1V5WA

Crystal structure of the human dmc1 protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
239
Chain Sequence
PGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Meiotic recombination protein DMC1/LIM15 homolog
publication title Structural basis for octameric ring formation and DNA interaction of the human homologous-pairing protein dmc1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Recombination
total genus 57
structure length 239
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1v5wA00
3I4LA 3K70D 3CPEA 1NVVQ 1OYWA 2PT7A 3OHMA 5JJIA 2CCKA 3VNVA 3B1YA 1KI6A 3VTKA 3GEIA 1G21E 2QROA 2QP3A 2FSHA 3X1XA 1TL7C 3C5HA 5JLJA 1EFCA 1N6HA 1KI4A 1T0JB 2BBOA 2PBRA 3AGQA 4LUCA 1P72A 4Q03A 3BH7A 5FI1B 1L8QA 5C4GB 4I1SA 4XWAA 2DB3A 1J2JA 3G82C 1NIPA 1VHLA 1T5LA 1E9RA 4W5HA 3J81k 1NLZA 5EP2A 3SJAA 1LY1A 2IBMA 4R98A 4RD0A 4Q18A 1KSGA 1G64A 1IN8A 2LKCA 1GRRA 3I8XA 1YR6A 2PL3A 1GZSA 3PJRA 2DFLA 3BFKA 3TJZA 5KSOA 1PLLA 4OI2A 3TW4A 3CKLA 4TL7A 3TAHA 2P67A 2F3RA 4H1VA 1FFHA 4O0MA 1VYTA 4GZLA 1S9DA 4XOIA 3SR0A 5DI9A 5DHFA 4EFLA 2GBLA 5F2EA 4ZDIA 4LX0A 4URZR 2VHUA 3QOFA 4MRRA 5ANRB 3LBHA 4C0SA 3MSXA 3BOSA 4W7SA 4LJYA 4LJ6A 2F9LA 5G3YA 4DSOA 4DDUA 4PC2A 4R7ZA 3JVVA 4BQSA 2C78A 4BEJA 4XWKA 1VYVA 3L0SA 2JJ1A 1C4OA 5KYKA 3H1TA 5F98A 4A36A 1DARA 3A1VA 3SC3A 4QHTA 1XMJA 4YMWA 3I61A 4S2EA 2YWHA 1SHZA 1Z0KA 1QG2A 4BE7B 1HE8B 3UG7A 1VPLA 1IJEA 2I1QA 4R9UC 1N5IA 3AGPA 3AF3A 3KKMA 3RRYA 4Q9IA 3EZ9A 2CHGA 2CXXA 2VL7A 4D0GA 1NIJA 1R0ZA 1Z08A 5TXGA 4GT1A 4C7OB 2GA8A 1RW4A 4BFYA 1M34E 2Y8EA 4NMMA 4A9AA 1ZNWA 1OH6A 5JCZA 2QQ0A 1P2VA 1LF0A 2F9MA 2PX0A 2GF9A 3ZS8A 4KXFB 2DYKA 3IHLA 4V0KA 3M4YA 3MWJA 3VR4A 3TSZA 1ZINA 4IRUB 1IN6A 2QA5A 1RIFA 4D0LB 1DAGA 1XF9A 1Z2AA 3KXLA 3V4FA 4DB2A 1NKSA 5D3QA 2PMDA 1ZNZA 4B74A 1Z22A 2BCJQ 2OFWA 2V54A 2XTNA 5HTKA 1GRQA 1SULA 5B57C 5HZKA 1XXHB 1S2MA 5LD2B 3DEFA 3MJHA 3RWMB 4OQLA 3NTUA 4JVMA 1VHTA 1HV8A 4A0HA 2VHTA 5TARA 3PQCA 5LD2C 2J5XA 1R0YA 2ATVA 2R44A 2F7SA 1COWA 2XXAB 4BLRA 4E22A 3K0AB 2OBNA 1ZP6A 2AXNA 2YNMA 2YYZA 1QHGA 1P2TA 2AXPA 1FUKA 2Q3MA 3TMKA 1UBEA 2PLFA 3VR3A 3M6AA 4HLUA 1DO0A 1OIXA 3FWYA 3RSLA 1Z6GA 4LBYA 1ANKA 1SVSA 4ACBA 4TYQA 1Q44A 5DH9A 2V7QD 3B1VA 3EIEA 3RC3A 4BFTA 3IDQA 3NEJA 4ZDWA 3GLIA 1LS6A 2H1LA 2GJAA 2CVFA 4ZI3A 2RHDA 3QPWA 1NJGA 3C41J 5KSPA 3P4YA 2QSYA 4YXWD 3AVOA 3HR7A 3PR1A 2R6DA 3V4RA 3ZDQA 3Q5EA 4C7OA 2BVNA 4PPQA 3I73A 1W5TA 4Q02A 2DR3A 1HUQA 4PAOA 3I62A 4NYMR 1WDTA 3K70B 4RD2A 1MRSA 4R2HA 1XEWY 1X1RA 2RGBA 3TUIC 1WQ1R 2JDID 3X2SA 4O3MA 4WVFA 4Q21A 3K70C 2IYWA 5B58C 2A7QA 2OESA 3CW2A 3B6EA 2W2XA 3UMFA 2FU5C 4A6XA 1XXHA 2ZQ5A 4B71A 2D4HA 3FKQA 1XTQA 2GHIA 2X19A 5DGXA 2H18A 5HCIA 1XPOA 3ECCA 3EPHA 2JLYA 1KI8A 2V4ZA 1K6MA 3FHOA 1X8KA 3IKJA 3HR8A 1CJTC 4DC9A 2XXAA 4PX9A 3WRXC 3TSOA 4MRPA 4V0NA 3K0AA 4LDJA 3K09C 4Q4HA 3TQFA 1ZUHA 2OSBA 4OYHA 4OHZA 4ZKEA 1EXMA 1LV7A 2QPTA 3CF6R 4GZMA 4AKEA 3T1OA 1CU1A 3K0SA 2QPOA 3U44B 4DSNA 4O2RA 4UJ5A 3AUYA 3LVRE 1NF3A 3AEZA 1CR0A 1NRJB 1JJVA 2KBFA 1Z0JA 5C4MA 3QBTA 4B2PA 1JJ7A 4LYFA 4A1FA 4AG5A 1P73A 1G19A 2O8DB 1E9BA 1TX4B 1O87A 2HLDD 3FE2A 2PZFA 5H70A 1VG9B 2Z4SA 1ZAKA 1GDDA 3PFIA 2R6CA 3LAWA 3RC8A 4YONB 5IDVA 1NG1A 1GNPA 1OXXK 1JQLB 3N2IA 4OHXA 1E9DA 4W9MC 2GZDA 4BRUA 4Q7MB 1NVXQ 3MGCA 1D2EA 1WF3A 3LFUA 5H1YA 2J0UB 3ADDA 3TKLA 3Q8XB 2HXSA 1Z47A 1GOTA 4IXMA 3IGFA 1H65A 1E2LA 4GP6A 5EUMA 4PPNA 2NQ2C 5UKDA 4B33A 4GOJA 3FMIA 2F3TA 3LX5A 4GP7A 4RZ2A 3ZS9A 3X1ZA 1PVOA 1G8PA 3ONWA 1ZMXA 3AF2A 3HYTA 3WNBA 3K09A 3A37A 4EJSB 5GJVC 1IY0A 3P20A 4P33A 5DHAA 3QEJA 2ZXUA 5FL7A 1YQTA 3NG1A 4BLQA 2VP5A 3OEED 1E2EA 5HR5A 2WVJA 4WZBE 4EJSC 1UAAA 4MGZR 2IC5A 4OJKA 3BB3A 2V1XA 2ZI7A 1GRNA 4NKRA 4IVQA 2YV5A 3CZPA 3U44A 2D2FA 1E9CA 3TSWA 2CL0X 4MYUA 1PV4A 1UEIA 4DSTA 3AVQA 4PC1A 1YRBA 3NIBA 2O8DA 1BH2A 5E7IA 4M1WA 2KI5A 1ZNXA 3CR8A 1CKEA 5A0FA 4MKGA 5E3HA 4JVLA 4TTPA 4LHZA 5JI2E 4M1SA 4OQXA 1W46A 721PA 4OI0A 4NYIQ 4EKDA 4KO8A 2EU8A 1KOFA 5CIQA 1H8ED 2DPXA 2XZPA 4QM7A 4JLVA 3CWQA 3KXIA 1NVVR 2J0UA 1YZQA 2XNDD 2ZJZA 4TZ0A 3H86A 1GP2A 4LV8B 4PO9A 2J0QA 4NH0A 1UKEA 2P2LA 3NXSA 4FMDB 3L43A 3OEHD 1R4AA 3I1FA 4IDNA 5DE3A 2PMKA 3UWOA 1K5GA 1Z29A 2C9CA 3BJIC 3EC2A 4JMPA 4EFMA 3KJGA 3AVTA 2OAP1 4KFSA 1KMHA 2QMEA 1AJEA 4WW0A 2ZSDA 4EJSA 1Z0AA 2OM2A 4US0R 3RANA 4RJLA 2F1JA 2PEZA 3VHLB 1ZW6A 1YZNA 3RABA 3VX3A 1IJFA 3UANA 2WKPA 3CONA 1F2UB 1Q1ZA 4Q4AB 3S1AB 4F38A 1BO6A 1SXJE 3DM9B 1U90A 3EASA 1XTJA 2OZEA 1Q0UA 1GUAA 3SJCA 3O8RA 2QZ4A 5FR2A 1ZJ6A 4Q9LA 5DN6D 3CX6A 4TMTA 3PEUA 3AF1A 1Z2CA 1G8YA 3M0EA 4HLDA 4C0KA 1AM4D 3ZQ6A 1G8GA 4WOPA 1TU3A 3BERA 3VX4A 4GI7A 3DM5A 2IXGA 1PZNA 4OJQA 5EE1A 2LCFA 2IUSA 3REGA 1YR8A 3WNDA 1VG0B 4PZLA 4BPBA 5EXSA 2QY9A 1GKYA 4DJTA 1AZTA 4Q00A 4G5QA 3T06B 3OIWA 2LWIA 2VP2A 4BZPA 3WMEA 4G1UC 4TSFD 1OIWA 4OI4A 1FTNA 4KJZA 3EG5A 4FCWA 2V7QA 3FMPB 4IOLA 5GVRA 2D62A 3FGNA 2BMJA 2KB0A 1DBSA 4LOAA 3SN6A 2ANCA 3Q72A 2ZE8A 1W2HA 4QHYA 2P5TB 5EP4A 3I72A 3PITA 4PC3A 1GL6A 1CLUA 2EFEB 1X8JA 3ND8A 4R2IA 2QM8A 1VIYA 521PA 1VKJA 4C0JA 4K46A 2VO1A 5CM8B 5KSZA 2GXAA 3KJHA 4TLEA 4IOMA 2WZQA 4M9SA 1AKYA 1E9SA 3B9QA 5EE5B 3FDIA 2JDIA 1BYIA 1E9FA 4JKYA 1Z6TA 2OFOA 3PVSA 2D7CA 1E96A 4JZKA 1F2UA 1J90A 4JLBA 4Q4AA 3S1AA 3ASYA 1RC8A 2ZU6A 2NG1A 5EZ6B 5J4LA 4UNNA 5AUPB 4DIEA 3KKQA 4M4SA 2WV9A 1OE0A 1UFQA 5FR1A 4URWR 2HF8A 2XZLA 3D3QA 1E79D 3R9XA 2AKYA 2FE4A 5TVKA 3Q85A 2O0HA 1RJ9B 3KFVA 3LD9A 2B8WA 2HV8A 1VCNA 4DCVA 2P3SA 1G16A 5JMTA 5KNDA 4Z8XA 5DO9A 1NJFA 5HKKD 1ZVQA 5IK2D 3NHBA 1E98A 2JJ1D 3GJ6A 1NY6A 3KUCA 5F9HA 1JBKA 1A2KC 2CMKA 1MRNA 3I32A 3ZH9B 3VKHA 2ZAMA 3IBGA 1X86B 1YJ5A 2V8OA 4PSKA 1DOAA 1EG7A 2W2TA 1S8FA 1E0JA 2W6JA 4TYPA 2JLZA 1KJYA 1KO1A 3T1QA 1KK3A 2AN9A 2YKGA 4WXRA 2GXQA 2O0KA 1SKQA 5AJZA 5BW8A 3NH6A 4FWTA 4JLKA 4KODA 3PG5A 4QNMA 1CJUC 2HLDA 4QM6A 1KI7A 4XD7D 3TVDA 3AQ4A 2H16A 4AURA 4CZ2A 2QNRA 5L3QB 4N1AA 2DWOA 4I99A 2V9PA 4XIGS 4NYMQ 3U3JA 1SVLA 3BIFA 1LF5A 2ZI5A 3B2EA 1SKYB 1Q20A 1XEXB 3CNOA 2UKDA 1GNQA 3ZVMA 2Q0HA 1W4RA 4S35A 5JSZB 2CL6X 2BHRA 4BFXA 221PA 4LBVA 1W1WA 2O8CB 5BN5A 5LPNA 3TUZC 1JQJC 1RRPA 3U6BA 1P2SA 3UATA 1KO7A 1LVGA 3LRPA 3RS7A 1S1CA 4XVRA 1IHUA 3RWOA 2P6RA 2PZEA 2JLRA 2ZR7A 1XZQA 2ORWA 1P9RA 2XB2A 1Q1QA 4D2IA 4URVR 1L4UA 5J4HA 2MMGA 4A82A 1RJ9A 1KZGB 3ZVRA 2C9OA 2RGAA 4POAA 4JL6A 2WJVA 3OEEA 2GAAA 4JJKA 4M8NE 4IJMA 2BC9A 4BFVA 1W4BA 1GSIA 3KKPA 1I4DD 2GK6A 3W9YA 2QGNA 1N6KA 4KFUA 3VR6A 1R5NA 4X8MA 1N0VC 1PUJA 2ZRMA 4TYWA 2ZRPA 4DLTA 3KKOA 3PUWA 2UZ3A 4TQ9A 5FPSA 1OXTA 4XTRA 1JEDA 4L4UA 2VYFA 1QHIA 3MRSA 4Q1CA 1RVDA 1DAMA 4PAMA 4ZIRB 2GEVA 4RD6A 4AC9A 3KXKA 1ZBDA 2NOAA 5TB5A 2GCNA 5KSYA 3U7EB 1Z83A 1KDTA 5EE0A 1GVNB 4QGFA 3W6NA 1GM5A 1US8B 4DIDA 3CF0A 4KLZA 3R7WB 1ZM9A 3ZIAA 1XMIA 4KYUA 4FCTA 1NN3A 1UM8A 1P2UA 5DI3B 4FWIB 1XPUA 2JA1A 5JECA 3JZAA 1FX0B 4IVPA 4X8HA 3UXMA 3W5IA 5KNBA 4AKIA 2QRZA 2XNDA 4EAQA 1EESA 2VRWA 3PUZA 1CIPA 4AWXA 4TWZA 5JSZA 4JLDA 4MYCA 1HT2E 5E7MA 3SEAA 4NPHA 4FD2A 1T8UA 2ZE7A 2ZVQX 4M9XA 2O8EA 3K0CC 2O8CA 3E2IA 1TF2A 1TQ4A 3CBQA 3EIQA 4Q9HA 4WZAE 4CIDA 4CEJA 2QPAA 4Q1DA 1CS4C 1SVKA 3OEHA 1HH4A 4ESVA 1ZIOA 1TAGA 3P4XA 3THXB 5JZVA 2Q3FA 3AH8A 2ZI4A 5KPDA 2Q21A 3IPXA 4ITRC 1KK0A 4NZYA 3DZ8A 4UQOA 4TYNA 2G83A 3B82A 3FMOB 1B0UA 5LB2A 2Z0MA 4ON9A 4V0ME 4A8JC 2ZUBA 2NMVA 3DMNA 3P26A 4HZUB 4MRNA 4NE2A 4KFTA 3FYHA 4Q66C 1SQ5A 1SXJD 4JIMA 4MYHA 2VP6A 4DB4A 3QKTA 1U8ZA 4IEEA 2MMCA 4UNPA 2VHCA 3H2YA 3IUYA 1P75A 2QORA 2BMDA 1UDWA 2A5GA 2GWHA 5DN6A 1ZC4A 2HJGA 4LY6A 3KFXA 1E4YA 3SYLA 1DO2A 2ZS8A 3LNCA 4RZ3A 1C1YA 3F8TA 4EFNA 4TLAA 1XTSA 4ZIRA 2OUKA 3GLGB 4RKFA 4DLRA 4LJ9A 3CM0A 1RYFA 3KQKA 1P61B 1US8A 2GCOB 4NCJA 4M1OA 1NMYA 3ADKA 4KHZA 4DCNA 2CE7A 3QVVA 3AVUA 2O52A 2ZPTX 1T3LA 3R7WA 2J9RA 3KUDA 4NYIR 1N3BA 4EQ6B 4TSFA 3RS5A 4CW7A 1W48A 4LHXA 5DI3A 4LHWA 2DFTA 1EK0A 2QUZA 3BBPA 3TK1A 1FX0A 2R2AA 3RDPA 1E1RA 3K0CA 5DYGA 4TYYA 3MAAC 4HB3A 4CRWB 2QAGB 2GAOA 3VR1A 3WMFA 2R62A 2NTYC 5H68A 1NP6A 4DHEA 4IVRA 1G3QA 2QAGC 1BYUA 2WOOA 3QXXA 3KQNA 1A82A 1D5CA 3THXA 2VIIA 1FP7A 4QOSA 2ZR0A 2ZITA 4A8JA 1U8YA 5FL7D 5HE9A 1YR7A 3T5GA 4QBIA 3U60B 1R5BA 5K8LA 4RCZA 5IRCD 4QHSA 3CH5A 1E32A 3CRMA 1M7HA 4QJ5A 2FDCA 4US2R 2BMFA 2XJ9A 3EA0A 1ZUIA 4HZUA 1J99A 4HUQB 1TMKA 3KTAB 3O8BA 1L7VC 2IHBA 3DL0A 1MT0A 5LBIA 4A4DA 2Q3HA 2QE7A 1ELOA 3CNLA 3FMFA 1SVOA 3B8HA 4RY2A 5FI0B 1OB2A 1E79A 4Q9JA 2NPFA 3GP8A 4PQFA 4X8LA 4GL2A 4MGYR 3C16C 3QXHA 2WAYA 3SYKA 2AL7A 3A4MA 3EWAA 2DHRA 5HKKA 2BJWA 2PLRA 5IK2A 4LRWA 2ERYA 3JZMA 4YC7A 2GCOA 2ZI3A 4KBGA 2IK8A 3THWB 3RS4A 5HE8A 1I4TD 4AG6A 3VKGA 1T4GA 3LLUA 3CX7A 4EQ6A 3NWJA 4JSTA 1SKYE 1KK2A 2IEZA 1KO4A 2ZRDA 4HLUC 3W6OA 2JATA 4GMXA 3OF5A 3LW8A 2VH5R 4KSBA 1E2QA 1OFUX 4UNRA 1P4SA 4K8OA 2JLUA 2XTZA 1KSFX 1WBBA 2QAGA 3P1JA 4XD7A 3IILA 4P32A 2RKOA 1K5DA 1PLKA 1W49A 2PEYA 2MSDB 3CR7A 4AYTA 5E95A 4WAUA 3QPUA 5JWRA 1OSNA 1JALA 4BLSA 3AB3A 2ANBA 4TMKA 4L9SA 2NIPA 4Q5IA 4DLZA 2DWPA 3CO5A 3U7GA 4Q48A 3CIOA 1XNJA 4KVAA 4DEXA 4DSUA 5AUOB 2YOFA 5KDDA 4FMCB 2DY1A 2J3EA 1CXZA 2J41A 1F60A 3VU9B 2JJ2D 4M1KA 1X1SA 2BDTA 2FZLA 2A5YB 4TMVA 3N70A 1G41A 4HUQA 1G5RA 3DDCA 1MO3A 4B3CA 2FFBA 2FEOA 1Y3AA 2R65A 1N6RA 2XNSA 1Y63A 1OHHD 1KDPA 5J4VA 4PFSA 2YWGA 4B3XA 1OW3B 2C8VA 3W34A 2CHQA 2A3RA 1NY5A 3A6PC 2FMXA 2WWXA 1J70A 2WPDD 2ZS7A 1ZYUA 2EW1A 2XAUA 3LLMA 3Q7PA 4DKXA 3AF0A 2IYXA 5CJ2A 1NBME 1SXJB 3THWA 4L5BA 3A58B 3EZ2A 3GFOA 3GJ0A 4JBWA 1Z8FA 3B13B 4MKFA 2QTHA 3QXSA 3A4NA 1N6NA 5K8TA 4F91B 2YHSA 5FTNA 2WSSD 1SXJC 1TTTA 3C5CA 4NCHA 4GBMA 2REOA 4PZYA 4M53A 1KO8A 1FQKA 3SZRA 5FH9A 4HAXA 5G40A 2UZIR 4HEJA 4NU0A 4NTZA 3RRNA 4LHYA 1OXUA 1W0JD 2GILA 1R2QA 1TEVA 3EPKA 4A92A 3GMTA 4FMCF 1J8MF 3AKEA 1Q1BA 5AJVB 2IYVA 1SVMA 3SYNA 2ZROA 3U3RA 2D2EA 4F4IA 2XB4A 3VQTA 4JLNA 1AKEA 2IYUA 2BKEA 1HA3A 2GJ8A 1QRAA 1G20E 3NC0C 4B73A 4CEIB 1DAIA 1A4RA 1G4AE 3KX2A 3VU9A 1XCPA 4UNQA 3PUYA 1RYHA 1ESNA 2PX3A 4IDOA 3KL4A 1DTSA 3LDAA 5FUVA 5JWOA 4DZZA 1NSFA 2JLSA 4RD3A 4C0AC 2RGXA 3L0OA 1E3MA 2FFHA 3QKRB 4OK3A 3GLGE 1TQ2A 2ZJ2A 3TH5A 3C7KA 1RKBA 4PQYA 2P6UA 1P9NA 1OKKD 2ZYWX 2QRNA 4HAYA 1BMFD 1KY2A 3IBYA 4XVQA 1P62B 1F6BA 1SXJA 1TF7A 1NLFA 1Z5ZA 1ODFA 4GNKA 2XTMA 4DBLC 1D2NA 1XFAA 2GK7A 2FFAA 3CWZA 4TLCA 5GJBA 1OFHA 3IIKA 2W6JD 3QXJA 1D9XA 1E4VA 1QVRA 2I1VB 4LBWA 4PXAA 4M9QA 3HPQA 2F43B 1KO5A 3CZQA 4HAWA 1YR9A 2OLJA 4JJZA 3SU8A 3T61A 3UIEA 3EPJA 1HTWA 1G6OA 3MWLA 4M2LA 3BD9A 2HYIC 3LX8A 4MGKR 3RAPR 4ZO4A 4ZV4A 3SQXA 1XD2B 4MDEA 3MUFA 2AK2A 1ZD1A 421PA 1N6OA 2FSFA 2YOHA 4IOKA 4KVGA 4E5UA 4P4TA 1LTQA 3VKWA 2FNAA 1NN0A 3DKVA 3ASZA 5AJYA 3T34A 5GVSA 1NKTA 1OFTA 5FPTA 1QHXA 2ZIAA 5CITA 4N0DA 4G0NA 3BB1A 4RFVA 2W0MA 1N5KA 3BH6A 1FNMA 3UPUA 3OZXA 2XZOA 1Q12A 2YWFA 3K8YA 1VCOA 4IHQA 3GD7A 1IXSB 4BFUA 4Z54A 2B92A 2FOLA 2L0XA 4NCKA 5FFMA 4JBYA 3AKYA 1FW6A 1Q3TA 3KZ1E 3ZYCA 2DBYA 2KWIA 1E2NA 2QT0A 1XMVA 1Z0FA 1AZSC 1IBRA 1ZM4A 2FN4A 1QVAA 5G41A 3QKRA 1H8HD 2WWFA 2GJ9A 2ZRGA 5TV2A 4OI1A 4C4PA 4LSGA 5JWHA 2IYLD 3A1UA 2YC4C 1R6BX 1JXMA 4GPTA 2AKAB 4MH0R 5JI3E 1OB5A 1I2MA 3U2QA 2PH1A 3SOPA 3K0FB 2F6RA 3E70C 4WA7A 2VLIA 4NYJQ 3A8TA 4M1YA 2F55A 4XSHA 1W36D 3LA6A 1XU4A 2F43A 4M1TA 3GJ7A 2BBSA 4CDGA 2C95A 1G3UA 2R6GA 4NCNA 1KSJA 4JLPA 4UJ3A 1SZPA 1N6LA 4TT3D 2CNWD 1KKMA 3AP1A 3X1DA 1CF4A 3U6KA 4OHYA 2JIZD 1L2TA 1XD2A 1DAEA 2CLSA 2QTFA 4DCSA 4MGIR 3ZIAD 5AR1A 1XPRA 3EIHA 4BFSA 3DVLA 3BH0A 1NVUQ 2G1KA 1AQYA 3PIRA 1A7JA 4Q4LA 5B30A 3SQWA 3BC1A 3X1WA 1XJ0A 3CB4A 3MMPA 2FH5B 2GCPA 4MQBA 4L16A 4OQMA 4HSEA 4ZCIA 1XP8A 1E69A 3G0HA 3SFVA 5B64A 3EPLA 2ZYTX 4TN1A 3ZQJA 3R9WA 4EPXA 4LWZA 4BWYA 3RVBA 2RGGA 2IYTA 2WSMA 3CRRA 3T12A 2DFNA 2C77A 2B7BA 3OIUA 4UKDA 1RFLA 1TF5A 2GNOA 1E2KA 4A2WA 2QP9X 2CLDX 3AF4A 3TW8B 1ZCAA 1Q1EA 2FV8A 1WP9A 4G5OA 4IDPA 5DYIA 2IS2A 2QTVB 2QG6A 1RRCA 1TADA 3BB4A 5GADl 4P3YA 1YVDA 2W2VA 4DLVA 3I8SA 3AM1A 2Q6TA 2JJ2A 3QPVA 2FJUA 1VCMA 1KTVA 2G9NA 4HDCA 5DSZA 4JLMA 3RNLA 1JAIA 3THYB 3A36A 4ESHA 5CB8A 3QUSA 2OLKA 4D4JA 2KJQA 3E5HA 4JLAA 4PTLA 2J87A 1Z0IA 2OT3B 3WYAA 1OHHA 1P9WA 3R8FA 4V02A 2OXCA 1D9ZA 4MKIA 2IWRA 4PANA 2KE5A 2ONKA 1S3GA 4LCBA 3PEWA 1SVIA 4HATA 5KDOA 2WPDA 2X2FA 4B44A 3WHKA 3O8DA 4MKHA 1NBMD 2OV2A 3W3AA 3LQQA 3QI2A 3MWKA 4HLQB 2WM9B 1E9EA 4KITB 1PJRA 3P32A 4BFZA 3PEVA 1OXVA 4FMDF 2YOGA 4P0TA 2EFCB 5L8VA 2EFHB 1OXSC 2WSSA 4DEYA 1E1RD 1MV5A 3BWDD 3GLFE 3H0KA 4RD4A 4D6PA 1ZM3A 4FW9A 4KLNA 4XH9B 1FP6A 4AK9A 4JL5A 4DVGA 1U9IC 1P6XA 1XTKA 2J0VA 3QG1A 4CYMA 1W0JA 2ZRCA 4LI0A 5HZHA 2V55B 2IYRA 4YLGA 3SI7A 3VNUA 3WYFA 3H4MA 4FMBB 4R71A 3TGPA 4RZXA 4Q47A 1Z6AA 2VP9A 5JJLA 1W7AA 2JASA 1N6PA 3E1SA 4BUJA 3GJ8A 1ZU5A 4V0OA 1Z6YA 2XGJA 1GL9B 2IT1A 3B78A 3WNCA 3OIVA 2ZANA 4G01B 4KI0A 4IXNA 3WHLA 2ODNA 2ZU0C 2XX3A 2HCJB 4Q7LA 5JRJA 2ZUCA 2GF0A 1TQDA 3L8ZA 4ACAA 3TNFA 4AY2A 2QE7D 5CLLA 1II9A 3RRZA 2P6NA 3KB2A 2QEQA 4F7WA 2Z4RA 2QMOA 2ZVPX 4OBEA 4PSVA 2MSEB 3AP3A 2DCUA 2R6FA 1KDOA 1U0LA 5FOUA 3CPJB 5FTJA 4I1OA 5JHGB 3FOZA 5F9FA 4JLJA 4U00A 4F4JA 4V0MA 1E0KA 1G7TA 1MR3F 2W00A 3K9NA 1OKKA 2GDJA 4Z8YA 5KUTA 5AK0A 1BMFA 1FMJA 2ODBA 2J1LA 2WWIA 1GKIA 2GXUA 4PC6A 4A2QA 5ELXA 4PQRA 4URXR 3VHXA 5P21A 1W36B 1IONA 4MDFA 1S9HA 1U9IA 2W6IA 4QXAA 2GRJA 5KU1A 2IX3A 5J47A 5BN4A 4RSGA 1II0A 2EWWA 2VHJA 3Q3JB 2VEDA 5BQ5A 2FX3A 1DE0A 1W36C 2HT1A 5C46F 2A9KA 1QHHB 1VYUA 3BFXA 3CRW1 1KY3A 2IS4A 4MA4A 2IF2A 3ZZ0A 5KDLA 4G3XA 5FOSA 1S96A 4HDQB 1EX7A 4B47A 1T91A 1T8TA 2ZRHA 3ADCA 2WICA 3ZD6A 1XEWX 5JEDA 3CX8A 1BIFA 2JGNA 2ZE5A 4BECA 3KQUA 4TMXA 1E94E 3L82B 1QG4A 4YMSA 1ZUNB 3CLVA 4CVNA 5FBQB 5KTYA 1N6IA 3V00A 1UJ2A 2FFQA 2NO9A 1HY3A 2EVWX 2X2EA 2ZSBA 3B9PA 4W5JA 5FUWA 1FMLA 2CCGA 4PSAA 5JCPA 3A1WA 4HB4A 4IOJA 4FIDA 4KV9A 3DMDA 1UBGA 1OF1A 1VG1A 1MKYA 2G77B 1M8PA 1AS3A 3PXGA 1H8HA 1YRAA 4HAZA 3THOA 1E2GA 4OKSA 3W8RA 1IM2A 5FUYA 1JECA 3PV0A 5A5GA 4F4CA 2PCJA 4CT5A 4LBZA 4JVNA 4CEHB 3ND9A 3TAUA 1M7GA 1XB2A 1NN5A 4ZCMA 5C2JB 4KFRA 1EX6A 4TLBA 3IQXA 3KJIA 2IUTA 1LS1A 5JS7A 4FI3C 4LJAA 4YDSA 2F1RA 1II8B 2GEDA 4GFDA 2I3BA 2O8FB 1FPMA 1CJVC 1VIAA 1YZUA 2PCLA 3A1TA 1NG9A 3R8CA 3B1XA 4Z51A 2FEMA 4TT3A 4MITA 5L3QA 1F5NA 2CNWA 2H92A 3MWYW 4DCUA 5HPYB 2C9YA 1F2TB 4AKGA 3OESA 2OCYC 1QHHA 1WE2A 3QQ5A 2JIZA 3LQRA 3MJRA 4Q1EA 1R8QA 5CB6A 1UF9A 1SHKA 3KQHA 3T15A 2ODEA 3WBKA 3ICQB 1T0HB 2EYUA 4GRAA 5FBRB 4MUBA 4TL9A 1G1MA 3NBFA 3K1JA 2ZJBA 1K8RA 4C30A 1G4UR 1XEXA 1GWNA 2VP0A 2C5LA 2WMOB 4PZZA 1DELA 2FZ4A 1OLOA 4Z1MD 3EX7C 1N0UA 4IDQA 1ZU4A 4HUTA 5KO2A 1G3MA 4IFBA 1U81A 3LO5A 1OT3A 4BZQA 3NBXX 3F3YA 3BK7A 3QG5A 4I4LA 4P4SB 3GLHE 4B35A 2JAQA 2ZSEA 1JEEA 4M21A 4TL6A 1UEJA 4Q1FA 1VCIA 2A78A 4HAUA 3VMFA 4ZKDA 4LJ5A 3T1TA 5E4FA 5J4YA 2OEPA 4FCVA 2Z43A 2B21A 3IIMA 3H84A 4BLPA 5IF9A 3GQBA 1GFIA 3SNHA 1JR3E 1YZTA 2QT1A 821PA 1YHNA 1CBUA 1VDZA 1GIAA 4JBXA 4DLSA 4CEHA 2BOVA 1O3YA 1UPTA 4UNSA 3TR0A 1XJCA 3JVUA 5J40A 5SZIA 3NH9A 5SZKB 2C04A 5JHHB 3AVVA 2MSCB 2IHYA 3DOEA 5B2ZA 4A2PA 2ZI6A 3VR2A 4NYJR 4GOKA 3QF7A 1MOZA 2QI9C 5G3ZA 3WMGA 2AD1A 5BYJA 5FPKA 2VSXA 1D8TA 2WKRA 1NSTA 2H8KA 2W0SA 4Q9KA 4C0QC 1IAQA 2O8FA 4LPKA 4QNRA 4YMVA 3IQWA 2J59A 2WHXA 4GOXA 4II7A 5CK4A 5FUXA 1XX6A 2AHOA 2O0JA 2ERXA 1TU4A 1F2TA 2ZRKA 1A2BA 2FPLA 1NBMA 3PUVA 1B23P 1U8AA 4EPTA 1GKUB 1ZRHA 3ZLJA 1JR6A 1ZC3A 2PJRA 5EE3A 2CBZA 2CJWB 1KI1A 3LBNA 2XEXA 1EWRA 4BEBA 4ILEA 4TMWA 2CVHA 1EFHA 2ZSFA 4C3ZA 3BFVA 4Q7JB 1CEEA 1D2MA 1YE8A 1JB1A 1DAKA 1IXZA 2X1VA 4LJ7A 3CF2A 1R10A 4AYWA 2RB4A 1S0UA 5E7JA 5K8IA 4P4SA 3LV8A 4QRHA 4RZUA 3R9IA 4IFEA 4FN5A 1NVWQ 3EWSA 1R0XA 2ZEJA 4PHGA 1XDBA 1E9AA 2RGNA 1BKDR 2CEAA 2RHMA 4TQUS 1UBFA 3EZ7A 4I81A 5CDFE 1CR4A 1OH7A 1OH5A 1QDEA 2D06A 4DT1B 3NVAA 4NONA 5AUNB 4D82A 2JLXA 1TUEA 1IN7A 3D31A 3ZZTA 1BOFA 2EQBA 3HU3A 3KQLA 4JS0A 2VSOA 2HF9A 3DKPA 3B7GA 2Q9CA 3IO3A 3K9HA 4XSGA 5FPHA 3U3OA 2ORIA 4D25A 2BBWA 2TMKA 3OE7A 2H17A 4J0QA 3U61B 2ZTSA 2VF7A 2NO0A 4V03A 4N3NA 2WIAA 3QSYA 4L15A 4O25A 4XWOA 3GLGA 1UKYA 2D7DA 2YJTD 2ZJ8A 2HEIA 2IF0A 5DIFA 2FWRA 2XJ4A 1PLJA 4UXJA 5AUQA 4WZ6A 4CF7A 1XRJA 2JLQA 2DFKB 1EGAA 1AGRA 2B8TA 3PUXA 3IIJA 2VF8A 2BM1A 2CHVA 1E2JA 1AS0A 1E2IA 1UBCA 3GPLA 1DVRA 2CJWA 2GESA 4C2UA 2GJSA 4JYCA 1UADA 2WWGA 3BAFA 4PHTA 3UMRA 2QBYB 2P0EA 2GVZC 2HCBA 3CNNA 2BKUA 1TEXA 3WXMA 3ZVLA 4XVUA 2J7KA 1R7RA 4B6FA 1U2RA 2V1UA 2VPPA 3HWSA 4B3BA 1AIPA 2O8BB 4JT2A 3DO6A 3EW9A 3O8CA 2EYQA 3QXCA 2ZRFA 4B48A 4QFMA 3QVUA 4URUR 3SS8A 4H9GA 2NGRA 1CRQA 4E09A 2QP4A 2GZHA 5FTMA 2AR7A 2N42A 3RLFA 3GLIB 4L9WA 4IW3B 3SHWA 5A4JA 3K53A 1CP2A 5EJEA 4TMZA 4DXAA 1ZM2A 3WP1B 4DT1A 1HT1E 5JJKA 2ZI9A 4KU4A 3WYGA 3HJNA 4MYTA 2IA5A 2BEKA 1EFRD 2O5VA 3KTAA 4M1MA 2AFIE 1BS1A 3FB4A 3AVXA 3F5FA 2OCAA 4EDHA 4OHWA 1U0HC 2W58A 3BE4A 121PA 3C4JA 4QJ3A 5EUQB 1VTKA 2YWEA 1MO6A 2BM0A 1M6NA 3A4LA 1T3HA 4O2LA 5D3MB 8OHMA 1E0SA 5GJWC 1YU9A 3MLEA 4PHFA 2IS6A 2V3CC 2ZETA 2VP4A 4U7DA 3AVWA 1W4CA 4BLOA 1DG3A 1N0WA 4DUGD 2D74A 3I5XA 1JXOA 3RRMA 1QF9A 1FL9A 3FHTA 2QAJA 4G5SA 4HB2A 3W90A 2AWOA 3NC1C 4G5RA 1G17A 1Z3IX 4A0GA 1U98A 4QL3A 2GETA 4Q4HB 1DEKA 2QBYA 3NEYA 2VQSA 3I3SR 4AYXA 1TNDA 3ZJYA 1VG8A 5KNCA 4K81B 1CJKC 4ZPXA 2NO7A 2X8AA 3EXAA 5J5CA 2CK3D 2FPKA 3EC1A 1NMXA 2O8BA 3AVYA 1LW7A 4FINA 4LYJA 1YZGA 1G3IA 2D3WA 1E2FA 1W44A 1UKVY 4JL8A 1QHYA 3GLFB 4LPSA 2JEOA 1X6VA 621PA 2BV3A 2C99A 4Z1MA 2ZYUX 4UXHA 4QBHA 1E2HA 4PO1A 3PEYA 5G53C 2QU8A 1E2PA 5KOYA 2GKSA 2ZS9A 1XTRA 1NLYA 2WOJA 3Q7QA 1GITA 3IHWA 4JVSB 4RD1A 5JFGA 1GTVA 4LC1A 1G6HA 3WY9A 4D26A 1R5OA 1FUUA 1Q22A 2ZAOA 4NHOA 2IYZA 2BIFA 1UDXA 3LBIA 3R20A 4B2IA 2XSZA 3HDTA 4YMTA 4A0RA 1EWQA 2C96A 3D6TB 5FTLA 5M04A 3U4QB 2ZJAA 2GEUA 4RFSB 1JR3D 5DISB 5D3MA 4QGGA 3HPRA 1LNZA 2K5UA 1T3SA 3KDSE 2GXSA 1HYQA 1IQPA 5LDDC 3QY0A 3KJEA 3NBZC 4YDHB 2IWHA 3CPHA 3MCAA 1HEIA 1VECA 2N46A 2NZJA 2HDNB 3FKSA 1TQ6A 1HQYE 2AX4A 3SFZA 3U3KA 4LV6A 4AIIA 4A6PA 3EARA 1IY2A 2OCBA 2BEJA 2ZR9A 2G88A 3UMSA 4QGAA 1FTSA 1G3RA 2W6ID 4QG7A 4HAVA 5TMPA 1MH1A 1WCV1 1G5TA 2NO6A 4TLDA 1Q3HA 3ZZUA 4TQAA 1FOEB 2N1BA 2CE2X 2VHQA 5GJCA 4QC2A 1E2DA 1IY1A 1KNQA 1XCGB 1YKSA 3NBYC 1LB1B 4KSCA 3TUJC 2WWYA 3C8UA 1OH8A 4F92B 3UKDA 3UK6A 1D6JA 2AWNA 3NDPA 4HDOB 3UG6A 4YQFA 2EWVA 1AS2A 1JI0A 3SJBA 4M0LA 2R6AA 5JS8A 4OQNA 3GEHA 4M9ZA 1RRGA 5CK5A 3GLFA 2SHKA 2ZRLA 1X8LA 5FL3A 2JLWA 1WA5A 3CRQA 4LJ8A 1W2GA 3T35A 4CEIA 2F1IA 1P60A 4D4KA 2QGZA 3LY5A 4DLWA 5C18A 2R8RA 1XWIA 2OBLA 4LHVA 5FBLB 3SDZA 1Q57A 3LXRA 4KAXA 2WJJA 2ZJOA 4RCYA 5EZ5A 3NKVA 4LZZA 4XJXA 1UKZA 3B85A 3I5YA 3N2EA 4WXPA 1G7CA 1HQCA 5EE9A 4ASUD 1WBDA 1G8HA 4DLYA 3ZD7A 5AWFC 2ZRIA 1VMAA 5IT5A 2VBCA 3K0EA 3QF4B 5AJWA 2IUUA 3U4QA 1G8FA 1F48A 1SGWA 3BGWA 4RFSA 1C9KA 4WBSA 1QBKC 2PZGA 2E9SA 1E1QD 3Q5DA 4H1UA 4BRWA 2FA9A 2R9VA 2PT5A 4D81A 3RYTC 2RGDA 3B1ZA 2CCJA 2RCNA 2REBA 3QEOA 4CGZA 2ZUDA 3AUXA 3D7MA 2B6HA 1WB9A 3RS0A 2FF7A 2J7PD 3AV0B 1KMHB 1JAHA 5BXQC 1Z06A 2GTPA 2J0SA 1F3OA 3X1YA 3GCGA 1FQJA 4LGMA 1XCMA 2J46A 1Q21A 4C0LA 2ZREA 2QMHA 1DG1G 2A30A 3OAAD 4QGHA 2Z83A 2JLVA 2YC2C 2ZJYA 1XMSA 1YZLA 2RMKA 4WIAA 5CJPA 2BCGY 4BASA 4U5XA 2REXB 4C0HA 3L8YA 2ZM5A 1MO4A 2IS1A 2CL7X 1Z6XA 2CDNA 3QKUA 3WRYC 4C2TA 2ODWA 1XTIA 2QL6A 1LFDB 3DHWC 3EA5A 2H7VA 3ADBA 2WTUA 2VTKA 3TQCA 2QQEA 4BFWA 3BXZA 1T9HA 3GLIE 2WJYA 3GJ4A 4OHVA 5CM9C 5EP1A 3VFDA 4Q4JB 5HCNA 1QZXA 3GFTA 4B3FX 2C98A 2HUPA 1JPNA 3CUEF 3QKSB 1NL3A 1CJMA 1M2OB 3LVQE 4EPWA 2IXEA 1RRFA 3DOFA 5FTKA 1TPZA 1DAFA 1V5WA 1NI3A 4GDFA 3L0IB 1P7CA 4B76A 4B6EA 3W3ZB 2WAXA 1PUIA 2WBLC 3W8NA 2Q9AA 3RSOA 1ZIPA 2XOKD 4Q19A 4C0BA 3L0PA 4A0FA 4I1VA 1KI3A 4OK5A 1QHSA 1CR2A 4JT4A 1G291 3HU2A 3ZVNA 4LC0A 2ZJ5A 3QF4A 3AKDA 4OK6A 1Z07A 4JLOA 2RGEA 1XXHE 3TR5A 2ASEA 1ESMA 5KHOC 4NCIA 3K0FA 2EFDB 3KKNA 5DLQC 3C14C 1NMZA 3N5CA 1EFRA 3OFND 3FFAA 3GLHB 4D4LA 1R8SA 4AD8A 1W5SA 2VA8A 3D8BA 3FVQA 1GL7A 1DPFA 3K9LA 4LK2A 4XTCS 5K8UA 4IEIA 4OQFA 4JKIA 4PC7A 1OV4A 1S1MA 4P31A 4HYYA 4D4MA 1KK1A 4KYIB 1ZD9A 4LV5B 4US1R 5KPJA 5CYOA 4MUAA 1XBTA 3G5UA 3QBVA 5SZJA 4Q7KA 4GMDA 1E0AA 1W47A 2QSZA 1CR1A 4F93B 2QMUA 4NP6A 1FZQA 3VR5A 4DUGA 1N2CE 4TTQA 2W83A 4W5WA 1T6NA 3T1VA 4D0NA 2E87A 4MRVA 1KYIA 3LXXA 1P3JA 1N5LA 2Z5FA 5EXXA 4G5GA 3B60A 6Q21A 4Q4JA 3EZ6A 5IHPA 3QKSA 5LB4A 1IN4A 2KSQA 1KAGA 4LYAA 4KBFA 2BWJA 1W0KD 2ECKA 3FPAA 1ZCBA 5H8WA 4LJ4A 2CK3A 5CYPA 4ARZB 4QKQA 1DAHA 3UWKA 4NBSA 5JEEA 4EIWA 3ICEA 1CULC 1G18A 3WBJA 1SVWA 2GZAA 4NL4H 1KKLA 2VSFA 3O47A 4Q1AA 2OO7A 2A5DA 5BN3A 2QM7A 2FPMA 2AFHE 2WKQA 3TE6A 4C9BA 2AK3A 4DDTA 1ONBA 2ZRNA 2AD5A 4FXPA 4YXWA 1AQUA 3WP0A 1XD9A 4B32A 1M7BA 1KI2A 1X3SA 1ZM7A 3IPYA 4N0EA 4RKEA 1DADA 2IEYA 4Y0VA 3SHFA 3THYA 2JJ8A 3IEUA 3GLHA 3MG9A 3OE7D 3T5DA 1KIMA 4DDWA 4DRZA 2I4IA 2E1RA 2WJGA 4DDVA 1MABB 2QENA 1JR3A 2RGCA 3K9GA 2WIBA 1XJQA 4ERNA 3U5ZB 4EPYA 3TBKA 2OAQ1 2ATXA 4DLUA 2HJVA 1IXRC 1Z0DA 2WJIA 1M1YE 2YINC 4PPFA 2BBTA 1ETUA 4DWJA 1RE0A 4D80A 2IL1A 4Y0AA 5L3SB 4QBFA 3QE0A 4Q01A 1R0WA 2ZE6A 3M1IA 1OPXA 2HT6A 2XITA 2ZSAA 3ETLA 2WJHA 4GSYA 1V43A 1EFUA 1E2MA 1U94A 4UXIA 2LKDA 1CRPA 4U02A 2OILA 3EAQA 4TL8A 2OE2A 4IKEA 1FNNA 2QN6A 4ARZA 4PO8A 1OJLA 3QIAA 3RS3A 2GVDC 4AKHA 1I2DA 2CLCX 1J8YF 1DS6A 2OCPA 3GFPA 3I92A 1T5IA 1WRBA 2NO1A 3GJ3A 4QBGB 4ZI2A 1W4AA 1WXQA 1ZNYA 3L2OB 2V6JA 2G3YA 3W5JA 1JNYA 3SBEA 2C2HA 4BLTA 2IXFA 4I1UA 3TIFA 2A5JA 2H57A 4JSYA 5EP3A 4EUNA 1GILA 1KZ7B 2J45A 3BRWD 3IEVA 1U0JA 3ZGXA 1ZD8A 3VAAA 2B7CA 1G9XA 1RZ3A 3NHAA 2OBMA 4ASUA 1NNEA 2P65A 4EPVA 2C03A 3PCRB 3FTQA 5FOVA 4QJ4A 3HYRA 5SZHB 1MABA 2YVUA 5BWMA 5CDFA 3P27A 5C1BA 2O8EB 4Q1BA 2YZ2A 1MO5A 4B43A 1E1QA 4CEJB 1CTQA 1WMSA 4PPGA 1KSHA 4OL0A 5CLQA 3B5JA 5L3RA 3EZFA 4A15A 3CRVA 1KI9A 3HP1A 4KCGA 4DCTA 2J7PA 1COWD 5L3SA 1GAJA 3AKCA 2FSGA 3OIYA 2Q9BA 1AK2A 1S3SA 2FSIA 1XD8A 3AP2A 2G1JA 3RHFA 3OAAA 1G7RA 3B1WA 2F1HA 2WWWA 4P4UA 1OIVA 2BMEA 2OG2A 4URYR 2A2ZA 5FOTA 2ORVA 2OXRA 3HU1A 5TY0A 3BORA 3LWNA 4AI6A 5TDHA 1I4LD 1GNRA 2H5EA 3AVPA 2ZRBA 1EFTA 4LYHA 2G6BA 1XEFA 4HLCA 1M74A 1AA9A 3DPUA 2WWHA 2NPIA 2ZRAA 3PENA 1P5ZB 3QJYA 1A5TA 1KDRA 2Z6VA 4B3GA 4YMUA 5FOWA 2DWQA 2OHFA 4B2LA 5JRZA 2FGKA 2HYDA 5BYKA 4BGDA 3TRFA 4HB0A 4PAQA 2RH5A 4HI0E 1IOZA 2HXYA 1QHNA 3TVTA 4BZXA 5AJXA 3RS2A 3LH5A 3KB1A 3GJXC 5F3WB 3GJ5A 3TLXA 4RVCA 4ABYA 2XOKA 3MFYA 1NN1A 4ZDJA 1Z28A 1H8EA 2NZ8A 2XSZD 1GG2A 1KI6B 3SJZA 3V9PA 2UVQA 3GEEA 4ZDKA 2ONJA 4JYBA 5EQTA 1G5PA 2ZRJA 3DZDA 3IO5A 3MD0A 2IYYA 5CIWA 2KBEA 2IW3A 5FBVB 4DLXA 3U7FB 4L8GA 3F0TA 1Z63A 4E03A 3BS4A 2JCSA 2RGNC 3FKSD 1AN0A 4B34A 1JPJA 1U99A 1OYYA 5JBQA 1XZPA 2FG5A 4B3DA 1A1VA 3FFBA 3OFNA 1S4QA 2V6IA 4A8JB 1KJWA 2P5SA 3W6PA 1G7SA 1HE1C 1II8A 1OFIA 4IDHA 1IN5A 4B75A 5FPYA 5L3VA 3NDBB 3QENA 2GJKA 1N25A 2WMNB 1J7KA 1KNXA 2ZYVX 1TUIA 4M22A 4ZCLA 1RPZA 5J4KA 3LW7A 4TTRA 4NDZA 1YZKA 2PJZA 1HURA 1L4YA 2EFGA 3C15C 3Q9LA 2OFXA 5EXPA 4PHHA 1KJZA 4E07A 1AGPA 2IYQA 1KAOA 3FHCB 1E6CA 4PR0A 3U7HB 2FGJA 2GBLC 2BJVA 4CT4B 3SBDA 2G0NA 4EPRA 3SE0A 3QNUA 3REFA 5DNYB 4V0LA 1KHTA 5FOXA 2RAPA 3U3MA 4HZIA 1N5JA 4X8OA 1W0KA 2G0TA 5FBWB 3CH4B 1KMQA 2X77A 5EXTA 1KGDA 4TZ6A 3A1SA 1E99A 2A5FA 2IYSA 4MRSA
chains in the Genus database with same CATH superfamily
3LI2A 2BGNA 4ZU1X 2DJ5A 5DHSA 1NT4A 1Q0PA 4ZO8A 1OYWA 3WLJA 4CCSA 3KZOA 2VLBA 2PT7A 3FPCA 2H1VA 2IU4A 4IWXA 3MILA 2PUVA 4S0XA 2C8KA 4QSMA 2B36A 3VTKA 3GEIA 5ADUS 4M0KA 3P0IA 4TTAA 2QP3A 2HR1A 5JLJA 1EFCA 1N6HA 1KI4A 1MW9X 2BBOA 2A9FA 4Q03A 4PZPA 5FTNA 1KDYA 4BZZA 3A4IA 1HETA 1Q1AA 3IVXA 3O92A 1TJYA 4HXEB 2ZIEA 4I1SA 5C4GB 4CIYA 2VQ3A 3IUBA 4CQLA 1E4EB 4E30A 1SXPA 3J81k 3P19A 1UDRA 4JQZA 4FLEA 1QVVA 3C5VA 1B1AA 4HNAA 1BCSB 1Y98A 4IX1A 1G64A 2I6TA 1Q77A 1BU5A 2IGBA 2LKCA 3TGLA 1QIFA 2FRDC 1NFFA 2PY6A 4LJRA 3N2ZB 3BFKA 1KP3A 4E13A 4LZOA 2YWCA 4GI1A 3A32A 1NTOA 3EQ8A 4TS9A 1A88A 4UDXX 3AR6A 1H6BA 4RORA 4O4IB 3TW4A 1XTTA 2P67A 1FFHA 3NWOA 1E7QA 1MG5A 4FNOA 1KC1A 4K2AA 4O0MA 4CL3A 4GZLA 1MP0A 3SR0A 5DHFA 1WLYA 3PYXA 1SB9A 3F1LA 1ONOA 4X6YA 1PTKA 2NNWB 3QHQA 1TZBA 4WXMA 3DV0A 5FAXA 5KJFA 1UMCA 2O9JA 5ANRB 3WYCA 2Z2YA 4C0SA 1IHOA 1FB5A 1UK6A 4DUGD 2RGWA 4MLCA 4YJKA 5C5EA 5G3YA 2OHHA 3IAS1 4DSOA 1FBNA 3F97A 4DSAA 4MVJH 5CFMA 4QATA 3HTXA 2I3ZA 3MUOA 4ZYWA 3QY9A 4BEJA 2GWRA 5JTTA 1VYVA 4UBIA 4M0UA 4TUYB 5JCJA 4FVTA 3ZGYA 5KYKA 3DP7A 4LRUA 1VL6A 1KGSA 4CI9A 4LY3A 2HPVA 2RHJA 3H11B 5AMXA 4QHTA 4YMWA 3I61A 1IHPA 1EPUA 2YWHA 3NPAA 4EITA 4BE7B 4RA6A 1HE8B 1PGOA 1VPLA 3R23A 4C1BA 3MBIA 2OBBA 2DPLA 3QLUC 3HN2A 3EEFA 4UPVA 5LSAA 3AGPA 4L5AA 4D3FA 4CE6A 2HD4A 3KKMA 4G89A 3UJ7A 1IWPB 1P5JA 2WE7A 3A9TA 4D0GA 2CSXA 4QYXA 2I6FA 1R0ZA 1XZIA 4NAHA 3EAFA 4RNDB 4HS9A 1V7ZA 2BFOA 3PQ8A 4GT1A 5TXGA 1RRMA 1IXYA 2KLBA 3KD3A 4HQOA 4H1TA 4YECA 2FW0A 4A27A 5I51A 1M34E 1M8FA 1NYQA 4XLTA 1OH6A 3QE9Y 1E4EA 4N6GA 1AKUA 2GF9A 5B7QA 4DR3B 1H5UA 1NVTA 1BCSA 3IHLA 4V0KA 2XTAA 4IRUB 4QUEA 4BP3A 1IN6A 1JMYA 3GLUA 2UXDB 2G04A 1VHWA 1CR6A 4JLUA 1E77A 2J9FB 1U2EA 5LIRA 4C05A 5D3QA 1TOAA 2OFWA 2LVBA 2H7XA 5IKPA 3STTA 2ZG6A 2VKTA 1SULA 2J07A 3I0NA 3NPMA 1XXHB 5B57C 3G2KA 1P0QA 4O4IA 3DEFA 4RELA 3ROMA 1BJTA 2C29D 3RWMB 2J6HA 1GTSA 4JVMA 4K9LA 3PYLA 5HYVA 2XDQB 2Q3EA 2C4MA 5HFNA 3O73A 2VHTA 5I7RA 4Z9XA 3PNVA 4FZRA 5TARA 5IZCC 4JAVC 5LD2C 2XUZA 5EHXA 1HLFA 1ZPDA 4GVXA 1COWA 5EIXA 3WMRA 4PSCA 3T1QA 2F1OA 3AFHA 3UXYA 4AL4A 5AXCA 4V1CB 1KEKA 1Z4NA 4PCUA 1IZZA 4LVCA 5LYJB 2GN6A 1RE1A 1FUKA 4O1MA 3TMKA 3ZWNA 4TUYA 3TLYA 4HBGA 3VR3A 3VXKA 4XFKA 1KRWA 1OIXA 3RSLA 4FKZA 1LRKA 4Z7QB 2CV1A 3P8ZA 4I4IA 3H11A 1ANKA 4P22A 4EHBA 1DJOA 1MJNA 3G2IA 3L7YA 5I7AA 4EI8A 1VPWA 1ZH6A 1Q44A 2Y05A 1ZGBA 4NATA 3EIEA 5DH9A 3ZK7A 2XVXA 2G6TA 2C7VA 5BWLA 4J6EA 4RH1A 5JAQA 1HDIA 3CVUA 3GLIA 2NSHA 2Y2VA 3N8IA 4GI2A 5KSPA 3S8EA 1CB7A 4KR6A 3P4YA 3F6EX 4AZSA 1IQUA 4KDEA 3VSAA 2CFCA 3DE5X 2BRUC 3PR1A 2R6DA 4JOCA 3T3EA 3RV4A 5KX5A 4WKCA 4P84A 3VHRA 3BK1A 1R15A 1YE5A 2P0YA 3K3PA 5DHQA 2Y67A 1ZIDA 2PGDA 4EMBA 1HUQA 3Q9NA 4AJKA 4KRFA 3E8MA 5ILOA 3SWWA 1FJXA 1ZXLA 3NDIA 5KQPA 1Y6ZA 2E3JA 3HA3A 4R2HA 4YRIA 4GSLA 5DGDA 4XQEA 2XVAA 3ZBUA 2AFHB 4ZJPA 5AW0A 3FAKA 4EVRA 1FU8A 1WQ1R 1M5RA 1Y81A 1VHJA 2J9FA 5FHQA 4Q21A 1SC6A 1SN7A 2QJFA 3K70C 4O2BF 3ZWWA 4DQDA 2FU5C 1XXHA 1A7AA 3FTDA 5DN9A 1NI4B 3C1TA 2OAEA 2D4HA 4B71A 1EK6A 4EG8A 4CIWA 1XG5A 1Y6GA 4KR9A 4UCFA 3WGOA 4YLEA 3FOWA 3EBPA 3H99A 2JFXA 2XDQA 3ACCA 3D7NA 2V4ZA 1K6MA 2Y3IA 4XR9A 3IUJA 1DDOA 2ZXEA 4ER7A 3WRXC 2IYEA 3HHPA 3TSOA 1WU7A 1ZLXA 4V0NA 5TIIA 4PYKA 1TJNA 1YRYE 3L8FA 4V1CA 4Q4HA 3EOZA 1ZUHA 2A9RA 2OSBA 2XAAA 3DNMA 5LYJA 1QOZA 4OHZA 3DTNA 1AB5A 1EXMA 3LOPA 4AKEA 2Q1SA 4INZA 2D2IA 4QE3A 1J06A 1U04A 4A10A 5I4IA 2ZDHA 5M5BA 1U5BA 2Z2KA 1CU1A 2Q4DA 4INOA 1P7WA 4EGSA 5JQGF 4G86A 1Z5NA 4UATA 3A27A 3AUYA 3SVZA 1E6KA 4JT8A 5IJZA 1NF3A 2OORA 5JSUA 3GLKA 1U5CA 3SCZA 3QBTA 1JJ7A 2BEVA 4MVXA 1G19A 1D1QA 3L01A 3UV7A 2HLDD 3DBLB 5CBPB 1LBIA 4JEMA 1AN9A 3G0BA 3HDHA 3FZEA 4M1ZA 3UB3A 1A8IA 2R96A 2XUHA 1OWLA 3JAWA 3V80A 3RC8A 4BVJA 2FVXA 4O2AF 3H9JA 1R12A 4IJUA 4U3JB 3ZXIA 1JQLB 3JATB 4Q12A 3N2IA 1S8NA 2VJQA 1AUQA 1E9DA 2YQ5A 3C6ZA 2QTBA 3G85A 3KOYA 4NBUA 4OHXA 2O54A 2QRHA 5T6BA 4BRUA 1GQFA 1OLUB 2JCBA 3CEAA 2J0UB 2XUIA 4J7XA 5H1YA 3OZCA 3DB2A 3Q8XB 4QREA 1DJLA 5JPIA 5LC1A 2ST1A 3TKLA 1GOTA 2AFHA 2XZDA 3W04A 5DHPA 2IPOA 1ORVA 1H65A 3LHSA 4OLHA 3UGJA 1Y42X 1QE0A 2ACKA 3C7AA 1UXIA 3RPEA 2V6MA 1BFUA 3AKZA 2A0XA 4PPNA 2TMGA 4GOJA 1NI4A 2IOYA 3AM4A 1E61A 3R8XA 5KTOA 4GP7A 4KIUA 5FORA 1PVOA 5H5JA 2D00A 1ZMXA 5DCUA 5GMOA 2ZUTA 2OHIA 2K7ZA 1N8TA 5EEHA 4EJSB 5I3ZA 1W5EA 4HEQA 3L1JA 3O2QB 3I30X 4P33A 2GZ1A 2QX9A 4RJIA 3IS3A 4K6OA 1BXGA 2BHLA 3NG1A 1BX1A 4W1RA 2VP5A 2YHUA 3G2QA 1A7KA 2WVJA 4KQMA 4JI5B 5AM4A 4DV1B 5AVVA 1L8LA 4MGZR 2PFKA 3ADDA 2GS9A 1USIA 3R74A 1GRNA 4LJKA 5FYQA 1G5QA 2CVZA 2ORYA 2QL5A 2WD8A 4P93A 4IVQA 3CZPA 1QF7A 2D2FA 1QDLB 1PL7A 3C1OA 1NPTO 3PFKA 4MYUA 2C5BA 1OFGA 4ZA2A 3TSWA 2QIPA 1Z4PX 1NA5A 3D43A 1YRBA 2DT8A 2G9VA 1JDSA 1FYEA 2P9JA 1BH2A 3HB9A 4D3ZA 3INYA 3DBLA 1QF6A 1M75A 3CR8A 4NCXA 4Q7QA 1IG3A 2IPXA 2Q3BA 3BIJA 3D1VA 5CBPA 4MKGA 4JVLA 1Q2UA 4LHZA 5JI2E 4ZAXA 4YJFB 1YV9A 4R41A 1UXJA 721PA 5DV9A 4NYIQ 4YP6A 4DIKA 2N3ZA 1YRQA 1GGHA 4U3JA 4C6SA 5EUCA 2ECPA 2GBGA 3FI0A 1JG2A 3JATA 4MMXB 4YRDA 3B38A 1TA9A 5AHXA 1TJ4A 3GR6A 2CNNA 3C6KA 3CF4A 1JEJA 4JLVA 3RVPA 2C4UA 1OLUA 4UTXA 4EYEA 2J0UA 1YZQA 2XNDD 3PHIA 1FXSA 1WPRA 3H86A 3IERA 1VM6A 4B7AA 1YBFA 4EBBA 2B1GA 3ONDA 4E15A 4MICA 4FGJA 4LV8B 3O4JA 4NH0A 5EWJB 4BQNA 4LECA 1ZS9A 3Q98A 2B34A 4Z0NA 3KAQA 4FMDB 1D0SA 1KDVA 2AI3A 2H0AA 4IIJF 3S27A 1KZYC 3KJFA 3N2YA 4CKXA 3VYSB 1N2JA 3LS2A 4JMPA 5EMKA 3BJIC 4F9GA 4EFMA 3KJGA 3S8MA 1FQOA 1Q7RA 4GMFA 3L8HA 2DBQA 2QMEA 1T5HX 4HN4B 2ZSDA 4R83A 5J9FA 4EJSA 1MJGM 1PX2A 4KUHA 4GOND 1ATIA 2FXVA 4AWBA 3OY7A 1LTHR 2PEZA 3DGFC 4CN9A 2R6R1 3DVSX 1Y1PA 5BT9A 1IJFA 3UANA 1FC0A 1KP9A 3JQEA 4B5LA 3FMGA 4Q4AB 4J9UE 5AW5A 4JJFA 5AI4A 3P2IA 1U90A 4YI5A 1MTZA 3JQ7B 3ED1A 2JH3A 4UUBA 3WSVA 1F8UA 2DBRA 4Q3KA 4R2XA 3RG2A 4C6TB 2QZ4A 1ZJ6A 5ALDA 1TLTA 4F6RB 4YAKA 3TQOA 3PHBE 2ASVA 4BNZA 1Z2CA 2AJ8A 4AJIA 4YP0A 4WOPA 3KSDO 3IMFA 1S6YA 4XB2A 2BMVA 1QKKA 1VBNA 1NXQA 2RCYA 4IIXA 3N75A 2JHPA 4P36A 2IUSA 5BO5A 4XX0B 2AMLA 3FTFA 4PZLA 5FV4A 4L0CA 3VNQA 5EXSA 4DS3A 3FUVA 2QY9A 3DMYA 4IZOA 2P2CA 1PNVA 2CNOA 3L93A 4WLEA 1RLMA 3L46A 3OIWA 1GT6A 4YJFA 3T9CA 4C29A 2XQIA 3ZNNA 2AF4C 5LZ7A 4BZPA 3WA7A 4ZOLB 3A9CA 3AY0A 4PGAA 4LIPD 1UWLA 1U9ZA 1ULUA 1MX1A 4HADA 4KJZA 3RVLA 4GUDA 4WY8A 3NNNA 5H9WA 5LU9A 2A0YA 3Q7TA 2PU7A 2A1UB 3C3CA 1GGVA 1DBSA 1QOQB 2HWUA 4YVFA 3WLIA 1DIRA 1UODA 3BDVA 3PLAE 1W2HA 1XWFA 2F00A 3HVJA 3OJLA 2V7TA 2OB2A 2H59A 4AMVA 2VPYA 4CV1A 1O5IA 2VC2B 3A7EA 4PC3A 4MHTA 1CRLA 4OJYA 3L7OA 4CPDA 1UM9B 4R16A 3OZTA 4YS6A 1EJ2A 3TXAA 2H2WA 1XTUA 2JI8A 2QM8A 3RH0A 2ZIFA 4C0JA 4DG9A 1JA9A 1QX3A 3D8SA 4H7JA 3M4ZA 1K8XB 2B8EA 2YUTA 4E70A 2QK4A 3SM3A 1DUVG 3PC3A 4CXMA 2JDIA 4XQCA 2BEWB 4JKYA 2L2QA 1OH7A 4NZPA 1Z6TA 1MC1A 1GPUA 3GLVA 1CHDA 5BRNA 5KYXB 3UQZA 3PVSA 4Q4AA 1UZMA 3ASYA 3WDKA 4OG2A 4C88A 4OB6A 3JQ7A 4F2PA 4RTPA 5C1IA 3KKQA 1T43A 1RJEA 1Y9JA 2X86A 1PF7E 1PZMA 5FR1A 2OXIA 3T94A 4C6TA 5EIEA 5KINB 2HMWA 2HF8A 3CH7A 5DM4A 2AKYA 2OV3A 2AOUA 3Q85A 1EIZA 4QVKA 3VYRB 2O0HA 4KOAA 3KFVA 5CX1B 2HV8A 1PNTA 1VCNA 3OO0A 4BV8A 4Z8XA 1GSOA 5DO9A 1DC3A 1LPNA 2Y76A 2HFKA 4XX0A 5HKKD 5LA6B 4INJA 3NHBA 3RUIA 2ICAA 3MGAA 4NE7A 5IUNC 1GGJA 5TS2A 3VKHA 1MRNA 3IBGA 3RJ9A 1XVUA 2VTEA 4Y6SA 5EVCA 4ZYVA 4XAQA 1EU1A 2IDKA 4H27A 4V3CA 5IM5A 1DOAA 3SVTA 1WABA 4ZOLA 3ZHTA 3WNVA 5CUQA 3JQFA 2W6JA 3KEOA 2JLZA 1H2FA 3LZCA 3KWFA 3ZCSA 2WP0A 5JNTA 4ARBA 1SMKA 4K86A 1YRHA 4MQMA 3HMQA 4JLKA 5KCMA 4AF6A 5A5DA 4QM6A 4MPJA 3T1YB 2WZBA 2QNRA 4L75A 2V9PA 3MCTA 5C1PA 4FFVA 3OOJA 5ICFA 1Y5IA 1ZDMA 4XIGS 2EX0A 2ZJ7A 1UM9A 4IF6A 3RARA 2Q7DA 1SVLA 1LF5A 3B2EA 1F0KA 2UYOA 3L84A 3OT1B 4UAUA 3W9UA 1Q20A 2WF6A 3B9BA 4CFSA 5IM4A 3LBFA 1X0XA 1C3LA 1VE9A 1HEYA 1XF1A 3CNOA 3H2IA 3IJ5A 4QUDA 1XRSB 5IVHA 1NMQA 2QN1A 1W4RA 2TSYB 3V1MA 4S35A 2P9QA 2QNIA 3EVDA 3HJRA 1IZ0A 3OLYA 4PYNA 4LBVA 4QOHA 2BEWA 2PPVA 3MYRA 1HFEL 1C30B 1TPYA 4HG2A 1YGYA 1D2CA 4OMUA 1RRPA 1FDOA 3E4DA 1DRJA 1P2SA 1SBTA 3UATA 5CCDA 4BRZA 1KO7A 4F9EA 1FDRA 5CEEA 4XVRA 2P6RA 2C9BA 3SC2B 4I6JA 4F4HA 1C0KA 1WCYA 2PZEA 2JLRA 5CVTA 2ZM6B 3KFLA 1XZQA 2ORWA 3T5AA 1P9RA 2I71A 4QUGA 2YVAA 3RWBA 2NYVA 1L4UA 2MMGA 2FUG1 3Q7RA 2GN9A 5CYGA 1KZGB 5CX1A 1RD4A 2WVGA 3ZR4B 4EF6A 1MPTA 4MUIA 4JL6A 5CVCA 2R1TB 1UQRA 4EKIA 3ABQB 5K2OA 4LF5B 2F8TA 2BC9A 3KT6A 5LA6A 3G2MA 1P19A 4P7FA 1W4BA 4N65A 1Y0BA 2EC5A 3ESCA 3PNKA 2CXOA 4HJXA 3MOSA 4V0SA 1E3TA 1L3CA 3C3AA 3GXBA 1JX6A 2JIQA 2B1QA 2QZZA 1N0VC 1PUJA 1J0CA 1GU1A 2ZRMA 3FN4A 4FBMA 4G1EB 2NZXA 4NOMA 4TXNA 1OXTA 2APJA 2WLSA 1YI8A 3WWOA 5DP1A 1BCRB 1JEDA 1L9XA 3A3PA 3HLTA 1XQ1A 2X0DA 3U09A 4MJLA 4Q37A 2HSEA 1O1YA 1NQUA 1U0FA 2GYUA 3BWMA 2NOAA 3TE7A 3VMMA 1M73E 4FOOA 4DUPA 4L4ZA 1Z83A 1UT6A 3U4IA 1GVNB 3W6NA 5BPFA 3UAYA 1JE0A 3JPWA 1D7AA 1Q1GA 5G0WA 2X41A 1N3IA 2ZAYA 1EIWA 1JHYA 5AHWA 1KZ6A 1N33B 3BJRA 2EJCA 2UZ4A 4U63A 4ZTZB 3LQ2A 4IDEA 1NN3A 3G17A 2OKCA 3L5KA 3B8EA 3CN9A 5LNK6 4FWIB 1YKGA 1BEEA 1LRJA 1LSJA 1FX0B 4X8HA 1LWOA 5K3SA 4AUMA 3NIWA 1Y6RA 4X84A 5KNBA 4AKIA 5GZ1A 1E5DA 2VRWA 2B4AA 3PUZA 3A6KA 4IIHA 1SHJA 2ZE7A 3F8SA 1EGHA 1C30A 4NE9A 2VZ0A 1DC4A 3EIQA 2CUZA 4GVPA 4JVOA 1LKZA 4Q9HA 4CIDA 4NRDA 3VYTB 2Q5HA 4L28A 5JO0A 1SVKA 2BDEA 1V8DA 3W2EA 1ZRMA 1HH4A 4ESVA 4H17A 2Y2UA 3OF2A 2PWPA 2XRZA 3SC2A 3P4XA 5BVHA 2PFGA 2X9VA 3L4BC 4UOZA 3GELA 2Q3FA 3AH8A 3HJCA 4UPDA 1OR8A 1KK0A 5HFJA 4DJ5X 5BW6B 1X1AA 3R4CA 2IIPA 2Q3LA 4UQOA 4C1NA 2XVMA 3B82A 3I34X 1USKA 1YJBA 5IMBA 5J43A 5BNFA 2R1TA 2O1WA 2ZUBA 3EDYA 5CT8A 1U7XA 3GPIA 2DKFA 3MUNA 1W96A 2ZZMA 2HIMA 4A1OA 3MPOA 4DB4A 4U9UA 3EXFB 4OB8A 4JZYA 1D04A 4LWQA 3FR7A 3IUYA 5A02A 2QRKA 4B2YA 5JZMA 4OHPA 4UBNA 5DN6A 5ITVA 2NWQA 1YJAA 2EJTA 3ANYB 3KFXA 1QV7A 1E4YA 2WV7A 3WLMA 5HKOA 1BCRA 1KXZA 3LNCA 5B4VA 1IOWA 3F8TA 3RRXA 4TLAA 4EH1A 2V7VA 5E1OA 1TYCA 3WTCA 2PUFA 2DUJA 1PT9A 3QFSA 3OP1A 1KZHA 4BYGA 4M0PA 4POOA 2F8MA 3U39A 4EHDA 3KQKA 1P61B 1E59A 2GO1A 2GCOB 3GU3A 3N2LA 4M1OA 5ICGA 3R7DA 2MSWA 2WJWA 4KHZA 4DCNA 5D7NA 3QVVA 4ECEA 3AVUA 5EIAA 2XE8A 1N3BA 2W90A 4J76A 4NYIR 5AKEA 2UYQA 3GGDA 3GVXA 2BKLA 4B79A 2KW5A 4TSFA 1FMCA 2DOKA 4ES6A 4QARA 1VLJA 4LHWA 4ZANA 5ED4A 1W75A 4NBLA 4EGQA 1EK0A 4H08A 5DT9A 2QUZA 4DV7B 4M8LA 1FX0A 1VZ2A 1MEJA 1R0CA 1TD1A 3E3NA 3QFRA 3RDPA 5DTRA 3T3GA 4BTVA 3MAAC 4CRWB 1S5PA 5HIJA 3LIIA 1U2SA 1ZI9A 3GD5A 2PGAA 3AL3A 5I47A 5GIOE 3VR1A 3DFZA 3WMFA 2P78A 3L7KA 5KCZA 5H68A 1SIBE 2AVNA 4EB6B 4DA9A 5KVQA 5ALPA 1N9ZA 2FHPA 2WT8A 1NSYA 1BYUA 3A2KA 1O9GA 2B1IA 4DLAA 1SZCA 1R0LA 1X13A 3OZDA 1CUCA 1V1MA 4QOSA 3WWCA 4AY4A 3F74A 3H5AA 4DF3A 2YZ7A 3P2MA 2J4CA 2Y0PA 1M67A 5ALEA 2XUKA 3OFSA 3VUEA 5FWYA 5IRCD 1E32A 1WB4A 1M7HA 1T13A 3CRMA 2FDCA 3EA0A 5DGIA 3CUKA 2RC6A 2V5UA 3U5TA 2QX7A 3CLUC 1VYHA 4HUQB 3EA4A 2Q8PA 1L7VC 1LBHA 3EXFA 2XMZA 3IAEA 5AK4A 5LBIA 4A4DA 3FMFA 3SKYA 1ST2A 4B9AA 1CVRA 5EYPB 3S2YA 1E79A 2FETA 3N8GA 2NPFA 3F5QA 2FEXA 4E5VA 3GP8A 1A97A 1OU4A 3GZNA 3N7UA 2Z8ZA 5JIBA 1XDDA 2EKZA 2WAYA 5CFPA 2PE5A 1PWHA 2AL7A 3CV3A 2I7CA 5F7ZA 1T26A 2MOKA 3RIHA 1RXVA 2BJWA 2OXTA 3V4PB 4WZBB 4LRWA 1X9IA 2NSLA 1O94C 2ERYA 2X5NA 3R5XA 4Y2JA 2V7XA 2GCOA 5CT6A 5IJXA 5AVTA 4KBGA 1V5FA 4MWZA 4YFVA 3RS4A 3UOAB 1RS0A 3WL7A 4AG6A 4BTLA 3PXAA 4K8RB 4TZTA 1UL1X 1AB6A 1J1ZA 1XA0A 2G80A 3NWJA 3MYYA 3DBIA 2QN7A 2IEZA 3ZCUA 3BRSA 2YN2A 1BJRE 2ZRDA 3B89A 3B6IA 2NQTA 4D1YA 3UXEA 2HY7A 1OGIA 1T0PA 3L49A 3OF5A 1NNLA 1E2QA 4IO1A 3ZJ5A 4PWZA 2B7LA 3EXHA 1EXDA 3HP7A 4KXMA 1YBMA 2RB5A 4BVFA 1MMFB 4P32A 4RK5A 1OZ0A 1ZSYA 1ES9A 2NXJA 1W49A 1C1XB 3U1TA 4EB6A 3MFQA 2PEYA 2MSDB 1JZSA 4ZARA 4YJ3B 3O0DA 1J4AA 1XCOA 3IJPA 5EQJB 3CVJA 4LGVA 1ZK2A 3BZBA 4NARA 3VR4H 2UXBB 3T7TA 2HA6A 4CMIA 2ANBA 3DULA 3HL0A 4TMKA 1UIRA 2P7IA 4R69A 3AHJA 3UAXA 3WSTA 2NIPA 3PNYA 4IQFA 3ST7A 4G09A 1NLUA 1RAFA 3IODA 3IPRA 4S3MA 1WW2A 1Z8HA 2VH1A 2WVHA 5TQJA 2OGTA 1X38A 1NQVA 3DT6A 5KYVA 4DSUA 1T29A 5F5XA 3ILXA 3N58A 5KVCA 3M3HA 2IHTA 2NT3A 1K6XA 1NJ1A 1UJBA 1P74A 2JJ2D 4M1KA 2BDTA 5KYTA 3FWZA 3OX2A 2A5YB 2B3TA 5DTIA 2O4UX 3HR4A 4LOJA 4HUQA 2VPWA 3JAMA 4W1QA 1CY8A 1MO3A 2V7EA 1YF3A 3UJBA 2ZVDA 2FFBA 3M33A 2R65A 1N6RA 3AHIA 4WJLA 2Z6AA 1OHHD 2R68A 1UBHS 3C3WA 2PR7A 4P3XA 1PZHA 5EYPA 1B26A 5JV5A 5KJ1A 2EF1A 4TYYA 4P1ZA 1CE8B 2CHQA 1YZFA 2A3RA 3VPSA 2DHCA 1P91A 4WCDA 5I5GA 4ZOAA 1XI2A 2EGGA 4N03A 4YRPA 2PNJA 2FMXA 1G9TA 3PGA1 1ZYUA 2PBFA 4D6YA 5IDXA 1LDNA 4DKXA 1HT3A 1PG5A 1CDEA 4WZBA 2IYXA 3TOSA 3H04A 3DCJA 5CJ2A 3R7LA 4AROA 2G5GX 3W3AD 5KMGB 5MFPA 1SXJB 3PPIA 3VI4B 2ESRA 4L5BA 4YV1A 1I51A 5GY7A 4D8UA 1Z8FA 1QPGA 4M87A 2QVZX 4HS4A 3A4NA 4MV5A 3F98A 4EI7A 3F73A 3HZZA 4FR2A 5K8TA 4ND8B 1LC0A 4I5EA 4L3OA 5J23A 3WJ7A 1KFJB 1AHPA 2XUQA 1RYZA 2YN4A 4WERA 1ODIA 5AI0A 1RLJA 4PZYA 4G25A 1KO8A 4CHTA 2VUHB 2VDQB 4EY3A 5G40A 2UZIR 1T9GS 3V3KA 3WLSA 1P45A 4PYRA 1VL5A 5CX4A 3OQ1A 1S7CA 5KAPA 3IA7A 1I5EA 1C1XA 5EA2A 5CM2Z 1Q83A 4W1SA 1TEVA 3VSBA 2FOIA 5KYNA 2K2QB 2AS0A 5G0VA 4YJ3A 3UK7A 1LLDA 5M3BA 3BYZA 3W9BA 4RFLA 1LEHA 3V55A 4C4YA 2C1XA 1YJCA 5AJVB 3STYA 1R6TA 2IYVA 5JC8A 2PG3A 4WZZA 1P7PA 2R8OA 4B7ZA 5C5CA 2D2EA 2UZ0A 4A8HA 3IP9A 2ZBGA 2CXQA 3IVRA 1TO2E 3PL1A 1Q14A 4K03A 1HA3A 1IHDA 1OLXB 4MRMB 1JA0A 5DBOA 3ZDCA 5EWLB 1XCJA 2PANA 4QDUA 5KVVA 1PD0A 2Y1KA 4W5RA 1VJGA 2A0WA 2Q0SA 3FNQA 3LU1A 4AJOA 4Z9YA 2EWMA 1DT3A 2F64A 3ICWA 3D0RA 3GMIA 5ENDA 1WETA 1ESNA 4R7GA 3Q40A 1RABA 5JWOA 5KYUB 5DYWA 5LYJF 4E4YA 4DZZA 3HYCA 4BB0A 1EP2B 4Y2RA 1A9OA 1DQNA 2RGXA 4PZEA 4EHAA 1CX9B 1A95A 3ER8A 4Z7OB 3FW1A 3ED5A 4BNNA 3UMYA 3B3GA 5I7VA 4HNGA 2WP8J 1HE5A 3C5WP 4HC4A 4XGKA 3GLGE 4JI7B 3JQPA 1FYXA 2A7XA 2B5OA 1CW2B 2H1RA 3KK0A 1T8RA 1QORA 3EGOA 4WL0A 4XVQA 2H2IA 1SXJA 3PQ5A 5HRAA 2UVDA 4WFIA 5F2OA 1NU6A 3CWZA 3HCAA 3JASB 4JEHA 1YVEI 2BSXA 2QTZA 2VJAA 1OFHA 4KIJA 4XKJA 4RK1A 1QIJA 2X2PA 2W6JD 3KZKA 1D9XA 3QXJA 3SZMA 4YRBA 2JJMA 4NMLA 1L7QA 4PSDA 1KO5A 3I37X 3MMNA 3E7FA 2UUOA 1MFPA 2O0LA 4FQ8A 4HAWA 3RD5A 2CDBA 2X22A 3W78A 2HTEA 2B5VA 1C0EA 3MWLA 4NEQA 3D4IA 5JU6A 2HYIC 5KQSA 5C53B 1NXWA 2P68A 2IV7A 5CLIA 5I3CA 2JFGA 1I3LA 3KLPX 3A1FA 1WQ3A 5K0SA 2O23A 2AKEA 4H7EA 3WZLA 1N6OA 1TZCA 2IOQA 3UN1A 3KWLA 4C4SA 3ZCTA 4XDHA 4MYRA 1YH3A 2IFTA 3CLRD 3DMHA 4KMOA 1LTQA 3VKWA 3ANNA 4M8SA 1TKBA 1U7ZA 1NZDA 1H6DA 3VPXA 4IJQA 1JTFA 1UKCA 4MO9A 1ZVVA 4N0DA 3F4LA 3GFGA 3GT4A 5K0BA 1CF9A 1XU9A 1OLXA 3H1AA 3O93A 1N5KA 2FW7A 4MRMA 3BH6A 5U1PA 5EWLA 3EIUA 2YZNA 4KMSA 4S1WA 1VFPA 2R85A 3OZXA 3EAGA 3UXHA 3Q9SA 1AQNA 3L9WA 3OTQA 3GD7A 4BFUA 3L7AA 3NI2A 4JIGA 4NZMA 4U2EA 3N8KA 2D1RA 4JBYA 2X0EA 4AP6A 3AEYA 1MC4A 3SOZA 3EUEA 3LT5A 2DBYA 2DH5A 1E2NA 2QT0A 1XMVA 4U7HA 3SPXA 1AZSC 1IBRA 2FN4A 4NBVA 3LFTA 2XMSA 1H8HD 2ZRGA 3EVNA 3HWWA 4JGBA 3RSQA 1ZWKA 1Y4ZA 4BBPA 4LSGA 5JWHA 1S3FA 1Q0HA 1L7XA 3A1UA 4GRIA 1K6IA 1R6BX 3BTUA 1JXMA 3LX6A 3FJOA 4GPTA 1NC3A 2AMVA 3F6PA 1FS5A 1I2MA 1Q92A 4BC1A 5JI3E 4IXWA 1ICEA 1LK0A 5JY1A 4BNWA 3K0FB 1RM5A 3MS7A 1Z4JA 1ZEJA 3K31A 4MR8B 2AOTB 3C74A 3OQOA 5CGQB 2A88A 2VLIA 3JASA 2XCUA 1JLRA 4M1YA 4QU0A 4AY5A 4XSHA 1T6BY 3O8OB 2JK1A 1HDGO 2W9XA 3WLOA 1W36D 4Y1EA 3CKYA 3GCWA 2C95A 1WDMA 4JLPA 2BZ0A 3F71A 1DDIA 2VAWA 3B48A 2A1TS 3AP1A 2FZ5A 4MIKA 4CM9D 3PJDA 3U6KA 1L3BA 4OHYA 1A8HA 4BMPB 1L2TA 4F5ZA 2GUWA 3SSOA 4PZ0A 1XPRA 1A2OA 1SRQA 3EIHA 4KSYA 4BFSA 3PWZA 2WU8A 3BH0A 5A71A 3JQAD 5J1SB 5D6OA 4UUPA 3UB4A 3BC1A 4KIWA 1BAPA 3TF5A 4RIGA 2J3IA 5KNBD 3QUCA 3K92A 3MMPA 4BO4A 3ZE0B 2H63A 5IFKA 1EAMA 4ZVQA 3H9CA 5ITSA 1XAGA 3VZDA 2YFKA 2H1WA 4LWZA 1U6JA 2RGGA 1PZXA 3RVBA 4F72A 2WFMA 3GN1A 3MF4A 4FOPA 4REQA 5G1OA 1PAUA 2C77A 2DFNA 5E4TA 4F5YA 1I33A 5ISMA 3LDGA 2DH6A 4UKDA 4ZQGA 4LYYA 4A2WA 1GQ2A 1H6AA 1PDVA 1UP7A 4ZGGA 5I9IA 2OBYA 3BULA 1WVIA 1Q1EA 1WUYA 5DYIA 3NATA 4IDPA 5JASA 4H4DA 2IS2A 1T8SA 2WNIA 3G1UA 1L4MA 3BB4A 4LSMA 3WKBA 3O2JA 5D5HA 2NU9B 4AG3A 4H2DA 3KALA 2JGIA 1LDGA 3KZMA 4EO4A 4F56A 3BMOB 1F0YA 1JJIA 3I8SA 2WUGA 3CUSA 4ND7A 1DV1A 1N2EA 2FPXA 3U48A 4LISA 3QPVA 2FJUA 2I8CA 3DONA 3NZEA 4WCVA 1KTVA 3KOZA 4WZAB 4FJ0A 5DSZA 3RNLA 2O2IA 5IBQA 3PDCA 1JAIA 2AOTA 4MR8A 3SF0A 5IFLA 4ESHA 5THXA 2OLKA 3NAMA 2CB9A 2EERA 2J87A 5ALWA 1M6HA 3R0JA 4BQRA 1DIAA 1ECLA 1P9WA 5AYVA 3O8OA 4OREX 3RVSA 4I1RA 1D9ZA 2AC7A 1OWOA 1ZD5A 3D81A 4MKIA 3H05A 1TO6A 4H7FA 3BCUA 3EF1A 4I8DA 1U6KA 1RM0A 4OSEA 5K3CA 3LK7A 2WHPA 5CLFA 4NCBA 1GZ4A 2ZJ1A 2H11A 3D59A 3BMCB 4J0DA 4MKHA 4QUJA 1VJ1A 2YVQA 4J2HA 2BHTA 2IVFA 1TKAA 3JY6A 2ZUVA 3I09A 2P1ZA 5IDWA 1KEPA 4FMDF 4LQLA 2YOGA 4BKQA 2P3LA 2RGYA 1YA6A 2WSSA 3CW9A 3ORSA 1L5WA 1I3CA 2G70A 2NYAA 5DTQA 5DSTA 3H0KA 3OA0A 1YFJA 2IBSA 5KTMA 1J25A 2O1XA 1JHVA 2Q2QA 1ZM3A 2DE0X 4KLNA 3BT7A 4EGJA 1MJGA 2JJYA 2CDRA 2QLLA 3L0YA 3BXPA 1MEOA 3HUTA 3A3NA 5K8VA 5ALJA 3IHTA 2CXUA 4DEVA 3GRPA 4OTZA 2EL9A 4ZT3A 1UPCA 1ZN7A 4LI0A 3RB8A 4NU8X 3O8LA 4EENA 3VDRA 1CEYA 3OCJA 2ON6A 2V45A 3HA2A 1NHWA 3TEJA 4CR7A 4Z1OA 4RZXA 4ZICA 4Q47A 4YMLA 1FUYB 3ZLTA 3HB1A 1RWQA 3BD7A 3ZG6A 2E2WA 3MHTA 1Q19A 2QVCA 4QOEA 1W7AA 3D4PA 2R8XA 3QZUA 2JGKA 3E1SA 3GJ8A 2NU6B 1VXOA 4O4HB 3WGLA 4OFWA 4BUJA 1P8JA 2NW6A 1BU8A 2IT1A 3D6VA 2H4XA 1J23A 4JWTA 4YK7A 2NU9A 2DTXA 2FDRA 2ZANA 1EA7A 2HPHA 2ZFUA 3LPNA 4GPZA 4OJTA 4QXMA 4UVHA 4WT7A 1RYYA 2W8ZA 4Q7LA 3CPSA 4HNVA 4OV6B 1EDEA 1P5RA 4WZAA 1TQDA 4QLBA 1RWPA 2GN1A 4AY2A 4WKBA 2IH2A 2EQ5A 4JI6B 2QEQA 2V7UA 1Y7IA 3FNEA 3MS4A 1KF0A 5CW2A 4AX4A 1G59A 4FFMA 4EHKA 3AP3A 2R6FA 4DE5A 3CSUA 5KNDH 3QFCA 1U0LA 2ZTHA 4UE6A 3WQSB 3GEPA 5HNKA 3QITA 4CR8A 2OZVA 3L8MA 2NZYA 1LLUA 3PPWA 4FDUA 4JLJA 4V0MA 1G7TA 1Q0ZA 1YCDA 1HL7A 1YQUA 2GD1O 2VPZA 1KY4A 2ZYRA 3K9NA 3OHPA 1FVHA 3BMCA 5AK0A 4CJXA 3KTDA 1FMJA 3FGZA 1JDTA 3L02A 3SQLA 2I6GA 1E3EA 4JXXA 4QTZA 1WY7A 1PP4A 1JAYA 2IX9A 4URXR 3HLKA 4HNUA 1F4VA 5T4EA 7AT1A 3SHVA 2WEKA 3F6BX 3OICA 5JNRA 5LQMA 2IX3A 3UV3A 5J47A 1NNSA 4ZAZA 1UANA 1LBTA 3P7MA 1E6EA 4TS1A 2FX3A 5H3LA 3JU3A 1TM5E 1VRVA 2HT1A 2Q1TA 4BBZA 1LUAA 4NWIA 4RESA 5JCXA 1VYUA 4G9BA 3WISA 5K20A 4MP6A 2RJNA 5CTAA