2FHSA

Structure of acyl carrier protein bound to fabi, the enoyl reductase from escherichia coli
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
258
structure length
258
Chain Sequence
b'GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords enoyl-[acyl-carrier-protein] reductase, NADH-dependent
molecule tags Oxidoreductase/biosynthetic protein
source organism Escherichia coli
publication title Structure of Acyl Carrier Protein Bound to FabI, the FASII Enoyl Reductase from Escherichia coli.
pubmed doi rcsb
total genus 83
structure length 258
sequence length 258
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2005-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2fhsA00
4L4RA 1LBEA 2IZ0A 4NBWA 2AG8A 4WEQA 5JSFA 2AE1A 3KLPX 5KJ6A 4OQZA 2BFOA 3GDFA 1Z73A 4PLGA 2NADA 1DEHA 5KVSA 2IEDA 3IJPA 5HM8A 4ZQGA 3ZWVA 2CVQA 4FC6A 3VAZA 1I01A 1ISGA 4YPOA 1N9GA 2I6TA 2Y05A 4N5LA 2GUGA 2PTGA 1YDWA 4A27A 4BKPA 2EHDA 2X4GA 3EHEA 1E92A 4YJDA 3D4OA 5T64A 1DOHA 1FXSA 2HU2A 4BOYA 1Q7BA 3RVDA 3INRA 1IPEA 1PJBA 4I9NA 3EYWA 1GUFA 1AN9A 2CZCA 3KBOA 3VPSA 1I2CA 2PGDA 3ROPA 1GZ4A 2G76A 1F12A 5JFOA 1OC4A 1AHIA 3L9WA 4YJGA 5GZ6A 1YONA 3PXXA 4XR4A 3PJFA 3VPGA 1KETA 1QSGA 1B0AA 1JAXA 4PLFA 4B8ZA 1NASA 4PG8A 4P38A 1XLTA 4TSKA 3V1UA 2X7HA 3KYCB 1DIHA 3VDQA 1R4MA 1GDHA 5BSGA 1M6HA 1Z45A 2CUKA 3DOCA 2D5CA 4KUEA 5ER6A 4BKUA 3H9UA 3MJEA 1YH3A 4TROA 5HBRA 2HK9A 3DAGA 3GUCA 4B7UA 4KZPA 1GU7A 2Z5LA 4IZHA 4BQRA 1ID1A 4D7AA 3D4PA 1LQTA 3JQAB 1CEQA 2CDBA 1B3RA 1ZSVA 2FPPA 2QW8A 4ZQFA 3V1TC 3BHMA 3PDUA 4XQEA 4J6FA 4LISA 3WWYA 1E7QA 1J4AA 2Z1MA 2UYYA 3KHUA 4MVJG 4OXNA 1KEWA 1JU9A 1V3VA 1O89A 1B14A 2YFHA 1F8FA 3AFNA 2G1UA 1Y1PA 2AW5A 4BO9A 1R6DA 2PKQO 3W8EA 1LLQA 2FPGA 1HDOA 2EJVA 3ENKA 3PZBA 1YJ8A 4PZCA 2O3UA 3E9MA 3I23A 4BO8A 1HE2A 1SZJG 3ICCA 4ZD6A 5JNLA 1NPTO 3VH4A 1ISIA 2NQTA 3HN7A 4CLOA 1E7YA 3SC6A 4XYEA 3I6IA 1DO8A 1UR5A 1Y8RA 4R5MA 4TRRA 1JAYA 1XQ6A 4J4TA 2X22A 4EITA 1SOVA 4AG3A 1H93A 3OEYA 3RUAA 4BGVA 5KVCA 3MJSA 2C54A 1S6YA 3GGPA 3TRIA 4OOFA 4ALMA 2VTEA 1E3LA 3X2EA 1SMKA 2OFPA 1KEUA 1UXKA 4IMRA 2JAPA 4BGUA 5K9ZA 4R1UA 2C7VA 2DBVO 5MDHA 2C82A 3WLFA 2X5KO 2PFGA 1PJTA 2OL4A 3PPIA 1FF9A 5TLSA 4RVFA 5L7TA 3O26A 5L95A 3A14A 4Q3CA 3VOSA 1H6AA 4UREA 1K2WA 1NTOA 2Y1FA 5TRTA 4DL9A 4MIEA 5I7EA 3E6AA 4MPDA 3DTTA 1JKFA 2GPTA 1PR9A 2XPCA 1NPDA 3OJ0A 4BNUA 5CDYA 2OXIA 1H9AA 1T4DA 3DMTA 1GEEA 4E21A 3KSUA 1ENZA 4E5YA 4PIVA 2Y68A 3IKVA 1Y6JA 5HTOA 4W99A 2O23A 2PY6A 2X58A 4DC1A 5IJZA 3ZNQA 4J90A 4F6LA 4RLSA 1LX6A 2OMEA 5A4DA 1P9LA 1EQUA 1UAYA 5L7YA 4N18A 2VWGA 2HMWA 2VT2A 4Z3DA 4EEZA 4WLOA 1EVJA 1K3TA 2VUUA 3O9ZA 3PYLA 1E77A 3GGGA 3P7MA 2D8AA 2GN4A 1SNYA 3W4KA 4CV0A 5F5NA 3WXBA 4E3ZA 4E32A 3ADPA 3JQAD 1OBFO 3ZDFA 1QRRA 3PFFA 3JD0A 4E31A 1DC6A 2O3JA 5IDQA 1I3MA 1BVRA 1M6WA 5I7SA 3KETA 3ANNA 3JQ9C 3ONEA 2ZB7A 1I2BA 4YRDA 4AJOA 5HA5A 1YBAA 3CXRA 4BO2A 1P0CA 5JO9A 5CG1A 4R1SA 1X7GA 4KUHA 4A73A 1JTVA 3GN2A 1N5DA 1VLLA 4A5OA 3NUGA 1LC0A 4KTVE 1B8VA 4AJPA 3I3OA 5FF9A 3WMXA 1HSOA 1ADGA 1JVSA 2NM0A 3T4EA 1FK8A 4DBVO 2B35A 5B4TA 3BMQA 2H9IA 3HJAA 3F4LA 1VPDA 2EWMA 1DXYA 3QWBA 3GRKA 4PRKA 3FNFA 1ZK2A 1HDCA 4NK5A 3U4CA 3RJ9A 4EUFA 1HF3A 1DB3A 3PFWO 3WIEA 2Q1TA 3ABIA 2XF8A 1EK6A 1HE4A 5JC8A 1UDAA 4MVJP 4FS3A 1QYXA 4ROSA 2AMFA 1X0VA 5IXSA 3RJ5A 4EBFA 1E6UA 4NU6A 4E33A 1X7DA 4BO4A 5KJCA 2BLLA 1QORA 3AI2A 3FWZA 4HWKA 3BZUA 2O48X 1T2FA 3LZ6A 3Q11A 4BNNA 3ROMA 3BA1A 4GSLA 4WLEA 1Z74A 3RFTA 4LMRA 4KDFA 1I0ZA 3H65A 2JKVA 2Q49A 3TF5A 3STHA 3UAGA 3ZWOA 3P2YA 3NT4A 2AA3A 1KIFA 2PA3A 4WUVA 3RBXA 4OIMA 3U62A 4PG5A 3CUKA 3IUPA 1N8KA 3NDRA 4FGWA 4R54A 4YQZA 3UKOA 4I1IA 5CAEA 1UZLA 5COBA 3RIHA 1LRKA 3C1AA 3NJ4A 4NBTA 3S2FA 1EFLA 1V3UA 3BHJA 3JD2A 4BNLA 2RHCA 2VHZA 2NVBA 2Y1DA 5EESA 1LDEA 1U7TA 2DPGA 4XYGA 1HYHA 3F46A 1ZFNA 3OEWA 4MINA 2WYVA 4J1TA 4JQCA 2ZB3A 3C7CB 3FHLA 4GGPA 3QVSA 1AXGA 2NV6A 2NTNA 4CV2A 3QA9A 2H5LA 1PJ3A 2IEBA 2G17A 5FWNA 5JCXA 4GI2A 1NAIA 3ZWCA 2FR8A 2D2IA 3T7CA 2VZ9A 1LEHA 3GT0A 2I3GA 1RM3A 4FDAA 1D4FA 1XGKA 3ENNA 3JQCA 3H9QA 2PKQP 2J3KA 3K5PA 4RF3A 4YAJA 3K2BA 4BB6A 3VZQA 1PL6A 4UUOA 3Q9UA 4E0BA 5T57A 3KO8A 3AI3A 4L76A 4UEKA 1D7OA 3A06A 3JQ7B 4MKRA 4B3JA 4O59O 4TQGA 3EUWA 3W4JA 5L4NA 4RVUA 5THKA 3H9EO 1LDMA 2HLPA 4XA8A 4GGOA 2OBNA 4NJOA 3PWZA 4R1NA 4JJGA 1ZEMA 2Q2QA 2W2LD 4DVJA 4KQWA 1PSDA 3RROA 1NYTA 1Q1NA 4YT8A 2JJYA 3TL2A 1CRWG 1PJ4A 4DYDA 1H2HA 1IE3A 3GG9A 4G5HA 1O94A 1KYQA 5FYDA 1PIWA 3IP1A 4MOWA 1C1XB 1X13A 2NVUA 4L4SA 2J3IA 2HK8A 1O9BA 4O63O 4BHTA 1P1FA 4ZICA 4FN4A 4YTEA 3RC1A 1XYGA 3H2SA 4IS3A 3R3JA 4UUMA 4WNCA 3AM4A 3E82A 4U6SA 4YT5A 5AQ1A 2JHGA 3JQDA 4DLBA 5JXWA 4KP7A 4L74A 2W2KB 1OAAA 3I83A 3WMWA 3NGXA 2ET6A 3PGJA 4RQTA 3M2TA 2I5PO 3OJFA 3PQEA 3U4DA 1PL7A 4NFYA 4KDEA 4XB2A 4BNGA 1QXSA 1LDGA 4IQ8A 5L4LA 5ADHA 2JCVA 4MVJI 4D43A 2EW8A 4OQYA 3JD3A 1KOLA 4IIUA 3A28A 2YHIA 3AOEA 4LCJA 3WBBA 3VH3A 4ITUA 3E5MA 3COSA 3FNEA 2YV1A 4JXKA 2GZ3A 4CM9A 9LDBA 1YDEA 2A4KA 4CQMB 1GQ2A 2ZTVA 1GZ3A 1WWKA 2Q2WA 3KTDA 2I3AA 2GERA 4FJ0A 3WGTA 1IOLA 3ZHZA 4PCVA 2X23A 5GY7A 1SBYA 3G79A 5ES3A 2AQIA 5CEJA 3AY7A 4K1LA 3UUWA 5B4VA 1FDWA 2GNAA 3E1KA 3N58A 1FJHA 2DBRA 1XKQA 4ND1A 3VZRA 3OBBA 2ZB4A 1UZNA 2WYWA 4NZ9A 3D3WB 1YBVA 3QP9A 3ZWMA 3RCBA 1X14A 3Q9NA 3OQ1A 3SC4A 4UULA 3Q3CA 4B79A 1CERA 1D1TA 5EERA 2QRKA 3DHYA 2EGGA 2W8ZA 3VDRA 3R1IA 1MX3A 3F3SA 2PD3A 3GVPA 1MB4A 5AXAA 1PQWA 1A7KA 2JD1A 5JPIA 5HWSA 1N1EA 1G0OA 1ZCJA 3WSVA 5JS6A 3T4XA 5JDIA 1IULA 4XCVA 1M75A 3IC5A 1P1JA 4Q3AA 1R4NB 4AJNA 4M54A 3BMCB 3NDIA 1CIVA 3V5NA 4AJ2A 3QJ5A 4ALJA 2ZKLA 3BAZA 3BHIA 2QX7A 1U4OA 3OH8A 5A03A 2Y1OA 2C2XA 3OFSA 3L07A 4JK3A 1NVMB 1ISFA 2R00C 5JLAA 4BVAA 5F1KA 3JQGA 3E8XA 4GBJA 5CHEA 1VSVA 2EGHA 4XIYA 2D0IA 5F1OA 3LC2O 5KOIA 4CPDA 5JMPA 4FC7A 4CMIA 3K6JA 4XRRA 1HDYA 4FFOA 5CEFA 1IY8A 1GTMA 5T67A 2P91A 4ALNA 1ENOA 1CDOA 3H7AA 1H9BA 2AHRA 3M2PA 3WQRA 3GQVA 3B20A 4CLRB 1QYCA 3KXDA 2QRLA 4WLNA 3ZWBA 1JDJA 2Q3EA 1QYVA 1RPNA 2P4HX 3Q2IA 3R0IA 5DT9A 3WGGA 4AL4A 4U0KA 3LU1A 1H6CA 4JNKA 5ENDA 3WGOA 3FBGA 2EKQA 3DONA 4C7KA 2XOXA 4WOJA 1Q0HA 1W0CA 1IHYA 3DZBA 2WE8A 4EYEA 4IINA 4RDHA 4WCFA 4D0RA 1XHLA 5L9AA 3VVBA 1A9YA 1BXKA 3UFXA 1ZBQA 5CPBA 1PR3A 2BMAA 3AWDA 4J1SA 4XDZA 4CMHA 4DA9A 4I5EA 1PS8A 1B26A 1JA9A 2BGKA 1E7WA 2VHVA 2SCUA 4JLWA 3NDJA 1YWGO 1F06A 1ZK4A 2QZZA 1NPYA 3AY3A 4X54A 1VRWA 4FQ8A 4J0EA 3JYQA 4PLYA 2GZ1A 1I3NA 3M6IA 3LDHA 3PYXA 1NM5A 3K73O 1T4BA 3C7DB 3O38A 3LF2A 2Q1WA 1F14A 3HN2A 4LSWA 2JD2A 4MVJA 3SX2A 1JW9B 2NQ8A 3EDMA 4CLHA 1WLYA 2YZ7A 1TI7A 4XJTA 3DZJA 4FJ1A 4ZVVA 4P4LA 1F0YA 1E7RA 3DHNA 3ORFA 4JIGA 2Y93A 3UXYA 1P3DA 2JFFA 1SOWA 4PZEA 1ZK0A 1OOEA 3GNSA 2VUSA 5I9LA 2GR9A 4HFRA 3W6UA 3FPCA 1DAOA 5JDCC 4UVEA 1C0KA 4R69A 2DC1A 1E1MA 3WDSA 2YV2A 1U1IA 3GHYA 1IHXA 5A02A 3RQSA 3PDJA 5FFFA 3RC9A 1GPDG 3ZH2A 1O8CA 2O2SA 2IZZA 2O4CA 2DLDA 2AEMA 3UGKA 1WXDA 1RWBA 3IAHA 1HDGO 5LDHA 2VN8A 1EE9A 1GUZA 2NNLD 2A92A 1PX0A 3DZGA 4D46A 1LSUA 4R51A 3WOHA 3EW7A 1O5IA 2OO5A 2DUUA 4FR5A 4XQ9A 5K6AC 5U1PA 5ICSA 3DBHA 4BB5A 1CETA 2FZEA 3F47A 5CDUA 1NBOA 3PJGA 3ICPA 1ZJZA 3I6QA 1NR1A 2B4QA 3PHIA 4J4HA 4I08A 4PG4A 2FP4A 2G82A 4U5QA 1SC6A 5A3VA 2E6UX 3JQBA 3LQFA 2GCGA 4DBZA 3BTSA 1U2GA 4PG6A 1DJNA 5DCWA 1PGOA 3NEPX 4EJ0A 1JKJA 3CZRA 1SO8A 5AOVA 4E5KA 4FOSA 1T2EA 3VKVA 2NSDA 4XIJA 2ZJ0A 2EIHA 3RBZA 1GZ6A 1XU9A 1FDUA 4E5MA 2CSUA 3OSUA 1FDTA 1NVGA 5A3JA 4IDAA 2F1KA 3RC7A 5B12A 2VNAA 2EP5A 2BHLA 2GN6A 2VOEA 4XYLA 5DBIA 4Z3KA 1MC4A 4BUCA 3UVEA 4E5NA 1QLJA 3W6ZA 4J2OA 3L6DA 2C7GA 4L4XA 3KZVA 4DWVA 1W8DA 3OIDA 2ILTA 5BSFA 1B8PA 1G6KA 2NWQA 4BKRA 1MG5A 1U2DA 4ND2A 4MP6A 3AFMA 4TKMA 4BNYA 3JTMA 2HK7A 2HMSA 3PIDA 3RSHA 5JBIA 1ZZEA 3QVTA 1P77A 4YA6A 4PLCA 2D59A 4DYVA 1E5QA 3QVXA 2EV9A 5G4LA 1YB5A 3S2EA 1VL8A 3TSCA 3IS3A 2HDHA 3DBLB 1L7EA 1DIRA 1NFQA 3WB9A 3IQDB 4ALIA 5KTKA 5F3RA 2W2LA 5K0ZA 3E18A 2Y99A 3TZCA 1IPFA 2BI8A 4CR8A 2ZJ1A 1ONOA 1BVUA 3JQBC 4BGEA 5L4SA 2EKPA 2B83A 2X0NA 3I9MA 4N54A 1AE1A 5B4UA 4R3WA 4QTZA 3IOYA 5TS3A 4YAIA 2AXQA 3JV7A 1P44A 4RZHA 1EVYA 3UHAA 3WQQA 2C59A 3WBFA 3PQFA 4A7PA 1R0LA 4D45A 1NHWA 5A9SA 5JAZA 3K30A 4DC0A 3OIGA 3U4IA 1M2WA 1NQ5A 1VSUA 2EP7A 4FBGA 4U0JA 3VPFA 3NGLA 5BR7A 2GO1A 4HY3A 3H5AA 1BRMA 1R12A 2C07A 1KS9A 1J6UA 1GYRA 3BMCA 2PGLA 3PIIA 1BDBA 2VHXA 5I8WA 4L8VA 1V3TA 4HXYA 1HRDA 1DIBA 5KJ1A 4II3A 2PK3A 4MDHA 4CODB 2HMVA 2Y0CA 3L4SO 2VZ0A 4ID9A 4J3FA 4OYRA 4YAKA 3JCZA 2C2YA 4IJVA 3QQPA 3BTUA 4JJIA 2CMDA 4BNVA 4U8GA 2C5AA 4RJTA 5KWEA 4CM4A 4GMFA 5B37A 1BW9B 2FHSA 3JQ9A 4E12A 5CFZA 5F5LA 3GEGA 1TB4A 3IDSA 4A03A 1HDXA 5ER9A 4WK6A 4NHEA 5COAA 2C29D 5IAAA 1NVTA 4AJHA 1WVGA 3FNHA 2OOSA 2VZ8A 4WASA 5EJ2A 1KVSA 4OM8A 4LVUA 5DN9A 4XZ3A 3CE6A 3GDGA 2VQ3A 1B7GO 1RJWA 3EMKA 3N7UA 4IUYA 4M87A 1NWCA 3OP4A 3D5QA 4N7RA 3GZ4A 5T8KC 4AJIA 1CYDA 1UDBA 4UVGA 4NBVA 5BNTA 2VWPA 1EUDA 1MV8A 1SEVA 2O7SA 4WCFC 1BXGB 4P8RA 4RORA 2V6GA 4J91A 4I5DA 4B7XA 4QFCA 2IYPA 3OMLA 3WGYA 2DPHA 1P1HA 5JCJA 3VH2A 1GCOA 4PVDA 2UVDA 4GAEA 4NNJA 3B1KA 2ZIZA 1I5RA 4J16A 1V9LA 2WD8A 1R4NA 3DO5A 1H5QA 5A04A 3WGHA 4AJEA 5TIIA 4LW8A 1PGQA 4K26A 4P22A 1ISJA 1ML3A 3PHJA 1GYPA 4YJGB 1QYWA 1LLCA 1Z7EA 2E4AA 4WJZA 5G2OA 2XXBA 1DC3A 1MGOA 3MJCA 5TT1A 4IJWA 4BMSA 5KNLA 1ZUD1 4RVSA 4Z9XA 1UXIA 3ANLA 4LN1A 2Q4BA 3GAZA 2NUAA 2PZLA 1UXJA 3OJEA 1YE3A 4B4WA 2UUOA 1ULSA 2X6TA 2X5OA 2PNFA 4IIVA 4QSMA 4EUHA 2YHUA 2BKAA 1DC4A 5JDCA 4H15A 4M55A 3ZZNA 2AG5A 1PEDA 4CMEC 5DP2A 3UCXA 3LVFO 5DDIP 2JAHA 1B15A 2PV7A 1Y8QB 3DQPA 1EVIA 3INGA 3GUYA 4BNIA 2O3SA 4CR6A 3RWBA 3V8BA 4LCEA 3ZCXA 2DKNA 4PN3A 3IL2A 3JQEA 4WKGA 3IJRA 4YDRA 4PLPA 4ZRMA 2B69A 1A4UA 2NU6A 5HRUA 4E5PA 5TT0A 1XSEA 1HKUA 1GUYA 2YW9A 4XGIA 3ZWAA 4MO2A 3KRTA 4DIOA 3G0OA 1ADCA 2CFCA 1WP4A 4OGWA 4Q3NA 1KC1A 2Q46A 1SAYA 4J1QA 1ZXBA 5I8ZA 1I32A 2DBQA 4Y6PA 4TVOA 1Q0LA 2QYSA 3W8DA 3LLVA 4YEDA 3O8QB 2P5YA 1DRVA 5AXCA 3KM0A 3I52A 2W4QA 5JC1A 3HDJA 3TJRA 1FMCA 4HFMA 3CMCO 1C0IA 4DUPA 1E1NA 3JQGB 4CM1A 3RAJA 1J0XO 1Z7BA 3RKUA 1LU9A 4R9SA 4TKLA 2ZYAA 4HNGA 3TOXA 3FWNA 5JY1A 4BNFA 4S3MA 2PZKA 3PVZA 3HQ4O 4OSOA 5IZCA 2ZTLA 3OHSX 2I65A 1QYDA 4QUKA 3ZWPA 4B8WA 5EPOA 2OZPA 2JHFA 1BXGA 2QG4A 2QZ9A 5JW6A 3LT1A 1P74A 4GX5A 5A9SB 3Q6IA 4EJ6A 2GF2A 3DMYA 1VE9A 1MA0A 2P9CA 4NFHA 1EBFA 4DREA 5KIAA 3OJLA 1HZJA 1I33A 4W9NA 3GZNB 4CMEA 2TMGA 4W7HA 4K28A 2J5QA 3F5SA 5G0TA 1PWXA 2C0CA 2HUNA 3EK2A 2DQ4A 2X9VA 2EF1A 3I9JA 5DBFA 3GHHA 5I7VA 5BSEA 1B16A 3EGOA 1LLDA 1PJCA 4KOAA 1Y9AA 2A94A 4D42A 1LNQA 5ITWA 2WMDA 1EVZA 3RUFA 4CUZA 2HMTA 1EDOA 4XWYA 2VCYA 4DGSA 1Z75A 4N5NA 1ONPA 1ADBA 5DP1A 1OI7A 3PP8A 2YQ4A 1PWZA 1U3UA 4YQYA 4R41A 3WNVA 4TWRA 1PL8A 1HSZA 3K96A 3HB5X 2OBYA 3MWEB 2ZTMA 3OECA 3RFVA 3SJUA 4Y8VA 3TOZA 2EERA 1XELA 4NQZA 1Y5MA 1JWAB 1B2LA 2X9GA 3FRJA 4YAEA 3ZHXA 3WGIA 4R1TA 1UZMA 3QVWA 2WE7A 3BIOA 1EBUA 2VNSA 5LCXA 2B4RO 4M86A 3B6ZA 3WYCA 1YL7A 1KBZA 3M1AA 4NBRA 4RPKA 2AEJA 4RO0A 4XYMA 4WLVA 2DTXA 1MUUA 3TZ6A 4A2CA 2BF7A 4KMSA 3ROKA 4BO3A 4BO1A 3TL3A 3KYDB 4AJLA 5CDTA 3JD4A 4IS2A 4C4OA 4JP3A 2J3JA 4E13A 1ZW1A 3WX0A 4GSKA 4XQCA 1H6BA 4CM8A 3GC6A 4XX0A 3AY6A 3RUDA 2W2KA 1B8UA 3WYEA 4IXWA 3RBVA 2Y66A 3ZU5A 1MP0A 2A9FA 1U4SA 4HADA 4ZRNA 2P9GA 3MJTA 4NJMB 2O4UX 3CMMA 4FSHA 3TN7A 1I24A 4G2NA 4L75A 1HEUA 4Y98A 1TLTA 3RFXA 4L73A 5TF4A 1ZK1A 1GYQA 1RKXA 4D79A 1T2DA 3A9WA 4ESOA 3KSDO 1BWSA 2RH4A 1NFRA 3QWHA 3GVXA 5DCYA 2WJPA 3JYPA 3UF0A 1WMAA 1DDOA 3DC2A 2E49A 3E9QA 3QWFA 2B36A 3EAGA 1TXGA 3D7LA 4D3SA 5G0UA 3EVTA 1BGVA 1K6IA 1ENYA 4IPTA 3WS7A 4OL9A 2G0TA 3B70A 1LSJA 1YQDA 2R6JA 2B37A 2PWZA 8ADHA 3HE3A 2JL1A 4UVIA 1DFIA 1ZMTA 2PR2A 4RZIA 1HZZA 3LC1O 4NI5A 3S55A 3UW3A 3GMDA 6LDHA 1GY8A 1YQGA 1XQ1A 3C24A 2P2SA 3L6OO 3MOIA 3HADA 1E3SA 4PLVA 3U4HA 1PGPA 2ZCUA 5DF1A 4IBOA 4I9HA 4AICA 1VKNA 3R6DA 4BS9A 1U3WA 3SLKA 1V8BA 1VL6A 2VYVA 4BMVA 1A27A 4BQPA 4J4BA 3OA0A 4LSMA 1DSSG 1F17A 3WQSB 3SJ7A 1QG6A 2GLXA 4QX6A 4NBUA 4CJXA 4LRSB 5IFLA 3DZHA 4FFNA 1C14A 4BNXA 4RVHA 1UXHA 4YXFA 2PZJA 3S2IA 4E2XA 1QV7A 3L6EA 4UUNA 2PZMA 1IL0A 1OMOA 3AM5A 3PK0A 3RASA 1TVEA 5DNAA 3TDKA 2V6MA 1EE2A 4FCCA 2P5UA 4R68A 4TZTA 3ZWNA 3GY0A 5B1YA 3E9NA 2EKLA 1ZSYA 4JBHA 2D1YA 1I36A 1NWHA 3G1UA 3DBHB 4GL4A 1PGNA 4GWKA 3W4IA 3H6KA 2VHWA 3H4VA 3LK7A 4IQGA 4K6FA 1E3WA 1UXGA 3DFUA 1T26A 1E3EA 3QWIA 5JYDA 5GZ3A 1DPGA 1Q0QA 3WWZA 4P4NA 3ASUA 3TZQA 4GX2A 4IDDA 4R9RA 2ZQYA 4E2WA 3HFSA 1IYZA 3GF4A 3CEAA 1Q7GA 3UCFA 1BW9A 3ZV3A 2ZB8A 1LRJA 3ZV5A 2B5WA 1WZIA 1BMDA 2GRAA 4J7UA 3NX4A 3ULKA 1W4ZA 3D1LA 1HXHA 4UAGA 3U0BA 2OGUA 2FOIA 2ZYDA 3R3SA 4HBGA 5AVOA 2VRCA 1UH5A 2OP1A 3RD5A 4MJLA 2E48A 2AEFA 1G0NA 3VTZA 4R3NA 3DAFA 4NPCA 1IZ9A 2YQ5A 4WPGA 4JGBA 4XYBA 4BMNA 4J43A 2RH8A 2O3QA 2ZATA 4H7PA 5THQA 3BMNA 5IXYA 3WYBA 3EY4A 2WM3A 3O4RA 2NU7A 3F6YA 2ZCVA 4RPLA 3U5TA 3DB2A 4QEDA 1AHHA 3ZNNA 3BXXA 5G4KA 5KJFA 2ZQZA 5G0SA 5C5IA 1Y8RB 4DRYA 4RGBA 2B0JA 2RHRA 2O2YA 3ADOA 4C7JA 3I9NA 5IDXA 2FWMX 3JQ8B 2UUPA 4YRBA 3RUCA 1XR3A 4XD2A 1YVEI 4IDFA 4GWGA 1K0UA 2FSSA 3NV9A 3DBVO 1WDMA 2LDXA 3DEYX 3MTGA 2Q1SA 3H9JA 5T6BA 4D0SA 3UOGA 1P1IA 4G81A 3K31A 1GL3A 1V0JA 1V35A 4J0FA 2C20A 2PGJA 3MZ0A 3I4FA 4CQLA 3CH6A 4K9DA 1R15A 3OJOA 4HFNA 4PVCA 5ENVA 4IDGA 1YQXA 4CQLB 1KVQA 2EJWA 4XQGA 1ONNA 4FJ2A 1LUAA 5TGDA 4AJKA 3D3WA 3JQAA 2YDYA 3FNGA 1Y81A 3D4NA 2CVOA 2I76A 1XG5A 1WZEA 1KEPA 2JFHA 3C1OA 2IZ1A 1ZVMA 3AU8A 1ARZA 4ZA2A 4WEOA 1XU7A 3NJ8A 1DAPA 4YVFA 2X86A 1T1RA 1QP8A 2VRBA 3JQ8A 4KUGA 3TZHA 1XEAA 3E48A 4PLWA 2P4QA 4PZDA 2PLAA 1Q7CA 4CMKA 4ZQHA 4BO5A 1T24A 1PJQA 1R0KA 3BMOB 1CQJA 2YHIB 5G0WA 4DLAA 2UV8A 4MVJH 3ZU2A 7ADHA 4OO3A 3G1TA 5U4QA 2WDZA 2EW2A 4XGNA 3KEQA 1JWBB 3FD8A 8LDHA 4YAGA 4J9UE 3VZSA 3ANMA 3QE3A 2VT3A 3AW9A 4ND4A 2BGMA 2NVUB 4BNWA 3GGOA 4IDCA 1ZEJA 2FZWA 4R01A 5EN4A 5BT9A 4A10A 5BQFA 2DU8A 3AM3A 2TMDA 1OFGA 4II2A 4Q3EA 3ROQA 1A4IA 1R66A 3QW2A 1LRLA 5DOVA 5HS6A 4CL8A 5IG2A 1U9JA 1X7HA 5IN5A 3CSDA 4MVJF 4O1MA 4DQUA 4EDFA 3DZIA 1VI2A 3QSGA 4RPGA 2CY0A 4MP8A 4RLHA 1BTOA 1UAGA 3ZNPA 4DPKA 1GQQA 2V6FA 3I9OA 2FR1A 4NU5A 4FB5A 2CDAA 4QT0A 5H81A 4YB8A 1S7CA 1ISHA 3F9IA 4Y67A 4HKTA 1E6EA 3OA2A 2OORA 1TA4A 4CLRA 4OXKA 1U5AA 1NR7A 1ZNQO 3HWRA 4B7CA 1HWYA 3FPLA 1PJ2A 2IYOA 1UUFA 3JSAA 1GFSA 4GKVA 3UCEA 4CM9D 3DXFA 3IUSA 1ZMOA 4B4OA 4YYZA 3TPCA 4EZBA 1HE5A 4JCOA 1N92A 3ZV6A 5EQDA 1K5HA 4YRAA 5EQFA 1MFZA 3WJ7A 3C1TA 4DPLA 1EUZA 4RVDA 3ETEA 2Z95A 4CLXA 4KWHA 1HLDA 4ND5A 1P31A 2CF6A 4G65A 4PG7A 3VVCA 3KEOA 4I5FA 5FEUA 3GDOA 4INAA 2WWRA 3FBTA 2PH5A 3CKYA 4XR9A 4D44A 4DLLA 4IZIA 3GOHA 3M1LA 1M67A 4JJFA 1GPJA 4MVJE 7MDHA 3WIDA 3RU7A 1VJTA 4FFLA 3RUHA 2IODA 3KLMX 4BNKA 1PGJA 1GQYA 5C7LO 4FGSA 2FSVA 3K92A 3DOJA 4LK3A 3JQFC 1QR6A 3ZW9A 1UP7A 4U6QA 5DBGA 1T2AA 3QLJA 1MG0A 3ITKA 3TWOA 5A9TA 1VJ0A 4ZQEA 3VH1A 4BNZA 3RUEA 4IM7A 1R16A 2VRCD 4BNMA 4UEJA 5CP8A 3BYZA 1SCUA 2W98A 2Y67A 5KKAA 3GNTA 3NYWA 2FY8A 1YL5A 3GAFA 3GFBA 3V2HA 4W9NC 4IMPA 4URFA 3G17A 3ZGYA 3HFGA 4CLDA 4R16A 2P68A 3AUSA 1X1TA 1A72A 4A26A 2O50A 3AU9A 4RDIA 4Q3BA 4CUKA 1I30A 1DRUA 4D41A 4XRGA 1VJ1A 1E3JA 2WSBA 4Z9FA 2ZYGA 4XGKA 4QFDA 1A5ZA 4GLOA 4I9UA 5T5QA 5A5EA 4UVHA 4RPJA 1GD1O 1NQTA 3W8FA 4FFRA 1UP4A 3KV3O 4ZN6A 4Q9NA 1H94A 1LJ8A 1M76A 5I9MA 4JX8A 1PS9A 1ZJYA 4RL6A 5A05A 3GLQA 1HYEA 3HSKA 1WNTA 5TX7A 1ZIDA 3MWDB 4OXYA 5CDSA 2VOJA 1NXQA 1RM0A 1E7MA 5FI3A 3EZLA 5TC4A 2BFMA 1DLJA 1LI4A 3RU9A 4AVYA 5BSHA 1TT5B 1K6JA 4OMUA 3GRPA 2Z1NA 1BG6A 1KY5A 4NFSA 3GR6A 4QO8A 1U8XX 3MOGA 3NT2A 1SB8A 4PLHA 1QLHA 2X8LA 1KEVA 3NRCA 1YOVA 1D3AA 4IDBA 3AUTA 4JBGA 3ZWWA 3FR8A 1NQAO 1HLPA 3DTYA 3NTOA 4RF4A 3AOEC 1PZGA 1YRLA 4BNJA 3HB4X 3PEFA 5IN4A 1Y9EA 2WEKA 1BHSA 4XDYA 4P4GA 5DOZA 2AQKA 4KTTE 4DTIA 1ZH8A 2FR0A 4J1NA 3VTFA 3H9GA 3LSYA 2CD9A 4GX0A 1QMGA 2Q50A 1KVUA 1Y8QA 1ZSNA 1PZHA 1TEHA 1K6XA 3DL2A 3GG2A 3GEMA 4WCFB 3DWFA 1DJQA 5C3MA 5C7IO 3MEQA 3DBRB 4R5HA 3PWSA 2HAEA 1MFPA 3PZRA 3B1JA 4GLLA 4B4UA 2YFQA 4Z6KA 1DLIA 1KVRA 1JKIA 1OC2A 4BIIA 4NJMA 1I2ZA 3IKTA 3I9LA 4RV9A 2Y1GA 2GYYA 1DFGA 1RYDA 4YR9A 4CV1A 4IGFA 3ZHBA 4E6PA 3U9LA 4HFJA 4ZQBA 4Z0TA 3F5QA 3NKLA 3UH1A 2PD6A 3G49A 2XAAA 3PLRA 2EG9A 2FPIA 2NACA 4CMIB 2DTDA 4OKIA 3DAPA 5EL0A 2X0IA 3LLSA 4AFNA 4EI2A 1YB1A 4PLTA 1C1DB 5H82A 3K2EA 5C7OO 2J5KA 3DR3A 2YUTA 3L0DA 4CQMA 3KYBA 1E6WA 4QXMA 1A9ZA 2QQ5A 3L77A 1V6AA 1HE3A 1HDRA 1NAHA 1PQPA 2RCYA 2VYND 2Y1CA 4CL3A 1VM6A 1WW8A 3EVNA 9LDTA 4S1VA 3IMFA 4GX1A 1K89A 2I66A 1LQUA 1JVBA 4ALLA 5JO0A 1U7HA 4TRMA 2R2GA 2HKIA 4CM3A 2W90A 3P5SA 1KY4A 1O6ZA 3PJEA 6ADHA 2V6BA 3HNPA 1O95A 3BTOA 2OUIA 4FOOA 1T25A 2AE2A 4Y9DA 3WICA 4L0QA 3S2GA 3LYLA 4UVDA 4OHUA 3FTNA 2NU8A 3WGQA 3I9KA 4EGFA 1HETA 4NR0A 1FDVA 4EW6A 3CINA 1BDMA 2Q45A 4IDEA 3C7AA 5H83A 3AI1A 4CM4B 3Q1LA 4GQAA 4NDNE 3OETA 3HDHA 3ZHYA 5FI5A 2J3HA 1DFHA 3V1YA 1C3VA 1EFKA 3E5RA 3NAQA 4OAQA 4M49A 3SEFA 1DHRA 1Z82A 2VYNA 1T2CA 4O0LA 2FRDA 3PGXA 1GV0A 2WYUA 3GN1A 4BO0A 3AUAA 3U49A 4IJKA 1YXMA 5HS4A 1QKIA 1D1SA 2EXXA 4I5GA 1MXFA 1PU2A 1B3BA 3PTZA 2VWQA 2IDZA 3MJ4A 4BKOA 1Z6ZA 3DDNA 1GEGA 3QVOA 4YJFB 1U3VA 2IXBA 4XB1A 1DIGA 4O6VA 3H3JA 4RQUA 4NMHA 3KUXA 5IZCC 2DT5A 1HDZA 3VPHA 4YJFA 5JY6A 1Q2XA 2X0RA 3I1JA 5JAMA 4CQMD 3DZFA 3GNQA 4JBIA 1P33A 1ORRA 1GCUA 2DBZA 2Y0EA 1L7DA 4ONEA 4AJJA 1KERA 4F45A 4PRLA 1LDNA 2VYVD 1A71A 3ETGA 4TRJA 4AJ1A 1VKOA 1DC5A 4WE3A 2QRJA 1UJMA 1D8AA 1LSOA 4Z9YA 4GMGA 1BXZA 5G0VA 3HHPA 2B4TO 3CIFA 3WLEA 4CLEA 3RI3A 3TFOA 3U09A 1EEHA 5F21A 4M8SA 1AUPA 4ZJUA 1ULUA 1JQBA 4YBZA 4IXTA 2GN8A 3E03A 1WMBA 3D3EA 3VC7A 3ZI0A 1EK5A 1XIVA 2GD1O 3JYOA 4CV3A 3OM9A 1QV6A 4JROA 1HYGA 2J8ZA 3D5TA 3OQBA 3V2GA 3NTQA 5U9CA 4MKXA 2GN9A 2YV3A 4F6CA 5L45A 5JAQA 5C37A 2EEZA 3BTVA 4CM7A 1I3KA 4HUJA 2I99A 3WNQA 2DTEA 4JP2A 4BV8A 3WSWA 3B1FA 4FFMA 1LDYA 4GPD1 4NIMA 3U3XA 2Y0DA 3RUIA 4UEOA 4HP8A 2OP0A 2GSDA 4MP3A 2DM6A 2WD7A 3UN1A 4OKNA 5IDWA 3GPDG 5ITVA 3CTMA 5KJEA 3JQFA 1EUCA 1UP6A 4IY1A 2HJRA 2I9PA 3FN4A 4B3HA 5I7FA 1J49A 2AQHA 1T1SA 5DULA 1U5CA 1DBVO 2J5RA 3DMTC 2HMUA 1H0KA 3ASVA 3WFIA 3GMSA 4PGFA 3QY9A 5DZSA 5IF3A 3BMOA 4DMMA 1XWFA 2QYTA 3ZU4A 4IQ0A 4LGVA 1Y5RA 3TZKA 4AJ4A 5KVVA 2XXJA 4N5MA 5JAIA 1N2SA 4ZHSA 4GVLA 2DUWA 5LC1A 1UDCA 4J2HA 1RYEA 2BRUA 3SXPA 5JCJD 1N9GB 1PZFA 3DFZA 1E5LA 5EIOA 4BV9A 2BD0A 5A1TA 1JN0A 3LF1A 3GA0A 1RM5A 1VL0A 5EMHA 5T8KA 3H3FA 1HL3A 3C85A 3JQ6A 4OSPA 1F8GA 1LXCA 2J6IA 3WFJA 5CG2A 4H16A 2BH9A 4BGIA 4RCVA 3HZZA 5TSDA 3ZWXA 4TVBA 3GZNA 3NT5A 1WDLA 3JYNA 4LMPA 4YACA 1AXEA 1BSVA 3HG7A 4YWJA 2FN7A 4RPHA 2X1HA 3GPIA 1LLUA 1GV1A 4D3DA 5L40A 2GDZA 5KCZA 2BGLA 1NHGA 3D0OA 4WNIA 1ADFA 1AGNA 4U7WA 2HRZA 3K9QO 2H1SA 4F46A 1YBMA 1SB9A 1DRWA 1FDSA 4UUPA 4YJHA 3TQHA 2GGSA 1EZ4A 2CNBA 4O5OA 1MC5A 3WG9A 5JMWA 5JYEA 1CQIA 4XJSA 1U28A 2JCXA 3NTRA 3LT2A 1ISMA 2FMUA 2DAPA 3S8MA 4Q39A 2OHXA 4DQXA 1C0PA 5ICMA 1WPQA 2CDCA 3RKRA 1PJLA 3PYMA 3ONFA 3P19A 4WLFA 3P2OA 1IUKA 1YS4A 4MIYA 1TT5A 4IGEA 1YL6A 3A1NA 4EEXA 1PS0A 2V65A 1C0LA 1C1DA 3PI7A 3SLGA 4CMBA 4CR7A 2H63A 3H8VA 4K6CA 3WR5A 1PJSA 4DMLA 3AUUA 4PLZA 1JLLA 4E4YA 4R4JA 4Z0PA 1LDBA 3ST7A 4BO7A 5I9NA 5BNFA 2HRBA 3GH3A 3SVTA 3QWAA 3S1LA 2BFAA 2IXAA 1YJQA 1J5PA 2QHXA 2DVMA 3I4CA 1W6UA 3VPXA 2CVZA 1U3TA 3ITDA 4CLOB 4OJNA 4DIFA 5COQA 3AJRA 3TFQA 4DQVA 4Z0HO 3WTBA 2ZTUA 2ZK7A 4A0SA 4XEHA 2NTJA 2Q99A 1P1RA 1X1EA 1E3WB 5L7WA 2YJZA 1LSSA 4CMAA 4Y6SA 3HDYA 3PLNA 5TJHA 2V7PA 4WCDA 1ZO8A 2X5JO 2YYYA 4MKZA 4QECA 1GR0A 5A06A 3ZN2A 2NLOA 4ILKA 1I10A 2P9EA 3MTJA 1W73A 3A4VA 3GEDA 3OF2A 4NK4A 3VHRA 3ONDA 3FI9A 4FPXA 4E2YA 2H6EA 2BFPA 4CM8B 1IB6A 2HO5A 2RIRA 3RC2A 3LT0A 5CEEA 2Q2VA 3TNLA 5IZ4A 3F1KA 5G4KB 4QQRA 2F00A 4FFPA 3EC7A 3N74A 5JDIC 3LT4A 1MXHA 4Q3DA 2O3RA 2D3TA 1IZ0A 5IDYA 3FCOA 1KVTA 1R4MB 5BNIA 4CM5A 3H2ZA 2NTVA 1VC2A 4WGGA 5AXBA 3Q0EA 1E7SA 1P0FA 5L51A 4DXHA 3G3EA 3OIFA 3I5MA 4RF2A 1YGYA 1EDZA 3V2UA 1I8TA 1NX6A 3DOOA 2DFVA 4L9RA 3GVCA 3GVIA 3DHEA 1E1LA 3Q2KA 2E37A 2JCYA 4M1QA 2PH3A 3GVHA 2JD0A 4KQXA 2POQX 1SEPA 4RVGA 4I8XA 1R37A 4GKBA 3INTA 5A5FA 4EJMA 1G1AA 2D5AA 1CWUA 4H3VA 2PD4A 3DBRA 1EQ2A 2YY7A 2GASA 4QO7A 3KOUA 2BELA 1N1GA 1O0SA 4LVCA 1M66A 4EUEA 3AOGA 4NG5A 4ALKA 2AQ8A 2VHYA 3QIVA 4TRNA 1H6DA 2RAFA 4YCAA 1ZK3A 3UICA 3ZNOA 3PQDA 4ZGWA 1LC3A 5F1PA 5EINA 3CPSA 2HSDA 4GVXA 2HQ1A 5K6AA 2LDBA 5GMOA 4XKJA 3QRWA 3VKUA 5CDGA 1YB4A 2I67A 1E1KA 4BNTA 3ZWYA 1MLDA 3ON5A 3FF4A 1NQOA 2PKRA 3AK4A 4TMFA 4WOKA 3L9XA 3OQ6A 2GZ2A 2C5EA 2IRWA 3BMQB 1Y7TA 1YOVB 4DIBA 1PZEA 3D64A 3KYDA 3WTCA 3K8ZA 5JE8A 3JYLA 3W1VA 3PRJA 4W82A 2BI7A 2WTBA 5TQVA 3PHLA 1ZXLA 3BMNB 3ETDA 3HDQA 3PHGA 3T7EA 3KYCA 3ZV4A 3ZU3A 1H2BA 4YT4A 5MGBA 1P45A 1YKFA 2JFGA 3MJVA 1U8FO 2UDPA 4FD3A 2B5VA 3JD1A 1XA0A 3L4BA 2VWHA 1LA2A 2QIOA 1HTBA 1EMDA 3FSRA 4W6ZA 5A9RA 3O8QA 1XDWA 4YJHB 1NFFA 4IJUA 3CZMA 4OH1A 2HCTA 5L3ZA 2VTDA 4JN6B 3WGZA 4CMCA 3GFGA 5AYVA 4W7IA 4HX5A 4J7CA 2RBEA 1DIAA 4BL5A 5LDGA 4E2ZA 1PTJA 4MVJD 5ILOA 3WJAA 5TNXA 3EZYA 3PHHA 1R0SA 3L4BC 4LRTB 1SPXA 3C3XA 2CF5A 4J7XA 4F3YA 5AXDA 4TZKA 3LC7O 4B4VA 1WAMA 4CMJA 4W4TA 4FIZA 2DFDA 1HT0A 2X0JA 2NVWA 1WDKA 3KB6A 1YO6A 3H5RA 1CF2O 4ZU3A 5ILGA 5J23A 1X0XA 2HJSA 4J49A 3DBLA 3QHAA 1A7AA 5CPFA 3IIEA 1PQUA 2O7QA 4HV4A 2Q4EA 3DZKA 1DHTA 4Y6RA 3KVOA 4BO6A 4HNHA 4WECA 1E0DA 3O03A 4OOEA 5KKCA 3FR7A 3QV1A 3PJDA 5KVQA 4NH4A 5TJ9A 4GH5A 1ZKMA 1P1KA 2D4AA 4RF5A 4CUJA 4CMGA 3HUDA 3F1LA 1NP3A 4M89A 5DCUA 1GAEO 1I3LA 1LTHR 2YDXA 3MCVA 3OICA 2X9NA 1XCBA 1N7HA 2NU9A 2A35A 2UAGA 3PWKA 3FTPA 3H5NA 3X2FA 3F4BA 1KC3A 1RM4A 4ND3A 4DPMA 1NNUA 2R00A 1X15A 1TT7A 2G5CA 4MVJM 3SBOA 4B3IA 1GADO 1N7GA 2WD7B 4BKQA 2IE0A 1CJCA 4YT2A 4MIOA 1L1FA 2E82A 2O3TA 5L53A 3VZPA 1ENPA 1OZAA 1E3IA 3IP3A 2Q1UA 4FW8A 4D3FA 5GZ1A 3C8MA 4CM6A 4WLUA 2VUTA 2Y1EA 3GK3A 4BNHA 3KSZO 4KWIA 3ZW8A 1C1XA 4PFJA 4E30A 3JQ7A 4J9VA
chains in the Genus database with same CATH superfamily
4N9WA 1LBEA 1QIFA 1GQFA 5JSFA 1QAMA 2ZBFA 1WPGA 3WDMA 4CQJA 1CPYA 5KJ6A 3PD7A 4OQZA 2BFOA 4KO3S 4RW0A 2ZWOA 4HSEA 5JEEA 3H4TA 3KOMA 2EJCA 4PLGA 4IGIA 1DEHA 1L2TA 3TZLA 5KVSA 2IEDA 5HM8A 4E15A 1JHOA 4XOUA 1YZYA 2HDOA 3U7GA 3QEMB 4GVPA 1CUBA 1E2LA 2IF0A 3I5XA 3DV0B 1D9ZA 1I01A 1M2VA 1DUSA 2V4ZA 2IXDA 4WI1A 1HKHA 2OYRA 3KKQA 3OTWA 2A0YA 1N75A 5DW0A 1YDWA 1P9WA 3NHJA 2FK8A 3CVUA 4OQNA 4I81A 4NECA 1KPGA 2X4GA 4BKPA 3MXTA 2QVZX 2VJCA 3A8TA 1DOHA 1FXSA 2Y2VA 2HU2A 4DLNA 1RLOA 1XKXA 4PPNA 2R7NA 5TEVA 1K27A 3IR7A 3WKDA 3EYWA 1GUFA 5JI3E 1WEKA 5I3CA 1U28C 2G76A 1NVDA 1F12A 2GM3A 3RRFA 3PJFA 3STWA 3KQKA 3VPGA 3G8BA 1Y1TA 1NZFA 4UNSA 1QSGA 4IOMA 4N76A 1JAXA 4B8ZA 4PLFA 4H4EA 3HWSA 4V0KA 4KDRA 4LHXA 3HKCA 3VDQA 2ECOA 1HT1E 3RAEC 1UODA 4ROTA 2MSCB 2R65A 3DOCA 4FI3F 4OATA 4E11A 3H9UA 3MJEA 4EQ6B 1RXIA 3PU6A 1G8MA 2WUGA 3ZWDA 3FTFA 3COZA 3CUWA 3LGSA 2WUVA 4YWHA 5HBRA 2J67A 4K6MA 1JVNA 3D2AA 1GU7A 1R0WA 2BC9A 3C45A 1XWIA 2AKYA 3H97A 3KB1A 5D5HA 3OPNA 5EQTA 4BQRA 2D2VA 8AT1A 2CHGA 4GYKA 1B3RA 1MJGM 1RAFA 3TBFA 4WBNB 1RRCA 3I8XA 2QW8A 3IMGA 1SXGA 5LA6B 1DCMA 3BHMA 2VK8A 3PFKA 2QJWA 1J4AA 1H1LA 3OIUA 2NPFA 4IRXA 4KI7A 4MVJG 2J7KA 3VYVA 4YAOA 2PUHA 3F74A 4J3NA 1MEJA 1RVDA 3IAS1 1KEWA 2KWIA 3ZZ1A 1YU9A 4UATA 3IEVA 4CTJA 3IUQA 1AKYA 1V3VA 1B14A 3ZLBA 5C18A 2IU4A 2G1UA 2AW5A 3BJIC 2R44A 4C0LA 4NOLA 2VBIA 1Z8NA 3W8RA 4HNRA 4WDQA 4V0NA 4BN0A 3H4IA 3UA4A 4D9GA 3E9MA 1XTJA 4BO8A 3N0RA 4ERNA 1YUNA 4HH0A 4R1LA 5JNLA 1NPTO 2NQTA 1BIFA 3GP5A 4WFKA 3AHGA 2L42A 4NARA 4DQKA 1DO8A 1Z6GA 3KVYA 1T1EA 2REQA 1HM5A 1XNQB 1YVRA 4JKIA 4J4TA 3IHWA 2X5XA 5CXSA 1W30A 3IDOA 5CYOA 5LQSA 3TR0A 2VHQA 4DC9A 3EQ7A 2PM8A 3MJSA 1F9EA 3TZBA 1O4VA 1GJRA 2VTEA 4ALMA 4K0RA 1Q1EA 5C7YA 2BEVA 1SMKA 1M1ZA 4BB0A 5EWMB 2OGZA 4YFYA 2C7VA 4HJRA 5MDHA 2OECA 3H2IA 1M2OA 3GCDA 2PFGA 3MF4A 1R8QA 2XUIA 2O0KA 5TLSA 4KN9S 4RVFA 5KTMA 3WHLA 2BOVA 4PO8A 1H6AA 2QD1A 4OB7A 4UREA 1K2WA 4GC5A 1G41A 1N8NA 4BX8A 5EC8A 5TRTA 3ZDAA 2XCOA 4HN2A 4PGMA 721PA 1KSHA 1YD7A 4MPDA 1T6YA 4WAUA 1PBTA 1W47A 1FU8A 1F8YA 3DWGA 1PR9A 1TQ8A 1X38A 2X3UA 3NIGB 3BIXA 3OJ0A 4QWMA 1XV5A 3AKYA 3LUPA 3Q3VA 1H9AA 1QS0B 1RHUA 3DMTA 5AI9A 2J9FB 4RK0A 4M37A 3WK4A 1XJQA 1I4OA 2XT6A 2XZLA 4FHCA 4V02A 2EWWA 5CB4B 2PY6A 3LLUA 1ZAKA 1AMOA 5C35A 1CULC 4J90A 5LP6A 2OWEA 1LX6A 2OMEA 1A76A 5IM5A 3V46A 3G0CA 4CIYA 4IIFA 4N18A 3F7MA 4KCGA 2HMWA 3VO8A 1DWOA 4WLOA 1NUTA 2OCXA 3QX8A 3R09A 1MR3F 3G7UA 4BATA 2A8YA 4P3XA 2FW1A 1KDZA 4D8XA 2JLZA 1SNYA 3WXBA 4KAXA 5E8RA 5IT5A 2GXAA 2JLSA 1WTAA 4FGKA 4B3MB 2OHHA 3VHLB 3PFFA 3V8PA 2V3CC 1T8SA 5A0FA 1RJFA 2AC2A 2WAOA 3HLTA 2EZ8A 5IDQA 2M32A 2WKRA 3TQRA 2BDEA 1TUEA 3FOCA 3FOFC 3ILYA 2HN9A 3BL8A 3IBSA 4Q7KA 4LV5B 3P0HA 3L1KA 3FTEA 3G9UA 3H18A 3ZHOA 3FPAA 4AJOA 2WSIA 5ERYA 4EVIA 4GE3A 2WMOB 2AXPA 2XITA 3K72B 1SHLA 3KZ1E 4GOMD 4UTZA 3CONA 2TMKA 4ED9A 3CXRA 3S1AB 3D1JA 5JO9A 3ZI4A 2NO4A 3OEED 4OHVA 5LZ5A 3LBNA 5HF8A 2E3JA 1I7LA 2XB6A 1IDOA 1DJOA 1HMYA 1L5FA 4BYMA 4WV3A 1MF7A 3NUGA 4NEHB 4A5OA 2DKFA 1GNVA 1KK2A 3OESA 4S24A 4BVJA 1U3FA 1JI0A 1HSOA 1XRJA 3G8CA 5EPUA 2BWJA 1NVAA 3WMXA 4EHAA 1FK8A 2F3UA 2WF7A 3L6UA 2H1CA 3BMQA 1RI3A 5HIJA 3TLGB 3AEQA 1ZGJA 1PAUA 2XVMA 1XJ5A 1W85B 4RGYA 1EZZA 1W0JA 3P45A 1JLRA 2OAQ1 3T9EA 4HNVA 2EBWA 3GFRA 1ECCA 4NK5A 2GBPA 4FQ5A 3QNWA 2WWFA 1E9CA 4L8FA 3RJ9A 1OXBB 2RK4A 4ZVTA 1DB3A 1JDVA 3Q8LA 1Y7PA 1SA0A 3EMVA 3ABIA 1EK6A 2WJIA 2XNJA 3EGEA 3M4ZA 1UDAA 4D9BA 5J3JA 3IV6A 2I0FA 4K2AA 1Z5VA 3Q3GE 1X0VA 4CU2A 3RJ5A 3WLAA 2ZJFA 1DKRA 3PL1A 4AYXA 2W70A 1E6UA 1EGVB 1AV6A 4RKWA 2QK4A 4ARSA 2JFNA 3F6CA 4GXQA 1HOXA 4QAQA 3JALA 1CQZA 5E2AA 4XSVA 5C8YB 1XNHA 3MMPA 3G5LA 2F6RA 3OTIA 3UWKA 5F4BA 5HPYB 3JYHA 3LZ6A 3ZDRA 1Y6ZA 4GR5A 3Q11A 3DCJA 4BNNA 5E1OA 4MQEA 4WLEA 1YMUA 3AFIA 1A9OA 1S2NA 2IHJA 4K8OA 4XFKA 1HA3A 4KODA 1NJ8A 1NNI1 4RTRA 1TC1A 5ESWA 1VECA 2P69A 3S2ZA 5JHHB 2JAQA 3MGBA 3IJEB 3V4PB 3W5IA 4NCBA 1Z5GA 3NT4A 1DEXA 3L7CA 1I14A 1XX6A 2IXFA 4HEA6 3GBSA 5EUMA 1DELA 3RBXA 4IFTA 1R3DA 4PG5A 4RVNA 1DTWA 4YQZA 3DDUA 1UFQA 2A3NA 3UKOA 3VNUA 1EP1B 4JI2B 3RIHA 4GG1A 4ZC1A 2C0PA 2K7ZA 3NJ4A 4NBTA 1ZG3A 3BHJA 3QEOA 5G53C 3VR6D 3H84A 4NMMA 4MHOA 5EESA 4TWZA 2Y0BA 5EVCA 2YIJA 4REQB 2QE7A 5BORA 4UU8A 1U7TA 3AHCA 2AFHE 3I2HA 3KLNA 3MILA 2TS1A 3KOYA 2EDAA 1DC7A 4ZOLA 4B9AA 1ZFNA 2FPUA 3S7ZA 3H11B 2WYVA 4TL7A 4K9PA 4JQCA 4ZWNA 2YVUA 3C7CB 3DVQX 4M4SA 5DEOA 1SKYE 1R64A 3EIUA 5T3YA 1RXVA 5DHSA 1I0LA 1CUJA 2H5LA 1L7AA 5AJVB 5ECGC 4MUBA 2PVSA 3GJXC 1XTBA 3UG7A 1NAIA 5JXHA 3ZR4B 4EDHA 3T7CA 2D2IA 1UWVA 2E1PA 4KW7A 4TLEA 4BQQA 5LVAA 1VE7A 1LEHA 1SQSA 3G8DA 2OCGA 4G5YA 4N7MA 3RYIA 4KFUA 1T8YA 2I3GA 4M9QA 4ZOLB 5DLQC 4CTOA 4Z8XA 4HQFA 5MN6A 1RM3A 3DYIA 3PDIB 4JBNA 3UT0A 3RSSA 1Z4KA 1YI0A 4PCUA 1YJAA 3JQCA 2H31A 4R7TA 3K5PA 5FA6A 1RAHA 2J3KA 2WKPA 3A37A 4H7FA 4D3ZA 1Z4LA 2OB2A 5EXPA 4E0BA 1POXA 5T57A 3AI3A 4Q7MB 3AEUA 3ASYA 4V1CI 2QQGA 2JRCA 3JQ7B 4MKRA 4QXOA 4BZPA 4B3JA 5KSOA 1M33A 2IW1A 3EUWA 4TQGA 2Z98A 2Z3WA 2Q41A 3H9EO 5THKA 4EB6B 5HDQA 3L6CA 1Y34E 1DU4A 1EK1A 1KR2A 3BA6A 1I2AA 4QBHA 3X1MA 1ACJA 1GITA 3NWJA 3IT3A 4RUKA 4B6PA 3I01M 2HYIC 5FNVF 3WC4A 2OK7A 1EFVA 4P3PA 1CUHA 1H23A 2UYCA 3TL2A 1UC5B 5TE9A 5K4AA 4DYDA 3DEKA 1VYTA 1KYQA 2BFFA 2V58A 4MOWA 1PO7A 4JLPA 2P5SA 1FY2A 1X13A 2QU7A 3HV2A 3R5FA 4KXXA 2J3IA 3RYFA 1O9BA 4BHTA 3O74A 4ESHA 4FN4A 4YTEA 4GLJA 3RC1A 3TAUA 2GKOA 1K7XB 3PRYA 4YI3A 1QHXA 2EFYA 4YN3A 4V03A 3T3PB 4MWGA 3M82A 2EYQA 4U6SA 1KQ3A 4YT5A 4GI1A 5AQ1A 1TQDA 3JQDA 5HEKA 3RRYA 3UMCA 1JX6A 5JXWA 1KO4A 2PH7A 3S28A 5CJPA 3LRPA 3A1TA 5HFAA 2H4WA 3PQEA 1NBMD 2Q5FA 5TPWA 4NFYA 4KDEA 4YMWA 3GCWA 2DYKA 3WQBA 4TLLB 4IQ8A 4QTXA 2WHEA 3C6BA 4C6TA 3QBEA 1VHQA 2Q6LA 2XF2A 2YWDA 1UK7A 3DULA 4OQYA 4QOIA 2V7TA 2GSWA 4KG7A 1OTHA 2I34A 5DHFA 1RWQA 2GNPA 3E3LA 4LCJA 3P0JA 3G5UA 2IUUA 2DFTA 3JW8A 3GEBA 4AJ9A 4DA6A 2QMYA 1KZ7B 1VJ5A 2YV1A 2GZ3A 2R96A 3BE4A 4JXKA 1T0HB 4CM9A 1JG1A 5DW3A 1VBNA 2OCKA 1BO6A 2AOWA 2ZR9A 4QFMA 4LIPD 1ZVQA 3RS9A 5KKNB 2I3AA 5DTIA 1WQ3A 2GERA 3D8NA 3GIDA 4F5ZA 3A05A 5GY7A 4M22A 1OPRA 5ES3A 3AY7A 4FE4A 1N34B 1RAGA 4K1LA 1N2GA 5CX1B 5DFAA 2GNAA 2DSNA 2F17A 5I5GA 3N58A 4BNDA 4CF4A 1XKQA 1W29A 2JPDA 2QM8A 3A6JA 3G0GA 1G6OA 4N6OA 3SR0A 3I0NA 3ZPXA 3K0CA 3LQ4A 3M4NA 3CH7A 3N0TA 1TFUA 4NZ9A 4WA8A 2C8KA 4ETNA 3COJA 2B3DA 2C3UA 3PR3A 1E94E 3IQZA 1CLEA 1A9QA 3Q9NA 3OQ1A 2QPOA 2ZJYA 4FOLA 3V8VA 4OP2A 4EGSA 4QQNA 4Z4IA 4UULA 3NNDA 6CHYA 4RKEA 4N8EA 3VDRA 4M53A 4QDJA 4HDAA 1VFNA 2C4UA 2PT6A 3R1IA 2ON6A 2AJDA 3QTBA 1OLXB 4M9XA 1YR8A 1QGZA 3GVPA 3LX8A 4HLQB 3U7JA 2Q5OA 3HLKA 1N6KA 3KQWA 2G9ZA 3LUKA 3UMFA 4DXDA 4GNKA 4LBVA 2H4FA 3LCVB 4Q7LA 2QU8A 2GF0A 2KLHA 5KX5F 2XQVA 5ED0A 5BNZA 2Y6VA 3TLAA 1A69A 3IOMA 1X8XA 3FA2A 3WSVA 4ZT7A 1NMZA 1QVWA 3KKLA 4KXVA 1OFIA 3HKBA 1P72A 2Y77A 4HYEA 1M75A 4NENB 3OEHD 3QM1A 4LUCA 1QQ6A 1HGXA 4RXMA 2QTTA 3Q7QA 3WL7A 3ETCA 4AJNA 4I4NA 1MJFA 4P0QB 5JS2A 2R4UA 3L8DA 3NDIA 1E4YA 1PFGA 2ZKLA 3HU1A 2MJLA 2P77A 3D3KA 2C2XA 2PEYA 3OFSA 4JP8A 2BW0A 2AF3C 4JJEA 4NF2A 5CIQA 1EZ1A 2R00C 4I66A 4P2BA 2HF2A 5K0JA 1M2OB 1ZJ4A 3ZHCA 4A15A 4GBJA 2B1QA 2TECE 2P8SA 4X8HA 5F1OA 2YWJA 2EKZA 4DLKA 1EFPA 4Q6WA 4CPDA 2ODBA 1GN8A 5JMPA 4HTFA 4UDYX 4XRRA 2FU5C 4MWZA 3DLPX 4O2AA 1IY8A 1GTMA 5T67A 2HJHA 3BK1A 3DEHA 2A1TR 3H7AA 3ES9A 4PTLA 3LSTA 1J8YF 4ZEWA 4CLRB 3GQVA 2NNWB 2ZAOA 1PT7A 3AERA 1E64A 2ADMA 4I55F 4MI9A 5TVGA 2Q9CA 4EPTA 3C5WP 4V0OA 4BEVA 2I6SA 2Z2JA 3T9BA 4ATNA 5A3SA 1ACMA 2PR7A 2W48A 2Q3EA 1QYVA 3HSYA 3PC8C 3DMHA 3R0IA 4Y1FA 1GG2A 5DT9A 3CUTA 4OGFA 3RDPA 3LU1A 1SBCA 2XOKA 2EEPA 4D81A 5KX5B 1QZZA 5ENDA 3WGOA 4AXXA 4NV0A 4Z4EA 1LD3A 1ORVA 4KO1S 4DIEA 4EYEA 2WE8A 3MIZA 4X85A 3W5JA 1UT5A 4GT1A 2OCPA 1UT6A 4RDHA 3SC2A 9GPBA 5KYXB 4JVNA 5J2UF 3CPHA 4D8WA 5L9AA 1RHKA 1ZC3A 1JXMA 2QL9A 3P4UA 1BJKA 1EXMA 1BXKA 1ZD9A 1TQHA 1A9XB 1ZBQA 1OIXA 1SCNE 2XUPA 1NW8A 1X8KA 1JA9A 2VHVA 3D8TA 3G7NA 3O2NA 3CF0A 2QRNA 3NDJA 2ZT5A 3RSGA 1YWGO 3WL3A 1F06A 4F8YA 4JMPA 1OB5A 2C61A 1Z08A 2QZZA 3SFZA 3QX9A 4KPFC 3NP9A 2I22A 3F49S 3GYGA 3V6MA 4J0EA 4PLYA 3JYQA 1VXOA 2GZ1A 1FUYB 1I3NA 1UZUA 2QTNA 1JIXA 4M1KA 4TMVA 4A6PA 1EXVA 2DY1A 1NM5A 3VV3A 3I32A 2FF5A 4RA6A 1WDTA 3EIOA 3MSCA 2B99A 1ONBA 3UPUA 1ABBA 1E4OA 1WB6A 3O4VA 3OEHA 5AKGA 1CJUC 3ANSA 1FRZA 2Q1WA 4N4AA 3K35A 4LSWA 2JD2A 4TTIA 3SX2A 1GPAA 2IYXA 1MRZA 4CT4B 4TKVA 1SD2A 4UPVA 1QFSA 1JYSA 1Z16A 2ZS7A 3N0XA 1ND5A 4CLHA 5HUQA 1OYVA 2XD4A 2YZ7A 2PDAA 3HWX1 3W5UA 1TI7A 4XJTA 3DZJA 3V32A 1HOTA 5CB8A 2KE5A 4C4XA 5DNVA 7ABPA 1E7RA 3TVDA 3ORFA 4JIGA 4QUJA 1R9MA 3CT4A 2ZUCA 4IIDA 3SZGA 2JFFA 3UXYA 2W8BA 1II8A 4PZEA 3LFHA 4ZI7F 4ZC8A 3T5MA 3GNSA 4ZYUA 2PPLA 4ND8B 1I4TD 1TAHA 1P4AA 3HABA 4P92A 3U7QA 4DA8A 1FBTA 3W6UA 5BVHB 4UVEA 1HI9A 2NZ8A 2ZKIA 2VEDA 4M1OA 3P26A 4KU4A 1FFGA 3IB3A 3MSXA 1OASA 2DC1A 3H8JA 3PSAA 1T9KA 2G40A 4LBYA 3DKRA 4TXMA 3L0BA 2H8GA 2HIHA 1T4GA 2JF0A 1CE8B 3RQSA 2GMWA 5FT9A 1PSZA 3TG2A 3ZLJA 4MYHA 1CHNA 1XMSA 2O2SA 3ZH2A 1YJ5A 3W90A 4F2WA 5KWJA 4L4YA 2IZZA 2IUEA 3PUIA 4K7JA 5JH7B 2AEMA 2AC7A 3CURA 4O4JA 4O2BF 3IAHA 3T15A 1HDGO 4R0NA 3DZGA 1EE9A 1GUZA 1N6LA 1U9ZA 2A92A 2NNLD 2R97A 1QJCA 2RI0A 3GJ6A 3ID6C 4R51A 4UMVA 1DNPA 2KPOA 5JHGB 1G8PA 2OO5A 2DUUA 4J07A 4XQ9A 4IVQA 1OZGA 5U1PA 1AKMA 4U9UA 3UHFA 4G85A 5CDUA 1W75A 3ICPA 4KO8A 4J4HA 2B4QA 4DLUA 2E4ZA 3NHPA 4NICA 3AO0B 4PG4A 4KR2A 5IXJA 4Q9JA 1QP7A 4U7TB 3TOSA 3LQFA 1IXZA 4DDKA 2LGJA 1WXQA 4K9MA 5D8DA 3PI6A 1U2GA 5KDOA 2LPMA 4PG6A 4PYLA 3NYQA 4URUR 5DCWA 4UTNA 5DX1A 3CZRA 3W8NA 1XZMA 1NJFA 4E5KA 4IR7A 5AK3A 3VKVA 1Z06A 1E9RA 2PBZA 1W36C 1CVRA 1AUOA 1RWOA 1QM5A 2ZJ0A 2EARA 2NSJA 2YH2A 3M3PA 4BJ3A 1Y80A 2AR7A 2ESRA 2O19A 4TPKA 2CV1A 2JLUA 2CBXA 2HNKA 4XCQA 4E5MA 2OGSA 3K0FA 5A3JA 1VKRA 1U9IC 1UM9B 5AK6A 2JLAA 4JL8A 1PI3A 5BW8A 3RC7A 3ZQUA 3K9LA 1A8HA 3QOFA 4KR0A 4Y6LA 1RRKA 2A58A 2VNAA 3H19A 2EP5A 3OM1A 3CWQA 2IXGA 2GN6A 2VOEA 1I4EB 3BE5A 4XYLA 2XCUA 1U7UA 4WA7A 1QLJA 2JGJA 4MHSA 2OM2A 4R2JA 1FJXA 4DLSA 1RZUA 3OIDA 3RUPA 3QBVA 5DK6A 1B8PA 2FJUA 2FP4B 4YRCA 2B78A 4BKRA 2ZIUB 4RYDA 1MG5A 3ZWKA 3AG6A 3PG5A 4G86A 4TYPA 2CMFA 3OZFA 3T7RA 2HMSA 1PG5A 1ZY2A 4DCMA 1E2MA 5JBIA 4GMDA 4ARCA 1TGYA 3V8MA 3FNQA 1LWOA 3GCGA 1TCVA 4Q00A 4DV5B 1JG3A 4RTPA 3E35A 1X7ZB 1KPHA 2H2WA 4BECA 1BHO1 2O07A 2ZYHA 2IU0A 1K2VN 3ZZ0A 1A9XA 3KOZA 5GONA 4LZJA 2QW0X 2HDHA 4MZXA 4HS9A 3NHRA 1SXJE 1CEXA 1DIRA 3HCPA 3IVAA 3IQDB 3WB9A 2W2LA 2YJ6A 4A1FA 1WD7A 3P32A 3SVZA 2V7UA 3IUBA 3O82A 1E99A 3QLUC 5DBOA 4CR8A 4YCLA 4L7VA 2ZJ1A 4O8CA 1FYFA 1ONOA 3O4GA 2VJPA 4BGEA 4IKOA 3R7AA 1IQRA 2EKPA 3GRAA 3ZHRA 5L4SA 2R8OA 2E87A 4HLUC 4X62B 1OIVA 2CXUA 2ZDQA 3BREA 1NU8A 3FUVA 3I9MA 4HVTA 2Y1KA 3WHIA 2X0FA 3CX3A 1XZ8A 3VR5H 3L7LA 3MMXA 1RPAA 3QUQA 1RE0A 1UFRA 3U1BA 1EVYA 3LCUA 1TJYA 4EYOA 3UHOA 2AZDA 1QO0A 3UMMA 4UE2A 1TPYA 4D45A 5DNCA 1NHWA 5A9SA 1Z6TA 1KJJA 1XAHA 3V3TA 2YR0A 5LMCA 2C9CA 1NQ5A 3AG5A 4K1XA 4RD0A 5K3CA 1EAYA 4M0PA 4X6YA 1OWOA 4UW9A 2IHZA 3GJ8A 2XZTA 4WNAA 2QM0A 2Z2XA 1XVTA 3TLXA 2O7VA 1EB9A 2CLDX 2WWIA 3CXUA 2A9JA 4UCWA 3AVWA 2VHXA 4HXYA 1CUEA 3U7FB 1DIBA 5KJ1A 3JWHA 4II3A 1PF7E 1NJ1A 3OLCX 1KMHA 3CRQA 2Y0CA 4GMKA 2I78A 5EHQA 5GADl 2PSJA 4CL0A 5LMNB 2V0CA 4TS3A 3CH5A 1L6IA 1XO1A 1BEUB 3HRHA 2QF7A 4J3FA 4V1CA 1BS1A 4LXTA 4JLKA 5DYTA 3LBYA 4F7DA 3A6KA 4OQMA 2RAUA 2XTJA 1VKHA 5EIXA 1QZTA 3TG8A 3GXOA 4TQAA 4RS4A 5KWEA 1ZIXA 1Z2CA 1OLXA 2LW7A 3O2SB 5AMXA 5EMMA 1OT5A 4LX0A 3VC3A 4DILA 3MD9A 2XHEA 4WESA 3C3WA 1SKUA 4MMXB 3SLRA 5CFZA 1E4VA 2CJFA 1GQOA 4MI3A 4DWWA 1M34A 1TB4A 2QJRA 2XB9A 4A03A 3OE7A 4F56A 3FOZA 4B75A 5ER9A 4NHEA 2FZVA 1NMQA 1NVTA 1WVGA 1Y1SA 2CLSA 2OOSA 3AESA 3FNHA 2VZ8A 3NOQA 1DUIA 4YQEA 4E88A 2H1IA 1KVSA 1XTTA 1J0EA 4AZ3B 1LFDB 3GDGA 3C8UA 4GOJA 1RJWA 4IXDA 3ER6A 1GRNA 3GEEA 3L6BA 4US0R 3JR7A 4JI3B 1NWCA 1CF4A 1P60A 3OP4A 2A3RA 4N7RA 4ETMA 1NN1A 2C9ZA 1UDBA 3ZYZA 1LLFA 2WUEA 2VWPA 1RLIA 1GA1A 3MWLA 3U19A 2I9KA 1BXGB 4JOBA 2R6GA 3CLVA 2ZIVB 3IEKA 3NFRA 3QUTA 1E3DA 1K88A 3SICE 4LDAA 2QTLA 2RHGB 3KQVA 2VO1A 2PMEA 2QBYA 5C80A 1PYOA 4O33A 4ZO6A 4GAEA 4P58A 4ISBA 2CE7A 1C29B 1WBJB 1K92A 3UB2A 4J16A 4DA4A 1V9LA 2WD8A 4M2LA 5C3UA 4XI9A 1X80B 2WUDA 4MA0A 1D0VA 3RVMA 2HH9A 1ZOOA 2RC5A 3KL2A 4MWTA 3TI9A 3IOCA 3P0IA 9ABPA 2Q5CA 3MCUA 3RG2A 3WDSA 4K26A 4CDRA 5JZSA 5K0FA 4YJGB 1ISJA 3UK2A 2LCFA 1VIDA 3KWMA 4QTYA 3UJNA 4JU8A 1QYWA 1LLCA 2E4AA 1Z7EA 3JR3A 1E0KA 1TECE 1WSAA 1ZH6A 4PXYA 3R0JA 3ZU6A 3IEMA 2ETXA 1DC3A 2P11A 1ZGCA 3C14C 2PJRA 1YQ9A 2WVJA 1KARA 1PT6A 2YXLA 4QGBA 1UXIA 4UFOA 3QBDA 1QOPB 3ANLA 4QXAA 2ZUUA 1C80A 1TKAA 1E8NA 2C94A 5KWSA 4LN1A 1BH6A 2Q4BA 2ZFUA 3WIVA 1MDBA 3CLKA 3K4PA 3OUUA 2UUOA 1LTQA 2R1ZA 2X5OA 4MPJA 4EUHA 5KYGA 2YHUA 2BKAA 2Z8ZA 3T5CA 5JDCA 2PUDA 4OMDA 5A7FA 1I3CA 4JQZA 3U3DA 1HNNA 5AVTA 4AIRA 3MGCA 3NDPA 2JAHA 1B15A 5EAIA 5B7QA 1EVKA 3INGA 4AQYB 2HA2A 3A9UA 3GFSA 3NAMA 1CQPA 1ZLYA 3GOQA 4BP8A 1NOKA 2DKNA 5H3HA 3EVGA 3LY9A 4TSRA 3I28A 3CJTA 2CHVA 3N75A 3K9FC 1A5AB 3A32A 3NW9A 5TT0A 3M4YA 1GUYA 1KMHB 2FPPB 4MO2A 5TPZA 4DIOA 1Z0UA 3ZXXA 3RREA 2PS9A 5A5VA 1SAYA 4LV8B 1P7WA 1MTOA 5I8ZA 3MINB 2DBQA 3PDIA 1M0EA 5E4FA 1SUAA 4P36A 2W58A 5I9SA 3O8QB 3IP6A 5J4VA 1SU6A 5AXCA 2CZGA 3KM0A 4PX3A 1W19A 5EXXA 2D0DA 2NZWA 1XB2A 4DIDA 2I55A 3BF7A 3CGWA 5JC1A 2O14A 3TJRA 1FMCA 1XOIA 2R1TB 1TYBE 1QCYA 1JDTA 2CXPA 1DBSA 2VYQA 3CMCO 3CUVA 2CNDA 4KAAA 3T5AA 3HO1A 3EXIB 1J0XO 1RC0A 4G4SP 3L84A 3OZSA 4HWOA 4B1FA 4YIHA 3TUJC 2C7OA 2ZYAA 3AIIA 2XQKA 1GRQA 1JSCA 3KJGA 1UDXA 1Z0DA 1UL1X 1CUGA 3KUUA 3NNNA 4QPJC 2MSWA 4Z1MD 2I65A 2ZE5A 1QYDA 3T9CA 5MN4A 3CLSC 1R2QA 1BMTA 1Z2DA 2P62A 1RQPA 3L8YA 5JZVA 4YP7A 2QZ9A 2I54A 2WZDA 4B76A 1KNXA 1T13A 3Q6IA 1MOPA 2XTAA 1MA0A 2HTEA 1OH5A 1T6BY 4V0RA 2P9CA 4NFHA 2QTCA 1TDJA 1HZJA 2ZJZA 1HE1C 2UZ1B 1XFDA 2FX5A 3ZCUA 2I7XA 4W7HA 4K28A 2J5QA 3F5SA 2JIMA 1GTZA 2C0CA 3FDXA 2HUNA 3GUVA 2X9VA 4OK3A 1WJGA 4MROA 3I9JA 4V39A 1EFRD 5D84A 4BVHA 1VXRA 2ZZMA 1AGYA 2XDYA 4KOAA 1Q0RA 4D42A 1Y9AA 1RQXA 4CUZA 1SOUA 1DQSA 1N5MA 1UEXC 2D8MA 4DGSA 5JV5A 1KU6A 1Q21A 1ONPA 2AG6A 4IJ5A 4PG8A 1AGRA 1SCUB 3DA8A 4R9NA 2GJ9A 3ZCVA 3PP8A 1K98A 1J1ZA 4JLBA 4TT8A 4WFIA 4XWOA 1NUPA 3N8NA 3WV4A 1G5HA 4HQLA 2AV6A 2HBZA 1GFZA 1MJGA 4J7AA 4R41A 2L69A 4WBNA 3ISJA 4CE6A 2IEYA 3I39X 4I6GA 2ZS8A 3FPHA 3JAWA 2QM7A 4JUFA 4P7BA 4F3NA 1Z6PA 3MWEB 4GOND 3IB6A 4QBIA 4UTOA 2XUJA 4G3XA 1RRVA 2QTBA 1EX6A 3OECA 4WNYA 5EHIA 3SJUA 2R8ZA 2ZT8A 5F76A 1CY0A 3R4VA 2CE2X 2EERA 4NQZA 4PGAA 5ICEA 1QPBA 3SKXA 3O7MA 2P2NA 1S96A 4R1TA 5C8VA 2PUGA 3BIOA 4LECA 5LJLA 4KXQA 2B4RO 2H2AA 1UDWA 5CBKA 3G0BA 3I3SR 2Q6VA 4FB4A 5H59A 1YL7A 3R7LA 1VSBA 1KYVA 4RO0A 1U8CB 2O2XA 3AEQB 2R60A 3TTWA 1KQPA 4BO3A 2XNCA 2AFIE 3GQBB 4FNGA 4YASA 4JYAB 3KYDB 4H4CA 4IS2A 1Z18A 4QDXA 4JP3A 1J0BA 3IA2A 3CJQA 3L7IA 4XQCA 4B83A 3JATB 1XALA 4CM8A 2IYLD 4U63A 3N3AC 4P32A 2P9JA 3AY6A 3RUDA 4XB6B 1QK3A 2FSUA 4HCJA 1OGIA 4LHEA 4QBGB 3G2KA 3TW4A 1AC5A 1MB3A 1RMYA 1CZLA 2V7BA 3HMQA 3NTVA 4HPWA 5HE8A 3WYEA 3I1YA 4PNEA 5A2GA 1MP0A 4RJIA 3R3ZA 4HADA 2VJDA 3ZIUA 5JJ5A 3MJTA 3Q3JB 5LOVF 3IIIA 1I1HA 2Z8XA 4NJMB 4PC7A 1XJWA 4FSHA 1DJPA 1SVKA 1T0UA 1I24A 3C3AA 2ONCA 4KL8S 2DHEA 4Q4DA 4KB5A 1VG1A 5K3DA 2ZBVA 4UFNA 4HGOA 3RFXA 1AA6A 4AKIA 1MZVA 1NN5A 3PIRA 1ONSA 3A9WA 3WRYC 3LFUA 1EFTA 3PQ2A 3QWHA 3GVXA 4HL6A 1GZDA 1TM1E 3QUCA 3UF0A 3VAAA 3DBIA 2ILVA 3V00A 1TXGA 2ZUVA 1QZXA 4HB0A 4FT4A 1JPVA 4EL0A 3DMNA 4K0KB 1U0FA 2FPOA 3ENZA 3OZCA 4K87A 5DXAA 1LSJA 1X87A 3UH0A 2GBLC 1O1YA 4DN6A 4M99A 4JSRA 3WNDA 1SZDA 1VG8A 1NDUA 3K53A 4Q4JA 3X2SA 3HE3A 4UVIA 5ULLA 1KO7A 5CM8B 2NUPA 2PR2A 3TNJA 3N70A 4RZIA 1W7AA 4NI5A 1VA5A 4L4ZA 3GMDA 1H8HA 2C57A 5DYNA 3V2IA 4FYHA 3UW3A 5KYKA 1GY8A 3GEHA 1KEKA 2XNHA 3PLAE 2PRSA 1ZL2A 3MOIA 3U60B 4NDZA 4BLRA 2XY4A 2ZCUA 3GRRA 4BMZA 3QPBA 4G1BA 3N9IA 4BS9A 4BPRA 2RGEA 2RHTA 1CQJB 1V8BA 1NULA 1VL6A 2FWNA 1A27A 4JUAA 3T0FA 4BQPA 1L1QA 3JPWA 3KC2A 3WQSB 2A7XA 3N3BC 3E8MA 3QMPA 4LJKA 1GGEA 3RGWS 4X24A 1D2RA 5IYZB 4QX6A 2IHKA 2VXBA 2X42A 4Z7QB 1V8FA 3H1TA 2WF9A 3AR6A 1Q77A 4G0YA 4OHFA 2GCPA 4ZVRA 4V1CB 3AM1A 4BVBA 3EAQA 3AVQA 5DTQA 4AWAA 1UXHA 4GHWA 4IIJF 4QBFA 4IX9A 3HLYA 1VLJA 5H8WA 1K63A 4E2XA 2IX9A 2PZMA 3TGLA 1N5LA 5BYAA 3RASA 1DS6A 2B1JA 3WNZA 1Y9JA 2ATVA 5EHXA 1CS0A 4NPHA 3TTTA 1FTNA 2V6MA 1MNAA 4FCCA 4TZTA 3T3OA 2CUNA 3AVYA 2W6PA 5K8IA 2WB4A 3DAHA 3NNSA 3LWZA 1JSXA 5LYJA 3R7WB 5J1SB 1DTWB 2EKLA 4B7AA 3G1UA 3IAFA 1AB5A 3W4IA 1FNBA 2XA9A 1MD9A 1QH1B 5EJ9A 3X1DA 2ZSFA 3ILHA 1ZGZA 1R18A 3LK7A 1E3WA 2QSUA 3NBAA 3WP1B 4ZZ0A 1T26A 1E3EA 4MGEA 3FFBA 1E9VA 1YNOA 3BQNB 3OVMA 3RYHA 1S0UA 2DR3A 1OVGA 1Q0QA 2C3MA 4E22A 3LCRA 4UEWA 3FOWA 2QUIA 4B43A 5KU1A 4M7PA 1GGMA 2R62A 2PIDA 2ARKA 1Z62A 4GX2A 4IDDA 4R9RA 5DYWA 4E2WA 2Y76A 3RU3A 3HFSA 1V5GA 2B61A 2VUIB 1Q7GA 5AESA 4RHUA 1G21B 2FYTA 4J0JA 3O21A 1PJRA 1IRXA 2FEOA 1FMFA 2VSNA 5LQJA 2MSEB 2P0AA 3C3EA 5EZYA 4AU1A 2R8YA 1NJ5A 3MM4A 4PHFA 1ZCFA 1CF9A 2I8LA 4G23A 2C5SA 1QPGA 1YDHA 1Y3CE 2VF2A 3AF0A 3RD5A 4MJLA 5SYMA 5T7BA 1EA7A 1JFLA 3AEKA 1E2IA 3DXYA 5AW5A 1B76A 4RMHA 1MRNA 2YQ5A 3FYUC 3U16A 3A1EA 2IX3A 2ZSJA 5EI5A 2WNIA 3FWPA 1YZUA 4I0WB 2X40A 2JG3A 4NENA 3NASA 2RH8A 2ZATA 3GGCA 1FX0B 5FQOA 1M6EX 2JK0A 4H7PA 5THQA 1JU4A 1TA9A 4JI5B 3EY4A 3GJRA 2XBLA 3L2OB 3O4RA 4R2KA 3WL6A 3TOCA 4GMHA 4RPLA 4CKEA 1PD1A 3O0DA 3KE8A 1OGJA 3ED5A 3Q0IA 2Y71A 4MMZB 4R71A 3P9IA 5JU6A 1DGQA 5KJFA 3HPQA 3PNPA 5ARDA 4BX3A 4R40A 5C5IA 1Y8RB 2GI4A 4KLAA 2P3LA 3E3NA 1Z29A 2RMKA 3LK6A 4WKOA 2B0JA 2O2YA 3SDSA 3TK1A 3I9NA 2N3ZA 2FWMX 1URPA 1UBSB 4YRBA 2UUPA 1XPOA 4XD2A 4BQSA 4IDFA 1U65A 5CLQA 1EFRA 3E5NA 3QJYA 2JIZA 4D9JA 3QXGA 5J4KA 1WHSA 1M9NA 5L6MB 2QGNA 1SK8A 1G8AA 2W2NA 3EN0A 2IKQA 3MTGA 4LHZA 3WWCA 5JJLA 2RGAA 1UBOS 3EGDB 3NMUF 3OX2A 1YCGA 1P1IA 2JJ1A 3G2PA 4G2TA 4G81A 3TE7A 1V0JA 3U81A 5JAUA 2G1PA 1PL0A 1QJ4A 2G72A 1UQRA 4NOMA 4CEIB 3MZ0A 4I3FA 1K5PA 3V4SA 5JH7A 3MNFA 4CCAA 2J7PD 4QUDA 2V7EA 5JALA 3ZQJA 2V9CA 1U2GC 5FPHA 1ZINA 3V6LA 4CQLB 4XQGA 2JZOA 4PO1A 1ONNA 2HMAA 4FJ2A 1WMDA 1XQYA 2V0NA 3JQAA 4IOKA 1Y81A 4V0LA 1XVAA 2I76A 4OKSA 1WZEA 4FYYA 4R81A 1OX6A 2H2GA 4X8OA 2G71A 3P2KA 1H5UA 2IZ1A 3HPRA 4WEOA 1XU7A 3NJ8A 1DAPA 1LI7A 2X86A 4JNCA 5AT1A 3HH8A 3B38A 2W00A 3JQ8A 2IBMA 4C7BA 5CD9A 1S2OA 4LF8B 2P4QA 1IBSA 1Q7CA 2XYRA 4K05A 1P9OA 2GD2A 4MV8A 4Y0NA 3TQQA 2FN8A 1TC2A 4BO5A 2HA0A 1PJQA 1R0KA 3B36A 2ZDHA 4XTRA 1LWNA 1UWCA 2WTMA 2X4IA 2YHIB 5AOCA 5G0WA 2CW5A 3FVQA 4MVJH 4XWTA 3ZU2A 1RMTA 3K70B 2N46A 1CG6A 1Q16A 3G1TA 1RSZA 4WXMA 5U4QA 3SF0A 2OGTA 4AKHA 4IYRA 2I8CA 4MRAA 1SZCA 2FKAA 2HPVA 2Q8NA 4OHBA 4YAGA 5IJAA 3VZSA 1KAHA 1EUYA 3ANMA 5TQ2B 2AKEA 2J41A 2IS6A 1OLOA 2GILA 3D31A 2BUBA 3OLWA 3NM5A 1H2AS 2Q0XA 3LM8A 2Q2OA 2FZWA 5BT9A 3AYXB 4A10A 4GRDA 5BP7A 1A9SA 2O8FB 4P83A 1O0BA 4ZDIA 2BFFB 3QW2A 1KJIA 1AQUA 4L95C 5HS6A 2IPXA 2JK1A 3HR7A 3P96A 5NLLA 5IG2A 3OM0A 5IN5A 1R8JA 2B8TA 4OG2A 2V7WA 1HEIA 2REQB 3BB1A 2XCTB 3TVYA 4DLYA 5GJBA 4QRIA 2RHLA 3K09A 2DB3A 1QGUB 3QSGA 4ZI2A 4RPGA 5U4XA 2YJNA 1EKXA 3SEZA 2HC9A 3C5VA 4MP8A 3KKZA 1I7SB 5H9VA 3ZUPA 3HY3A 3JZDA 3PDCA 4PHTA 5K3FB 2G8NA 4NDAA 4UZEA 2R6FA 4RIGA 6AT1A 4MYTA 3V4VB 1FFEA 3LBFA 1FP4B 1X39A 2D1FA 2GVDC 4CN9A 5HFJA 1AVTA 4AY3A 4XCXA 4FNAA 1TU3A 4QT0A 2WJHA 5FHRA 5GONB 2BUAA 2BTOA 1ISHA 1YIOA 2JC3A 3F9IA 1DJMA 3L1JA 3KT6A 1DX4A 1T1JA 2VSQA 4F8JA 4CLRA 1XAJA 3T61A 3AQIA 1K97A 5LFAA 2PX2A