2FHSA

Structure of acyl carrier protein bound to fabi, the enoyl reductase from escherichia coli
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
258
structure length
258
Chain Sequence
b'GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords enoyl-[acyl-carrier-protein] reductase, NADH-dependent
publication title Structure of Acyl Carrier Protein Bound to FabI, the FASII Enoyl Reductase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/biosynthetic protein
total genus 83
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fhsA00
2R2GA 4BKPA 4A73A 3TFQA 3H65A 1E6UA 1A9YA 2VUTA 5ADHA 2QYSA 4R16A 3S2FA 4BNWA 4N5NA 2BHLA 4AJOA 4YT2A 1OAAA 2O3JA 3KUXA 3L4SO 4XGKA 4Z9XA 1X1EA 3ZCXA 5EQFA 1P1RA 5DF1A 1ZMOA 1B15A 1ADFA 1HTBA 1P0CA 2VRCA 3AM5A 4R3WA 2I5PO 3ZWPA 3HSKA 1RKXA 3PWZA 4AJ1A 3TZHA 3MTGA 5AXBA 1A27A 1BGVA 3C8MA 3DEYX 3O38A 4MVJD 4NI5A 4W4TA 1E7YA 4BO0A 4R41A 1N9GB 1ZZEA 1PJQA 3DBLB 1HE5A 4GX2A 1MP0A 3FD8A 4BV9A 3H9GA 4WLUA 1E3EA 1E3IA 2WWRA 1NTOA 2NVBA 1QG6A 5J23A 1JTVA 4HY3A 1NQTA 1ZK2A 3ICCA 3EDMA 5JW6A 1KBZA 4B3IA 1NNUA 5L7TA 1JWAB 2YY7A 3UOGA 1HRDA 3B1JA 4OKNA 5IDQA 3RBZA 1ZXBA 4DIFA 3M6IA 2NUAA 2JFFA 4Y9DA 3H9EO 1LA2A 2JCXA 2AEJA 5K6AA 1VLLA 3L77A 1B8UA 4A5OA 1ADBA 4YYZA 1D1SA 1JVBA 4LRSB 4XD2A 5L7WA 1NR1A 2X86A 4C7JA 3U3XA 1U3TA 1Z74A 4WGGA 4FB5A 3MZ0A 5L53A 1XWFA 4QFCA 2OGUA 4M1QA 2NQTA 1EVZA 2GYYA 4U0KA 1I33A 2C5EA 4AVYA 3ABIA 3RFTA 2PK3A 1Q7GA 2B4TO 1D8AA 1W0CA 4JLWA 1NQAO 1E1MA 1SOWA 3HDJA 1KVSA 4J91A 2GRAA 1YB4A 2QHXA 2Y93A 1P74A 4KUHA 4PLYA 5EL0A 2WMDA 1VKOA 2GN8A 3PJEA 2JHGA 1E3SA 5IXYA 4PN3A 4J7XA 1F14A 3LT2A 4QFDA 4CUJA 1FDSA 2OBNA 3CE6A 1PJ3A 4IJVA 5LCXA 4DYDA 3E9MA 3VKVA 1CETA 2OXIA 1P3DA 3JQ9A 4XIJA 4L4XA 2FR1A 1ZEMA 4YWJA 3WXBA 3GN1A 1F17A 2LDXA 2VOEA 1ZK0A 3GNQA 3DZFA 1F8FA 3ZHYA 1B8PA 4GI2A 4BMSA 1DXYA 4TRRA 2FPGA 4PLWA 4W9NC 1NVGA 5CEFA 4EGFA 1MGOA 2YFQA 4GKBA 1QR6A 2HK7A 4FQ8A 5U1PA 3UF0A 1E77A 1U1IA 2WD7A 2FWMX 2DQ4A 4CMGA 5KKCA 1YQGA 3RKRA 1R4MA 3NT4A 4J43A 1SNYA 1Z7BA 5I7EA 2PD3A 3FPLA 3GN2A 1YJ8A 3BZUA 5ICMA 1I2BA 4HKTA 4O6VA 4AJ4A 3HZZA 1FDVA 4RO0A 4WECA 4PLFA 2PWZA 5BT9A 3P2YA 2X22A 4OSOA 1R12A 2PGDA 4AFNA 1DEHA 3NJ8A 4GX1A 1E1NA 4Y6SA 1FJHA 2JD2A 2FN7A 4GX5A 1KC3A 4RJTA 1UDAA 2HMUA 3PYLA 2DFVA 2EGHA 2GN6A 3DB2A 1LDEA 1JAYA 3GDOA 3KXDA 4O63O 2AQKA 1OC2A 4N54A 5A06A 1XU7A 4FFPA 2C0CA 1G1AA 3TWOA 2Y99A 3RFXA 3ORFA 3LF1A 4B4OA 2BI8A 4YXFA 3IL2A 1YL7A 4YRDA 1ZSVA 3O4RA 4ID9A 2B83A 4F3YA 1WAMA 3BTVA 3S2IA 3ZH2A 3RUAA 3FBGA 1OI7A 2NVWA 4MVJI 3D3EA 1R6DA 4IZHA 3RSHA 5MGBA 3DWFA 2YV1A 5JAZA 3I6IA 4L73A 2RH4A 4J1SA 3G79A 5CG1A 1X0VA 1EVIA 1BW9A 5TT0A 3LC2O 4CM6A 4PZEA 2LDBA 4BQRA 3ADOA 4WASA 2ZKLA 3WGYA 1O9BA 1Y8QA 5EPOA 2QRJA 2NTJA 1LDYA 3HE3A 3OA0A 1PS0A 2P68A 3U49A 1LSJA 1LSSA 1SBYA 4AJPA 1HF3A 1R4NA 3JD3A 4P38A 1X7DA 2Q4EA 3EHEA 4U6SA 4Y8VA 1Q7BA 5I7VA 5IF3A 4NFSA 1X7GA 3P5SA 2DBRA 3ZHBA 1E3WB 2NVUA 1NQOA 2BD0A 2O2SA 3KBOA 3PEFA 4G81A 5JCJA 3I6QA 2X0RA 4XQGA 4BOYA 5KJ1A 5AXAA 4PZCA 2R00A 4J9VA 3JQAA 3H4VA 3UFXA 1XEAA 2JL1A 1LLDA 3GQVA 3GVPA 1ZJZA 1E92A 3JD4A 3ST7A 1PR3A 2J5KA 3FTNA 3I4FA 2IRWA 3MJTA 4E5YA 4JXKA 2AG5A 1NXQA 2CDCA 4D44A 4J16A 3DMTC 2ZB3A 3NDIA 4OXNA 2O50A 1OFGA 2BGLA 4KP7A 1KY4A 3G3EA 2J5RA 3HDHA 4MO2A 3G0OA 1PS9A 1JWBB 2YDXA 4BNNA 3ZW9A 2AW5A 5A5FA 3G1UA 3E6AA 3WGOA 3VDRA 1VRWA 2W2LD 2FP4A 4KTVE 4R54A 4RPHA 4L75A 4EEXA 1IOLA 5A9TA 1YRLA 3ONDA 3OH8A 3GVXA 2I99A 1PX0A 4N5MA 4A27A 1CYDA 3M1LA 1E7RA 5B37A 4E6PA 3ZGYA 4CMCA 2YQ5A 5ITWA 9LDTA 1LDMA 4P4LA 4FGWA 1I2CA 3I3OA 2Q2QA 1GFSA 4ALNA 3E9QA 4CM8B 4MKZA 2EWMA 3Q1LA 3VC7A 4FJ2A 3QWAA 2WD7B 1IHYA 2GN9A 3TOZA 3DOOA 1ZCJA 1IPEA 5L9AA 4WCFC 5TQVA 4CMJA 4CQLA 1H9BA 4BNGA 1MFZA 3OQBA 2DT5A 4J4BA 4JBHA 4UREA 1PJCA 2ET6A 4DRYA 1GU7A 4YDRA 2O4UX 5A03A 2HMWA 3KOUA 1T2EA 4ND3A 2UUPA 3SXPA 2X5JO 4CQMA 4NBUA 3TRIA 3HB5X 2EV9A 3KETA 1HSOA 2GZ1A 3K96A 4L8VA 1PJBA 2EP5A 2PZLA 3FNHA 1M75A 1FF9A 4NK4A 2H6EA 4ND2A 3IJRA 4QO7A 2CSUA 1I3KA 1DIBA 1J4AA 1ZSNA 1H6CA 2UUOA 3I52A 3VTFA 5ENDA 2VNAA 1I30A 3HN2A 5K0ZA 1TI7A 4LISA 2JJYA 2I66A 2B35A 2ZTMA 5LDHA 3LLVA 4IXTA 5EIOA 4XRGA 3QVOA 3P2OA 1DC4A 3LLSA 3JSAA 4JQCA 3IMFA 3ZWNA 1Y9AA 2W8ZA 3PVZA 4NH4A 1ZUD1 3BHIA 3FHLA 3QVSA 4BO1A 5CFZA 1FDTA 4G5HA 3U09A 5T8KA 4CLOB 4ZHSA 3HFGA 2CDBA 3RC9A 2OBYA 3VZRA 2EIHA 3SC6A 4A0SA 1KY5A 3PDJA 4AICA 3OJEA 1U7HA 1A5ZA 1RM5A 1XR3A 2YDYA 1R4NB 3E1KA 5U4QA 1QV6A 3VPFA 3E5MA 1P1KA 1K6IA 3AUSA 1SCUA 4GMFA 1AN9A 2GZ3A 4KQWA 4ROSA 1JN0A 4UULA 5BNTA 5IFLA 2YUTA 3NDJA 4OIMA 3U4CA 2F1KA 3ZNPA 5IXSA 3MTJA 3N74A 5EESA 3OFSA 3ZN2A 1KEWA 3GGOA 4FW8A 1T2AA 1IY8A 1XCBA 5ER9A 3KVOA 1YVEI 1ZXLA 2FSVA 4BO5A 1F12A 3AY7A 4IUYA 3UW3A 4WJZA 1BVUA 2AEMA 3K2BA 4HBGA 2XPCA 1ADGA 1BDMA 1MLDA 4BO2A 4JN6B 3NT5A 1JAXA 1WDKA 3PHJA 1LDBA 4OSPA 3ZWOA 1EBUA 2DC1A 2TMGA 3ITKA 2EG9A 3GG2A 2DAPA 3TOXA 1LC0A 3WGGA 2O4CA 1HT0A 4J90A 2X23A 3I4CA 1W4ZA 2D5CA 4YPOA 3PDUA 4AJIA 1OZAA 2VTDA 4M55A 1XA0A 4PLGA 3ZV3A 4PCVA 2Q99A 1T4BA 2JCVA 5A02A 2X5KO 4CMAA 3S2GA 1XSEA 3V2HA 3GFGA 3WQQA 2YYYA 3BAZA 4LW8A 2Z5LA 4PLVA 4R9SA 3FNFA 4BMVA 4BIIA 5C7OO 3VTZA 1G0NA 1AHHA 1LLQA 4DIOA 4GGOA 2XXBA 3LK7A 2QX7A 1CQJA 5T67A 2GR9A 4CLXA 4CQLB 2IEBA 4LGVA 3UAGA 3QA9A 4U5QA 3MJEA 2IDZA 5JBIA 4I5DA 3INGA 4YT8A 1SAYA 5C3MA 4CMBA 2CFCA 2X9VA 1X7HA 2X6TA 3GEMA 1G6KA 5THQA 4ALLA 3O9ZA 4G2NA 4QSMA 4XX0A 5L7YA 1PQUA 4BO3A 4FC6A 4CQMB 2GSDA 1HEUA 1LSUA 2HSDA 1ZSYA 2QIOA 3K5PA 4W82A 3RROA 5JCXA 2WYUA 4XR4A 5C5IA 5CDYA 1BMDA 2I67A 5BNFA 3ZU3A 1JKFA 5BSFA 4EW6A 1Q2XA 1Y81A 1NASA 3WG9A 1V3UA 2X0IA 2VYVA 1SMKA 3GFBA 4KWHA 5F1OA 5BSEA 3QHAA 4AJJA 5JDIA 4BNZA 1PR9A 4RPJA 4OMUA 4IDFA 2DPGA 1U4SA 3U4IA 5DT9A 5AXDA 2BGKA 3ADPA 3R3SA 1U3VA 4J1NA 3EMKA 3QVTA 4NBWA 1EMDA 3ZWVA 3EK2A 2J8ZA 3PYMA 2P91A 1FXSA 2EW8A 3WJ7A 3WWYA 4WPGA 4IBOA 4J3FA 3WTBA 1UXKA 1I0ZA 3D0OA 4EITA 3UUWA 1YO6A 1CERA 1HE2A 2VHWA 1GY8A 1HYEA 2CNBA 1ENZA 1RYEA 1X13A 4WLVA 4F6CA 3OECA 2DBQA 3VZSA 1E7MA 1D1TA 1DB3A 1XGKA 4IQ8A 4M8SA 4E5PA 4J6FA 3F3SA 1LBEA 1B16A 1WPQA 3VVCA 1O8CA 1YL6A 5CDSA 2VWPA 1U8FO 1Z6ZA 5EJ2A 2YV3A 1IZ9A 4DQXA 1I10A 1N9GA 2JAHA 4UAGA 3B6ZA 4XYLA 2HLPA 4Z0TA 5HBRA 1VJ0A 1PJSA 1WXDA 4E4YA 4NU5A 4HV4A 1BXGA 3JQFA 2PV7A 2BH9A 1L1FA 5I8WA 1GZ6A 1P1FA 4IINA 4MOWA 2CD9A 1X0XA 1ZW1A 3CMCO 3P7MA 1SB9A 4PRKA 1ULUA 5DBIA 3JQDA 3F46A 3RJ9A 2H1SA 1PZEA 1GPDG 2Y1OA 5BSHA 2CVQA 4D0SA 2GZ2A 3QW2A 4J9UE 4K9DA 2ZK7A 3ETEA 4ILKA 4FDAA 4IQ0A 1VL6A 3ZV4A 1QXSA 4U6QA 3NTOA 3NYWA 5A9RA 3AUAA 5ICSA 3C1AA 2Y1FA 5KWEA 2BFPA 3GPIA 1P1IA 5THKA 3ZWMA 1GV1A 5F5NA 4XEHA 3S8MA 1CDOA 2JKVA 1KERA 2AE1A 5A3VA 4XYMA 4Y6RA 4CLEA 4NBRA 2D1YA 4BO9A 2EJWA 5B4VA 6LDHA 4RQUA 3EAGA 4UEJA 2WTBA 1ZEJA 3H2ZA 5G4LA 4YQYA 4MKRA 1VSUA 3L0DA 5TGDA 3JD1A 4D43A 4EJ0A 2H9IA 5JY1A 2W98A 2BFMA 1UXJA 3HB4X 5FFFA 5AXCA 2CF5A 3OJOA 3C24A 2WYWA 2HKIA 3OEWA 3CSDA 1KYQA 4BV8A 4RV9A 2CVZA 5A3JA 4FBGA 5EERA 5IN5A 3VHRA 1D3AA 4IDDA 5A4DA 3KLMX 1DC6A 2GO1A 3S55A 4XWYA 3JCZA 2ILTA 3ROMA 1B2LA 1N1GA 1PEDA 2RHRA 1W8DA 3LZ6A 5IN4A 5DCWA 5L51A 4TVBA 1B8VA 3GGGA 5DZSA 1NFQA 3AU9A 4J1TA 1P1HA 1ZH8A 1WZEA 1AXGA 2P9CA 3CZRA 4CMHA 5L40A 4TRNA 1HDZA 5IG2A 3O03A 3M1AA 3QP9A 4LN1A 2EP7A 3OIGA 3HJAA 2PTGA 3IKTA 1C14A 2O3SA 3PTZA 3NV9A 5T6BA 1U3UA 2PZMA 1UUFA 2E4AA 2O3UA 4JIGA 1RJWA 1TB4A 3OP4A 3FF4A 1B14A 1S6YA 5DP1A 3ON5A 1SPXA 3DAFA 3ZWCA 4CLHA 4RCVA 4CM9A 1FDWA 5JNLA 4Q9NA 3Q6IA 3RU9A 1K3TA 4W7IA 3UH1A 2JCYA 4RVFA 3AOGA 2YHIA 2B36A 5DBFA 3GZ4A 4ZRMA 1AGNA 3TL2A 2GERA 1MX3A 1E7WA 1RM0A 3OEYA 4Q3DA 4U0JA 4DIBA 1MUUA 1KETA 3RUEA 2Q46A 1R37A 4W6ZA 1MB4A 2WE7A 2PY6A 1ZNQO 3IQDB 1DJNA 1EE2A 4WLOA 3RBVA 5CEJA 3QIVA 2HK9A 4HFJA 1AXEA 1MFPA 4XGIA 1J49A 3FBTA 1FK8A 2VHYA 1I24A 4ZU3A 2WJPA 1V6AA 3DZIA 4J7CA 3FN4A 5EQDA 1SO8A 1BXGB 3RUHA 2Y05A 3Q11A 4MIYA 2FMUA 3SJUA 1R66A 3AY3A 4YCAA 1GR0A 3L9XA 4CL8A 1NP3A 1DAPA 4RZHA 3FNEA 2C7GA 4IMPA 2DVMA 1K89A 1HLDA 3M2PA 3HWRA 4FJ1A 2Y1EA 4J4TA 2EW2A 3PWSA 2X7HA 5TSDA 4AJEA 1HDRA 3KHUA 3K92A 4URFA 4NJMA 1UZMA 4N5LA 1YBVA 4K6FA 4R1UA 2D8AA 3WX0A 2IYPA 3JQGA 3Q2IA 1E3WA 4NU6A 1WDMA 1QORA 3Q9UA 4DVJA 4OQZA 4R51A 1O6ZA 3H9QA 3ICPA 2H5LA 1ARZA 4YT4A 2Q4BA 1E3LA 1DHTA 3C7AA 1NFFA 4H16A 4GWGA 1XYGA 4MVJE 4QX6A 3AK4A 1HETA 3S2EA 2NQ8A 3NT2A 4EYEA 5KVVA 3NAQA 1C3VA 4DTIA 1BXZA 2PKRA 4MDHA 1PGQA 4Z9YA 1GADO 3VH2A 2C59A 5ES3A 4PG6A 1PGPA 3K31A 1VKNA 3QJ5A 4OKIA 4WEOA 1U3WA 5TJHA 4J2OA 4IXWA 4RPLA 4XR9A 4FD3A 4CV1A 4OL9A 3BMNA 1GTMA 4M49A 3AJRA 3DZJA 3KYCA 2DFDA 4KUGA 3I9LA 2VYNA 2OP1A 1E7SA 3Q3CA 4YTEA 3A06A 2QW8A 1JU9A 3GMSA 5JMPA 3CIFA 1K6JA 4MPDA 4E5NA 4XQ9A 5HRUA 3G17A 1A7AA 1Q1NA 1NAHA 1BRMA 1H6BA 1O5IA 3EZLA 3BTUA 3HN7A 3BMCB 2OFPA 2DM6A 5BR7A 3I9MA 4TVOA 1HSZA 1GYRA 2JAPA 3OMLA 4CM8A 4IDEA 1GEGA 4JK3A 1ENPA 1ISJA 3E48A 2XOXA 3BHJA 1GYQA 2J5QA 1HDYA 2X9GA 2GN4A 2PD4A 3IIEA 1JKJA 5KCZA 3LYLA 3FSRA 3QWHA 4IZIA 1VM6A 1YQXA 1E1LA 2WYVA 4WLEA 4IDGA 5MDHA 3D5TA 1DC5A 1MG5A 5H83A 4JJGA 4GSLA 2G0TA 1EK6A 3WIEA 3RVDA 2YHIB 3AOEC 4BNLA 3RD5A 4PGFA 3EW7A 5TC4A 3MCVA 1EQUA 4YA6A 3WGTA 1H9AA 1I2ZA 1IHXA 5CPFA 3PPIA 4IJWA 4J49A 4E5KA 3OJLA 5DBGA 4OGWA 5IDYA 3ZU5A 4J1QA 4A2CA 2G82A 5KJEA 5B1YA 1ZKMA 3F6YA 1NPDA 1KS9A 1V8BA 3T7EA 5IDXA 4DC1A 1MA0A 2BRUA 1KC1A 4YAEA 1UDBA 4BS9A 3JD2A 1ZVMA 2YW9A 2XF8A 3ANNA 3IAHA 3MJCA 4Q3BA 1EUCA 3RFVA 4AJ2A 4MIOA 4BO7A 3H6KA 2WEKA 3X2EA 3ZHXA 5I9NA 3GR6A 2CUKA 3PFFA 2FR0A 3CTMA 4II2A 3EVNA 1VPDA 1TLTA 1E1KA 2PFGA 4BNJA 3ZWWA 4CLOA 4KZPA 2ZYDA 3JYOA 2VNSA 2D3TA 1PS8A 3TL3A 2Y1CA 3W8FA 4QO8A 2EKQA 4R4JA 1U7TA 3GNSA 1DBVO 4LK3A 1WNTA 3F1KA 3PHHA 5C37A 4M89A 5AOVA 3GPDG 2O3TA 2VWQA 4MVJG 3ZW8A 1HKUA 3DBHA 5JXWA 3PYXA 3A9WA 3GUYA 3UHAA 4NJMB 4JX8A 1QKIA 3I9NA 3T4EA 1YWGO 7MDHA 3JQGB 1PIWA 3VOSA 1EDOA 3QE3A 3QVXA 4RPKA 4RDHA 2SCUA 3PJDA 1E6EA 2WDZA 4YJDA 4OHUA 4UUNA 1OC4A 3W8EA 1U28A 4ALMA 1CIVA 1L7DA 2C2XA 3BIOA 3ROQA 3KEQA 3KSZO 4K28A 4CLRA 1XDWA 5AQ1A 2FZEA 3FR7A 5DNAA 4LVUA 3V5NA 2DUUA 5I7FA 1BVRA 2HK8A 2Y1GA 4NMHA 4O0LA 1U5CA 3KEOA 2NU6A 3NEPX 3PRJA 4BGIA 4PG5A 2YV2A 3I5MA 4W9NA 2QZZA 3WWZA 3H3JA 1CRWG 3G49A 3NUGA 1K2WA 3PIDA 3U0BA 3BMNB 3QVWA 4OO3A 4ALKA 1LQUA 3DZKA 1HDOA 3KYCB 4MJLA 4EI2A 1RPNA 1KEUA 5TRTA 1BHSA 2PLAA 1WDLA 1MC4A 3ZNOA 4D3FA 4GPD1 4ZVVA 3TF5A 3OIDA 5JY6A 4GKVA 3FR8A 2Q3EA 4TZKA 3DFZA 1YDWA 1C0KA 2DPHA 4ND1A 2EEZA 1LQTA 3U62A 1ORRA 3ZWXA 2D2IA 1O94A 4CMEC 4PVCA 4RF4A 3O26A 4HADA 1H6AA 1A7KA 1BG6A 3AOEA 3F4BA 5T5QA 1LU9A 3WFIA 4MP6A 1A4UA 3ZWAA 4BGEA 1J5PA 4DLLA 5JFOA 4CPDA 4N7RA 1SB8A 1UZNA 1VI2A 1B3RA 4TMFA 3D1LA 2GNAA 2FRDA 1JLLA 1MG0A 4Y67A 3BYZA 1A71A 5CEEA 4L0QA 3SC4A 5JMWA 4PG8A 4DUPA 4I5GA 2X1HA 4LSMA 1BWSA 2VWHA 2QG4A 3WSWA 1BTOA 1WMBA 2A94A 3DAGA 4JP2A 2CZCA 4B4UA 4FN4A 4Y6PA 3CUKA 4ND5A 1W6UA 2EERA 2VRCD 3AI2A 3T4XA 3WMXA 3ZU4A 4CR7A 3I9OA 1SEPA 1RM4A 2IXBA 3GRPA 3ENKA 2YZ7A 2I9PA 1QSGA 3IUSA 3ZNQA 3TN7A 3OJFA 4JP3A 3CH6A 4RDIA 4JGBA 3CEAA 5GZ3A 2OHXA 4O59O 4YEDA 4Z3DA 2IEDA 1C1XB 5AVOA 1ISIA 5KVQA 3K2EA 3KSDO 1EEHA 4Q3EA 4LMPA 2B4RO 3OA2A 4PFJA 3WYEA 2X9NA 1RYDA 1UJMA 2AQIA 4JBGA 1F8GA 3R6DA 4BNTA 3EC7A 1YKFA 4IQGA 4A7PA 4WCDA 2NNLD 5FYDA 3PLRA 3JQEA 5JO0A 2RBEA 3ASUA 1YOVA 2HDHA 7ADHA 2I3AA 4P8RA 3DHYA 3W8DA 5KVSA 2Q1TA 2ZJ1A 4C7KA 1KVUA 4JNKA 3E5RA 1X1TA 8ADHA 4RL6A 3KYDA 2ZCUA 4RPGA 1Y1PA 4F45A 2CVOA 3Q0EA 3FI9A 4GVXA 1XG5A 4L9RA 1DIRA 2UYYA 4BUCA 4AJHA 4YR9A 2OO5A 4HNHA 4BNKA 3AFMA 5CDUA 1O95A 4R9RA 3A1NA 2AQ8A 3HUDA 4OXKA 4MVJH 3DBHB 2NM0A 4D3DA 3DMTA 2DKNA 2VN8A 3QWFA 4ALJA 2VZ9A 4FFLA 1G0OA 1P0FA 4C4OA 1Y5RA 1P44A 2Q45A 1M67A 3FCOA 2HMTA 2NWQA 1PZHA 3K8ZA 1B3BA 1XHLA 3VPGA 4ZQEA 2H63A 3NTRA 5G0UA 4GAEA 4GWKA 1V9LA 2C07A 2OZPA 3GMDA 4CLRB 1U2GA 1UAGA 3JD0A 2E6UX 4YRBA 2OMEA 5LC1A 1DHRA 2RH8A 1Y7TA 3GRKA 1GQQA 2C7VA 5G0WA 4H15A 3WGIA 4WNIA 3DFUA 1PSDA 1UXHA 2UAGA 4H3VA 4QQRA 4PLTA 3IOYA 4PIVA 3U5TA 1XELA 1LC3A 3VPHA 1GQ2A 4LCJA 2RAFA 1JVSA 3OICA 3UN1A 2V6GA 1T2CA 2E48A 1NM5A 4W7HA 2V65A 3F5SA 2XAAA 4E33A 4W99A 4WCFA 1DO8A 3L4BC 2FZWA 4TQGA 2C29D 4QUKA 4MVJA 4YJHA 1ONNA 5FWNA 3GEDA 4UVIA 5ER6A 4XGNA 1DIGA 4PLHA 3FNGA 4Z9FA 1U8XX 3D64A 3DTTA 1PL7A 4AJLA 2P4HX 2X8LA 3WSVA 2ZB4A 4NIMA 3WLEA 1YBMA 2QRKA 4TSKA 3C1OA 4I9NA 4AJNA 3R1IA 2IE0A 2PR2A 4PG4A 2O48X 4RF5A 5B4UA 1EUZA 2JFHA 3F9IA 3ROPA 2JHFA 3PHGA 4IIVA 1U9JA 3AI1A 4R68A 1E6WA 4RLSA 3R0IA 3ONFA 1LRLA 5H82A 5JLAA 4PG7A 4GL4A 4IDBA 5FF9A 3AWDA 5TF4A 3V1UA 1PQWA 2W90A 3W4JA 4OYRA 5A9SB 2NTVA 4GGPA 5JE8A 1M76A 2DTXA 1TA4A 3H5AA 2Q50A 2CMDA 1EFKA 1NPTO 4BNXA 1PWXA 1O89A 3RAJA 4YRAA 4NBTA 4INAA 1UXGA 5T64A 1NBOA 5JAIA 1AUPA 2UV8A 3BTOA 4CJXA 5L4SA 1LSOA 2I76A 3OIFA 4D0RA 2GPTA 4Z3KA 5DDIP 3DAPA 2POQX 5HTOA 1AE1A 3NJ4A 4M87A 2G5CA 1QLJA 2B0JA 2Q2WA 1YOVB 3K6JA 3WQSB 1A9ZA 1T1SA 4JJIA 3KTDA 3ETGA 4S1VA 4CUKA 1JKIA 1YE3A 4JROA 1VE9A 4NR0A 1F0YA 2HJRA 4HFRA 5A04A 3KYDB 1CQIA 1E7QA 1ZBQA 3LF2A 4XZ3A 5JCJD 4CODB 3W1VA 1FDUA 1IE3A 1V3TA 2A9FA 2VUSA 3CPSA 3JQAD 4D41A 1UH5A 1WW8A 4CM5A 1KIFA 3IDSA 5JDCC 1T2FA 3JQ6A 4NZ9A 2ZIZA 3DL2A 4IJUA 3BMQA 4XB2A 1CWUA 1GCOA 5DULA 3RC1A 4BNMA 3AUTA 1IB6A 2GD1O 5TT1A 3H5RA 3I23A 1EFLA 3C1TA 2AA3A 2UDPA 3A28A 1R0KA 3QRWA 4PLZA 3DO5A 4ZQBA 3RBXA 1IPFA 4I8XA 4WLFA 1WMAA 1M6HA 1E5QA 1ENYA 1BXKA 1ZO8A 3GF4A 3LQFA 4NK5A 4X54A 3AFNA 3L4BA 4FOOA 5FEUA 4KOAA 1OMOA 1YJQA 2IYOA 4FOSA 4XKJA 2C54A 5IJZA 5KKAA 3E9NA 4II3A 4IMRA 4B7CA 2D5AA 2DBZA 4J0EA 1KVRA 4E31A 3H9UA 3MWDB 4CM1A 4IJKA 1S7CA 1KEVA 3F4LA 1LI4A 2NADA 4BNYA 3TZCA 2WM3A 1AHIA 5JPIA 1EK5A 5L45A 4XRRA 1Y8RA 4WCFB 4ZJUA 3Q2KA 3PHIA 1UAYA 5TX7A 4U8GA 1J6UA 1VSVA 1U5AA 4YJHB 4I9HA 4MP8A 3HADA 2VHZA 3IKVA 1Z75A 4UVHA 3VPXA 1DOHA 5JSFA 3NDRA 2EGGA 1LTHR 1K0UA 2XXJA 4KQXA 3WYCA 4HP8A 3ZV6A 3DONA 1MXHA 2V6FA 4QECA 3SEFA 3PI7A 4ONEA 3KLPX 4J4HA 4CQMD 4Q39A 5KJCA 3A4VA 3FWZA 4ZA2A 1H2BA 3NGLA 1BSVA 1VJTA 1H6DA 3V1YA 4Q3AA 1ZK4A 3DMYA 3BTSA 2WD8A 4DA9A 5F1KA 3ZNNA 5L3ZA 2PNFA 2VRBA 3OF2A 1H93A 3K73O 4BMNA 5KIAA 3GY0A 3ANMA 3H8VA 1LLUA 4QXMA 4EJMA 3AY6A 1T2DA 3GG9A 3ZWYA 3P19A 3DHEA 4GSKA 4HX5A 5K6AC 3EUWA 2A4KA 4D3SA 4OXYA 4BO4A 4J2HA 4CV0A 3BMCA 1XIVA 5KOIA 1DLIA 1L7EA 1C0IA 5AYVA 3SJ7A 4KMSA 4NQZA 3GVCA 1HDCA 2IZZA 5G4KB 3F5QA 1H94A 1ZK1A 4YAJA 4EBFA 2HRZA 4EUFA 4MINA 3K30A 4RLHA 3T7CA 3PQEA 2C20A 1HDXA 4DMMA 4BGVA 4CMIA 4CR8A 5JDCA 1N8KA 1N7HA 2PH3A 4RZIA 3WBFA 1MXFA 4BNIA 1XKQA 1LX6A 1KVQA 3B70A 3UKOA 1P45A 3WICA 1GZ3A 3KB6A 1I3MA 4XQEA 4BQPA 1XQ1A 3MOIA 4TWRA 3OQ6A 5F5LA 1I3NA 2Y0DA 4FCCA 1T24A 2W2LA 2P5YA 1PJTA 3C7DB 3PZRA 1YBAA 4R3NA 2NSDA 2ZYAA 4R1SA 1QYXA 5JO9A 2FPIA 5KTKA 3VZQA 4AJKA 4BNUA 3LC1O 4XDYA 4DL9A 1NHWA 1DIAA 4LRTB 2A92A 2IODA 3BMQB 1LJ8A 1I32A 4I1IA 1ZK3A 3M2TA 3AI3A 3DBRB 4NJOA 2B5WA 4CM4A 2J3JA 2NU9A 5BNIA 4E2WA 5BSGA 3QWIA 1M2WA 1H5QA 1UP4A 1YGYA 1D4FA 1ULSA 4QEDA 4BKRA 1PL8A 2OP0A 3VH4A 1A72A 4N18A 2PGLA 3WFJA 3ITDA 5B4TA 1TVEA 1CEQA 4XB1A 5IZ4A 2Y1DA 2I3GA 4YB8A 4EEZA 1FMCA 1YH3A 3FWNA 4HFNA 3WNQA 4DPMA 1NWHA 3ZZNA 3OBBA 2BF7A 3CXRA 3OETA 4B8ZA 2Z1MA 3DHNA 3W6ZA 1QP8A 3NGXA 3U4HA 4ZGWA 3RQSA 1DFHA 2BELA 5BQFA 3GC6A 4WUVA 5B12A 4O5OA 2GDZA 1W73A 2HAEA 4TRMA 3JV7A 3O8QA 5I9MA 3LDHA 3N58A 2NTNA 5CG2A 4BNVA 3WGZA 2OOSA 4WOKA 5JC8A 5TIIA 1UP6A 1Y8RB 3KYBA 1ID1A 1QLHA 4DBZA 3GZNA 5CP8A 3C7CB 4YBZA 4EZBA 3KSUA 4NDNE 4S3MA 3CZMA 2V6MA 2ZTVA 2BMAA 3CINA 3I1JA 5KJFA 1RM3A 2PKQO 2GUGA 2ZB8A 5ILOA 3PJGA 2O3RA 4NBVA 4MVJP 1CF2O 4UVDA 1SOVA 2VT2A 4B7UA 2D0IA 1DRUA 3WS7A 5HA5A 2JFGA 3ULKA 3L6DA 3DOJA 1P9LA 1NVMB 2Y67A 4YJFB 2F00A 2Q49A 4Z0PA 4E2YA 1ISFA 1NWCA 3F1LA 3MJ4A 1SZJG 4DQUA 1N1EA 1WP4A 2VYVD 3RJ5A 4CR6A 4Q3NA 1LDGA 4GBJA 4I08A 3C85A 2NU7A 4FFOA 5C7IO 4E32A 2VOJA 3NRCA 4BKUA 2J6IA 1PJ2A 3WJAA 3JYPA 3TSCA 4E21A 5DOVA 3WGQA 4DMLA 5F1PA 4YAIA 2VHVA 1V0JA 3DBVO 3TZKA 3WGHA 2GLXA 4Q3CA 4H7PA 2D59A 4K26A 2C2YA 1Q7CA 4O1MA 2R00C 1ML3A 3HFSA 4YAGA 2X0NA 4IGFA 2JD0A 3UXYA 1NPYA 2TMDA 2O7SA 1LRKA 3ROKA 2Z1NA 4OJNA 1UZLA 4P4NA 1XU9A 5ITVA 4CMIB 2X5OA 1N92A 3B1FA 1QYCA 2PZJA 4OQYA 4DBVO 3VDQA 2ZTLA 3RCBA 1OOEA 3DC2A 5HWSA 2ZQZA 3VAZA 4K6CA 3G1TA 3QWBA 1QV7A 1JA9A 3EZYA 2CF6A 2GASA 1IULA 1IYZA 1C1XA 2AHRA 1Z73A 3W4KA 4DPLA 4PLPA 3K9QO 1MC5A 3GVHA 3QSGA 3CMMA 5A1TA 4OAQA 4FPXA 1NFRA 1LEHA 4P4GA 4TKLA 3WNVA 1RWBA 1YB5A 4I5EA 3U9LA 1BDBA 2IZ0A 3QY9A 1PGOA 4CM4B 2P2SA 5JYDA 4GQAA 4BHTA 1KVTA 4ZQGA 3UCXA 4RVSA 3KRTA 5DOZA 4UEKA 3U4DA 4E30A 3DDNA 3GOHA 3ZU2A 2GCGA 2VUUA 3GUCA 4IDAA 3UCEA 1P1JA 5G0TA 3SBOA 1VC2A 4DLBA 1I3LA 3DOCA 4DQVA 1Q0LA 5IAAA 3W6UA 2X0JA 1EDZA 3PQFA 3HHPA 1NQ5A 2Y0CA 1T26A 1QYDA 1P31A 4FFNA 2E49A 4ZN6A 3O8QB 1X14A 3X2FA 3HDYA 4FSHA 4AG3A 2P9EA 1VJ1A 3L07A 1Z82A 3S1LA 3D4PA 3WIDA 3DXFA 3GZNB 2RIRA 1UR5A 4NNJA 3FRJA 4BNHA 4CV2A 2BI7A 3LT0A 3BHMA 3RUFA 3VPSA 1XLTA 4IGEA 3I83A 2OUIA 2ZATA 3W4IA 1YS4A 1TT5A 3C3XA 3GGPA 3LT4A 5GY7A 4FFRA 4B8WA 3DZBA 3ETDA 3GEGA 2I6TA 3TJRA 4DXHA 2AXQA 4E5MA 3OQ1A 1ADCA 3ZWBA 4B3HA 4QTZA 4R01A 3COSA 3UGKA 5TLSA 4QT0A 3PK0A 5T8KC 3JTMA 4DC0A 3N7UA 4FR5A 1NYTA 2B37A 3GNTA 1C1DA 2QRLA 2W2KA 3A14A 1Z7EA 1OBFO 5CPBA 2AMFA 4GLOA 4KWIA 3RKUA 2Q1SA 3WB9A 1B26A 3VVBA 2JD1A 1R16A 1HE3A 1M6WA 4FC7A 5HS4A 3AM3A 4JCOA 3EGOA 3QV1A 3PLNA 3E03A 1V3VA 1ZJYA 3PFWO 4CM9D 3UVEA 4Z6KA 3JYQA 1Z45A 3AW9A 3BMOA 2AQHA 4L76A 4LSWA 2O2YA 4B79A 2YQ4A 1ENOA 4L4RA 5COAA 1KEPA 3IUPA 2VCYA 3SX2A 2FPPA 5I8ZA 4TRJA 2J3HA 4M86A 4EDFA 4RVHA 3GH3A 3BA1A 4WOJA 1K6XA 2BFOA 3IP3A 4AL4A 4PZDA 1HL3A 4RVUA 1NVTA 3PGJA 4RF2A 2PKQP 1Y5MA 5G0SA 4JBIA 1LNQA 4FFMA 3LVFO 3SLGA 4RF3A 4E3ZA 2B4QA 1P33A 4RGBA 4RVGA 5A9SA 3GAZA 2V6BA 2VWGA 4E2XA 1PJLA 1UP7A 3D7LA 5FI3A 2YHUA 5EINA 3PJFA 5L95A 4E0BA 2NU8A 4L4SA 4UUPA 2QZ9A 3VKUA 3WMWA 2NV6A 2HRBA 1R4MB 4JJFA 4EJ6A 1HZJA 5IDWA 1ISHA 3LSYA 1GDHA 2FOIA 4XYBA 3OSUA 4D7AA 4ESOA 5HM8A 5COQA 1SEVA 2A35A 4R5HA 1DLJA 1E3JA 3QLJA 3LC7O 4UUOA 5CAEA 2R6JA 1NAIA 5F3RA 2P9GA 4L74A 3JQ8A 5TJ9A 1F06A 1HYHA 4P22A 2X4GA 4WKGA 1T4DA 2Y66A 2HQ1A 4XYGA 1I8TA 2IZ1A 5IZCC 4XJTA 2CY0A 1TT7A 2QYTA 2YJZA 2CDAA 3RI3A 2VZ0A 2DBVO 3TZ6A 3PWKA 1UDCA 3SVTA 1NHGA 2O23A 4J0FA 5EMHA 3E18A 4D45A 2HO5A 5LDGA 1JW9B 1N7GA 1V35A 2VQ3A 2ZYGA 4XJSA 3UICA 4CV3A 1DAOA 1I5RA 3RC2A 3RWBA 1U4OA 4B4WA 4XYEA 3RASA 1PQPA 2I65A 1YQDA 6ADHA 1WLYA 4UVEA 1EZ4A 5K9ZA 1IZ0A 1YB1A 4D79A 4BB6A 2BLLA 2EKPA 2V7PA 4NHEA 3E82A 2ZJ0A 4LVCA 4K1LA 2VZ8A 4CL3A 2HUNA 4Z0HO 1HE4A 1DDOA 2HMSA 2OL4A 4IY1A 1BW9B 1DRVA 3TQHA 5KVCA 5JDIC 1HZZA 2P5UA 3GA0A 1JDJA 1Y8QB 1O0SA 3RIHA 1ZFNA 3NTQA 3NKLA 4CM3A 1H2HA 4BO6A 1R15A 1TT5B 3TPCA 2VYND 1LRJA 4LMRA 1ISGA 1MV8A 2G17A 3DZHA 4BKOA 2ZTUA 4XCVA 4DREA 5DCUA 4F6LA 1GZ4A 3WLFA 3OJ0A 5EN4A 4CMEA 2NVUB 4A03A 1GQYA 3JQ7A 4R5MA 5GMOA 4Y98A 3EVTA 3STHA 2J3KA 2PZKA 1PL6A 1Q0QA 4FS3A 3JQAB 1C1DB 1I36A 3GT0A 3IS3A 2W2KB 2IXAA 4YAKA 3VH3A 4DLAA 4NFYA 1NR7A 5KJ6A 1QYVA 4PRLA 3PZBA 5FI5A 4MVJM 3IC5A 4E13A 4XIYA 4XDZA 3GVIA 3MWEB 3EYWA 3HQ4O 2EF1A 4IM7A 5G2OA 4WE3A 4UVGA 3Q9NA 3BMOB 4D46A 3PGXA 5CDGA 1ONOA 2G1UA 4YVFA 4ZICA 1Q0HA 5L4LA 2X58A 2B69A 5DN9A 1TXGA 3JQCA 1GEEA 3H2SA 4KUEA 1GCUA 4B4VA 1R0SA 1I01A 4YJGA 2PH5A 3GHYA 4M54A 4WLNA 3JQFC 1ZIDA 3QQPA 3KZVA 2E82A 1ISMA 3AUUA 3R3JA 1PU2A 3HG7A 4R1TA 3RU7A 2EHDA 3D3WA 4TKMA 3B1KA 4UEOA 4U7WA 3WBBA 1CJCA 4FIZA 1K5HA 3H9JA 3ZV5A 3B20A 4A10A 1EVYA 3V2UA 2VTEA 2HJSA 2OORA 3LT1A 3HDQA 5HS6A 2Z95A 4KDFA 4G65A 2HMVA 3GLQA 2FHSA 2P4QA 3HNPA 5IZCA 1R0LA 4GVLA 2FR8A 4F46A 5JC1A 2VT3A 1PTJA 4BGUA 3F47A 5G4KA 3JQBC 1N2SA 4UUMA 2Q2VA 3FPCA 2EJVA 3BXXA 3GAFA 3JQ8B 5JS6A 1LDNA 2PA3A 3WOHA 4CUZA 2HU2A 3ZI0A 2E37A 4HUJA 4YACA 5I7SA 3RUDA 4ALIA 5A5EA 2AEFA 3MEQA 2G76A 2UVDA 4TROA 5JAMA 4LCEA 1GPJA 2B5VA 1EBFA 5JAQA 3DQPA 1HWYA 3RC7A 2ZB7A 1EVJA 3WYBA 2DU8A 2J3IA 3PXXA 4IS2A 1DIHA 4NFHA 1B7GO 2O7QA 2GGSA 4BKQA 4E12A 1GUFA 1GD1O 1YXMA 2PGJA 2O3QA 1KOLA 1SC6A 2EKLA 3INTA 1QYWA 3PP8A 3TFOA 4OOFA 4B7XA 1LXCA 3DBRA 4FGSA 4BNFA 4NPCA 1EQ2A 2Y68A 4WK6A 4ZQHA 1DJQA 3WR5A 5GZ1A 1PJ4A 3PHLA 3H3FA 1NX6A 3PQDA 3WQRA 1EE9A 4OM8A 1DFGA 5DP2A 3ZDFA 1Y9EA 5ILGA 2FY8A 3GK3A 5G0VA 2DLDA 1IL0A 2HCTA 4OH1A 3AU8A 1GYPA 3V8BA 2BKAA 1QMGA 4IS3A 3I9JA 4NG5A 4D42A 1M66A 5CHEA 3FTPA 2DTEA 1EUDA 1B0AA 4FJ0A 3ENNA 4CLDA 4B3JA 3DBLA 3MJVA 3KM0A 1IUKA 3JQ7B 1VL0A 2Y0EA 4PLCA 5KNLA 4GLLA 2VHXA 1PZFA 4GMGA 1GV0A 4MP3A 1Y6JA 3RUIA 3JYLA 1C0LA 4BL5A 4MKXA 5CDTA 3ANLA 5F21A 1A4IA 2Q1WA 2GF2A 2NACA 1U2DA 4GH5A 1WWKA 4R69A 3OHSX 1YONA 4HWKA 2AE2A 1PWZA 2AG8A 3I9KA 1E5LA 4DGSA 1H0KA 4IIUA 1ZMTA 4TZTA 3ONEA 2Q1UA 1PGNA 1UXIA 3VH1A 3UCFA 1XQ6A 3SLKA 5TS3A 3EY4A 3WTCA 4YJGB 2DTDA 3WDSA 4YJFA 3D4NA 2WE8A 3L9WA 3GHHA 1E0DA 3MOGA 4MVJF 5I9LA 3TNLA 3VZPA 5A05A 3D3WB 3JYNA 1D7OA 3E8XA 3JQBA 3D5QA 3DZGA 4I9UA 1WZIA 3TDKA 2ZQYA 3NX4A 4I5FA 5U9CA 1P77A 1C0PA 4YQZA 4IPTA 3GDGA 2DUWA 1T25A 3H5NA 2C82A 3L6OO 2NLOA 1LUAA 2WSBA 4DYVA 2W4QA 1DRWA 5C7LO 3IJPA 1YDEA 3INRA 3DR3A 2C5AA 1HXHA 1GL3A 1QRRA 1J0XO 1PZGA 3ASVA 2FSSA 4ITUA 5DCYA 3CKYA 1HDGO 3KV3O 4BVAA 4EUEA 1LLCA 4IDCA 3V1TC 3PIIA 2BGMA 1JQBA 4KTTE 3LU1A 4CM7A 4YT5A 4ZRNA 3MJSA 4ZQFA 4MIEA 2ZCVA 4HXYA 4OOEA 4WEQA 4XA8A 2YFHA 5ENVA 5H81A 4E2ZA 5GZ6A 2EXXA 3OM9A 4R1NA 4EUHA 4J7UA 4KDEA 4GX0A 4CMKA 5JYEA 4A26A 4BB5A 3D4OA 4PVDA 1WVGA 4DWVA 4ND4A 3V2GA 5T57A 1DC3A 4BO8A 1GUYA 3H7AA 4ZD6A 3GDFA 4RVDA 1DSSG 4XQCA 3DTYA 1HLPA 2RHCA 1T1RA 4WNCA 1YL5A 1GUZA 2QQ5A 3TZQA 9LDBA 1DFIA 4DPKA 4RORA 1ONPA 2D4AA 1HYGA 3JQ9C 2RCYA 5L4NA 3KO8A 1GAEO 5COBA 3RUCA 2BFAA 1TEHA 1DPGA 4HNGA 4HFMA 5TNXA 3ZHZA 8LDHA 2PD6A 3IP1A 1PGJA 3L6EA 4RQTA 3AM4A 1N5DA 1VL8A 1X15A
chains in the Genus database with same CATH superfamily
4MZDA 1RLTA 2RHWA 3F6EX 4YWHA 4A73A 3P2KA 4Z4QA 1BVYF 5ADHA 2QYSA 1RLJA 2VPYA 3DUFA 4BNWA 1NZJA 4EA9A 2ORYA 4YT2A 1OAAA 5CHYA 1QOQB 2R6CA 3Q4GA 1P1RA 2VHJA 1NONA 1DG3A 4ARZA 1GM5A 2X2OA 3H5WA 4DHWA 3A6ZA 1L8AA 1QQTA 1TC1A 5T3UA 2QVGA 3V4FA 2C3UA 4AJ1A 1CR2A 3CRNA 1JWLA 5AXBA 4TUYF 3ECSA 1EUDB 4FU0A 5CYPA 3C8MA 3DEYX 2BGIA 5EY5B 3PD7A 3IQGX 4BO0A 4EG1A 4Q4LA 5A0FA 3DEIA 3NTUA 3WGMA 8GPBA 1HE5A 1QIHA 1RWNA 1A76A 3G2PA 4WLUA 1P7YA 1E3EA 3REQA 2DLCX 1VGQA 1M2EA 3A6LA 1TLFA 2L17A 1NJ2A 4M4SA 5HF5A 3SZLA 1E2BA 1QG6A 4ISCA 3GBSA 4WKBA 2MSEB 3QKIA 4I46A 1PDVA 4YJKA 3W3AA 4HH0A 3EDMA 1KBZA 2DF8A 4W1SA 5GWXA 4B3IA 2IEYA 1JWAB 1GFIA 3UOGA 4RTJA 5IK2A 4CF3A 5NLLA 1KSJA 1BO6A 2B25A 4NCKA 2BRUC 2HF2A 3QLUA 1NVWQ 3PTLA 1VP9A 3V4OA 5AK6A 3WWEA 1TYEB 1XJQA 3B36A 4ZAYA 2O8BB 3D8SA 4GEGA 4DF3A 2ZI9A 1LW7A 3ZE2B 3PUHA 2JFFA 4L9SA 4D97A 4JV5B 3H9EO 3CBGA 3L41A 1IHDA 4GI7A 3UO8B 3PC2A 4NEHB 1AO0A 3HU1A 5U4XA 3L77A 4K9LA 2BISA 2R1TA 3TQIA 2EWVA 2XDAA 1ADBA 1X7WA 3BWMA 3X1DA 4AKEA 1JVBA 2UXBB 5E38A 1G63A 2I71A 4P4SA 1U3TA 2IOHA 1XWFA 3WB1A 2REQB 4V1CB 3A37A 4DV1B 4M1QA 1KJJA 2C3PA 2NQTA 4U0KA 4W8HA 3PEYA 2NTYC 3H8JA 2II6A 3ABIA 1KAMA 2ONKA 3UMBA 4DCSA 1U0GA 1Q7GA 2B4TO 2I2BA 1D8AA 1YQQA 3R7AA 1NQAO 1RKUA 2GRAA 3A6GA 1S01A 2Y93A 1GPLA 2AFIE 5LQMA 2GN8A 2QY6A 2O5RA 4TSFA 3ND6A 4B2LA 3K70D 3N6VA 3LT5A 4CCSA 4Q21A 1FYWA 5IXYA 5A5GA 1F14A 1UBTS 1II9A 1G6Q1 3RYFA 3K1AB 3LMKA 4PS0A 2JJ2D 1O6GA 1PJ3A 1R4ZA 4B9EA 4YCSA 3JY6A 5JFTA 1O03A 1XNRB 2OXIA 1P3DA 1U9YA 3JQ9A 2OTCA 1ZEMA 1WCIB 4NQRA 4ZCSA 5IYZF 3GN1A 2PJDA 4WY8A 3GNQA 1TMOA 4IWNA 1MR3F 5FWAA 3AI7A 4ZT5A 4I7EA 2X2EA 1V9SA 3SQNA 3I58A 4ERXA 2AMLA 4NCNA 1XZDA 1LK0A 3ZHQA 5K0FA 3TLEA 1OWNA 4W9NC 1NVGA 1CJSA 1JQ5A 2IYUA 3EVAA 4GMDA 1PHPA 2GO7A 2P40A 4FE4A 1ND5A 2YFQA 3S2SA 4UMDA 4EGFA 3ZDAA 4ZOLB 5F3WB 3C39A 3ACCA 4B9AA 1DQRA 1FOEB 1KYXA 5U1PA 5KWJA 1U1IA 2WD7A 4CMGA 4Y2GA 3HVIA 4DLSA 1Q5PA 4ZHQA 4JFRA 4DTCA 1CR0A 1Q0SA 1USIA 2C9BA 2WYIA 1BOFA 2OPHA 1F48A 3DE2X 2GH1A 1VYHA 2G25A 2PD3A 4HRXA 1M1YA 5HKKA 3AG5A 3FPLA 4LRYA 4MDEA 1SJ9A 3CVWA 3ABZA 3QZUA 2I7XA 4PYLA 5AK5A 3LI2A 5ICMA 1PO7A 4KQ6A 4S1PA 1FDVA 4EMUA 3HBFA 2FCRA 1YR2A 1KO4A 1PKXA 1YZHA 3W5SA 2X22A 1T91A 5DTRA 2B61A 4OSOA 1D9XA 2R96A 1XRNA 1NLYA 1V7CA 5KDLA 2FN7A 3F78A 3DUFB 3THXA 4ENSA 1AGYA 2A67A 3WK7A 4G0MA 4YPVA 2JLUA 1JAYA 3CWCA 3LWDA 3QPDA 5CA0A 1LB1B 3HCCA 1U7XA 5D00A 2ODTX 3PJRA 4O4HA 2ZPTX 4LGMA 4EARA 1ESNA 5EIWA 1G1AA 1XT6A 4FXOA 4FX5A 3K53A 3ORFA 4DNOA 5DH9A 4XX1A 2EQBA 4E11A 2DWUA 1YL7A 1UPBA 3RUPA 4HRVA 4PINA 3PE6A 3BTVA 1PUJA 4MUAA 1JSZA 5ERXA 5LDDC 3REQB 3RRFA 3MN1A 4MVJI 3WYDA 2XCRB 1WQ1R 1FS4A 1YJCA 4IZHA 3EXG1 5LQNA 1SULA 2B34A 4AN1A 4J1SA 5CG1A 3G79A 3L82B 1JHUA 4LVNA 1EVIA 1WULS 2ZI4A 3TLAA 2RGEA 3BXFA 2VZLA 1IK4A 5CLLA 2LDBA 1AY0A 1CY4A 3LQKA 2VZEA 4DZZA 2ZKLA 5F35A 1PNVA 1DT3A 3WGYA 2OV8A 2QS9A 1UJ6A 5KU7A 1M0WA 1QJCA 1E1YA 1V5IA 2MR5A 5TDHA 4D9IA 4EG7A 5AVRA 1XZJA 1KRXA 5LUAA 2A0WA 2FSIA 1SBYA 2GQ0A 2Q6OA 4LKRA 1HF3A 4AJPA 1R4NA 4P38A 3OKCA 3AJAA 3FH0A 5FR1A 4G8JA 5FA5A 1Q7BA 5IF3A 3E1SA 5F7ZA 4NFSA 3TVTA 1TKCA 3P9KA 2IOFK 4UMVA 4LTNA 2C7PA 1M7GA 3KT6A 3IMCA 2R1TB 1XTKA 2H85A 2NVUA 1ZICA 2YJ4A 3KBOA 2BD0A 4G81A 3SYRA 5JSUA 5J2TA 1PW5A 1D1QA 2Q0XA 2DR3A 4RJLA 2IUUA 2VPWA 2J59A 3R44A 3F90A 1BXRA 2TRSB 2V9ZA 3H4VA 4EW1A 3OCCA 2Z9CA 5JTTA 2WU3A 3VJKA 1WSWA 3D8RA 1ZH2A 2VP9A 2VG8A 1OI2A 1T0IA 2X15A 3M70A 1ZJZA 4KQHA 4EPVA 3ST7A 2OO5C 1T13A 1YUMA 5JXIA 2ISCA 2EJTA 3FTNA 4GEKA 5DK6A 3I4FA 1TQDA 3GXOA 4JXKA 2XF2A 3S1AB 4F6RA 2CDCA 2WHXA 4DV4B 3GLGE 3CSSA 1YC5A 4YO8A 5EC8A 3WK6A 4YX9A 3C8UA 3CO0S 1U99A 3A9UA 2O20A 1Z33A 3HXPA 5EPEA 4MO2A 2BGWA 1LNSA 3G0OA 2JEZA 4BMOB 1HNWB 1JWBB 3ANYB 4MMYB 3I2YX 1T15A 3RYFB 4BNNA 2AW5A 4N7MA 2IHTA 4X00A 3UNXA 3V8VA 1DG9A 3WGOA 1JF8A 2PL1A 3DM9B 4YAFA 2PFKA 1DZIA 2ZW9A 3EMVA 2AFRA 3IVRA 4Y2QA 5JNVA 1BD3A 1DXHA 2B0CA 2EFDB 2GN0A 4RPHA 4TTVA 4X7RA 3VNBA 4DYHA 1YRLA 3UHJA 2ZUUA 3GP8A 3P52A 4RH0A 3QUAA 4GS5A 2WZBA 3IQHX 4G3XA 5DASA 5LBIA 3ZI7A 5JAPA 4YIHA 3P2IA 3QKSA 5IP5A 3ZGYA 1KZ9A 1PL0A 2CWWA 4JEUA 9LDTA 3FFBA 3FVQA 3DEKA 5CXSA 1ODIA 4FGWA 4V3CA 1I2CA 1JR3A 2C9OA 2PSFA 3O6VA 3T94A 3IB3A 1ORWA 1RHKA 5IF9A 2FMXA 4ZHQB 2WD7B 3MNFA 5AT1A 2Q3CA 2H5EA 3WHKA 3I2JA 3KR2A 5TQVA 3INYA 4Y7DA 1QCCA 4HX2A 1Q83A 1U5BB 4K9KA 1XAJA 2DT5A 3HB9A 4MV9A 1M1YB 4X3PA 3JVVA 4BNGA 4CCYB 3MG9A 1E6KA 2ET6A 1I2MA 4RZUA 4YDRA 3B5JA 5D7NA 2O4UX 3EWAA 5A03A 4JD5A 1EWTA 2VF8A 3JVIA 2N47A 1Z0UA 3GH1A 4JP8A 4TMWA 3COVA 3N2KB 1NSFA 3ACBA 4YMGA 4BVLA 3JR7A 3B3AA 3HB5X 2EV9A 2BFFA 5CJ2A 3KETA 2CVPA 1FDIA 2R97A 4JKYA 3EGEA 3HY3A 1M75A 1FF9A 1ZKDA 3B3JA 5DGTA 3THXB 4QO7A 3QHPA 3HP4A 1IMJA 1WCXA 4NTZA 2XZLA 2UUOA 5EXDA 4H0FA 4U7HA 2QR2A 1SCKA 4K87A 4ZTBA 3AO0B 2VQDA 1X8JA 5AO9A 2JJYA 5FCDA 2F6RA 2OCAA 2XECA 4IVQA 3ZKAA 4BLWA 1GLNA 2I66A 3A9RA 1D2CA 5IKXA 1EUCB 2Q21A 1YRHA 3K0CA 3STYA 1H8HA 2VPZA 3DDZX 4XRGA 4US2R 1FFDA 5J43A 2W2OA 2FZKA 3CZ4A 4R2XA 3P2OA 4GR4A 4O4LA 4IDPA 1D2MA 1B6GA 2Q9CA 2W8ZA 4Y2XA 3QW4B 4NH4A 4YRIA 1BCSA 3GPBA 1OREA 1HT2E 3R77A 4ZAFA 2GARA 3U7QA 3QGMA 2H57A 1U0JA 2Q2NA 2QIPA 3H5TA 1ODCA 1FUEA 3DZDA 2PL3A 3N2ZB 3V55A 1JI0A 1Y4DE 4C6TA 3C70A 2OBYA 3VZRA 5HMLA 5K1ZA 4A0SA 1M83A 3B2NA 4ML3A 1IM2A 1G21E 3K71B 4UOEA 3WGLA 3I04A 1ZVKA 1R4NB 3G7NA 2HIHA 1KU6A 1F2TB 1P1KA 3ABOB 1K6IA 4HMOA 3SCZA 2IP2A 3FAKA 4GMFA 2GZ3A 4JELA 4KQWA 1YR1A 5AJVB 4D9FA 1QDUA 5IFLA 2H4FA 3OZFA 4R7TA 5AW4A 4OIMA 4W5QA 2PJUA 3KZNA 5J2TB 4QDOA 2GESA 2XMBA 3FJ1A 1IDOA 3GFPA 3TW8B 2YJ5A 2XIJA 2QMUA 3N74A 1H1LB 3NC0C 3OFSA 1KEWA 3ZN2A 4MUBA 4ZEVA 4ZDKA 5J4YA 4JR2A 1R3UA 1T2AA 1IY8A 2A88A 3GV0A 1VMIA 3ORYA 4NCXA 5EJ9A 2FWRA 4RZQA 3O83A 4H0CA 2VPXA 1QU3A 3M4NA 4Z54A 1IJKA 4IUYA 1TCVA 2VPIA 3AY7A 4UUQA 3OPYI 4LRQA 2VRNA 4UM8B 3TJMA 3M3DA 4I50B 1WF6A 2PUVA 5CFOA 1CVRA 1CV2A 4HBGA 4D4LA 5EEGA 1ADGA 1E61A 3PF8A 3R09A 4IFEA 3ZE8A 4JSYA 1E66A 6Q21A 1C4XA 1OH8A 3V32A 2ZVDA 2FEWB 1RLUA 3D7MA 3KAKA 2QSYA 3N05A 3NTXA 3T8YA 3NS7A 5LZ8A 4PHFA 3C3JA 4TT3D 2YCLA 3P9YA 2DAPA 3NIGB 2X5NA 1P4JA 1U6KA 4NNPA 4U39A 4Z8YA 5I47A 3BULA 1MVOA 2IOFA 3P4XA 4X3CA 3UQYS 1PT5A 3SHWA 2R1VB 1W4ZA 1XNJA 2EWWA 4DWWA 3KVNA 1OT5A 4B6QA 1P5RA 1QIJA 4PCVA 2Q99A 3JWHA 4J0KA 1T4BA 5A02A 2H2AA 4Q9LA 3DM5A 4M0EA 1DTWA 3W9BA 3ZI4A 7ABPA 1BDHA 3QKSB 3GEEA 4CMAA 2XE6A 4OQNA 1XSEA 3OE7D 4U7PB 3TM4A 2Z5GA 1NW6A 2C9YA 1YASA 2AFIA 4PV7A 3DLAA 1KU0A 2FXVA 3BAZA 2Z5LA 4LW8A 3BH6A 4R9SA 1E1CA 2D1SA 1E5DA 4Y2YA 3E8MA 2WF6A 2OLEA 1BE0A 1EXNA 1G0NA 1RQXA 4GLBA 4U02A 3LK7A 4Q4DA 3FRIA 2IEBA 4LGVA 2Q7DA 5JBIA 4I5DA 2B1RA 2F3TA 4AMUA 3S40A 5LNK6 4O2AB 2VO1A 1CULC 1RQRA 1X7HA 2X6TA 4FYIA 3MQ4A 3DJYA 1W0KD 1EFAA 2QZ4A 1NLMA 4ZRDA 2QXTA 5IJAA 4A9AA 5E2BA 5EJ6A 4JXZA 5B3KA 4P54A 5HXAA 3A4MA 1HEUA 3VUEA 1LSUA 2QIOA 4X44A 3B6MA 3RROA 4Y2RA 1KTIA 4ROTA 3QQ5A 1VMAA 2CNWA 1TA0A 2QV7A 3CNOA 4XR4A 5A5DA 3WP1B 4M8IA 1Z8DA 2JGNA 3D3QA 4GKKB 1W36D 2QA5A 1M1NB 4GZ5A 3ZU3A 5BSFA 1Q2XA 4OFXA 5ALZA 1NASA 2XV1A 3BZWA 2DT8A 1Q74A 5UKDA 3G2OA 3KWJA 3PCRB 1V4VA 2BR5A 1HT1E 3QHAA 2V7GA 5JDIA 1FXWA 3OCJA 1QTQA 2DOKA 3PU6A 2VAVA 5AXDA 3U4IA 4R7GA 5DEOA 4JB3A 3FDIA 3EUFA 3V46A 3LXUX 4J1TC 3NWBA 1GVNB 1JT2A 2BFEB 2H8GA 4DCTA 3EK2A 5FBVB 3KUCA 2HEGA 1FXSA 1O3YA 3DFFA 4O4LB 2E6KA 5CLIA 3SFVA 2Z83A 3WWYA 1MCZA 1Q2UA 3Q6NA 5ERYA 1UXKA 1W2WB 4RY0A 2X0KA 1BCSB 1D0IA 1VFNA 5EE9A 3O1JC 1ZX1A 4EITA 1CS0A 3AEQA 1PYOA 3E9RA 3U7QB 1EVKA 5DM70 2CNBA 4NXMB 2ACVA 2C5BA 4PSDA 1BMFD 5D84A 3TW4A 4DLNA 2XTZA 4F6CA 3MOSA 3OECA 2QNRA 3HRHA 4RNDB 1G19A 1D1TA 1G8JA 4FE7A 5IT9A 2O8EA 4M8SA 1QM5A 3LRXA 2IT1A 3UJDA 1OB2A 3KT8A 4AP9A 4TV8F 2H1IA 3A10A 1NVEA 1WPQA 2C3YA 3MGAA 3SMVA 1O8CA 3UJCA 3GROA 4A1FA 2BC9A 4K8OA 1XXHA 5EJ2A 3E3OA 1JPUA 3NU1A 4NENA 4ZGGA 3B13B 2JAHA 2YXDA 1L1QA 2PRSA 5ARBA 3PI6A 1C3OB 1KBOA 2YXNA 3KB8A 3W7VA 5DHFA 2ZRGA 3GARA 3K20A 4GP7A 4XYLA 4B87A 1K5PA 3INNA 4S2UA 4WN3A 1VJ0A 3D8HA 4GM1A 1TECE 2XKJE 3PE4A 5AHXA 4DCVA 1VYVA 3ZZ0A 3E5HA 3QE0A 2PV7A 2BH9A 1G8SA 4GBGA 5K51A 4B2YA 2ZAOA 1IEVA 1PP4A 4PCAA 1V71A 1Y7IA 3L7MA 2CD9A 2JCBA 1Z12A 3FCUB 4YRMA 5EHQA 2FEMA 2VHEA 3P7MA 1EFRD 1S2IA 1XRMA 1KJYA 2CXOA 3TCKA 3WGKA 3ZHVA 3RJ9A 2G4VA 3F46A 3S8YA 2Y1OA 5KTYA 4BLOA 3IT0A 5L3RA 4DCUA 4TMYA 4Q16A 4COKA 1JH8A 2CVQA 4J9UE 1LK5A 3CVXA 2H0QA 1JTFA 3B6EA 2ZK7A 2YYAA 4ILKA 3HRKA 3I0MA 4FX2A 3IDAA 4NPHA 1FFBA 4M8LA 2GEVA 3NTOA 4UXJA 2WV9A 4NE2A 5A9RA 3THRA 1N6LA 2E9SA 2HTEA 3MJFA 5AIAA 2LP4Y 1JDVA 3C1AA 2IIPA 1P1IA 4W1RA 3ZWMA 1IZ7A 3S8MA 4G4SP 1L7VC 2JKVA 4L02A 2HU8A 3O3NB 1SVMA 3A36A 4ZO4A 2YVKA 3TRFA 2ODAA 4CLEA 1EFTA 5TQJA 1C1HA 1J25A 2OHIA 2B8NA 5AUNB 1TVMA 2EJWA 5I3CA 1H2AS 5DWVA 4RQUA 3GP3A 1Z56C 1DTWB 4DNXA 3GLGA 1N0WA 2WTBA 3FNRA 3H2ZA 4X7MA 4MKRA 1VSUA 2IHZA 3AF1A 1E99A 5TGDA 4D43A 1EH5A 1NRIA 4PQYA 4EJ0A 3GLSA 2GJ9A 2PS3A 1ZUHA 1UXJA 1XRLA 1E1CB 1KMCA 2CF5A 3MJRA 2J08A 4D82A 1JEYB 5IN5A 3RFFA 3VHRA 5A4DA 4H7HA 1KDPA 1YR7A 3S28A 3BFKA 1BEZA 2FA9A 4EO4A 4KG7A 1X42A 3E2MA 3QE2A 3F74A 1FE8A 4QOGA 4BLVA 1RWKA 1N4AA 5KMGB 1SBTA 5BSRA 4DMKA 3OD5A 4WOCA 2B21A 4CEJA 1AQJA 3GGGA 5BNZA 1NFQA 4CIVA 1BC5A 4ZEWA 2D5LA 3B8HA 2P9CA 5ALWA 3U40A 5L40A 3QLVA 4TRNA 1Y3CE 3EIOA 2VLBA 3PG5A 1VI6A 3O03A 1KJQA 3OIGA 2KLBA 3B8EA 3N76A 4MJXA 2NX2A 1TYAE 2O3SA 4IOLA 5KB3A 2HT1A 4UXIA 1XN4A 2JFZA 5EHIA 1K7XB 1NC3A 5A4MS 2XGJA 1ZJWA 4JIGA 3UY4A 2JAOA 2IPMA 1TB4A 3OP4A 4B3GA 3SMQA 4EKEA 2OZKA 5KINB 1B14A 1FNDA 1QCYA 2KB0A 1S6YA 2QUHA 2ZIWB 1SPXA 3BSYA 3QNWA 3LX4A 2YZ2A 4HHEA 4I1VA 4MYCA 4PFSA 5C46F 5K8TA 5H8WA 4DSAA 3WO1A 4Q9NA 1KP9A 5DO9A 2OCPA 1K3TA 4JHXA 2CFOA 5ELMA 4EFKA 2JH8A 1P0PA 4LFAB 2JCYA 4ZZ3A 4R2KA 2CB9A 2XKKA 1NE7A 1F0NA 2EFHB 4OLJA 4GPBA 2AIRA 3PC8C 4JQZA 2V54A 4RU1A 2B36A 3VR6D 2A58A 3GZ4A 3AEQB 2YHSA 4TLCA 4ZYLA 5BN5A 3A0RB 2GERA 1MX3A 1ZD2P 5HJ5A 1E7WA 1RM0A 4Q3DA 1G1MA 3CEMA 1RPZA 3L04A 3ZKWB 1OBOA 5EZ6B 2LVBA 2FN9A 2O8EB 2WE7A 3ZWDA 2PY6A 3IQDB 4WLOA 1EE2A 4QVGA 3RBVA 1XCOA 4V3BA 5CEJA 4EG6A 4EG4A 2PYDA 3V4RA 5BMOA 4ZVNA 3EXG2 4JT4A 5IMSA 1ULAA 2BFCA 1MFPA 2FU5C 4B33A 1XXHB 5I7AA 1TUEA 2FSFA 4NENB 13PKA 4LGCA 4HGQA 5ALTA 3RLFA 1APBA 3K05A 1FK8A 1CJVC 1VMEA 2Y1WA 4NAUA 3R8XA 2FGJA 5IC5A 1V6AA 1JB9A 2ADFA 5E4JA 5KC8A 1EWYA 5HGJA 5BRNA 3UJ3X 4DZTA 3DZIA 3GX1A 4J7CA 3ZJTA 3FN4A 5AKXA 1SO8A 3CT6A 5KWVA 4YCAA 4PSKA 2PR7A 2P75A 1DO0A 1KE2A 4NVRA 3WNBA 1NXXA 2WTEA 3B2EA 1Y3BE 1YDHA 1XVIA 3HYSA 1OWPA 2C7GA 4IMPA 4C3OB 1ZU5A 5GAJA 4NMXB 1G21A 2I2XB 2ZJ8A 2Y1EA 2EW2A 4R8RA 5J5AA 1CHDA 5HGXA 3PWSA 1C8BA 2RB4A 3FCXA 1TAQA 4BJHB 4C6HA 2RGNA 2C0PA 4IIHA 5D8DA 1E2LA 4OQPA 1UZMA 2F67A 3MC1A 3NMUF 1WDMA 4XWOA 2NAPA 5KWSA 1EE1A 1Z36A 2R7AA 1RXUA 5AJXA 4TYNA 4DVJA 2KBEA 3AZOA 3ICPA 3A9CA 2YX1A 3H9QA 2H5LA 3WLSA 3TLMA 3V7NA 1ARZA 3FCYA 3LDGA 1GP2A 4BN4A 4DFDA 1JQ3A 2AMJA 1KSHA 1DHTA 3LKBA 1NFFA 1KYZA 4GWGA 1OXSC 4EY7A 4QX6A 3AK4A 4Q7QA 2NQ8A 3HU3A 3BPSA 2H5IA 4DTIA 2RKWA 3X3HA 2I2AA 2NPIA 4LE0A 1BXZA 2ZR8A 4KK4A 1IDN1 4ZARA 3KWLA 1I4DD 1YAHA 3IQWA 5ES3A 4WFKA 4PPGA 5AW9A 1PGPA 3E8SA 5CA1A 3RVNA 3DA8A 3BJEA 5FOVA 2I4NA 5TJHA 4J2OA 4RPLA 2NUTA 3IUYA 4MUHA 1KZ4A 4CV1A 4OL9A 4RHXA 3R5HA 5E2IA 5K0CA 5F98A 3DZJA 3FPKA 3I9LA 3WRVA 3I6ZA 1EESA 3LCUA 3HDTA 2NP7A 4DDWA 4Q1FA 1TK9A 4J0GA 4AN4A 2CNNA 4CEJB 1N2OA 3BFVA 3UJAA 1MDFA 3A06A 1B0PA 1FP7A 1XTRA 3GMSA 3E70C 3CIFA 2I6UA 4L07A 1L5HB 1Y6QA 1G8GA 1ONSA 2FX3A 4RGQA 4C2BA 5HRUA 4HDNB 2PKCA 3G17A 1GG8A 2BMJA 2I55A 4S1NA 2P90A 2PZ8A 1C9EA 2JK0A 3KCNA 1O6CA 1TJPB 2OFPA 3OPYB 5BR7A 3I9MA 4FUQA 2BGGA 3WGJA 3I01A 2GNPA 1M2OA 1HSZA 4TKZA 1GYRA 5EJFA 3WO0A 2J0QA 5BOVA 2ZVPX 1RFLA 2W6QA 3OZAA 2VQEB 4JK3A 4BVBA 4H1WA 5BV8A 2QM3A 1ENPA 2QLJA 2YQZA 2WHRA 5CURA 1XCJA 3BAFA 2J5QA 2X9GA 3QXSA 1L7AA 2E4WA 3LV8A 3W2TA 3PX2A 1JAZA 1OX4A 1SHUX 2ZIAA 3Q3IA 5LBTA 1DBWA 1JKJA 1SCAA 3ZR4B 5DI3A 1M8JA 3ZG6A 3KR9A 4TYQA 4K3UA 3O8CA 4M98A 1IOWA 1E89A 3ZGVA 4QGSA 4I1PA 3AGPA 1SCNE 2PWBA 2C61A 5CFMA 1ZRSA 2V97A 3D5TA 1TZJA 1ZRNA 1DC5A 5H3CA 4JWKA 3K1JA 3U17A 1HH4A 1AKWA 2G0TA 1UK7A 3T7AA 3G2QA 3VHLB 3AOEC 2AKEA 1HI9A 3AF0A 4PGFA 1SN7A 1XTPA 1LPSA 5JEEA 1ZNXA 4YA6A 4MS3B 2R6GA 3LPAA 4WK0B 5DGIA 1I2ZA 4PICA 2JJQA 3L1UA 1ZLYA 3KOXA 3PPIA 3VYSB 2CB0A 5DBGA 3KZCA 2XCSB 1S2OA 4QAJA 1RPAA 1CZUA 1DKOA 2VH2A 1BEEA 3MTQA 4Q6BA 1SIUA 2J0UA 2Q4DA 3H4MA 2VHUA 3M82A 4I8DA 1D6JA 1XEXA 2QUJA 3MUFA 4R31A 5FJJA 1CUEA 1ZKMA 1E94E 2O52A 1II0A 4I4IA 3Q41A 4M0UA 5IDXA 3ADCA 3T1VA 4FEAA 3E53A 3VDNB 2BRUA 4YAEA 1IRIA 4Q01A 2BFCB 3H86A 3JD2A 2XDQA 4IG9A 1W4BA 3DULA 3EQ9A 3G5UA 3OUUA 4AK9A 3B53X 3RFVA 4E14A 4ZDWA 4MIOA 4AYTA 4ZCIA 1D4OA 1O5OA 2F3UA 2PVPA 3GRVA 4YAOA 3X2EA 1XJCA 1E2KA 4QVIA 2P9QA 4R2JA 1RJFA 3EVFA 4DANA 4II2A 4DUGA 1UFQA 1HL7A 3EVNA 4BLRA 2WP0A 1JHXA 2W42A 1N1MA 1TLTA 2BKLA 1C8VB 1HOXA 4QBFA 3RRMA 4DR1B 2CLDX 2D2VA 5FNVA 4KH1A 4FEYA 3EYAA 4D3YA 4N03A 2ZYDA 5I9SA 2B20A 3FOWA 1ZUNB 1W2HA 2VNSA 4OMFG 1Z4LA 1PS8A 1J07A 2HPAA 3D5EA 4I2VA 2B2NA 1M6YA 4GIBA 4YBRA 4C5CA 1T9BA 2VWQA 1CUYA 4MVJG 5JXWA 3CT4A 3H2GA 3BE4A 4YRKA 1SQSA 4ZO9A 1Z3IX 1FTNA 3A9WA 1QF9A 1NIPA 3IT1A 4AUEA 2IDJA 4RTNA 2PUGA 4OFBA 2PLFA 4PEVA 3AC0A 1X7XA 2ISSD 3I9NA 1YWGO 3NOXA 4DIKA 4LI3X 1PIWA 1JIXA 5AICA 1MAAA 2ZJFA 4JBWA 3QE3A 3TECE 4GW3A 1SUPA 2MU1A 3MTAA 4RPKA 1T1JA 2L18A 4JLJA 3PJDA 4BXOA 5CYOA 3N3BC 2ZZMA 1EA7A 1GZ7A 1TMKA 1U28A 2FUG1 2WG0A 4O4JA 4X24A 3W8EA 4QZVA 5DYWA 1L7DA 2C2XA 4DW8A 2J0EA 4ESVA 5JJLA 4CF7A 3CRRA 3KSZO 4A6XA 4RKFA 2FSPA 2OENG 2JC3A 2QRHA 3CLTC 5K6TA 5AQ1A 5BYKA 3SC3A 2FZEA 4MS1B 3CR7A 4Y2HA 1BVRA 3A1DA 3A58B 4NMHA 4GRAA 2NU6A 3NEPX 1R8SA 4LC1A 5CA1B 1EUYA 4EF5A 2YV2A 1Q3KA 4W9NA 3V9AA 2I7DA 3WWZA 3L79A 5EP4A 5AW2A 1WETA 2HYIC 3G49A 3ZC3A 4UHFA 2A7XA 3EPRA 5IVIA 3QVWA 1LQUA 2QVLA 4G5RA 5E9JA 3VR5A 1G18A 1KEUA 4Q9HA 2C4TA 3SG0A 1MC4A 4PPQA 3ZNOA 1JAHA 4FZ3A 1YZFA 4Y6GB 4D3FA 3P26A 4GKVA 5JARA 1GJRA 1UPXA 1YMUA 2VP0A 3E61A 3U62A 2B82A 2BOVA 3EGCA 4OCZA 4PVCA 4YP9A 2ZSKA 1UC5B 1F4PA 1QGOA 4BRZA 1BD4A 1K5GA 2Z9BA 1LU9A 4INOA 4ETMA 2HXYA 1TW2A 4ZI2A 3TEFA 4Z5XA 4M22A 1SQ0A 4DLLA 4RTPA 3QFTA 4CEHA 1M2OB 2PGNA 3EQ7A 3UOWA 1H5UA 1SB8A 1ZGHA 3MSCA 4QJBA 1B3RA 4RKYA 1BMTA 2G72A 1KEKA 3UB2A 5TVKA 4ARVA 2H07A 5KOHB 1PWHA 5FYQA 4DUPA 1OX4B 1Q7EA 2QG4A 3EZ9A 1JKJB 1WMBA 5G1OA 5KWIA 2CZCA 3CUKA 4HDOB 4HSEA 1RBMA 2ZWOA 2OM2A 3EEQA 4JR0A 4OL0A 3VYVA 1RM4A 5HRCA 2OEPA 1QSGA 1XZ8A 2ZYUX 3OJFA 4JGBA 4F4DA 1Z6YA 4TYPA 2O1SA 3GDWA 4IHJF 1SIOA 3HPQA 3OT1B 3LGXA 5GZ3A 4M7RA 2RE8A 4C2UA 4O59O 2NYUA 4IUBS 1TJ5A 3WMEA 4MEJA 5ALKA 5AVOA 3HACA 1ISIA 2J0UB 1L1RA 5DPMA 1MAWA 3KSDO 5JBQA 2O5EA 2H7CA 1TL7C 3E27A 4AO8A 4YUXA 2EARA 1OFHA 3DMRA 1YI1A 2B4RO 3WYEA 3HYCA 4ZPXA 4EQ6A 2HL6A 1UJMA 3LFTA 3CE9A 1TK2A 1GNLA 2YVLA 1D4AA 3GLVA 5D86A 4BCDA 3D43A 1P72A 4BNTA 3EC7A 2P5TB 2C88A 1LF5A 2E4YA 3CPJB 4IQGA 5KPDA 2NNLD 4BN5A 3JQEA 2ECOA 3ASUA 2CE2X 1VBKA 2CFIA 3OZXA 7ADHA 4WY5A 5AKIA 1I1HA 5JZBA 4AXBA 2VSOA 1H9CA 2UYGA 3BXHA 1RC8A 4C7KA 4J0CA 3AEXA 4NF2A 4DCJA 1KVUA 3OJWA 4JLBA 3EPHA 4KXMA 1ZONA 2QTLA 1Y1PA 2IHKA 1QVAA 1ZOSA 3FI9A 3CUEF 3AB8A 3RS2A 4G23A 1K88A 1HK7A 4L9RA 2R8BA 1DIRA 5CCEA 2UYYA 1H4SA 2FWAA 4BCBA 4OUDA 3UWDA 2ZBEA 2OO5A 4BNKA 5SV2A 4FS8A 4DHEA 3A1NA 2HRCA 3MT0A 3N39C 2KM1A 2V7QD 2J4FA 3FLMA 3RK1A 4D3DA 3HBNA 3I30X 3H11A 2C97A 3DNFA 1G0OA 2QP9X 2WUVA 4QKQA 1R8YA 4LJYA 2BTOA 2QT0A 2GKOA 4B1FA 5I9IA 2GTHA 2X2FA 3TTTA 5BN1A 2VSYA 3MW8A 3BCRA 4S05A 1G9TA 4LSZA 1QQBA 121PA 3ZGLA 1SPBS 2X8JA 3GUHA 1ZVJA 5SYMA 2QUZA 1D2EA 4JLDA 5G0UA 3PPVA 1TJNA 2QLLA 2Q5EA 3CH7A 3DBOB 4TKVB 1WZ2A 5FEUA 3PICA 4N6OA 2C7BA 3LLUA 2WUGA 3AR8A 5KQSA 3WMRA 2E6UX 2IXFA 3PNYA 1RCUA 4EKIA 2RH8A 1Y7TA 1UK8A 3GRKA 3Q7SA 2C7VA 1NURA 4FWIB 3DFUA 2GILA 2NU6B 1PYDA 1UXHA 2UAGA 1M8GA 1PEYA 3CS3A 1NXPA 3EC1A 2GEJA 3IOYA 3QELA 4PLTA 4PIVA 1OH6A 5EMMA 1C3XA 2YRXA 1PK8A 2GFHA 3BWYA 1JVSA 4XPIA 1C7FA 5T4BA 3BIJA 1T2CA 3MRXA 1LPBB 1Z16A 2CBGA 2QI9C 4BTVA 2PKXA 1T0BA 2ZYRA 3NOOA 4OJYA 1GZDA 5BV0A 3NBZC 4EY4A 3AHGA 4RKWA 4W99A 4E51A 1DO8A 1L7NA 1Q1BA 2A9KA 2XUDA 2QMYA 3NHLA 1T1EA 3ZGNA 4YJHA 4ITRC 2PWAA 4X91A 1DAGA 4J76A 1YT5A 2WF5A 2GF9A 1DBQA 4HAUA 4HH3C 4J0IA 3A8TA 3PD1A 1TFRA 1W44A 4PLHA 3VO1A 3DLHA 4BRUA 4CTKA 3GIDA 4CIWA 3DTTA 3PXUA 4CETA 2AFHE 4HZIA 1PL7A 3QM1A 3VU9B 2P4HX 2X8LA 4F1KA 3V7YA 3EMBA 1XZFA 4AYWA 1RMQA 4CEHB 2G36A 4H7JA 5HQJA 1OE0A 1K7SN 1A8UA 2WZCA 4TSKA 2FPPB 3C1OA 1QFSA 2DE0X 4DDKA 3R1IA 3GRYA 5BXQC 1U1GA 2JAQA 1MH1A 1LK7A 2HZBA 1KDTA 4OHMA 2IYNA 2PHZA 1SXIA 4TLEA 1KRWA 4Z1OA 4B6PA 2ZRQA 3FZNA 2Y1LA 4RLSA 2EU8A 1PR5A 3HA5A 1LRLA 3GWZA 2F8LA 5H82A 2J5BA 2GBGA 3DBIA 2HIAA 5TPWA 3TW0A 1LF0A 3AWDA 3OCXA 2A2ZA 2R85A 4LC9A 1PSWA 1C30B 3K72B 5KNDD 2HXGA 3T95A 1XQXA 2VSXA 1KMMA 3BBLA 3A6FA 4K6KA 2A7QA 3ZGXA 3C14C 2VAMA 1PFWA 1FTGA 1Q12A 3KOMA 4N3NA 1SXGA 5EZYB 3TLZA 3FWYA 2FF7A 3QYFA 4ZO8A 1TM1E 3G0CA 4QL3A 1EFKA 2JFOA 3SBDA 2OGSA 3HM2A 3NFRA 3RAJA 1EX6A 2CYAA 4YK7A 3D9QX 1IFXA 1J90A 1T4GA 1NBOA 5KYKA 4BPRA 2C8KA 2UV8A 3U5ZB 4XWTA 3GJXC 3ZVMA 3SBEA 1MQSA 1LSOA 4EQ6B 3OQVA 4MW9A 2ERCA 3EVZA 2XB6A 4L3WA 2DQKA 1TO2E 3DAPA 5DBHX 4F3KA 4G67A 3SE0A 2WHYA 3PR2B 4C87A 4X63A 2G5CA 2F4VB 1QLJA 5IKMA 4YH1A 2G1JA 3UMGA 1A9ZA 4JJIA 3KEMA 5IM5A 3IKJA 1DKUA 3GI1A 3C5VA 4CUKA 4PYRA 4OU4A 1JKIA 4N0MA 4OY3A 1AZSC 4JROA 2IBSA 2O19A 2BM0A 1VE9A 1VCMA 2G07A 5A04A 1DMSA 1CQIA 1E7QA 2A0YA 3HCAA 4V0QA 1FTQA 5JCJD 2WWFA 4MUMA 4CODB 3AV3A 4CHTA 1FDUA 3WL4A 1Z4KA 4JVSB 4RXTA 5DX0A 1ISSA 4B46A 2A9FA 1C9KA 2VUSA 1YZQA 4PX2A 3JQAD 4OUDB 3PXGA 2P6RA 3L7NA 1WW8A 3IAM6 3FPBA 4CM5A 4QDXA 3QIAA 4PAGA 1YA4A 2QDXA 4JMLA 3ZGZA 3DL2A 4IJUA 3WL6A 5DXAA 3BMQA 3H11B 3KJEA 4XB2A 1YA6A 1C0EA 1II8B 3L7KA 2R8XA 4ENWA 2Z6QA 4RHUA 5TT1A 3IH5A 2AA3A 2UDPA 3IP5A 1R0KA 3QRWA 1NLUA 4BQOA 2BHNA 4EPRA 7AT1A 2Q2OA 2O8DA 2ZSUA 4I8XA 2BI4A 1WMAA 1IQUA 1MMFB 1P61B 3ZTWA 1SIWA 1M6HA 2X8JB 2WHEA 2YVAA 3JVDA 4F96A 3W9UA 4OGLA 4F11A 4ZI7F 3LQFA 3UWOA 3X2SA 4NK5A 4WT7A 4X54A 5ULLA 3ZIUA 4HDSA 5HX7A 1JEEA 3EGWA 2EJBA 2BJHA 3CB4A 4WZAE 3V34A 4B73A 1HUQA 1I4TD 1W5AA 2RHHA 3SSMA 4U7TB 3NWOA 2QRPA 4RY2A 4DCNA 4CL0A 5IJZA 5KKAA 3RYIA 3LGSA 1P6XA 2ZBPA 3MMPA 2HWUA 4AO6A 1KJWA 4IMRA 1ULHA 4BLSA 4J0EA 5DSTA 2GS9A 4E31A 4HC4A 2ZE8A 3GRRA 5LPNA 4IJKA 1S7CA 3PGA1 1KEVA 2LBPA 4DDVA 5C35A 3RSCA 1J99A 1AHIA 1XV5A 2C95A 2JGEA 5JPIA 3L1HA 4XRRA 5EUQB 3U4GA 1UIMA 5L45A 2PPVA 3KFLA 4ZJUA 4UEWA 1VCOA 3C45A 1KQFA 3FZGA 1SG6A 1QE5A 3MD0A 3SJZA 2MJLA 4YJHB 6GPBA 4KFRA 1XDSA 4I9HA 2PMEA 1KDVA 2GM9A 4R71A 3HADA 5DM4A 3VR3D 2BW0A 1YQ9A 4BWGA 1Z34A 3QBJA 3OZGA 2V7EA 2ZJZA 4ID3A 1K0UA 1ZJJA 4URZR 1L7PA 2OGWA 1I4WA 3B9RA 5E6SA 5FP0A 3WYCA 4IW3B 4IYRA 3VR2D 1VBFA 3DONA 4ZOAA 1TRHA 3PI7A 4KIUA 1J0BA 2BDTA 2ID4A 4B44A 2PZGA 4OP3A 1ZY2A 3D6FA 1B41A 3FWZA 3PQ2A 1PFVA 1UIRA 1VJTA 2HTFA 1XB2A 4MLDA 2DR2A 2F9FA 1UBSB 4MXDA 1ZK4A 3DMYA 3E3AA 2QLMA 1C7RA 2AHOA 3BTSA 2WABA 3LPMA 2WD8A 4EUNA 2IYEA 2B78A 5L3ZA 3ZNNA 1ABEA 3JARB 2PNFA 1JDTA 1FFGA 2VRBA 1XMSA 5TPWB 2VJDA 1SIBE 2G08A 2XCOA 3GY0A 5SZHB 4U7GA 1PFKA 2N0SA 2QRVB 1R6BX 5AW5A 3V6MA 1PDOA 3TK1A 1BVHA 1IBRA 2CWDA 1CJMA 2HLNA 2A4KA 4CIYA 2WLTA 4BO4A 1KAQA 1NVBA 2IXDA 4CV0A 2HV8A 3BMCA 5D7BA 421PA 1DLIA 1L7EA 4Z4CA 3D4BA 1A9XA 1NL3A 4KNWA 4YJ3F 2BR3A 2Q5LA 4IV8A 1CR1A 1XF1A 5AI5A 3F5QA 2HRZA 4ZI3A 5CVDA 4BV3A 5AM1A 1PR4A 4RLHA 5DTQA 3L7AA