2FHSA

Structure of acyl carrier protein bound to fabi, the enoyl reductase from escherichia coli
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
258
structure length
258
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/biosynthetic protein
molecule keywords enoyl-[acyl-carrier-protein] reductase, NADH-dependent
publication title Structure of Acyl Carrier Protein Bound to FabI, the FASII Enoyl Reductase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 83
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fhsA00
2Y1GA 1JA9A 1DLIA 1ZFNA 1LQUA 5MGBA 1KC1A 3CSDA 3AI1A 2O7SA 4O0LA 5DP1A 4ONEA 1ISFA 4RF4A 4PN3A 5EL0A 3EVNA 3DBLB 5JYEA 4UREA 4WK6A 3SEFA 3PPIA 3V8BA 3PQEA 4R1SA 2W4QA 5EERA 5ICMA 4NFHA 2VHWA 4D7AA 2X5OA 1BXGA 4XDYA 3AM4A 1PU2A 2DU8A 1XYGA 3BMNB 4TVOA 4EUEA 2H63A 3IL2A 3GPIA 3G79A 1GCUA 2J3KA 5AXBA 2O3TA 3UKOA 2NLOA 4BIIA 1G1AA 3JQAD 3V5NA 3H3JA 4YQZA 3WSVA 4CMAA 1RYDA 1NVGA 4YAIA 3W1VA 5G0UA 4QECA 5JCXA 4FFLA 2DLDA 3E5MA 1MB4A 4HFMA 2Q99A 1OC4A 3PEFA 3AY6A 1B0AA 1AHIA 3PDUA 5EMHA 1VL8A 1QSGA 3R0IA 5JDCA 2C59A 1GR0A 1OI7A 4EBFA 1U3WA 5HS4A 1Z45A 3EK2A 3ST7A 2ZQYA 4PG5A 1LUAA 1ZBQA 2D4AA 3GDFA 3OJEA 4K26A 1ENPA 4LSMA 2I9PA 4G81A 5A9RA 3AW9A 1M66A 4E32A 5AQ1A 2RHRA 1E5LA 3WQQA 1E7YA 2H5LA 4J2OA 1FDSA 1B16A 5AVOA 2CNBA 3BAZA 2YYYA 2BH9A 2QRJA 4AJHA 1KVSA 1QG6A 1TA4A 3VKUA 4BQPA 4MVJA 3E5RA 4E0BA 1EQ2A 1Z73A 4BO9A 5COBA 1XIVA 2AEFA 3GVIA 4UVIA 4E12A 4IGFA 4J1NA 2OO5A 1YBAA 4BNKA 1NQAO 3JQFA 2X1HA 3OJLA 5DCWA 2PNFA 3VDQA 1ISGA 2JJYA 5U1PA 1QYVA 1T4BA 5DT9A 4B3IA 2VYVD 5KJ6A 3WJAA 3TSCA 5A4DA 1DB3A 4RVUA 3ZWPA 1WAMA 2RHCA 1EUZA 1R0SA 1UXKA 3AOEA 4CMCA 4KP7A 4FDAA 1QKIA 2Q2QA 4Q3BA 2B5VA 1FDUA 4HFRA 1P44A 2D0IA 2I3GA 3JYNA 3V2GA 3ITKA 4YXFA 1DRWA 1KEUA 2Q49A 1MP0A 2UVDA 3BMCB 2BFOA 1KOLA 3QA9A 2IXAA 3ASVA 5I8ZA 4BNMA 1HYGA 1CQJA 3V2UA 5T5QA 2BGLA 4WECA 3JQDA 3DAFA 3VAZA 1BW9B 3DMYA 1K6JA 1E3LA 4RQTA 2DAPA 3BHJA 3H7AA 5EPOA 4PRLA 1Y8QA 4WNCA 4WCFA 1ZEJA 3U0BA 2HLPA 4J7CA 4RDHA 1C0IA 1XU9A 1U7HA 4HWKA 3GH3A 4HADA 4EDFA 3ZV6A 5IJZA 2GO1A 2UDPA 2B4QA 4RVFA 3PHHA 3H5RA 3LT1A 3QSGA 1HLDA 3ZWOA 1DO8A 5JO9A 3NV9A 3TPCA 4URFA 1C0LA 2BI8A 4OAQA 2WYWA 4CV0A 3OF2A 2NNLD 1YB5A 5F5NA 3VPFA 2P68A 1KVUA 4YAKA 2LDXA 4DMLA 2I6TA 1DC4A 4J7XA 1ZMOA 4XJTA 4BL5A 3P2YA 1UP4A 3ZNPA 1VKNA 4GLOA 1DC6A 4H3VA 4W9NC 1FK8A 1X0XA 4WJZA 1Y9EA 2P91A 4CODB 3BA1A 4CMEA 5KOIA 4QSMA 4EUFA 1I5RA 5TF4A 3RUFA 1KETA 3K30A 4D43A 4DIFA 3WR5A 2NVUA 1K0UA 3ONDA 3ANLA 1EBUA 2PGJA 2EJVA 4II2A 3KO8A 3CH6A 3DHEA 1HWYA 4NG5A 3Q2KA 1E3JA 2B0JA 4XGIA 4QEDA 4PCVA 8ADHA 4NPCA 4M54A 4E3ZA 2I67A 2PZLA 1B3BA 4QTZA 3W8FA 2Y1EA 1GQYA 1W4ZA 1TB4A 3F1KA 3KYCA 3H65A 1ZKMA 4UVDA 4BB6A 4BNWA 1Y1PA 4CLOB 1X1TA 4YYZA 4E5PA 3AY3A 4MVJD 1DEHA 3ZU4A 5KVQA 4GMGA 4E5NA 1IOLA 3OQ1A 2HDHA 4Q3EA 2HCTA 4XGNA 3M1LA 4IDDA 3FR8A 1QYWA 5DDIP 3VZPA 5IDXA 3K6JA 1R4NA 1EBFA 3GDGA 2FHSA 1A27A 1N2SA 1MV8A 1U2DA 3IS3A 4FSHA 4GGPA 2P5UA 1V35A 2YDYA 5BSGA 4FC7A 1CF2O 2AXQA 3GNQA 4IY1A 5KNLA 1X1EA 4HP8A 5TRTA 3QVOA 1Z74A 5H81A 1TXGA 1H6CA 4JP2A 3QQPA 4IGEA 4NBUA 4BO7A 1D8AA 2A35A 4A73A 1ZK1A 4LISA 3AUUA 3D7LA 2NTNA 5JNLA 4QXMA 4RL6A 3E1KA 5CAEA 2NQTA 3EYWA 3OH8A 1ENYA 5JDIC 3L9WA 1E92A 3JQ7B 1PR3A 3DMTA 2OUIA 4D45A 3LZ6A 3KOUA 1EDZA 2GN6A 1NBOA 1BG6A 3I23A 2JKVA 1M6HA 1N9GB 4ZICA 4MVJF 1MA0A 1QP8A 2XPCA 4YT2A 5G4KB 1ML3A 2CF6A 2HMTA 1PZFA 3JTMA 1ZSYA 4D3FA 4KDEA 3JD1A 1HE3A 4IDFA 5DBGA 1KEPA 3HADA 5IXSA 3PHIA 1WZIA 1T24A 2YZ7A 1B7GO 4IINA 1LDGA 1XEAA 2DC1A 3WYCA 2C29D 5I7VA 3VDRA 2QIOA 2GGSA 3K5PA 3X2EA 4WGGA 4PLGA 4IJWA 3F1LA 3M2PA 3O8QA 3F3SA 3VZRA 2EGGA 2IDZA 4QFCA 4U7WA 4AJOA 3LC2O 2HSDA 3GRKA 4KUHA 3QVWA 4XYGA 1P9LA 1OC2A 4P38A 1XDWA 3KUXA 3BMOA 3PYLA 1WP4A 1Q7GA 1EEHA 4GVXA 4RF2A 1E1LA 3UFXA 4CUKA 3RFVA 1TT7A 3OJ0A 1EVYA 3DC2A 3FPCA 2I3AA 1HRDA 3VPGA 1AE1A 2LDBA 3I9OA 1BXKA 3OEWA 3CZMA 1C1DB 5FI3A 5FWNA 2CDBA 4GBJA 3WNQA 5JDCC 1U5CA 1KC3A 1ORRA 4CL8A 3ON5A 3VZSA 1SOWA 4HNHA 1VPDA 5KJ1A 4CM3A 1P74A 5AXDA 3ROKA 3NYWA 4I08A 3PRJA 4D3DA 1U7TA 3WYEA 2VHZA 4G2NA 3U4HA 3STHA 1OBFO 4EEZA 4WLFA 1NHWA 1UZLA 5BQFA 3JQFC 3ABIA 2GLXA 4AFNA 4HKTA 1C1XA 4G65A 3I9NA 1EZ4A 3ZW9A 4CLXA 5EIOA 1HSOA 1E7MA 1VL6A 1ZK2A 2B35A 3B1KA 4GQAA 2TMDA 5KVVA 1TT5A 1P1IA 2A92A 2BRUA 5TT0A 4WLVA 1I01A 1UXGA 4FIZA 4Y6PA 1H94A 4GSLA 5DULA 1NFQA 3AOEC 3CINA 3D3WB 2W2KB 3O38A 3Q9UA 4MKZA 3KXDA 1SB9A 1MC4A 4RV9A 3FI9A 4YT5A 1U1IA 4MPDA 4B3HA 2O2SA 4E5MA 4RPJA 1D3AA 2FSSA 2EHDA 1LSOA 2DPHA 2G82A 4BNUA 3OA2A 5CP8A 2VUSA 3P7MA 1GEGA 3AUSA 3PQDA 4OO3A 3LQFA 2AEMA 1PIWA 2X4GA 3DZFA 1K6IA 1QLHA 3JD0A 5C7IO 3NAQA 1PGQA 4TRJA 4NFSA 4RLHA 4CLHA 1VSVA 4KZPA 1TI7A 5A3JA 3R3SA 3FPLA 4WCFC 1U2GA 4PRKA 2ZJ1A 1EVIA 3ADOA 2G76A 2UYYA 3BHMA 4YQYA 1OZAA 4L4RA 1NXQA 1LLQA 2VNAA 3MEQA 3ZHYA 7ADHA 2Y0DA 3RC7A 3L6EA 4YJGA 1HDCA 4DMMA 2Z5LA 4IS2A 4DLLA 1JAYA 5G4LA 5ENVA 1NWCA 1E6WA 4IMRA 4B8ZA 3C1TA 3RUDA 1NFFA 2YUTA 2YDXA 4LGVA 1Z82A 5GMOA 5JAIA 3F9IA 2RH4A 4KQWA 4XGKA 1ISIA 3GEGA 4NIMA 4CMEC 1EFLA 1ISJA 4IDCA 1DC3A 4WNIA 3H4VA 3DB2A 1NQOA 4YJFB 1XKQA 3AM3A 4PGFA 3VZQA 5G0VA 3WGQA 3AK4A 2CVOA 3RSHA 1J5PA 2I66A 4Y9DA 5IXYA 2QHXA 5KKCA 3TWOA 3ZHBA 4D41A 5HTOA 2BLLA 1YQXA 2I76A 2FSVA 2R6JA 4M55A 1U3TA 2I99A 3BTSA 3RROA 3AUTA 3NDIA 1HL3A 3JQCA 3F6YA 4BB5A 2IZ1A 4I9HA 1YQGA 3OJOA 4BMSA 2X86A 4L9RA 4P22A 3UF0A 2Q46A 5AYVA 4BNVA 5BNIA 1CYDA 2DFDA 2H9IA 1F17A 2EV9A 2YHIB 4DIOA 4XJSA 4GX2A 4RF3A 2J6IA 5KJCA 2PFGA 1YVEI 4J1SA 2HKIA 4ZGWA 2QZZA 2C5AA 2GZ1A 4IQ0A 1PQWA 5FI5A 1VSUA 3LF2A 2ET6A 4YA6A 1VI2A 4KQXA 2W8ZA 2P9CA 2AQ8A 2Q1UA 5A9TA 4R5HA 2V6BA 4MVJM 1GUZA 4RVSA 3Q3CA 5I9LA 3OP4A 4J7UA 4BNLA 2ZIZA 1GPDG 1ZJYA 3DZIA 3HJAA 4R16A 3U62A 5LDGA 4DQUA 2NACA 3E03A 4RPHA 4CMIB 1G0OA 3IQDB 3GN2A 3I9KA 3R3JA 5IDQA 2GZ3A 4ND3A 3ZWAA 4BO0A 3FNEA 4H16A 4JJIA 4JQCA 1UR5A 3C3XA 2X6TA 1T26A 5H83A 5I7EA 4DLAA 2CDAA 4L73A 5GZ1A 5KJFA 2WE8A 4JROA 3JD4A 1EDOA 4BGUA 3FWNA 4ZQFA 1XSEA 1BTOA 2Z1MA 3PFFA 4BGVA 4DREA 3F4BA 2GASA 3OIFA 4UVEA 3VPHA 1YB1A 3I6QA 4R9SA 5DP2A 5L51A 3ZI0A 4QFDA 2NVBA 4BVAA 2O50A 1YDWA 2P4QA 3KEOA 3EZYA 2EIHA 3DXFA 1XWFA 3KHUA 2WTBA 1Y9AA 1F14A 4AJNA 3TOZA 2VOEA 1I8TA 2X5JO 1FXSA 3VTFA 4EJMA 3JD2A 4IZHA 2E6UX 4N5MA 3FNHA 3C7DB 1E7WA 4UUNA 3GQVA 1PJQA 1XR3A 1DHRA 4CR6A 1WDMA 1ZIDA 2NM0A 4BKQA 1AN9A 5AOVA 2DBVO 4OHUA 4J6FA 5B4TA 3U4IA 3LLSA 3DFUA 1JQBA 3ROPA 1HDOA 1E6EA 1RM3A 2QG4A 3P5SA 4PZCA 3QP9A 4U5QA 1JKIA 1QXSA 2EXXA 2OORA 4OKIA 4RPGA 2G5CA 3HQ4O 3MTJA 3I4FA 3RC2A 1PS8A 1Y8RA 2W98A 3GAZA 3VVBA 2CD9A 3F46A 1L7DA 1WXDA 4WPGA 5F1PA 2VWHA 1NM5A 1BDMA 3GZNA 3RBZA 3MCVA 4ZHSA 4YJFA 1YH3A 2P9EA 2WMDA 3WFJA 4QO7A 4OKNA 4CUZA 3DBRA 1B26A 1M75A 4H7PA 2NVWA 4EYEA 1YJ8A 4NJMA 3OSUA 4TSKA 4MP8A 4NBVA 3CMMA 4QUKA 1E77A 4GSKA 3SBOA 3LK7A 2VZ9A 4WASA 3S8MA 1SMKA 1HZZA 4ND1A 1PGPA 3GY0A 1TVEA 4E30A 3PVZA 3U4DA 5G0WA 2EW2A 3CMCO 3IP3A 3F47A 4YRDA 1JAXA 3CKYA 3MOGA 2FRDA 3G49A 5JYDA 2EKQA 2FZEA 3BTVA 4IXWA 4IJUA 2EKLA 3CPSA 2OBYA 3EUWA 1SAYA 4PVCA 2Y68A 3FBGA 1GYRA 5BNFA 1WDKA 1QV7A 2H1SA 2DT5A 4MIOA 1UUFA 5B37A 3DZJA 1GCOA 4D44A 4CMJA 1O95A 4HUJA 3VH3A 1WPQA 3E82A 1TLTA 3NT4A 1PSDA 3PP8A 1WLYA 4WCDA 4Z0TA 5JLAA 4D79A 1H6BA 3TZCA 1I24A 1GD1O 3B1FA 1DSSG 2JD0A 2OL4A 5CFZA 1DAPA 4JCOA 1C14A 2XF8A 5F1OA 4PLPA 1LRLA 1WMAA 4OOEA 5U9CA 2B5WA 2Q1SA 1B2LA 4DPKA 3WS7A 3QV1A 3U09A 1NVTA 3AFNA 3AI2A 3MZ0A 4N7RA 1YOVB 5ICSA 4IXTA 4CQMA 1Z6ZA 2VRBA 3MJ4A 3RD5A 1WZEA 3WXBA 2NU8A 3ETDA 4D0SA 3BXXA 5TC4A 4GH5A 4CM9A 4E2YA 4NNJA 4INAA 3LLVA 5BSHA 1UZMA 1A9YA 3DOOA 4RJTA 3HN2A 4ND5A 2FN7A 3EW7A 3BIOA 4EUHA 3Q2IA 4J91A 1UDCA 4YAJA 9LDTA 3DBHB 1LSJA 5CPFA 5DNAA 4BO4A 1P31A 1H2HA 1PR9A 3N74A 3N7UA 4IS3A 5JSFA 2VTDA 4CM5A 4FR5A 1U8FO 2DTXA 1JN0A 3PJGA 4Q3NA 1PTJA 3X2FA 5LDHA 1MXHA 2WJPA 4BNGA 3WWZA 4JBGA 3ZGYA 1ULUA 1XU7A 5CG1A 3E9QA 4UUOA 1PZGA 5I9NA 2J8ZA 2HU2A 2ZYAA 5KVCA 1XLTA 4OQZA 1BGVA 3QWIA 4XZ3A 3TL3A 3B6ZA 5FF9A 4BUCA 3WGOA 1PZEA 3CTMA 1PGOA 3HDYA 1GAEO 2FMUA 3JQGB 4OYRA 4AJ1A 1ISHA 3HWRA 3ANNA 2IEDA 1R4MB 2V6FA 3UOGA 4RGBA 3AUAA 3GUCA 3OICA 2OP0A 2UUPA 3QRWA 2Q3EA 4B8WA 2OBNA 3WGTA 1SEVA 5ADHA 3ZCXA 5C37A 4B4OA 2ZYDA 3WDSA 4XB1A 2PA3A 4DC0A 4XQ9A 1PJSA 3F5SA 2NADA 3OFSA 2UAGA 1ZMTA 2QQ5A 3PHJA 1E3EA 2X9GA 3WGIA 4ZQHA 3GR6A 2OP1A 4EITA 2J3IA 4ITUA 4J0FA 4BHTA 3D3EA 1DHTA 4NH4A 1CERA 3DZHA 3LT0A 4LCJA 1N1EA 3FTPA 1P3DA 2UV8A 3E9MA 4DXHA 1PGNA 3TZ6A 3B1JA 4GPD1 3GA0A 3I9JA 1ZXLA 3TFOA 2I65A 3D0OA 3P19A 3PK0A 1ZVMA 4BNFA 3VOSA 2RAFA 3N58A 3M1AA 1DRUA 4BO3A 1P33A 1HXHA 2JL1A 3ICCA 5CDYA 1JWBB 1H6DA 4Q3CA 5BR7A 2C7VA 5KWEA 3FRJA 1CJCA 4NK4A 3COSA 5CHEA 4BO8A 4JX8A 1GV1A 4CM1A 2IYOA 3B20A 3U4CA 1BSVA 4CQMD 1FF9A 4W7HA 1VLLA 7MDHA 3INRA 4YJHA 3A14A 4MDHA 4CM9D 2HK8A 3LF1A 4ALKA 4BNNA 1QR6A 5L45A 3OECA 5HWSA 1U5AA 1AXGA 2HJRA 5G0SA 4FCCA 2Y1DA 4NHEA 4QQRA 4RVHA 4YWJA 1GY8A 2E4AA 3GMSA 5EQDA 5TX7A 4UEOA 4L74A 1Z7EA 3NUGA 1LSUA 1KVRA 1NP3A 4U0JA 5I9MA 3DBLA 1H93A 1LRJA 3ZV4A 5JCJA 1G6KA 3S2IA 2DBRA 4R4JA 4XRGA 1PJ2A 5A04A 1BMDA 5DCUA 3BMNA 4UEKA 5COQA 3JYPA 3Q11A 5JC8A 5DOZA 1Y5MA 2CDCA 3PHGA 1O5IA 2IRWA 3NGXA 4RPLA 3SC6A 2J5RA 4J43A 2AEJA 1PJ3A 5JAQA 5I7FA 2X9VA 3HB5X 3ZV5A 1VRWA 4LMPA 4XQCA 4AICA 3FSRA 3T4XA 4CM4B 3K9QO 3L0DA 4R51A 1CRWG 5DZSA 3UVEA 4R68A 3V1UA 2JD2A 3RQSA 5A9SB 2VUTA 3K73O 3E48A 3EAGA 4EJ6A 3NKLA 5A1TA 1M2WA 2VZ0A 1V3TA 2X9NA 3LDHA 1BVRA 2EGHA 1O6ZA 3K2EA 1V3UA 4PLTA 2X0NA 1LXCA 4E21A 3DTTA 1SBYA 4Q3DA 3ICPA 1Y81A 3ZWXA 2JD1A 1NAIA 1A5ZA 2Y1FA 3KYDB 3I4CA 1I10A 4BGEA 1F06A 4XWYA 1E6UA 2GD1O 4TRRA 4DL9A 3ZV3A 2Q50A 1HLPA 2O3JA 1I2BA 1IHYA 1ZK3A 4FBGA 4B7XA 3NJ4A 3UCEA 1SZJG 4L8VA 1PS0A 2BELA 3DO5A 4W6ZA 1JW9B 1S6YA 5K0ZA 1T25A 2E48A 4XA8A 1SOVA 1VJ0A 1HDRA 3RBXA 3TNLA 5A5FA 2PLAA 4GLLA 4QT0A 2CVQA 3BZUA 1L7EA 1ZUD1 5IN5A 1I2ZA 1JTVA 4NBWA 1UAGA 3KM0A 3WOHA 2GN9A 2A9FA 2NUAA 2WM3A 4TKMA 4YJDA 1R12A 1T2DA 3GHYA 4HFJA 2QW8A 3WYBA 4JN6B 2O7QA 3CE6A 2VT3A 1BHSA 5CDSA 4NR0A 5T6BA 3W6UA 1ZCJA 2B4RO 2SCUA 3DDNA 3ZWCA 3HDJA 2P4HX 2PH3A 3SC4A 1M67A 3WGGA 4HXYA 3ZWYA 3PXXA 2NTJA 3WX0A 4E5KA 4K1LA 4G5HA 4HFNA 4HX5A 1RKXA 3BMCA 3NRCA 4Z0PA 1HDYA 2EKPA 4E2ZA 5ER9A 3L9XA 1T2EA 4XYMA 4RPKA 2DFVA 5G0TA 1NQTA 2X8LA 1BW9A 1GZ3A 1ZO8A 4OQYA 3HZZA 5HA5A 1DOHA 5I7SA 3F4LA 2JAPA 4UVHA 1OOEA 1DIBA 4DUPA 2WD7B 1YJQA 1IHXA 5A3VA 2YQ4A 3KLPX 4DBZA 1NNUA 2FZWA 3LYLA 4FFOA 5TGDA 4BKRA 4YPOA 2PD6A 2VRCA 4AJPA 1PWXA 5A5EA 4J2HA 2BMAA 3WGYA 1IB6A 1EUCA 2EERA 1HE2A 1WNTA 1KVQA 4M87A 4XDZA 4CV3A 3PIIA 3HFSA 5LC1A 3SJ7A 4CQLB 1H2BA 1QYDA 2EW8A 2PZMA 4GKVA 5ES3A 5JO0A 2C07A 4EW6A 5CEFA 1H9AA 1QRRA 3H5AA 2VWGA 2PKQO 3GAFA 3IUPA 1HDGO 4GWKA 1Y6JA 4KOAA 4CUJA 1LI4A 3OJFA 3HE3A 5L95A 3FCOA 4R5MA 3KV3O 5TSDA 4NI5A 3A28A 2VYNA 3ITDA 1ISMA 4FC6A 2PK3A 3RFXA 1WDLA 2J3HA 2Y99A 5K9ZA 1UP7A 1H5QA 5J23A 2B36A 3OIGA 2WYVA 3ZWNA 1NPTO 1ID1A 4BO2A 2Q4BA 1GDHA 4H15A 3U3XA 5L7YA 2GF2A 4IDAA 1O89A 3ZH2A 3PTZA 3VH4A 4D0RA 5TJ9A 4WUVA 5EESA 2WD8A 1IULA 3UICA 3DL2A 3D64A 3GOHA 1NASA 3BMQB 2NQ8A 2EF1A 4CLOA 1XHLA 3KZVA 3RASA 3WLEA 2VHYA 5CPBA 4P8RA 2UUOA 3I5MA 1G0NA 4TROA 5T67A 3ENKA 9LDBA 5TNXA 1GYQA 1GL3A 4O1MA 3H9EO 2DUWA 3LSYA 3RKUA 1B14A 2QYSA 3B70A 4MO2A 5DCYA 5A02A 1HDXA 5GY7A 1R16A 2ZB3A 3KRTA 5TJHA 1R15A 4GX0A 3DAGA 1ZSVA 4BKOA 5ILOA 3AI3A 2YW9A 3D5QA 3C24A 3ULKA 3NTOA 3TJRA 1IE3A 1M6WA 4Z0HO 3ONFA 1K6XA 2EP7A 1DIHA 5JY1A 2AQKA 3SLKA 2QRKA 1X7HA 2WDZA 2ZTMA 4MJLA 4R41A 1VE9A 4CMKA 3ZHZA 1BDBA 3RUEA 3T4EA 2GERA 3ROMA 5JAMA 2CUKA 2Q2VA 3JQ7A 1YB4A 4DTIA 3C1AA 3PYXA 1HTBA 1LNQA 1LLUA 4IQGA 2O48X 5CEJA 1LDBA 5L40A 5JE8A 1E3WB 3RKRA 4JNKA 4ZA2A 3S2GA 1N9GA 4NDNE 3TZKA 1PL6A 2VOJA 4JBIA 1EE9A 3BHIA 2ZK7A 1FDWA 3D4PA 5L4LA 4EGFA 5L9AA 5G4KA 1LDEA 1WVGA 3EZLA 3LT2A 2VRCD 1MUUA 2YV3A 4IBOA 4XCVA 1W0CA 4MIYA 1E1KA 3S2EA 4IZIA 4MVJG 3UXYA 1H9BA 3QWBA 2FR8A 1EMDA 2JCVA 4KUGA 3RUAA 4DRYA 4LCEA 2EJWA 4ZRNA 2CZCA 4XR4A 3GK3A 3PJDA 4OH1A 4AJEA 3PDJA 3HHPA 4NBRA 4II3A 1WW8A 3VVCA 3ETEA 2PTGA 2HAEA 2B4TO 2DPGA 4HBGA 5JPIA 2NSDA 3DBVO 2IE0A 2Y1OA 3RUHA 1LDMA 4S3MA 4LRTB 3FNFA 3JQAB 1PS9A 2VYND 5KKAA 3OMLA 4JJFA 5FYDA 1DIGA 2Q1WA 2PKRA 2YHUA 2DBQA 4WOKA 1P1JA 3SVTA 3H9UA 1GUFA 1LLCA 4IJVA 2PD4A 3RU9A 3IUSA 4B4VA 4YACA 1N8KA 3ADPA 4PG6A 1FMCA 3WJ7A 3ZU5A 3JQ8B 1SO8A 3UCFA 1U4SA 1MLDA 3IKVA 1C1DA 4L76A 1I33A 1KVTA 4OSOA 2W2LA 2VHXA 3AM5A 3LU1A 2X0IA 4XRRA 3MOIA 4NBTA 4JJGA 2GR9A 5MDHA 3O03A 4RLSA 2P5YA 1F12A 1UZNA 1X7GA 4BQRA 4Q9NA 4D3SA 4LN1A 4ZD6A 1HYEA 1U8XX 1W6UA 4TMFA 1F0YA 4GX1A 4JK3A 4YCAA 2DTDA 3UN1A 3MJCA 4PFJA 3L4BA 1PL8A 3GGPA 1VM6A 2D2IA 2AG5A 2WSBA 1Z75A 3RJ5A 3C7AA 1MG5A 1Q0HA 4Z9YA 1UDAA 3MJTA 3PZBA 4WEOA 4LRSB 1BRMA 4Y98A 2E49A 4CLRB 2PR2A 3NT2A 1R0KA 2PGLA 3GRPA 4TRMA 4CM6A 1IUKA 3FTNA 4CM8B 1NX6A 4CR7A 4RO0A 2JCYA 3JQ9A 1KS9A 2Y1CA 1I3KA 1VL0A 4N5LA 3ROQA 3DMTC 4FD3A 4OGWA 3ZN2A 3D3WA 2W2KA 2AMFA 3INTA 1XGKA 3E9NA 2AE1A 1I0ZA 4RDIA 3W4KA 1YL5A 5KJEA 4O63O 4LVUA 5IFLA 2ZKLA 3WBBA 1MFZA 1B8VA 4RORA 1VKOA 2GSDA 1E7RA 1ZK4A 4ALNA 4HNGA 1B3RA 1U4OA 4A7PA 3JQBA 2C2YA 2IEBA 2D3TA 2BKAA 5F3RA 3DHYA 5BT9A 5IZ4A 1P0CA 3MTGA 5JBIA 2FPIA 2C82A 4PIVA 1LA2A 3PJFA 4J4BA 1Q7BA 1C0PA 3GUYA 3ZWMA 4C7KA 1HE4A 5CDGA 1E5QA 4NU5A 4UVGA 1E1MA 3HUDA 3DOJA 4YB8A 1X7DA 4ESOA 2HJSA 3LC1O 3ZZNA 1KY4A 4AJKA 1GPJA 1SC6A 1R0LA 4W4TA 5JY6A 1T1RA 2ILTA 3JV7A 1LC0A 2VT2A 3Q6IA 3DZKA 4UAGA 1B15A 3S1LA 3GNTA 3AY7A 4A0SA 4JBHA 4HV4A 4J1TA 2XOXA 3DAPA 4RF5A 2PGDA 3L77A 3WB9A 1QYCA 1KERA 5CDTA 4NFYA 4XIJA 1Y5RA 1PJBA 4YDRA 2OMEA 3KB6A 4PLCA 3RU7A 1NFRA 2BFAA 4WOJA 1K2WA 1SNYA 3I1JA 3D4NA 1ADFA 2AE2A 3GPDG 3RFTA 1SB8A 4BNJA 2W2LD 2XXBA 3MJSA 5IZCA 2Z95A 4F45A 4Y6RA 3WQRA 4FS3A 4LVCA 2BGKA 4LSWA 3TOXA 1HKUA 3JYQA 3PWKA 3W8EA 1HZJA 4WE3A 4Y8VA 3RVDA 3TL2A 3EGOA 2HMVA 2YJZA 3ONEA 1P77A 1Q7CA 1P1FA 3QY9A 1ZXBA 3EHEA 1DIAA 4W99A 4RZIA 4XQGA 4DBVO 4P4GA 3KETA 2YHIA 3QWFA 4WLEA 5JMWA 3R1IA 1EUDA 1PX0A 3FWZA 1UXJA 4I5EA 2IZ0A 4MP6A 4BNYA 3GVXA 3GG2A 3P2OA 1JU9A 1MGOA 2FP4A 4QX6A 4FB5A 5B1YA 3PIDA 3V1YA 4B4WA 4J3FA 3H2SA 1CDOA 2QZ9A 1UH5A 2RBEA 3FR7A 1IYZA 2O3QA 2I5PO 3D5TA 4U0KA 4EJ0A 4YT8A 5B4UA 5IAAA 3TF5A 4GWGA 1MC5A 3C1OA 4CMIA 2JHFA 3BTUA 1PJ4A 2PV7A 1I2CA 4R01A 4YVFA 2YY7A 2AG8A 1I3MA 3ANMA 5ITVA 1YE3A 2EWMA 4KTVE 1A71A 3T7EA 3U5TA 4KWHA 5EN4A 4M89A 4BV9A 2VYVA 4BNTA 3H9QA 4ZQEA 3PGXA 2AQIA 4CMHA 1IY8A 1YL6A 3LT4A 3K92A 1GUYA 1SCUA 3A06A 3KSUA 4JGBA 4YAEA 3JQEA 2POQX 3GVHA 4B3JA 4CLEA 5CEEA 1O8CA 3L4SO 5JDIA 5KIAA 1QORA 4I9NA 1JVBA 4BO1A 4MVJH 1HYHA 4TRNA 4CPDA 3GFGA 1Y8QB 4WCFB 3H8VA 2R2GA 1BWSA 1QLJA 1T2CA 1XQ1A 3K2BA 3CEAA 1DRVA 4FFMA 1I36A 4OXKA 1V9LA 3E18A 3GZ4A 4PLVA 3VPXA 3WBFA 3A9WA 3HDHA 3GG9A 5H82A 1DFGA 4I9UA 3UUWA 3QW2A 1GQ2A 3GLQA 4DYVA 3CXRA 4MOWA 4OSPA 5F1KA 4RQUA 4FOOA 5JAZA 2FOIA 4U6SA 2DKNA 2FR1A 4JXKA 2C7GA 3OA0A 4DPMA 5IF3A 2D1YA 3GEDA 4FJ2A 4OIMA 3VTZA 3DHNA 3SJUA 1NQ5A 3GHHA 3PLRA 2NWQA 2O4UX 3OHSX 1C3VA 3GC6A 4I5GA 5IDYA 4DLBA 2FWMX 1ONOA 2A94A 1M76A 3ZW8A 4ALLA 1RM5A 2GYYA 2NTVA 3DONA 3WIEA 2NVUB 4OL9A 2F00A 5A06A 3RBVA 2YQ5A 3PJEA 3C7CB 2D59A 3C85A 4PG4A 4AVYA 1XQ6A 2NV6A 2CVZA 1KEVA 2AHRA 1ZH8A 4FGSA 4M1QA 1EK5A 1LC3A 1ONNA 3SXPA 2D5CA 2VHVA 2C20A 1J4AA 2Q1TA 4BOYA 3HNPA 5L7WA 1LX6A 3FBTA 1PJCA 1VC2A 3KYCB 5CG2A 4Z9FA 4ND2A 1P0FA 3L4BC 4LMRA 3ZWWA 5TLSA 1D1SA 4RVGA 2D5AA 1N7HA 1F8GA 3IOYA 3Q0EA 1DBVO 3C8MA 3NX4A 4PVDA 1N92A 5EJ2A 4K9DA 1L1FA 5BSEA 1R4NB 5L53A 4R69A 3CIFA 2IZZA 3A1NA 1PJTA 1PWZA 2NU6A 4ALMA 1GQQA 1ZJZA 4XX0A 5G2OA 4F3YA 4KTTE 3QLJA 2X23A 3NT5A 4J1QA 1ENOA 3JQ9C 3K31A 3JD3A 4DQXA 5A05A 3HSKA 5T8KA 4LW8A 3OQ6A 3MJEA 2AA3A 3K8ZA 1IZ9A 1NTOA 1GEEA 1EVZA 3LC7O 1AXEA 4FJ1A 4IMPA 5HS6A 5KVSA 5B12A 5DN9A 1NYTA 1UDBA 1YXMA 4N54A 2VCYA 1AUPA 3I3OA 4XD2A 3L6OO 1B8PA 4I5DA 4ID9A 4JLWA 1YOVA 4R3NA 3EMKA 1J0XO 2HMSA 3JQBC 4MKRA 5THQA 3QWAA 2WWRA 3PHLA 4K6CA 4XEHA 3EDMA 2GUGA 3H6KA 3WSWA 5HRUA 1YKFA 3WTCA 5DOVA 1I3LA 3CUKA 1JLLA 3EVTA 4E5YA 1OAAA 4AJ2A 1JKJA 2HUNA 3L6DA 4UEJA 1H0KA 4P4LA 4TZTA 5KTKA 1YS4A 3ENNA 1ZW1A 3DBHA 3G1UA 4TWRA 4ALIA 2QRLA 4DPLA 1C0KA 3UH1A 1GU7A 4MIEA 1DFHA 4GAEA 4BMNA 4YRBA 2E82A 3TRIA 4PLYA 1KIFA 3O8QB 2OFPA 1GADO 2IYPA 4AJIA 4BNXA 2OGUA 4FW8A 5HBRA 2EG9A 2GNAA 2OHXA 2ZJ0A 1DFIA 2RIRA 4RCVA 1K5HA 4NZ9A 1T2FA 3BMOB 4E2XA 3PQFA 2HO5A 3NTQA 2DUUA 1ZK0A 1N7GA 3KVOA 1NPDA 2X5KO 2Z1NA 2DVMA 2PKQP 3IJRA 1D1TA 1U28A 5EQFA 1GV0A 2JFFA 3RC1A 2CMDA 3U9LA 4IIUA 2PD3A 4BKPA 5JS6A 1YGYA 4B7UA 2Q4EA 3JQGA 4DVJA 1NHGA 3NDRA 1R4MA 3CZRA 4A2CA 4OXYA 3AU8A 1W8DA 5IZCC 4LK3A 4MINA 5LCXA 4NJOA 1PEDA 4ZU3A 1YL7A 3ZNNA 4UULA 1GYPA 1BVUA 2G0TA 4CLDA 1CIVA 1Q1NA 4NU6A 1PQUA 1ZSNA 3WG9A 2YV1A 3O26A 3VH2A 3ZNOA 4DIBA 4TKLA 4CJXA 1PL7A 1V6AA 4J9UE 4TVBA 4E2WA 2RCYA 4X54A 3TQHA 2C2XA 2BF7A 3L07A 3UAGA 3PWSA 3JYOA 4OOFA 1V0JA 1W73A 2JHGA 4ZQGA 3QHAA 5IDWA 4K28A 4GI2A 4B4UA 3AFMA 4D42A 5JW6A 4I8XA 1C1XB 1DDOA 1A72A 3QVXA 5COAA 1HSZA 1LTHR 4BMVA 2JFHA 1ENZA 2VTEA 4I5FA 4M49A 5IG2A 2CY0A 1TT5B 3QVTA 2O23A 4JP3A 4B79A 1K89A 1NWHA 4A5OA 3VHRA 2BHLA 3DFZA 1R66A 2WYUA 5TT1A 4OXNA 3ZNQA 3M6IA 5TS3A 2X0JA 1UXHA 4L4SA 3E6AA 4M8SA 3S2FA 4RZHA 4U6QA 3Q9NA 1P1KA 3O4RA 4IM7A 5T57A 5JFOA 5C7OO 2BFPA 4AJ4A 2VUUA 1A4IA 2X7HA 2XAAA 4GGOA 1CETA 3BTOA 3HFGA 4NK5A 3W6ZA 4XYLA 1ZNQO 4A26A 1PGJA 1TEHA 2CF5A 3ZWVA 4BS9A 2FY8A 3DR3A 2DBZA 3IP1A 2FR0A 1LSSA 3HB4X 2EEZA 2ZTVA 1ADBA 5ER6A 1LBEA 4DGSA 1KY5A 4R54A 1A7KA 1DPGA 5JCJD 4YJGB 2HMWA 3KTDA 4FFRA 4N5NA 1JVSA 3MWEB 3AJRA 3WGHA 1IZ0A 3V2HA 1IPFA 2DQ4A 2CSUA 4DWVA 1D4FA 3PZRA 2ZB4A 3H9JA 1HEUA 4BV8A 1UAYA 4JIGA 3ZU2A 3WLFA 2CFCA 4PG7A 3MWDB 4R9RA 1N5DA 5TQVA 4XYBA 3NEPX 1SPXA 2Q2WA 1LDYA 5C3MA 4CM4A 2O3RA 1AGNA 2R00A 4I1IA 4WLNA 4A10A 1E1NA 3GNSA 2B69A 1XG5A 2ZATA 5A9SA 3WQSB 2P2SA 1LJ8A 4W7IA 4J0EA 1XCBA 4YEDA 5F5LA 4O59O 4CMGA 5L7TA 3UCXA 2ZQZA 1H6AA 2ZB7A 2ZTLA 1QV6A 2PZJA 2BGMA 1JKFA 3GEMA 4CMBA 5L4NA 2NU7A 1IPEA 3I9MA 3KYDA 1E3IA 5THKA 1GFSA 3TDKA 1MXFA 3W8DA 3KYBA 2GDZA 3I83A 1PQPA 4UUPA 3DZGA 1D7OA 4L75A 5U4QA 3KSZO 1JWAB 2GZ2A 2Y0CA 1X15A 1UP6A 4PLHA 2GRAA 2O2YA 1Q2XA 3IJPA 3JYLA 1JDJA 2VQ3A 4YR9A 3HDQA 2J5KA 1P1HA 1PJLA 1ADGA 1I3NA 3IC5A 1LEHA 1Q0QA 3UGKA 2BFMA 1B8UA 1U9JA 5K6AA 4U8GA 5T8KC 2HRBA 3PYMA 3HG7A 5ITWA 4GX5A 4FFNA 3GVCA 1DJNA 2QYTA 3EY4A 4PG8A 4PLZA 5BNTA 3TFQA 1E7QA 5GZ6A 1YBVA 4N18A 4FGWA 3O9ZA 4CV1A 3I9LA 1P45A 1QMGA 1UXIA 1ARZA 3QWHA 3MJVA 2ZYGA 3OM9A 5KCZA 4OJNA 3KEQA 1NVMB 1T1SA 1YONA 2Y66A 3WNVA 4MVJI 3PFWO 1XELA 4J16A 4KWIA 1RM0A 4MKXA 2D8AA 4IIVA 1DC5A 1ONPA 2FPPA 2YV2A 4BNZA 2G17A 2JFGA 4WLOA 1X0VA 2BI7A 5FFFA 2WD7A 3FF4A 5ILGA 5L3ZA 2C0CA 1NAHA 3PLNA 3RCBA 3BYZA 3RIHA 2O3UA 1HETA 1YRLA 3KSDO 4GKBA 1X13A 1R6DA 1YO6A 4R1NA 1FDTA 1AHHA 2VN8A 3K96A 3VH1A 2WEKA 1ZEMA 1RYEA 1RJWA 1CQIA 3PI7A 4CQLA 3IKTA 4FPXA 3JCZA 4Z3KA 3U49A 4XB2A 3H9GA 2RH8A 4J4HA 1QYXA 4RVDA 2V65A 4PLFA 2B37A 4D46A 4E13A 4Z6KA 3EC7A 1S7CA 4KMSA 1OFGA 2DM6A 2PWZA 4P4NA 1LLDA 1Y8RB 2TMGA 4Z3DA 1N1GA 4R3WA 1SEPA 1HDZA 3RUCA 2C5EA 3DOCA 3TN7A 4BNHA 3IAHA 3GF4A 3W4IA 3GZNB 2ZCUA 4MVJE 1O94A 4IPTA 2O4CA 2VZ8A 3GMDA 4IDGA 4L0QA 4YRAA 2PY6A 2V7PA 3INGA 3FN4A 1F8FA 2B83A 1I32A 3H3FA 4E31A 2HK9A 1MG0A 3DBRB 5C7LO 3G1TA 1RPNA 1X14A 4UUMA 3SLGA 4FN4A 4WKGA 3LVFO 3RI3A 4NJMB 3SX2A 2IODA 3GN1A 3TZQA 4FJ0A 4XKJA 2VWPA 3VPSA 4DC1A 1E7SA 4BO6A 2VNSA 3GVPA 3DEYX 2E37A 3RUIA 1Y7TA 4XYEA 4DQVA 3BMQA 1Q0LA 3ZWBA 1XA0A 4BO5A 4ZJUA 4J49A 1NR1A 3D4OA 3G3EA 3T7CA 4O6VA 2AQHA 3ORFA 4C7JA 4YBZA 4Z9XA 2Q45A 4NQZA 4AJJA 3IDSA 4K6FA 1Z7BA 4A27A 3DTYA 3GGOA 2YFQA 3QJ5A 3RC9A 1FDVA 1K3TA 3DWFA 3UW3A 3Q1LA 3WWYA 1LU9A 4CV2A 5B4VA 3IIEA 3DQPA 3JQ6A 4WEQA 3GFBA 2H6EA 4B7CA 3PGJA 3AOGA 2HK7A 1U3VA 5DBIA 4E4YA 4QO8A 3TZHA 3OQBA 6LDHA 2O3SA 2X22A 4EZBA 5F21A 4GL4A 1ADCA 4CL3A 1O0SA 4IJKA 3A4VA 1A9ZA 3D1LA 3OETA 4FOSA 1U3UA 3ZDFA 5IN4A 1MFPA 4AG3A 4J4TA 1ZZEA 5JXWA 4J90A 2ZTUA 2V6MA 2GPTA 3HN7A 4FQ8A 4CQMB 3GT0A 1DLJA 1KEWA 2Y0EA 1LRKA 1VJTA 1E3WA 1O9BA 3R6DA 3WMXA 8LDHA 4M86A 1A4UA 1DJQA 4KUEA 4PZEA 5JMPA 5I8WA 4CM7A 4YT4A 3WFIA 2W90A 1YDEA 4XQEA 3S55A 3E8XA 4HY3A 1IL0A 3W4JA 2GCGA 3OEYA 4GMFA 1R37A 4YAGA 5ENDA 2GN8A 2JCXA 1KBZA 3QVSA 4ND4A 1KYQA 5C5IA 4XIYA 1A7AA 4Y6SA 4YTEA 3AWDA 4ILKA 1BXGB 2BD0A 3M2TA 4ZN6A 3NTRA 4ZQBA 4Y67A 5CDUA 2IXBA 5L4SA 2OZPA 2VWQA 1J49A 3KLMX 3NJ8A 4MP3A 4AJLA 4Q39A 4TQGA 4R1UA 4PLWA 4O5OA 1EQUA 2JAHA 2Y93A 4WLUA 2AW5A 2OOSA 1P1RA 2P9GA 3ASUA 4AL4A 4W9NA 4EEXA 4IQ8A 5JC1A 2QX7A 5DF1A 4ROSA 1EE2A 3GGGA 3JQAA 3RWBA 1HF3A 1DIRA 2HQ1A 1EK6A 4TZKA 3QIVA 1EFKA 1OMOA 2R00C 3KBOA 3NGLA 4KDFA 3H2ZA 3DZBA 4BNIA 2V6GA 3I52A 1UJMA 1YWGO 1VJ1A 3FD8A 1CWUA 3JQ8A 5DBFA 3G17A 3VC7A 5FEUA 1ULSA 1E0DA 4FFPA 3V1TC 2WE7A 3WICA 3G0OA 4E6PA 5GZ3A 3QE3A 4A03A 1T4DA 3ZHXA 1HT0A 3WIDA 1NPYA 5A03A 2HRZA 4F46A 1CEQA 2FPGA 3ZU3A 3I6IA 4XR9A 3IMFA 3NDJA 5T64A 4MVJP 1LQTA 4CR8A 2X0RA 1GTMA 4OM8A 3WGZA 5EINA 4BKUA 2YFHA 2Y05A 2Y67A 4GVLA 4L4XA 4OMUA 3ETGA 1EVJA 2F1KA 1YBMA 3GDOA 4PZDA 4Q3AA 4DA9A 2XXJA 1PZHA 4ZVVA 4CLRA 2J5QA 2PH5A 3OBBA 4IDEA 4R1TA 5K6AC 5AXCA 3RJ9A 4J9VA 3JSAA 1HE5A 1RM4A 2ZB8A 4CM8A 4C4OA 1I30A 4BGIA 4F6CA 3F5QA 1J6UA 4F6LA 1YQDA 2J3JA 6ADHA 4IDBA 1WMBA 1DXYA 1E3SA 2PZKA 2A4KA 3RAJA 1LDNA 1BXZA 2X58A 1V8BA 3FHLA 1FJHA 2GN4A 1T2AA 4DYDA 1WWKA 2HMUA 3PWZA 3VKVA 3OIDA 2EP5A 1GZ6A 2NU9A 4S1VA 5BSFA 5AXAA 4ALJA 3FNGA 2C54A 1MX3A 4YJHB 3WMWA 3WTBA 1DAOA 2G1UA 3UHAA 5TIIA 2ZCVA 3AU9A 4E33A 4EI2A 4W82A 3H5NA 4NMHA 4ZRMA 1NR7A 2OXIA 5HM8A 2DTEA 1RWBA 1GZ4A 1V3VA 4IUYA
chains in the Genus database with same CATH superfamily
4PFKA 1JA9A 1H85A 1JZQA 2CXSA 1VIAA 2R8EA 1DLIA 2ORED 1XFAA 1YQEA 2PCJA 3LHKA 1KC1A 4YJ3A 3CSDA 3AI1A 4LKRA 3T5GA 4O0LA 5LU9A 4PN3A 1ISFA 2VDWB 1X1SA 2JK0A 2V45A 1WCWA 5EL0A 1GQFA 3RYIB 3L6CA 3VR2D 4UREA 3SEFA 4C6TB 4WFJA 3ABZA 4WKPA 4LRYA 2EQAA 1NQUA 2PVSA 3PQEA 4PYQA 1MIOB 4R1SA 4CT0A 4W5RA 3FIUA 3NXKA 2X8WA 2XA9A 4NFHA 4RPIA 4WZZA 5F7JA 1XZEA 4C14A 2GK6A 2X5OA 3D6HA 4D7AA 2C9MA 2ATVA 5CHYA 5C4MA 3AM4A 1IY1A 3FGZA 1MT3A 3L6RA 4YI5A 4PC6A 1GRRA 4GNRA 4TVOA 3UHPA 2Q3HA 2PMCA 4OV6B 4B3BA 3CNOA 3IL2A 3H4MA 4W5HA 1CP3A 4JBLA 1G1AA 2JRCA 3BUSA 4GXNA 1OFTA 4KAFA 4P0TA 3H11B 5HJ7A 4B09A 5J4HA 2J0QA 5EWMB 1XZGA 1JH8A 1YU6A 3BORA 1PK9A 1U2SA 2JFOA 3EFOA 4YAIA 3LP6A 3BRWA 2PL3A 4J76A 1DDGA 1CS0A 3H9BA 2JAXA 4OQ4A 4QGSA 4ZQCB 4US2R 1TVCA 2D5BA 4FFLA 1U3DA 1YSCA 2DLDA 2JLSA 5FPPA 4I2VA 5CXUA 3O5AA 3M83A 2PT5A 1JKXA 3PEFA 3PDUA 3HK2A 1AHIA 4YMHA 2ZJ7A 2MR6A 3DVAA 5ALEA 2C59A 3HRIA 3WK7A 4BATA 3ZXSA 1LUAA 4BWGA 1W52X 3QITA 4A36A 1V7ZA 3GDFA 4R0VA 1DJPA 4LSMA 4X7RA 3GRYA 3TPZA 5AQ1A 1Z34A 2Z2XA 2EU8A 4CCAA 4JUCA 1E5LA 3DUFB 5FNVA 5P21A 3WA6A 5K0SA 1E7YA 3OM0A 3LRTA 4QUHA 3BAZA 4Z3OA 1ECBA 5BVGA 2QRJA 4AJHA 2AJLI 1USUA 1ZIOA 3T06B 3UHFA 3VKUA 1M34A 2X5XA 4MVJA 1NRXA 4E0BA 1OGYA 1E1CB 1J5XA 2VPTA 1TVMA 3PBKA 4KE6A 4Z86A 4YECA 5TV2A 3PFCA 4BO9A 1I13A 2AEFA 3HDVA 1X8LA 3GVIA 4UVIA 4ZU6X 3ZTTA 5EIWA 3L8DA 3UK6A 3X43A 4IGFA 3WIUA 3V3TA 2OO5A 1E4YA 3ZCRA 1GG2A 3OU6A 3OJLA 2PNFA 2PSEA 2XECA 5FO0A 1NUQA 1RE0A 1HY3A 2HFKA 2QVXX 5BQ3A 2JJYA 1WOMA 2RONA 5U1PA 1RCTE 1N2GA 2ZIGA 5SYNA 1LX7A 2RCNA 4DSZA 2JFBA 1T4BA 1XZDA 3EN0A 3ZQKA 4B3IA 1FCJA 2VYVD 3D3KA 5KJ6A 4MA5A 4ITVA 4J2TA 3TSCA 3FZQA 3WJAA 3IQHX 4RVUA 3ZWPA 4B9EA 1UXKA 2VSOA 3AXSA 4BVBA 3J80A 2REXB 4CMCA 5C2JB 5EYPA 5FFMA 3K0SA 1U7ZA 1QVAA 4E08A 4GOMD 1FDUA 3PPXA 2Z6QA 3JYNA 1B4DA 2I3GA 3HHEA 3PR2B 4AT1A 2XMGA 4OB6A 1ZBDA 3BMCB 4MRNA 4BVGA 1H8ED 3ZHTA 4D3ZA 4E14A 1W94A 1HYGA 2CFSA 1P4RA 3R5XA 5T5QA 4WECA 3NAZA 1A96A 1KEZA 1TAQA 1VCMA 2O6HA 4XPZA 1WQ3A 1XDZA 5T4BA 1DCFA 2G08A 3DMYA 3DQZA 3PFNA 4ZANA 4ZMRA 2QY9A 1HC7A 3P9SA 4L8GA 3A4IA 4G4JA 5EMKA 2BKXA 4JUBA 3E2MA 3IVCA 2Q9BA 4RTOA 2BKEA 3U0BA 1JJAA 2R7KA 4HYYA 3Q12A 1C0IA 4RDHA 1YR8A 1JSXA 4NARA 3RC8A 1KYYA 1VIMA 5IJZA 2GO1A 4EBBA 3PHHA 2X2EA 4AZVA 1LW7A 4D5GA 3MBKA 2KS6A 4URFA 1C0LA 2WVGA 4FT2A 2EDCA 1EWYA 2EEPA 4PX9A 3NCTA 2C96A 1DAEA 4ZYYA 3CISA 3HXTA 1S9HA 3QPUA 4DMLA 4YAKA 1FFBA 5KBYA 4JOSA 5K0TA 2XGMA 2VDRB 4WXHA 1QHFA 4NSNA 4MWGA 4N3BA 2ZSEA 4X3OA 1VQ1A 4HDKA 3C6XA 5I47A 4KRFA 1FK8A 1X2EA 1Y9EA 1GKKA 5HP4A 2ZG6A 2R68A 5ARBA 3U2QA 1NONA 3EVCA 1DV1A 1G4AE 1I5RA 2RGEA 3L8GA 1CFZA 1EDDA 1W30A 3LL7A 1M7HA 1KETA 2BTQA 2IW1A 4NULA 3N2GB 4QVKA 3K30A 5CX1B 1FX1A 4PCUA 3OJXA 3LPDA 4HH0A 2WB2A 2AEEA 5DM1A 1KNXA 1PEAA 2YL2A 3AGPA 3EPKA 2H4ZA 3OCWA 2QT1A 2BUAA 5A4MS 4QATA 2ZUWA 1K0UA 3ONDA 5CUQA 1LV7A 5AICA 4B32A 2PGJA 1D4ZA 3MYRA 5KYTA 5JQWA 2EJVA 3VAYA 1L5ZA 3DHEA 3MPUA 1ZQ1A 4UU8A 5DK4A 1T10A 2DFNA 2G67A 2Q4OA 4XGIA 3IERA 3WL4A 1ISSA 2ZP1A 5IKPA 4M54A 4J0HA 5JS7A 5EP4A 4YJ3F 2I67A 3SG0A 1B3BA 1ZOPA 4QTZA 5EHXA 5IAGA 2XYVA 2YXEA 4MDFA 4X20A 1W4ZA 1X19A 4CLOB 3HR4A 1ZKMA 4UVDA 3U80A 3VX3A 2ODTX 2D00A 2ID8A 1X1TA 1AO3A 2Z9BA 2WW8A 4FKBA 5D8DA 4YYZA 3AY3A 2UXDB 4GMGA 4MZDA 1IOLA 1HYBA 3BA6A 2OV4A 2C95A 4G0WA 2HCTA 4U2BA 4L8LA 3FR8A 3RVNA 5DDIP 4YUXA 5EKDA 2VAXA 4JI1B 3R76A 3K0HA 3UGQA 4LXIA 1U2DA 3BXOA 4YBRA 3TBHA 4GGPA 2W0SA 1XEWX 4H7HA 4BEBA 4DA7A 3LUAA 1Q1EA 4FQ5A 5AI5A 3IE1A 1OVGA 2VJAA 4DA0A 2O8EA 5CLHA 5BSGA 2JIDA 1V5EA 1ZL0A 2GVDC 4Y1RB 2AXQA 1KDOA 2AVDA 5KAPA 3FPFA 4ND6A 4CETA 5KNLA 2WIJA 1X1EA 2JI8A 4EJSC 1FTYA 1P2SA 1BGXT 1VCHA 1FMFA 4HZUB 2NPOA 1THZA 2XHZA 4H7DA 3CF4G 4HPXB 1SCDA 2HHCA 4R9VA 4ACBA 4C2TA 2XCLA 4P5PA 4D82A 5BYBA 2D06A 3CNEA 4IDPA 1YFLA 2RG1A 2X4LA 4QXMA 5EVJA 4BP3A 3E1KA 3MT0A 2OFWA 5KPJA 4CEJA 3DWEX 3FYUA 1M2OB 3GGCA 4QU8A 5AVWA 5JDIC 1SC1A 3DEFA 3ILXA 4AZTA 1FTQA 1PR3A 3DMTA 3N05A 3HXOA 4TV9B 4Q05A 2JVIA 2R6GA 2XB8A 2DF8A 1P7WA 3LZ6A 3H7IA 5B6IA 1T9BA 5FNVF 2ZW9A 3A36A 4BAUA 2FDXA 1PV1A 2JKVA 1N3LA 2CUNA 4PHTA 1SU4A 4D6XA 1Y8CA 3ZQJA 4FT4A 1R8QA 4MVJF 1QP8A 2VNIA 3TZEA 4O4IB 2HMYB 2OFFA 2G36A 3A9UA 2C8JA 2ZQ5A 4L9WA 5HX7A 2HMTA 1TYBE 2C00A 4E5VA 2RG7A 1JDNA 1ZSYA 3IO5A 4KDEA 3JD1A 5DBGA 4Y2YA 3VBEA 1KEPA 4JASB 5KYXB 5LZ2A 5BURA 2PYIA 4ZOQI 1Z06A 1B0UA 1O5OA 1QDLB 1J9GA 1TTTA 3DM5A 3SQLA 2XUIA 2EYUA 1VL5A 1KFJB 1C9KA 4LZLA 1WZIA 5MFPA 2YZ7A 1XAGA 1XEAA 4HVCA 2UZAA 4EF6A 5I7VA 4MDEA 4LBYA 1JDZA 1JYEA 1AKRA 1LH0A 1TDJA 1UM8A 2GGSA 2SKCA 3CCFA 2REOA 4KXXA 1ZNYA 3F1LA 1SHZA 2Z58A 2WJAA 1KYXA 3H2BA 3M2PA 2EGGA 3O8QA 2IYSA 4TMYA 4BLVA 4CKYA 4CM7A 1QCCA 1F0KA 2Q5IA 3AKCA 1KDVA 3GRKA 1EXNA 1V45E 5G02A 3T7IA 1V39A 1OC2A 1SCKA 1VA5A 1ORWA 1XDWA 4HAYA 1DTWA 3BMOA 4X8LA 3AB7A 1H42A 4CUKA 3RFVA 1QO9A 2B21A 5B1IA 2ADFA 5BV8A 2PDAA 4C5CA 1HRDA 4PX5A 3EXAA 1SU6A 2I91A 1MDBA 4K2AA 4RDCA 1PLKA 3I9OA 5KTTA 3ZBTA 2P6NA 1WDWB 2HXSA 3OEWA 4GYWA 5HE8A 5FI3A 2NG1A 3QUQA 4DDUA 4GBJA 1E60A 4AIIA 3FX2A 1KC3A 3H5OA 2XVAA 1ORRA 2PX3A 1AVTA 4L5JA 2WICA 2YVLA 1Z25A 2EKZA 3FUVA 3VZSA 1TQ8A 1VPDA 1Z6AA 1B93A 4QXAA 1BHQ1 1ODLA 4ATNA 2C1EA 3EQ6A 4UD6A 2GTIA 4I50B 4D9IA 4QLBA 1CLEA 3HXKA 1YB7A 2PKEA 4DABA 2O8DA 3AFGA 2O7NA 5JTTA 1KU0A 1P4GA 3BWEA 4MQEB 1KWKA 5C8ZA 3B1VA 1YK0A 3NTXA 4AURA 3OJCA 1EB8A 2FEXA 1KEEB 1II9A 1NXOA 1VZ3A 1XXHA 3N76A 2Q62A 5FT9A 5ALQA 4OTZA 3A9CA 1JQLB 1ZCFA 3DV0A 2XCRB 4NXNB 1OBFO 4WLFA 3QF7A 3NBAA 1X1CA 2G63A 3ZOZA 2FK7A 1JJFA 1SKYB 4MW2A 4RHFA 1FQJA 3IVGA 1Y1QA 1ZJJA 2BZ1A 1LLFA 2CHQA 3ORYA 4G65A 4YRSA 4LY6A 1VL6A 1K5GA 4GD3Q 4Q1AA 4REMA 3LV8A 1F9AA 2HDWA 1SUCA 2A92A 3T3PB 1HNWB 3JARA 1IHDA 4Y6PA 5AUPB 1SWVA 4RWEA 1LI5A 1E9BA 2CCGA 1QDUA 3Q9UA 4RFLA 4MKZA 1UBNA 3S3TA 2VBGA 3TD2A 5INTA 4MWCA 4DR5B 1U1IA 2RI0A 4JELA 2O2SA 4QUAA 4RPJA 1D3AA 2ZU6A 4FDLA 1GPLA 3LCRA 5T4HA 3TIFA 3GLGB 2PGAA 2DPHA 2G82A 2Q4RA 5CP8A 1GEGA 2V7TA 1JLSA 1Q83A 1ZITA 2V8OA 3EXHA 4JB0A 2G88A 4LJAA 4ACAA 3A1CA 1DMSA 3IT3A 4UCFA 2AEMA 2X4GA 3CNLA 3DZFA 4MGIR 3W06A 3HC7A 4NFSA 4DM3A 5AI8A 4QGGA 4RLHA 2FZKA 5EUBA 1CULC 1W36D 1VSVA 4MMXB 2PRIA 4FNMA 1NF9A 2EZ8A 4KZPA 4NE7A 4WCFC 3ZGNA 5A3JA 1XPUA 4DQDA 4EPTA 1V71A 1COZA 1WBBA 2AWNA 1ELOA 1KK0A 1I2MA 2LTAA 3AKDA 3BHMA 4YQYA 1JWLA 2FPOA 1RHMA 1ZH6A 4BN4A 2B2NA 1NVBA 3MEQA 5FYQA 1DC8A 2JLUA 2QAGA 2EZ9A 5EHZA 4EG0A 5IYZB 1JFFA 1K88A 2GN0A 3K8QA 3X2EA 4A2WA 3U4MA 1YKGA 3MWEA 4PX2A 5J47A 2CZQA 1UBRS 2WV9A 3FZYA 5BW4A 3GV0A 5G4LA 3MVEA 1CS4C 2AYXA 1KAEA 1RVDA 4IMRA 4I99A 1R6AA 4WOCA 1PVVA 5JAPA 5J9FA 1JT2A 4PQEA 2YUTA 4LGVA 3JWPA 5GMOA 4Z7QB 3EULA 4N3NA 3F9IA 5JAIA 3OTHA 2P2YA 1KMMA 4KQWA 3K9HA 3GEGA 1M34E 3DE6X 1ISJA 1QJCA 4G4GA 4WNIA 3H4VA 3DB2A 4QBGB 1XKQA 2QVCA 3ODPA 3N8GA 3AK4A 3AGQA 3C6KA 4Y9DA 5IXYA 5I7OA 1QQAA 2QHXA 4MWZA 1AS3A 3PFGA 1MA3A 2H4XA 1XQ9A 1IN8A 3HB9A 5HTOA 2CWDA 2FSVA 2R6JA 3EGVA 2N46A 3SDSA 5KUTA 1DT3A 4RGYA 3RROA 3GOQA 2LV8A 2ZWAA 3NDIA 4RK4A 4Q9LA 1IM2A 2DHRA 2PH1A 3ZE2B 3CB2A 5EIFA 3BSYA 1NVXQ 3F6YA 4BB5A 3WLAA 3LW8A 2FYTA 3OJOA 4BMSA 2ADMA 2OCLA 5ECWA 4R2LA 3IHTA 1OX4B 3THYA 2XUFA 2ISSD 3L8ZA 2Q46A 3AF0A 3EWAA 4IH1A 1THGA 4BNVA 2QN7A 3E8MA 4CBVA 1CYDA 1QZUA 5GOZA 1S7GA 1P62B 4UASA 5AJTA 4ZHQB 2IUTA 1OROA 4DIOA 3TXXA 5A5VA 1BYUA 1YR7A 2ZPAA 4GX2A 4PONA 4WBXC 4ZGWA 2QZZA 2X1VA 1U80A 2C5AA 3I01A 2EBFX 2GZ1A 2QL6A 1J42A 3CE9A 1V8PA 3MWLA 1Z16A 3I1IA 4OB8A 1MOPA 2ET6A 3K9LA 4MW7A 2W2TA 5CVJA 3UZUA 4CF3A 4JLBA 1UBGA 2DWUA 2IYZA 2FDCA 5GPBA 1SUEA 1GNPA 2Q1UA 2CV1A 1JDPA 1KSHA 1GUZA 3KDAA 3Q3CA 5I9LA 4LMBA 3JAWB 3NW9A 4TLLB 1KEEA 1ZGGA 4R16A 1AZWA 1JHOA 1H23A 3D6VA 3BJRA 4FHDA 3RYHB 2PUTA 1UDXA 1ZA2A 1G0OA 3GN2A 2LW7A 2P69A 4EVRA 2QRHA 4DFDA 3KHKA 3NUQA 1OLSA 3WVNA 3AERB 3SP1A 1J24A 3AUYA 1DKNA 3OO0A 4Z8YA 1U7WA 4Q24A 3SX4A 2X6TA 5ALFA 5J63A 4DLAA 1LBIA 1E4OA 1BN7A 2VK8A 1DAHA 2FV8A 3UJNA 1N33B 4NPHA 1E9VA 1W0JD 2DFTA 1XSEA 3BFVA 4JYPA 4R3UC 4XDGA 4JJKA 5EQJB 4BGVA 5D51S 3PUKA 1OXTA 1SY7A 1TO1E 3W6OA 5E38A 3T5MA 2GASA 1XI2A 2QXTA 4AG5A 1KJIA 3E4DA 3VPHA 5LZ4A 3WO0A 1TJYA 1J56A 1Q16A 1YB1A 2LPMA 5DP2A 2OV2A 3MAJA 2WYIA 2G77B 3G82C 4QFDA 4BVAA 3F6SA 2JARA 3ZWQA 4KR9A 1YDWA 2XGGA 3E05A 2BMJA 3DV9A 3HI4A 1IBKB 2CXHA 4WY2A 4ON9A 4IO0A 2B8WA 2R8ZA 3DXFA 3L7OA 5EE3A 5JNWA 1ZM2A 3KHUA 3LYAA 3L1KA 1H2AS 2OV6A 1UQRA 2J0UA 1F14A 2WUFA 3PXUA 2QVLA 3I8XA 5HIKA 3G2OA 1FXSA 3W9BA 4RFVA 1C1HA 5CW1A 4MUHA 5L3QA 2O8FA 3LQ1A 2AZMA 2A5FA 3JD2A 1TF7A 1SG6A 4N5MA 2IYLD 5HQTA 4UOZA 3GQVA 3LLMA 221PA 4ZRDA 3ZV7A 4RD1A 1WDMA 3OT1A 5CCDA 2NM0A 3RS8A 3ZS8A 1AN9A 1MJFA 1SWWA 4TMWA 1H1LB 2RGDA 3R41A 3SIXA 4RHTA 5J40A 3BD8A 4EHHA 4NMMA 2RDMA 1QMPA 1XCGB 2B82A 1FMJA 1RABA 4XJXA 1O96A 3K6SB 4YAFA 1HDOA 1NBIA 3S7ZA 5IYZA 4U5QA 4BBJA 1FRFS 1JKIA 2EXXA 2K7ZA 3HQ4O 5JSYA 2XYPA 2WJYA 4DRXB 1DNPA 1EFRA 2A0UA 1WHTB 2YRXA 1PS8A 2C92A 1CDDA 3BGSA 3QVUA 3CLUD 3GAZA 1E98A 4HO1X 4V3BA 3A4NA 4WQMA 1UBKS 1L7DA 3ZE1B 1ITZA 1NP7A 3KR2A 4WPGA 5F1PA 1Z22A 1UKZA 2L2QA 1AU9A 1GAQA 1NKTA 3AJEA 4CU5A 1Z0KA 4HCJA 4TV9F 1VBKA 2QUIA 1I94B 2EWVA 3C4QA 4BEWA 4ZT3A 1Y4SA 2A5DA 3CEHA 3G7UA 4X8HA 1Z83A 2FAXA 3CYFA 4FOLA 3SC2A 3LXXA 4D9EA 4JHXA 4WNAB 4BNDB 3RRNA 1ADYA 1SOMA 2UKDA 3N2LA 4GYKA 4PNEA 4OKNA 4CUZA 1WW2A 4OUDB 4RESA 4JI0B 1B26A 2J9FA 3ZK7A 3SXJA 4X93A 4H7PA 4WXYB 2QM0A 4EVQA 1OIXA 2DJ5A 4EYEA 3QVGA 1YJ8A 2PLWA 4TSKA 1FFEA 2Q9AA 1RYBA 1N2CB 2VJCA 2XYHA 3PC4A 4IRUB 4LBVA 4OFXA 4BLQA 4C7XA 4V1CA 3L8MA 4QUKA 4F3NA 3SBOA 3S8MA 2OT3B 1JPUA 1SMKA 2V97A 4B34A 1HZZA 4XWKA 1N8SA 2BMEA 3S1AA 5GADl 1TVEA 4TQ9A 1XNGA 2F3QA 1SG0A 2WWFA 4W63A 4HDRB 3IP3A 1ZM3A 1SVOA 4RSRA 1Y0BA 5TMPA 1JAXA 1XPOA 1PR1A 2GAFA 4C0QC 4IJ5A 1IB0A 2FRDA 4G1BA 5JYDA 3HWX1 4B2LA 4LOHA 1RMTA 3A2NA 4IXWA 4HNSA 1ZRSA 5CTJA 1EXDA 2NSYA 1NXVA 5GJVC 1J09A 1T9DA 1SAYA 1UJ2A 3OKCA 1S3IA 2Y68A 1RXIA 4PVCA 4RY0A 1XKXA 2R1VB 5BNFA 3A6GA 2PFSA 1C30A 1QV7A 2IQ5A 1U1EA 1S1MA 5J5CA 3RBAA 1JG7A 3SXUB 3WNDA 5C53B 1S1CA 1NA5A 1PG2A 4NCHA 3EFEA 3V8MA 2K87A 1JHMA 4D44A 1WB9A 3E22A 4IWYA 1O95A 1UMDB 2ZS7A 4OFWA 4ZEVA 1NUHA 3H2YA 3VH3A 4M0CA 1QHNA 2OAGA 1WPQA 2ZWMA 3Q40A 1GPYA 2CEAA 1TLTA 2ZBVA 2AFHA 3GFOA 4JP1A 4Z0TA 3G7NA 3LUPA 3TZCA 1GD1O 3FSGD 1DSSG 2JD0A 3EISA 1IWBB 2XOKA 4U7JA 4PO8A 1J2EA 5F1OA 2BM8A 3TVTA 4FI3F 1NXTA 3PRKE 2AYZA 1Z5NA 2B5WA 2JFXA 4J16C 2GH1A 3WS7A 1PG0A 1RW4A 2BGRA 5U9CA 1U8AA 2Z2IA 2P79A 3N7TA 3QV1A 1D8TA 3U09A 1NVTA 3LS2A 4J07A 3AI2A 1U9CA 5GJWC 1P91A 1ZGZA 4Y18A 1AUVA 1Z6ZA 2VRBA 3MJ4A 2BEWB 4KI7A 3RD5A 1WZEA 1PYDA 3IPCA 3FAKA 3GBVA 4EFLA 1Y82A 4GOOD 2GCNA 2HCRA 3L6BA 4AO8A 1CUHA 3O4FA 4CM9A 4QJ5A 3X1DA 3GFQA 4E2YA 5BSHA 4ED9A 2UYCA 1JEYA 4JI5B 2FN7A 1KYIA 3BIOA 4EUHA 3ZHUA 4IILA 2VQ6A 3DMPA 5FQOA 1OWMA 1RZUA 1SULA 4J91A 1JIVA 4YAJA 1ZUNA 3ABSB 5CPFA 2RHHA 5SY4A 4JL8A 4P54A 2JGLA 4I6JA 3UHJA 4CG3A 5LIRA 4TLAA 3OEHD 1NSFA 3N7UA 3R0JA 4ZYUA 5JSFA 1IRXA 5A62A 1U8FO 2DTXA 4C0HA 2P78A 1SD1A 4Q3NA 4LNUB 3WMFA 3KQPA 5K8LA 4DWOA 4G0ZA 4QXQA 4MV6A 1EG2A 2REQB 2ORYA 4PXYA 2O5CA 3MWJA 5CG1A 1E3QA 1R3DA 4OYHA 2QX9A 1PZGA 3KFLA 4K5QA 3AHJA 1TPYA 4FMBB 4OQZA 3NI2A 1X7YB 4DSAA 1IHUA 4FWIB 5CT6A 4HNAB 5C9ZA 3OSZA 4TKUB 3WGOA 4BUCA 1IHPA 2NTYC 2VAMA 4DNPA 2BFEB 3AJAA 3ZIAA 4HDQB 4MJ3A 2A1TR 5EJ9A 4RANA 1LTKA 1L5KA 1C8VB 3UIEA 1GZSA 4MYDA 1K8QA 4RGBA 3UG7A 1M1NB 2ECKA 2OBBA 1VIVA 2X76A 3ZDQA 4DUGA 1R9MA 2J4FA 3A70A 1MJ5A 3PQ3A 2WTEA 4URUR 3CBGA 1K7XB 4GDFA 5C37A 2EL7A 2R62A 4X6XA 4AWXA 3QUSA 1Z18A 1ZC3A 1NY5A 3Q5DA 5JIBA 4WNAA 2G1AA 1B8OA 1EA5A 1I4EB 1SCJA 3BH7A 3O8DA 2YXLA 2ZSIA 4RHXA 4X5OA 4HNUA 3OFSA 3U3JA 1I6LA 3IYLW 4WJLA 3CWZA 3SAJA 1ZMTA 4U7TB 1L7RA 1E3EA 2WV7A 4MR9B 1GTSA 3WGIA 3NO4A 4OBXA 4ZQHA 4JLDA 3AEUB 4I3GA 3VYWA 1LI7A 3IKMB 3O82A 1K7SN 3Q85A 4ITUA 4J0FA 4NOKA 1WB5A 1Y3IA 3D3EA 5IYZF 4NH4A 3WK6A 4AZ3B 4W5NA 4LCJA 1N1EA 3ZUPA 1XMXA 1P3DA 2UV8A 3UAZA 1L5HA 4RGVA 5LB4A 4D92A 1PGNA 2W6QA 3S40A 3U9SA 1THMA 4DXHA 1QVWA 4UBIA 3WE7A 5CYGA 3I9JA 3I6MA 2A14A 2FUG1 2I78A 2H1IA 2QE7D 1F0PA 3JWHA 3PK0A 4OYLA 4QFMA 5IAOA 4XFDA 1SXGA 4W8OA 5CFRA 2VSYA 4N8DA 4YCCA 2RAUA 3ZVKA 3HBJA 1KAGA 1C3LA 1N5IA 1CQXA 3FLAA 3HN6A 2OCKA 4FLFA 5T41A 3R0QA 1BX1A 1DRUA 5D1HA 3RIYA 2WT9A 4BRSA 4OI1A 5LMCA 1W4CA 3C3JA 3BWDD 1KH2A 1RCUA 2H4WA 1V2GA 2C4HA 4F92B 2R6ZA 4TV8B 1JWBB 3EWSA 1T5DX 1H6DA 3WFZA 5FBQB 2C7VA 2P3LA 4YONB 5H8WA 3NWPA 4Q82A 3G2QA 1HRKA 3CIOA 1JE1A 4OI2A 5DM60 4BPBA 1ONBA 3LVBA 1GKUB 3B20A 4CRWB 1ZNZA 3K8YA 1BSVA 3FCUB 1BMTA 1XEXB 2PVCA 3CUVA 4HGNA 2O8BA 3L18A 2OHOA 4W7HA 5EZSA 1VLLA 5C81A 4Y6QA 4GW3A 2ARKA 1U11A 4MDHA 3CVYA 3L0YA 4UM8B 2EZ4A 1DAFA 4DUZB 2TMYA 2C2HA 1SD5A 2ONYA 3R4VA 4YP6A 3SKXA 2I7XA 3WAGA 1FYEA 5FWAA 3UK2A 1MTZA 1CVRA 1ULZA 3L0BA 2I4NA 2Y1DA 2FUG6 4L6CA 3UMGA 3GP5A 1DUVG 1DXQA 1GY8A 4W1QA 1MW8X 1E66A 4IRMA 4PZAA 2F9FA 3B6JA 5BQOA 4UEOA 1YIDA 4P3XA 4B6RA 3HMQA 2N47A 1LSUA 1D9XA 1NP3A 3CLVA 3QVMA 5AQEA 3TLGB 1A9XB 3NFYA 2X1LA 1B6GA 1LRJA 2HYDA 5C1DA 2O2IA 1QTRA 2C04A 4BQOA 5AW4A 4B81A 3THRA 1M73E 4R4JA 3IODA 4PXAA 3TCXB 1F0NA 4Z7NB 1PJ2A 4B2IA 2PZ8A 3CQ9A 1BMDA 5KDOA 4O2RA 3BMNA 3JYPA 4BKMA 5ICFA 1PZNA 1QRDA 2IRWA 1DUSA 2WA1A 5I51A 1FTWA 2QV0A 2P90A 3Q7SA 3L1IA 2X9VA 4M88A 1N5MA 4XQCA 4YRPA 3U1TA 1NM5C 3FSRA 3I32A 1DV2A 1SCBA 2FFBA 3K35A 5HQ3B 1P1BA 5JXJA 3L0DA 1XVUA 1DOAA 5DZSA 1PFYA 4B33A 4R68A 3V1UA 4PXSA 2X2OA 1J7JA 3K73O 3ZPXA 1R9NA 4ECEA 4LJ4A 3A25A 4LYEA 1AHNA 1V3TA 3OMXA 4BJ6A 3RKSA 2X9NA 1BHO1 1PJAA 2CE2X 2P9TA 3EGEA 4OK6A 1SKYE 1O6ZA 2JCSA 4US1R 5LQAA 1V3UA 4GMKA 4PLTA 4WINA 3K0AB 1LXCA 4A6EA 4ES6A 3DTTA 1SBYA 4RVOA 1KRXA 3GCWA 5CLQA 3ZWXA 1M1YB 1BWPA 1N3IA 1U0OC 3JRXA 3UJ7A 3IT1A 4I2NA 3VNBA 1A97A 3KYDB 2QGZA 4B6FA 3H86A 4P98A 2LCIA 4JYMA 3GJRA 3ZDRA 2GD1O 1FFGA 2CLLB 3ZV3A 3QJGA 4PPQA 2ACKA 1V16B 2QI9F 4N5IX 4YNBA 1IHYA 1X8JA 1SRRA 2J3DA 2OC4A 1AK9A 1EINA 3AKEA 4C30A 3RVOA 3IAUA 3P8ZA 2Z3WA 2BELA 3DO5A 3R3YA 4W6ZA 4XA8A 3RBXA 1SOVA 5A5FA 3BGIA 1C3JA 3SM9A 4UTVA 2PLAA 4RDXA 4DV6B 3CG4A 2NT4A 4MQLA 2NMVA 1I2ZA 2HOQA 2NSJA 4PO1A 1EFUA 1UAGA 3HYNA 1P0MA 5FPQA 1O2DA 3PX7A 1Z8FA 4GR5A 2NUAA 2WM3A 1LZLA 2Q1XA 5HBGA 1Y80A 5BSUA 1TLFA 3EQ8A 4MVCA 4PZUA 4DLYA 4NR0A 1NF2A 1U0EA 2E4VA 1M8PA 1N5OX 1KZYC 5ELXA 3ZWCA 4P3OA 2PH3A 4U7FA 3Q88A 1JS1X 1NI3A 4HXYA 1DBQA 2E6KA 3PXXA 2NTJA 3WX0A 1QP0A 4M1KA 4F8EA 4XIIA 1OVMA 1JECA 1RKXA 3W9YA 3A7DA 1K7FB 4XYMA 1UBUS 2IEGA 1ES9A 2JGDB 4I1PA 2L19A 5KWSA 3TUZC 3M1IA 5G0TA 2WMNB 3T5DA 3DVLA 3OUUA 1XTJA 1Z0ZA 3V00A 3YASA 3F9RA 2HRDA 3GYGA 4G8BA 2FPPB 5JRZA 3HZZA 5HA5A 1NMQA 2X5NA 3EAQA 3NVDA 3TMKA 1W4RA 3F4LA 1OOEA 1SBCA 2JRLA 1YJQA 2A5GA 1Q1BA 3LFHA 2YQ4A 4RETA 2R0QC 2LWIA 3FCAA 1NNUA 3TR0A 4LF7B 1M6VA 3NRBA 4H1VA 2TRSB 4YPOA 1OH7A 3OCVA 3NWJA 3VNQA 1JPJA 2PD6A 2VRCA 2D13A 5DBOA 2CNWA 1XD9A 4J2HA 5CLIA 1U1CA 4PNPA 3U3RA 1XDSA 1EUCA 1AG9A 5K2OA 3GPLA 1HE2A 1WNTA 2YIVX 4M87A 4S2UA 5KQLA 1UOPA 1QCZA 4X91A 2OBFA 3LQ4A 2EATA 5BQXA 4MS4A 2VP0A 5EOVA 2ZM5A 1H2BA 1QYDA 4GKVA 3EMVA 1PTJC 4WKOA 4EW6A 3F9CA 1YHYA 1P2TA 1T0IA 1VL1A 3H5WA 5BN5B 1FQKA 4M3NA 2XB9A 3CNQS 3TLGA 1Y6JA 1A9XA 2VQDA 5EXDA 2E1RA 4CUJA 5EJGA 4EGSA 1R18A 4M0UA 2GEUA 1H2WA 4GOKA 5EQTA 4P0PB 4QXOA 3F6EX 1TK9A 2GN2A 1SVMA 1Z47A 4KXVA 2HLNA 3ZGLA 5AUOB 5TSDA 5ALVA 4NI5A 3ITDA 3OKAA 2X2PA 1ISMA 1P60A 1UFOA 3C98A 2ZGVA 4FC6A 1WDLA 1IJFA 3ZCVA 2J3HA 3FBWA 4L2IA 4N12A 4RK0A 1UKEA 5E6UB 4TLEA 4NEHB 2Y99A 5K9ZA 2EBHX 4BEVA 3ZKAA 1EWRA 1H5QA 2ZIWB 3EPLA 2W6NA 1N5KA 2WYVA 2YWRA 4CXMA 5JSUA 2BAGA 2YXNA 4DCOA 2GF2A 3H1BA 5CIQA 1T4CA 4D0RA 2ZRIA 3RF6A 3DNFA 1O9HA 3GBSA 1CJVC 1BD4A 2AFHE 3D02A 5EESA 1YQUA 3QFRA 5DM4A 4P36A 3UICA 3VR0A 1NT4A 3HV2A 1SVUA 3DL2A 5E4JA 2JLZA 1NASA 1ZA1A 2C7OA 1XHLA 4QYMA 1V1MB 5T4EA 4DIEA 5KTSA 2GEBA 1DAKA 4CKEA 1OTYA 2QLMA 1C2YA 4M46A 1XE3A 2AJ8A 4L4YA 4P8RA 4Y0VA 5KHOC 4QYIB 1I4DD 3ZHCA 4YMGA 5T67A 3VSCA 2D74A 2OCGA 1FQWA 3RODA 1CUBA 2CLHB 4O1MA 3H9EO 1T36B 3NKFA 5HJ2A 4NS1A 2ZR8A 3S81A 2VG8A 4MV4A 1P61B 2GM9A 4QDOA 3QXSA 2IDKA 1EXMA 3FKJA 4LZZA 1V95A 3TTYA 1NATA 1TQ6A 1Y1SA 3UGTA 2IBTA 3AI3A 5D00A 2YW9A 3BCHA 1RXYA 5B3LA 2YJTD 2IHBA 3FUUA 4PZZA 4XWTA 4G5YA 3T54A 2OMKA 1G3QA 1IE3A 3CKKA 1J90A 1M6WA 4Z0HO 4JI4B 1YS9A 2RGNC 5JY1A 5JECA 1RQ2A 1OUMA 3QXJA 3TIXB 3DBIA 3HRHA 3EWIA 4JLSA 3HO1A 4H77A 4MKGA 4C0WA 4MULA 1VRVA 1X38A 1YB4A 3ZY2A 1RC8A 2XI4A 1JKMA 5KDDA 2OFXA 4ARZB 4PZLA 1G5RA 3FDJA 2VP9A 1O8BA 4JX9A 3GWGA 3MK31 5C35A 4PRYA 3TINA 2FGKA 3RAFC 4NDNE 1PL6A 2VOJA 1MO3A 2Q9UA 3BHIA 4JBIA 2JGRA 3CX7A 3D4PA 5L4LA 3DLBA 4RTSA 4Y2PA 4GUDA 2DCUA 2GPBA 1W2WB 1Q1QA 3LT2A 1PFGA 4HS9A 4HWOA 4K0KB 1PJZA 2WHYA 3KUCA 4FHEA 4G9BA 4PANA 1M8FA 1O58A 3DMNA 1M1XB 4XCVA 5EVCA 4AUKA 1E1KA 4ZJZA 2EDAA 3S2EA 4Z4QA 2X0EA 4IZIA 3W1EA 2HA5A 3NTLA 4IX1A 3UXYA 4L0CA 1EMDA 5AD1A 4DMHA 1G5FA 2XMRA 4MYSA 3ZOKA 2OC9A 2CZCA 3GK3A 2YH2A 4PINA 3HHPA 2VPQA 1JAHA 2IYWA 3ETEA 3LVQE 8OHMA 2PTGA 1TOAA 4RIGA 4AF6A 2XRFA 4AZWA 5BWBA 4X62B 2QDKA 3DT8A 2NSDA 4NAUA 5JPIA 4NCAA 3FG9A 3RVKA 5J1SB 3QMPA 3HO8A 5BSTA 4D3YA 3S8YA 4QM7A 2Q28A 2VYND 5KKAA 1KHTA 2J6HA 4C4YA 2PKRA 3T7RA 2DBQA 3LDUA 1T0BA 1VPLA 3H9UA 1XD2B 4W5JA 4DXAA 5SICE 3GQBA 3W04A 4EL0A 4EY7A 1M2JA 2P4EA 3IUSA 4YACA 4B4VA 4CM6A 5JS1A 3C74A 3TBFA 1LV8A 3ADPA 1FMCA 1IU9A 2I2WA 1W0KD 2XSZA 1C1DA 4L76A 5E7JA 3O4VA 4ASUD 2W2LA 1U5BB 3LU1A 2GYVA 4MA0A 4UAVA 2ZTSA 5F7ZA 2IU6A 1OWNA 1SBQA 2GR9A 2V4UA 3DXXA 1CQWA 4JJGA 4UU0A 4CYMA 2P5YA 4RHEA 2FF5A 2OQRA 2ENWA 4FFWA 3SS9X 3L0ZA 3MMXA 1UZNA 3UWKA 2FW6A 2YIMA 4BQRA 4C4XA 3R9WA 1HFEL 4D3SA 1VGQA 4LN1A 3P2KA 5CXXA 1G17A 3O8OA 4TMFA 1RWNA 5DYNA 1FFXB 3UH0A 3L4BA 1G8GA 3HXPA 4ZVPA 3RJ5A 1BKDR 5CBPA 3LWZA 2AN3A 1AKVA 3C7AA 1XAHA 4C06A 2YZMA 1XVIA 4DXDA 1FP4A 1GAXA 2ZUCA 3R44A 3HYTA 5BOVA 5IPFA 4BX0A 1UDAA 1BH6A 1YRBA 2GJ4A 2F59A 3L1JA 1JDBB 1ZJWA 1DX9A 2H7YA 2IHUA 5BOSB 4CN9A 3GRPA 4TRMA 1P18A 2ZIXA 2BW0A 1K66A 2MHCA 4LAFA 1IUKA 4MSUA 1VGRA 2XNDA 1T36A 4M21A 4CM8B 2WHXA 2Q6LA 3NIFB 4S05A 2BFBB 3Q6MA 5BY2A 4RKFA 1ZQ9A 4FMDB 4O2AA 2X2FA 3F0TA 2KLBA 5EEGA 2VDOB 3TSYA 4C3OB 3DMTC 3QENA 1RS0A 2W2KA 2AMFA 2A78A 3TQSA 5I7HA 5KOJA 3TUJC 2J59A 1QH1A 2AE1A 4EQ6B 1MH1A 4REOA 4RDIA 1IXSB 4IG4A 4LZOA 3EDOA 5DLPA 1Q0RA 5NLLA 3LT5A 1GRVA 5FWXA 5CH5A 1MPXA 3OKPA 1MFZA 4PTZA 1VKOA 1MKYA 2XBLA 3JRWA 1QRSA 4M9XA 4Y6LA 4L0MA 5HMLA 4JJ7A 1B3RA 3VPCA 5BUSA 5IK2D 3UAWA 3R0VA 2D3TA 2BKAA 4JYCA 1HV8A 5FWYB 4UM7A 4KR0A 1NVKA 4PGHA 1WQ4A 4P4SA 2WMYA 3UB3A 4DA4A 2FPIA 3FXAA 2PMKA 3IMGA 1PFUA 2QJOA 2CK3A 1C0PA 3LBIA 3F3YA 3GEIA 5K4HA 3GROA 3O1LA 4GXTA 4ZFNA 3L8EA 1W8IA 3DOJA 3HUDA 1P5RA 1Z12A 2C8LA 4FBLA 3P9NA 4YB8A 5GONB 4ZZ0A 3ZZNA 2HSEA 4ENQA 5LYJB 4W4TA 3CW8X 3FVVA 4TMXA 4DCCA 2JFZA 3F7MA 3DXZA 1KIMA 5LDDC 4UAGA 5AIBA 1LC0A 4H18A 3VR2A 3GNTA 4FGZA 1ZHOA 1CUJA 2VYQA 4O4HA 3G88A 4J1TA 3UFXA 5AHXA 4DMFA 2V7QA 3CF4A 4EPVA 1Q50A 4HB4A 1J8QA 1YR2A 2QU8A 2ZBQA 5ABPA 3L77A 5E2BA 3G0DA 2CLMB 4BNWA 3FYTA 2Q5EA 4NFYA 3EC2A 2JEZA 3G8YA 1CRZA 4EX7A 3F5DA 2XVMA 2OMEA 4N03A 4C4AA 2VNJA 1EXVA 4KR6A 2NP6A 4WOJA 3B3QA 1SNYA 4RTLA 3LQRA 4BCCA 3FYCA 2CHUA 4EOGA 3L7YA 3A1EA 1GJRA 4Y2XA 3L7IA 2JH9A 3EZ6A 1J39A 4I81A 3ZVNA 5L3SB 3REFA 2XXBA 4WRRA 1XD2A 1DBRA 3BPSA 1BVYF 4FYPA 1N34B 3ISJA 2V3WA 4Y6RA 2I4RA 3NR2A 4C2BA 5DGIA 3MMSA 2O8CB 1CDZA 4C43A 1HKUA 3PWKA 3IV9A 4KVFA 3W8EA 4U2DA 3WNZA 1DS6A 2PX8A 1Q7CA 3C5HA 2DGDA 3LQQA 4KLRA