1V5WA

Crystal structure of the human dmc1 protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
258
structure length
239
Chain Sequence
b'PGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Meiotic recombination protein DMC1/LIM15 homolog
molecule tags Recombination
source organism Homo sapiens
publication title Structural basis for octameric ring formation and DNA interaction of the human homologous-pairing protein dmc1
pubmed doi rcsb
total genus 57
structure length 239
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08423 Rad51 Rad51
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1v5wA00
1W7AA 1E2HA 2R6DA 2D3WA 2O8FB 4MYCA 5JJLA 3A37A 1R0ZA 4RD1A 3TW4A 4DEYA 1RRCA 1P9NA 4JZKA 1CEEA 1KMHA 4A2WA 1R10A 4XD7D 1CJUC 4P4SB 3ZDQA 4ILEA 5L3SB 2P6RA 4TMZA 4LC0A 2W00A 1W48A 5FPTA 2DWPA 4YONB 1LFDB 2ERXA 3BORA 2IBMA 1G41A 1AQUA 4Q01A 1JEDA 4GZLA 3TNFA 4IDOA 1OJLA 2R65A 4Q1DA 3RRYA 1TQ2A 2OFXA 1IXSB 2W2TA 3ADBA 1VCMA 1OXVA 2ZJ8A 4DLVA 4V03A 3AUXA 4NL4H 5CK4A 1EESA 1VECA 2GKSA 2ZREA 4L8GA 3EARA 1LB1B 3PVSA 2IYSA 5IK2A 2QPOA 2B6HA 3LW7A 5CJPA 5DIFA 1YZQA 2D4HA 3W8NA 4U7DA 1X6VA 1CP2A 4ZDIA 2H17A 1B23P 4Q7LA 3ZQ6A 1IHUA 1F3OA 3GJ3A 4ACBA 1R5BA 2XOKA 2QTVB 4UXIA 3FKSA 4EPRA 2P5SA 3HWSA 1LY1A 2ZITA 4A2QA 1MABB 2WM9B 2YC4C 3CX6A 1DELA 1XD9A 2F3RA 1A4RA 1KNXA 4MGYR 4XSGA 1PUJA 1WA5A 3IGFA 4BEJA 2ZIAA 4V0KA 3LLUA 4GT1A 1IQPA 1P3JA 1AK2A 4NP6A 4I1OA 2IF0A 4HB2A 1E9FA 1E6CA 4DJTA 1GKUB 2IL1A 1DADA 1FMLA 1RE0A 3NHBA 2QAJA 2XNSA 5CIQA 4LJ5A 1KI3A 4TMVA 2G1KA 1XMJA 4TMWA 4CEJB 1NN3A 4V0LA 3U3MA 2JLWA 4CEHA 4O3MA 4ZPXA 2ZANA 3ECCA 1Z6XA 4LSGA 1SXJC 1Z0AA 3SJCA 1J7KA 3TBKA 1GITA 2CVHA 3BD9A 1ZCAA 4N1AA 4N3NA 2W6JD 3DO6A 4YC7A 1KZGB 1KSGA 1OFHA 1S1MA 2QQEA 2JDIA 1XXHB 2ECKA 4MKGA 1LW7A 2GF9A 4RKEA 2OCYC 3SC3A 5KTYA 4Q4AB 4LHZA 5JJIA 3AVOA 1XPRA 1NVXQ 2QMHA 3Q72A 2QI9C 1S4QA 3T1VA 3FMOB 2O0HA 4LJAA 1W4RA 1KTVA 1CULC 4CIDA 4XD7A 2ORIA 5TVKA 2DCUA 2ZSAA 3H1TA 1W2HA 3QEJA 1TX4B 3THWB 4M9ZA 1KO5A 2RGNC 1KOFA 1EFHA 4F7WA 4FWTA 1QHSA 1E79D 5AJWA 1IN8A 4KFUA 2ZJBA 1FP7A 4O2RA 4EKDA 2QP3A 4M4SA 2REBA 4B3DA 2GJSA 1Q3HA 1I2MA 1DVRA 2IT1A 1TF2A 4Y0VA 3S1AB 3TR0A 1IY1A 3X1XA 4Q9HA 1D9ZA 2AK3A 2VPPA 3Q7PA 1XPOA 1YR9A 4M1OA 4TZ6A 4IDHA 4AG6A 3NEYA 2VIIA 3GJ7A 3BXZA 1SKYE 2BBOA 2QSZA 3H0KA 4PC7A 2GK6A 4DVGA 5FTLA 2WTUA 1YJ5A 1GNPA 1SXJD 3PEWA 2UZIR 5JECA 3N2IA 3I73A 1U99A 5DI9A 4KYIB 3AF1A 1WE2A 1OXSC 3LBNA 2J0UA 5BWMA 2HJGA 2QBYB 1M7HA 2VO1A 4KLNA 4XSHA 2X2FA 5FBRB 1NLYA 2VTKA 4WW0A 2JASA 5JSZB 1NBME 1GL9B 1JEEA 4Q4HB 5J4KA 2RGGA 3CH4B 2G3YA 4FINA 3I8XA 2HLDA 3LDAA 3UG7A 2GJ9A 1ZM2A 3ZVRA 4TYWA 2FEMA 1P5ZB 4JLAA 2WVJA 4JMPA 2AD5A 4MH0R 1E9CA 1W46A 1DAGA 1U0JA 5AUOB 3AF2A 2BBTA 3BH6A 1T5LA 5KDLA 1K5GA 3OESA 1DS6A 2B92A 1D2EA 4ZO4A 2W83A 3CPJB 4PSKA 4B75A 1NG1A 4Q00A 1BMFA 4DLSA 4NYMQ 4DCUA 2BJVA 3H86A 3D31A 2B7BA 4B3GA 1T3SA 4BPBA 3EZ7A 4Q1EA 2I4IA 3NVAA 4P33A 3WBJA 3Q5DA 1IXRC 3P4YA 4I4LA 1V43A 1A2KC 3I92A 2QAGB 1KI4A 2JJ1D 2N46A 3GJ6A 4L9SA 4A0HA 2PJZA 1JXOA 1NF3A 1SXJE 1G7RA 1NVVQ 1Z0DA 2V6JA 2WPDA 2WWHA 2OXRA 2PT7A 3NBFA 1J70A 1OPXA 3C7KA 3GLHA 3KB2A 3HYTA 1G8GA 4LJ9A 3QG5A 5EP3A 5HZHA 2ZSFA 2ONKA 5BW8A 3V4FA 3BBPA 5KYKA 3QKRB 2MMGA 3OE7D 3VAAA 4KODA 4IXNA 1VYTA 2ODNA 2IF2A 5KOYA 3KUCA 2WBLC 2ZI7A 4EFNA 2ATVA 3AVWA 3DMNA 2V4ZA 3C4JA 3D7MA 4XWKA 3IQXA 2GZHA 1U8AA 2CK3D 4PHFA 3H84A 1AZTA 3LV8A 4H1VA 1Q3TA 3ND9A 4E09A 1LTQA 2OV2A 3KB1A 1ESNA 1R6BX 3PXGA 3PUYA 3GEIA 5BYJA 1FTSA 1XB2A 4OL0A 1E2KA 4FWIB 1Q21A 4PC6A 5TDHA 2ATXA 1KI7A 2CK3A 3VFDA 2ZYTX 3EPLA 3B82A 4JL8A 1KI9A 5J47A 4LBVA 1GIAA 4N0DA 3CF6R 4Q9JA 1R0WA 3GFOA 5EQTA 2G0NA 2ZROA 3H4MA 2C77A 1VCNA 2EYQA 3OE7A 4QXAA 3UMFA 3SHWA 1NN1A 3QNUA 1M7BA 1FNMA 1CJKC 3UWOA 2JLXA 4PTLA 1XZQA 3U3JA 3TAHA 3ND8A 3ICEA 3QENA 4D26A 1W49A 3KTAA 1NSTA 5B64A 1M1YE 4GFDA 4URYR 3SZRA 1F2UB 4A15A 4NCKA 3T1QA 1NKSA 5LDDC 3HU2A 2C95A 2KWIA 3Q9LA 1VG1A 2XZOA 3I32A 1P75A 2Q9BA 1XMVA 1OIWA 3PUZA 4ERNA 1CS4C 3EA0A 5AWFC 3P4XA 4N0EA 4B2LA 3RAPR 1R4AA 3UWKA 1IN5A 2Q6TA 2H92A 4CRWB 4NYIQ 2A2ZA 4IDPA 5J5CA 3ZJYA 4AKHA 2DHRA 2IYUA 3MFYA 3Q85A 4BFTA 4DB4A 3UIEA 1E2FA 4BZQA 1CKEA 4D25A 3PQCA 1QBKC 2P2LA 3EAQA 3MWLA 4JLBA 1BOFA 1HT1E 2IHBA 1XCMA 3CUEF 3NH9A 5FH9A 3GLIB 3K9GA 4JLMA 1E3MA 1WDTA 1KK0A 1YE8A 3KFVA 3W9YA 4KV9A 2YC2C 2VH5R 1R5NA 4LYFA 4NMMA 5AJYA 2NPIA 1KIMA 1XZPA 1OFUX 2GCOB 1KY3A 4HSEA 3ONWA 3T12A 5GADl 5G53C 2WKRA 3U7EB 4WZBE 5JZVA 4M8NE 2JIZA 4KSBA 3GJ8A 3HP1A 2KB0A 2PZGA 4NHOA 3SHFA 3TQFA 4HLUC 3OAAD 2PCJA 1GNRA 5CM8B 1SGWA 3AP3A 3MRSA 4NZYA 2VP5A 3SU8A 4XTRA 3WHLA 1I2DA 5C4GB 1ZC3A 1D9XA 1E96A 1WRBA 2JLSA 4NDZA 1SVWA 4FMCF 1Q1QA 4R2IA 1E0AA 3G82C 3NDBB 1UBGA 1JPJA 1E2GA 2OUKA 4QHSA 3L0PA 5P21A 4CEIA 4WXRA 3Q3JB 5GJWC 2JJ2A 2FPLA 1OXTA 1E79A 2O8CA 1G5PA 2PL3A 2KBEA 4JLVA 1SKYB 1JXMA 1XEXB 3D3QA 3GQBA 2HUPA 5JHHB 2O0KA 4OHXA 1W36B 1DAFA 3VR3A 2DFNA 3AP2A 3CRRA 1F60A 3AV0B 3HJNA 3RYTC 4XVQA 4A2PA 3RLFA 2C96A 3EPKA 1M34E 3BAFA 5HCNA 3HU1A 4AY2A 2BC9A 1Z83A 2HCBA 5FFMA 1RZ3A 2GF0A 5J4HA 2DFTA 2BDTA 1ZU4A 1NIJA 4TL7A 2YOHA 1Z2AA 4DRZA 2VP9A 2WJYA 1YZTA 1EFUA 2J0UB 3G0HA 1ZYUA 3DKVA 4F4IA 3OFNA 4Q66C 4XVRA 2JDID 2CNWA 3OF5A 3T5GA 2W6JA 5EE9A 1S0UA 2YWHA 2OLKA 1IOZA 1SHKA 1YVDA 2ZI9A 2BEKA 1DEKA 2JLQA 4IDNA 3GMTA 5DYGA 4A6PA 3AF0A 3IEUA 4KCGA 1KAOA 2H16A 2G83A 2ZJYA 3B1ZA 4G01B 5FBQB 1P7CA 4TLBA 3SNHA 3I61A 2JATA 3KKMA 2BM0A 2R62A 4BQSA 1W0JA 2GCNA 4C3ZA 2JLRA 5JCZA 1BYUA 1N6OA 1VKJA 4Q02A 4PSVA 1G1MA 1G291 3EASA 3VU9B 2OG2A 4CT4B 2HF9A 4NYIR 3IILA 3IUYA 1U0LA 1II8A 4TYPA 3KJHA 2J59A 3D6TB 2FX3A 1HE1C 3FTQA 1VG8A 2BMJA 1DAMA 2J0VA 3FGNA 4LHVA 4PZLA 1KKMA 3ZQJA 2XOKD 2QMEA 2DPXA 1XEWX 5FPYA 1MT0A 3EXAA 5KUTA 1RRPA 2ZUCA 3TRFA 1ZVQA 4EDHA 1JB1A 2CCGA 2A5DA 3CRMA 3QKRA 4GDFA 3TVTA 1IXZA 5EP2A 3GD7A 3ZH9B 4BASA 1JR3A 2X19A 2BHRA 3OIWA 5BN4A 3W3AA 2WSSA 4Z1MA 1R8QA 1YHNA 4GZMA 2XXAA 3EC2A 1SHZA 3B85A 3LX5A 2QN6A 4W5JA 1Z8FA 2FGJA 3O8BA 1SVKA 2QEQA 2WJVA 3A6PC 1DG3A 2VSFA 1NY6A 3BWDD 3IPYA 4BZXA 3JZAA 2AWNA 4BFXA 4C0HA 1UKVY 1J90A 2OCPA 3FYHA 4LJYA 2QSYA 3BFKA 2ZI5A 3T5DA 1NKTA 1XCGB 1FQKA 4EPTA 2JA1A 4TLEA 1RVDA 4JL6A 5FOXA 5C1BA 1N6IA 2QG6A 4LRWA 4BLOA 3OZXA 4KVGA 4ZI3A 2QGNA 1UFQA 1YQTA 2H5EA 1HUQA 3QEOA 3IPXA 4JBXA 1QHHA 1AKYA 2OXCA 1HV8A 2IS1A 2PEYA 2VRWA 4MRPA 5FTKA 2P67A 3SJBA 3AVUA 2IHYA 2XB4A 2GHIA 5JRJA 3VHXA 4DLUA 2V1UA 2PLRA 2OLJA 3MUFA 3SS8A 3TLXA 4Q1CA 5KHOC 2ZRJA 2ZRKA 5CM9C 3A8TA 4DLTA 3RC8A 1EFTA 1CR4A 1L4YA 1FP6A 4YDHB 1W47A 5DHAA 3EWAA 1ZD8A 3R8CA 3JZMA 2BM1A 2AKYA 3F5FA 1LS6A 2A7QA 3AVYA 2A5GA 2FZ4A 1RJ9A 3WYFA 1F2TB 1H8EA 5KPJA 3GJXC 3RS2A 2D2EA 2GAAA 1CR0A 2IK8A 4X8OA 4AYWA 4L15A 2RB4A 1U2RA 2WICA 4NTZA 4Q21A 2AFIE 1ZD9A 4DDTA 3GLGA 1ZCBA 3VQTA 3VTKA 4PAQA 4DCVA 5GJBA 2W6IA 4DSUA 1EFCA 3OIYA 1Q57A 2RAPA 3PIRA 4OHWA 5E95A 4HB3A 2WWYA 1WB9A 1G18A 4DLXA 4TYYA 4W5WA 1S9DA 1E4VA 1HE8B 2R8RA 2W6ID 3VU9A 4OQNA 5D3MB 2CL6X 3KJEA 5HE8A 3TR5A 4OK5A 4IEIA 2XJ4A 1TMKA 3VR2A 4Q4JB 1ESMA 2FGKA 2OSBA 3NBYC 4HUQB 4QFMA 4IEEA 4URUR 1BKDR 4B2IA 1G19A 3DZ8A 5DGXA 3DL0A 4BRUA 2J46A 2O8DB 2VHUA 1IONA 1NBMD 3TW8B 5J4LA 1JNYA 3U7HB 2HT6A 1D2MA 4DCNA 4QC2A 2XTMA 3CZPA 4NKRA 1OYYA 4UNQA 4XWOA 4U02A 1ZIPA 3KJIA 2W58A 1WMSA 2FFBA 3HDTA 1FTNA 5LB4A 5JS8A 1Z5ZA 4JLPA 3FMPB 1F6BA 2WWFA 3ADKA 3K70C 1E9DA 1FNNA 2ODEA 4RD4A 4B3FX 3ZZUA 4KBGA 8OHMA 3QG1A 5K8UA 2XZPA 4MA4A 2FSIA 1K5DA 1NLFA 1BO6A 4FMDF 2ZYVX 1WQ1R 2WAYA 1DARA 2MSEB 4M1SA 4S35A 2GVZC 1UM8A 3L82B 1BS1A 1OLOA 4JVLA 1E9RA 3B6EA 4QJ3A 5TARA 1NLZA 121PA 2IX3A 2HYDA 4KSCA 1AS3A 4G5OA 4Y0AA 2ANCA 2EU8A 1KSFX 1MABA 1AJEA 4YLGA 4B34A 1TADA 1W4BA 1UDWA 3DPUA 1G8PA 3NBZC 4YXWD 2NQ2C 4C30A 1K8RA 2K5UA 4WZAE 3SE0A 1XTJA 3PEYA 3C15C 4PQFA 2F3TA 3SQXA 5KSPA 5JWRA 4D0LB 2V7QD 3QXHA 2JCSA 4BLTA 1KHTA 4JLJA 4NE2A 2JLZA 3V4RA 3VX3A 3AB3A 4UNNA 2ZSEA 2IYQA 3IBYA 5EXSA 4DSOA 2RHMA 1VIYA 1JR3D 2BMFA 3IO3A 4LUCA 4G5QA 4V0OA 1LF0A 3GLHB 3W6PA 3LXRA 1W0KD 4O2LA 3FFBA 3ASZA 1DO0A 1KI1A 2PEZA 3AF4A 4IJMA 5FR1A 3ZZTA 2WMOB 1E0KA 4EPVA 1C4OA 2PLFA 3E2IA 3JVUA 1GRRA 3CX8A 4Q9KA 2IWRA 4JS0A 2OO7A 1R8SA 1F48A 3VKGA 3QKSB 5CLLA 1N5JA 4V0ME 4XVUA 1ZM7A 4LOAA 5KSOA 2QL6A 2VP4A 4EJSC 3QKUA 1AA9A 5FUVA 5JJKA 1EGAA 1WCV1 3PFIA 1VTKA 1AQYA 1HYQA 2GCOA 3BFXA 4G3XA 2ZM5A 4RFSA 2EFDB 1KJWA 4ARZB 2ZJ2A 4TMKA 3VKWA 3THYB 4URVR 3ADDA 3A36A 5JEDA 1G9XA 2ANBA 1NL3A 1Z6GA 2FA9A 2HXSA 2I1VB 4JLDA 2VSOA 3R7WA 3WMFA 1X8JA 1XX6A 4TT3A 1Q1BA 1P9RA 3B9QA 1NMZA 5AUPB 4LI0A 1OYWA 2FSGA 2BVNA 2XXAB 5EJEA 1QHXA 3EIHA 4D80A 3E5HA 3RSLA 4RFSB 2GZDA 2C2HA 3RABA 4YMUA 1IJFA 4DKXA 3K0CA 5FI1B 4PQRA 4ZKEA 3W3ZB 3QXSA 3O8RA 5ELXA 3C14C 3EZ2A 3EA5A 1OFTA 4BFUA 1ZUIA 4ZCMA 4E07A 2CNWD 3NXSA 1G16A 2P6NA 1ZBDA 2KE5A 1HEIA 1RFLA 2ONJA 4Q9IA 2FWRA 3AF3A 2O8BB 3E1SA 4OHYA 1P2VA 1T3HA 3ZD7A 3QBVA 4IW3B 3KKPA 4P0TA 1X3SA 3K0AA 3O47A 4PZYA 3KX2A 1G17A 2ZXUA 5EE5B 1KSJA 3PV0A 4IOMA 1UDXA 4LV8B 5H8WA 3Q7QA 5GJVC 1TU4A 5F98A 2OM2A 2F1JA 4LJ8A 4AC9A 5L3RA 4LHYA 4WBSA 1G5RA 3GJ4A 5E7JA 3KQLA 4AKGA 4ZDWA 5KSZA 2YVUA 1QVRA 2NPFA 3MGCA 3ASYA 2OBLA 4C0LA 1FUUA 1OIXA 1N6PA 1UBEA 4MITA 5DYIA 3FHCB 2P0EA 3PEUA 4C7OB 2AWOA 1L2TA 1YU9A 3SQWA 4QOSA 4MGZR 4ZCIA 2C5LA 2P5TB 4NPHA 3QPVA 4NONA 2DWQA 2GNOA 5EP1A 1ZW6A 4LWZA 1J8YF 3FDIA 1I4LD 2HF8A 2NZ8A 2DR3A 2WWGA 1XTKA 4JLOA 4NU0A 4TTQA 3EC1A 4TYNA 2FN4A 4FN5A 5B58C 3W90A 3U44A 3BH0A 4G5RA 4O0MA 4Z8YA 5FTMA 4PO1A 4QBGB 2WV9A 1H8HA 3O8DA 1QG2A 1E94E 4FI3C 2F9LA 3NIBA 4LPKA 4AD8A 4XWAA 2F55A 3AM1A 2FPMA 4UXHA 2IUTA 1QRAA 3BGWA 2REOA 4IRUB 2FEOA 2ZPTX 3AGPA 1SVSA 2PZEA 4QHTA 4WZ6A 2N1BA 3NBXX 4HI0E 3RS3A 2IYYA 3THOA 2FE4A 3QY0A 2C99A 2CJWA 1Z3IX 2GJAA 3QJYA 2VP6A 1Q44A 4FXPA 2QORA 1NJFA 4KYUA 3X1DA 5AUNB 2WJHA 1SVLA 1PJRA 3BB3A 5DN6D 1W4CA 4DLWA 3SFZA 2PZFA 1OHHA 2NGRA 4HUTA 2ZRNA 1T8UA 2GBLA 2O8CB 2WJIA 1ZUNB 2ZRAA 2HYIC 1IJEA 1SVMA 1G20E 1G8YA 3WMEA 1KDPA 1XF9A 4Q4JA 3B7GA 2AN9A 2G6BA 2GAOA 4YMWA 821PA 4DBLC 3RS0A 5HKKD 3BERA 3A4NA 3EZFA 2F1IA 3QXXA 2BIFA 3V9PA 2BMEA 3WXMA 1G7SA 1Z06A 4D4LA 4TT3D 4LHWA 1N6HA 1A5TA 1N6LA 1YZGA 5FPSA 4TMTA 4RZUA 1AM4D 4LHXA 4QGAA 4LK2A 1G3IA 1KI2A 3BH7A 3L43A 4HAUA 3WNDA 4UNRA 4MYHA 4NCJA 4DZZA 1U8ZA 4YMSA 3IEVA 2W2XA 4JT4A 3W6NA 2CHVA 2E87A 3FKQA 4JKYA 1YR8A 3EWSA 1XEWY 3PR1A 1JAIA 4Q19A 2AX4A 2XTNA 4D0NA 1N6RA 2Q3MA 4GP6A 5G40A 5UKDA 4ASUA 3BB1A 4PPNA 2X8AA 1LVGA 3GEEA 4PAOA 3WP0A 1R7RA 2QPAA 5C46F 2ZE7A 1GILA 4W7SA 1E2PA 1YZKA 4C0QC 4US0R 2ZUBA 3QQ5A 3ETLA 3K1JA 3CO5A 2DFLA 3TQCA 4KBFA 2A9KA 1OH8A 2BKUA 1FOEB 3B60A 5H1YA 3B1VA 4GI7A 1ZP6A 1RJ9B 3NEJA 5C2JB 2Z4SA 3RRZA 1UKZA 3L0IB 3PENA 3WRXC 1P61B 3E70C 4OBEA 2EVWX 2H7VA 4CZ2A 2PJRA 2FU5C 3LWNA 4IVRA 3B1YA 4RFVA 5H68A 2Y8EA 4I81A 2E1RA 2ZRDA 1BYIA 3QOFA 2EFHB 2VYFA 1J8MF 1NG9A 2KBFA 3MJRA 4HZUB 1NNEA 1E9EA 2AFHE 4G1UC 1E98A 1XEXA 5DLQC 2LWIA 2XJ9A 4QGHA 4A1FA 4B48A 2OCBA 2OILA 4C0SA 4HATA 4J0QA 4HUQA 4RZ2A 1TUEA 4HEJA 4TTRA 1RPZA 2CCKA 2OFOA 2O8EB 2I1QA 4C4PA 3DM9B 4Z8XA 1CBUA 1ZAKA 4YMVA 3QI2A 2ZS9A 4US1R 2OE2A 4FMBB 5FPHA 3REGA 2C8VA 4KHZA 2BOVA 2I3BA 2QA5A 3C41J 3NDPA 4RD3A 1XRJA 2VHCA 4GMXA 3U6BA 1NBMA 2IYRA 4P31A 4ZV4A 3TSWA 3B13B 1Z6TA 2Q21A 5BQ5A 4D81A 2R6FA 1Z2CA 4QRHA 5L3QB 4PQYA 3NG1A 5G41A 2F43B 5CDFA 4IFBA 2Q9CA 4A0GA 4PC3A 2OAP1 1UPTA 2ZRIA 3A1TA 4P4SA 4LBWA 3W5JA 4EQ6B 1II0A 1OW3B 3TMKA 1UF9A 1P2UA 3EPJA 1T91A 3K09C 1F5NA 3KFXA 1VHLA 1M74A 1X1RA 3N2EA 4PPQA 2VQSA 5FPKA 2VP2A 5F2EA 2CHGA 1G4UR 5EE1A 3T61A 4JVMA 1T6NA 4RZ3A 5FUYA 4CF7A 2ZRBA 2FF7A 4Q1BA 3KTAB 2BV3A 3AEZA 3CRW1 1IY0A 2F9MA 2HCJB 1H8ED 3R9XA 1ONBA 1PLLA 3EW9A 3WNBA 5CB6A 1KY2A 4OHVA 5KNCA 1MKYA 1SXJA 4B44A 1XMSA 3IKJA 2XNDD 3RS4A 4B43A 1G64A 1OH6A 1ZNZA 1NI3A 1ZNYA 4OK3A 1VG0B 4M1MA 4RD6A 2ZAOA 3B1XA 4DT1B 4PANA 1COWD 1XXHA 4NCIA 1XTSA 2GXUA 5E3HA 1MO3A 4Q4AA 5FOVA 5LD2C 3FFAA 4NYJQ 2G77B 1WF3A 3LX8A 4DB2A 4BZPA 2CLSA 3MLEA 4OJQA 2A5FA 5CYOA 4ABYA 4OQLA 5JLJA 3OEHA 5D3MA 3F3YA 2LCFA 2IW3A 5AK0A 1Y3AA 1XU4A 3PCRB 4X8HA 3TKLA 4M1KA 4KU4A 4Q9LA 5FBWB 1P2TA 1E1RA 1RYHA 1XTIA 3RWMB 5BXQC 1XNJA 4EQ6A 2IYVA 3T15A 4MGKR 1CRQA 1SULA 3TSZA 4FD2A 2X1VA 1S96A 1XEFA 3GLFE 2VLIA 1J2JA 4D4JA 2P6UA 3U61B 1Z63A 2W0MA 4HZUA 3X1YA 4B76A 2NO0A 3LQQA 1GDDA 2YKGA 1MRSA 2WOJA 4GMDA 1Z22A 3WBKA 1W5TA 1X8KA 3LNCA 5TY0A 3RSOA 4KITB 3M1IA 5C4MA 4RCYA 1IY2A 4D2IA 1OE0A 221PA 1ZM4A 5EZ5A 4B71A 5C18A 3DZDA 2IYXA 3EG5A 4MQBA 3UMRA 3SYNA 3R9WA 1Q0UA 1S3GA 1KJYA 2IS6A 3IIKA 4Q1FA 1UKYA 4QNMA 2A5JA 2G9NA 2GXAA 1A82A 2PX3A 2W2VA 1DAIA 2WJGA 4RZXA 2A78A 1AGPA 1PZNA 3MMPA 5FTJA 3I5YA 2CE2X 4QL3A 1U9IA 2F1RA 1S1CA 5FBLB 1Z6AA 1GG2A 3RC3A 1E2JA 3X1ZA 3LA6A 4M2LA 2CL7X 3B9PA 2ZSBA 4CGZA 1XD2A 4OQXA 1P60A 1HQYE 2D62A 2DY1A 621PA 1TUIA 1G6HA 3PUXA 1VIAA 1NVWQ 5G3ZA 1N6NA 3CWZA 4PHTA 4HAVA 3KXIA 1GNQA 1U90A 3SR0A 3PJRA 4LY6A 1PUIA 1ZUHA 2W0SA 3QXCA 3FKSD 1P72A 1KMHB 3U2QA 1W0JD 1W36D 2D7DA 4DCTA 3A4LA 5FOTA 4G0NA 1GRQA 4DLRA 1N5IA 2VSXA 1P2SA 1JPNA 2RGNA 2NG1A 5CJ2A 4AI6A 4FCVA 1LNZA 1XBTA 4TQUS 5JHGB 1FW6A 2ZR9A 2ZJAA 5HR5A 5IK2D 2XX3A 2YOGA 3LH5A 1GUAA 3EZ6A 2O52A 3VR4A 1Q1EA 5JCPA 5K8TA 5L3VA 1N6KA 4MUBA 4RSGA 3SBDA 4V02A 3TUIC 4ZIRA 1W1WA 1HH4A 3HR8A 4WIAA 4ZKDA 4F91B 4C2TA 3OFND 1EX7A 2NO6A 2HT1A 2ZYWX 1KO1A 4LJ4A 3CRVA 4F93B 2B8TA 4OHZA 4GL2A 1A2BA 4TTPA 4BLRA 1QHIA 2FFQA 1QF9A 4B32A 1XD8A 4QG7A 4BRWA 4Q4HA 2PMDA 2DB3A 1I4DD 1TNDA 2C04A 3TH5A 2J41A 2O8FA 4C0AC 3GLIA 2ORVA 2VA8A 3GEHA 3C5HA 1E1RD 4XTCS 1F2TA 2R6CA 4Z51A 2G1JA 2P65A 4Q7JB 5LD2B 1ZNWA 1ANKA 3PUVA 421PA 2DBYA 2GEUA 2AXNA 4LGMA 2IXEA 4WA7A 3AQ4A 1XFAA 2CE7A 5JS7A 1G3MA 4US2R 4L5BA 3AP1A 1UADA 2OFWA 4WXPA 5CLQA 5AJVB 3K8YA 3RWOA 1CR1A 2YJTD 4TL8A 4EAQA 2J87A 2B8WA 1MH1A 3UXMA 5JSZA 4Q7MB 2WIAA 4OI0A 2FJUA 4FCTA 5HPYB 3K9HA 1TAGA 3QBTA 3SBEA 2DYKA 4HAYA 5LPNA 4X8MA 2XNDA 3KL4A 4JSTA 1OB2A 4DDVA 4ZDJA 1A1VA 3L0OA 3NWJA 2IC5A 4EUNA 1Z0IA 2C9YA 3D8BA 4KXFB 4PO9A 4R2HA 4BFWA 3KQKA 1UAAA 2IXFA 3K70B 2ZU6A 3X2SA 4AWXA 1N3BA 4LJ7A 1U8YA 2QUZA 1JALA 1VYUA 2QRZA 2KSQA 1CTQA 2FH5B 2HDNB 1HQCA 1KKLA 1P6XA 2IYWA 2GXQA 3A1VA 3N70A 1OKKD 3AH8A 1SQ5A 3UG6A 2FOLA 1U81A 5JMTA 1CRPA 3AKYA 3K53A 1DO2A 2GVDC 2Z0MA 4HLUA 5JI3E 3RS5A 3PUWA 1AS0A 2BCGY 2ZJOA 2RGAA 2AKAB 4AK9A 2ERYA 1CJTC 2ZR0A 2RCNA 3IDQA 3TGPA 1NSFA 2IYTA 4GOKA 5B30A 1G4AE 2PMKA 1JBKA 5EUMA 1YR6A 4DC9A 1OIVA 4QGFA 3ZD6A 2YWEA 1MO6A 1TU3A 2EYUA 5JBQA 3QF7A 1FPMA 4DLZA 2GWHA 1PLJA 1NJGA 1N25A 1I4TD 2QT0A 1Z47A 2LKCA 4P3YA 4TSFD 3U3OA 4E03A 5DO9A 3DVLA 1UJ2A 2NOAA 3K09A 2AD1A 3LAWA 2XTZA 1OSNA 3MAAC 2WAXA 2WZQA 3EIQA 2ODWA 1FZQA 1HA3A 2IWHA 3VMFA 2ZAMA 4X8LA 2J7KA 4DUGA 1RYFA 4CT5A 3K70D 1UEIA 2F1HA 4JBWA 3TJZA 1GKYA 4HLDA 4EFLA 1KO8A 2WWWA 4DSTA 1NN5A 3DOEA 4I1UA 4BLSA 4LX0A 1NMYA 1GKIA 2QE7A 3QKSA 4M1TA 4BFZA 4F38A 4MYTA 4Q1AA 2BJWA 2QGZA 4YQFA 4OJKA 3OEEA 2H57A 2OESA 2EFGA 5E7MA 4E22A 1XJCA 4WAUA 2NO9A 4B3CA 4DHEA 5FUXA 5KDDA 4JLNA 3THYA 2AK2A 1S2MA 2PX0A 1QZXA 3KKNA 3RDPA 4HLQB 4OKSA 3ZGXA 4IOKA 4K8OA 5JI2E 4B35A 2O5VA 1P9WA 3LO5A 4CW7A 3TSOA 2GA8A 4LC1A 3K0FA 5SZIA 4TN1A 1TL7C 1OF1A 4KFSA 2G0TA 1TEXA 5J4VA 1E2IA 4BEBA 2IS4A 1OH5A 2F43A 1F2UA 2ZRCA 4IDQA 4UJ3A 3OEED 1UKEA 2GJ8A 4LV6A 5CIWA 1VG9B 3AKEA 5CYPA 2P3SA 5IF9A 4XJXA 1GOTA 2QE7D 2AXPA 3KQNA 1O3YA 1G8HA 2QAGC 2CBZA 4DIDA 4M22A 2WSMA 3H2YA 3I8SA 3P26A 4LYHA 2ZETA 3CB4A 3W34A 1GM5A 1N5LA 1A7JA 3MCAA 4IFEA 2ZRGA 4QBIA 4BECA 4B73A 2YV5A 3NHAA 1NN0A 3F0TA 4A8JB 4M9QA 1JR6A 2AL7A 2XSZA 1JQLB 3B78A 1S9HA 1EX6A 3K9NA 4BUJA 2D74A 2GEVA 4CEHB 3WY9A 2JJ1A 1US8A 4DWJA 5DH9A 4IVQA 2AR7A 1VMAA 4B6EA 2WOOA 3GLGE 1BMFD 1ZM9A 5HKKA 1GZSA 3SYLA 3T1OA 1KI6B 4BWYA 1HTWA 2FMXA 2FV8A 4ITRC 3REFA 4A8JA 1TEVA 3P20A 4MKHA 1N0WA 4UJ5A 3T1TA 2RGDA 3EZ9A 1QG4A 3VKHA 1OHHD 4JT2A 2RGXA 4B74A 2C98A 4OYHA 4POAA 3CNNA 4BFSA 4KAXA 1EFRA 1M6NA 2HLDD 1T4GA 5IT5A 4WOPA 5FUWA 5HE9A 1U98A 2Z5FA 3IQWA 2D2FA 1YRBA 4XH9B 1E2LA 4M1YA 4PPFA 3P27A 3CNOA 2QAGA 3UKDA 1KI6A 1KO4A 5JWHA 3THWA 1EG7A 4BLPA 5L3SA 1CR2A 3LVQE 4AYTA 3ZVLA 4B6FA 5IDVA 4QNRA 4URXR 3K0CC 2V3CC 3CH5A 3R7WB 4NCNA 4OK6A 4HDQB 1AIPA 4TZ0A 3UANA 4MKFA 3AGQA 4DEXA 2X2EA 4W9MC 2WWXA 4TLDA 2WWIA 4URWR 2QNRA 4EJSB 2X77A 1NY5A 4MKIA 3IHLA 3T06B 3DKPA 4L16A 3I5XA 4DDUA 4KO8A 1N5KA 2PCLA 4JLKA 2LKDA 2ZR7A 4RCZA 3U7FB 5B57C 2A30A 2R6GA 4ESVA 1KAGA 1SKQA 3ZLJA 2GK7A 5F3WB 1Q20A 4KLZA 1XPUA 2WIBA 2PT5A 5KDOA 3ZS9A 1W36C 2H1LA 4IHQA 5F9HA 3QSYA 3K9LA 3S1AA 1ZNXA 1GSIA 2OHFA 4PC1A 4TMXA 4I1SA 5CITA 4TQ9A 3TUZC 3N5CA 1R0YA 4U00A 2ZUDA 1TTTA 5TMPA 1RIFA 4ACAA 5KO2A 2ZTSA 4FMCB 1Y63A 4M1WA 2YYZA 3FWYA 4EPWA 1MOZA 5EE3A 3THXB 3GJ5A 1R5OA 4TLAA 1IN4A 4KJZA 4UKDA 2GILA 2Z4RA 5HZKA 3HYRA 1RRGA 3SJZA 3DDCA 2MSDB 3U4QB 4KFTA 1N0UA 2OBMA 2TMKA 4V0MA 4HAXA 3PG5A 4MDEA 2RGBA 4MRSA 3CIOA 3DMDA 1GL6A 1YRAA 1Z29A 2CCJA 2R2AA 3FE2A 2ZI4A 3QKTA 5DHFA 1N0VC 3GFTA 1E9SA 2CVFA 1D2NA 5JFGA 1X86B 1YKSA 1ETUA 4QKQA 1W4AA 4HAZA 5CB8A 5TXGA 2JLVA 1II9A 3CBQA 5A0FA 4BE7B 1GTVA 4HDOB 4EJSA 1S8FA 1G3RA 1JJVA 1FL9A 4B47A 3GP8A 4E5UA 4R7ZA 5SZHB 4OI2A 3SI7A 2UZ3A 4QBFA 3U4QA 4P4UA 2AHOA 5KSYA 2ZRPA 3VR5A 2MSCB 1AN0A 2QENA 4L9WA 3ZZ0A 1E9BA 3L0SA 2ASEA 1C9KA 2IUUA 5F9FA 3R8FA 2XB2A 4PC2A 1ZC4A 4WVFA 3C8UA 2ZS7A 2Q3HA 2GRJA 3WRYC 2C03A 3RRNA 4F4CA 2QROA 1KNQA 4C0BA 2ZJZA 5KPDA 1T0HB 4ARZA 1E2DA 1D8TA 1KI8A 2EW1A 3CNLA 1E99A 5EXTA 2JGNA 2NMVA 4O25A 3L8YA 1M8PA 1BH2A 4TL9A 1FFHA 4I99A 5FOWA 2FNAA 3TE6A 1W0KA 2YZ2A 3GLHE 1KDTA 2O0JA 3K0FB 4QJ4A 3RVBA 1DAEA 5BYKA 4A82A 5K8LA 4AKIA 2JEOA 3ADCA 2MMCA 3BFVA 2R44A 1XD2B 4R9UC 4LYJA 2V7QA 3A1WA 1G7TA 4Q18A 4QM7A 1XTRA 1FQJA 2E9SA 1VPLA 4YXWA 1GRNA 1NVUQ 4OQMA 2ZS8A 3BS4A 3L8ZA 4MUAA 1UBCA 2BEJA 3BK7A 1EWRA 2KI5A 3LFUA 4MRRA 1XDBA 4Q48A 1VYVA 3LVRE 2R9VA 4MRNA 3A58B 1G7CA 1X8LA 3SN6A 3KQUA 1OV4A 5EXPA 1EWQA 3QF4A 2QMOA 5IRCD 3LBHA 5EP4A 1Z07A 2O8DA 3DHWC 4P4TA 2ZSDA 3OEHD 3VX4A 1M7GA 1BIFA 1RRFA 4DDWA 2BKEA 1UEJA 2A3RA 4JVNA 4BGDA 4RY2A 1V5WA 1MO5A 3CF2A 4CVNA 3OIVA 3A4MA 4EIWA 1DG1G 2VHQA 1MV5A 2ZVPX 2GTPA 1EK0A 1AZSC 4S2EA 4H1UA 2L0XA 3W6OA 1COWA 3QPUA 1GP2A 4ESHA 1P62B 4PFSA 1R2QA 1JECA 4B2PA 2J7PD 1QDEA 4Q03A 4Z54A 4IOJA 2IA5A 4PAMA 5DI3B 2FFHA 4PPGA 1ZD1A 4AURA 4D4KA 1MO4A 2ZI6A 4PR0A 2CL0X 3QE0A 2CJWB 2ZJ5A 2XGJA 4P32A 3TIFA 4EFMA 2ZE6A 3VNVA 3ZYCA 2UVQA 3HU3A 4GOXA 4D4MA 4A36A 2YINC 3WP1B 3RNLA 3G5UA 2EWWA 2WKQA 1W2GA 2Z83A 1IBRA 2XITA 2XAUA 2CHQA 1CF4A 1G5TA 2IEYA 1NP6A 4QM6A 1RW4A 3AVPA 3IHWA 3ZVNA 4KI0A 2J0SA 2RGEA 4LBYA 1SZPA 2FPKA 3UK6A 3EIEA 1J99A 3U5ZB 2WKPA 3CPHA 2JJ8A 3FHOA 4RVCA 4F4JA 3K0SA 1PV4A 4MRVA 1XP8A 1TF5A 1U0HC 4NBSA 4M53A 4LDJA 2ZRLA 3A1UA 4DLYA 1KGDA 3KDSE 3CR8A 5JEEA 2NZJA 3U6KA 4NCHA 1DPFA 3PITA 5BN3A 2J7PA 1GVNB 3PEVA 3T34A 4HB0A 3C16C 2VHTA 1NMXA 1DAHA 2VBCA 4NYJR 2QY9A 2J45A 2V54A 1G21E 5KU1A 5EUQB 3U7GA 3P32A 1Z0JA 2BMDA 2IYZA 3FMIA 1UBFA 3LY5A 1ZM3A 1E2NA 1Z0KA 1R0XA 2C78A 4JKIA 5DI3A 1VHTA 1CU1A 1VCOA 4UNPA 1CJMA 2ZRFA 3SYKA 3W8RA 3NC0C 4ZDKA 3AVXA 4AKEA 1ZJ6A 2WJJA 1G8FA 4FW9A 2HXYA 2Z6VA 5FL7D 2NIPA 3AKDA 3BIFA 3CRQA 3NKVA 1E1QD 2BBSA 2IUSA 3R20A 4TL6A 1NVVR 1ZMXA 1HURA 3CX7A 3KXLA 4TLCA 5DE3A 4AIIA 2DFKB 4DCSA 2CXXA 2C9OA 3TAUA 3WHKA 2YWFA 3WMGA 4QHYA 3MWYW 3WYGA 4DIEA 1FMJA 2V1XA 3RHFA 5IHPA 4PHGA 1G3QA 2JLYA 3BRWD 1ELOA 3Q8XB 3THXA 3QVUA 5AJXA 2RHDA 4Z1MD 2WSSD 4IOLA 1LS1A 1E32A 2IXGA 4L4UA 3M0EA 2YWGA 1EXMA 2J3EA 4JYCA 4QGGA 2ODBA 5LB2A 2FSHA 3ZIAD 4ASUD 5SZJA 4IKEA 3NTUA 4HB4A 3CM0A 4C2UA 3LBIA 1WXQA 4C0KA 4GP7A 5JWOA 4FCWA 4JJZA 2QP4A 2HJVA 4MGIR 5GJCA 2YOFA 5KNDA 2CLDX 3BB4A 1Z08A 1H65A 3CLVA 4NH0A 4D82A 1IN6A 1E2EA 2FZLA 3LD9A 4G5GA 4A0RA 5HTKA 1G3UA 4A92A 3R9IA 4D0GA 1D6JA 3KJGA 1VCIA 1OFIA 2ZEJA 3WYAA 1Q12A 2ZE8A 2BWJA 1W44A 2BCJQ 3LRPA 1E4YA 4GPTA 5GVRA 2J0QA 4OQFA 5CDFE 4M9XA 5AJZA 2CEAA 2CMKA 1VDZA 2J9RA 2EWVA 2ZVQX 2GZAA 2N42A 2QBYA 4A9AA 2V8OA 4EPYA 1G6OA 1IM2A 2VHJA 3QIAA 3MWJA 4CYMA 4F92B 3KZ1E 1TQ6A 1XTQA 3GLFB 2H8KA 2OBNA 3Q5EA 2O8EA 5H70A 1MRNA 3QUSA 4II7A 3L2OB 2ZQ5A 5CK5A 1DOAA 3I62A 1KDOA 4IVPA 1CXZA 3CW2A 3SJAA 4M21A 5DN6A 2ZRMA 3IIJA 1ZRHA 1QHNA 1Z0FA 2V6IA 1KSHA 5ANRB 3GCGA 4MDFA 5D3QA 2Q0HA 2R6AA 3SDZA 5G3YA 2OEPA 4QJ5A 4UQOA 1E0SA 1KZ7B 2QTFA 4C7OA 2RGCA 3CZQA 4YMTA 4PO8A 1QHHB 1JR3E 1XXHE 2OT3B 4HAWA 2F7SA 4HLCA 4B3BA 4JYBA 3QVVA 3BE4A 2VF8A 2GCPA 3VR1A 4Q5IA 4NYMR 4XOIA 2RKOA 2VL7A 2QP9X 2NTYC 2ORWA 2GEDA 4DT1A 5E7IA 2XZLA 5FR2A 3MSXA 1HY3A 1H8HD 1X1SA 2SHKA 2V9PA 3AUYA 4W5HA 5EZ6B 3U3KA 2PH1A 1KYIA 4FIDA 3AKCA 3CWQA 3OHMA 3KKQA 2JJ2D 3K0AB 3LQRA 4RKFA 1CIPA 3DM5A 2ZYUX 3CKLA 2CLCX 1AS2A 1CLUA 5A4JA 3X1WA 4ZI2A 2FDCA 3SOPA 1SVOA 1JAHA 1YZUA 4HZIA 1KK3A 4K81B 1QVAA 1D5CA 3GLFA 4PZZA 2Z43A 3OIUA 1L8QA 3SEAA 5EE0A 3OAAA 1IAQA 4R71A 4BLQA 5SZKB 2JIZD 4LYAA 4DXAA 4UNSA 4H9GA 3KQHA 3FHTA 2RMKA 3KXKA 4GNKA 1JQJC 6Q21A 2YHSA 5TV2A 2XEXA 1E0JA 1QHYA 3VNUA 4Q47A 1CJVC 1GAJA 2IS2A 2B7CA 4M9SA 4GBMA 4JBYA 2Q3FA 1PLKA 2DWOA 4OI1A 1EFRD 3IIMA 1T9HA 3ZVMA 1GL7A 3AVQA 1Z28A 3C5CA 3ICQB 3J81k 3WNCA 3MJHA 2GJKA 1RC8A 1TPZA 1TQ4A 2Q9AA 3ZS8A 4A0FA 1DBSA 2BBWA 1GWNA 3U3RA 5DSZA 4V0NA 5AR1A 1SVIA 5HCIA 3I1FA 2NO7A 3NC1C 4A8JC 3GFPA 2CDNA 1DTSA 4JL5A 3F8TA 3I72A 2QQ0A 1P73A 2J1LA 1W5SA 2VF7A 3EX7C 4EPXA 2OAQ1 4HYYA 1XMIA 3K0EA 1L7VC 1Q22A 3MWKA 2JAQA 3HPRA 2XSZD 5L8VA 1NIPA 3LW8A 4JJKA 4LPSA 4UXJA 1DAKA 2GXSA 3HPQA 3BJIC 2JLUA 3JVVA 3KUDA 3IO5A 3FVQA 3VR6A 2FG5A 3M6AA 1XJQA 3CR7A 1FUKA 3I4LA 2HEIA 4CDGA 2HV8A 1YR7A 3GPLA 3UATA 2G88A 4CEIB 3LLMA 4R98A 2QU8A 1KJZA 2GBLC 2EFEB 1TF7A 2ZRHA 1B0UA 1K6MA 3V00A 3ZIAA 5TB5A 1KDRA 1NRJB 5KNBA 3CONA 1QHGA 1O87A 1TQDA 4GOJA 5DNYB 4B33A 2PBRA 4GSYA 4YDSA 2WMNB 5L3QA 4URZR 2YNMA 1IN7A 3B2EA 3GLIE 4LBZA 1RKBA 1ZINA 2B21A 1LF5A 1LV7A 4B3XA 2OCAA 2ZU0C 2V55B 1II8B 4M0LA 4TQAA 4LCBA 2GESA 1XWIA 4ZIRB 4GRAA 1KO7A 3LXXA 2QZ4A 3FB4A 4BFYA 3TK1A 3U44B 3AVTA 1E1QA 4MYUA 521PA 4JVSB 1YZLA 5FL7A 4PSAA 3FPAA 4G5SA 1MR3F 3A1SA 3IBGA 2C9CA 3T35A 3GJ0A 4OI4A 1ZIOA 5FI0B 1JJ7A 2QM8A 1DE0A 1HT2E 2F6RA 3VHLB 5FL3A 3I3SR 1FX0B 2RH5A 1M2OB 3B1WA 4RD0A 5E4FA 1OT3A 4DUGD 2EQBA 5JRZA 4C0JA 3B8HA 2WPDD 1OXXK 4JIMA 5FOSA 1JI0A 2QRNA 3O8CA 4QBHA 2A5YB 5J4YA 1U9IC 1OH7A 1Z6YA 4PXAA 4TSFA 5K8IA 5FOUA 1OXUA 5DISB 1AKEA 1AGRA 3W5IA 2FSFA 4A6XA 4C9BA 2H18A 2IYLD 1Q1ZA 3SFVA 3QXJA 2VEDA 5B2ZA 4ZCLA 2ZI3A 4Q4LA 2IEZA 1P4SA 4BFVA 2D06A 2WHXA 1FX0A 2REXB 3B5JA 2QMUA 5GVSA 1XCPA 3MG9A 2UKDA 721PA 4DSNA 2O8BA 1WBBA 3MD0A 4RD2A 1T5IA 1WP9A 4I1VA 4U5XA 1E2QA 2EFCB 1C1YA 3QF4B 1U94A 4LZZA 4KVAA 5J40A 2NO1A 2QPTA 3M4YA 4PX9A 1E69A 1SXJB 4TYQA 1KK1A 2J5XA 3RRMA 2GETA 1OKKA 3NH6A 2OZEA 3HR7A 5AUQA 4TWZA 5FTNA 3RS7A 3CF0A 3TVDA 1ODFA 3BC1A 3AVVA 5FBVB 4ON9A 1PVOA 4JSYA 3BOSA 4AG5A 4CEJA 4KFRA 2D7CA 4FMDB 2FFAA 3FOZA 1OB5A 4IXMA 4HDCA 1ZU5A 2VP0A 1L4UA 2KJQA 1T8TA 1KMQA 1US8B 5LBIA 3RANA 1S3SA 1WBDA 3QPWA 5A5GA 1T0JB 1YZNA 3EPHA 2QT1A 4XIGS 2ZE5A 3CPEA 4LV5B 4LJ6A 3UPUA 3U60B 1KK2A 3DOFA 4RJLA 5BN5A 4Q7KA 3DEFA 5M04A 1T3LA 3GLGB 2GDJA 1XJ0A 1E9AA 1GFIA 3P1JA 4PHHA 1N2CE 3FMFA 4K46A 5EXXA 3TUJC 1E2MA 2QTHA 4AYXA 3KKOA 2QM7A 4A4DA 3UMSA 4D6PA
chains in the Genus database with same CATH superfamily
1W7AA 1PP4A 2RKBA 1Y6QA 2RG7A 3AMVA 4IG4A 2R6DA 5AK5A 3WJAA 2MSLA 1QTIA 5TQ0A 4MUYA 3UT5A 4MYCA 3A37A 2JFHA 2WT9A 4RD1A 3NATA 5TPZD 1ZHOA 3VO8A 4J0EA 3UJNA 3DLBA 4KWTA 2BMAA 4FYWA 1RJDA 3D6NB 3NTLA 1KMHA 2IHTA 4Q93A 3NT2A 5CT8A 2DBZA 1YS1X 4XD7D 1JN0A 4JYMA 4AO6A 4ILEA 1HI9A 1NDUA 1NV9A 4PBTA 4TMZA 4LC0A 4X1IA 3CUSA 3WYDA 5L3SB 1W48A 5FPTA 2DWPA 4YONB 1NI4A 4YT4A 3G17A 4BJ3A 2Q27A 1P8AA 3DV0B 1JEDA 3AJ8A 3NBKA 4PCLA 3OM8A 3QJGA 3QHQA 3PRYA 1IAVA 2Q28A 4GZLA 1NXTA 5AI9A 1PGPA 3EEOA 1HG1A 2BKVA 1PG5A 4K0KB 2P69A 1IHXA 1OJLA 2BGKA 4Q1DA 2R6R1 3HVRA 1T9GS 1QOPB 1IXSB 1NXVA 3ADBA 1VCMA 2RHJA 1JDVA 1VIDA 3CURA 4IAOA 4OM7A 1EESA 2GKSA 2Y0CA 2ZREA 2Y67A 3CX4A 3EARA 5HF5A 3ZGYA 1QWOA 5ICGA 1ADCA 3PVSA 4WCFC 4TMFA 2WSYB 5IEJA 5IK2A 5JC1A 1ARZA 4CLRB 4P5PA 3LW7A 5KTPA 1YZQA 4ZQCB 3W8NA 1AV7A 4RV5A 4OREX 3SE7A 2H65A 2Y66A 3PFFA 4Z53A 3IT3A 4NBUA 1RXYA 1V5IA 2DWUA 2FZVA 2ZULA 3E6AA 4BQFA 5AJUA 1U0BB 1KEUA 1UK6A 2YFHA 2ZUWA 3MIZA 4LC9A 3AF6A 2UUAB 4G1EB 1JS1X 1JR2A 2QGFA 2WM9B 2YC4C 1DELA 1LBTA 1XD9A 2C8KA 2PZJA 3EXHC 3QH4A 4CM6A 4XXHA 5JYEA 2Z8YM 4ISBA 4OYRA 2W2NA 3TSCA 1RYZA 3SIRA 4UM5A 4YCNA 4V0KA 4GT1A 4C4TA 2QYOA 1TYCA 1I3KA 3OKFA 4N4AA 4LXXA 1OWOA 4C4OA 3BIOA 2V7GA 2WUEA 1Y48E 1X77A 4NP6A 4OSOA 4DUZB 2IF0A 4HB2A 1UMCB 3H19A 3VR5D 3OQNA 2IL1A 2VC2B 3JPWA 1IMOA 5ECDA 3EJ6A 3H3XA 4O5OA 3DT6A 1W73A 3MGGA 4LJ5A 1GU7A 4TMVA 2G1KA 1RHKA 1IB0A 4HQKA 5GZ1A 4PQEA 3JPYA 2JLWA 4G24A 1T26A 4E5VA 1P19A 1E18A 3ONFA 5E4JA 5E9QA 4U7HA 3FDZB 1W4ZA 4LSGA 3CZ5A 2YICA 1GTMA 3HHPA 1J7KA 3D6AA 1ZK2A 2G1AA 2IYEA 2HJSA 4BBPA 2Y2UA 4N1AA 2W6JD 4YIKA 4YC7A 1KSGA 1ZJJA 1N2JA 2GSDA 4EJ0A 5DX1A 3HS3A 2Y1DA 4UATA 3K9CA 4YACA 5F76A 2GF9A 4RJJA 2Y68A 4LHZA 5CYGA 2X9VA 2WUGA 1DQPA 4FFWA 5BSVA 1WHSA 3TSAA 3AVOA 4EYGA 3KOUA 4G97A 3UJBA 2R48A 4XVHA 1J2YA 5ALKA 1Y9ZA 1W6RA 2EARA 3L7IA 3T38A 2ACWA 4AMGA 5BUSA 1S4QA 3ZUGA 2LIPA 3EGWA 3T1VA 5C80A 2H2HA 2Z8YA 5JDCA 3E48A 1GLGA 4PE5B 1A4XA 2WNHA 1QE0A 2XNKA 5THXA 3ROPA 3U9LA 2AT1A 2NLOA 3URKA 2YWRA 4C1NA 4J2HA 1BDMA 2ORIA 2XA1A 4XD7A 5TC4A 5TVKA 3TOSA 5B36A 2DT8A 5CDSA 3P0HA 1ZN2A 1R3UA 3QEJA 5DLDA 4TWJA 3WLQA 2HV9A 3CUWA 3GFRA 3P2JA 5KOJB 2PHZA 3CN9A 3EXEB 4HRAA 4D9MA 4DYHA 1EFHA 2BHSA 1VQ1A 2Q5IA 4MQLA 3STTA 4W7IA 2H7CA 4WQMA 3R8XA 3AJ9A 4AN0A 1K4KA 3GFGA 4OMCA 1XVIA 2ZVJA 4KFUA 2QDKA 4MVJP 2A3NA 4LQLA 4MICA 3W5UA 3ZHQA 5A2GA 5A4AA 1LNSA 5EHGA 5ARBA 2GJSA 3VMMA 1Q3HA 4DA6A 1I2MA 1OD6A 2IT1A 4JOQA 2GBCA 1B43A 4KR9A 3B2QA 3PQ2A 3O4FA 4N5LA 3NCHA 4QXMA 1GU0A 2EGUA 4A16A 3QMVA 4F72A 3GRZA 5FOQA 5DIZA 4IDHA 1TVKB 4H59A 1U63A 3GJ7A 3AHIA 3D1LA 2QSZA 1I30A 3Q15C 2J9YB 3ZWBA 3KQPA 2UZIR 4NBNA 3ROKA 4RJ2A 4ZYVA 3PXDA 4WESA 5DWDA 1QP7A 3ULKA 3RIXA 2B5VA 3U9SA 5JG7A 4C14A 4C4AA 3DVAB 5TJ9A 4X1KA 2IPXA 1CK4A 1SAYA 1K8XB 1ZDMA 2J0UA 5BWMA 4OVKA 1Q83A 3F8SA 1HZZA 4Q24A 1M7HA 2Q8QA 4DDHA 1T9GR 1QGOA 2X2FA 3EGDA 3H1BA 5BQFA 3P2IA 1MN6A 3WL4A 3M6VA 4RTKA 5IX8A 4ZCSA 2CF6A 4V38A 5C31A 4IR7A 1ISSA 2G3YA 2FJ0A 4FINA 1WXDA 1L5KA 3WQSB 1VYHA 3X2FA 3ZVRA 4B79A 4UTPA 1AMNA 3TQQA 2EL7A 2H29A 2WVJA 4TSKA 3SXUA 1BCSB 5I4CA 1E9CA 1NT4A 1NR5A 2DETA 1DAGA 3BSWA 3V1YA 3EMKA 3SHVA 1CY6A 3W2EA 2D1QA 2DY0A 3OESA 4BHTA 3Q11A 2B92A 3FTDA 3HSYA 4R16A 1PKEA 1D2EA 1TO2E 3LUAA 2AOWA 3TCNA 3NJ8A 4B75A 1GPJA 1GQSA 3N3AC 3KL2A 4R8VA 2WD7B 2I91A 4DLSA 3R3VA 4DFDA 1T3SA 1M76A 5D7BA 4NFLA 4XRRA 4BPBA 4P33A 3Q5DA 1UOPA 4L9SA 2JJ1D 4A0HA 2EKQA 2PJZA 5I51A 1FUYB 1NF3A 1Z45A 1NVVQ 1Z0DA 3FW1A 3OQVA 4RDHA 4V2UA 5E1DA 2WZCA 1KAMA 2PT7A 4CKYA 2NVWA 1JG6A 2AXEA 3GLHA 3PGVA 1G8GA 4XYGA 4XM2A 4Y6QA 5EP3A 1IBSA 2YFKA 3R5HA 4ND1A 2ZSFA 3GJTA 3U0BA 3FPHA 2X76A 3BD7A 1GUZA 3KT8A 4J8PA 4OD0A 4QTTB 1ZI8A 3OLWA 4I55A 4QBTA 1VYTA 2Q8PA 2ODNA 1X7YA 3LUCA 3A9TA 4PRKA 5KOYA 4IDBA 9GPBA 4ARBA 3Q3VA 1I51A 5EJMA 1PS8A 1S3IA 5JVDB 4EJFA 4DG5A 2OHHA 4YWHA 1EDZA 4FP9A 5A7GA 2AZXA 3VDQA 1CJBA 2VYVA 1TT5A 2NZYA 5T8KC 4PHFA 1AZTA 3TM4A 4H1VA 5CDGA 1DGQA 4E09A 3BGIA 2FRDC 3KB1A 2BONA 5L95A 3PXGA 3KZVA 2BELA 3CLSC 1ND5A 1IULA 4QARA 3L4EA 1XB2A 4OL0A 5BYJA 1A71A 3D54D 2YNMD 3WMRA 4P4NA 2D6FA 5K0LA 4YCAA 2DERA 1UZLA 3HDGA 3LQ4A 3RAEC 5TDHA 3A7EA 1KI7A 2MR6A 4PQRA 4G1FA 1QIDA 4LBVA 2AN1A 2AYXA 2G82A 5EVCA 3GFOA 3AIMA 3OA0A 2EYQA 1VCNA 1T1RA 5HYVA 1SBTA 2RAVA 4QXAA 4DZRA 5HQ3A 5NLLA 3V4LA 2XRFA 3QFRA 3WV4A 2NU8A 1HKUA 1FNMA 1PNQA 4LS3A 2G5TA 5DTIA 1RQRA 1P5HA 3ZTTA 3GZNB 5CCEA 2JLXA 4AS1A 1DCMA 3TAHA 3ORSA 3TSYA 2CVOA 1LRJA 3JRNA 3B5IA 3FF1A 3PR3A 4ZOLF 3ZWMA 1NSTA 1M1YE 1ZH4A 3SZRA 3EUWA 1Y7IA 3B9RA 1JMKC 2B98A 4MRAA 1Z5VA 2XGSA 2AV6A 4FKMA 2QVYX 1ZY2A 3F5DA 3BRCA 3CSDA 1LVUA 4RVUA 4LXYA 1PYGA 1XRPA 5JY1A 3ANXA 4FXOA 1X7YB 2VJBA 5B7QA 3EA0A 1U7WA 3FAZA 2HBZA 2XCIA 3P4XA 4L4XA 4N0EA 4RANA 1AB6A 3QYFA 4D42A 2HRQA 3RAPR 1Z4KA 2B9EA 3PLAE 3E3NA 4BKUA 4LA4A 2Q6TA 5JCOC 1JIXA 2JFVA 3RBXA 2A2ZA 3ORQA 4QULA 2OCKA 5J5CA 1FTGA 4LFAB 4AKHA 3ZXSA 3UMGA 1I32A 4BVKA 4BFTA 5FHRA 3L5OA 2CXSA 2W48A 2HMAA 4E46A 1WUTA 1AGYA 1EM8A 3VRHA 1I3LA 3RIGA 4BZQA 5LOVA 2WJPA 1IZ9A 3RQIA 1JIIA 2AQ8A 2P2LA 3MWLA 7AT1A 4S12A 4JLBA 2ZJ1A 3EWNA 1XCMA 3AEUA 3FUWA 4E5DA 1I94B 5IBQA 1NLMA 3IPCA 3ML1A 4WUTA 1HDIA 3JX9A 2YC2C 4ETMA 4NMMA 3VYUB 2NPIA 1XZPA 4GQIA 4YK7A 1KY3A 5GADl 3ONWA 1MEEA 1QH8B 5EJIA 1MC8A 5AKHA 4D57A 2WKRA 2ZDGA 3U7EB 4O63O 4QOEA 5KINB 2H2FA 1KU0A 3BDIA 1IQ0A 1EZ4A 1NC1A 2C4UA 3H6HA 5F33A 3NQ41 3T4PA 5CU7A 4D79A 1E5XA 1JVSA 1JT2A 1N77A 2BFAA 1HDOA 4L9RA 4LOLA 5KIAA 5CM8B 4DC1A 3AP3A 4NZYA 2VP5A 1KYZA 3QW2A 3WHLA 2DJIA 1FBTA 1OLSA 1ZC3A 3WDMA 5LNK6 1D9XA 1C3VA 1WRBA 2ZFUA 3KYJB 1SVWA 4FMCF 3EG9B 3WQRA 4W63A 1Q1QA 1HOXA 1H9CA 1E0AA 5H02A 5KYVA 5EGNA 3NETA 1MENA 1FP2A 1JPJA 4R41A 3RT9A 2NSJA 1QH8A 2P9BA 3PC8C 5FEMA 2OXTA 1ABEA 2ZWMA 4W7HA 5I6DA 1DMSA 5M2QA 5FWDA 2BD0A 1DXYA 3Q3JB 4WXRA 4DCPA 1SRQA 2FPLA 3PHIA 4QSMA 2VJMA 4Z4FA 4HL6A 4HXYA 1L3IA 2G8NA 1X42A 1JJBA 1NYQA 2MT9A 4KB5A 4ZXFA 3UKJA 5K20A 4GM0A 1XEXB 3EDQA 3GPCA 3GQBA 4JLVA 2HUPA 5E6UA 4OHXA 5JHHB 1W36B 4XPIB 4B3RB 1DAFA 2X86A 1YHZA 4MS3A 3UY4A 2DQKA 3DHNA 3AV0B 3VR3A 5JNTA 4PS1A 1PWEA 1YI8A 2ID4A 3DZGA 1PL8A 1QV9A 5HCNA 3HU1A 4O8ZA 2ZIZA 3R3XA 5D00A 2BC9A 1UOEA 1Q7GA 1MJGA 1RZ3A 5J4HA 3LLCA 1IOVA 2PFKA 2ZBRA 3ONDA 1B3RA 4TWAA 3MJVA 4AM8A 2Z5GA 3SK0A 3CKMA 3N86A 2X4LA 4OLJA 4PVDA 4EVQA 3ZD9A 4DIKA 4YP5A 4BO2A 2VP9A 1Q6YA 1EFUA 1ZYUA 3NT5A 2YUTA 3W9BA 1R0CA 4WOJA 3WB9A 4Q66C 3CVJA 3RAJA 3GA7A 2X13A 1I9CA 4PLPA 5E6SB 4TRJA 2V59A 1MAAA 1S0UA 2OLKA 3PT9A 2Q3LA 1DUSA 2ZBUA 1WEKA 1F2VA 1ZI9A 1P1KA 2BEKA 2NPOA 2O3RA 2ZI9A 4IDNA 4JODA 4MLCA 1KFKB 2OKGA 1ZMBA 2YV1A 1RM4A 3CHYA 4KCGA 4LZOA 2FEPA 2H16A 5IM5A 2G83A 4JLUA 3B1ZA 2J07A 4RDXA 1FJGB 1SCDA 1SR8A 2GK3A 3D81A 4H6WA 4KQKA 3SNHA 3I61A 2DQ4A 1WKCA 3GLKA 2XUFA 4BQSA 1BW9A 5COQA 1VKRA 3FNRA 1K06A 2BE7A 2YYAA 1BYUA 1YUNA 3RF7A 2PD4A 4QUIA 1XCJA 1VBNA 2K7FA 3I9V1 1JFLA 3KYDA 3IILA 3I6ZA 1FFSA 2V5AA 4PRZA 4RSMA 2PUBA 5GPBA 1N9KA 3RYIB 2VXBA 3D6TB 3PHCA 5CVEA 4E08A 3GAZA 5K3BA 5EIBC 1JLRA 2BMJA 5KSWB 1UFOA 1T29A 2EG9A 2BAGA 2E37A 2VA9A 3EEFA 4QDUA 4DC0A 4FSXA 4EMBA 4O4HA 4CJXA 2DPXA 2PMFA 2C97A 2OC9A 5FPYA 3OZFA 1YOVA 3PNSA 4F5EA 1EFVB 1KY5A 1FU8A 2BH9A 4CM4A 3DQZA 3CRMA 4UBOA 3BGVA 6REQA 5SICE 1HFKA 1YZYA 3PB3A 1NJ2A 3OZWA 4EHBA 1BDJA 4Z99A 4BASA 1FY2A 1YV9A 2X19A 2XR1A 5K3FA 1IEVA 1AV6A 1NFFA 4ZHSA 3W3AA 5BN4A 4Z1MA 4KH1A 5ICMA 2PKWA 3EC2A 3P8ZA 4Q82A 1U5AA 3D4PA 5ELMA 5AW5A 1SVKA 5E4TA 3CLUC 3U4GA 2XT6A 2X1LA 1NY6A 3Q9UA 3WLKX 1V16B 2NUTA 4Y9RA 5KJ1A 3PD1A 1ZQ9A 2HM7A 4ER6A 2IY8A 4Z9XA 3JV7A 4Z49A 3K15A 2C3OA 4EHNA 2VJMB 3WKEA 5BN5B 2CB9A 3RYFA 3GH1A 3C7TA 3DULA 3QUCA 1KIFA 1GPUA 4DCCA 4QGSA 5C1BA 2PQ6A 3BVPA 2QG6A 3TLCA 2E49A 1V8ZA 2VS1A 4KVGA 4X41A 5C1DA 2QGNA 3LQ2A 3TW6A 3QKIA 2PVPA 3E3OA 3F1KA 1HUQA 3PVZA 5FUBA 3GGCA 3QEOA 3OHPA 5ALIA 4BNGA 3G1UA 1V9SA 2AUTA 2JNWA 2ZB3A 4CN9A 3DBHB 3DUFA 3FSGA 1F8YA 3IMGA 1JDTA 2OXCA 4ZZ1A 2XBMA 1Z4PX 3KB8A 1XZ8A 4G8BA 4MWZA 5FTKA 2PLWA 3AVUA 5F1PA 5ILGA 5DFAA 1YDMA 1EP3B 2QF7A 1EBBA 2XB4A 5JRJA 3WK9A 1H94A 4I9GA 2E5WA 1UFVA 4YHHB 5FI3A 4YJHA 4CR6A 3H8JA 1LU9A 1VPTA 1U0GA 4Q1CA 4R81A 4WXHA 4MYDA 2D2VA 4WHMA 3T8YA 2ZRKA 3IP9A 5J1TB 2HAEA 1EFTA 4EFDA 4YRTA 2FR8C 1WVGA 3EWAA 5ICCA 3N87A 2DR2A 2VDKB 3JZMA 4REQA 2AKYA 2IELA 3DAYA 4MI3A 5HDBB 4IBOA 5ADWA 1YJXA 3PUKA 1Z75A 3GGGA 1RJ9A 4OUKX 2JF0A 1H8EA 1NQUA 2C7VA 2C8JA 3EC7A 2FP4A 2GAAA 1QIIA 3IOYA 2RD2A 4JZYA 1RHQA 2H4ZA 2HJWA 2O3QA 2R8EA 4X8OA 3JQAB 1XNHA 3OZUA 3OU6A 3W05A 2CSXA 4D98A 2XA2A 1GFWA 2WEKA 3H9BA 1IVYA 4Q6WA 5KWVA 5GJBA 2W6IA 4RK6A 4BMCA 1RAIA 3AZQA 1Q57A 2FG6C 4KNWA 4YCJA 3UHAA 4HB3A 4AJHA 3NGLA 3OC6A 2WFZA 4KWHA 1G18A 2V65A 2GF2A 1XVUA 2Z5VA 1R50A 2R11A 4OQNA 5FNVF 3GLVA 3PVCA 3GJSA 5HE8A 2XCSB 1T2UA 4JJ6A 1OYVA 4R8KA 1V37A 3FZGA 2WG2A 1XRLA 4EZBA 3UJPA 3KQWA 2HLNA 4P3OA 3G0BA 2FGKA 4Q4JB 4WKPA 4IUDS 4C6HA 5LZ2A 4G0YA 4D02A 4FOLA 4IEEA 3N28A 1JEOA 2QTLA 1KGSA 2NXJA 3GPBA 1DJLA 3HXPA 3HB9A 1G19A 4URUR 5DGXA 3DL0A 4BRUA 2J46A 5DLPA 3TW8B 4F84A 2C5EA 4KX3A 5C0OE 1JNYA 2JAPA 2Y1WA 1D2MA 4DCNA 2YTZA 3ROQA 1ZIPA 2P9HA 3CW9A 2W58A 3I53A 3HDTA 1KJJA 1NU8A 1K1EA 5KVSA 2V3WA 2QZPA 5ADVA 5JS8A 2XH8A 1RYNA 1T1JA 1ID8A 1OAAA 4CV1A 4O0LA 1KDZA 2IIVA 5K3SA 3ADKA 1L1QA 4E3ZA 4BVLA 2ODEA 4B3FX 2HPZA 1OILA 4XIIA 4MV8A 5T57A 4F04A 3JASA 4MZDA 1UKCA 1FFBA 2AG0A 2UZ1B 2V96A 2XZPA 5KYUB 4D74A 4MA4A 2BHTA 1FDIA 1YASA 1NSYA 2EZ9A 3S5JA 1BO6A 3CXUA 3T7KA 1V2HE 2V0GA 2IYPA 3WLIA 3LPNA 3GDGA 4NV3A 3LLSA 4S35A 4QEKA 3WTBA 1J0BA 1M2VA 1RHRA 4CKBB 1E9RA 3B6EA 4OP3A 4Y2VA 1ONPA 4C2AA 1YMQA 2PBFA 3LM8A 2LXNA 1ZVJA 1IVNA 2QX6A 3EBPA 3OZIA 4X66B 3L0BA 2ANCA 3NT4A 3CLRD 4EI8A 1I6MA 1MABA 1QUEA 5IANA 4YLGA 2B7LA 4B34A 1PT7A 1W4BA 1UDWA 1AJEA 2O1XA 4MWTA 3JRXA 3NBZC 1YE3A 4I4CA 2CLKB 2XCOA 3AEXA 4KAJA 4WZAE 3SE0A 4H6VA 4OBWA 5HNKA 2OHOA 1EINA 1D0VA 2V7QD 3B38A 3FBWA 3FUCA 4RLQA 3WADA 4D0LB 4BLTA 3VU1A 1E59A 3HL0A 4NE2A 4BO9A 3JALB 2NAFA 4FFRA 4WKNA 3FXAA 2JZCA 3D8RA 3SSAA 5FYDA 1JFVA 1VIYA 3IO3A 1AUPA 2UVPB 1RHUA 3GLHB 2NUAA 3LXRA 1J2RA 1QTNA 3ASZA 3KXPA 2GZRA 4II3A 2HK9A 4IJMA 2XVYA 4WEQA 4I1PA 2WILA 3FA2A 1X80A 3WGKA 3H5LA 2V7XA 4JS0A 1D5WA 1YDFA 2XE7A 1PF7E 4X6YA 4RGVA 5JAQA 1ZSYA 3W7BA 1N5JA 1Z82A 3BSYA 2HTEA 3WIOA 4GH5A 2IYNA 5LP1A 5KSOA 1CB7A 1DC5A 4EJSC 3TECE 1VRWA 5BT8A 2XUHA 1WCV1 1VTKA 2DQZA 3VR6D 1AQYA 2FPGA 1BVHA 1MPXA 3BFXA 1AKMA 4G3XA 4IXTA 4O33A 2W98A 2WE8A 4Z6KA 2II6A 3H18A 3VKWA 4TMKA 4XLLA 2ZQYA 1G0NA 1G42A 4UCFA 3A36A 3ADDA 3FPSA 1MRZA 2PWAA 1NL3A 4LDZA 2FUNB 2X2OA 3TKYA 1Y6FA 1CY0A 1JHAA 1L7XA 3UJ8A 1Q1BA 2IP4A 2XZTA 1P9RA 2R8OA 3OLYA 1N4AA 4BV3A 5LU9A 4II2A 1FCJA 4ZHQF 3T0FA 3LOQA 2FSGA 1QO0D 1TCBA 1KXJA 2BVNA 2QJWA 1O6CA 1UH5A 1T9ZA 3G6KA 3KVNA 1QHXA 4D80A 4P3KA 4PWYA 5F51A 3SHOA 3C8ZA 3JVEA 3RSLA 3JSAA 3ZCUA 1UT8A 3LFHA 4WKOA 2C2HA 5K51A 5BSMA 3K0CA 3W3ZB 5ELXA 4XR4A 3D3WA 3BMQB 2B8EA 2NXCA 1PAUA 3Q1KA 3AU9A 1ZUIA 2NUBA 4QXQA 3L49A 3S2SA 4BFUA 4E07A 2OB1A 3S2GA 5JAZA 3VVMA 1SD2A 4IUCS 5EWJA 1RD4A 2HO5A 1FVOA 2E4UA 2H08A 2PD6A 4Q9IA 5KTKA 1NOKA 3C3KA 2GH1A 2GSWA 5FPQA 3EAGA 1VE7A 4OHYA 2Q4EA 3MOIA 1SXQA 3GX1A 3TXAA 5K8CA 1LSJA 3KKPA 3L6BA 1BDBA 1P2GA 1SUIA 4IV8A 5FORA 4IFIA 2BGGA 3OTOB 3KX2A 4BMVA 3QPDA 5EE5B 1KSJA 2C54A 1UPBA 1QX4A 1UDXA 1PEYA 5T4HA 1WSDA 2RHOA 1RZUA 3CG0A 5BSFA 2OM2A 2F1JA 4LJ8A 4AC9A 3LYLA 5HZGA 4WBSA 1G5RA 4MUXA 3GJ4A 4KPFC 1WTCA 1J6UA 2OWDA 1TMOA 2PZBA 5E7JA 3KQLA 3I9V6 3IQHX 4HCJA 4JA0A 1XZEA 4CG3A 1F8XA 3KBBA 1GQFA 1PEDA 3SLGA 4RAOA 4CDMA 4EARA 1Z5NA 3FHCB 4EHFA 2W2OA 3PEUA 1FTQA 4MUEA 1DZIA 4K7JA 4CQMD 1JJIA 1FFYA 4ZI7A 2X8BA 4QOSA 4MGZR 2X2PA 4ZCIA 2P5TB 4IGEA 1ZGBA 5EPOA 3QPVA 4PG4A 3FB1A 2GNOA 2FSUA 3P9YA 4V0SA 2D1FA 1E62A 2RH4A 2HF8A 4JLOA 2NZ8A 2DR3A 2BFNA 3ABZA 1SWWA 3A9CA 2JLBA 1Y8RB 2NZWA 3IDAA 5HILA 5KWJA 4S1WA 2PXCA 3EC1A 4FGUA 1T8PA 4CM8B 4DR4B 1EVQA 2XKJE 3DH0A 3BH0A 1AKNA 3FBGA 2WUVA 3R7BA 4A1OA 4N03A 4O0MA 4Z8YA 3DP7A 2X7HA 3IKVA 2GD2A 4L8FA 5FTMA 2NUAB 5KMGB 3BJRA 1V11B 3O8DA 2OV1A 1FNSA 4J29A 1Z6QA 2GAFA 1XN4A 3JQCA 4GZ6A 4UMDA 1NC3A 5K3DA 5JAIA 3AIKA 4UXHA 2OXEA 3BGWA 2REOA 2VOJA 1M5TA 2Q1WA 3M81A 3PIIA 3AOEC 4QHTA 1P45A 4ALMA 2N1BA 2XB9A 1AHPA 4R01A 4PZCA 3AFMA 1FVHA 5DTEA 3G6WA 3LWBA 1SBQA 5E2AA 3ROEA 5JS2A 5BWLA 1EUQA 2W93A 3ZDDA 2NP7A 1GNVA 1P0MA 2X7JA 2FPPA 4E2ZA 3LS2A 3N0WA 2MSKA 2RBEA 1Q44A 3PXUA 2Q1XA 2PU5A 2O7QA 1SC9A 1NJFA 4KYUA 2HI0A 1IUNA 1SCQA 5EJ2A 5AUNB 4A0QA 2WJHA 1PJRA 4BNLA 1ZRNA 5A5VA 4DLWA 2J3LA 4N8DA 4HN9A 3O82A 1T8UA 2GBLA 2G40A 1XALA 2WJIA 4BFCA 1ZUNB 1F8FA 1RU3A 2ZKIA 2ZRAA 2ZTLA 3WWPA 2HYIC 2C82A 2BKXA 1G8YA 1XQ9A 3JATB 4S3MA 3RYHB 1T6BY 1JIVA 3WMEA 3WLJA 4UD6A 5AK4A 2A7XA 2AN9A 3OTIA 2GAOA 4I9NA 3L3BA 2BTQA 821PA 1RBMA 4CN8A 4DBLC 2GD1O 4LNHA 2XBLA 3OZDA 4M9RA 2B61A 4OHPA 4AP5A 3A4NA 3KWJA 5HKKD 4ALLA 3RROA 5LM3A 3DL4A 3V9PA 2ZUFA 2ZSJA 2DUUA 2GASA 1UDCA 4N0MA 3EUAA 4BWGA 1G7SA 4UVIA 1N75A 1Z06A 2LCQA 5AW1A 4AJ1A 3RKRA 3BL6A 1AF4A 3M9WA 3EK2A 2ERCA 1YZGA 4WBXC 5FPSA 1C4XA 2FRDA 1SCAA 2VHWA 3MRVA 1JLSA 2WM8A 3L7JA 5B4UA 4TMTA 1DRVA 1AM4D 1M2VB 1ZXLA 4LHXA 3AM5A 3PF9A 3HCAA 4HAUA 1DO8A 5G1OA 3DVSX 1NP7A 2C9DA 3AEYA 3T9AA 1U8ZA 4DZZA 1KH2A 3IEVA 2W2XA 1VGVA 2CLEB 3E7XA 4JKYA 4PRLA 1E3QA 3BCHA 1JAIA 1T5TA 4EENA 4PU0A 5HP4A 1VCHA 3DZBA 5TMEA 3Q2IA 3LHKA 1MX9A 3RHZA 2NU7B 1I3NA 5K6RA 2HSZA 1U8XX 3T5AA 3WP0A 2X8AA 1LVGA 1TZJA 1PR3A 1R7RA 5C46F 2EEPA 4JT8A 4XGQA 4EL0A 4W7SA 3ZE2B 5LLTA 1Q11A 1NHWA 1QSGA 4DM4A 2D1YA 3VH3A 4US0R 3SC6A 2BR3A 4RZQA 1U7TA 2Z2IA 1NZFA 4H15A 1M2WA 2GA9A 3FPJA 2C2WA 3CO5A 2DFLA 5ALVA 1C7ZA 1GGFA 3VDRA 4MUIA 2OTCA 4KBFA 4DIFA 2FTKE 1OH8A 3M1AA 3QBDA 3VNSA 4WN9B 4DHWA 3RK4A 3GNTA 1K66A 2Q1UA 5E38A 3IP5A 4LOJA 4GI7A 3IUMA 4B6SA 1ESZA 3JATA 4PO3X 1QE3A 1NVKA 4BOYA 4QDOA 1YB5A 1JMYA 3UYKA 4MVJE 1X13A 2BTQB 3KEMA 3LIIA 3WRXC 2P4EA 4EMSA 1NWHA 3R5XA 5IM4F 2PJRA 1D2GA 1DC4A 2CNOA 5LMCA 4IVRA 3DFUA 5H68A 4NU8X 5MFPA 4TKUB 2XUQA 4DMGA 4Y6LA 1UXJA 5LA6B 3G5TA 4BMZA 4RABA 1IDOA 3P0FA 1SOVA 3QYAA 4L4SA 4AZTA 2OPBA 3GBVA 5I45A 3HO6A 4Y67A 5IZ4A 4ZD6A 1P18A 2KBFA 1JLLB 2AW5A 4ZT5A 4HZUB 2C57A 3N2NA 1E9EA 5J59A 4YRNA 1Q14A 1XELA 1XEXA 5DLQC 5B53A 3RIYA 1QK5A 4RWZA 3BDVA 2XJ9A 1Y81A 3A1CA 3CUYA 3RFXA 4UHBA 2BZ1A 2GPTA 2OILA 3DBRB 2QDXA 3EISA 3GARA 5ER9A 2BM8A 3IBCA 5CA1A 1DKOA 4J0QA 4HUQA 5JRDS 4BTVA 1CD5A 1TUEA 4CG0A 3NBQA 1N1DA 1P7VA 4NABA 3FNFA 1C30A 4YAOA 1GEEA 4A7PA 4FR5A 3VI4B 2P1RA 3O4VA 5JAPA 2J6IA 3ZDAA 2OE2A 4FMBB 2IDKA 5DKFA 5FPHA 3REGA 4E5MA 2C8VA 1BE0A 3NDPA 4MYRA 3SVZA 2VHCA 5F9MA 4QASA 2C7RA 2JHFA 1JLLA 2BKLA 1MMFB 1TZKA 1GLNA 5BQ5A 3K35A 1VMIA 4YP9A 4DCJA 1N7IA 2CF5A 2J3IA 1Z2CA 3CVXA 1O95A 4JV5B 4FSHA 2WJAA 4ZAXA 1AQ6A 2Q9CA 3R3YA 1KPGA 3DUFB 3HJGA 3O0DA 4P4SA 3VR2D 3VHQA 3UOAB 4EB3A 2FFJA 4EQ6B 5C9ZA 1LDGA 1II0A 4R3NA 4QU0A 1P2UA 4N8SA 2WAMA 2AJCA 3KFXA 2X1MA 4EB0A 4I9UA 1FJ2A 1X1RA 3MT0A 4UW9A 1E1DA 1U04A 2IH5A 5D6NA 1WZIA 3EDMA 1YULA 4JVMA 3TB6A 3L8HA 3BJZA 3L0DA 2C4TA 3KQMA 4XCVA 3H75A 3L77A 4Q1BA 1GAEO 3AEZA 5D1NA 1IBKB 1Q7RA 2F9MA 1JLMA 3DW1X 4IDGA 4CU5A 3P97A 3B70A 3EW9A 1PLLA 3L1UA 4Q7EA 4WUVA 3TZCA 5KNCA 4FFDA 1RJFA 1AK9A 5B4TA 3IKJA 2C2GA 1OH6A 2E4VA 4MQUA 1G64A 3QWAA 3WRYA 1GG5A 4WBNA 3GDFA 1Z8DA 1VG0B 2XGOA 3Q7TA 4RD6A 2FP4B 1FSFA 4RMNA 5FA8A 4B8WA 4DT1B 4CL3A 2NU6B 4NCIA 1IWOA 1L7AA 1KKUA 1D0SA 3B9BA 3P0IA 3PGA1 2GXUA 2H1HA 3S4YA 2PR7A 2PPVA 1MDFA 3MLBA 5LD2C 1Z34A 4O4JF 1RJEA 4V39A 3LX8A 4EG7A 1THGA 1MAVA 2CLSA 3EQ9A 4ZOAA 3ZV4A 2JCXA 4LOHA 1QTQA 2QK4A 4KIUA 1E8DA 4KE6A 3AKZA 1I7NA 3OEHA 1AXEA 3ANTA 4C20A 6PFKA 3F3YA 1RT9A 3A4VA 4J94A 5CLIA 3KQYA 4CMIB 1MQ9A 3CNBA 4B84A 1HQDA 3RJ5A 3I6BA 3OT1A 3NBAA 3AERA 1J2TA 1RYHA 1C8LA 1RRVA 1K86A 1XTIA 3PUHA 3HUFA 1HT3A 3QU7A 2I1WA 4QUBA 1NBWB 3OZEA 3RWMB 2PDAA 3F74A 4O4JB 4Z9BA 3VC7A 5LMNB 1BW9B 3WICA 3HDHA 4FD2A 4UAVA 2X1VA 2BTEA 3HEAA 3GLFE 3U61B 3H7IA 3CX3A 4G2NA 4J16C 4JEHA 3I0NA 1QLHA 4QYTA 5AI5A 1GDDA 5IC5A 4H7EA 1MRSA 3KKKA 5LXTB 4HNHA 3ZDCA 1XK7A 3IV7A 3U80A 1X8KA 1OZ0A 5TY0A 1EE1A 3C97A 4PGFA 2BUBA 2EHDA 4RCYA 4N5HX 2PL1A 1B4DA 3BZBA 1M6VA 4AJPA 1MZPA 3M3PA 4JB8A 4NSNA 5C18A 1WHTB 3OQ6A 3P2EA 4HNQA 2PM8A 1M1YA 2NVBA 4QNMA 2CKDA 1A0OA 1BCRA 1SNYA 3WZLA 4JJGA 1DAIA 3A32A 3D6HA 2A78A 1PZNA 2O4UX 4RZXA 1OFGA 1NPTO 3DFIA 3ZEIA 4QL3A 1U2GC 3MELA 1S1CA 4FFNA 3VBCA 3STXA 3HNPA 3ORYA 3X1ZA 1PX0A 2CJXA 4AFNA 1ZMTA 3JQGA 4GQAA 2AJTA 3CGWA 3TOXA 3B9PA 3LKVA 5FD8A 4CGZA 2IV3A 2DY1A 1HDZA 3SLRA 1CJSA 621PA 1G6HA 3H05A 3PUXA 1ISHA 5JIBA 1VIAA 2ZBPA 4IYRA 1NVWQ 3PRHA 1BNCA 1JX6A 1N6NA 2CJFA 4PHTA 5D6OA 4NK5A 1UDBA 4CMIA 3PJRA 2NZUG 5L4LA 3TGLA 2FSVC 2W0SA 1CFJA 1Q3KA 3FKSD 1NQAO 1KMHB 3IAEA 1W0JD 5IJ0A 3IYLW 2PN1A 4CKCB 1ZHHA 4YUWA 3G2OA 5ALQA 3KNZA 4G0NA 5IXJA 5KZMB 1RKQA 2RGNA 1QO7A 3E23A 2JGEA 1UXHA 4FCVA 1XBTA 5JHGB 5JMPA 1NGSA 2ZR9A 2ZJAA 4RYDA 5GTDA 2E18A 2YOGA 4Z3OA 2XCQA 3CUKA 2H11A 3LH5A 1I0IA 3AUTA 4AS3A 5EKXA 5DXAA 5KNBH 4M0MA 3EXG1 2Z2JA 5L3VA 4V02A 3MCVA 4GMKA 1IG0A 1ZH2A 1WPRA 1HOTA 1U8TA 3GRFA 2OD7A 1LDNA 1JDJA 2R86A 4L78A 4B7ZA 4ZKDA 3UA4A 2COUA 5BMOA 5KKCA 1D2RA 2AW3A 1QQBA 1EX7A 2HT1A 4BU1A 3IAM1 4FHCA 3L6UA 1YK0A 2J30A 1H69A 1A2BA 3QLTA 4TTPA 5LA6A 4WBNF 1QHIA 1YA8A 4FYVA 4E2WA 2VUHB 4CLRA 1WZUA 1QR2A 1XL0A 1USKA 1CLEA 2AVDA 2J0EA 2V5UA 4QG7A 1OQAA 4Q4HA 1QIJA 4ITVA 3CC8A 3KKZA 1I4DD 3MAGA 4UCXA 3ZWAA 1TU0A 1ZITA 2R4UA 3QELA 3TH5A 1SH7A 4FZ3A 3RO7A 2E4WA 3GLIA 4DADA 1LBSA 1CUCA 2ORVA 3OZTA 3H1EA 4I4TA 1E1RD 4XTCS 4CFSA 1F2TA 3BKXA 3HU5A 4FR0A 4REOA 2FRVA 2G1JA 4ZVVA 5C5IA 2P65A 2GZMA 4M89A 2FOXA 4BRWA 5LD2B 1ANKA 2FUEA 1SOMA 2YYYA 5IAJA 1PL7A 4B87A 1CNMA 4LGMA 2A9QA 2IXEA 2YCLA 3IUQA 2DULA 1M1UA 3M83A 4YP1A 5IVHA 4O4IF 5JS7A 3SR4A 3O4JA 3T5PA 4DV6B 1PZGA 4L5BA 1PR6A 1UADA 3G89A 1EEHA 1WMEA 3ZLUA 5CLQA 1MXFA 1CR1A 3C4VA 3MOGA 4DPLA 4I6GA 1UQTA 1OBOA 1VL6A 2B8WA 2PSHA 2UDPA 3RTCA 2EV9A