A7QA 4B3DA 2QAJA 2PZFA 3G82C 4BRUA 2BOVA 2XZOA 3GLFA 3NBZC 4NE2A 1QHNA 3PUVA 2WIAA 3IIJA 4HB4A 4M1KA 5IK2A 1KI9A 3DEFA 2XSZA 1K6MA 5JI3E 1OB5A 3GLFE 2KE5A 4KFSA 5CLLA 5G41A 1Z6TA 3H0KA 5EE0A 1XEXB 2JLQA 1OKKD 4Q48A 3THYB 2PJRA 2Q0HA 1GNRA 5EXPA 1HYQA 2AK3A 4PANA 5DHAA 2QNRA 2ZJBA 3BB4A 3UXMA 2VSFA 1EFRA 1N0UA 3Q8XB 2ZSFA 1E9EA 1KY3A 2GZHA 2OILA 3EWAA 3H86A 2FOLA 4P32A 4TL6A 2IYXA 3QEOA 4DCSA 2ZU0C 3BWDD 3RSOA 4JLPA 2C95A 3QXXA 3SBDA 4MKGA 1NLFA 1W0JD 3UANA 1M8PA 4X8OA 5L3RA 4JJKA 4US0R 4AK9A 4LYHA 3I92A 1IOZA 2MMCA 1IJFA 2ZRMA 1E79D 821PA 1M7HA 1RJ9A 2XNDD 3P1JA 1OSNA 1P61B 2WKRA 3BS4A 2WAYA 3I8XA 3THWA 4G3XA 3QF4B 1AS0A 3OIWA 4Q03A 1QBKC 1NBMD 1UBGA 3IHWA 2BEKA 2FPLA 5EP4A 4IFEA 4AKIA 4Q4HB 1CRQA 2EVWX 1ETUA 5GVSA 3AVTA 1NKTA 4M1SA 4QGHA 2CEAA 1G9XA 2ZI9A 1Z0FA 4DBLC 4LJ8A 3B60A 4Y0AA 1Z0IA 1N5IA 1CJVC 2QL6A 1PV4A 1IM2A 2VO1A 4P3YA 2EU8A 2OCPA 1K5GA 3B85A 4G0NA 4WVFA 1N6HA 3TGPA 4B2LA 2NOAA 3U44A 1C1YA 1A5TA 1OV4A 3RC8A 2AXNA 1YR7A 4TYPA 1PVOA 4ZKEA 1EESA 1PZNA 2E87A 3T06B 1OFTA 3ZDQA 5B58C 4NDZA 1A4RA 1OH6A 1E2KA 1G17A 1G41A 1RIFA 3DM5A 4BWYA 1MO3A 1KI1A 5D3QA 3L8ZA 4R2HA 1NSFA 5JFGA 4H1VA 5JJLA 1NY5A 1YQTA 4GRAA 1Z0JA 2CNWD 2CMKA 4PHTA 5FOXA 2H92A 2ORVA 3P4YA 1E2FA 4L4UA 1T0HB 3TW8B 1EX7A 3L0OA 4R98A 4V0LA 3RC3A 1FQKA 2WJHA 4OJQA 4RY2A 4WZAE 3T1QA 4MKIA 1HUQA 2V7QA 5FBLB 3A1WA 1KO8A 3A58B 3LVQE 4O25A 1FNMA 3SFVA 1E2GA 1F5NA 3WMGA 4D4LA 1JAIA 1KZGB 3EASA 3CNOA 3H84A 3KJHA 3E5HA 4DWJA 1G8PA 4B34A 1H8HA 1CJUC 2AWOA 4DCVA 1KMQA 1Z5ZA 2FWRA 5CJ2A 1JXOA 1TU4A 4KHZA 3UWOA 1MABA 5C4GB 2GEDA 2HF9A 4DHEA 1CLUA 1R4AA 3RWMB 3MWKA 1Z07A 2HYDA 1D9XA 3EPJA 3CM0A 3PJRA 5A0FA 3SEAA 4JT2A 1WQ1R 1SVSA 4GT1A 5JSZA 3MFYA 2OESA 5A4JA 1RRPA 3ADBA 3TUZC 4V0MA 3FKQA 3THOA 2FEOA 1TEVA 1LTQA 1DAMA 3IBYA 2H1LA 5K8TA 2AR7A 4V0ME 4LSGA 1W48A 3A1SA 4RCZA 3L0SA 1XJQA 2EFCB 2ZM5A 2D4HA 1E4YA 3I32A 3VKWA 3GLHA 2FGKA 5B57C 5KSZA 2P65A 4JL5A 4OK6A 3CRQA 3DKPA 3QKUA 4M9ZA 5HZHA 3IQXA 4JLDA 1W0JA 1KDOA 3GLHE 4R7ZA 4BFWA 4TMKA 2BMFA 1EWRA 2A5FA 2QP3A 1II9A 4D0NA 5LD2B 3KTAB 4PQFA 3VMFA 2DWQA 3TAHA 3EPHA 1J8MF 2XNDA 3IEUA 5KDLA 4L8GA 2BJVA 1N6LA 5JWRA 1QVRA 3TQCA 4DKXA 2OUKA 4JLBA 5AUOB 4BFXA 1W36B 4CEJA 4MGKR 3VU9A 3W34A 2HJGA 4FMDB 1E2NA 4CZ2A 1IJEA 2F1RA 2J5XA 3NTUA 1ZUIA 2DR3A 3FKSA 3O8BA 4U02A 1CJMA 1KDTA 2P2LA 4I4LA 3QPWA 2PLFA 2ZE5A 4DEXA 2EFHB 4PO1A 4QG7A 3IHLA 4ZCMA 2OHFA 2ZRJA 4II7A 3I73A 4DLTA 4BFVA 2OSBA 4KBGA 2HDNB 5H8WA 3KXIA 2OCYC 2IYRA 3B6EA 2VSXA 3TUJC 2IS2A 5DI3A 3S1AB 1XJ0A 4MKFA 2IUSA 4PPFA 3KB2A 1JR6A 4LYFA 2N1BA 1ZRHA 1ZM9A 4Q7KA 3THXB 2VHTA 1OXXK 2PEZA 4DDWA 3MD0A 1QHHB 3PUZA 2FPMA 4UNSA 2WMNB 2JLWA 1Q20A 4AWXA 1DAEA 1KK2A 4KFRA 2IXFA 1G64A 1B23P 3QXCA 4QNRA 3C8UA 1RRCA 2FFHA 2QRZA 4ILEA 1T91A 2NTYC 3WNDA 4LBVA 4M9SA 5C1BA 2YHSA 2OBNA 2OBMA 3GJ6A 3MLEA 2WJGA 1YJ5A 4KXFB 4XD7D 1NVXQ 2ZVQX 4OI1A 2OLKA 2NO0A 1SKYE 5KPDA 4IW3B 1KI3A 2C9YA 5HE8A 2CVFA 2NGRA 5EQTA 3C15C 5L3QA 1MT0A 1GVNB 5ELXA 2WPDD 4MRSA 4F92B 5F3WB 4CVNA 4Z8XA 5G53C 2ZI7A 1KMHB 2BMDA 2IYWA 3OIUA 4TTPA 2QENA 2V55B 2RKOA 3B82A 4ZIRA 5CITA 4RFVA 1RYHA 1DO0A 1S9DA 2CL6X 1GRQA 2EYUA 2PH1A 4JYCA 2FFBA 4OK3A 2YYZA 3IGFA 3T1OA 1OW3B 3N5CA 1ZCAA 1ZAKA 1LS6A 3UMRA 4PO9A 5BWMA 4URXR 1I2MA 1TAGA 1OH7A 5EE3A 4TSFD 1EFTA 5KDOA 4M1WA 1UBEA 3U6BA 2JLYA 1B0UA 4HSEA 1DVRA 1YZUA 1IN6A 3ZLJA 1GG2A 3THWB 3RWOA 1JEDA 4FI3C 1ELOA 3GMTA 3MCAA 4JLKA 1Q1EA 1VG8A 1T0JB 2JJ8A 1OXUA 5EZ6B 2O52A 1JALA 1IN7A 1IXRC 3QE0A 4LBZA 3EG5A 5CLQA 5SZHB 2WHXA 3K0FB 4Q66C 3I61A 1ZINA 1KY2A 4U00A 2I1VB 2AD5A 1F6BA 4URWR 4TLCA 2O8CA 2XTMA 3L8YA 2BWJA 3D6TB 2ZYTX 1ONBA 4PAQA 1JECA 4M8NE 2X77A 5A5GA 1OHHD 4MRRA 2ZAMA 1BYIA 1ZMXA 4B6EA 1CXZA 4OI0A 4I1SA 4BFTA 1CTQA 2CHQA 4EAQA 3MWJA 3MSXA 3QI2A 4DT1B 4HEJA 5F98A 4N1AA 3M6AA 4Z54A 5JHHB 1AZTA 3B7GA 4BGDA 5DYIA 3AQ4A 4QHSA 3I5XA 3DVLA 3DO6A 3K0CA 5JI2E 2QM7A 4IOJA 4YMTA 4LGMA 1C9KA 1VCOA 5KO2A 1U8YA 5SZKB 1KGDA 1S3SA 4EKDA 2RGDA 2A30A 3D8BA 4A2WA 1KIMA 3K70C 2I3BA 4CEHA 4A36A 1A7JA 3IBGA 3PITA 4CGZA 3BK7A 3C41J 1X8JA 3ZQJA 4P4SA 4QJ4A 4ZCIA 1XMVA 2GAOA 1RZ3A 2GF0A 4LZZA 2VTKA 2V9PA 4RD6A 4DEYA 2GJKA 1KSGA 3SDZA 3PEVA 5E4FA 2ZRLA 3TVDA 2JLXA 1YR6A 1ZU4A 2CE7A 2ASEA 1J2JA 3B1VA 3SQWA 1PUIA 1UJ2A 4EPRA 4ACBA 3M0EA 1YR9A 3AUXA 2IUUA 3RS0A 3PV0A 2GAAA 4EFLA 1AIPA 1MABB 4IEIA 1A2KC 2BM1A 3WMEA 2OV2A 3ND9A 4NZYA 4EFNA 3LV8A 1ZIOA 2F1JA 4LHYA 3W90A 1ZNXA 1II8B 2AFIE 4UXIA 5FUVA 1T6NA 4QGGA 3B9QA 4N3NA 5JZVA 2G88A 3C16C 1OH8A 5L3SA 1NMYA 5CDFA 3KL4A 4XJXA 1FMJA 3AP1A 1E69A 1ZW6A 1MH1A 5B64A 2FJUA 4FCWA 2QTFA 2ZR7A 2QAGA 2YINC 4XWKA 3U7GA 3SZRA 3UATA 5CDFE 5G40A 3VR1A 1GITA 5DH9A 1KDRA 2OO7A 3SJCA 2W2TA 5DLQC 2WPDA 2Q3FA 3FVQA 2JEOA 4G5OA 5IDVA 3LNCA 4IHQA 3FMOB 4UNNA 1D8TA 1DOAA 4PC3A 1E0JA 2H18A 3WMFA 3K0SA 1IQPA 3QKSB 3KKOA 2NQ2C 2ZUBA 3RVBA 1G6HA 1Z08A 4LHVA 3BFXA 2Q9BA 2BCGY 4EJSB 2QMUA 4TSFA 4EPYA 1LY1A 3WRYC 4IOLA 3A6PC 4B3XA 2BJWA 3DOEA 3RAPR 4D4KA 2VF8A 1MV5A 1P4SA 1U9IA 1NRJB 1P7CA 3NXSA 3VQTA 3P4XA 2JIZA 3K9HA 2WICA 3CKLA 4AIIA 4B3GA 1VECA 1OE0A 4GDFA 4QHYA 2A78A 3P32A 4DSTA 2YNMA 1NN3A 3OEHD 5JS8A 1YU9A 3HR8A 3OEEA 4MKHA 3SYLA 4PFSA 2ZJ5A 4NCKA 3KQNA 3CW2A 1HT1E 2GXQA 1SVWA 3ASYA 1OHHA 1XEXA 3FMPB 5FPSA 4NP6A 3R9WA 4GPTA 4FD2A 3THYA 1YZGA 1YE8A 1Z8FA 3ZD7A 1W44A 5JEDA 3I1FA 4ZI2A 4D82A 1KDPA 1AN0A 1CBUA 3IIMA 3AVXA 1N25A 2WJVA 1IY1A 2PT7A 4US1R 2J0SA 2QMOA 4KLZA 4Q1DA 4QKQA 4QJ5A 2B8TA 4ZDIA 1VIYA 3QKRB 4D0LB 2PBRA 1R6BX 4DLUA 2ZYUX 3P27A 4I81A 1N6NA 1KNQA 1VMAA 2AD1A 1JBKA 1XBTA 2RHDA 4BFSA 1SQ5A 4B73A 4G5GA 1G1MA 5JCZA 4ESHA 1GL7A 4NYIQ 5EUQB 3M1IA 4C7OA 4M4SA 2JGNA 2OXRA 1HA3A 3QF4A 4N0EA 4BASA 3TH5A 2XGJA 2P5TB 2EWWA 4GOKA 3LXXA 1UFQA 1KI8A 3RRZA 5TARA 2G77B 2ZRPA 1OB2A 2IYLD 1KSHA 1F2UB 4Q4HA 2X1VA 4XOIA 2CCGA 4G5QA 3NDPA 4FCVA 2P0EA 1HV8A 2KSQA 4ZIRB 1HE1C 1Q44A 2EYQA 4L15A 1US8B 4LY6A 4TZ0A 4GFDA 3U2QA 5DE3A 1FW6A 3T34A 5LB4A 3EAQA 5AJVB 1N2CE 4BLPA 2JLZA 3BAFA 2H7VA 3VAAA 3K0EA 1E0KA 2FA9A 2HCJB 3K0CC 2K5UA 4AYWA 3LW8A 4F4JA 1ZD9A 2P6RA 1G8YA 5E7IA 4LBWA 1W4RA 8OHMA 3R7WB 3TK1A 4ON9A 4DIEA 1QRAA 1V43A 3EX7C 5DGXA 4UQOA 4IEEA 5M04A 1PLKA 1YKSA 1MKYA 1N6RA 1WCV1 1TMKA 2JLRA 3EC2A 4PPQA 4W7SA 4BZXA 2VYFA 3HPQA 3BH0A 3SJZA 1OFUX 4XSHA 3TQFA 2V1UA 1II0A 1RKBA 1XTKA 2WKPA 4Q7MB 1Z06A 5JBQA 4QRHA 2CHVA 4GOJA 3LO5A 4KVGA 1TL7C 1Q3TA 3SBEA 3TVTA 4DVGA 4MRPA 1RE0A 2WZQA 5FI0B 2R6AA 2QP9X 1XTQA 3Q7PA 1TQ6A 421PA 1MRNA 2XAUA 3B78A 3IQWA 4HAUA 1OIVA 2X19A 5FTMA 1BKDR 3CNNA 3U7EB 2HLDD 3OESA 4YLGA 1W1WA 5AJYA 2YOFA 4XIGS 1R8SA 3GEHA 1GRRA 1JEEA 5CJPA 4A1FA 3OEHA 4DCNA 3LBHA 1LF5A 1G3UA 3LFUA 4BLTA 4IFBA 2ZROA 1NN1A 4TMZA 5FUWA 5J4KA 2BBSA 3PCRB 4RD1A 4XVUA 4U7DA 1F2TB 3R8FA 2QAGC 3LLUA 2L0XA 4TMVA 3ZIAA 2H8KA 1TQ2A 2SHKA 5J5CA 1EWQA 1HH4A 5J47A 1EX6A 4TQUS 4B3BA 4JYBA 4HB2A 3WNBA 5J4HA 2RGXA 5B2ZA 1ZBDA 2A5JA 3WHKA 4ITRC 2OM2A 3CX6A 4C0HA 1CIPA 2FU5C 1XWIA 3CZQA 1GKIA 3EA5A 621PA 5AWFC 4X8LA 1KO4A 1L2TA 2VLIA 1R5NA 5H68A 4UKDA 3KTAA 3OAAD 1KNXA 3BORA 3EW9A 1ZUNB 1TQDA 1XMJA 4LJ7A 1OXTA 4HDOB 2D74A 1U9IC 5BQ5A 1OPXA 2RH5A 2GJ9A 2ZJ8A 3QXSA 3CWZA 3CF0A 2PT5A 3FFBA 3AVOA 3PUYA 4K46A 4O0MA 2O8FB 4UXJA 2ZE7A 1W2GA 2E1RA 2PZEA 4A0GA 1HQCA 4GZMA 3RSLA 2YJTD 4OHVA 4F91B 3BBPA 1Z6XA 2GF9A 4M2LA 1Z6AA 1NP6A 1UM8A 5FL3A 4MRVA 1NJGA 3GLGB 4PZYA 2C98A 1QHSA 4ASUD 1KO7A 1Z47A 4QBFA 4A92A 3DM9B 1H8ED 4M0LA 1AS2A 3QPUA 3DPUA 1XEWX 4QGAA 3NC1C 1N6KA 1CP2A 4E03A 3P20A 3BH7A 4C0LA 4B47A 1AGRA 1G4UR 1IAQA 3B13B 4KBFA 2VHCA 2E9SA 4NYMR 1WBBA 1GNPA 3S1AA 1TPZA 2VP4A 3DMNA 2HYIC 1KJYA 2HT1A 1CR2A 3THXA 3D7MA 3SNHA 2OG2A 4GSYA 3KJIA 3QXHA 2WVJA 4BLRA 1F48A 1GILA 1EK0A 5BYKA 3LBNA 1EFCA 1FUUA 1QHHA 3ECCA 4J0QA 3ZGXA 1OF1A 4YMSA 3C5CA 5E95A 3HJNA 3QBVA 1L8QA 3IO3A 2QRNA 5FPTA 4DLXA 5KUTA 4BQSA 3Q5EA 2YOHA 2CK3A 1IN4A 1JQJC 4LV6A 2Z83A 5F9FA 1CRPA 3SFZA 4DXAA 3NEYA 3CBQA 2GKSA 3QOFA 5P21A 4A0FA 4P4UA 2ZRIA 1ZP6A 1N0WA 3SR0A 2R6GA 1W5TA 3UPUA 1ZIPA 4Q9JA 3SYKA 2GWHA 4Z51A 2J59A 3QF7A 4URVR 5EE5B 1KMHA 2FG5A 5JWHA 4DLVA 2PCJA 1FQJA 3PIRA 1R5OA 3W3ZB 3O8DA 2IXGA 2QPTA 3RNLA 3MUFA 1Z6GA 1NL3A 5CK4A 4YXWA 2PEYA 1KK3A 4BEJA 3I62A 3B8HA 1FP7A 4OL0A 4Z8YA 2MSEB 1MOZA 2XZLA 2C96A 1U0HC 4C7OB 2O8EB 3R9XA 3I5YA 1FTNA 2BDTA 4DB2A 4OHYA 5GJWC 1R2QA 1FPMA 2CCJA 4DSNA 1FFHA 3SN6A 5HTKA 4PHGA 4EFMA 3GJ8A 2WSMA 1AKEA 3K0FA 3ZYCA 3IPYA 3DOFA 4B33A 4IXMA 2H17A 3ZQ6A 3DKVA 3BOSA 3AF3A 1AM4D 2A9KA 4UNRA 2DPXA 4JLMA 3ZZTA 5KHOC 2D7DA 2GVZC 2A3RA 1EXMA 2VRWA 3B9PA 4FMBB 4MH0R 4L5BA 2IX3A 4PC2A 2OLJA 5J4YA 3EC1A 1E1QD 3NHBA 3NWJA 4U5XA 5FH9A 4DT1A 1Z3IX 4QHTA 5G3ZA 2F9MA 2P6UA 3A1VA 1MR3F 1SVMA 3OAAA 1OFIA 5EP1A 1QVAA 3GJ7A 4RZUA 4RKFA 1JPNA 4E07A 3O47A 1W5SA 2WWGA 5EE9A 3TSOA 1R0WA 2QQ0A 2WSSA 3GP8A 4BE7B 5GJCA 1HE8B 4NH0A 5DO9A 2OFWA 1D6JA 1M74A 3ZVNA 4LOAA 1G20E 2RGNA 4IVPA 2FPKA 3W5JA 2BVNA 4Q9IA 2F3TA 1G3RA 2R6FA 4IDQA 2ZUDA 4TQ9A 1N5JA 1G8GA 2IF0A 4B44A 2YKGA 1UKEA 2VP2A 3AM1A 3K9GA 4GBMA 4PZLA 1JNYA 1E2QA 3FPAA 1W0KD 3CLVA 5AJWA 3Q5DA 3WP1B 4RJLA 2BV3A 2I4IA 2Q21A 3W6PA 3U4QB 3RRMA 3KXKA 1YRBA 3OE7A 1G5PA 2RCNA 1OJLA 4HAWA 3WBJA 4JVSB 1UBFA 2ZYVX 4GMDA 3FWYA 1IONA 2I1QA 1Z6YA 2A2ZA 3QBTA 1G3QA 5LD2C 3TUIC 3TMKA 1II8A 4YQFA 1CR0A 2ODWA 1K8RA 4XH9B 4X8HA 4FCTA 3CPHA 2W2VA 2TMKA 3RLFA 4F38A 3PFIA 2J3EA 2ERYA 1W36C 3UIEA 2FV8A 4NCNA 5EXXA 4Q9LA 4PAMA 2OAP1 1WE2A 2LWIA 1OKKA 2VHQA 2ERXA 1CKEA 3WYAA 4GP7A 5FUXA 4KLNA 3FE2A 5BXQC 2J87A 3IKJA 3MJHA 1NN0A 1NLZA 3AF2A 4KVAA 3GEEA 4LC0A 2ZETA 2ZITA 1WXQA 2RHMA 3VX4A 3U3OA 3AEZA 3QENA 721PA 2GJAA 4DLWA 3QKSA 1UDWA 2R8RA 3EWSA 2GK7A 3Q3JB 4RD3A 2ZIAA 1SZPA 4EJSA 2BKEA 4PPNA 3KKPA 3VTKA 3FGNA 1E79A 2HF8A 4LJYA 2B92A 1WBDA 2CJWB 3C4JA 2QGNA 3HYRA 1VG1A 1VYVA 3D31A 4NCIA 2CLSA 4MYHA 4PTLA 3L0PA 3I72A 2GTPA 1GIAA 1NBMA 4Q01A 3IPXA 1J7KA 1G8FA 1Z2CA 3F8TA 3AGQA 1NBME 2RB4A 4AG6A 1ESNA 3MJRA 3SYNA 4RD4A 4PPGA 2JLVA 2F43B 1G19A 2G6BA 1KO1A 2CCKA 4NHOA 2DHRA 1G3IA 1XXHB 1XD2A 2W0SA 2IYVA 4CYMA 4QM6A 3MRSA 4ZI3A 4NYJQ 2EFEB 4RSGA 2IYSA 4FWTA 4JL6A 1GKUB 1HT2E 2GZAA 2PMDA 2UVQA 1KSFX 4TQAA 4MYCA 2FZLA 2NG1A 3TR5A 1ANKA 2R62A 4KODA 3RHFA 5C46F 3RRYA 1J90A 1FOEB 2BMJA 2GXSA 2REXB 1WB9A 3QKRA 4KI0A 1E2LA 4ZKDA 5KNCA 1GDDA 1TF7A 2IHBA 3KQUA 1JJVA 2XB2A 5EE1A 1M2OB 3NVAA 3LH5A 4RZ2A 4M9QA 5UKDA 2CNWA 1P2VA 4XVRA 1KYIA 2AN9A 4EPVA 4V0NA 1Z0AA 1RVDA 1VKJA 4HB0A 1XNJA 2LCFA 2XTZA 4CIDA 1TUEA 2WOOA 2ZQ5A 1IXSB 1FX0A 1NN5A 2QMHA 4QXAA 2V6IA 1TNDA 3UWKA 3CX8A 4D0GA 2J7PD 4URUR 4JLOA 4EDHA 1F2UA 2F3RA 3ZH9B 1U81A 1XZQA 1RW4A 4TMWA 1YZTA 3AGPA 3BFKA 2AKAB 2C5LA 3X1WA 3KFXA 2WWXA 2KWIA 1US8A 1SXJD 2CL7X 4A4DA 4DRZA 2VPPA 2ZE8A 3PENA 4OQFA 1WP9A 5CYPA 2YZ2A 1RFLA 2IYZA 1KK0A 1A2BA 2ZE6A 2J45A 4KCGA 4PC6A 3VNUA 1K5DA 4LHZA 1VCMA 2FZ4A 1S3GA 3CR7A 4AI6A 5CIWA 3GFPA 3A4MA 2XNSA 2XITA 4DZZA 1P75A 1P5ZB 3EZ6A 2EFGA 1I4LD 3LAWA 2NO6A 2QROA 3U7HB 5FFMA 2RGNC 2G9NA 2XB4A 1DAGA 1S4QA 3R7WA 3GJXC 2QPOA 4M53A 4AC9A 3BH6A 4M1OA 4POAA 3KFVA 4NYIR 2ZRBA 5FOSA 1GUAA 4XSGA 3WYFA 2BBWA 1KJWA 2OEPA 4TLAA 1XCPA 4IXNA 2GRJA 2Q9CA 2C9OA 1XD8A 1Z0DA 4Q1EA 4W5HA 2HCBA 1SVKA 3R9IA 4NKRA 3MAAC 4IKEA 4F7WA 2YWGA 4NL4H 4KU4A 3WHLA 3KJEA 5GJVC 3OF5A 4LV8B 4DDUA 3H2YA 2O8DA 2P67A 2QN6A 4ARZB 1TF2A 2RGCA 4URYR 3IIKA 1UDXA 2PX0A 2ZJYA 5JRJA 3UG7A 1G6OA 2QUZA 3LX5A 3T1VA 1CR4A 3FMIA 2H5EA 2HT6A 1E1RD 1F2TA 3UKDA 3RYTC 2WIBA 2AX4A 2VHUA 4Q02A 1LB1B 3JVUA 4V0OA 1U8ZA 3AP2A 4MITA 1G7TA 2PJZA 4TL7A 4URZR 3BGWA 3UMFA 2ORWA 1GL6A 3ADKA 4Q9KA 2IXEA 2KJQA 1E2MA 2XOKD 3EZFA 2MMGA 1I4DD 1RRFA 2C04A 3U3KA 4IDOA 2HXYA 2EWVA 5JLJA 3W8NA 3PVSA 1PLLA 2O5VA 4EJSC 5C2JB 3W3AA 1G5RA 3C7KA 1U2RA 4CRWB 2ZS7A 4JT4A 3NKVA 2ZI5A 3ADCA 3T5DA 3K8YA 2IWRA 3GEIA 1LNZA 4YDHB 5DI9A 1CULC 3HU2A 2IUTA 2Z5FA 4LYAA 2O8FA 3IDQA 3W6NA 1Z2AA 2IK8A 5CK5A 4DCTA 2GA8A 2RGAA 3O8RA 1MO4A 1QDEA 4XD7A 4D81A 2P3SA 2FH5B 4AKEA 4OI2A 2REOA 1XCGB 4D4MA 2J7PA 4LUCA 1R10A 3GLGA 4KSCA 1JR3D 2NZJA 2VEDA 1MRSA 3SOPA 3EZ2A 3PEUA 2ODNA 1G18A 2Y8EA 4IRUB 1SULA 3B5JA 3GLGE 3NC0C 4A6PA 1G16A 2ANCA 1SXJA 2G83A 2MSDB 2IYYA 2VH5R 2ZI4A 4XVQA 1F3OA 3BC1A 1U90A 2IS6A 4C4PA 1NVUQ 2WWWA 4HLCA 4LPKA 1KAOA 1N6PA 2ODBA 3PUWA 5FTKA 4B3FX 1D2EA 3DHWC 4IDHA 4TYNA 4JSTA 1KI7A 4Q4JB 1M7GA 2GETA 3RS4A 2C9CA 4PHFA 4CEIA 3GD7A 4EPTA 1X8KA 4FMDF 2VBCA 1LVGA 2ZRNA 3QQ5A 5J4VA 5AUNB 2CL0X 2JAQA 2WM9B 2IWHA 5DN6D 2GCOB 4A8JB 4A9AA 5FPYA 2FGJA 2WWYA 1G7RA 4JBXA 4TLEA 2WAXA 2ZJAA 4LJ5A 3FFAA 3JZMA 1BS1A 3LD9A 3VNVA 1XD2B 4OKSA 4PX9A 2VP9A 1RC8A 2OXCA 2GHIA 1DG1G 2QG6A 2B21A 1A82A 2EW1A 4OHXA 1BH2A 2Z6VA 2X2FA 3GJ0A 1DADA 5FBVB 2QE7D 4JSYA 1M1YE 3BRWD 3TLXA 1CEEA 1VYTA 2BMEA 1SHKA 4LCBA 1AQUA 2NZ8A 2C03A 4FN5A 2CXXA 4TL8A 5KPJA 2EQBA 5FTLA 3ZVMA 4JBWA 1VG0B 4WA7A 2IEYA 2W83A 4Q5IA 2AKYA 5CB8A 1S9HA 3C14C 1S96A 2FDCA 4LC1A 1P2SA 1P3JA 4FWIB 2O8EA 1E99A 4Z1MD 2GEUA 3MWYW 1SVOA 1E1RA 1BMFD 1FX0B 3NDBB 4W5WA 1P9NA 4MYUA 1N6IA 2QM8A 2ZRFA 3AV0B 3SU8A 4DSUA 3RANA 2WOJA 2JCSA 1E2HA 1E9FA 1AA9A 1VCIA 2NO9A 2N42A 3KUCA 4C30A 1VG9B 4PSAA 2P5SA 5AJXA 4CDGA 2PMKA 1GP2A 3CWQA 5JJIA 2XOKA 2IC5A 4KFUA 3KQKA 2OT3B 3CRMA 3T12A 4DIDA 1NIJA 2EFDB 2JJ1D 1P72A 2AXPA 4LYJA 4R71A 4QOSA 1E6CA 1E3MA 2J1LA 5EZ5A 3W8RA 5JCPA 4ZDJA 1R0XA 3R20A 3BE4A 3ZZUA 2C2HA 2CE2X 2D06A 3BB1A 1ZU5A 2WWFA 4WXPA 4NU0A 4BLSA 1FZQA 1DAIA 1ZYUA 2RGGA 3CRW1 3WYGA 1X6VA 5CM8B 2F6RA 4M1YA 5GVRA 5J40A 1D2NA 3SJAA 4QBGB 4CT4B 3PEYA 2V6JA 3N70A 5F9HA 4JKYA 1JR3A 3AUYA 3GPLA 5FTJA 5TDHA 4MDFA 4DLZA 3LA6A 1G7SA 2QP4A 4MRNA 5HKKD 1VTKA 1JR3E 2OFOA 2GBLA 4NPHA 4I99A 4WW0A 1OH5A 2QSZA 4LHXA 1BIFA 3QXJA 1NIPA 3QG5A 2F7SA 1X8LA 2GJSA 4FMCB 3U4QA 1LFDB 5FPHA 2JASA 2WJJA 3CUEF 3RS3A 5KNBA 5IK2D 2O8DB 1W46A 2XSZD 2JJ2D 3F5FA 4KFTA 1N0VC 5DNYB 5JJKA 1ZCBA 1G21E 5CYOA 2OBLA 1T8TA 6Q21A 3PQCA 3U7FB 4C3ZA 3QG1A 1DS6A 3LQQA 2JDID 3EA0A 5FOUA 4JJZA 1EFRD 4K8OA 2ZVPX 4PZZA 3KQLA 3AKYA 3KJGA 1C4OA 4LK2A 2A5DA 2W2XA 3EPKA 4C0KA 1WA5A 3A1TA 1TTTA 2DYKA 2IF2A 2QE7A 4OJKA 4LWZA 5BW8A 1BOFA 3REFA 1GNQA 2NIPA 2AL7A 5BN4A 1BYUA 1AKYA 4TTRA 1Q1ZA 1G291 5BYJA 4D6PA 5FBQB 3AF0A 4UXHA 1EFUA 2IBMA 1WMSA 4EPWA 3GLIA 2OFXA 3LXRA 2GJ8A 5K8LA 3KQHA 1GM5A 2GEVA 4QBIA 3UMSA 4P31A 1XFAA 3ETLA 1ZNZA 4PHHA 5ANRB 2CJWA 3GLIE 4M1TA 1DAHA 1A1VA 4Z1MA 1NVVQ 2FSIA 2YWHA 3NIBA 1BMFA 2QT1A 3W9YA 1UAAA 2OE2A 4IJMA 1JJ7A 2ZRAA 3X1ZA 1Z63A 4NBSA 1N6OA 1W4AA 4QFMA 3DMDA 5SZIA 3VKHA 3M4YA 1UEIA 2QPAA 4W5JA 1IY2A 1AZSC 4PSKA 4AD8A 2QMEA 3VR5A 3HU1A 2ZRGA 3U5ZB 1DE0A 2F43A 2F55A 4P4TA 1ODFA 3NEJA 4OBEA 5FOVA 1SXJB 1E2PA 1XXHA 2QU8A 2D7CA 4Q18A 4IOKA 1AS3A 3PG5A 3QJYA 4F93B 4JIMA 2YWFA 2XEXA 1TADA 2H16A 1XXHE 1GWNA 4YMWA 2WMOB 2QQEA 3U61B 4UJ3A 4CEIB 3SHFA 1T3LA 3BD9A 3U3MA 4NTZA 2RAPA 5BN5A 3TAUA 1JXMA 4LJ9A 2BIFA 3GJ3A 3Q72A 4HLQB 4HLUA 5EXTA 5HE9A 1P9WA 4RZXA 3EIEA 2B7BA 3KX2A 5LDDC 2IT1A 3MMPA 4Q9HA 2WJYA 2KI5A 3H1TA 5FBRB 3SJBA 1MO6A 1XP8A 4E5UA 1E2JA 4AY2A 3FHTA 4FINA 5HKKA 2A5YB 4G5SA 4XWOA 4M22A 4C2TA 1D5CA 1G3MA 2ATVA 3L2OB 3MWLA 1EGAA 4DLSA 1W7AA 2ZU6A 5FTNA 3QSYA 3B2EA 2OZEA 5EJEA 2D3WA 3FTQA 1Q1BA 3NBFA 4Q21A 3VR3A 3VR4A 3WY9A 1OT3A 4OHZA 3EPLA 2JJ2A 3K70D 4QL3A 3HWSA 4PXAA 4L9WA 1KZ7B 5B30A 4DJTA 3VR6A 1NNEA 2HLDA 1YHNA 4NYJR 4NCJA 2ZPTX 3K1JA 5FR1A 4ZDWA 3CZPA 2JDIA 3HU3A 3OHMA 2IS1A 4C9BA 4ZDKA 3GJ4A 4WXRA 4RKEA 3IO5A 4QC2A 3A4LA 1NSTA 1UEJA 4I1OA 3NG1A 2B6HA 2QT0A 4HDCA 4Q1FA 2IA5A 3OIVA 4JLAA 4HDQB 2ZAOA 4L16A 2YV5A 1QHGA 4LJAA 4PR0A 1HEIA 1VDZA 3I4LA 3Q7QA 4UNPA 2C8VA 3OZXA 5H70A 1G7CA 3ZS9A 4MGZR 1T3HA 4S2EA 5LB2A 4LX0A 4TYWA 3QY0A 4RFSB 4DB4A 3FYHA 4TZ6A 2GBLC 2QTHA 2R9VA 4K81B 5DYGA 3K0AB 2W58A 2DB3A 3LWNA 1KI6B 1KO5A 2FF7A 3CNLA 1DELA 1Q12A 2ZR0A 1I2DA 1IXZA 3AVVA 5C18A 3MGCA 2ZRDA 1TX4B 2WKQA 2FX3A 4ZO4A 2W00A 3KB1A 4M1MA 1U0JA 3LRPA 4JZKA 1FUKA 3FKSD 1TEXA 1E2EA 4HI0E 2WTUA 1Q22A 2Q3HA 4Q1BA 4RVCA 3LBIA 1KKMA 3A4NA 3E70C 4ARZA 2UZ3A 4JLJA 4V0KA 1OIXA 5KSOA 1E9BA 4TT3D 2MSCB 2PZGA 4C0JA 4DDTA 1VHTA 4HZUB 4JVMA 1OYWA 3TR0A 4ASUA 4HAZA 1Q0UA 1H8EA 2ZSDA 1Q57A 3H4MA 5EP2A 521PA 4A2PA 3PEWA 3WNCA 1S0UA 1LF0A 5FL7D 3KDSE 3NHAA 5LPNA 1Z28A 2KBFA 2LKDA 1NVWQ 4PQRA 4M21A 3Q85A 3QUSA 3BFVA 5AJZA 1T3SA 3MG9A 4FMCF 1QHIA 2IYTA 1AJEA 3N2EA 1XPOA 1DTSA 2HV8A 2C99A 3BIFA 1E32A 1E94E 4AYXA 1NMZA 3C5HA 1XZPA 3AVUA 1DG3A 5E3HA 2FE4A 2C78A 2NO7A 4EIWA 1E9RA 1JAHA 4H9GA 1Z22A 2XXAA 3EZ9A 2ZXUA 2C77A 4DC9A 4GOXA 5IRCD 2N46A 5KOYA 4TMTA 4YDSA 1GTVA 3A36A 2CLCX 2IEZA 4CF7A 1XB2A 3V9PA 4YC7A 4CT5A 1NY6A 2AHOA 4A15A 1YZNA 5J4LA 4XTCS 4C0AC 3TE6A 2V54A 3B1XA 4US2R 2DCUA 1UKVY 1SHZA 2FNAA 2HXSA 4MGIR 2UKDA 3X2SA 1LW7A 2R44A 4PAOA 1XDBA 3GLIB 1JPJA 1YR8A 3U60B 4MYTA 4JMPA 3QVVA 2VHJA 1OXVA 4JBYA 4TLDA 2QI9C 4LI0A 4BFZA 3CR8A 3LLMA 2BEJA 3BB3A 4AYTA 4EUNA 4G01B 4KAXA 4NYMQ 2ONJA 2AWNA 4B32A 4Q4JA 2D2EA 1UKZA 4Q4LA 4GMXA 3IEVA 2H57A 4JVNA 5JHGB 1TUIA 4IOMA 4WOPA 3E2IA 4HLUC 2FFAA 2PCLA 2NPFA 1DAFA 1IY0A 5FOTA 5TXGA 5HCIA 4Q4AB 2GCOA 4A8JA 1S1CA 1COWD 2P6NA 5AR1A 2PL3A 4TWZA 1KSJA 2V4ZA 4MDEA 2QSYA 5D3MB 4HZIA 2XJ4A 3D3QA 1X86B 3F3YA 5TV2A 3RDPA 2BKUA 4ZPXA 4C0SA 1E1QA 5K8UA 4F4IA 3ICQB 4CW7A 4B35A 2D62A 2NO1A 4O2LA 1R0YA 5JMTA 1WRBA 3CF6R 3A8TA 2O0HA 4I1UA 2QBYA 3QPVA 4RCYA 3KZ1E 1FNNA 3K9LA 3V4RA 4QJ3A 2GDJA 3J81k 3TJZA 2O0KA 1XMIA 1OXSC 1AGPA 5TMPA 4TT3A 2J41A 4MUBA 1FL9A 3OIYA 2BBTA 2J0UB 1M34E 1XTSA 4HUQB 4B48A 2GXUA 2YOGA 5L8VA 1M6NA 3EIHA 4EQ6B 3SC3A 2VP5A 2ZI6A 4NONA 1S8FA 3RS7A 3U3JA 4WBSA 1FTSA 3FHOA 1QG4A 4NMMA 5FL7A 5DHFA 1BO6A 1SKQA 4LHWA 3SHWA 1W0KA 3FB4A 3ZS8A 2F1IA 2J46A 4GP6A 4QGFA 1EFHA 3DDCA 4B43A 1WDTA 4LJ4A 2VL7A 2ZRKA 2QZ4A 1E0SA 3I3SR 2FEMA 2ZREA 2ZJZA 5SZJA 1LS1A 2YVUA 3OFND 4A0HA 4D2IA 5CIQA 3GLFB 4KO8A 4D25A 4TL9A 1VIAA 3ZD6A 4IDPA 4HAYA 5GADl 2QA5A 5E7JA 1G5TA 1ZC4A 2QEQA 2DWOA 1X1SA 4IVQA 1XMSA 3TNFA 3CB4A 4ACAA 4AKGA 3VFDA 2F9LA 1U0LA 1P62B 4V03A 2PX3A 3LX8A 4WZ6A 3SQXA 4N0DA 1XU4A 2NMVA 3T5GA 4AKHA 2ORIA 1ESMA 3G0HA 1TF5A 2KBEA 3V00A 2FSFA 5JEEA 5IF9A 4P33A 4WAUA 2HJVA 3EIQA 4BECA 2GILA 3TRFA 1RRGA 2OCAA 3FDIA 4MGYR 3WBKA 3LVRE 1RJ9B 3X1YA 4LPSA 3U6KA 2XJ9A 4OI4A 3T1TA 3A1UA 1E9CA 1N5KA 2JATA 3K9NA 3X1XA 1T9HA 3AP3A 1ZJ6A 5FBWB 2R6DA 2BBOA 2JIZD 1QF9A 4XTRA 3CH4B 4KV9A 4OQXA 5KSPA 4OHWA 3OEED 2HUPA 5TB5A 1QHXA 3CPEA 1ZM2A 1E98A 3DZDA 3UK6A 1JQLB 3ASZA 121PA 1E0AA 2DFNA 4QBHA 4C0QC 3N2IA 2WJIA 1COWA 3DZ8A 3FHCB 4S35A 3U44B 4C2UA 1P2TA 1X1RA 3FMFA 1F60A 5JRZA 1GKYA 1DEKA 1XCMA 2WV9A 3AKEA 5C4MA 4D4JA 2ZEJA 2QORA 4DLRA 1UKYA 2OAQ1 4GZLA 4JS0A 3CIOA 4WIAA 1OLOA 4R9UC 1G4AE 1Y3AA 2HEIA 3CRVA 4M9XA 4HLDA 2ECKA 4JVLA 2ONKA 2FSHA 2ZS9A 1E4VA 3AF4A 4LDJA 5TY0A 3GJ5A 2Q9AA 1CJKC 1DO2A 2O0JA 4YMVA 1J70A 4QNMA 4B75A 1Q3HA 2G0TA 3CO5A 3LY5A 2W6JD 1KTVA 4Q00A 2IL1A 1PJRA 2X8AA 3REGA 2Z43A 4BFYA 2XXAB 4X8MA 3W6OA 1W49A 2ANBA 3VKGA 3ZVLA 1Y63A 1HQYE 2R2AA 2BHRA 2J9RA 3B1ZA 2GVDC 1GSIA 1L4YA 1NJFA 1RYFA 1U8AA 3GQBA 3DL0A 2DWPA 3PUXA 4Q1CA 2Q6TA 2ATXA 1KK1A 1YZKA 4Q7LA 2Z0MA 4A8JC 2IS4A 2CLDX 4TTQA 3A37A 5FUYA 4DCUA 2GK6A 4KJZA 2Z4SA 4BFUA 1CU1A 2ZJ2A 3FOZA 2A5GA 3E1SA 4V02A 5HCNA 3OFNA 4B2PA 3I8SA 3VR2A 2OCBA 3VHXA 1ZNWA
chains in the Genus database with same CATH superfamily
1Z68A 3QNUA 4EGQA 16PKA 3R7LA 4ENPA 1P9RA 1AKQA 5LCXA 2R84A 1E1DA 2FLKA 1BA2A 3NH9A 4L95C 2GZMA 4AG5A 2VTBA 4C7JA 2OA0A 2BFBA 5JTUA 3L7AA 3AKCA 1YS7A 3FFTA 4S1TA 1B0AA 4MQLA 1JWLA 2QKYA 4JUFA 2MSNA 3BIXA 3WGVA 1WMDA 3BERA 5K4HA 1KKLA 1ZEJA 3CF4A 1O89A 1JKMA 2SECE 2VN8A 4C88A 4FS8A 3B1WA 2E4AA 2FPIA 3ELDA 5JS7A 1A9TA 3T3IA 1Z83A 2AE1A 1DQNA 1CF9A 2F1HA 1OFUA 2QRUA 2VBFA 2H2WA 2JLSA 3QYFA 5FOWA 3SXJA 5JARA 2HSJA 1HFEL 2P35A 4O6VA 3V42A 4DSOA 3NRJA 4DLYA 4WZBE 2I8CA 3MBOA 1GL9B 4EG5A 1TZ2A 4Z9YA 3JZAA 1RJDA 5FYDA 2RHJA 2PL1A 5ER6A 3W5SA 1TYCA 4WL0A 2ZBPA 4ZN6A 1LBTA 3FOFC 2AN4A 1V35A 5G0WA 1W30A 1NVVR 3QVUA 4UM5A 1ORWA 3BCUA 2ILVA 3EGIA 1EXWA 3QVXA 4NNOA 1XPUA 4GL2A 1VE3A 4MICA 3U3RA 2YWCA 1E9SA 2YRWA 3AEUB 4NESA 3PPYA 5JECA 3L9WA 2QY9A 2D0OB 1XTRA 4OH1A 1DAKA 2I6XA 4IGAA 3VU9B 2QLFA 3SC2B 1LRKA 1DG9A 3GMIA 1NG1A 3L82B 1ZGGA 4BGUA 1EU1A 2W6ID 3VDQA 3VGJA 5HILA 3WJAA 4HAOA 2ODEA 3IVAA 1CEXA 2J32A 3BRCA 1UBCA 3QLUA 3AR9A 3A1DA 2NADA 4HHEA 2WE8A 5LXTF 2ATCA 1U9CA 2FRVA 3F1KA 3LY7A 1WTAA 2MTBA 4LX8A 1AQJA 4YJ3F 3OA0A 4LRUA 4B6SA 3DBLB 4XB6B 4WY2A 4B3TB 4FLFA 2LKCA 4F3TA 1KYYA 1XVLA 3L77A 2H1RA 1N34B 1LNSA 4YIKA 1Y37A 1NMXA 2Q1SA 1CT9A 3AB3A 3KQYA 4ZT5A 4CMIA 4KZPA 3DMRA 1C1XA 2MR5A 4IDNA 4Y1FA 3WDKA 3UV6A 2BC9A 2ECOA 1QZUA 2YJZA 4HAVA 1N5LA 2TS1A 5CM9C 3A2KA 5DMHA 4JMLA 4P0TA 3LT1A 3L9XA 4GUAA 1SGWA 5ESRA 1FJGB 2OXTA 1WF3A 4E21A 5KYXB 3HL4A 1ZD8A 1XRSB 2ZS8A 1QDLB 4UM7A 3PXGA 3DMPA 3E9CA 4TKVB 1G9TA 3IPLA 5KX5B 2W6JA 2A9RA 3HCEA 1AKVA 3P9NA 4GI7A 2ZSAA 3I2FA 1ZVQA 3CRNA 1YJXA 3RVQA 1XJCA 2B8WA 2PV0A 3I0ZA 1YQQA 3JWHA 4LDQA 1W36D 1QK5A 5A2QA 3KZMA 3KBOA 2QTTA 2AMLA 4JR0A 3W0LB 5GIPE 3AVWA 1IHUA 3G49A 3TG8A 3R5JA 3OIDA 3L4EA 5A9TA 5K4GA 1NW8A 3K32A 2O6HA 1YACA 3MLAA 1UF9A 4XEUA 1CQIB 2YC2C 4F8JA 2CBZA 1TJNA 2HSGA 3AV3A 3IT2A 3MINA 4I2NA 3T15A 4A0RA 4CMBA 2DY0A 1QYXA 5HR5A 2UZIR 5C3MA 2QWXA 2F4VB 4MW6A 4OGGA 3C3DA 4MQ4A 5I51A 2AG0A 1XMQB 4GXNA 1UBOS 1P7VA 1DC6A 3CZ5A 5HFAA 5L3ZA 2Q5IA 3Q88A 3T61A 3DKIA 3ZY6A 1G8HA 2HH9A 2O2ZA 3AR6A 3UG6A 2OCGA 4BX2A 1J8FA 4QYSA 2XTNA 1YOVB 1YA8A 2BGRA 4HZUA 1KI4A 4YTEA 3RROA 1L5VA 3U26A 2C94A 1AQYA 4AN1A 3GFTA 4BB5A 5HRAA 4MWSA 1VCNA 4AQDA 3EOAI 2JPDA 3ABQB 3II6X 4UVGA 4WVLA 1UJBA 1TFUA 1J8YF 2RBGA 2YZKA 3C3AA 1ODKA 1G8JA 3MSCA 4MQBA 4PR3A 1NUAA 2VHVA 3A7EA 1BMQA 1SBTA 3DL7A 3B3JA 3EGXB 2BR4A 4BZPA 1Q77A 1DV2A 2B34A 4RSMA 2FP4A 2LZ0A 3FYDA 3HGTA 2EKQA 4ABYA 1PWXA 3GRCA 3BGOS 2YYAA 2P62A 3HKBA 4TWRA 2Z9CA 5EMLA 1VYUA 4UJ5A 2X5JO 5DDIP 3IEPA 4ZANA 2CK3D 4UAUA 2ZSEA 5A4IS 5FI1B 3UJNA 1ZM7A 3TOCA 3L7DA 2OY0A 3KXLA 4M0KA 1Q7RA 4RE6A 1T8SA 2RI6A 4OK5A 4F3RA 4YCSA 3C6BA 3ZWBA 4EAAA 4ZV4A 2EEPA 4JP5A 1UJNA 1OFHA 5F2EA 5GJBA 3FUCA 2DERA 4L1KA 1BMTA 2OBXA 2B7CA 4RV5A 3KL2A 4ZMRA 1RI3A 3MRVA 1CR1A 3GRFA 2QUJA 1HDXA 2VJAA 3W8FA 5D86A 1AZLA 2UUOA 2J0VA 4E3WA 3JYQA 4RENA 3KCQA 1YZLA 5BWLA 3X0DA 2GN8A 1VBFA 2XVZA 4M46A 5JXIA 2VQFB 4S1PA 2QTLA 3MCVA 4QYWA 5DIFA 3S27A 2BEUB 3U4HA 4DUYB 3V4FA 4MO9A 3K20A 4BTLA 4W5TA 2BFOA 1N9GA 1NUUA 4NMLA 3QX7A 2XUGA 1F17A 4N48A 4R2JA 3KZCA 4H7DA 3KAKA 4KYTA 4PZEA 5F7ZA 3T0IA 4HH1A 3EEIA 3L0IB 1YQDA 1N2JA 2NP7A 1UXKA 1F2DA 2EGUA 2XECA 3QKTA 1TTPB 3EIUA 3EBLA 3F47A 1S2MA 4FBMA 5DXAA 4ZC8A 4DDVA 4RTQA 1DWUA 4MWDA 7ADHA 3J7AC 1JYEA 2LRHA 3RV4A 3K09C 4OQEA 3B1YA 4QAJA 1QG2A 5IC5A 1PE0A 5A3RA 4TYYA 1OA1A 1R7RA 4J8PA 4P5DA 3SI7A 3O2JA 4PC7A 5EMKA 1ZD3A 1CY0A 4PG6A 3ZD8A 3ROFA 4E09A 1N32B 2Q5FA 1LV7A 5FADA 1PG5A 4B6QA 4YO8A 1QS0A 4ZYLA 2HRQA 1EGQA 2VP6A 3LF1A 1O94C 5FA6A 4RPJA 1CJTC 2ZUCA 2CZCA 3ZV5A 2ZRCA 1HETA 1DARA 2QF7A 3CH5A 3WKCA 4ESVA 1KI2A 3VNVA 4O3MA 3OPXA 4RD2A 4Z4GA 4DQ0A 5CCBA 3K9CA 2VIIA 4N8EA 1H65A 1JX6A 4NOMA 4C0BA 1C3VA 3UUEA 2CWWA 3LQYA 2HO5A 4JJGA 4TV8A 5A6VA 3MPUA 3GZNA 3Q8LA 3U09A 4LZOA 5A0TA 4UNQA 1IL0A 2IITA 3TPZA 1FP6A 3LP6A 3LZCA 3KE8A 3ZCXA 3G8BA 2O2IA 3QWFA 4GZ3A 4P36A 1YGYA 3SE0A 4D4IA 1ZK0A 4RZ3A 1A0OA 1HURA 1OAOA 4UUMA 1KAGA 3MJDA 2AYYA 2ERCA 4HGRA 4JXJA 4KYUA 3D7NA 4FFLA 4UMFA 5E7MA 4GX2A 3RTEA 1ZITA 5FWDA 4YMUA 3QWBA 5KYNA 2JS7A 1KZ9A 3AL0C 5ES4B 2AJ8A 3VPAA 4B2IA 3NBXX 3PQ6A 4E1VA 4Z0NA 4I7EA 2R1VB 3W1VA 1FP1D 3KVNA 1TLTA 2WQ7A 3KUDA 1ZONA 1Z7GA 2FY8A 2I80A 2V0NA 2V7QD 1ZFNA 1GQYA 1KR5A 2AFHE 3IBSA 4HUQA 5EP3A 3T7RA 4MW9A 2XCTB 2RMKA 3U4IA 3M3DA 2N47A 1TQ4A 3BSWA 3CPJB 5JISA 4KO2S 1O97C 1Z6QA 5JCJD 1O9BA 3VPGA 2V3CC 3FZEA 4Q12A 4J7AA 4OHFA 4BJ1A 3EY4A 3OE7D 3HM2A 1NVEA 1KFJB 3X1DA 3JYLA 4FLMA 1I4TD 3DV2A 4YAIA 4KR2A 2YMMA 5ALTA 2HM7A 4PO8A 4B31A 2I4RA 4QBTA 1O08A 2G1UA 1PT9A 1M7BA 1YOBA 2V8BA 3E3NA 2O1WA 4BRUA 1G6Q1 4FKZA 2EZ9A 1UPFA 2R4QA 4IF4A 3PUVA 4BKUA 3IIJA 4M1KA 4O1IA 5IK2A 2MYPA 1KI9A 5L95A 4RULA 3C74A 3AEQA 3LZ6A 1PNQA 5GMOA 3GLFE 1J1IA 3IRUA 4JI4B 1HLPA 5EE0A 2LIVA 4KDEA 1YDWA 4EJMA 5LOVA 1KOGA 2AOXA 2VDVE 4Q48A 2D5LA 4FZVA 2GA9A 3SXUA 3CMCO 4B7AA 5EXPA 4TKZA 3REOA 1CYEA 5HZGA 2HXGA 1UXIA 4KXXA 3UXMA 2G09A 3S3TA 1EFRA 5FB3A 1N0UA 2W4IA 3FG9A 1E9EA 3DAOA 3WGUA 3EWAA 4I55A 3SKXA 4H7EA 1T2NA 2AT1A 3ZJVA 1FDTA 2CVZA 1E8NA 1K86A 1JBEA 5F7JA 2HPZA 2IYAA 2JFWA 4F12A 1FSGA 4JJKA 4LTDA 1L8OA 4AK9A 5GV7A 3A6DA 1Y1KE 4DMKA 2LCQA 1GQFA 4Z5XA 1PFQA 821PA 3A1FA 4Q34A 5JANA 3EDOA 3SHTA 1EH5A 3E35A 1OSNA 1P61B 3E9NA 4FHEA 4DMFA 1JPVA 1QOPB 1SOMA 3GBSA 1JNXX 3I8XA 5BSTA 4G3XA 4F96A 1L7OA 5GONF 3IL2A 1AQ6A 4V0QA 1AS0A 1S2GA 1WCIA 1LTKA 1I13A 1YZVA 3SY8A 3I6BA 3MJVA 3DT8A 2HA7A 1YBMA 3TQHA 2X7HA 3KLMX 2DECA 4EO4A 1ETUA 1IBCA 4M1SA 3FWPA 4KBYA 2BGKA 2DXIA 4DBLC 2QRPA 4EYOA 1I0IA 4LJ8A 3VSAA 3VVBA 1N2CB 3ND7A 3GLUA 4DADA 4ABTA 3GYBA 3BA1A 3KPYA 4C43A 2VO1A 4EKEA 1Z6ZA 1K5GA 2XWPA 1WS6A 4K5QA 3KS9A 1UZLA 3G2OA 1OXBB 1DEAA 1G59A 2VZ9A 3U44A 1C1YA 3LTEA 4HP8A 4IIUA 1P17A 2XVAA 1IZ8A 1VSBA 3GGPA 4GOOD 3T35A 2E87A 3V3TA 2IHNA 1PVOA 4R9RA 2QLMA 2JRLA 3OX2A 4Q9NA 3V4LA 1G20A 2O2XA 1G41A 4DMHA 3DM5A 5CH8A 3WZLA 4LFBB 5FXMA 1HDIA 1ZESA 1H2FA 1SNYA 1PIWA 3R7AA 3SHWA 3DKRA 3DOOA 3WFIA 1XZBA 4YJFA 3ETCA 3W5BA 4TRMA 5JFGA 2FP4B 1NY5A 1YQTA 2CKDA 4WOCA 5FWAA 3ZWXA 1B8OA 1Z0JA 2HK8A 2QN2A 2IU6A 4ZHQB 5HBGA 1ZGZA 4QDXA 4PCAA 3SF8B 4IDFA 2ORVA 1BQEA 4L4UA 4KR9A 4Q05A 4V0LA 3TW8B 1YVEI 4MUKA 3HB5X 2VJPA 4M88A 3WOHA 1RRKA 2C3UA 3PX7A 4WZAE 1PS8A 3PIDA 5FBLB 5A5FA 1WB5A 9GPBA 5CEJA 1C7RA 3LVQE 2ZWIA 4FZRA 2AW3A 3FCXA 5AMXA 1OLSB 3VNQA 4Z3KA 3PGA1 1MVNA 1F5NA 1Z38A 1VFPA 1ID1A 1HSZA 1K89A 3WMGA 1MFPA 1YKFA 4D4LA 4MA0A 2AG1A 1KH2A 2QMQA 2WMDA 3OO1A 3TQSA 4DCVA 2AWOA 2PK3A 1K1EA 2FN3A 3GRVA 1BQ4A 4RV4A 4EYKA 4RKQA 5ER9A 2OSVA 1TU4A 3K3PA 4IICA 2D4AA 4GYKA 1V95A 2HF9A 1JQ3A 4I8DA 4YREA 1JIVA 3C6QA 4FHDA 4DHEA 3B70A 2HMUA 4RE5A 1NRXA 4PYMA 4Q3AA 4YBRA 1Z07A 4YP1A 2LPMA 1U1EA 2C4NA 4G4IA 4WFQA 3CM0A 4FDAA 3E9YA 3JQ9A 5ALYA 3SEAA 3ZNPA 6ADHA 1GNLA 5JSZA 3I01A 4LF6B 4M6WA 5EAIA 3TFWA 2OESA 1OTYA 2AR0A 2FZCA 3OU7A 2I3AA 3BMNA 4BYGA 3ADBA 3P19A 4MKZA 1O4WA 2FEOA 5EHIA 2JC3A 4RO0A 1VJ1A 2F90A 2DU8A 1LTQA 3PVZA 5LLSA 2PR7A 4ZK2A 3IP5A 2GM9A 5TRTA 4EHAA 7MHTA 1MQ8B 4V0ME 3AI1A 2YWJA 1JU4A 3A1SA 4MWOA 1JEJA 1KYQA 2ZM5A 2D4HA 1WPGA 2N9UA 3DV0B 1QS0B 5KSZA 2JZOA 3MOSA 1Y9ZA 2O54A 3H42B 5TQ0A 3ZGYA 3QKUA 3C5EA 4FGJA 4FYMA 4BFWA 1V0JA 2OGUA 1KDOA 3GLHE 1KFCB 1MEEA 4N8DA 2I34A 3DSRA 3CT6A 1EWRA 2A5FA 2QP3A 1Y7PA 3M6XA 4FQ8A 3KTAB 4J0HA 4PQFA 1NI4A 3WSWA 4D0NA 1RYMA 3TAHA 3BSSA 4COOA 5BUZA 1RXUA 5JWRA 1JIXA 4MRAA 2DULA 3TQCA 3BD6A 4QOJA 3T5MA 1WDLA 3SG0A 3W2HA 4ALMA 1M2WA 1F06A 2OUKA 1Z7EA 2A9FA 2C2XA 3BIWA 2INGX 1DI0A 4JLBA 1NFRA 4QDJA 4YQYA 3EEOA 1S7CA 1YQXA 1KTIA 1E2NA 1WD7A 3N39C 4A3SA 4CZ2A 2F1RA 3OZAA 3FWNA 1PSDA 3NTUA 4DAOA 1Z5WA 3NFRA 4U4AA 3FKSA 3O8BA 3T4XA 3PXBA 4UU0A 5G0VA 3N0XA 2G06A 2PLFA 2W2PA 1DOZA 3JVIA 1LU9A 3KNZA 2PX6A 3I73A 2I2FA 3L8CA 1W88A 3K0BA 3DZCA 1ADJA 4CLHA 1D3AA 1C1DA 2QY6A 4D9HA 4EI2A 1IZYA 3TUJC 2IS2A 5DI3A 5EG5A 1XJ0A 4RWEA 4MKFA 4NU6A 4XPIA 4ZOLB 3UK0A 1ZM9A 1PG2A 3NTXA 2JKZA 1OXXK 1VLJA 4JYPA 4XYBA 2GBPA 4OUDA 1MAAA 1WBJB 5KVCA 2ENWA 2XMGA 3GXOA 2FPMA 1L7EA 2VNAA 5PGMA 2VBGA 4HC4A 4AWXA 5DTJA 3AHDA 2H0AA 1O9GA 3KZVA 4HR7A 3I1IA 1O5TA 1A9ZA 3C8UA 4PV7A 4E3ZA 1I7NA 2NTYC 4GM1A 3AEQB 2P77A 4CKEA 5C1BA 5DPMA 1P3DA 1DO8A 5LOVB 3V1LA 1TOAA 3ROPA 5DHSA 2OBMA 4KXFB 1U0NA 3MLEA 4KXLA 4LISA 4XD7D 4OI1A 3STYA 3SXUB 1MMFB 2HIMA 2OLKA 2NO0A 2X2PA 4BVJA 5DHUA 3NV7A 3P71T 1OGIA 4XYGA 2OO5A 2FPUA 3C15C 1GVNB 3KXPA 1JVNA 3C98A 4F92B 3A31A 5F3WB 5DRYA 5IM5A 1EK2A 4Z8XA 2P4HX 3RSGA 3T54A 5AKZA 1C3XA 1W35A 3BE5A 4X6UA 3U4AA 4ZIRA 2RKOA 4RFVA 1JPUA 3P5BA 2PH1A 3KK0A 1BE6A 2FFBA 4OK3A 3R1IA 3FSEA 3OOSA 4MJ7A 3RRBA 5AVUA 1Y4ZA 2WYUA 3GUHA 1Z5OA 4YROA 3I3OA 3OZWA 3MGBA 4G5YA 4NNJA 5BWMA 5AICA 1DBWA 1TAGA 1G0NA 3H9QA 3L04A 1EFTA 4M1WA 2WRZA 4PTZA 3ZJUA 1DVRA 3A6JA 1PW7A 1PYOA 5G0SA 1E20A 2CVOA 4JP2A 1B43A 1KEPA 5CYFA 1JIKA 3GC6A 4FI3C 1ELOA 4JLKA 1T0JB 2JJ8A 3LCMA 3X1KA 2O52A 2HW8A 2GHRA 4MDHA 3EG5A 2BTQB 3TB6A 3GY0A 1GPJA 2GYUA 5B53A 2JHGA 3KAPA 4MEAA 2PO7A 2I1VB 3KR0A 1CHDA 1F6BA 3NZEA 3QEKA 4QOHA 4NZOA 4URWR 5JS2A 4EHHA 2I9KA 5BNWA 4LNHA 3L8YA 4MQ6A 4PAQA 4M8NE 4WKCA 1AXRA 2X77A 4B1FA 3DZHA 1GZHB 1CXZA 1P74A 2B30A 3LNTA 3PJDA 2V7TA 1G9SA 4GNRA 4L51A 2NZVG 2EGHA 4ALJA 4LW8A 4DT1B 1Q19A 4EAQA 5CA1B 2PT9A 2QRLA 1G8MA 4HWRA 4N1AA 2ST1A 4DNOA 4Z54A 5JHHB 4LXIA 2DP4E 1ZPDA 1CUIA 4RK0A 2DQSA 5DYIA 2VUTA 1K6XA 1DKNA 1DZ3A 1G20B 1YBAA 5SY4A 2VK1A 4PZAA 3DVLA 1FY2A 3E53A 4R9NA 4ZT6A 5A4MS 3U1BA 3GPCA 2QM7A 1RI5A 5LQMA 4JQSA 2ZWVA 1U31A 3CEPB 4L78A 1C9KA 1VCOA 3PPXA 4YJFB 4EHKA 2DH6A 1BMDA 1S3SA 4PSCA 5AHXA 2PKRA 2VNSA 3A3KA 1OJ7A 4MPPA 4QYIA 3L6DA 3PL5A 3K70C 2I3BA 4CEHA 1RXSA 1QQ5A 1Y6ZA 2JGDB 4INZA 3DC7A 5EPEA 5EPUA 4HRVA 5DHTA 3BK7A 5BSUA 3VHRA 3ZZMA 1X8JA 4BMCA 3ZQJA 2V4MA 3OPYI 4DV5B 3ZE9A 1TM1E 5I8ZA 2GAOA 3VR4H 4LTMA 4GQIA 2VTKA 4LZZA 2G1PA 1GA1A 1JU9A 4MP3A 3AESB 4XR4A 2C8LA 4AS1A 5AM0A 2OCLA 2C82A 2JLXA 4HLNA 1RPNA 4R1QA 1FU8A 3B1VA 2V65A 3C97A 4EPRA 3I12A 2PIAA 5D7BA 3VDXA 1GPBA 2ZB7A 4ZA2A 4HDKA 3KT3A 3PV0A 2DTDA 2AFIA 2PZAA 3NOOA 5TPZD 1SCBA 3HBNA 1ZIOA 3G13A 1WUJS 2PRYA 2VDKB 2D3TA 1VIDA 3QEMA 1JSLA 5IUNC 4O3FA 4UXIA 4QGGA 1ZUNA 2PBLA 3B9QA 1Y1LA 2ZVDA 5JZVA 3RFVA 5G1OA 4M6WB 2G88A 1Q74A 3D8NA 3GWGA 4BNDA 5IAJA 1QH9A 3OQJA 5JY1A 3AP1A 4P3OA 2OBBA 1E69A 4ADSG 2FJUA 1E59A 4YCJA 3N0RA 4M9UA 1R1DA 3BZUA 5JH7A 3NTLA 4L8LA 2I67A 5G40A 3GDGA 2W37A 5DH9A 1VCHA 4HGZA 2X3FA 1EESA 3SJCA 2W2TA 2F3PA 2NU7B 2R96A 2X5NA 3HDQA 5DLQC 4CI9A 3HVUA 4DARA 4DCPA 3FVQA 2RG1A 5IDVA 1YVPA 2JHFA 4UNNA 1J1ZA 2DR2A 5DTIA 1E0JA 2E4UA 2H18A 3IUSA 5TQ0B 4BX3A 1IQPA 3QKSB 3KKOA 2GLUA 3JWGA 3H8VA 1QV7A 1CEYA 4X61A 1LDGA 1FBTA 1VI5A 3NHSA 3BFXA 2Q9BA 2BCGY 9ABPA 4CDRA 2CLMB 2QMUA 4OFZA 3UHFA 3ZU2A 2I2AA 4JX8A 3WRYC 2WFLA 2ZPUA 2BJWA 2FR0A 3GNTA 2FW0A 1U9IA 3P9KA 1WXFA 2PU7A 1WXGA 5ECDA 1SC3A 3HMKA 4UHBA 3EK2A 3VQTA 1K2WA 2C2BA 1ES9A 5DNUA 2Z04A 4M9CA 3ANNA 3K9HA 5BUQA 1YDMA 2GPAA 2MU1A 2XGMA 1OE0A 3JQ6A 4GDFA 4WKGA 5B4UA 2A33A 1JEAA 2A78A 4U7TB 1QRRA 5IARA 4YUXA 2YNMA 1NN3A 3HR8A 4FX5A 5ESXA 2QUIA 3L6EA 2GXQA 3I8OA 1OHHA 2RARA 3L84A 1EE1A 2ADOA 5FPSA 3D1VA 5TS3A 5TLSA 4J3FA 1Z8FA 2CNDA 2J85A 4FB4A 1W44A 2H06A 2VWGA 3I1FA 2Q3CA 5JEDA 3RT9A 2R25B 4GPBA 4D82A 1RQLA 3ELWA 1Y8QB 1EVYA 4FMPA 1AN0A 2NU9B 3ANTA 1N25A 1P1KA 1KBQA 2QJOA 3AJ8A 3REQB 4B4VA 2ORED 3PWSA 1CUBA 4KXNA 4US1R 5C1PA 4OUDB 2G9RA 3P2JA 2QMOA 5AVKA 4QKQA 4Q1DA 4C7XA 3EDRA 2B8TA 1YL7A 3DE2X 3H0EA 3OM0A 2QTBA 2PBRA 4NE7A 4PBSA 5LQSA 3T3OA 4DLUA 1F9EA 1UOPA 4I81A 1DEOA 1KKUA 2XVYA 4GQBA 3VAZA 5B3KA 1KNQA 5HK9A 4DKJA 1JBKA 1RLTA 2DHEA 3F67A 3IV9A 2PR2A 2AIRA 2I6GA 3EWIA 3OU6A 5IAAA 2WU3A 1Z4JA 1SQ5A 1XZLA 2IPNA 4G5GA 1G1MA 3NBAA 1RZVA 1SHTX 2DPHA 1YWGO 1JDJA 1JDNA 1F9AA 1OI3A 2BUAA 3M1IA 4AJIA 4B2YA 1NVMB 5JUWA 2C7QA 3A04A 1E7YA 1HA3A 2QYOA 3VTFA 5F35A 4N0EA 1F0KA 4CNQA 5IBRA 2HF2A 2P5TB 1GTJ1 4GOKA 1RXWA 4QTTB 2OOKA 5ILGA 2ZRPA 4YCMA 4I50B 1ABFA 5KIAA 4EKNB 5GZ3A 1SCQA 2JLAA 2X1VA 4YVFA 4XOIA 5IPFA 3NDPA 4AJOA 2X6RA 4FCVA 4UEOA 1GFWA 5THXA 2FKNA 1D4FA 2KSQA 4ZIRB 1HE1C 1M6HA 2EYQA 5I3ZA 5ALOA 1AK9A 4G1BA 2W6PA 4GFDA 5DE3A 2E7ZA 3T34A 1G66A 1Y7HA 3INRA 3H17A 1IWPB 4YP7A 4BNMA 4OYYA 4ZRDA 4RFLA 2PNJA 2OTCA 1DLIA 4E94A 1VLQA 1GTSA 2WK1A 1JMVA 3ESCA 3UMGA 3K0EA 3VAAA 4A6DA 2FA9A 3AF6A 1PNOA 3LO8A 4QUDA 1B74A 4DA4A 4X71A 3ZBUA 3IP8A 4F4JA 1MIOA 4UOEA 4Y9RA 2EZ8A 3DKKA 5F1YA 1G8YA 4D0SA 4LBWA 1OBFO 1RQ2A 1Y7IA 2EATA 3W7BA 3BGDA 4ON9A 4DIEA 2KS6A 3HCWA 3PJFA 4KKVA 3ZNQA 1E2BA 2DHDA 3AIKA 4RMJA 5DGXA 1NM5C 1MKYA 5A9RA 3FGPA 3MOGA 3P9YA 4KWEA 5IX8A 2Z6QA 4EZIA 4L0QA 4PPQA 4RKRA 4W7SA 1YB5A 3QE2A 4BZXA 3HPQA 5C4IA 1SCUB 2IIQA 3FYCA 4U0JA 3K0HA 3SM9A 3QOWA 4L85A 1OFUX 4XSHA 2BFCA 5DGIA 2H3HA 1RKBA 2EQAA 1ODJA 2WD7B 4XX1A 1USUA 3BTSA 1N8TA 1RMTA 4BE4A 3N1UA 2YJ3A 4QRHA 3N7AA 1Q3TA 4A0SA 4MLPA 4QDZA 3UA3A 5KYYA 4RAQA 2WILA 2BHNA 3HLYA 3Q7PA 421PA 4G67A 4UBJA 4MLCA 1KZYC 1OIVA 3EF1A 4NJMB 5AVOA 4GP9A 2DQKA 4FP9A 2YJ4A 3OESA 2YOFA 2A84A 3KKLA 3S2EA 3V5NA 1GRRA 3ZHQA 3NUGA 5KOIA 4O8ZA 2BHSA 4Q1VA 1H9CA 1KQOA 2ZROA 4TMZA 3L8HA 4XVUA 4U7DA 3FZYA 1F2TB 4GE0A 3QLTA 3VI3B 4KXMA 5A1TA 3O3MB 1NZDA 4CL0A 4D02A 3ZIAA 4DA7A 2H8KA 3UXEA 1KOJA 2I2BA 4OFXA 4IFIA 3Q1LA 1IXKA 2PGOA 1EX6A 4TQUS 3U7QB 3BUSA 2D1RA 3OEYA 5MN6A 4RA6A 5B2ZA 1N5MA 5A0VA 4YRKA 3RQSA 3NASA 3EIFA 2WF5A 2CXTA 3Q7RA 4YAGA 4LTNA 4O2BA 4U2EA 2FU5C 621PA 1XR3A 2QUBA 2WV7A 1KO4A 2XUZA 3FUWA 3MAJA 3SLKA 4BXOA 2VLIA 4F1WA 1R5NA 5H68A 3X2FA 1X9IA 4QM6A 1U8XX 1TM7E 2Q28A 1ZUNB 3EW9A 4CHGA 4YRNA 2GM4A 3MTBA 5JPIA 2D74A 3LY9A 3OJEA 1U3CA 5M3BA 4ZJZA 2QLLA 2PGJA 3BREA 1KAQA 1XRQA 1RNLA 2DM6A 3CWZA 4BNDB 2ZWOA 3O8OB 3AVOA 4L6AA 4O2AA 5LVAA 1UZMA 2J9XB 2IHVA 2ZE7A 5DCUA 3K92A 4C4TA 1T29A 5P8WA 1W1UA 2PZEA 3RU9A 5KVSA 1HQCA 1RPAA 3H2KA 4GZMA 4YRDA 2YJTD 4DLKA 4ETIA 5JH7B 2GF9A 3AR3A 5GWXA 1T2CA 3LRTA 4HNAA 2DKFA 3QEBZ 1Y3BE 3KYDB 2ICAA 1JQEA 1FFEA 1NJGA 4BVBA 4YT2A 5TPWB 4EHJA 1TZBA 5E0KB 4ASUD 1J0EA 3KOUA 3R3WA 1C5KA 2Z2ZA 3PBKA 4TXJA 4WK4B 3T3NA 1AS2A 3QPUA 3DPUA 4QGAA 3HJUA 5JRDS 4TM8A 3WL5A 3BH7A 5JDIA 2WM2A 4H15A 4A8HA 1C41A 2I7TA 1KJQA 1KVRA 2FN7A 3DR3A 3B13B 4LECA 3TRKA 1PK7A 4XX0A 3BMXA 5LDHA 3S1AA 1TPZA 1JG3A 2FFJA 3JQAB 3OH8A 3N9IA 3OOYA 4JEIA 3VU1A 4DR3B 2HYIC 1CR2A 2HT1A 3THXA 4MHOA 3D7MA 3TG2A 3SNHA 1VPDA 2OG2A 3HXOA 1IULA 4C2AA 3L4KA 3CVXA 3UT6A 1EFCA 1C9DB 1O2DA 1QHHA 3FIUA 3PHIA 3PNPA 4EYSA 4ZI7A 3NBMA 4OXKA 1QV9A 1JZTA 1JG6A 1NU6A 2Z8YM 4BKPA 3KQVA 1Q3KA 1TK9A 2FW7A 4J90A 1L8QA 4U2GA 3TF5A 1GPKA 3IO3A 1BW9A 3NATA 3I2KA 5TGTA 5ED0A 3SQLA 4DLXA 5HZMA 2PMBA 4BQSA 3Q5EA 4ZOAA 1QIDA 4FYKA 3T4EA 2JFZA 1KERA 2Z5VA 4BNZA 5F9FA 4U6SA 4ZYUA 2AMFA 4WGGA 4C3OB 5TGZA 2WDZA 3IKVA 3NEYA 3KSMA 2IDMA 3GLQA 4A0FA 1ZP6A 2JFPA 2B35A 1UWKA 3G5MA 1U2QA 2R6GA 2VHEA 1W5TA 3BKXA 3PTLA 4X90A 3ON5A 3SYKA 2GWHA 1WU7A 2OHIA 4Y18A 1W52X 1C0KA 1V39A 2IOHA 3Q41A 4EB6A 4Z0PA 2CD9A 4JKOA 4PINA 4QYTA 4ZEMA 3GDWA 4X6XA 4AKSA 4JI7B 1EA7A 1IUPA 1M8KA 1E2UA 3GIDA 4ND8B 1MDFA 4DDHA 3L1KA 2IRWA 4I5IA 3ZHTA 2EBHX 2HCTA 4IO1A 4PZPA 3W3ZB 3OQPA 4GLJA 1ZIXA 6CHYA 3UMMA 5K0CA 3W1WA 4P4NA 1FDUA 3MUFA 4YXWA 4BEJA 3GB9A 1G38A 4Z2YA 2PTGA 2B8NA 2PUBA 3B8HA 3CLKA 4KJXA 2Y0PA 4L74A 3SIPA 4AJLA 4C05A 2C96A 3SZGA 3T7AA 3FPLA 2O8EB 4IGFA 4P82A 1SUCA 3STTA 1ODSA 1UBLS 2C5EA 1AUVA 2EX4A 2ZBVA 3JQEA 4RHYA 2IJGX 2FG7C 3GGGA 5EIHA 1FPMA 2CCJA 3IXQA 5BORA 2HA3A 3KZXA 4BB6A 4BO9A 4P3NA 3FOEC 3GJ8A 4K6GA 1V1JA 2DPYA 2LCIA 4V0RA 1AKEA 3PC8C 2Z57A 3IR6A 4I3HA 2FPGA 2Q29A 2X41A 2YXPX 4IXMA 3TLJA 3ZQ6A 1O8BA 3BOSA 3I04A 1OH6A 2A9KA 4UNRA 1V8ZA 2DPXA 3KB6A 1U3FA 2H2DA 3B38A 4OY3A 2YWBA 1Q5PA 3I30X 4AY5A 4BFLA 3T5BA 1HNNA 3B9PA 4ZAZA 2FI1A 1U9JA 2VJMB 2PKEA 3IH5A 4L5BA 3WLJA 1NYQA 1OPRA 1UPCA 2DGDA 1NVDA 2R6JA 3EC1A 2BFWA 1L1QA 4OATA 4PC2A 4W7HA 4EJ6A 5FDFA 4E30A 5FH9A 4I1PA 5EOVA 3ZLTA 1A76A 1Z3IX 5G3ZA 3A1VA 4OXIA 1SVMA 1CJCA 3E8SA 1OFIA 2ZIXB 2ZTHA 3SVTA 3ZDFA 3EJ6A 5ARBA 3P5SA 2ABWA 1Q0RA 4XR9A 1I80A 2A1TS 3ANMA 2H07A 2QQ0A 5KOHB 1QYIA 5HS6A 5GJCA 1Y1SA 3NM5A 1DIBA 4KQHA 3RYHA 2YWXA 2OFWA 4WA8A 1D6JA 1M74A 1ZD2P 5DO9A 4GX1A 3F9RA 1RXVA 2F3UA 4IVPA 1VLMA 3W5JA 4BV3A 3U0BA 3C1UA 2ZTMA 2VHZA 1PT6A 5AKEA 4Z7NB 4TQ9A 3GFQA 2IF0A 1N2BA 4RSRA 5F3DA 2FB9A 1HWYA 3C6MA 3IQDB 2BFDB 3L4BA 1JFSA 3DTVD 3K9GA 4MROA 1A7KA 1JNYA 1Y80A 1G2OA 3QTTA 3UAZA 4MXDA 1WL8A 1EP1B 1YDFA 4XPZA 2B8EA 3DDOA 3WP1B 5KKAA 4LDAA 1F8FA 5T5QA 2UZ4A 4PG4A 1MHPA 1L4LA 2VXCA 1YBHA 2A6PA 2IZ6A 3KXKA 5ALGA 3HCAA 4QU8A 2LXNA 3FPGA 5NLLA 4RHFA 1SCJA 4IXWA 3ZY4A 3M9LA 4MS4B 1JEYB 3FWYA 1IONA 2UVDA 1GCGA 3QBTA 3KXDA 4HWTA 3TMKA 3OKAA 5HJ7A 4YQFA 2EBUA 4LIPD 2ODWA 3IMKA 5LMCA 1GPNA 1YK1A 1H6CA 1S6YA 3CPHA 3BGIA 4A8TA 4B79A 3C85A 3PQ8A 4F2PA 1H0KA 3RLFA 4JI1B 1JUDA 4QECA 3HYCA 2H1IA 3PFGA 3A9VA 3PFIA 3IQEA 1W36C 2FV8A 4FEGA 2OYRA 1T4BA 4LRXA 2ZOSA 3FGZA 5CX1B 3U3DA 1WE2A 1MU0A 3HLKA 3EOBI 2ERXA 4X3PA 3E81A 4RIIA 1V4NA 3WYAA 4GP7A 2Q2QA 2R47A 4FHCA 1B2LA 4QO7A 3G88A 2J87A 4BGEA 2OV6A 3PXXA 1ABBA 2HO4A 4LSMA 4AZ3B 4KVAA 3NJRA 4LC0A 4OFBA 3AU9A 5JCXA 2BGJA 1V3UA 4QAQA 1FIUA 2FEXA 5DTEA 5KINB 3G17A 1FS5A 3AEZA 2QVGA 3CG0A 3NIWA 3QENA 1P8JA 4U7FA 5H3HA 4CKWA 1W5FA 3PDCA 1E63A 4YJGA 2JIOA 4MW4A 2Y1WA 4EJSA 5B12A 2CNKA 5KMGA 3QI7A 3N2KB 3P9RA 5BWOA 3PC3A 3D1JA 5LP6F 2C92A 1WBDA 2CJWB 3FJOA 2DTXA 3AHHA 2IZ7A 3HJBA 3R7NA 1T4CA 5AK4A 2I71A 3HVRA 3D31A 3STHA 3ILYA 4R01A 1VC2A 3AFIA 1P7YA 4K8RB 4MYHA 4PTLA 1U7DA 3JZIA 4RDHA 4YRJA 1G5IA 2M6RA 3LJKA 5H9WA 4LFCB 1GIAA 4MUXA 2IODA 2Q5JA 3WQSB 3JZFA 3GNLA 4Q01A 1ADBA 3IPXA 5BV8A 4F6RB 4ARCA 3U39A 1T9CA 1P0MA 1G8FA 1ESZA 1TEHA 3F8TA 4JLUA 3AGQA 1KQFA 4B4WA 3TEJA 3TZEA 1FXSA 2XH8A 3MWGA 4PPGA 1HNZB 3AMVA 1G5HA 2F43B 3IAS1 3IMEA 3G9QA 5K0JA 3SDBA 4O33A 3L0BA 1G3IA 5L7WA 4RL6A 1UFOA 3R4VA 5ES3A 3O73A 1BXRA 1VMDA 4ARAA 4ZI3A 2IYSA 3M4NA 3D4BA 2HNKA 1GKUB 3JALA 4JL6A 4NH4A 4FWTA 1ZNQO 4TUYB 2QB5A 1LLFA