1V5WA

Crystal structure of the human dmc1 protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
239
Chain Sequence
PGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Meiotic recombination protein DMC1/LIM15 homolog
publication title Structural basis for octameric ring formation and DNA interaction of the human homologous-pairing protein dmc1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Recombination
total genus 57
structure length 239
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1v5wA00
1T5IA 4LOAA 3EIQA 1MH1A 1I2MA 2FDCA 2X2EA 2A5JA 2GZDA 4R2HA 2LCFA 2HYIC 2FSGA 3TRFA 1IONA 2OZEA 2W6ID 3I72A 1JNYA 2VTKA 2NQ2C 1W0KD 1ZP6A 1F2UB 5JZVA 3TSOA 4HATA 3NDBB 2IUSA 2V7QD 3GFTA 4M4SA 1A2BA 2Z4SA 4BWYA 3ZZ0A 1E2HA 2KJQA 4P0TA 2V1UA 3PITA 5LD2C 2VF7A 4LDJA 4B48A 4Q1FA 1Z6AA 3EZ2A 5P21A 1XBTA 1Y3AA 1OHHD 1IM2A 2A3RA 4BLRA 5B30A 3K9NA 5AUPB 1CXZA 2IUTA 4Q21A 3Q7PA 4GI7A 4IVRA 3QJYA 2D2FA 3W34A 1G6HA 4EPVA 4QM7A 3K0FA 5TV2A 4DCVA 4GOXA 4ASUD 3THOA 2ZIAA 1D6JA 1XD2A 5JCZA 1L8QA 2WBLC 1E2PA 2PMDA 2CL0X 1OT3A 2Z43A 1SVSA 4CIDA 1E1RD 5SZHB 3VMFA 1ETUA 4GP6A 1RRFA 4BFVA 3VX3A 4L9SA 4LRWA 2WWHA 2YWEA 3I3SR 1KZGB 4CEHA 2GCOA 3R7WB 4MKGA 5AUOB 3V00A 2J0UB 1ZYUA 4ZCIA 2R2AA 4DWJA 3TSZA 4DLVA 4P4TA 4LUCA 1RZ3A 3RWOA 2VQSA 2YWGA 4PC1A 1GRNA 1G291 1ZIPA 2EFEB 2OUKA 4RFSB 3UK6A 1XTSA 1DAFA 2JLUA 1R6BX 1LS6A 3AV0B 3K0CC 3O8BA 2UKDA 5BYJA 3VNUA 2J46A 2AD5A 3F3YA 1CULC 4PC2A 2PJZA 1E6CA 2W58A 3EIHA 1Q1BA 3WP0A 2CL7X 2P5TB 3BAFA 2FN4A 1YHNA 3T1OA 3PENA 4BQSA 2P2LA 1DOAA 4IDNA 4BFZA 5BQ5A 2OM2A 3M6AA 1CEEA 3TUJC 2QBYA 2DFKB 1XF9A 1XEXB 2OCPA 121PA 4WIAA 2QQ0A 1E79D 2ODEA 2ZRHA 1OJLA 3DEFA 2WWGA 2HCJB 4F7WA 2SHKA 4KCGA 3ZS8A 1P9NA 1AZSC 3SJBA 5DO9A 1CR4A 4Q7LA 1L2TA 4HB3A 2GBLC 2AL7A 1C4OA 4ILEA 1UAAA 3GD7A 3Q5EA 3W5JA 1I4TD 2BBSA 4BECA 1KJYA 1UBEA 2QM8A 4DIEA 3GJ8A 1XD8A 1WQ1R 1B0UA 2WWWA 1OV4A 3PV0A 2NMVA 1DBSA 2E87A 2FZLA 3K0AB 4IW3B 3LQQA 3NBXX 3FDIA 5CYPA 4AI6A 1XCGB 2J5XA 3VKHA 3B6EA 1FTNA 3RABA 4BZXA 4A15A 4I1VA 1HE1C 2O8DB 5JS8A 3THXB 1JAHA 2P5SA 2DR3A 3AVYA 3LO5A 3AP2A 1YR6A 1NMYA 2KB0A 5IT5A 5FOXA 1Z6GA 1XTRA 3GFPA 1U0HC 4DSOA 2CHQA 4EAQA 3U4QA 3K0CA 4E03A 2MSCB 5TXGA 2I1QA 5B57C 1VIYA 3WHLA 2GXQA 4Q4AA 4TQAA 2X19A 5FI0B 4B34A 1G7SA 4M9QA 3B7GA 4Z51A 2KBEA 4HUTA 3LV8A 2I4IA 2IXGA 4TMKA 2ZEJA 1KY3A 4A1FA 4U00A 2ZYTX 2J41A 3RS7A 4EFLA 1TEVA 3VR3A 4JLBA 8OHMA 4LYJA 4U5XA 1GKYA 1E9DA 3B5JA 4YMSA 1RC8A 1G17A 4MA4A 2BKEA 1XDBA 2CK3D 1HA3A 4TT3A 2GVZC 3UATA 1UBFA 4F38A 4URXR 2AWNA 2A5YB 2XJ9A 2IYVA 2OHFA 3GJ6A 1ZMXA 4AD8A 2GBLA 5E95A 3THWA 4G5SA 1Q57A 1GNQA 2BBOA 2AXNA 4JLNA 5EP3A 4CT5A 2ZRKA 3LH5A 1MOZA 1KDOA 4TZ6A 4KV9A 4RY2A 2WSMA 1AGRA 3AGPA 3T1QA 2F9MA 1QHHA 4LJ8A 2PH1A 4TYQA 4DSNA 1GVNB 2REBA 3WHKA 3ZS9A 3GLIE 2ANCA 3IQXA 4MYTA 1F2TB 4LBZA 5A5GA 3MWLA 1U99A 4GL2A 1ESNA 2Q21A 5AWFC 5HTKA 1Z0KA 4NYMR 3CRQA 4Q66C 5FI1B 3B1ZA 3WYGA 3DKPA 1VCIA 4FMCF 4LK2A 5EE9A 1AZTA 2HJGA 3IBYA 2ZYUX 4U7DA 1R0XA 4JS0A 1Z63A 1OH8A 4BRUA 1CRPA 4PPNA 2F3RA 1S2MA 2ZJOA 3AVUA 1IAQA 1KI6A 2J7PA 2YYZA 1XXHB 5B2ZA 1DEKA 1GWNA 1RRPA 2A5FA 3G82C 3A1WA 3U3OA 3G5UA 2GKSA 3KUDA 4UNNA 4CVNA 2ZYVX 1M7BA 5KDLA 1CIPA 4Q47A 3B85A 3NIBA 3QNUA 4Z1MD 1YZNA 1JJ7A 2OXRA 3F0TA 4NZYA 1Z0DA 3DPUA 3F8TA 2KI5A 1PJRA 3TK1A 1KKLA 1UBGA 1KSFX 3UG7A 1Q0UA 1VPLA 4LBYA 3PIRA 1J70A 1N0WA 1KAOA 4DEXA 4TL9A 3FHTA 1EWQA 2VH5R 3OESA 3EIEA 2FEMA 4PO1A 3SJAA 1K5GA 3TGPA 3OEEA 2RHDA 1VHTA 2OT3B 1U2RA 4Q1EA 1DO2A 2JDID 2OLJA 2LKDA 2B8WA 3QE0A 4JVSB 1NBME 1P75A 2IYTA 4PC7A 4A4DA 1NLFA 4QBGB 4A82A 2DFLA 2EYUA 3AF0A 3PQCA 1OB2A 2JJ2A 4I1UA 1RJ9A 1OXTA 4W7SA 5C18A 2CNWA 1FMLA 1FTSA 3GLHE 5H8WA 4DHEA 1X86B 2C9YA 2XSZA 2QE7D 4B6EA 4PX9A 1G6OA 2V3CC 1NN1A 3K0FB 4WA7A 1J2JA 3Q7QA 2QL6A 1YVDA 5CDFE 1XD2B 5J4KA 5SZIA 1G7TA 1KIMA 4TYPA 1S9DA 2W0SA 1JB1A 1XJ0A 3QXXA 1Z83A 5H70A 1G8FA 1TUIA 1Z0JA 1FUUA 2X8AA 5GVSA 4Q1BA 1E2LA 3QSYA 3WYAA 2GK7A 4CEHB 3P27A 4YMVA 5IDVA 1GNRA 1HUQA 2CDNA 3A58B 2R9VA 1N6PA 2FA9A 2LKCA 4IJMA 4DB4A 2IHYA 4RD0A 4M1TA 2WIAA 4HUQA 4RD6A 3BFKA 4Q1DA 1KNXA 3NEYA 3LXXA 4JL6A 4K8OA 3SU8A 2IS6A 2LWIA 3ZDQA 3MWYW 2G9NA 2P6UA 2R8RA 3KKOA 5E7JA 2Q9CA 2EFHB 3AUXA 3TJZA 3EX7C 5LD2B 5FUWA 4FCVA 3T5DA 4HAXA 4MRNA 4DCUA 3U7GA 1B23P 1P62B 2CCJA 1KI8A 5CK5A 5JJIA 4NCJA 1U8AA 1SVIA 2DYKA 4AY2A 5J5CA 4B76A 1YZTA 3OIYA 2ZI5A 3NHBA 2O8CA 1N6KA 2FNAA 2J59A 1ZRHA 5GJCA 2UVQA 4DLSA 2JLVA 3QKTA 4HAWA 1G19A 2IXFA 3KKNA 3GJ0A 4GFDA 3ADCA 1CKEA 3L0IB 4MQBA 1RE0A 1X8KA 4RZ2A 1E96A 3KB2A 3U3MA 4JVMA 4LHZA 1JR3E 2XTZA 4M21A 1LS1A 1WB9A 4Q4JB 4I4LA 4LYFA 1E9RA 3I61A 5EE3A 3WNCA 1YZUA 1OPXA 4M0LA 3FTQA 2H18A 4ERNA 4G1UC 2BEJA 1IQPA 3THYA 5LB4A 4Q01A 2PX3A 2ZE8A 2O8BA 4WVFA 1VYTA 3VR1A 3WRYC 1OYYA 3NEJA 1PUJA 1ZUIA 3U7HB 3TR5A 4JBWA 2VHUA 4RD2A 5F2EA 1T91A 4PSAA 3R9IA 1BIFA 3AP1A 2AKAB 1Z0FA 4B33A 5AJYA 1H8EA 2XB4A 2L0XA 3GLFA 4UNQA 4DT1A 4HAVA 4OKSA 2YJTD 4PSVA 3CM0A 2QENA 4J0QA 3ZLJA 1OE0A 1YR7A 3LX8A 4F4IA 1GP2A 4O3MA 1G18A 1EFCA 1KSGA 2RH5A 2RGCA 4TTQA 5F9FA 5JFGA 2AD1A 4QGGA 1QG4A 1Z2AA 3EWAA 1ZVQA 1T6NA 4OQXA 1J7KA 1KO5A 3FKSA 1BMFA 3PCRB 4C0LA 3THWB 3U60B 2RKOA 1HT2E 1MT0A 5G53C 3WP1B 5E4FA 4DCNA 1U90A 4V03A 3BH6A 4LSGA 4KFRA 4DLUA 5FR1A 1ZUHA 5JRJA 2Q6TA 4OI0A 4F4JA 2ZJ8A 2ZRIA 1II0A 4ZCMA 5JSZB 5FOUA 4N0EA 2CHVA 2GEUA 3BGWA 1ZD8A 2ZRFA 4YQFA 5LBIA 2PJRA 4RKFA 4P4SA 1M74A 2BJVA 2OLKA 5KDDA 1F3OA 2QPOA 2JIZA 4NCNA 4V02A 3HPQA 4QM6A 3W90A 1SKQA 4C2TA 2YNMA 1JEEA 3PEYA 3BS4A 1COWA 2VHCA 5JJKA 2UZ3A 3LBIA 4LJYA 4KITB 3FVQA 4LYHA 1HV8A 4KFUA 4FMDB 1C9KA 1W4BA 1N6LA 1G5PA 2DFTA 3LRPA 4FI3C 2H92A 1UKYA 1HQCA 1D9XA 5FPKA 4TT3D 1F2UA 2RMKA 4IEEA 4HB4A 4POAA 3B13B 2ODBA 4PANA 3NH9A 2ZS7A 1NVUQ 4BLTA 2J0SA 3O8CA 2MSDB 5EXXA 3QXJA 4A2QA 4M9ZA 1XZQA 3KTAB 1E9SA 3RS0A 1KO8A 4A92A 2ZSFA 5IF9A 2GF0A 2QU8A 2WAYA 3HR7A 4RCZA 3EZ9A 1ODFA 3BBPA 4A6PA 1W5TA 1WCV1 4XTCS 3TH5A 4A0RA 3KQKA 2FG5A 4RVCA 3C8UA 4XVUA 2FFQA 4DLRA 3IIMA 3WBJA 3SQWA 1E2QA 2CVHA 2ATVA 3FB4A 1NI3A 1YE8A 2AN9A 2IT1A 2V6IA 4Z54A 1S0UA 4TLEA 3JVVA 2CCGA 2PCJA 4JLMA 4MKFA 3SYKA 1KKMA 4FINA 4JIMA 3ASZA 3GQBA 1LTQA 4BFTA 1RW4A 5HR5A 3NXSA 4KU4A 3KQNA 3QEOA 3AGQA 2J7PD 3K9GA 2AX4A 4QJ4A 3EPJA 2J0UA 2QMHA 3GJ7A 2ZSDA 4NYJR 2GNOA 1X1SA 3RWMB 4B3BA 1KZ7B 2IEZA 1GDDA 4RFSA 2ZM5A 2ZAOA 3LQRA 2YINC 3TUZC 2G83A 2QPTA 1KK3A 2IC5A 2XTMA 5E7MA 3WYFA 2CXXA 4MYCA 1OFTA 2BHRA 1TL7C 4KJZA 4LJAA 2GA8A 2BMJA 5CIQA 3UMRA 4NBSA 5TVKA 1VECA 2OG2A 2ZSAA 4MKHA 3GLGA 5F3WB 2FE4A 1SXJB 4NCHA 1CP2A 1XTJA 2JLQA 2PT5A 3OEED 2JATA 3B78A 1T0HB 1S3SA 4JSYA 2OCYC 4DC9A 1ESMA 3DHWC 1KSHA 4Y0VA 5H68A 2QMEA 4FWIB 2QA5A 3A1UA 2W2TA 1NIJA 4B2PA 1FNNA 1TUEA 2JJ2D 4ZO4A 4NKRA 4BLPA 1TQ4A 4GP7A 1SGWA 2XSZD 2HF9A 3GCGA 5GJWC 2CLDX 2ZJZA 1YU9A 3K0AA 1N5LA 1X6VA 4IOKA 4QJ3A 1EFTA 2W83A 2VPPA 1XMJA 4ZV4A 5HKKA 1NVVR 4V0NA 5FBRB 3OEHA 2C5LA 2O8DA 5FOVA 3GP8A 4PPGA 1CR1A 2F43B 1VKJA 3THXA 3IHWA 3FOZA 1NLZA 3NWJA 4PQFA 5CYOA 2WMNB 4V0LA 2ZYWX 3U3JA 1IN4A 3E70C 3NDPA 4AURA 3SJCA 4AWXA 3OZXA 3BFXA 3MWKA 4ZCLA 3T61A 2QAJA 3LBNA 4JT4A 2OFOA 4XD7A 3B1YA 2IBMA 3OFND 5KUTA 1W47A 1LB1B 1QRAA 2OXCA 1R5OA 1E2IA 4RCYA 3CRVA 1SULA 1M34E 5LPNA 2HV8A 1A82A 4H9GA 3EPKA 2IYYA 4LYAA 1DAEA 4JBYA 2YOFA 1DVRA 1RRGA 3EAQA 1M6NA 2ZUBA 1E2KA 4FCTA 4MRPA 5DGXA 2FZ4A 1WXQA 3LY5A 3B60A 2IYRA 4TMXA 4W5WA 3B8HA 2F1JA 3CPHA 4R9UC 3C4JA 2JAQA 5CM9C 1W0JA 4MYUA 2AK3A 4PZYA 2IS4A 3IO5A 2WKRA 4UNSA 1Z06A 5EP4A 2ZSEA 3SN6A 2BMEA 4XTRA 2VL7A 1Q12A 1JXOA 4KYIB 2XX3A 4DJTA 2GETA 2ATXA 1GSIA 4D80A 4JJZA 2QGZA 4OHVA 1R4AA 1ZUNB 1NLYA 1NMZA 1OW3B 3C5CA 1T8TA 3AVQA 3F5FA 2O8FB 5CJPA 1F2TA 3ZD6A 4KODA 5JWHA 4AYTA 5BWMA 2ZRJA 3EA5A 3NH6A 5L3VA 2V55B 3M4YA 5AK0A 2FMXA 1AQYA 1L7VC 1WP9A 2FGKA 3KJEA 4HDCA 1E3MA 3JVUA 2OCBA 4KVAA 2VHTA 2CMKA 2V4ZA 3SI7A 1MKYA 2EWWA 1GL9B 4W5JA 5D3MB 3LD9A 4MRRA 3RC3A 2DY1A 1Q44A 1RKBA 2IYSA 2WAXA 3P32A 4UQOA 4TQUS 1G8GA 3QOFA 1Q1ZA 4PSKA 4M1YA 4NE2A 1Q20A 1H8ED 2JJ8A 4P4SB 1OFHA 2H1LA 1GKUB 4BEJA 5J4LA 3KJHA 5JLJA 1DARA 2C2HA 2V9PA 1FQJA 2ZJYA 3I32A 4TWZA 5CM8B 1Z29A 5JEEA 5KHOC 5M04A 4CEJB 3C5HA 4M1KA 4LC0A 2WTUA 2HF8A 4ZDIA 5E3HA 2YV5A 4RZ3A 1N6RA 1YJ5A 1WF3A 1R5BA 2ZUDA 4QJ5A 3GLIB 3FKSD 1BMFD 2XXAB 1CBUA 4RZXA 4OHYA 2QNRA 2J0VA 3IGFA 2GRJA 1P2SA 1QHYA 2QROA 5FFMA 5KPJA 4NDZA 1U94A 2QAGB 2ZSBA 3R8CA 2FPKA 2B7BA 4D0LB 2BWJA 5F98A 1G20E 1W48A 3NKVA 4XH9B 3U7EB 4E22A 3V9PA 1M1YE 4QBIA 3VKWA 1Q3TA 4NP6A 4RFVA 1E0KA 2PLRA 4B3CA 2QT1A 3U6BA 1GKIA 5FH9A 2JIZD 2VSOA 5J4VA 3LVQE 521PA 5DE3A 2JLZA 1JR6A 3TVDA 2QP4A 4BRWA 3NBYC 1COWD 4LHVA 1T3SA 4IKEA 5EZ5A 3V4RA 2RGAA 2W2VA 2XITA 1A2KC 3AM1A 5DHFA 2VIIA 4LBVA 1KDRA 1QHNA 3LA6A 1VG8A 1Q1EA 3RHFA 5BW8A 5SZKB 2QZ4A 5KPDA 1RYHA 1R5NA 2VP9A 2R6AA 2ZRMA 3X1YA 3PEUA 4RD4A 2GILA 5FPTA 3U61B 4TYWA 4LCBA 1W36B 1JALA 4R7ZA 2H5EA 4LHYA 2VHQA 3T12A 3BE4A 1VG1A 4XWKA 3A1VA 3HR8A 1XNJA 4C0QC 4KBFA 3VQTA 3ZVRA 2X2FA 3VNVA 4IDPA 3ND8A 3AVOA 2ZI9A 1FNMA 3D8BA 3TE6A 4EQ6A 5EP2A 4IOLA 4TQ9A 1D5CA 2ZE6A 4BFUA 3GLGB 2WHXA 1KYIA 2CJWA 3KFVA 2WKQA 1S8FA 2GJSA 1E9AA 3WBKA 1XEWY 5IRCD 3PXGA 2ZRNA 4NMMA 2CBZA 4YXWA 1TADA 1ANKA 2QSYA 1KNQA 1ZM4A 1AKYA 2ZU0C 2WVJA 1TQDA 1I4DD 1L4YA 1Q22A 4Q4JA 2H57A 3ZJYA 4WW0A 4N1AA 2Q9AA 4B75A 4B71A 4F4CA 3UWOA 4OQMA 1R8SA 1XEFA 1KK0A 2DWQA 1NKSA 1OYWA 3TIFA 3EC1A 2H8KA 3P1JA 1XD9A 2G1KA 2ANBA 1MO3A 4GMDA 3T15A 3QUSA 4FIDA 3NBFA 3T06B 1KO7A 4WZBE 4XJXA 3BOSA 3IDQA 2WWYA 1R2QA 1BO6A 3ECCA 4JLAA 1U8ZA 1UPTA 1SKYE 2OBMA 2QG6A 2VO1A 4M2LA 4Z8YA 2ZE7A 4ZKEA 4OK5A 2XB2A 3R9WA 1ZNZA 221PA 2QM7A 4LV6A 4LPSA 3KKPA 1CLUA 2FU5C 3BXZA 1G3IA 2Q9BA 2FH5B 2PEYA 4AKIA 3PG5A 4F93B 1O87A 1FQKA 2Q3FA 4Q18A 1K6MA 4DZZA 1G3RA 2NIPA 3EG5A 4OI2A 3IQWA 4PXAA 5EUQB 4KAXA 3HDTA 1A4RA 4UXHA 4L4UA 4URYR 1X8LA 1ZC4A 4PR0A 4R71A 1QHSA 2NO0A 4GRAA 4JJKA 4PZLA 4Q00A 4Q9IA 3EC2A 5UKDA 4B3GA 2ZS8A 1YR8A 5HKKD 1IY2A 3OEHD 2N1BA 5FPHA 3RDPA 5EJEA 1RIFA 2BDTA 1XPOA 3DVLA 1G4AE 2NPFA 2WZQA 4LBWA 5JSZA 2FX3A 2QUZA 3GJ3A 3AQ4A 4WXRA 4XD7D 4C30A 2EWVA 1H8HA 1IN6A 1VCNA 4LZZA 4DLZA 4B74A 2FSHA 2FPLA 4P33A 4C0KA 2EW1A 5L3QB 2PEZA 3SJZA 2NO7A 4IDQA 4TL7A 4BZQA 1AS0A 1CR0A 4BUJA 1J90A 2P3SA 3W6PA 3DL0A 4FXPA 5EXPA 4C9BA 3ICEA 3TVTA 1II8B 1OXSC 4BFYA 3LW7A 4MITA 4URZR 3ADDA 1KO1A 5FL7A 1E94E 1D9ZA 1SHZA 4ESHA 2ODWA 1DS6A 1R7RA 1U0JA 1E9EA 2C96A 2G88A 4DIDA 2VP6A 3FFBA 1P2UA 4HAUA 3PUYA 3U6KA 3QENA 5KYKA 3VHXA 1DO0A 2V1XA 1WBDA 2W6JA 1W0JD 3AUYA 4LGMA 5JI2E 2D74A 4D81A 3KQHA 1NY6A 3BC1A 3TKLA 4D26A 4DDVA 4Q5IA 1ZM2A 2OAQ1 2NOAA 4QHSA 2HUPA 3KTAA 1SXJC 1X8JA 1P5ZB 2A78A 3AVTA 5TDHA 4PAQA 2QI9C 2V8OA 2VP0A 4X8HA 1NVWQ 3NC1C 3QVVA 3CZPA 3DM9B 5CJ2A 1AKEA 1ZNXA 5JBQA 1ZINA 4L8GA 4DLTA 2PZGA 2FJUA 3ZQ6A 3EWSA 1GTVA 1W2HA 3PFIA 3TW4A 1N6IA 1R10A 4QGAA 1R8QA 1UJ2A 2J9RA 4DCSA 4LJ7A 2ECKA 3CF0A 4LWZA 4EKDA 1KHTA 1MABA 2AHOA 1VTKA 3WNBA 2IYUA 4CZ2A 1N5JA 2HEIA 4AYXA 1XPUA 3PUXA 1E0SA 5BN3A 1M8PA 621PA 4A36A 4HYYA 4OQFA 3KXLA 2QY9A 2RGXA 4MKIA 2XTNA 2RB4A 3FWYA 1P73A 5JWRA 4FD2A 3RLFA 3A6PC 3BERA 4AYWA 1RVDA 1KI2A 4TYNA 4A0HA 3W3ZB 5FTJA 1W1WA 2Q3MA 3X1ZA 1CJMA 2XZOA 2C9CA 4MGIR 1Q21A 3B9QA 4JLPA 5FOWA 1P2TA 1S9HA 1SVLA 1SXJA 4OK3A 4ZIRA 2GVDC 4AG6A 4C0JA 1UF9A 1FMJA 3CKLA 4O2LA 2MSEB 3QBVA 4B3FX 4DBLC 2OV2A 4XWAA 1DTSA 2ASEA 3U44B 5HCIA 3IHLA 2P65A 4GT1A 3L2OB 1OIWA 2OILA 3Q9LA 4KO8A 4M1WA 4EQ6B 1MRNA 2XEXA 3HYTA 2GF9A 4BPBA 3LW8A 5JHGB 2IHBA 2CJWB 3ZYCA 2JEOA 3CUEF 3H0KA 4D4KA 3JZAA 4DLYA 1R0WA 3BK7A 4L9WA 3KDSE 2NTYC 2F43A 1EFHA 1IJFA 1CF4A 1ZCBA 5J4YA 4NYIQ 4QG7A 4E5UA 4N0DA 3DZ8A 1IN5A 3JZMA 3RYTC 3HYRA 1KSJA 4I1SA 1VMAA 5A0FA 3K1JA 2HDNB 2CVFA 1TEXA 2O5VA 1FL9A 1QVRA 4D2IA 4OHZA 1XWIA 3C16C 4M9XA 4FN5A 4QHTA 4PPQA 4AKEA 1NMXA 4FMCB 4ITRC 4Q1CA 1JPNA 1XPRA 4TL8A 1KDTA 1T4GA 2IYXA 3HJNA 4OL0A 2WJVA 3CH4B 4M9SA 3AF1A 1F5NA 3CRMA 4HB0A 2A5DA 4DXAA 2CLSA 3A4NA 2G1JA 3ZQJA 5J47A 4ZDKA 4BFXA 5CB8A 1E2FA 1OSNA 1WBBA 1ZM3A 1HQYE 4KFSA 2RGEA 2ZI6A 3A36A 3TR0A 5ELXA 4ESVA 3X2SA 2QGNA 3BD9A 4B35A 2REXB 5C2JB 1FPMA 4LX0A 1T3LA 2EYQA 5G40A 2QTHA 4W9MC 4YXWD 1A7JA 2Z5FA 4OYHA 5KSYA 1A1VA 2A30A 4NCIA 3R20A 2OESA 1O3YA 1Z2CA 3C41J 721PA 2QSZA 4EIWA 3O8RA 1WRBA 4R98A 2QAGC 1VIAA 1WE2A 2O8FA 1PZNA 2JASA 2BBTA 1MR3F 2V54A 3LBHA 1N25A 2J1LA 2WJIA 4L16A 4PAOA 1TTTA 1OLOA 1GAJA 4DUGA 2E9SA 5A4JA 4G5RA 5EE0A 1EFRA 2O0HA 5GVRA 2D3WA 3U7FB 1F60A 3BB4A 5D3MA 3LNCA 3QKSB 4ABYA 4EPRA 2W6IA 3KL4A 4QFMA 5DISB 3E2IA 5CIWA 3PEWA 1XXHE 2VBCA 3QXSA 2ZU6A 5KNBA 2V7QA 1KOFA 2HXYA 3DZDA 1ELOA 3X1XA 4B43A 2RCNA 3PJRA 3E1SA 1QHIA 1P72A 1IXZA 5E7IA 5FPYA 5DNYB 4FW9A 3WMEA 4CEJA 1XU4A 4A2WA 1US8A 2WIBA 1XCPA 1KY2A 2OAP1 2QRNA 1Z8FA 2YWHA 3QI2A 3CF2A 1KI4A 1QDEA 1JQJC 4A8JB 2WSSA 2F9LA 1TX4B 3DO6A 4G5OA 3HU2A 1EGAA 2XNDA 3K53A 4G5QA 2H17A 3U3RA 1W7AA 4IXNA 1AN0A 3K70B 4WZAE 3GLIA 3EZ6A 2FPMA 2XXAA 3AKCA 2WJYA 3T35A 1IY0A 3OIWA 2QT0A 2ZRPA 3I1FA 4URVR 4FCWA 4Q9LA 2BIFA 3O47A 1NN3A 1EWRA 3SHFA 2XZLA 2QAGA 1P61B 3MLEA 2YZ2A 2BCGY 2R65A 1R0ZA 2F3TA 3FMFA 1KI9A 1ONBA 1H8HD 1D2EA 4LJ4A 5JJLA 1Z6TA 3ZZUA 1N6NA 3MAAC 4GSYA 2IWRA 5CITA 1LNZA 2B6HA 2GJ9A 2O0JA 1G9XA 2IEYA 1W2GA 2BEKA 4TMZA 2ZJ2A 2ZR7A 5EXSA 3T34A 4BASA 1PV4A 3UIEA 5DYIA 1ZAKA 1N0UA 1J8MF 5FL7D 1MABB 1YQTA 1XTQA 2ZR0A 5JI3E 4GBMA 2ZJAA 4RSGA 3W3AA 4MRSA 3QF7A 2PMKA 3VU9B 1ZM9A 3LVRE 1EG7A 5K8IA 2ZRAA 4Q48A 2C03A 2EU8A 5IHPA 3FPAA 2YKGA 3SOPA 2W6JD 1NVXQ 2R6GA 1DAHA 4NH0A 5KNCA 1E9FA 2KBFA 4KBGA 1Y63A 4XVRA 1SVKA 1P9WA 4JLJA 1HTWA 3IILA 2CHGA 5FUYA 1VG0B 1CJUC 1XFAA 1M7GA 1N6OA 3B2EA 3OAAA 4KSBA 1TF7A 1NBMA 1RYFA 3CF6R 4EPXA 5EZ6B 1TU4A 1ZCAA 4G5GA 4NTZA 3UANA 2C8VA 4PO9A 3VAAA 1LV7A 1KMQA 1UKZA 5FPSA 3ASYA 1JBKA 4QNMA 2YC4C 2W00A 1EESA 5L3RA 3OF5A 2JLWA 2BC9A 1N6HA 2JGNA 4PC3A 4ZIRB 5CDFA 3QKUA 4HLDA 2HXSA 3VTKA 1E2GA 2VP5A 3SS8A 3WNDA 5EUMA 4M53A 3WXMA 1NF3A 2CNWD 4QOSA 2ZS9A 3HU3A 4PFSA 4BFSA 3VR2A 2KSQA 3DMNA 1TF2A 1XTKA 5HPYB 3GEEA 4N3NA 4IFBA 3SYLA 3OHMA 3KKMA 4LI0A 1V5WA 3SE0A 4UNRA 2NGRA 3SNHA 1VG9B 3GMTA 1DG3A 1VCMA 3FKQA 3L0OA 1Z0AA 3DOFA 4CDGA 1MO5A 4JYBA 5BN5A 3ZZTA 4AKHA 2KE5A 3ND9A 1T5LA 2GDJA 1GL7A 4JSTA 4L15A 5SZJA 3ZIAA 1QHGA 4PPFA 1HURA 2ORVA 3GFOA 3D3QA 5KU1A 1W4CA 2GJKA 3LXRA 3VR6A 1QZXA 1SXJD 1OFIA 2A5GA 1CRQA 2ORWA 3EASA 3FHCB 5AJWA 1NL3A 5HCNA 1NG1A 1I4LD 2GWHA 3QIAA 3UMSA 1RFLA 1JXMA 3TAHA 3I62A 1GNPA 2VF8A 3BWDD 1G64A 1AA9A 2I3BA 4UJ5A 1ZM7A 4GMXA 1FZQA 2RAPA 3RS4A 2FSIA 1ZNYA 4EPWA 1PLKA 4PHGA 3W8RA 1F6BA 3VFDA 2JLSA 4B2LA 2C98A 1SVMA 3AP3A 4EFNA 1JR3A 3H86A 1G4UR 4XSGA 2GAOA 3CPEA 1PUIA 4GNKA 5TY0A 1BKDR 1ZC3A 1Q1QA 3FGNA 3H1TA 3NG1A 5KO2A 2JJ1A 3I73A 2ZANA 4GZLA 2C78A 3GJ4A 4OQNA 5AJVB 3T1VA 4A0GA 2RGDA 1OH7A 1D2NA 1NN5A 1OH6A 3CONA 3CLVA 4CEIA 1D8TA 1ZJ6A 1MO4A 1X3SA 4TTRA 3ICQB 3U5ZB 1FUKA 3K09C 3KQLA 4DDTA 1OIVA 4GPTA 3EW9A 2ZVPX 1WA5A 3EXAA 3R8FA 5GJBA 3AH8A 4NYMQ 5JRZA 2D4HA 2XZPA 4ZDWA 4E09A 3QPWA 5L3QA 3CR8A 1D2MA 4KLNA 2R6DA 4MGYR 1II8A 4V0MA 3FMOB 2PT7A 3U3KA 4MYHA 3R9XA 4KFTA 3I5YA 1RRCA 1KO4A 1EXMA 1AK2A 1IHUA 4Q9JA 3WRXC 4MUAA 4BGDA 4XVQA 3VHLB 4NHOA 4CW7A 2GTPA 5L8VA 4HLQB 2ZR9A 4Z8XA 2V6JA 3HPRA 4FMBB 3KKQA 3RS2A 2QORA 4IRUB 4C0AC 1KMHB 2HLDA 3ADBA 4DKXA 1MV5A 3T1TA 2GXSA 4A6XA 1P3JA 3IO3A 3TSWA 3IEUA 1E2DA 2JA1A 4MGKR 2ZAMA 4UXJA 1US8B 2FFAA 821PA 4HDOB 1YKSA 2C9OA 3UXMA 1IY1A 1UDXA 5FR2A 4D4MA 4RZUA 5HE8A 1U8YA 2FGJA 3FFAA 1G3MA 1G3QA 4ARZA 3CRRA 3KJIA 2Z0MA 2IYWA 3W6NA 4PQRA 3GPLA 3FE2A 3SBDA 4B47A 4DUGD 2XOKA 3N5CA 4H1UA 2WOJA 3B1XA 3Q3JB 1EFRD 3K09A 4UKDA 1NNEA 3EZFA 4EJSB 1FX0A 1CU1A 2ZPTX 2RGNC 3KZ1E 4EPTA 3RC8A 2ZQ5A 5DIFA 5EQTA 1YZGA 1J8YF 3SFZA 4TLBA 2OFXA 5AJXA 4DDWA 2YVUA 3LLMA 4ACAA 1K8RA 4BLOA 4PQYA 3QPVA 4JKIA 4BZPA 1AS2A 4CT4B 1G1MA 2BOVA 1G21E 1YZLA 2CE2X 4KXFB 3SFVA 1JEDA 4BE7B 2AK2A 1OKKA 2X77A 3CBQA 4Q02A 5JMTA 4Q4HB 1DAKA 2ZROA 1IN8A 3LWNA 5GADl 2QP9X 3QKRB 4G0NA 1TNDA 1UEJA 2B7CA 2WSSD 3EZ7A 1M2OB 2XNDD 3L0PA 4W5HA 2JLYA 2UZIR 3RRMA 3N2EA 4P4UA 3ADKA 5K8LA 3IIJA 4WOPA 3CB4A 2P0EA 1SXJE 1Z22A 5KSPA 1U0LA 1ZD1A 2R44A 3PVSA 3A1SA 4M1MA 4C0SA 2DWPA 4YMTA 2BM1A 4B44A 1NJGA 4WXPA 2ONKA 1VYUA 2XJ4A 1U81A 4K46A 4AK9A 1UKEA 4G01B 5DLQC 1G41A 4OHWA 4KSCA 4RKEA 4B3XA 1XJCA 4CRWB 1HEIA 3U44A 2YHSA 2VP2A 2A9KA 5GJVC 2JLXA 4DEYA 1M7HA 2E1RA 2F6RA 2O52A 4DB2A 4LHXA 1UM8A 1XMIA 3O8DA 3GLHB 4WBSA 2VHJA 4TLDA 4IXMA 2RGNA 5DN6A 3VKGA 2ZRCA 3ZVNA 3RAPR 1UFQA 4ZI3A 1S1CA 3MWJA 5FBVB 2ZJ5A 1WDTA 2O8EA 2NPIA 2GESA 1DADA 3IPYA 3QG5A 4Q7JB 1JPJA 2NZJA 1VHLA 4ACBA 2Z83A 1W5SA 1HY3A 2G0NA 1GG2A 3SR0A 3AVVA 3HU1A 4ZI2A 2QMOA 2WPDA 3GEHA 1S3GA 1P4SA 3REFA 4MDEA 3SQXA 4YDHB 2QTVB 1VDZA 3MJRA 4XOIA 1W36D 5TARA 1JECA 1P60A 4KYUA 3RSLA 3IBGA 4NCKA 2A7QA 3OAAD 3K0EA 2J0QA 5JHHB 1G8HA 4OJKA 1NBMD 1LF0A 1E1QA 4QBHA 5DI3B 4D4LA 2BM0A 2YOHA 4KI0A 2H7VA 2PBRA 2B21A 5C46F 4F91B 4UNPA 3QG1A 2QEQA 3AKDA 1HH4A 4QGFA 5DSZA 5G3ZA 1EX7A 2DBYA 2WJJA 4Q9HA 3QQ5A 4C0BA 3L0SA 4QKQA 3RNLA 4P3YA 4IVQA 1XP8A 3Q5DA 4DVGA 1NRJB 4WZ6A 4A8JC 3P26A 5F9HA 2IW3A 4MRVA 5FTLA 3OIVA 2RGGA 3TAUA 3GLFE 2WM9B 3TBKA 2QQEA 1AS3A 2B8TA 3MMPA 4US2R 3K70C 4YMWA 3D6TB 1BYIA 2DFNA 1WMSA 2PZFA 1N0VC 3S1AB 1IXSB 2Z4RA 2C95A 3FHOA 4TSFA 1QG2A 4PZZA 5C1BA 1DE0A 1ZNWA 3A1TA 4C4PA 1P9RA 3MG9A 4OI4A 1U98A 4PC6A 1DAGA 1NP6A 3TNFA 4I99A 4G3XA 4Q1AA 1LVGA 3NC0C 1JAIA 3ZD7A 1BH2A 2HYDA 4LY6A 2D06A 2ZTSA 2BMFA 3ZIAD 2VP4A 4OJQA 2EQBA 4ON9A 4Q03A 1KGDA 3QKSA 1HT1E 4AC9A 5HZHA 2GCNA 4LC1A 2ORIA 2ZI7A 3REGA 1OFUX 4CEIB 4MGZR 1E2EA 3UPUA 2ZI3A 2DB3A 1GFIA 1JJVA 3MCAA 5KNDA 1N5IA 3CNNA 1UKVY 4JLVA 4QBFA 2BBWA 1C1YA 2WJGA 3A4MA 2GXUA 2NG1A 1FP7A 3QBTA 4OI1A 3B1VA 4C7OA 5KSZA 4D0NA 3IEVA 1KJZA 1IXRC 3SDZA 1LFDB 2CE7A 2JLRA 5AUNB 2R62A 3IPXA 3QY0A 4M1OA 2ZXUA 5JCPA 4MUBA 2F55A 2OCAA 3RVBA 1Z47A 1GITA 4A8JA 2PX0A 1PVOA 3SHWA 1G7CA 1JR3D 3WMGA 3QF4B 3VR5A 3I8XA 1W4RA 1TMKA 3UG6A 5KTYA 5DYGA 3RSOA 2PZEA 3BORA 3ONWA 3WMFA 2JJ1D 3RS3A 1KI3A 2DCUA 5BYKA 3TLXA 4HI0E 2BV3A 2IWHA 4IOMA 3QXCA 4UXIA 3CPJB 5KOYA 3KQUA 3B82A 2OBLA 1NY5A 3I4LA 5FUXA 1IOZA 1UDWA 4JLDA 2ZITA 1GL6A 2YC2C 4LJ6A 5BN4A 2OFWA 4QNRA 3NVAA 3ZGXA 4S35A 2QP3A 1OXXK 2P67A 2C77A 3C15C 1SZPA 1ZW6A 3PUVA 1W44A 4ARZB 5JECA 3KUCA 5L3SB 3FMPB 2F1HA 4TTPA 2P6RA 5EP1A 4H1VA 4L5BA 3DOEA 1CJKC 4A0FA 2R6FA 1ZU4A 3SYNA 4CF7A 1KK2A 1FX0B 3BB1A 3I8SA 4DLXA 2G77B 1Z08A 2GAAA 1DAIA 1T9HA 3OIUA 5AR1A 2FWRA 3CR7A 5IK2A 4ZDJA 2EFDB 1QVAA 2NZ8A 1T8UA 3C7KA 4IDHA 4NYJQ 4XSHA 3VU9A 4I81A 1DPFA 2IA5A 4JBXA 3MFYA 4AG5A 1SHKA 2HLDD 1KTVA 1ZBDA 4JMPA 1OXUA 4KHZA 1IJEA 2IYZA 3T5GA 4C3ZA 3BH0A 3EARA 2X1VA 4GOKA 4GOJA 5CLLA 4GZMA 2GZAA 1RPZA 2GJ8A 1BOFA 2D62A 5K8UA 2QN6A 4PHTA 4KVGA 1K5DA 3W5IA 1KAGA 4Q19A 2ZE5A 4S2EA 3GLGE 4U02A 5FOTA 1AQUA 5HZKA 2XOKD 2ZRDA 1J99A 2IS2A 3LDAA 4II7A 2IF0A 2ZRGA 4QRHA 2WOOA 1XTIA 3FMIA 3P4YA 1QHXA 2ZVQX 2FSFA 2PL3A 1KDPA 3X1DA 4BLSA 3OE7A 4HDQB 1TPZA 1UEIA 1P6XA 4DCTA 4FMDF 3AF2A 3GJ5A 1XZPA 2B92A 3IIKA 2GCOB 3AVPA 4HZIA 3L8ZA 4D6PA 3K9HA 4OQLA 1A5TA 3OFNA 3NBZC 3CW2A 3PUWA 1NVVQ 3VX4A 6Q21A 2AKYA 4JT2A 5CB6A 2VLIA 1GM5A 1E2MA 1MRSA 1OKKD 5FBQB 3RRZA 2O8EB 1Q3HA 5C4GB 3SBEA 3A37A 1YZQA 2ODNA 2ZETA 4B73A 2XNSA 3UMFA 1SVOA 2F7SA 3IUYA 1TQ2A 4YLGA 3BB3A 2QMUA 2KWIA 1OF1A 2OO7A 1YRAA 1LY1A 1MO6A 3CZQA 1GZSA 2VEDA 1EK0A 4WAUA 4LJ5A 3D31A 2QBYB 1IBRA 3QPUA 4A9AA 2WMOB 1NSTA 2GHIA 1Z6YA 5FBLB 1E98A 1G5TA 4JLKA 4Q4LA 4EUNA 1SQ5A 5H1YA 3MSXA 3X1WA 1DAMA 1OIXA 2VRWA 5BXQC 4EDHA 3KJGA 4YONB 4IDOA 5HE9A 4XIGS 4AIIA 2RGBA 1E2JA 2FEOA 4I1OA 4TMTA 5JEDA 3KX2A 3LAWA 4HSEA 3RANA 2VSFA 3BFVA 1UBCA 4URUR 4HZUA 4IFEA 5DN6D 2N46A 2N42A 1E0JA 3LFUA 5FBWB 4X8MA 3AKYA 2F1IA 2FFHA 4OK6A 1R0YA 1KI1A 1FFHA 1ZIOA 5CK4A 1T0JB 3PUZA 2G3YA 3PR1A 3HWSA 1BYUA 3Q8XB 2FOLA 1UADA 4EPYA 4K81B 1TQ6A 2WPDD 4JYCA 3U4QB 1P2VA 1Z6XA 1CS4C 2ZREA 4JKYA 4ZKDA 4C0HA 4P32A 5KSOA 1E69A 3KXKA 4EJSC 4PO8A 1W4AA 4Q4AB 2IUUA 3W6OA 1DELA 2AFHE 2QTFA 1I2DA 4CGZA 2EFCB 3U2QA 4NL4H 4V0ME 1E1QD 3AB3A 4M8NE 2TMKA 4Q9KA 1XMVA 2IX3A 2REOA 3B9PA 2GZHA 4M22A 3KB1A 4QGHA 3N70A 4IOJA 4FWTA 2BVNA 1W0KA 4PAMA 1II9A 2HJVA 4UJ3A 2AXPA 4QHYA 4URWR 3CNLA 2VSXA 2P6NA 2EVWX 4P31A 2JCSA 4JL5A 5AUQA 4OHXA 3P20A 1KMHA 1GOTA 5J40A 4A2PA 1W49A 4C7OB 1NIPA 3I92A 1G8PA 1GUAA 2BMDA 1G16A 4JVLA 4US0R 3AEZA 3EPHA 2J3EA 4HB2A 1OHHA 4TSFD 5EE5B 4US1R 3EPLA 2GXAA 1QHHB 3CO5A 1QF9A 5FTKA 3I5XA 3BJIC 1G5RA 5G3YA 2BKUA 1GIAA 3M0EA 5B58C 1DG1G 3DDCA 2BJWA 4LV8B 4PTLA 3IKJA 4TMWA 4B6FA 5FL3A 3G0HA 3Q72A 2ERXA 1E99A 1H65A 2VA8A 4ASUA 2IXEA 3N2IA 3QXHA 2R6CA 4TN1A 2IK8A 4EJSA 4IVPA 2FF7A 1E1RA 2GCPA 1CTQA 3Q85A 1JQLB 2WWXA 2C99A 4V0KA 4B32A 5J4HA 2XGJA 1TF5A 4JZKA 4DSTA 4TL6A 3AKEA 1KI6B 3L8YA 1XCMA 5TB5A 4RD3A 4YC7A 2OSBA 3EA0A 4O25A 4PHFA 5FTNA 4TMVA 5JWOA 1GILA 2Q0HA 3PEVA 4BLQA 4YMUA 4Q4HA 4XWOA 3LX5A 3P4XA 3CX8A 3QKRA 3K8YA 3L43A 1YR9A 1S96A 1L4UA 1XRJA 1IN7A 1YZKA 3E5HA 4QC2A 5DHAA 3SC3A 4BFWA 5EE1A 4D0GA 1E4YA 1FOEB 3K70D 2HT1A 3CWQA 2K5UA 4HAYA 2IYQA 3BRWD 1KK1A 1XMSA 3A8TA 1TU3A 3ZVMA 2GEVA 1NJFA 1CJVC 3CRW1 4PHHA 4EFMA 2CEAA 1OB5A 4AKGA 1YRBA 1BS1A 1E2NA 2I1VB 421PA 1E79A 2WJHA 1XJQA 3WY9A 1N2CE 3TQCA 1Z3IX 1P7CA 3C14C 1JI0A 1VYVA 1ZD9A 2J87A 3CNOA 1G3UA 1RJ9B 2J45A 1N3BA 2QPAA 4E07A 2PCLA 2CLCX 3GLHA 2OE2A 3L82B 2DWOA 1T3HA 3D7MA 3R7WA 4NONA 3M1IA 4QL3A 3AVWA 3KXIA 1EFUA 4GDFA 3ZVLA 1NN0A 1E0AA 4CYMA 4M1SA 4RD1A 2BCJQ 5CLQA 1ZU5A 2Q3HA 1SVWA 4BEBA 4DRZA 2G0TA 5IK2D 3MD0A 2AFIE 2FV8A 1AIPA 4MH0R 5AJZA 3V4FA 4C2UA 1PLLA 4IHQA 4YDSA 1Z0IA 2ERYA 1Z28A 2J7KA 4NPHA 3FYHA 2VYFA 1NG9A 4R2IA 3GEIA 4F92B 1XEXA 4HLUC 4LHWA 2AR7A 2EFGA 2O0KA 2CL6X 4HUQB 1PLJA 4IEIA 1W46A 2C04A 3K9LA 3RS5A 5LDDC 1G8YA 3UKDA 3A4LA 4X8OA 5DI3A 3MJHA 5LB2A 1XB2A 4HLCA 2MMCA 1XX6A 1E9BA 1LW7A 2CCKA 4TLCA 4HAZA 2MMGA 3ZH9B 1U9IC 1AM4D 1AJEA 4LJ9A 4TLAA 2CK3A 3HP1A 3MRSA 4X8LA 5EXTA 1CJTC 3CX6A 3TW8B 5FUVA 4MDFA 2GK6A 1GRRA 2W2XA 1X1RA 1FP6A 2WV9A 4LV5B 5ANRB 1E4VA 2O8CB 3BH7A 2GJAA 2WWIA 3TUIC 5K8TA 4TYYA 3CX7A 5DH9A 3OE7D 3DMDA 3S1AA 2ZRBA 2ZUCA 2D7CA 4HEJA 1KI7A 1Z5ZA 4NU0A 2WICA 5D3QA 2DPXA 4DSUA 4B2IA 4NYIR 1E9CA 5KDOA 4HZUB 2YWFA 2ZI4A 3AF4A 3W8NA 2F1RA 3J81k 1EX6A 2OBNA 3ETLA 3UWKA 5JS7A 3K0SA 1E32A 2A2ZA 4RJLA 2NO6A 5G41A 2W0MA 1HE8B 5TMPA 4O0MA 3THYB 1TAGA 4O2RA 3H4MA 2RHMA 2O8BB 4V0OA 1GRQA 1NSFA 2XAUA 4D82A 4OBEA 1G7RA 1NKTA 3MUFA 4HLUA 5B64A 4QXAA 1HYQA 4B3DA 3TQFA 1SKYB 2IS1A 5DI9A 2NO1A 2AWOA 1F48A 2IL1A 3NTUA 3DM5A 4DLWA 4D4JA 2D2EA 1AGPA 2D7DA 1U9IA 1V43A 2NO9A 1LF5A 4JLOA 3H84A 1CR2A 3QVUA 3CWZA 3TMKA 3GLFB 5FTMA 2H16A 2OEPA 4DT1B 2Y8EA 4Z1MA 2ZRLA 1XEWX 4JVNA 3AVXA 4JL8A 2ZJBA 4TZ0A 2Z6VA 1Z07A 2HT6A 2G6BA 3QF4A 2FFBA 3W9YA 4KLZA 2IF2A 4ZPXA 1W36C 3CIOA 3KFXA 2IYLD 3NHAA 4DDUA 2YOGA 2DHRA 5FOSA 3GJXC 1S4QA 3RRNA 3BIFA 3QEJA 2ONJA 3AF3A 2GEDA 1OH5A 3CH5A 2PLFA 2JDIA 3MGCA 1QBKC 2WKPA 1N5KA 1KJWA 3H2YA 3SEAA 4Q7MB 2HCBA 3SZRA 1S1MA 3DKVA 3B1WA 5C4MA 4D25A 3VR4A 2WWFA 1XXHA 5L3SA 2QE7A 1FW6A 1OXVA 4Q7KA 3LLUA 4Y0AA 1VCOA 2QRZA 4LPKA 3RRYA
chains in the Genus database with same CATH superfamily
2QZJA 3DTVD 4LOAA 2HK9A 2VI5A 2X2EA 2EFYA 4E88A 3TB4A 1T0PA 2BKVA 4FX2A 4D41A 1IZYA 2FSGA 3TRFA 3F7OA 1IONA 2AJLI 2C54A 2OZEA 5H80A 4HH3C 2WY2D 2RE8A 1JNYA 1NVTA 3ZQUA 2F8MA 1Z73A 2YZ7A 1ATIA 4I3FA 1F2UB 2BUAA 3QUTA 3NDBB 1U3DA 1K9VF 2YIDA 3C5VA 1TIBA 1GUBA 2V7QD 1L4HA 3EISA 3GFTA 4LEIA 3F9CA 1A2BA 4JP1A 3ROEA 2H2GA 3WQHA 1PK8A 5BMVF 3DAOA 4HEA6 4YUXA 3HBNA 1E2HA 1HI9A 2KJQA 4FYJA 4LZNA 4P0TA 4PTZA 5J2TF 4QG3A 2V1UA 5LD2C 4LDJA 4RQAA 2V9CA 4P53A 4B48A 4D8YA 5CLJA 1Z6AA 2QSJA 2C4WA 3IELA 4HXYA 4B7ZA 5JXGA 4YQYA 5EEHA 5BV7A 5ICGA 4EF6A 4BLRA 4IGAA 1JIXA 4X1KB 2IUTA 3TTXA 3LS2A 4PBSA 3Q7PA 4ISCA 3KEMA 4LDNA 1K89A 2ZUTA 2NP6A 2ZSJA 3K32A 1B6GA 4FYIA 3W34A 4A6DA 1DJQA 4K2AA 3U4GA 1G6HA 1O6CA 4GR4A 1OILA 2DBZA 4GOXA 3THOA 4DC0A 5JS6A 3C3XA 2PKQP 3EVEA 2XKBA 1JHXA 3V2UA 4C76A 4JLWA 2NW6A 4NLLA 4WERA 1E1RD 2ATIA 5SZHB 1ETUA 2OYSA 2IDMA 3SSNA 3TQTA 5LL6P 1V26A 3NEAA 1O96A 3VX3A 1T8YA 1IHDA 2WWHA 2ATCA 2PL1A 5JZBA 2OV3A 4J7XA 5LC1A 3S29A 4EGSA 1HT3A 3NHMA 3WMWA 4RQTA 4RMJA 3ZBQA 2AN4A 2WYWA 1UZNA 2ZJFA 3H5TA 4G84A 3VC1A 4P4TA 4AJ1A 2VWHA 3QUBA 3ETNA 1YFJA 2VQSA 4X0EA 4LDQA 5EIBD 3IUQA 5DTIA 5JW6A 1ZIPA 3QHAA 3EXEB 2OUKA 5KQPA 1GGNA 3L0ZA 3O8QA 4PBRA 1LS6A 5CVTA 1YBMA 2UKDA 5BYJA 2J46A 3F3YA 3HZZA 1CULC 4FFDA 5ALUA 1PKEA 1HSOA 1H0RA 3C98A 5DBOA 4OBBA 2TECE 2GN9A 3GRPA 2WIGA 4HGOA 1VQ1A 1FDSA 3HYSA 3PSHA 4IG9A 4OQQA 2PD4A 3H6GA 1DOAA 3M6LA 1DTEA 3ZBUA 1G2PA 4BFZA 4AJEA 5BQ5A 1SIUA 4C20A 4CLOA 4PNZA 5B1SA 2HWWA 1Y9DA 1QG6A 2J5KA 3BD8A 3QITA 1J42A 3S27A 3W5HA 3YASA 3U9SA 1FC0A 1UMKA 121PA 1RADA 1ZD5A 4XA8A 4BQQA 4U7HA 3NUZA 2ODEA 4RY8A 1PFGA 1OJLA 3SIWA 1VBKA 4RS3A 1WABA 2SHKA 3FTFA 3RAJA 4K9PA 4H6PA 3U7QA 5DNVA 2GZMA 4ZQEA 1CZLA 3AUFA 2P4UA 3GG2A 2GBLC 2AL7A 2QN2A 3GD7A 1YH3A 4G65A 2BBSA 1GCUA 2FWIA 4TKUB 2NTVA 1KJYA 1NATA 2WUEA 1Y82A 1NTOA 2ADOA 3I9KA 4UOEA 4ZVSA 4DIEA 3A6GA 1OV4A 5ESXA 1T5HX 3KBBA 1OGIA 3K0AB 4DV7B 1EVJA 3A05A 1XCGB 2WFMA 3B6EA 1XELA 4CM8B 2Z3VA 1LPAB 4GBED 4BZXA 1JU4A 2PXXA 3I83A 4I1VA 1PJBA 1PR5A 2NPOA 3EHDA 4IDFA 3RJ9A 3SZGA 3KO8A 3QMWA 4CHTA 2Y0DA 3DBLA 3OPYA 5DT2A 1MZVA 2DR3A 5SV2A 4E08A 3LO5A 1EFPA 3PQ5A 1T4CA 3HZOA 2K87A 4RXTA 3WB2A 5IT5A 2GZ2A 1BHO1 4FQ7A 3AR9A 4LXQA 2QW8A 3I09A 5B57C 1A71A 1C7IA 1BEUB 5FI0B 3CB2A 4B34A 3URKA 3OY2A 1FDUA 4BNMA 1NQ5A 1S2NA 4KGXA 2J0EA 1DRJA 2IPLA 1XGKA 3LX4A 3LV8A 2I4IA 5AI0A 2ZEJA 5KVAA 2QNIA 1DNPA 1EUQA 2I67A 1PNOA 2J41A 1XXLA 4EFLA 4GWGA 1TJ3A 5KTPA 1WL8A 2M2IA 1E9VA 2EJUA 2YJ4A 3AFIA 4KKVA 4JLBA 3ROKA 1P44A 4LYJA 4AUKA 4I0WB 4J7CA 2CVOA 3R7LA 1G17A 4MA4A 1SC9A 3OBBA 4QARA 1NF9A 3O8OA 4ZT5A 1O9HA 1ZD3A 4IWYA 4URXR 2AWNA 4YX9A 2A5YB 2XJ9A 3BA1A 5JH7F 2RAFA 5LZ2A 2FW1A 3R77A 2GBLA 4FEAA 4BP9A 4G5SA 2OPHA 1CRWG 2ZAGA 1GNQA 1VI2A 4LXYA 4DR6B 2PN1A 4JLNA 1L6IA 2C9BA 2HDWA 3R0JA 4ZARA 5G4KA 1H69A 2ZRKA 3ZPXA 1MOZA 2VK1A 3EQ2A 4W5TA 4KV9A 1S2GA 2BTOA 4GYYA 1QHHA 2C1EA 2O5RA 4F1WA 5EYPA 5CFPA 1GGKA 5CDYA 1B8PA 2QUKA 1WOMA 1VCHA 1E3WB 3AI2A 3ZS9A 4DY6A 3ZXUB 5I8WA 2FOIA 3LZDA 3OZWA 4GLLA 2VF2A 3RW9A 4JYPA 2XB8A 5FULA 4EVQA 1GV1A 4YAWA 3UUGA 4DJJA 5A3SA 3MWLA 1U99A 3D0KA 3NOQA 5EIHA 4K6CA 2Q21A 3EFOB 3UB2A 1Z0KA 5A6SB 3CRQA 3DKPA 2VYVA 5EE9A 3NC4A 3AM5A 3IBYA 1O6FA 1W4LA 2XF2A 1Z63A 4NENB 4CU5A 3OT1B 4X54A 1Y1SA 4A7PA 3SWWA 1CY1A 2ZBVA 3VDNB 1Y9JA 2FUCA 2IU4A 3VJMA 1SA0B 1YAHA 3B5EA 1Y8ZA 4YMIA 1QJCA 1XXHB 3TLEA 3LUHA 1QLJA 1RRPA 3QV1A 3G82C 3U3OA 1ZG3A 1JA1A 4LYGA 4QDXA 3NTVA 3CQ9A 3LUBA 2OBXA 3PPYA 2YXNA 2Z3ZA 1L4GA 1WKBA 3QEMB 3B85A 3E9YA 2QZPA 4G25A 2HJHA 4AIRA 3F0TA 2VTBA 4E46A 4F2WA 1Z0DA 3CMMA 3TK1A 3S40A 2X3FA 3JQAD 1KKLA 3QTTA 2DKNA 3A6LA 4PIPA 3SICE 3UG7A 1Q0UA 1QHEA 5JD5A 3C3WA 1ZO8A 3AF5A 3TQQA 1Y1TA 2HEGA 4LBYA 2XTJA 3PIRA 4GVPA 3VXKA 3IURA 1OTXA 3NHFA 1QZZA 3DAHA 4WZAB 2VYNA 4TL9A 3T5BA 1SCDA 5CNIA 2VH5R 2QR2A 2R97A 4R9RA 4FNAA 1K5GA 2Z6UA 1CEQA 1ZH2A 3H42B 4C6SA 2RHDA 4IXTA 2OT3B 5AH0A 1YMUA 3NYRA 1U2RA 3F6PA 2RI1A 3MWDA 4JC0A 4JHLA 4HH0A 4C04A 1DO2A 1Q0ZA 5EJIA 2LKDA 4TWBA 4ARCA 1NBME 1P75A 4G0XA 4R5HA 3AF0A 4AKHA 4X7PA 1Q6ZA 3ZN2A 4BTVA 4I1UA 1OB2A 3TDMA 3C7DB 1ESZA 2WD9A 4O4LA 2RG7A 2CNWA 2DHEA 4NV1A 3ZNNA 4LN1A 3C1AA 3EMVA 4OLHA 3RK1A 5U4XA 2EKPA 2ZXEA 2I2FA 2M32A 3PTZA 2Z1MA 1G6OA 4YH1A 3ZBPA 1XMOB 3WB9A 3TD9A 3AT1A 4IDGA 1CUIA 4Y1GA 3KAPA 4EECA 1FNBA 1Y7TA 1ZOPA 1TAHA 3P2EA 3IOEA 4DLAA 3UOWA 5EHXA 1S9DA 3QXXA 5FADA 5K0LA 1TUIA 1Z0JA 1JFVA 3F4BA 1EE1A 2IZ0A 3WGUA 5GVSA 1RSZA 3COWA 4PF1A 4YCLA 1O96B 3EXFB 5I9LA 3QSYA 3WYAA 4P93A 3CUSA 2MYUA 4EF5A 3P27A 4K9DA 4KQIA 4EUHA 4I5EA 4O2AB 1AUPA 3A58B 4C4AA 3TS1A 3OY7A 4LA4A 3SKVA 4U0KA 4ZEXA 1EE2A 4EKIA 2OB1A 4Q7EA 3O8QB 4Q1DA 4HV4A 5BW4A 1HG0A 4JL6A 4P2GA 3V4VB 3OP4A 4JQZA 1M2VA 4RL6A 1UKAA 1Z0UA 2Q9CA 2LP4Y 4M38A 4FQ8A 4RADA 5LD2B 1Z8NA 3IMFA 1J0EA 4XRGA 2RARA 4HAXA 4MRNA 3LLVA 4HQ6A 2Y0PA 5KVCA 1P62B 3FTPA 2CCJA 1KI8A 2YN2A 2XA2A 4WY5A 5CB4A 1KIAA 3QVJA 2HCFA 3OJFA 1U8AA 1BDHA 1SVIA 1Y3CE 1JIVA 1LC3A 4LDPA 5EHNA 1DKNA 1ZPDA 1JG1A 2J59A 1ZRHA 1VJTA 3FRJA 5GJCA 2JLVA 1CW2B 3K4QA 4Z0TA 1PUXA 2CC2A 1UWCA 1RAEA 1VJ0A 3R41A 4MQBA 3W78A 4RZ2A 3BMQA 3HLTA 3OJWA 3U3MA 2CLMB 1JR3E 1LS1A 4CIWA 4I4LA 4LYFA 4MWBA 1B8NA 4X94A 5KOHB 2DWCA 2X6QA 4M0LA 3MT8A 1EBBA 2H18A 3HO1A 2VG8A 4OXRA 1E0DA 4U7JA 2I22A 3KAJA 1ZVMA 1Q83A 3WLQA 1UK8A 1EAMA 4Q01A 4C4XA 5B6PA 3THYA 1ZR4A 2B83A 2JIQA 1PEDA 3QVOA 1VYTA 1V25A 2EBFX 2PT6A 2QM0A 2G4VA 3B8EA 3DBLB 3ESYA 4I50F 5EGNA 1FIUA 2HNKA 4WZBA 1EFPB 4CMJA 4DNPA 1T4CB 4LTMA 4RULA 5F2EA 1T91A 4PZPA 1K66A 2GM3A 4AJIA 1SZJG 1ARZA 2AKAB 2AV6A 1Z0FA 2HTEA 1XO1A 4MS1A 1WDMA 4D5GA 3P9KA 1ISIA 3ZG6A 4EW6A 8ADHA 2L0XA 3SHQA 1TZCA 5HA5A 3ZTYA 2POQX 3AHFA 1XT6A 4PSVA 4R0MA 1ZAYA 4JT8A 2VJOA 1QONA 1P5RA 5I9SA 4GWLA 3FI9A 1PQUA 4F4IA 1GP2A 2AJDA 2QK4A 2R25B 1Y9EA 4BWFB 3O8OB 2RGCA 4PGGA 2HH9A 1GUFA 3O9VA 2AD1A 4Y30A 1QG4A 1PFYA 2DC1A 3C24A 4C0LA 4ETWA 4BQRA 2XGOA 4PBTA 1ISSA 3STHA 1B15A 1DJOA 1WOYA 1CQIB 3WP1B 4F5ZA 5CA1A 1U90A 1QQTA 2BM9A 4V03A 1DAOA 5C52B 1DBWA 5HX7A 3F4LA 3IXLA 2VJQA 5JRJA 2Q6TA 3BKXA 1SK9A 4GQAA 2OFFA 2ZJ8A 4KDCA 2EW2A 1II0A 3E0XA 3JTMA 3TTSA 4HTAA 4EUSA 3WIVA 4RHXA 2C7GA 3SZMA 4N0EA 2CHVA 3A6HA 1WKCA 5HVNA 1O9GA 3L5KA 3BGWA 1ZD8A 5SY9A 1I30A 2J8ZA 1I94B 5HG0A 4N54A 3NYWA 1FNCA 4PCAA 4P4SA 4Y2JA 2BJVA 3L9WA 2H3EA 3HKDB 3RYHB 3SYTA 1O08A 1XRLA 2YJ5A 5CVEA 4ZZ1A 2G72A 1YE5A 1U2GC 1KPGA 3G9TA 5JJKA 2UZ3A 1ZN7A 3OF3A 5BSEA 4KITB 3FVQA 4LYHA 1DKRA 1OAAA 1YE3A 1C9KA 4KFUA 1N6LA 3U26A 1G5PA 1F2DA 1GTSA 1Z16A 3H2BA 1HQCA 1IQ0A 4B3JA 1D9XA 2Q5CA 5FPKA 2Q1UA 4TT3D 2ZP1A 1YOVA 1Z4LA 1U3TA 4PONA 1TT7A 1FDVA 2UDPA 1V9LA 2ETXA 4ZODA 4Y1FA 3BJMA 5DYYA 1BMQA 1C8LA 1J9ZA 4RHCA 2G25A 1VOTA 1UBNA 1UWKA 1ID8A 3JWJA 1XKLA 3ZK9A 5JCOC 4WOBA 1ZOIA 3HJAA 3B1JA 2MSDB 5EXXA 1JX6A 4A2QA 4KRYA 4KX5A 1TTQB 3N6VA 4N5DA 4I9FA 5CPBA 4A92A 1TPYA 4OQEA 2GF0A 3IT0A 3ANSA 4GMFA 1XQYA 4D6YA 5KC8A 1EB9A 1T1SA 2BFMA 3AIOA 1ODFA 3BBPA 4A6PA 1WCV1 2YVKA 3M6XA 5AKGA 4JBNA 3ND6A 3DHNA 4BGVA 4XVUA 2H00A 2FFQA 2NXEA 1EHIA 1WXEA 3IIMA 5A2QA 1JDNA 3FB4A 4FGZA 3UJCA 1NI3A 2KPOA 1VSQA 2SECE 4FFPA 2XRMA 3R7NA 2Q62A 4CPDA 4JQCA 2IOHA 2V6IA 3VOAA 1X7YB 1WY5A 1RXCA 2VJNA 3A1NA 4LJKA 4MR9A 4UM7A 1CETA 4KACA 3GQBA 3H8JA 1RZUA 4KBYA 1OUMA 1RW4A 2I34A 4EW1A 5HR5A 3KQNA 5JAHA 1WD7A 1ODLA 2W2MA 1PIWA 3U13A 2ZSDA 4P0QB 1KEVA 3ZNOA 2PE5A 2OAEA 4ZAFA 3L04A 1B7GO 3RWMB 3GJRA 4B3BA 3CG4A 2CLFB 1FPQA 1M1UA 4ENVA 4RVNA 2DU8A 2GGSA 3OH8A 3UEOA 4CI9A 1VZ2A 2G83A 1WAMA 2XTMA 1ONSA 5E7MA 2FF5A 4HQLA 2WT4A 3P96A 2X22A 1TVEA 3INNA 1EK2A 3HVJA 3IUJA 3LT4A 2BHRA 4MYCA 5J59A 2I1LA 4HGQA 1A8QA 3AG6A 4KJZA 1MJNA 4LJAA 1CY7A 1IHOA 1JA0A 1RM3A 2ADFA 2GA8A 3G1WA 3SYMA 5JCOA 2BW0A 4NBSA 2DTXA 1VECA 3W9BA 4LHEA 4UASA 2TYSB 4Q3BA 4A8PA 4MKHA 3OHSX 4EUFA 3CVXA 4IQGA 2V58A 1NP3A 2NU7A 2BMWA 1XTJA 3DVRX 3OEED 4O4HA 2OKCA 2JATA 4E2FA 4PRLA 4DN6A 1V6SA 1RYYA 1WB4A 4D6XA 1TLTA 1QUFA 3GD5A 4OXKA 3URMA 4XLTA 3BUSA 1Y6GA 1KORA 3DHWC 3VOBA 3N8GA 1JMKC 3IIEA 1C8BA 4B2PA 4CG3A 3E4DA 3AZOA 4KQGA 5JJ5A 1KYVA 4NKRA 2E6KA 1SR8A 3SLKA 5C9ZA 1V5FA 4GP7A 3D6FA 2XSZD 1BH6A 3DWFA 1OBCA 3K5IA 5GJWC 4N7RA 2ISQA 1OI3A 1MJHA 4RTRA 1QH8B 3MIZA 1FFWA 1QV7A 3PPXA 2WB2A 1YO6A 3OSUA 4PRKA 1X1EA 4QECA 2H1OA 2V4MA 4KREA 2B78A 2TMGA 4ZV4A 5HKKA 1NVVR 2O8DA 3I6BA 3JASA 3FG9A 3OEHA 2FZ5A 3THXA 1RXIA 1YUNA 5CYOA 1RHMA 1U9ZA 2JIBA 2Y99A 3ETHA 3SFTA 3E70C 3SJCA 4AWXA 3IJPA 3BFXA 2PD6A 3T61A 3BSWA 3TB6A 2QTAA 4D98A 3HJHA 3LBNA 1ZK1A 2CKMA 4R9VA 4BFLA 4XD7A 5BNFA 3OFND 2IBMA 4XW2A 1GUZA 5KUTA 2EF0A 2G67A 3GUCA 4CCSA 1DHRA 4KN5A 3WSWA 1U2ZA 3R7DA 5CYFA 1ZBQA 2GD2A 2J9FB 4RCYA 3BEDA 3EVFA 4AT1A 3CRVA 2WG2A 5GM1A 2I80A 3RAEC 2VDUE 5LPNA 3DZFA 4ZQBA 1JFRA 2E21A 2F8TA 3GGCA 4M99A 2IYYA 1F7UA 4JBYA 1C8KA 1DVRA 1HDEA 1RJWA 2NYRA 4DV4B 3RNOA 1M6NA 2ZUBA 4JNCA 4MRPA 5DGXA 4PLZA 3AHHA 5DBGA 2DERA 1OLXB 2D6FA 1B93A 4D8VA 5BURA 4S1TA 5F2OA 4ESEA 4WBNA 4MYUA 2E4UA 2AK3A 3FBWA 3OVMA 3IO5A 1Z06A 4LVUA 3ZE1B 1NVMB 2ZSEA 4I3GA 5KMGA 3EIXA 1RQPA 1KPIA 1Q12A 1EQAA 2SKCA 1XDGA 2GETA 3IDZA 4H17A 3EIWA 1Q2XA 4I46A 4Y2VA 5TNXA 4BGIA 2V74B 3IKMB 3QYAA 4D44A 4RKQA 4D80A 1R4AA 1UQTA 5LYYA 3QLUC 4F6CA 1NLYA 1OW3B 1Y80A 3VPFA 5ECYA 4JYAB 2YWCA 3C6ZA 3HUTA 2O8FB 1UKBA 2EP8A 3OX3A 1F2TA 1D4OA 2C00A 3I01A 4GP9A 3BZWA 1DBQA 4KODA 4AYTA 1D0IA 1JVBA 2G8NA 1LK7A 2GN8A 3BEOA 3GFRA 3KM0A 2PU5A 1L3IA 4IILA 3HRKA 1AQYA 4BATA 1DOZA 1TJNA 2FGKA 5A4FS 4RNDB 3BKWA 4GZ3A 4TVBA 1SQGA 2VDWA 4KJXA 3HCWA 4KLCA 2OGWA 4W5JA 3P9YA 4HPJB 1J2UA 3ROQA 4C88A 3DTTA 2WAXA 3EDRA 4K6OA 4U2GA 3HKEA 4HP8A 2GB4A 3WIUA 1ACMA 4GGMX 2WRZA 2JJ8A 3EHEA 4H6VA 2AMVA 2RGUA 3EDQA 4P4SB 3JPYA 1GSAA 1SVNA 5J4LA 2PY6A 3E58A 3PI6A 3BK1A 5JLJA 4MVYA 1XZJA 1YMQA 1DARA 4IIEA 2WV7A 1S2OA 2Q5EA 1U28C 2UYYA 3I5AA 2ID8A 3PDIA 3UN1A 3ORQA 3ZDEA 4CN8A 3KWJA 5I7SA 4YWHA 2HF8A 4C4OA 4NK4A 1IDN1 5E3HA 3UCFA 4ZDIA 2I7VA 3EXHC 3D7RA 5C1OA 1YJ5A 2GKGA 4CKXA 2AZ4A 1X2EA 2VYCA 4LQCA 5KWEA 2XECA 3OURA 1LRLA 1BMFD 1A1SA 2E5FA 3DEJA 5FIUA 1BJRE 3SQDA 3UENA 1XZEA 3BHJA 3EGVA 3ZJUA 4TXJA 1UOEA 1HPLA 1N7GA 2K6GA 4U7TB 4C6TA 4L2IA 4F46A 2X4DA 2QROA 3GVCA 3FOEC 3QLUA 1TW3A 4J29A 1L7DA 3UV7A 3VVBA 4BZZA 3Q7SA 5AKXA 4BO0A 4Y2GA 5BSKA 3PICA 4M0UA 2B7BA 2BWJA 3CR3C 1JJIA 3W2TA 3GVPA 2J5RA 3AUUA 1G20E 3NKVA 4XH9B 4XQEA 5E1DA 3WFIA 4B1FA 4E22A 5FBKA 2OKGA 3KZKA 3BE8A 3MGGA 3VKWA 2R1UA 3CEJA 3N0RA 4H1HA 1Q3TA 4IHAA 4NP6A 3V7YA 3GEPA 4RFVA 3Q0TA 1E0KA 2PLRA 5B36A 2O1SA 1XDZA 4X20A 5FH9A 4L76A 1ND6A 5DE3A 3QBEA 1GYQA 1ZUWA 3H97A 3RJTA 4BRWA 3LPNA 4AUNA 4CMIB 4J9VA 3U49A 1YJAA 4KMMA 4LHVA 5EZ5A 3V4RA 2RGAA 2XITA 1C7ZA 1Q77A 1JLLB 4JAVC 1A2KC 3I9V6 4MV0A 3IAFA 1EXNA 3LA6A 4LBVA 2M98A 1VG8A 1ORVA 1LDYA 1H42A 2WAAA 3W1WA 5JVDF 5GJBA 3LTEA 3EWNA 1BFDA 5BW8A 2PGDA 3DV9A 2QZ4A 3MRXA 2IEGA 1U28A 3U4DA 5IG2A 1RYHA 1R5NA 1Z88A 1OX6A 3PEUA 4OFXA 2EBWA 2Q1TA 4LWOA 4X60A 4IS2A 5FPTA 4TKVA 1WXGA 3LYUA 4TYWA 1ZOSA 4LCBA 1D2HA 4R7ZA 4ZO9A 3EXHA 4LHYA 4XVCA 3TM5A 2JBAB 1B14A 3RUIA 1NAHA 3ZR4B 3C3CA 5AJHA 1J2RA 3HR8A 1YZFA 2ONCA 3JAMA 1YRHA 2ZFUA 4OYYA 4BTEA 4IDPA 2YJGA 1UR5A 2EDAA 5F1YA 4A23A 1CIVA 4KKXB 1KMIY 2A84A 4HNVA 2GBFA 5LU9A 5BUZA 4LTNA 3TE6A 2RHCA 5EP2A 2HRRA 5H9WA 3SC2A 1PJQA 1FRFS 3WSVA 4EYQA 2IKSA 3JARB 2NU7B 2CJWA 2WKQA 1S8FA 2JGRA 4G24A 1WZNA 2GJSA 5K3AA 5JQGF 3I9LA 1NX6A 4RVOA 3CVVA 4H3VA 1XEWY 3WS7A 5IRCD 3RGWS 3TZEA 5U9CA 2FZEA 1DQRA 3LUGA 4NMMA 1E8DA 5CEEA 4ND5A 4YXWA 1DDIA 1NQAO 1TADA 2F59A 3NJ4A 1WHSA 4TS9A 3ZDYB 1UXIA 1ZM4A 1AKYA 1VRVA 4MUNA 4ZVOA 2WVJA 3SHVA 3EGOA 2WI8A 3VZQA 4FFMA 2HIHA 3L8MA 3V1MA 3CISA 2FYTA 2QRQA 2AOTB 1I4DD 4WL0A 1OR8A 4DL9A 3UAWA 3T3OA 4N1AA 4RAQA 1WZCA 3T38A 4OQMA 1ND5A 1R8SA 2UZ4A 1KK0A 1RYZA 1BD3A 2DWQA 2SKDA 3GMSA 4DVJA 3ZE7A 1G1AA 4AXXA 2OM6A 2JFYA 3EC1A 3PUKA 3AERB 4V2IA 1XD9A 3JASB 1MO3A 5CFNA 1MHPA 3T15A 3QUSA 4FIDA 5BN5B 3NHPA 1KFCB 4DJEC 3FWPA 3U4MA 1NUUA 4XJXA 2Q2VA 3ANYB 3BOSA 2UZAA 3KSAC 2WWYA 3NFRA 2MYNA 4JLAA 5DLPA 5B55A 4M2LA 1WMEA 4YNBA 2QG6A 3AW8A 4DYVA 2XTAA 2ZE7A 3CLTD 1F06A 3LE8A 1L1QA 5K45A 221PA 3VDMA 2QM7A 4DRXB 5K0JA 4JGBA 1G8AA 5EZYA 1QIGA 2Z08A 1L3BA 5FF9A 3X3HA 3KKPA 1CLUA 1G4HA 3C43A 2FU5C 3BXZA 3R6DA 5A9SA 3U37A 4FEGA 1I6WA 1CIJA 1PQPA 1SCUB 2O4UX 3I9JA 3ZHCA 3ZI0A 1OZHA 1NLUA 3PG5A 3HEBA 1I6LA 4W1QA 1WPQA 4PS0A 3IS3A 1C0EA 3AEUA 4OMCA 1XWWA 5DXJA 4YT4A 3LC0A 1G3RA 3C3AA 5DP2A 4BO5A 4D3FA 1IVYA 1BX3A 3TZKA 3MQ4A 3RQIA 1ZGBA 3W04A 4PN3A 2E7ZA 4L4UA 1X8LA 1BRMA 4BKRA 3DF7A 1A9PA 3HM2A 3PGLA 4R71A 3B1FA 5B7NA 2NO0A 4GRAA 4JJKA 1DUIA 4MS3A 2V7PA 3AZPA 5CLIA 2AFRA 1ADCA 2N1BA 3OQIA 4JJAA 5FPHA 4BMDA 2C57A 5EJEA 1JSRA 4E13A 5E6RA 3U3XA 2FEAA 2E4XA 5KMGB 1EFDN 2CDBA 1P17A 5LQRA 2WMYA 4N5LA 2NPFA 3LYHA 4QUGA 3IAM1 5LBTA 1JHDA 3V7FA 5JSZA 5CLHA 1WIWA 1TGYA 1QH0A 2PUVA 4LIPD 1YRWA 1H8HA 4H7EA 4DLZA 2NV6A 4LZZA 3QOYA 4B74A 2PGLA 4P33A 4C0KA 3CZ5A 3SJZA 2NO7A 3O83A 5ETJA 3OLCX 4BUJA 2LUOA 1C14A 1NZJA 5EXPA 4JEMA 3D0OA 1K08A 3F3SA 3GBVA 3UTDA 4AF7A 4MITA 4BFYA 2NU6A 1Q7EA 4REOA 1N8SA 3QNWA 3QSGA 3TNJA 4TPKA 5DHRA 1LX6A 1AUXA 1F14A 2AXQA 2O14A 1U0EA 5ALZA 1E9EA 2C96A 2Q4DA 4OGFA 3ZWWA 3FFBA 4DIDA 1P2UA 1EYZA 1T1JA 3KEFA 3U6KA 4KX3A 2HX1A 3VHXA 1X42A 2DT8A 4HNRA 3U09A 1WBDA 4BBJA 3HJTA 4DFDA 3MRVA 3BMNA 2C4VA 2CMFA 1DQSA 5FJJA 3BC1A 1NM5C 2G5PA 2PXAA 3L06A 2CV1A 5CX4A 4Q5IA 5HQ3A 3G0OA 9MHTA 3L18A 1M0SA 1OQAA 3N0XA 1DGQA 3DG9A 4QVKA 4PHCA 3PDIB 2NOAA 4HDKB 2R5NA 3NM4A 2F00A 1SXJC 3EVDA 1VLZA 4J0DA 2R6ZA 4CM9A 1O6ZA 2EIHA 3G17A 4HPXB 2QI9C 3SE7A 3U81A 2W6CX 1NVWQ 3NC1C 4N6NA 2P2NA 4KB5A 5LQKA 2HCRA 3VYWA 1L6RA 3H05A 3N53A 3QVWA 2R47A 1LRKA 3OKPA 2UYQA 5JBQA 5JXHA 1R9MA 2WTXA 3WQSB 2FOXA 4G0OA 4PRYA 3IEMA 2VR1A 2Z5GA 1V3UA 3NNSA 1UJ2A 3H2JA 1H5UA 3PXAA 4DCSA 5LXTA 2JD1A 3I04M 1GQSA 3I58A 4YRNA 2ZZKA 2BI4A 2FQYA 3AY3A 2IHUA 3L8CA 5EWJB 1L5HA 1C50A 3FWNA 3Q9SA 3NAQA 3H04A 2OSVA 3DYVA 1VTKA 2Z9DA 3KIPA 5D01A 1JT2A 3WNBA 1B8UA 2DTEA 3SZ3A 4CZ2A 1V47A 2ODQA 3JV7A 3AONB 4QIHA 1V9CA 1CUFA 1E0SA 3DNPA 2YXLA 1Q17A 1W19A 4ALMA 2OECA 4A36A 1FDIA 3ETGA 3KVVA 4IF4A 4OQFA 2A0XA 3DMRA 3WK9A 2QY9A 1U5BA 2O23A 3PLNA 4R5MA 3R0IA 2XTNA 4DCPA 3ZJVA 4EY7A 1P73A 2WYUA 2BFDB 3C45A 4UBJA 4OMUA 3GNLA 4KUGA 4XGRA 5JWRA 2IH5A 3GFGA 1PG2A 1Q0SA 1U7XA 4YRBA 4A0HA 3U1TA 3GJYA 5JPDA 1MBZA 4TS4A 1W1WA 2Q3MA 2QYHA 1CJMA 1E89A 2D2VA 2JGEA 2YV3A 2ZIVB 3CF4G 1NM5A 1Q21A 4I5IA 4MGIR 4QXMA 5AK3A 3P2IA 1YA4A 3FPEA 3I0ZA 4JLPA 5FOWA 4D92A 5FNZA 1SXJA 1OWLA 1W1IA 5E1BA 1M6VB 2L2QA 2QRGA 5G02A 4OK3A 1VA4A 4AG6A 1ZONA 3GBPA 1IZ8A 3KDPA 2GQ0A 1N9GA 4Z4EA 1IUNA 4KR6A 3WGTA 4RZQA 2ODPA 3ESCA 3IALA 5JBNA 2VT7A 2GKOA 1JEYA 3OOWA 1EJ2A 1X7ZB 4ZEWA 1NHWA 1SKBA 4RTQA 5EIFA 3LBAA 4KG7A 4AULA 4GT1A 1AX9A 1I2AA 4KO8A 1FYEA 5TS2A 5E38A 2Y66A 1MRNA 3WQRA 1NW7A 4GXQA 4AWBA 2GF9A 3LK7A 3SC2B 3UJ6A 4AKTA 1ETHA 1YHZA 4QXPA 2CJWB 3RU2A 2CLEB 3H0KA 3JZAA 4EZIA 4E4TA 5HHTA 1YQGA 2MSWA 4GXTA 4LX8A 4CXMA 3HFJA 4REQB 1DKUA 3WG9A 3BK7A 3JQBC 2HHHB 1E3LA 2C5FA 2F43A 4IIBA 5HEKA 3U19A 3A27A 4ZD6A 1U1IA 1Z33A 1WHSB 3PHJA 2I6SA 3GEMA 2R00C 1SKUA 4NYIQ 4IKPA 1R6DA 5DIZA 2I7CA 3ZWNA 3C5EA 1IN5A 1DFGA 3FVRA 1V8OA 2QXTA 3JZMA 4FMPA 1L5LA 3E84A 4MMXB 4MICA 4ZVRA 3DDOA 2H9IA 2HDNB 4EGJA 1Q0TA 1TEXA 1PEAA 1DWPA 1FL9A 1KQ3A 4W7HA 4DLSA 1XWIA 3C16C 3QTLA 4M9XA 4QHTA 4Q1CA 2BYTA 1V7ZA 3N1UA 2Z56A 4YR9A 5J3JA 4U63A 4B4DA 1KDTA 1YGPA 3BSSA 3D0RA 2IYXA 1ZJJA 2WJVA 4YJ3F 1I8TA 4HGRA 4OUDB 4PE5B 2W70A 2I4MA 1KYQA 5SYMA 1EP2B 5K4AA 4EW3A 5IUNC 4KVFA 1QGUA 3IBSA 3R5TA 3A4NA 2G1JA 1ZZEA 4KWHA 5BSUA 1PTKA 3D2AA 2H65A 3PHGA 5CB8A 1E2FA 1OSNA 1JG7A 3T0FA 3UCXA 3OWXA 5JDIC 4GSLA 1K0FA 3D5TA 1AURA 1Y4DE 1XQWA 2RGEA 1MB3A 3DDSA 3QQPA 4ZWNA 3TR0A 2YHUA 5A9SB 2I4NA 1RJGA 3F9IA 3UGQA 4LX0A 1EP3B 1T3LA 4LGVA 5EAIA 5G40A 3AM4A 3VO1A 4O4IF 1DRVA 5DCWA 2IQ5A 3MOSA 2Z5FA 1WNFA 4Q3NA 5TQ0B 4D9NA 4UOZA 5KSYA 4LSZA 3H9BA 4BV3A 2OD7A 2A4MA 2FCAA 3B70A 2JFHA 2OESA 3R20A 4WRRA 3SF0A 1UBSB 3C41J 4JITA 4HHEA 3JQBA 4DLLA 4EIWA 3TTYA 7YASA 1WRBA 1AXGA 4R98A 4O63O 2P3LA 4KXYA 4CMCA 2VNHA 1SHTX 2QX6A 3TOZA 3LBHA 3N8DA 3D9QX 4L16A 2R00A 1OLOA 4MS3B 4TLMB 1NFRA 1DDOA 3H7IA 1R6AA 4OHMA 4JUBA 3PXUA 1JDVA 3RUPA 1EFRA 3ELDA 4CF4A 1NNI1 4ZCSA 2H85A 2IITA 1ESCA 1F60A 2HSZA 3BB4A 3HCBA 3I34X 3ICOA 3NYIA 2GEKA 3K94A 4XASA 2OP0A 3P45A 4YWJA 2A94A 3PNVA 3VGPA 4B6RA 5K01A 4BYGA 5F7ZA 1IEVA 2W6IA 2HV9A 3ZY6A 2R1VA 2BEUB 5CIWA 4UPEA 3H11A 1JEQB 1K8QA 3KTDA 1XXHE 3OUTA 3QXSA 5KNBA 1J23A 5H3LA 4DC1A 4ZJUA 5CYGA 2HWUA 5MHTA 5CG2A 3T4XA 4F6RB 1ELOA 3PJRA 4IIDA 3E1SA 2X40A 1QHIA 2NTNA 3FPKA 3ENNA 5E7IA 4AO6A 4FW9A 3FJYA 1TT5A 2EJBA 1XU4A 4ZI5A 2XUGA 5GONF 1KY2A 1MC4A 1HZJA 4H31A 1ENOA 3CF2A 1QDEA 3IUEA 1JQJC 3KALA 2WSSA 4G5OA 3RVPA 3T4PA 3U4CA 4A8JB 5BT8A 3B48A 5DGCA 3UWSA 3L3BA 3RRBA 2C42A 1WV1A 3GPDG 4WZAE 5CIYA 3OLYA 2NUBA 4MSUA 3EZ6A 2XXAA 2PANA 2F8SA 3BMNB 2ARKA 3T35A 1IY0A 1DCFA 1GTG1 1PEYA 2HGSA 2Y0EA 3FLAA 4NJMA 4URVR 4Q9LA 5BT9A 3CZMA 5HQ3B 1EWRA 3ACDA 3R75A 3UK1A 4AP6A 2AZXA 1JDSA 1PYOA 1RI5A 3CLTC 1WMAA 2O06A 3HWRA 3MLEA 4V1CA 2XQKA 4Z4HA 3GGGA 1IUOA 4K05A 1IWOA 3WB0A 1G5QA 2RAVA 4XDGA 4I55B 5IBCA 2F3TA 2E89A 1DO8A 1PW5A 3HCNA 3FMFA 1KI9A 2GMWA 2PX5A 3ER9A 2Q3JA 4L78A 4G0QA 1XP5A 4BB6A 5CITA 2O1EA 2B6HA 2C4MA 4BASA 2BEKA 3K35A 4G1CA 3NCHA 5T64A 3ELUA 3IYLW 1K8XB 1VBMA 1PR0A 1XRSB 2IRWA 3AFMA 3IBFA 3VVMA 4FDVA 4I2NA 4UATA 1J8MF 1UXHA 3B6MA 3FGOA 2D5IA 1L5HB 1YQTA 3QFFA 3W9SA 4Z49A 2DUMA 3IEXA 5TRTA 1CY6A 2IZZA 2ZR0A 3CGWA 1GG9A 1S8AA 3UM9A 4ZHSA 4YEDA 4LK3A 4ZOBA 5AVZA 3ER8A 3L01A 2PMKA 3VU9B 4XWTA 5DW0A 5K8IA 2HIMA 4Y9UA 1I7PA 2C03A 4QXOA 5IHPA 3G5MA 2AI2A 2CL5A 2R6GA 2W6JD 3ITNA 4NR0A 4NH0A 5FPQA 1MQAA 1MQ9A 2XUIA 4KBGA 4Q6BA 4JV5B 5I4BA 2LPMA 4C03A 2RBEA 1SVKA 3JQ8A 1JMVA 1OI2A 3EVBA 5HZGA 1A04A 1HTWA 2FX2A 4MPRA 5FUYA 4W5RA 1HYEA 3EQ9A 1EBFA 1VG0B 5TJHA 3E03A 1FBTA 1DCTA 1XFAA 3JQGA 1XYYA 1M5TA