3AJ9A

X-ray analysis of crystal of proteinase k obtained from d2o solution using peg 8000
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title High-resolution X-ray study of the effects of deuteration on crystal growth and the crystal structure of proteinase K
pubmed doi rcsb
molecule tags Hydrolase
total genus 104
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3aj9A00
3Q5GA 1TM4E 2PWAA 3DE0X 3DE5X 3QMPA 1BFUA 1SCAA 3GCWA 1TECE 3EIFA 5JXHA 1BJRE 4I0WB 1THMA 1LW6E 1YJBA 4NE7A 2ID8A 2W2QA 4GI3A 1PJ8A 2WUWE 1YJCA 4MZDA 1P7VA 3F7MA 1T1GA 4J94A 4Z2AA 3I2YX 2Z30A 4AKTA 1GA4A 1AQNA 1SUPA 3WQBA 1AH2A 2SNIE 1EGQA 2HPZA 3T41A 1SBTA 4CFZA 4HVLA 1AU9A 3PTLA 5B1EA 1WSDA 3CO0S 5AVKA 3UNXA 3EDYA 1CSEE 2PKCA 1AF4A 1YJAA 3EE6A 1SCJA 2B6NA 1SN7A 2SICE 1T1IA 1WVMA 5FAXA 1SUDA 3DE2X 1OYVA 4NE9A 4OV6B 2Z57A 4LVOA 1Q5PA 2DUJA 1GCIA 1WMEA 1SBHA 3ZXXA 2WWTA 3BX1A 3A3NA 1SIBE 4K8RB 1SCNE 3DDZX 4AKSA 4LVNA 1NDUA 1SUCA 5AQEA 1Y3FE 1TM1E 1Y48E 1GTL1 1SUAA 3P5BA 3VHQA 2W2OA 1SBNE 3DE6X 2P4EA 1Y4DE 1ZVJA 1Y3DE 1UBNA 4WOBA 1SBCA 4ZARA 2PWBA 2PRKA 3DVQX 1GT91 1TM7E 3DYBA 3OSZA 1IAVA 1TM5E 3GCXA 2WV7A 3LPAA 3VTAA 2ST1A 1VSBA 2Z2YA 2Z2XA 1T1EA 1NLUA 2IY9A 2PMWB 2GKOA 1ST3A 2W2NA 5JXGA 1KDVA 3DVSX 2W2PA 5JMOA 2QTWB 3D43A 2SBTA 3DE1X 5FBZA 1SELA 1Y9ZA 2TECE 3CNQS 4BWGA 1Y4AE 2DP4E 5I9SA 3AJ9A 3QFHA 5JXIA 1CNMA 1P7WA 4B5LA 3A3PA 4ZOQI 1IC6A 1SBIA 1P8JA 2IXTA 4H6XA 1V5IA 3PRKE 1GNVA 3GT3A 5JXJA 1GA1A 1SUEA 2E1PA 3VSBA 1A2QA 3H42B 3WHIA 4RYDA 5CW1A 4C3UA 5SICE 3I37X 1PFGA 1BE8A 3DW1X 1PTKA 3AFGA 3GT4A 4DWWA 1C3LA 3VV3A 1AV7A 1Y34E 1KE1A 1R0RE 3SQOA 2ID4A 1SIOA 1TK2A 3VV2A 1C9JA 2ZRQA 3DE7X 1KDYA 3VYVA 4JP8A 1MPTA 1OYOA 1MEEA 1BE6A 4YN3A 3TI9A 2XTJA 1GTJ1 2Z58A 3LPCA 1TO1E 1SPBS 1SCBA 5ARBA 1DBIA 1KDZA 2WUVA 4HX2A 3LXUX 5ARCA 4H6VA 5B1DA 1WMFA 4CFYA 3BPSA 2SECE 2X8JA 2Z2ZA 4KG7A 3WIVA 1YU6A 1Y1KE 2DQKA 3DVRX 2PQ2A 1DUIA 3D9QX 3I34X 1XF1A 3QTLA 3HJRA 3F7OA 1BH6A 4DJ5X 1S2NA 1SCDA 4FONA 1NDQA 5K7SA 1R64A 2HD4A 1Y3CE 2PYZA 1SVNA 1PEKE 3DWEX 1OT5A 1SIUA 3WIUA 2V8BA 4C3VA 1V6CA 3F49S 1GNSA 4WOCA 1Y33E 5AMXA 1GTG1 1TO2E 1C9NA 3I30X 3DE3X 2X8JB 1Y3BE 1TM3E 4OMDA 1C9MA 1SUBA 3LPDA 2Z56A 4M1ZA 2XRMA 1GA6A 3ZXYA 1AVTA 4KB5A 3L1KA 3TI7A 1AK9A 4DZTA 1WMDA 3A3OA 1ST2A 1R6VA 3AJ8A 3DE4X 3TECE 2G4VA 5AVJA 2ZWOA 4CG0A 4OMCA 1ZVKA 5FFNA 1S01A 3SICE 1KE2A 1JEAA 3BGOS 1BFKA 1HT3A 4KPGA 1SH7A 5ARDA 4H6WA 1EA7A 2ZWPA 2W2MA 1S02A 3Q40A 3DW3X 4NMXB 1TMGE
chains in the Genus database with same CATH superfamily
3AF1A 1M2WA 2CUTA 4PG7A 4HAZA 4E22A 2XMZA 3TQOA 3WVNA 3G49A 2GM9A 3UGJA 3A32A 3LQRA 5TMEA 2QI9C 1PJCA 2H1WA 1ITZA 1HOXA 3DE5X 4C3ZA 1GG8A 2FF7A 3E0QA 1JIQA 1BWSA 4XXHA 2ZR7A 5HSGA 5CTJA 1JQBA 2CY0A 5TJHA 3FPAA 4LCBA 5I7FA 2IEYA 3BIOA 4F2HA 5KSWB 4OHYA 5JJLA 3F71A 4FTWA 2W48A 4RKFA 1MORA 5TQ2B 1F3LA 1V7QA 1VLZA 2FRDC 4REOA 3K0AB 2RKBA 4FFNA 4N0PA 1WUTA 5KHLB 2C77A 3W2EA 2Q6OA 1YJBA 4OB6A 4WECA 3NOXA 4I4NA 1R9JA 5CU7A 3ZWQA 4CTMA 1VZ3A 2ID8A 4HRAA 1O94C 3A1WA 1HFEL 1L4FA 2H06A 2WUWE 3KOWA 3K9CA 1GUBA 3BSWA 1QGYA 3LO5A 3EMKA 4PZZA 4OQMA 3T5GA 5DFAA 1XRSB 1PLJA 1H69A 4PG4A 3H05A 5COBA 3ESXA 5F3DA 1YFLA 3E3NA 1S3IA 2IQ5A 3IV6A 1T5TA 5DTQA 3GUVA 4N3NA 5KTKA 1Z5PA 4Y7DA 2GRUA 3FFTA 2MWMA 1W1WA 1YWGO 2D5LA 2CUNA 3N58A 1X1CA 5HBGA 2EP8A 1A7AA 1E2MA 3JVUA 1QVVA 3FKSA 1ZLYA 2ERYA 3NUGA 2GEDA 4WGGA 4C1BA 4I7EA 1INLA 2H18A 3U3RA 3W3AD 2VXCA 3IA7A 5P8WA 3JAKA 2IYPA 3DBRB 4ZAZA 5DGCA 5IWCA 3WJ7A 5A4KA 2BF4A 4RKYA 3S2EA 4B6RA 4HB3A 3RC1A 2CNNA 3G7NA 3VNBA 4HTFB 3KDSE 3CVVA 1SBTA 3N75A 2H0RA 3ENKA 4FFMA 3T7RA 4E5KA 4KE7A 1DG9A 1FUUA 2DQ4A 1DRJA 1JHXA 1GO2A 2HCBA 4PV7A 3NYIA 5KDOA 5KREA 1AHIA 5IWAB 5DTRA 2VQDA 1OH8A 3LIIA 3CO0S 1Z6AA 1EM8A 1RWOA 2H29A 3U31A 3EPKA 3SEQA 2DMRA 1CSEE 1XHFA 4NDAA 4NV1A 1T4CA 1MMFB 3H8WA 5JDCC 4QM7A 2PANA 4HPWA 3B9QA 1KI1A 2JVIA 4MK4A 5HILA 5TIIA 2JHCA 1SC6A 1V37A 1LQTA 3HY4A 1KIFA 3B70A 3HFSA 5EGNA 4I9NA 5JNSA 2YFYA 1H5NA 1XKXA 3EE6A 2OCGA 2RGGA 5LFAA 1L5ZA 3C7TA 4L8WB 3THSA 3WIOA 4ZYWA 2Z1DA 1UP7A 2PFSA 4JJFA 4YECA 1NOIA 4DXAA 1P7PA 4EGSA 4ESOA 2WWWA 2DFTA 5DN6D 1PD1A 1TB4A 4F3CA 4LOAA 2HJGA 3WZ2A 4OV6B 5KQLA 1WW2A 4TZKA 3U9LA 1FL9A 1Q5PA 1QH8B 2HU2A 4Q3EA 3H3XA 3HB4X 1VIAA 1AD2A 3LP8A 4IGFA 4K9KA 5CH5A 2OYCA 3B12A 1DRUA 1ELOA 3IQZA 2EYUA 3QUCA 1E3IA 4Z0NA 3IAFA 2H4FA 4QU8A 3QVWA 1OFUA 4S0ZA 3EHDA 2RGRA 4XM0A 1ZG3A 4YUZA 4JY7A 3L40A 3HKEA 3OT1B 4RFLA 2SCUA 3ETNA 3IDOA 2XOXA 3SE0A 2BEWB 1ZI8A 3FNIA 2WMYA 3LUPA 1IZ9A 4KVGA 3HMKA 4GYJA 1GARA 4TS3A 4BLVA 2I4TA 3Q3GE 4DBLE 2GDJA 3STHA 1TF7A 2WJYA 4BLQA 1IJFA 2AEFA 2B1QA 3WK4A 1LBQA 1XVAA 1TEHA 1T5SA 2Q5CA 1AKYA 2NXEA 2YQZA 2XQJA 2XWJI 1PQUA 1Y48E 2YV1A 3GFQA 3I1IA 3LHIA 3OO1A 3K15A 5H3HA 2W58A 2YXNA 1IATA 1V5FA 1QHHB 2C78A 2WIAA 3AG6A 3ME5A 3ETGA 4XDGA 1N7GA 3EXEB 2V7GA 3OZ7A 4RLHA 3ANNA 4G0PA 4ZQCB 3LK6A 3FTNA 2EBHX 5HWSA 1N2IA 2IZ6A 4TLAA 3TW4A 2H85A 4F72A 1C1YA 2WIFA 4FK8A 4YLGA 2FEAA 3C4VA 3M3PA 2XV1A 2Z8ZA 3RUDA 4B1FA 2QX7A 2VUIB 3PQ3A 3S0JA 3QOWA 4Q19A 1WU8A 4OKSA 1ESZA 1BGWA 1K3TA 3AI3A 1EFDN 3WLFA 3KOXA 1XQVA 4YJ2A 3WRYC 1GPMA 4OQZA 5K99A 4JQCA 4LV8B 3VR5A 4LJ9A 4OXKA 5EUMA 2FWBA 2J3DA 2HXGA 2HXYA 2NVWA 3DVQX 4KQIA 2B1JA 1RLMA 4EJMA 3UV3A 2HPAA 3VPHA 1KPGA 3IB3A 2C2HA 1EFKA 2JEYA 2XGMA 3MD0A 2G04A 4RO0A 5WRFA 1WS6A 2G63A 2R6AA 1A9QA 4L27A 1IHYA 5DASA 4DR7B 2O2CA 3BWBA 4DEYA 1Q91A 2VPZA 1MH9A 3BFPA 1TM5E 1TA9A 1ZUNB 2AEMA 5L3SA 3TAUA 1AKQA 1NVWQ 4HGRA 1DOAA 4IXWA 4DMRA 1T26A 3QP9A 4P33A 5EQDA 1U28A 1BOOA 1LQ2A 3CX6A 3NVAA 5IVHA 1WCWA 4HWSA 4LZLA 2IXDA 3IOEA 4MR9B 5L3ZA 1G5TA 4DBVO 2X0NA 3GAZA 4PTYA 4B3RB 1D8AA 1MVLA 3QXJA 2QKYA 3TR6A 4CMHA 3OU2A 5JAUA 5CHEA 3AEKB 4TVBA 1OIXA 3WO1A 1CY2A 4HPJB 2HSDA 1NMYA 5EYPA 5K3OA 1OXSC 3GLFB 4XWTA 2E4VA 3GQBB 1SCIA 1JHUA 3AETA 1GV1A 1AE1A 1U7OA 2OK7A 3HCPA 1ZX1A 4YJDA 3S7ZA 4UULA 3I3OA 2HA0A 5AK5A 2RGAA 3CO5A 1F06A 3GJRA 4KR6A 3F5FA 3UGKA 4UNIA 3PF9A 1AGPA 2AF4C 1R6TA 2YFQA 1BWPA 2W2NA 4FZ3A 1FLNA 1YZNA 2PZBA 3ZR4B 4D43A 3U44B 5KQRA 1UDWA 4BY9E 1XCMA 4FHGA 4IQFA 4C88A 3UJHA 4FOPA 1Q95A 4K81B 2H5LA 4Y6GB 2VHEA 3MMXA 1E79A 2HA5A 1CIPA 3FPLA 1P9LA 3U26A 5PNTA 2BM0A 3WV5A 3PUJA 3GRCA 3W2TA 4Y7CA 3L7NA 4ZA2A 4MVWA 4DWJA 5CAEA 3VR5H 5HTKA 1DIOB 2VDOB 5JXIA 4NXMB 1P7WA 1TKAA 2B0CA 5FL7D 1GZ5A 1ULZA 4TS4A 2AJCA 3HBAA 3Q72A 4TUYF 4U8GA 4OB7A 5DRTA 5G0TA 1RM3A 1PUXA 4YUYA 4LX8A 2JK0A 4RD4A 1DTWB 3EXHB 5A5DA 2MJLA 3H9UA 3KUKA 3LLSA 1V5WA 1W2WB 4X41A 4AW9A 1VKHA 1W0CA 3D54D 3STYA 1PR2A 3TM4A 1U1IA 2WJHA 2H5IA 3OJCA 4TKVA 4PAGA 3HH8A 3K8QA 2BEKA 1TUBA 3K31A 1UXKA 4UEKA 2QYOA 1TA4A 2ANCA 2XNKA 3SI7A 4NJEA 1U98A 3GGSA 3LKZA 3ZZ0A 4AZTA 1O95D 2G71A 3IBCA 4CCSA 2VSYA 2ONZA 3CCFA 1IG0A 3Q85A 4X54A 5CD9A 3OIGA 2YW2A 3V4PB 3VKUA 1FXUA 3I4LA 1QC5A 2L2QA 1WMAA 1B0PA 1UFQA 1KWKA 2FMHA 1WQ3A 4W8OA 5DW3A 3AONB 4OJKA 2PJRA 2NVBA 4M36A 5AHWA 2VRBA 2PBFA 1VI5A 4MVJP 3U80A 3Q0IA 2A1UA 4ACBA 5EHIA 3OZXA 3OO0A 3P0FA 4Y1FA 1KE1A 3T1TA 1JI0A 5F9HA 2HF7A 2LDXA 2Y1WA 3HFJA 3SQOA 3SSMA 3SYLA 2R00A 2WE7A 5TGTA 2W37A 1QGUA 1DE0A 1KYWA 2O2DA 3KR9A 3HUEA 1SPXA 3VSAA 3CMCO 1NW6A 1O87A 1K06A 1ZRSA 3PQFA 5JT1A 4L4ZA 3EGDA 1ZITA 3P9KA 2ZRQA 2W6JA 4ER3A 4W1SA 5EJ8A 1E2BA 3O1HB 4Q24A 1PAUA 1E1CB 4JP8A 4NY1A 1QE3A 3AG5A 4XJVA 3H99A 5AVUA 3P94A 2FZGA 3G89A 3IUYA 3B1FA 1NJ5A 4TMFA 4J90A 4L78A 1TCUA 4JS0A 3G0IA 1A0OA 2XGJA 2O8CB 4OI2A 4A8JC 3U3ZA 1OFHA 4L16A 4AJNA 4BVJA 5BR7A 5HVNA 1VKNA 4AKIA 2IEDA 2D0DA 1SJ9A 1F51E 1OLUA 4HWRA 4NJOA 4Q3OA 4BYGA 1ILWA 2XTJA 3OQBA 5BWCA 1WD5A 1FPMA 5ECDA 3RS5A 2HLPA 2PMCA 4EFLA 3GB9A 1JBKA 1HMYA 2X2OA 1JEOA 2UYQA 4B3JA 5FI3A 3RSGA 2CXNA 2AX3A 2QZSA 5T5QA 2Q5LA 3OY7A 4FGWA 4TLEA 3WNZA 1JFFB 4E5UA 1TCVA 2VRWA 2CL7X 3DMYA 4BNWA 1AS2A 1M6WA 2XGOA 3UT5B 3IEVA 2EHJA 4LMAA 2CHFA 2II6A 2CC2A 3EXFA 2P91A 4NU6A 4V1CI 2CVHA 2GNPA 3WIEA 3W8DA 1SVUA 3KSRA 2DF8A 2YZNA 5GOZA 3LXUX 3RODA 4TV9A 3ED5A 5JNTA 4O63O 1U8FO 3TG2A 3P2OA 1ZI9A 1ZL0A 4CIWA 9LDTA 3O21A 4NG5A 3F6CA 3GHHA 3J7TA 3R6GA 1LBIA 2VATA 3CNEA 2DQKA 4HAVA 4OLAA 4WVFA 1CIJA 1U5BB 3QQPA 4EVQA 2XE7A 1VB5A 4R1QA 4RF5A 4QQFA 1EVYA 1XQ6A 3E7WA 2GF9A 2A14A 1NVDA 4FWIB 1N5LA 1T0IA 2Z9CA 1WCYA 4D45A 3HEAA 4LYFA 4GKJB 5EZYB 3CMMA 1QR6A 1G21E 4EATA 3ND6A 1RXWA 2OCIA 2F6RA 3ZD6A 2R8XA 3NUZA 4NECA 1X7ZA 1D0SA 1ZMRA 4RH3A 3P4YA 4TWBA 4P81A 4M0EA 5D85A 4UUAA 3C14C 1PEKE 3GA5A 2ZE6A 3DWEX 1ISIA 3VU8A 2YYZA 1O5OA 3ONNA 4NX2A 1GHTA 1EGHA 4UM9D 3EYAA 3GIDA 4HBZA 2DKFA 3T54A 1YACA 3MWEA 2R7KA 5ALNA 4ZHQA 2ZVDA 3C3MA 4EHFA 1DBWA 3SKXA 2I33A 4MGZR 3UMRA 3EIHA 3UG6A 1GNSA 3NRBA 3SKYA 4V39A 4L2IB 4BFXA 1FCJA 3BL6A 4GMDA 1CTQA 1KO8A 1SOUA 5AMXA 2OZVA 3OKCA 3TIFA 4D4JA 4BGDA 1O0BA 1Y6FA 2VZ0A 4P83A 4UPEA 1Z08A 1N7HA 1VFNA 3CM0A 1C9KA 1WLYA 4WADA 5HZKA 4WAUA 5EI5A 4O5OA 4LKOA 5EUQB 3STXA 3GH1A 4DDKA 2CFCA 4OGKA 4G1UC 3FG9A 2XR1A 1KI7A 2XUJA 1Q84A 2B9EA 1P18A 2WOJA 5LB2A 5KNDH 3MCWA 3RRMA 1NLYA 3NNSA 2WB4A 2XWSA 4QUIA 3DULA 4CIDA 4UTRA 2F4VB 2FJ0A 2QGNA 3G23A 1J21A 4FYIA 3KYCA 5CYFA 5BYKA 1ISFA 4QNNA 1TMKA 5DYTA 2XYQA 4PANA 3IV9A 1XPUA 5IJZA 4G0YA 5T41A 3W3ZB 1HDRA 1UXJA 2UVPA 1F48A 4AWAA 2Q2WA 4CT5A 4II2A 1G5FA 4ARBA 4PGFA 2Y76A 1XAHA 4XQGA 1LH0A 1XQ9A 2C94A 1D1QA 3JCZA 4JU9A 4C0JA 3U62A 4BOYA 4DUGD 3QBTA 3GNSA 5JWRA 1UUFA 2H7YA 5KC8A 1O97C 1GQRA 1H2BA 3PXGA 5BSGA 2P2ZA 4K7JA 4J7UA 5D3ZA 4YCBA 1N9GA 2DY0A 3VPXA 5DVZA 4NPCA 3K71B 2QUKA 1JE0A 4IDNA 4KO1S 2W2LD 4ZZ1A 1NG9A 1U9IA 5IDXA 1FA9A 4K9SA 1G5RA 3JVEA 4G1MB 3L0BA 4QWMA 3TE7A 4J0IA 1BJKA 1TQDA 2X77A 5ALGA 5E9QA 2XDQB 3A6EA 5FADA 5H8WA 3FNGA 1P4SA 5AM2A 1PGQA 3UAGA 3VQTA 2BMEA 2YJ4A 3DMHA 5TGDA 1S1MA 1U0SY 4UDNA 1CS4C 2FUEA 5AK3A 3IDZA 2BZSA 5DBIA 1CQPA 2RHRA 4ALJA 4EW1A 1GZ3A 4XD2A 3KOUA 2ISCA 3SHTA 1C7EA 3MJSA 4AJJA 4N48A 1MG5A 2OCPA 4L22A 5HRAA 2YUTA 3VSDA 3JVVA 2DVMA 3MEQA 4XR4A 5LC1A 3TUJC 3X0DA 3FY4A 3EFOB 3R40A 1N7IA 1V1JA 4NMXB 1HYHA 4RLFA 2FZWA 2R6DA 4CU2A 2E4UA 4DYHA 5AD1A 3GC6A 3MMPA 1G3MA 4MA0A 1OQAA 3T5TA 1B42A 1D1SA 1OLSB 1Z6ZA 3DOJA 1GFIA 2DFLA 2A78A 5AKHA 4QE3A 3NJ4A 3C48A 3S5UA 5C1IA 5K6AC 3IE1A 4H0NA 1Q0TA 3M6AA 2ZB8A 1ZHOA 1RI4A 2A5LA 2PWYA 1ZJZA 1SCAA 3OVMA 2QWXA 2FN3A 2R84A 2WUGA 3NTUA 1BCRB 4E33A 5KNCA 2EBUA 4HDMB 4WXHA 4P3XA 4R41A 2C4VA 4WXRA 5DYGA 4MUBA 1C7FA 3FH0A 5FI0B 4Q9LA 3DEYX 1ZWLA 1T3TA 5EP1A 5FR1A 2WVGA 1GUAA 4HRYA 4BP1A 3L0IB 3ON5A 4UD6A 1VI2A 3DAOA 3AJRA 1Z38A 4EEKA 9MHTA 1AUVA 3LT1A 4MKZA 4B35A 2ZBGA 3VZCA 3TLYA 4IIXA 4KEAA 5LQAA 2HLDD 1FP4A 1RP7A 2PSEA 3H2GA 4J0KA 1XDSA 5F64A 1XXLA 1ZP6A 3IKLA 4FMDB 3GHYA 3R7LA 5B7GA 1GLNA 1ZVVA 4F84A 3TXXA 3LECA 3WGVA 1RRMA 1LPMA 3DNMA 3PNBA 4F4IA 3EZLA 4LFAB 2FSUA 1W9HA 3G0CA 4HDKA 3GRFA 3E27A 2WJAA 1N6RA 4KDRA 4JB3A 2SKEA 1TJNA 2VDUE 3N8KA 1RYFA 1KEZA 1PJZA 3D2LA 4RK1A 4XUGB 4TT3D 3WWZA 3AEUB 2G83A 1P7ZA 5ILGA 5BOVA 4PICA 2LDBA 2WOOA 3FHOA 1W6RA 4MB0A 4BMYA 4DSAA 5IYZA 5LYJB 4GS5A 3T1HB 4FGSA 1NXQA 4LW8A 1PGOA 2R8OA 1XMJA 3LP5A 3NDRA 4DSNA 5HKBA 4IJ6A 4W5RA 4KBGA 3O4JA 1JEYB 2CL5A 2C0QA 1JIKA 3CF4G 4HB0A 4QUJA 1NHGA 1XTQA 1R6DA 3DZBA 4IXNA 5KUTA 1JR6A 4FFDA 5AKJA 1TYZA 3U3DA 4YRGA 4DMGA 1NN1A 3DBVO 5KTSA 2IIVA 4KITB 1I4LD 3P8ZA 3KQYA 4RTRA 4KE9A 3K0EA 4XQCA 5KNLA 2NUBA 2HRQA 4C29A 1XZQA 4URUR 3CIFA 4FCVA 2HKIA 4MXDA 1T6XA 5IH3A 4I5IA 3FTFA 1O0CA 4Q4JB 1QKIA 1J49A 3D3KA 2Q7DA 2WD9A 1SU6A 1QQAA 1OKKD 4BE9A 2MR6A 3D6VA 3N7TA 4NV3A 3VTFA 5CA1A 2B4KA 7MDHA 3KZNA 2XMPA 2DYKA 3HB1A 1KNQA 3L18A 1CJCA 2ZSAA 1XRMA 3ANYB 3RYCB 3SSOA 4YMUA 3GEHA 5GJBA 1F4PA 4ISCA 5ALUA 1FS4A 1P0PA 1VBKA 2X8WA 3KFVA 1KK2A 1ATIA 1EIWA 3DL0A 5HM8A 1Y63A 5IJWA 5FPYA 1B93A 4N3AA 4ZT5A 2QN7A 1H2WA 2XSZA 1FOEB 1H93A 1Z6QA 2CJWB 1UKAA 3EZFA 3H8JA 2CNKA 2EG5A 1WMEA 4D4GA 1CFZA 3SJCA 1ZK4A 3FPHA 5JDIC 3R23A 4C4AA 3QFSA 3EZ7A 3BX1A 4KL8S 2X0JA 3AVYA 1CPYA 4K8RB 4FHEA 3LW7A 5CA1F 1P44A 4TSRA 5IAGA 1TAHA 4FR0A 1H6CA 2AWNA 4JQYA 4MWCA 5D7NA 5A5VA 2QQFA 4RVCA 5K3AA 1BHQ1 4DMUB 4BV8A 1S9DA 4EZEA 2BYTA 1KI6B 3C16C 4JEMA 1R0KA 4RMNA 4Q03A 4OUKX 1JILA 1Y1QA 4R3UC 4YTEA 4IHJA 4KWTA 3HXKA 3VI4B 4D99A 1FUKA 1UDAA 3FYDA 4P7GA 3U3MA 3L6UA 3NC4A 5GGXA 3T12A 3CUSA 3E8SA 4FD3A 4B43A 4ESEA 4HGZA 1H3EA 1JHZA 1DFGA 1U8CB 2HO4A 3P5BA 4M9XA 3TZ6A 2GAFA 1W29A 4TTQA 3WWYA 4G26A 4UVEA 1E2FA 1WKVA 2IXBA 1NI3A 2JZOA 4KDFA 3NAZA 4N1AA 3JWGA 4K40A 2C5BA 2HMWA 4OL0A 4WLFA 4ZT7A 1J2TA 1WNTA 5JVDB 3I45A 3TBKA 3WZMA 1TW3A 2VJMB 3VHXA 3ZK9A 1R5BA 2HHLA 3PGLA 4JR1A 1QG6A 2XB6A 4S1PA 4LEIA 5D5HA 1K0UA 1V39A 3PC8C 4F8JA 5JRZA 1RRFA 5DYIA 2VBFA 1FX0A 2C3PA 2VT7A 1BW9B 3C3XA 1QSGA 4RZUA 1OXXK 2QG4A 5E9WA 5A9SB 1QJ4A 3FX2A 4QELA 4M1WA 5LBUA 5IANA 3QPBA 4D3SA 3R5FA 1IBRA 4IHJF 3RK4A 3T3PB 1V1RB 2XTZA 5AWFC 2YZKA 5CCDA 4A8JB 2ZPAA 3RC3A 3OMXA 3FRIA 2GARA 3KQUA 3BJEA 4A6PA 4CUZA 3IVCA 1PJ2A 5DGDA 5K0TA 1QIEA 3FTDA 4BASA 4GC9A 2VHVA 1PNOA 4Y6SA 1O6FA 3DG9A 3I4CA 3OZEA 5H3CA 3TBHA 4KGDA 3IBGA 3WLMA 2Q4EA 5DLEA 1D04A 4MDHA 1UFKA 4EA6A 5A5EA 5J4YA 4A5OA 1PR6A 2KBEA 4B81A 2O9JA 2K7FA 3JRNA 4EUEA 4Z49A 5H80A 1TEXA 3ZJVA 2D5CA 5EMLA 1GXSA 1Q7BA 2AQIA 3B1ZA 3HVJA 2GN2A 4JWKA 3GRVA 4RVSA 4G3XA 3O31A 5HGJA 3R0JA 1L5SA 2ZTVA 4MV3A 4PYKA 4AUEA 5KHOC 4URHA 2B37A 3NFYA 2HRDA 1LD3A 1EFHA 1Z6TA 3DEZA 3MT0A 1G21A 3UYKA 4QTYA 1GKLA 1ODJA 2YZ2A 4EENA 2NUAA 1Q0SA 3IR7A 4IGEA 4IUDS 4JDPA 4DCGA 3O1LA 1W1IA 3QLUC 4YJFB 2IX9A 5A7FA 1DJNA 4G37A 1AY0A 2JGJA 4IFIA 2BZGA 1LGYA 3USCS 3RYHB 3WL7A 2HBQA 1WHTB 3PFGA 4L02A 4MAFA 2DR2A 3LWDA 4K6KA 1ST3A 5JOQA 3HJCA 5J2UF 1I0ZA 1LF0A 4B6EA 8LDHA 2JBHA 1N2GA 2ODWA 4GHWA 3QE2A 2YVAA 1ZS9A 2W2PA 4D9MA 4F4HA 2QRZA 3EIWA 4J29A 1QNLA 2BEUA 2EL9A 4DY6A 2C82A 3EPRA 3ZE1B 3MFQA 5K3EA 1QF6A 4DWOA 3G1WA 3UO8B 5M7EA 4NQZA 3QENA 4F3TA 3MQ2A 4I2NA 2Y1FA 4HOYA 1UIMA 3KZKA 2B9VA 3ZWBA 3CSUA 2Q27A 1Q16A 3QGMA 1L5VA 3AYZB 3KPUA 4ESHA 4Y6LA 4GM1A 3UWDA 3B6MA 1VIYA 1D6MA 2MU1A 5K3CA 2QUBA 3EAGA 3EAFA 3WKBA 3GZ4A 4KQFA 4OGFA 4DQDA 4I3HA 1OD6A 2PMBA 3I83A 4OJMX 1UC9A 4LGCA 1JFSA 2HMSA 2PH7A 1FNMA 4HVAA 2XAAA 3PQ8A 4L57A 4XOUA 3SJUA 4M0KA 4J6FA 4F9FA 1UJCA 2FP4A 1PU2A 2VUUA 4UMFA 2QNIA 5FDFA 3WWPA 2GVNA 5L3QB 4HVCA 3ILVA 3RUPA 4JH0A 2FPSA 5C8XA 4TX1A 5NULA 5HKOA 2WAYA 5IVPA 5DOZA 5KJ1A 2BWJA 2P9TA 1XLTC 4MHOA 1A2QA 4NFHA 1XZAA 2LV8A 3B5IA 1PLKA 2MSKA 4KR9A 1MC5A 1V25A 4NDZA 2JARA 4UDYX 5SICE 1BVRA 1BKYA 1D1PA 3V5NA 4X3OA 3HN7A 3PFNA 2D1YA 2P1ZA 2H8KA 2P9ZA 4DPMA 1Y6GA 2X1LA 4EPYA 1KMMA 4R6WA 1YRHA 4U6SA 1SBZA 4X62B 4EM6A 2G88A 4XWGA 2LD4A 1KY3A 1V43A 2VHXA 4OHVA 2R7NA 3MT7A 2GCPA 4FYHA 1TFRA 1D9XA 2HRZA 4FHDA 3OC6A 3QH4A 1JVNA 4G9EA 1JA1A 1YRWA 4UASA 5IRCD 5I8WA 5CPFA 1F20A 1ISHA 4HLNA 3SCZA 4EFKA 1Z25A 1AV7A 5HE8A 1RC1A 1Z39A 5HCUA 3ZS8A 2K2QB 4EG5A 3TDNA 5DM4A 1FTQA 1DWPA 5AT1A 4LC9A 2O8DA 3DMRA 4JI0B 4M9CA 4N3CA 1QX4A 1TK2A 1K5DA 2O3UA 4JGGA 4LC1A 4BBAA 4FCTA 2NWQA 4EW2A 3VA7A 1VPWA 3LCMA 4ZOLA 1MO6A 1RC8A 2RHBA 2FUKA 4MEAA 4PLCA 1O96B 4R8KA 2QZJA 3TRKA 1QCYA 5A2QA 1QFSA 2JCSA 2Q3BA 1GVHA 3LL7A 1R8QA 4H7EA 1I14A 5F4BA 4AXXA 3Q0TA 1T1RA 4JLMA 5DWVA 1OX4A 2AQKA 3DEFA 4K9NA 3V1LA 4BXOB 1BE6A 1G8AA 1SXQA 4HNHA 1VTKA 3WB0A 1CJUC 5MDHA 3DAPA 4FNAA 4MSUA 2GXSA 3VFDA 2SKCA 4F6RB 1UOEA 2GPTA 4Q4HA 2KLHA 2W7TA 2WWVD 4QGBA 5F5NA 1HLPA 3MWLA 4FZJA 2VHCA 2IXAA 1HE2A 1ZD1A 2Z4RA 1RM0A 1ZGJA 2O1EA 2Z58A 4GT1A 4JL6A 3ZV7A 5LQMA 1A2BA 2DFNA 5JFGA 1PZGA 2R6R1 5KVVA 2FGJA 4ZOLF 5ES3A 1VZ2A 4MYTA 3V2UA 1I1NA 1LBEA 5ADVA 3J81k 3D7RA 4V0OA 1DBIA 1PNTA 4S24A 2NU7B 1CUFA 3D3WA 1G8PA 4PR3A 1Z4MA 5TSDA 2BGUA 1V2HE 1MQ9A 2GTHA 4ND8A 1Z6XA 1RLJA 5JHGB 3T1YB 3O9ZA 5JCJA 4XWYA 1NY5A 4UTNA 2A57A 4B47A 4GOXA 3PUVA 4P32A 4YRBA 3ZCSA 3TD6A 3RREA 2OFOA 2Q8PA 2JFVA 4LOHA 4P4LA 4EA7A 1U3UA 1AGXA 2EFYA 2YASA 4IDGA 5DN9A 5ED0A 5ARCA 3ZV6A 3B8HA 4J1TA 3RR2A 4FFRA 2AXNA 3H9EO 3JQEA 1CS0A 4NNOA 5E95A 5EINA 5HTOA 1FJXA 1J1UA 1Z7EA 2OV2A 3DYIA 4CEJB 1T1SA 1B8PA 4LZJA 2BISA 5AKXA 3GLGB 1KK3A 2C57A 5LMNB 4AZVA 2D7JA 4D7AA 3DFZA 4E5SA 5C37A 1F2DA 3AEQB 1EWQA 4E09A 5D3MA 3QX7A 5P21A 6Q21A 2FEXA 3PUHA 1BH6A 1N3BA 2ZJOA 4IO0A 2GHRA 1NDQA 1BAPA 1THGA 4RY0A 5K3FB 4A3SA 3HA7A 1C4OA 3K5WA 5ESWA 5JRDS 5K7SA 2BGGA 1OU0A 4NQRA 2IL1A 3H97A 3IAHA 5TRTA 1MP0A 5LUAA 1OFVA 1IN5A 2YNMC 4BGIA 2PVSA 2Z3ZA 2NV2B 1WV0A 4QGGA 4BV2A 3CRQA 3VR3A 2OHFA 1HT2E 1QOPB 3IBSA 4G5OA 4F0JA 2O2ZA 1PW7A 1O94D 1XTIA 3VPCA 3WJ2A 4AJLA 4AKHA 1RPTA 3AESB 5JD5A 4BKMA 3RVLA 4EX7A 4Z9XA 3VU0A 1FSFA 1QHSA 1IOLA 1D3AA 2A84A 3CB4A 4WOCA 5EFZA 3TOSA 4LRTB 2Y0DA 3DBLB 2JJ2A 3D6MA 3SQNA 4C5BA 1GTG1 1YU9A 3OZRA 3CKYA 1PS0A 3I01M 3RBXA 5IVDA 4OYHA 1SU8A 1C3VA 1JT2A 2HNKA 3EXIB 4HDRB 4EI2A 1RAFA 1WMSA 4OO3A 1YHNA 1JLLB 3ZVMA 4BQPA 1AIPA 3RVDA 2GEVA 3SVZA 3R0VA 3R4VA 1ZKMA 2F59A 2XEDA 2V5UA 4PLWA 4EECA 4BATA 1UT6A 1VLLA 1R9GA 5BRJA 5KCMA 3SAJA 4P3OA 1QHIA 1Q92A 2GGSA 4ZJZA 2XYVA 5DCUA 3ABZA 1G20B 3F47A 3MOGA 2IU3A 3NBMA 1LCIA 1CDDA 3B1JA 4PO3X 1C8KA 2YWJA 4YDRA 3D1LA 3MJVA 3RANA 5JTTA 2ZBRA 3H18A 1A9XA 1QGOA 1RMYA 2J85A 3BG5A 3OMLA 5J2UA 3ZJUA 1ZMOA 2W6QA 3KT3A 4MQMA 5CGZA 2E5LB 3DHEA 1S6YA 2JHPA 3UOAB 4TRMA 3C45A 5B3LA 3UTDA 1BA2A 2GZHA 1F1BA 1V8OA 4KXVA 4OFWA 4YRLA 4YP6A 3WL6A 4WLEA 3ZOZA 3HDGA 3X2SA 4QLBA 5E3IA 4O4JA 1NMZA 1EUDB 2O2SA 5BSRA 4QC2A 1KHTA 3DDNA 4KWIA 3AJAA 3WIBA 3WMGA 5G2OA 2JGRA 3OQPA 4GPTA 4V38A 221PA 5MN4A 4O4IB 2ZZMA 3ZVKA 3LDUA 3LTNC 3IKJA 3NKLA 4NTZA 2OGTA 3O2JA 4GZ5A 4G0UA 1RRVA 3ITNA 5HKLA 3K0FB 4LWOA 1YR1A 1L5YA 3FYCA 4Q9DA 1QQ5A 4LHYA 2JGMA 3ENNA 3GFGA 3I9NA 5TPWB 4BKPA 4CF5A 4JFAA 3G7SA 4FI3F 1ESEA 3R9XB 1Z2PX 4R6XA 1JQEA 2G9NA 1L7NA 2ZB4A 1EDZA 1WXIA 2HMAA 3EGIA 3H11A 3GR6A 3KR0A 4FMCB 4HLQB 3M2TA 3U56A 1QO9A 3COJA 4KLZA 2QRHA 1DIBA 4GBJA 2X5XA 4GZ6A 2DH5A 4PQRA 1JHPA 4YNBA 5FO1A 4L73A 3VI3B 4D9FA 3OOHA 4RHYA 2P4QA 1V11B 4WZBB 3TLZA 1S02A 3A2NA 3ZYCA 5KU1A 5KTRA 3BS4A 5HMMA 2XLCA 5JS2A 1ZJ6A 3AVVA 2ZXFA 1CY1A 4GPIB 3OIVA 1P62B 5H83A 1R8JA 1PQPA 5DGXA 4KOAA 5DWDA 4HDQB 2OLJA 4WJKB 3JD1A 2I4MA 2FU5C 2FZVA 1RBYA 2RGBA 2OV8A 2D0OB 3JYQA 1UOQA 2GEUA 4IOMA 4MTLA 3ABQB 4B4KA 1JU4A 2V6IA 1GRCA 1NM5C 4EGFA 1JQAA 4Z1MD 2P79A 2WSSD 5DIFA 2WPNA 4FFWA 4KHZA 2G09A 2WIJA 3KC2A 3AGPA 1SHTX 3SGLA 1A95A 5HXAA 4EVRA 4NMHA 4BFLA 1Q20A 3EIFA 3KTOA 3VC1A 5A0TA 1EXWA 3EGWA 2IOFK 3CGWA 4NMLA 3SNHA 4ECAA 2QM7A 3KPYA 4F1WA 3RKSA 2J4CA 1LJUA 2EFHB 3B6JA 3LUFA 1PQWA 2VP2A 3LYUA 3NWOA 1YIAA 2OO7A 2IPMA 4UQOA 1YR6A 6CHYA 3PJEA 3EVTA 3P0EA 3I72A 2BFEA 4FUQA 4F04A 4LJ8A 1XZGA 1ZHHA 2QLFA 3C5VA 5K0EA 3IPXA 3PLRA 2HDWA 4HSGA 2BKLA 4LYDA 5IDWA 4BX9A 4QWWA 2ZI5A 2I7CA 3EGEA 1CR1A 3PQEA 1G5QA 4DDMA 4F56A 3S2IA 1P7CA 4KWHA 3G9TA 4EHIA 4X6XA 2A9QA 2CB9A 3TQIA 1XD9A 4JHXA 1TU0A 4LJKA 2J9YB 3NP7A 2V98A 4GGOA 4IOLA 2NYUA 3TZBA 5ELXA 2W8BA 4Q5IA 1D4OA 2ACEA 2R8RA 4QKQA 3I5YA 1AMUA 4CI9A 4UE3S 4RWEA 1I1HA 1WF3A 2IXEA 5F35A 1HXHA 3BH6A 1Z9BA 4MV7A 4PGAA 2J3MA 2P2CA 2Q1YA 5TMDA 2JFQA 1ABFA 2A3NA 3RTCA 3SR4A 3NBFA 4URWR 1NXXA 2QGFA 3A2MA 3ASZA 3F2VA 5HQ3B 3U3JA 3BSSA 4Z6KA 2IUTA 1E69A 4C5CA 1QFMA 5KYUB 1UKCA 4K0RA 1ACMA 2M9MA 1C0KA 1E2QA 3MWFA 1JYEA 3OLYA 4LV5B 4WKNA 1KC1A 2V4ZA 3OUZA 2H00A 4PBSA 3RAPR 3W06A 3GMSA 1P2UA 5KNDD 4TTSA 1SEPA 3IIKA 1E0DA 2FW6A 4GRDA 1T1IA 5BMOA 3N5CA 4ZK6A 2C2ZA 3QF7A 3T1OA 3IR6A 2X0KA 5ANRB 2Y6UA 4LUCA 2I2WA 1DSSG 4ZQHA 5THKA 3QF4B 1GADO 2OFWA 2QF7A 1WXDA 1CJMA 3AB8A 2G9ZA 5TQJA 4ZO7A 3DHYA 3H5TA 1T2FA 2AH5A 4M55A 4EG0A 3ESZA 4C03A 2G8NA 2VJYA 1W85B 4J43A 2AUMA 1NOJA 4M54A 1CUCA 5AM1A 3GUCA 4FCCA 4XVUA 3PENA 5EJ9A 2Q6KA 4IDAA 3IT2A 3K20A 2D0PB 2Y4NA 1F8YA 3GDFA 1Z8HA 1T6BY 2N3ZA 3AVPA 4XGKA 1XU7A 5E8RA 1CRZA 1KJ9A 4RVNA 5LMCA 1VCMA 3LX5A 3B48A 2WJPA 4KI0A 2J45A 1DG3A 5TQ2A 1Z5ZA 5CD1A 1VCOA 3RO7A 1NC1A 1VJ0A 2GJKA 3E9ZA 3RVOA 4CEHB 5JAOA 2RONA 5HHTA 4FDMA 2R44A 5IABA 3WGZA 5KQSA 1IZ7A 1EAYA 4OL9A 1W581 4P35A 3MBKA 4KLAA 3ZZ1A 3GZTB 4KBYA 5KAMA 4AZSA 1CQIB 2NO9A 1UMKA 4RDHA 1WUHS 3AIKA 4CIVA 4CKBA 4FGUA 1CUUA 4OJYA 3KUUA 3X1WA 4HFJA 4ZFNA 3HR4A 5EC8A 2W2TA 1JDNA 1M0SA 2D1RA 2VT2A 3CF0A 3DFFA 5E38A 1Y4DE 4F2WA 1O5TA 1YAJA 4YAJA 3OMWA 3ADDA 1XZJA 4C6RA 2P4HX 5JATA 1LWOA 4O1IA 3WK5A 3TL3A 3ZBQA 3O47A 4PHHA 4QNMA 1HI9A 1KJ8A 1M1YB 2X13A 2I71A 2IP1A 3EF1A 2IJGX 2FLVA 4QQNA 4TMTA 4HTFA 4UDXX 2CKDA 4PSKA 1RU3A 3EC1A 4TKUB 1L9XA 3RYFB 2N42A 1PSDA 1T5DX 1Q83A 4JBGA 4COKA 1ZK1A 1UL1X 1F2UA 3LW8A 1XO1A 1WULS 2XNHA 3TQQA 1I6LA 3ANMA 3I6QA 1P9NA 1L4LA 2QDXA 3DT6A 3OQ6A 4OQPA 2VCYA 4FGJA 1I2MA 4H2DA 4H35A 4PLFA 2BY4A 1E3LA 4YRQA 1IRXA 3L01A 6AT1A 3ZLUA 1C1XB 1WXXA 2C4NA 3CYFA 1A88A 3LT5A 3M6FA 5IJ9A 2MSWA 1J9GA 4P5EA 1VA4A 1LKZA 4RA6A 1HQKA 3WLQA 2Z2YA 2LCQA 2CYBA 5HFAA 2M2IA 2XVXA 4DQKA 2BFFB 3HU1A 4JI2B 4EVIA 4WHMA 4DV0B 2IBSA 5JO9A 2B34A 4O1MA 1OOEA 5K8LA 2DTXA 3A6DA 4N0EA 3OQOA 2GTPA 3VUFA 2IYQA 4CMIA 4BC0A 4JYMA 1GN8A 1ZK0A 1YFZA 1PUJA 2JBAB 4UCWA 4PVDA 5DEOA 3KAKA 2Q9UA 3L6BA 4CM8B 2QMOA 4U5XA 4ALMA 4V1CB 5IKPA 1RXYA 3ZJTA 3E7PA 2I6UA 4QO7A 4W7SA 1CDOA 1G2IA 1XQXA 2CEKA 4ZTBA 3RT7A 1XP5A 3OG9A 4B40A 2GBPA 6ABPA 4MV5A 3A2KA 2RSLA 1NU6A 2A67A 3KVRA 3OHPA 4DIOA 1KJIA 2Q3EA 3DJFA 2YVUA 1YZYA 1HOTA 1P5RA 3IUBA 1ISGA 4PCAA 3WYCA 1QG0A 2BMVA 1KDVA 4FE4A 3RH0A 1QLHA 5F7ZA 4WY8A 3SIRA 2BKVA 3IJPA 2C7BA 1GAQA 5FOSA 4W82A 4CR7A 1U3CA 4RV9A 4P3YA 4PY2A 2APJA 2JH3A 4RPGA 3X3HA 1U90A 2Y6VA 5JQGB 5JY6A 3VKGA 3NCHA 3PFFA 3H2IA 3NAGA 3CNQS 5AHKA 5JROA 1BGVA 4URFA 1TEZA 1X9IA 4EG1A 3WYAA 1J0BA 1J1IA 1QHHA 4FHFA 1MABB 2P6PA 4OK3A 4RV5A 1GPJA 4YPVA 3EXEA 3W1WA 1RXEA 1YSCA 5E6SA 3WWCA 1JR2A 2GJAA 1KYIA 3IBTA 1LSOA 1L7EA 4U3JA 3SF0A 4CIAA 3NCTA 2IOHA 1I7LA 4IDEA 1XEXA 3W2IA 1EGVB 1WMBA 2EZ4A 3WNCA 1J25A 1R6XA 1S2MA 3V34A 3A9VA 3D7NA 3P19A 1XZBA 5CYGA 1FW6A 1RTTA 1W5SA 1E9FA 4MS4A 3KK0A 4A7PA 5K8VA 4TPKA 1BMFD 1FYDA 1MG0A 3TFQA 4ZQBA 1OV4A 1TQ6A 2ZAMA 4M1TA 2PS9A 1XYYA 4EKDA 2EARA 3ELUA 3TW8B 3SHFA 1CUDA 2JJ1D 2Q45A 3G1TA 2DUMA 1AKNA 1NVMB 2W6IA 4RHTA 2YZMA 1BN6A 3I37X 4LMPA 4LWQA 1W87A 2XQVA 3QJYA 4I6JA 2XRFA 1NVEA 3DUFA 4FMBB 4IUCS 4ZT6A 3I62A 4MO2A 3QMVA 3BKXA 4AXBA 2Z5GA 2OEPA 1MDFA 3OWHA 5BNZA 4D98A 4AS1A 1HL3A 4HMPA 4XM2A 3FHLA 3JD0A 4B6SA 2ODNA 4AYTA 3L9WA 1BCSB 4MQUA 3R7SA 1OYYA 3LAWA 4MR9A 2NW6A 3ZE2B 2XGGA 2XH8A 4HWKA 1F5NA 1I3OA 2FPKA 2ID4A 3CRZA 4LJYA 4B73A 4IP0A 4HDSA 1POWA 1RYEA 4YMSA 1JQ5A 3FOAA 1ISRA 5EIFA 5JSYA 1ID8A 3E22B 1GZVA 2PKQP 1XMSA 4IIJB 3UWOA 3OFND 1IY9A 2K5UA 5EJMA 1BOFA 3GLFA 1U2GA 1MNAA 2CHEA 3JQFC 4FHZA 5EWJB 2WYVA 2OHVA 1KVTA 3S2GA 1EINA 3OM8A 3M4ZA 5ECGC 2CVZA 1CZUA 2AFVA 2OWDA 2OSVA 3A6JA 3BFJA 1G7SA 3X1KA 4XWOA 1QP8A 1RQGA 4IIUA 3UW3A 4C21A 1O97D 3OEED 1AN9A 2E7ZA 2HFKA 4RJ2A 4CRWB 3U44A 3BGVA 5FAKA 3H1PA 4F97A 4JUIA 1A1SA 1VJTA 1AO3A 1GCUA 1X7DA 2C96A 3MQ4A 4F96A 4EMUA 5HW0A 5JTUA 1WUJS 4NFSA 2HCTA 3IDSA 4UHFA 3RUFA 3CHYA 5DCWA 4FNOA 1G59A 2ZE7A 1NF9A 2GTIA 4UXIA 4YBZA 1P0MA 3GD5A 1YRAA 3SZMA 1OA0A 4NCBA 3K53A 1KBZA 4B3CA 2HU5A 5SYMA 3OJWA 4DCPA 1DBSA 2WTMA 3R77A 4K26A 3NPAA 5EP4A 4ZGGA 1E3JA 2FFAA 2HO5A 5JAMA 1JEQA 4FWBA 3HFGA 2YICA 4BO6A 3AFMA 4B71A 4B82A 4EYGA 1U9JA 1R66A 2H4YA 1DTWA 1IOWA 1G5HA 2C2BA 4XYBA 1OTXA 1WDMA 3EXHA 1E3SA 1XAJA 2H2FA 2RCYA 3EQZA 4HQRA 4Q12A 3RTEA 3QJ5A 4CZ2A 3I53A 3E70C 4MIEA 5K2OA 2C99A 3BGDA 3WNBA 2O2IA 4ZVNA 1C7QA 1XEWY 3V7UA 3LFHA 3C43A 1EAMA 1WHSB 4TLBA 2V0NA 1E8DA 2XTMA 4H15A 4PX9A 5LBIA 5E6RA 2PQ2A 4AX8A 5C8YB 1PJ3A 5EUCA 5I9NA 1DJOA 3L4BA 4TS1A 3DDOA 3BMOA 5KKCA 3AERB 1F0KA 2DKNA 1H6AA 2IHKA 2JIRA 1L5KA 3AJDA 4LDRA 4RKEA 3UJ9A 1E9EA 4DM7A 4I1UA 1CV2A 2OKGA 2FX5A 4C6HA 3EEQA 4PZ9A 4YI3A 5GQSA 3VJKA 4RTMA 1NUTA 3OLVA 4HY3A 2VI5A 3ER8A 1OPXA 7AT1A 2G7MC 1M2HA 1JQ3A 3UUEA 2D1TA 1LV7A 1SVNA 2Q5JA 3NXKA 4PYNA 3E15A 3WIUA 1XI2A 1AF7A 4XKJA 5KHAA 1E2LA 1GPKA 1KMHA 3WSVA 1LUAA 1ETHA 5B1IA 1Z5GA 4C3OB 2XCOA 5LXTB 1YGYA 2QQ5A 2HI0A 3GDGA 5IUKC 2PWZA 3T5CA 1OJLA 5KI6A 4E32A 4G0NA 4UPVA 3E7XA 3WLPA 3D4LA 2FQYA 3HYSA 5EIWA 4Q4LA 4MQEA 5JASA 3LBHA 4MP3A 5LDDC 4ZYUA 5BN3A 3L9XA 4XM1A 4E3ZA 1KJZA 3PXAA 2CCJA 1LDGA 2FK7A 2J3QA 4MUNA 1Y98A 1FK8A 1I7NA 4MI6A 3T0GA 3ISJA 5AVQA 4ZVLA 2ZIZA 3RG8A 5JY1A 5EKXA 2CYCA 2EP5A 1DUSA 1P2TA 2JNWA 2W6OA 3M1LA 4WSOA 3SF8B 2H07A 2ISSD 1L4UA 2B2CA 2O8CA 1UXIA 3AP1A 3DA8A 2JFBA 4J4BA 1JNYA 5K8IA 3S8YA 1JI3A 1XDGA 2FE4A 1KYZA 1GA6A 1WQ4A 2I6FA 2XYPA 3KSZO 5BW6B 4C07A 1HG0A 3FPBA 2HMYB 3NRCA 4C2AA 2WUEA 5CDTA 5CLIA 2X7XA 1G38A 3ES9A 4KB5A 4IH9A 3KZXA 3AM3A 4R84A 1EBBA 2NT4A 4Z8YA 2WHQA 4J2OA 4UNNA 2SHKA 4LY9A 5F5XA 2QHXA 1YCFA 4KN5A 1A2KC 1S2LA 2XY4A 1FNDA 3BM5A 2C9BA 1U94A 4UHBA 1JSCA 1Z6PA 3KQMA 5EXSA 1JPNA 3I5MA 5ELLA 2GPSA 5C7YA 1AZWA 3CXRA 1EXDA 1BXRB 5ALTA 4BVGA 1HQYE 3V3TA 1CETA 2FWMX 4R71A 4JP2A 1PR9A 1EP1B 1KMIY 1GKUB 2F9FA 4O3FA 1R5OA 3BRSA 4X84A 4YAFA 2HADA 3SX2A 4UEQA 3C6MA 5PGMA 4BAUA 1NGSA 1ZUIA 4D0SA 1XMVA 2O8BB 1ZR4A 1L5NA 3DP7A 1EFTA 1HT0A 1ZU4A 1WR8A 4Q4AA 3GGOA 3FCAA 4QOJA 4C7KA 4KN8A 2REXB 1MA0A 3JQ7A 2GZDA 4D41A 1OZ0A 1ZIOA 3EYWA 4X1IA 1YR2A 3B89A 1XWWA 1QDLB 4PTLA 2XUGA 4PRKA 3ZHRA 1FW8A 1X1QA 4I55B 2IHVA 2HUNA 2ZSDA 5EZYA 1CEXA 1BFKA 1LTHR 2EGGA 2ZREA 1J5PA 1SKYB 1ZIYA 1U0RA 1B4DA 3DVLA 2R65A 1XFAA 4H60A 4PNEA 4TTRA 1CP2A 1ZH2A 2FFRA 4GDMA 5DCYA 2C84A 5CFOA 5HR5A 3DW3X 1ISPA 3LC0A 4A27A 2VRCA 5DP2A 1TMGE 5MGBA 3Q6IA 4FIZA 4UMDA 2EG9A 1Z75A 3QG5A 1TM4E 2ZDGA 3H2JA 3OZBA 1KAEA 1KI2A 2PWAA 2WG1A 4MWEA 5LMZA 4MUHA 1P0IA 4AWBA 3GLTA 4GEGA 3SEFA 4BLRA 2XECA 4L2IA 5I8PA 3UGQA 1P6QA 1WXEA 4OFZA 3NM4A 3BEDA 1YXMA 3HGMA 3OZFA 4Z3DA 4I46A 3S8EA 3FZQA 1G8SA 4W8GA 5A4AA 4E5MA 1L7DA 3IAS1 1IU9A 4KI7A 1N1MA 5CVUA 1G0OA 2CNWD 3IALA 1K4MA 1C29B 5GPBA 1VG0B 5JI2E 1DS6A 2ZSUA 4BJ3A 1AH2A 4LTDA 1J99A 1XQ1A 1ZONA 1FJHA 1I01A 5BT9A 2EBWA 5KVSA 5BNTA 4XPIB 4GKBA 2XQIA 5A3QA 3AQIA 1BKDR 2W2QA 3JXEA 2WJZB 5BQ3A 1HLFA 2ZRPA 3B9RA 2IV3A 1JDBB 2JIPA 1JWLA 3PE6A 4G25A 2P6OA 4J0FA 3ROFA 1NJ1A 1A69A 3UXMA 1XKTA 3EA0A 2WM9B 3DFKA 3PD1A 2P2SA 1S2IA 3W5HA 5C7LO 4URXR 4AT1A 1P2BA 5F9MA 1T1GA 3BIJA 3MTQA 2WT9A 3FDZB 2CL6X 4KIJA 5JSKA 4TQGA 1JJ7A 3NYWA 3RVQA 3JYHA 3ZY6A 1UC8A 2CDCA 4KPUB 2Z30A 1K8XB 1S1CA 4RCZA 2EZ9A 3VKVA 4GSKA 3I9MA 4B84A 1Z6GA 3VPGA 4RK5A 4XSHA 5CBPA 5LIPA 2AHRA 3ESYA 1UBRS 4G86A 3UAWA 2BM8A 4DLZA 3AEXA 2NG1A 2A6PA 3ET4A 4W9NC 1U02A 2GPNA 2VNKA 3OUTA 4F8YA 1KMQA 2VP0A 3NV9A 5CVDA 2SNIE 2XJ4A 3E81A 2J7PD 4MW5A 4CMEC 3T41A 2A30A 4Z4GA 4HVLA 1EB9A 4P7KA 4CM5A 5I9BA 4ZYLA 1MO2A 2DUWA 3K16A 2VA9A 3QI7A 4GGPA 4TL7A 4ND6A 2BP7A 4YRZA 5BO5A 4YACA 5ALRA 4OJNA 1P4AA 5B1EA 2JD1A 3SLKA 3T9EA 3CH6A 1YA6A 1K86A 1W76A 2PIDA 3CQ9A 3O8QB 1C14A 5FT9A 1L4YA 3TW0A 1XA3A 2W6PA 3KYJB 3B9BA 3M8KA 4X1OA 3WJ1A 3NVKI 4L4RA 3OF5A 4JT4A 1MBZA 1P0FA 3E8MA 3GU3A 4QJBA 3TOXA 5KBYA 1HEYA 1V4NA 2O8EB 3PHBE 2DR0A 3ZI4A 1U8XX 1JKJB 4QBGB 3K2BA 1OE0A 1PLLA 4Y0AA 2F8MA 1GNQA 1NF3A 2Y92A 5EJGA 1NDHA 2Z6UA 1J2UA 4FR2A 1E7RA 3RE1A 4C14A 4FFPA 1OBVA 5JMWA 2OHXA 3K6RA 3N0XA 4TTPA 3EFOA 4IDPA 5KDLA 1W4RA 2QN1A 2RI6A 2Z3VA 3UPTA 2OXEA 2R6JA 3GWGA 5EQTA 1XR3A 3K9HA 1VJCA 2BHSA 2AXPA 2CHGA 2F90A 2PGOA 3L7BA 3NJ8A 3OE1A 4IDQA 4ZDJA 4PNPA 3QHPA 2I91A 3VHRA 2QP9X 3WYNA 2JD0A 1V3TA 3PEFA 4GYYA 1EWKA 4IGIA 4INAA 4HUQB 4UM5A 4F2PA 3TJZA 1EJ0A 1I1OA 1A8IA 4M49A 1WEHA 5G4KB 2DFKB 3F90A 1T8WA 4A26A 3B3FA 1OFIA 3D3JA 3QWAA 4OXIA 1YMUA 1WQ1R 2OQVA 3WBKA 1HF3A 4D8TA 5CXQA 1DAOA 4PIMA 1CJKC 4D9CA 2W90A 2YIDA 1W4BA 1YBAA 3IMEA 5DGTA 1NNLA 2QL7A 3H5AA 2CJFA 1CU1A 2VXBA 3FZEA 4ZO4A 2Y9MB 2WDZA 1RZUA 2IYVA 2WILA 3DLAA 1TM1E 3LIPA 3NASA 3WDKA 1PSWA 3JQ9C 4A0HA 3EIEA 4EHKA 2VNSA 1H94A 1BWQA 2COKA 1M5UA 4QDTA 3KT0A 3HNPA 1OTHA 3CLTC 3SMVA 2YV4A 1DADA 1PT9A 2I03A 2OXRA 5LLTA 4MKGA 5DPMA 1KVUA 1SUAA 2QN8A 1LDYA 4KSYA 1OASA 5FOWA 4Z4IA 1SBNE 1NUPA 3KPVA 3CJQA 3O91A 3K9GA 1G8KA 5MN6A 3GLGE 2EZUA 4MMYB 4P7FA 3KKEA 1P91A 4M46A 1JLHA 4G0ZA 1GJRA 1WPGA 1H23A 2C07A 1HE3A 2ZJ8A 3ZW8A 1A50B 1ZVJA 2POQX 1R88A 1DO2A 1H0RA 1Y3DE 5LYJA 1RI1A 2B20A 3DCNA 3FZGA 4DJEC 4JLJA 3NEAA 4D5GA 1X39A 1RBQA 1YL5A 2FKNA 1WO8A 2PX0A 3A27A 1KVRA 2X0IA 3O90A 1E1RD 2PWBA 5AJHA 2ZIXA 5FI1B 5ILOA 2NVOA 3HLTA 1JEYA 3ZWAA 1PTJC 1PV1A 2IYNA 3B1KA 3SJBA 3PTAA 3DEAA 5DV9A 2C3OA 5AW6A 4UHHA 2ZAYA 3ZS9A 4DAEA 3IQXA 3RRFA 1U0FA 1ZRMA 1CG6A 2JC3A 4ZVKA 2H0AA 2GJ4A 1ESMA 3GVXA 3ZJYA 4MLZA 3DKPA 1AC5A 2A5DA 3WGNA 2IZ1A 1NJ6A 1UANA 2DQYA 2AJBA 3AKCA 3A4IA 3SHWA 4J91A 2QRPA 3B38A 3INYA 2X9QA 1OAKA 4XR9A 4MUEA 4OCZA 3V1KA 3WQHA 4EP1A 2AK3A 2ABWA 5T64A 5ICCA 1OIVA 1R0XA 1RW4A 1P9WA 4GSYA 4WRRA 1KETA 2BDTA 1QOQB 2NNLD 3N70A 2Z2XA 4HNSA 1IN7A 4IIDA 4D0NA 2YJ3A 1UWVA 4M88A 3AI1A 4E12A 2JL1A 3I3SR 3NYRA 4MWBA 3OF3A 5JNUA 2QMHA 4LRYA 4RGVA 5K3DA 3REOA 3VYSB 4QT0A 1BXGB 2HDOA 4YLYA 1WBBA 2CJWA 2R1UA 2YDYA 2Z1NA 1KTVA 4KQHA 1NVVR 1G20E 3VGPA 1JSXA 4EGAA 4EDHA 1QTRA 5F3WB 3PFCA 2GUWA 2HGSA 2JFUA 3UFXB 3TNJA 1L5HB 3GZJA 3GDHA 4JVLA 4YJHB 5GIOE 3E9DA 3FTPA 4U7GA 1VM6A 2WHEA 3ZDRA 3GGDA 1B6SA 4ID3A 4FZVA 4IV5A 3RSOA 1YOVA 4MRVA 1U1EA 4HQ6A 2VUHB 5THQA 4UAUA 2V3CC 5DLYA 3UW1A 1ULBA 2YHIB 1LXCA 2H5EA 4HO1X 1W0JA 5ECWA 5B2ZA 1M7HA 4LA4A 1UJ5A 1UPTA 4GXNA 5KKAA 3D5QA 3VPBA 4D4KA 3BDIA 5A7HA 2ZRAA 4JB2A 4CE6A 1NONA 1YNOA 5KX5B 4XWWA 1EWTA 4JXZA 1J1ZA 1YKSA 4MRMA 1X87A 4NHOA 1ZY2A 3AJ9A 4KXFB 2GK6A 4J6EA 1DC4A 3FYUA 4OOFA 2YS7A 4AI6A 2Y1GA 3U7HB 4V0QA 2V45A 2Q9AA 1WKBA 3BMQB 1G5IA 4MO9A 4MVJG 4YXWD 1OW3B 1DKLA 2FG5A 2IY7A 3DDCA 4LYHA 4PTZA 2VF2A 5IT9A 5F51A 2HOQA 3KSMA 4KWEA 4S3MA 2AG6A 3YASA 3FXAA 5KYYB 2GAIA 4BEBA 5DNCA 8MHTA 1Z36A 2H48A 2I2BA 5LP6C 1SXHA 2GJ9A 2MSDB 4TLCA 1P8JA 3N0WA 4X6LA 5A9SA 1BW9A 3KKMA 3MCUA 2YNMD 3SD7A 3UHJA 4DQVA 3PRKE 1TYEB 3K6SB 4JD5A 1YB1A 2LPMA 4OA5A 1HDGO 5BVGB 4Z8XA 1V1RA 1TF2A 4A8JA 5DOVA 4PS1A 1N75A 3WHIA 1GGHA 2DFPA 4RYDA 4WZBE 4H17A 2PUGA 2ZKLA 5CR9A 3P9QA 1T3SA 3OLCX 4X8LA 5BN4A 1B0AA 1CERA 1TZ2A 3HDVA 2EF1A 3UWMA 3A6PC 3ET5A 4LJAA 2AR7A 3D1JA 4DARA 5MGNA 1OVGA 3QE4A 3KEMA 4IDOA 3E5HA 1Q2XA 5HFJA 2XNJA 1JEJA 1U6IA 5CMLA 2OOKA 1LPOA 1SKQA 1YZ3A 1JLRA 1GPNA 2X3FA 1ZNXA 3H2BA 3HYNA 5EIOA 3R76A 1OCEA 3AUTA 1P2FA 1L7QA 1J06A 2FJUA 2GBLA 2H17A 2VK8A 1Z7BA 1GY8A 3OIFA 4HQOA 4I5DA 4IMIB 3RKRA 4C20A 2FG7C 2FY8A 4HJRA 3JD2A 3RFVA 4KK4A 3BL8A 1DRWA 3MWDB 4NWIA 5E9AA 4QEZA 1OT3A 3C1OA 5AI0A 3T7IA 3T9DA 3DLHA 5TR9A 5EP3A 4HZIA 3INRA 4UARA 1GUZA 3VV2A 1AUXA 3U3OA 1QZZA 3K0CC 2XKJE 4ALIA 1DKOA 1R6UA 1R4NA 2P78A 4I9GA 3GJTA 5JS8A 2HYIC 2ZQZA 2WD7B 1RKVA 2WYUA 3UK7A 4ARZA 4GLOA 4YJFA 3H2ZA 2DH6A 7MHTA 2HJSA 1V2GA 1SZDA 4LSZA 4N0DA 4K9RA 3AR5A 1UBJS 5AHOA 3T7EA 5A9RA 3DDHA 2EFJA 4TZ6A 1WHTA 1XRPA 4KFSA 4ZC8A 2BI4A 2QD1A 4BL5A 4M22A 4F4UA 1GCGA 3TVDA 3GUYA 4GPAA 1WSWA 1Z2NX 1L6RA 4YH1A 5GIPE 4BDSA 1U9ZA 3A1NA 2FKAA 3T94A 2BGLA 1XK7A 4M0MA 1T2NA 3SHQA 1GTJ1 5AKYA 2OCYC 3AOGA 2EWWA 3O0DA 4YP0A 3P2YA 3NBQA 1Z2DA 2JLWA 2NQ2C 2FSSA 3FDFA 5AVOA 1Z0FA 1FFCA 1OU4A 2B7LA 2CFOA 2ZFUA 3MB8A 3PF8A 2F9MA 2X6QA 4PGHA 1VOTA 5A9TA 4KV9A 3O2NA 1PDWA 3Q3JB 1YB7A 1B00A 2K6GA 4BQSA 5C8ZA 1N5JA 3ZU5A 3MRXA 4ZWNA 5C1PA 3MBOA 2VK1A 1KIAA 5MN5A 4Y2UA 4JMPA 4G84A 4CNBA 4BNFA 4H6VA 4C0KA 4MGIR 1T0HB 2FSVA 3OCZA 2GN0A 3WAGA 1X1TA 4R8MA 1L5LA 3PNPA 4NBRA 2FR1A 2OBXA 3ZCTA 1Y1KE 2G4CA 5F78A 2CF5A 4J3JA 1NKTA 4TV8B 1D09A 3LQFA 4LVCA 4ZO9A 2IS4A 3WL5A 1ORDA 5BYJA 1NKSA 1XF1A 2A0KA 2XYRA 4GPD1 4J9UE 1QTNA 4LCEA 2YWXA 3EZ2A 4L9RA 4YCLA 3JVIA 3R3UA 5C34B 5JR3A 1Q0PA 2ZSHA 1KXZA 4R2XA 4DRXA 1NVVQ 5I5EA 2PX8A 1AHNA 3WMWA 3A4TA 1M73E 3EG9B 4JAVC 1MW8X 3WYFA 2CF6A 5U1PA 2ENUA 4OLJA 1RLUA 1YBHA 3I2HA 5LNK1 3HO6A 3I8XA 1UJ4A 3ND5A 2BFOA 2PLNA 3LC7O 5JU6A 1IN1A 2B69A 1PW5A 2ODQA 4NYJR 3SC2B 2NTVA 4Y0VA 1MFZA 5IG2A 4J16C 2PU7A 3M4NA 2XW6A 1CY7A 4X1KB 1RLTA 4I1RA 4JC4A 4I1OA 4CFSA 4YMLA 3W5BA 4RIIA 3FCUB 2GASA 3O5AA 3T0FA 2JAXA 4CHGA 4LKRA 2ORED 2RHDA 1LEHA 2AC2A 4C7BA 3PJGA 3HRIA 5EAIA 2FQQA 3HSYA 3CE6A 3N3AC 3BBPA 4IUYA 1O96A 2FB9A 3GGCA 2CBXA 1ZHFA 3HCOA 3L84A 1Y1RA 1N2OA 5FQNA 5JALA 2J48A 4GO1A 1YF3A 1C9NA 3LY8A 3QOYA 4DY4A 1A9OA 1L5RA 3UOWA 3ZWKA 5EHXA 2X8JB 3ESCA 1ULHA 1TM3E 1YQ9A 4AIIA 2IOYA 3KQKA 1ZI6A 1Q12A 1G9XA 1CBUA 1XRNA 1I0IA 3H9GA 4E46A 2I76A 1C8VB 4CKZA 2H1OA 2IVZA 2P9QA 3MHTA 2MCFA 4F6RA 2YY6A 2QIPA 3LI2A 1QWOA 3WL3A 2IEGA 3D8SA 1EP9A 3OM1A 4NABA 3RFUA 1IHOA 5BV2P 4ENUA 2P3OA 1E6KA 1R6AA 3A04A 3JWIA 1XKLA 2QYHA 5J23A 1NBHA 1VBFA 4YUAA 2XUIA 4DMCA 1GAWA 2FZCA 3DXXA 3EIQA 1R6BX 1WPRA 4TTVA 4BVKA 1M1YE 5JIBA 2BKEA 3L1KA 4FC6A 4FS8A 4R9RA 2PWPA 3A3OA 1H6DA 4OXXA 2ZRIA 2R1ZA 3DBHB 4JP3A 4BNZA 2C9ZA 3TEMA 1G8MA 4BTLA 1O2DA 3K0HA 4F4DA 5K6AA 2BCJQ 2OV1A 2FEOA 3TECE 4BX0A 1ISSA 1PEAA 1F8XA 1ULTA 4JOSA 3CLKA 4LGYA 4IJUA 1KEUA 1CF4A 4JL8A 4RZHA 3W5UA 1PVVA 1BYUA 2FCRA 1E9AA 4NSNA 5I7UA 1VLQA 1Y3IA 5J1TB 1ZVKA 4DPLA 1S3SA 4G9BA 3LT4A 2HW8A 1YQEA 3DXYA 3H1AA 5TF4A 3WLTA 2SKDA 2BR5A 4ZV9A 4IDFA 3TXYA 2ES4A 1L8AA 3AEQA 3EODA 3I9V1 3KB6A 3VHLB 4FT4A 2FFHA 2PRJA 3KR1A 3BE5A 3BGOS 4MH0R 2ONCA 4YRJA 5G1PA 5CVTA 1HT3A 5EG5A 3VO9A 3L5KA 5ADWA 5K3FA 5EIHA 1ETUA 3C5EA 2VJDA 2B99A 5ARDA 3EX7C 3E9YA 4D8XA 2ZYWX 3CW9A 1AJEA 4OAOA 4V0ME 2ZWPA 4A1OA 3GOHA 3OQMA 3L8GA 3G0DA 1CUSA 5ALQA 3C8MA 4JT2A 2WT8A 2WTBA 3GF4A 1P77A 2YWGA 4RL4A 4Q6BA 5IHPA 2OAGA 4ZPXA 4J07A 4GOJA 5M29A 1K6IA 2CW5A 1HYBA 3O8BA 2A92A 1ZFNA 5H3LA 1FFSA 3L4EA 3W5DA 3AESA 4M37A 1XCGB 2RAPA 2ZWIA 5HYVA 3TGLA 3LFUA 1D2MA 2JIMA 3FVRA 1T5BA 3HGTA 3TJRA 5J2TA 1CR6A 1KVQA 1VCHA 2WSBA 3NXSA 4RD0A 2P7HA 3DBLA 3GCWA 2Z5LA 3EPHA 2NZ8A 2LW7A 3ONFA 2ECPA 4G1CA 4UHDA 4ARAA 1J8MF 5BMVF 1XELA 4IMPA 3EISA 4DEXA 4R2IA 1SK8A 4YEDA 1JAYA 1I4WA 2NU8B 1D2GA 3ZV3A 4A82A 2VA8A 1OB2A 1JLLA 3W6PA 4GPZA 1HNNA 2HRBA 16PKA 1WA5A 3OQVA 4NK4A 3C1TA 4UNSA 5IKEA 1T2UA 1X13A 2IHJA 1SCUB 4CYMA 1U9YA 4GEKA 3BMNB 5JADA 1U65A 1R10A 4QHTA 1II8B 5DBOA 1UT5A 1L4EA 2FHPA 3GPIA 4CF3A 3DLPX 1DQSA 3CIOA 3GVHA 4HEA6 5D7BA 1WL8A 1FE8A 1BC5A 3UGTA 4DR4B 5J2TF 3CNNA 1LBSA 2R60A 3MJRA 3VMFA 3VZDA 3K9FC 4DN6A 1DUVG 1KO4A 2QP4A 4MQ6A 5ALYA 1QVAA 4AP5A 2RK6A 2UVQA 2TMGA 4W4TA 1HBJA 4JUBA 2WLTA 3ZUPA 1C1DB 2QTFA 2VS1A 1HY3A 2XITA 5L4LA 2XQKA 2J7KA 2O2HA 3W4JA 1Z8NA 2AMFA 1GA4A 3JZFA 2BJWA 4JBIA 4RPJA 3RW9A 2VFAA 1EUDA 3G0GA 3PT5A 4JLDA 2ZPTX 3QVMA 3HACA 1CEYA 4ZEWA 2PRZA 3V97A 3IUSA 4NYJQ 2WHXA 3MINB 4LQDA 4NESA 1YZHA 1BX0A 1LK0A 1N4DA 1ZW1A 2BFDA 2IV7A 3S68A 5IZCA 4ARCA 5FOVA 3A8TA 3LHSA 4B4UA 3TRFA 5AVTA 3G8CA 3QQ5A 4YAKA 3QU4A 4CN9A 3A6LA 5FWXB 2I7VA 2VR1A 1WXGA 5B64A 2JATA 4G97A 1UXOA 3FYSA 3K0FA 3QV1A 5TVKA 1UKVY 4GOOD 4DIKA 2XCTB 2FN7A 1Q7CA 1R2QA 2M6LA 3SSAA 5TPWA 1IXRC 1DXOA 3MERA 5FV7A 4NU0A 1M1ZA 1XAIA 2G9UA 1KKLA 1YE8A 3OQJA 2AW3A 3QWBA 4FJ2A 1SQFA 1T8UA 3R9XA 4G4IA 5JZMA 1Z3IX 3NAQA 3C3EA 2FVYA 2GK7A 2CBZA 2L0XA 4JI6B 4C05A 3UB3A 3ED1A 5K8JB 3DDSA 3WJAA 2ZT5A 1SCJA 2VT3A 4TZ0A 1SQ0A 4MVJM 1BE0A 4INJA 3CG4A 1V11A 4WZBA 1BMTA 1E20A 3DCYA 4KAJA 3V1UA 1SUDA 3VR1A 3FTQA 5LP6B 3LNTA 2OP0A 3RRNA 2C9OA 4S1VA 2ATIA 3QPVA 3A37A 3ZWVA 5J3JA 5D51S 2NADA 4N5DA 1AS0A 1YL6A 2ZXEA 3WTBA 2XJ9A 1VCNA 3QW4B 2B7BA 3U7EB 4L0CA 4R31A 5JSQA 1T6ZA 5CFLA 4U00A 1ZGBA 3BD7A 5CIYA 2OCBA 5BOSB 3DDWA 2O8FA 4QIHA 2ISQA 3LY5A 3U60B 1SA0B 3ZU4A 1JU9A 2FEWB 4TGLA 3GJ5A 3VAYA 2EYQA 5EPEA 1L3CA 2C2OA 5FTKA 3H1EA 5B3AA 3WYBA 4GE3A 4JSTA 4AKSA 2O59A 4RYLA 3I1JA 1RI5A 4E4RA 1T2VA 1VLVA 3M6MD 4HNTA 2MHCA 5GAJA 1UBFA 1N4AA 1NY6A 2ZIUB 2ZUCA 4DSTA 4I50B 4IEEA 3ZQUA 3IYLW 4CJXA 3FR8A 5JLAA 3FNEA 2YZGA 4X9XA 1CYEA 3UMSA 1ZL2A 3TPCA 3GNLA 1SXJC 4RXMA 3IGFA 4M9QA 4PX2A 3LSTA 2G0AA 3HPRA 3SXUB 3W4KA 1A8QA 1UINA 3LKVA 2B21A 3TQRA 4U7DA 1ODIA 4PZAA 1BHSA 2DWPA 4NEQA 3W04A 2D00A 1NBAA 1UFOA 2HY7A 5GV7A 1J23A 4PFSA 1AB6A 3MBIA 2R6HA 4WBXC 3CKMA 5J63A 1V47A 4XIIA 1IEWA 1U2SA 2ZK7A 1FYXA 1IL0A 1OXBB 3LX4A 4EIWA 4ZZ0A 4KC0A 1U2QA 4BO1A 3ZV5A 4R83A 3ZX4A 2H2WA 1FDVA 1QRRA 2ZJ3A 3S2UA 4ZYYA 5GVRA 1J8YF 4AJHA 2R5NA 1WZNA 4M8KA 2EGHA 5EMKA 3E4CA 4HTAA 1TAQA 4MPRA 4P38A 1WDWB 3L7CA 4KQWA 4QOFA 4C1NA 2WBLC 4B4OA 4TKZA 3BAFA 3P0JA 4TN1A 5LIRA 4C0QC 4JIMA 4EOGA 1WOMA 3AUXA 2JI8A 3IERA 5AOAA 4KQ1A 2R68A 3PGA1 5JH7B 3GAAA 4LF6B 4GLLA 2PPLA 5EE5B 4NU8X 4QNRA 2EDCA 3EIOA 2IITA 3KO8A 2YXEA 2ZI7A 1M7GA 1BWRA 2I1WA 3T0IA 2R7LA 2A1TS 4HX9A 4ACAA 5CB4F 3RWOA 1F4VA 3I01A 4BB0A 4EABA 1E1QA 4FYXA 2QTVB 2G67A 2OMEA 1U0JA 3ZE6A 421PA 3EBOA 5CXXA 2Q2NA 2VPXA 3IJRA 4RK6A 1MJNA 5IS2A 4WV3A 1AB5A 1KAHA 1BYIA 3DZGA 1Q7EA 2ZI6A 3TGWA 4B3BA 2D8MA 4MCIA 1ZNWA 2OHJA 3QWIA 4DLWA 3G2PA 4ZU1X 3V1MA 1XNRB 3ZYZA 1MHTA 3UV7A 4B6QA 4BQQA 4GRIA 3TXAA 5B4TA 3QF4A 5DTMA 5B1HA 3DOCA 3KWJA 2OM2A 4B3MB 4CHTA 4YREA 3N74A 2ZJ6A 3OZAA 3FMVA 3HXOA 2G72A 1DV2A 2GD0A 2PMWB 5GWXA 4IDDA 1TKCA 2BOVA 5T8KC 1SQ6A 3PNKA 4KE6A 3W90A 1E89A 1JLSA 4RK7A 3AVTA 1KFJB 1ENYA 1E96A 2XNDD 2VLIA 3G6KA 1E59A 3KPJA 1TEVA 4I2VA 3SQXA 3TL6A 4CN8A 4P4SB 4OJTA 1JMKC 3QUBA 4BO9A 1VRWA 1YR8A 4KX5A 3JQAA 4YP5A 3W1VA 3S70A 4CKWB 5LQKA 3CBGA 1AG9A 5DBFA 1FRFS 3CA8A 3LCJA 2BONA 3C8HA 1CNEA 4MINA 4V3BA 2C5GA 4YGYA 3RSQA 4OHWA 1R15A 2XCUA 4MS1B 1W35A 1RZVA 4A03A 2XVZA 3C3WA 1ADCA 4CTNA 3T3GA 4DJDC 1K7SN 3O03A 4W9MC 3OJFA 1Y4AE 1KTIA 1XPOA 2BFMA 2HN9A 2I9PA 1L4HA 1N6PA 3AF4A 4P54A 1PFYA 1ZINA 3P9RA 3OPYB 9ABPA 1PDVA 4AQYB 1T5LA 2QW1A 4W6QA 1WG8A 1YMVA 3U7QB 2EJUA 2V7BA 3A3PA 1A5SB 5DZSA 2WU4A 2VL7A 4TT8A 4BMPB 5AJZA 2JA2A 1FFHA 4X7RA 4CCAA 3MAJA 2P30A 3SZGA 4IIFA 4QHSA 3ZHTA 1N2BA 3ZIAA 3HV2A 1PUIA 1JECA 1ZH0A 1FS5A 2QTRA 2B8NA 3OJXA 2QYSA 4PFJA 1SCQA 4H6XA 1NV9A 1SKYE 4QOSA 4EL0A 4NOJA 2ZANA 3QUQA 1M1YA 3HCNA 4XW2A 2IDKA 2KI5A 3VSBA 2D54A 3BULA 2C5LA 5IBCA 1S8OA 3GP5A 5K0FA 3V7NA 4LNAA 4XLLA 1QPZA 5FA6A 4OX9B 4RTNA 2IHBA 1EJ2A 4RGYA 3H1BA 4BQIA 3ICPA 1J8QA 3GA0A 3ORYA 1R0YA 1V8FA 1VXOA 3OF2A 2PGLA 4KKVA 2FFJA 2VP9A 1PZHA 2XE4A 3GT4A 4RK0A 3IMCA 1H9BA 1QNFA 1KJJA 4M1SA 2B7CA 4OLHA 3CTPA 3UC5A 1ID1A 4BNVA 1KEPA 2C9MA 4QDKA 5CFZA 5CT4A 3K0SA 1TFUA 3CZ9A 1C7RA 2OAP1 1UMBB 2QPTA 3BHMA 4UOEA 5EJEA 1C1XA 2GEBA 4HDNB 1Z4IA 4EUKA 1RQPA 5CK5A 2JBWA 1EFCA 3E03A 1XVIA 3RWBA 2WP0A 3ENWA 3OKFA 3LO8A 4CW7A 3WOHA 1U7WA 4TM8A 4EB6A 3W8RA 5JCOA 3ETDA 3GJQA 1N6KA 1ZM4A 2AG0A 3D6NB 3RYIB 3ZEIA 1QTQA 3DT9A 3FFAA 3HKDB 1QRAA 2V3VA 2AE1A 2CLEB 3R6TA 3AR9A 3CR3C 3T9CA 4Y2GA 5BR1A 3TEFA 3F1LA 3ETHA 3EZNA 4PLTA 4WLNA 2JBAA 4YV7A 4TMKA 1VSVA 3W9BA 5JYBA 4N41A 4YRMA 2A1TR 3TX6A 4N01A 2HRRA 1VGVA 4I8IA 4IDHA 1AM4D 1YDMA 1RJWA 1EX7A 4LMBA 1WEKA 1GKIA 3MK31 4Z3OA 3CW2A 4QUKA 4CM4B 1WUYA 2QORA 5JPIA 3OIWA 3DR5A 2AJDA 1YRLA 4KHPB 1D6JA 4TOIA 4AULA 4O2RA 4U1RA 3HA2A 1T9AA 4NBVA 1SGWA 3PA6A 5JQGA 4B4VA 4MROA 3J81A 1OYWA 1W1UA 2NZWA 2XMQA 3PC6A 5FR2A 4EZBA 4PCVA 5KNBA 3IPLA 2X8BA 3PWSA 5LOVF 3A4YA 3ZGVA 5CCBA 5A7GA 5KYWA 2IKSA 1AK1A 1M33A 4MV0A 2KLBA 5T4FA 1BVHA 1MABA 3ZZMA 3GLSA 1BEZA 3CSSA 1D5WA 2GETA 5DYYA 1TA0A 2Z9BA 3GRAA 4FDLA 3GP8A 1QP4A 2JZCA 3KJEA 4MRAA 3QBVA 3K32A 1PR0A 1HKHA 4WCFC 4X8HA 5DNEA 4Q47A 3RM3A 1BEEA 3PIDA 1L4KA 2P0YA 4EEZA 3PEWA 3KM0A 1JHRA 4ZKEA 3K72B 4FOLA 821PA 2DB3A 2RBEA 4JX9A 2E2WA 4DR2B 4CFYA 2Q28A 1GCOA 4DC0A 3C1UA 2H2GA 4PHFA 1QHYA 3LKBA 4UTPA 2DHEA 3GEIA 2WWHA 5DI3B 2HQSA 4M1MA 3QEBZ 3O8OB 3BSFA 3QA9A 2GSWA 2Z4TA 4URYR 1QWSA 1RFGE 2OTCA 3QTLA 4QVIA 3P9ZA 1JKFA 2OLEA 4BZXA 1BNCA 1SURA 1ZSVA 3HUDA 3E48A 3SSNA 3KZOA 2Q4DA 2J3JA 1E3EA 4L6IA 4QOGA 4PSCA 4B8YA 2R4UA 4FONA 3O6VA 1HZZC 2VP6A 2Y1XA 3A9CA 2YYSA 3HR8A 3U7JA 4Q4CA 4QDOA 1E4OA 1U7DA 2XYGA 1K2VN 4G5YA 2TSYB 3L1JA 1VHTA 3FOCA 2J6BA 2O4CA 4PX5A 1UMCB 3RFFA 4L3OA 5CFRA 1HLDA 3E61A 2OBFA 4FS3A 6ADHA 1BCSA 4D9JA 3ANSA 3FFBA 1RWQA 3BWVA 1SD1A 4MQFB 3T3EA 5FV4A 1AOXA 1Z06A 1N0UA 1ZGCA 2XZTA 1D8TA 3WL8A 2WNSA 4L5JA 2GA8A 2O3QA 2J0UA 2VSOA 2UV8A 4QOEA 2UXDB 4QXQA 3TLCA 4B7CA 1BXZA 4IIJA 2VP4A 1DL5A 1PJRA 3GRYA 4RF2A 2P2LA 5EWJA 3RU9A 1NYRA 4WNAA 3L8MA 5IJ0A 1NAIA 3KQWA 2Q8NA 3COPA 2CNDA 1Z45A 3NWPA 5H4HA 4E2ZA 4YIHA 3PHJA 3WDSA 3MGKA 4GECA 2YMLA 4KH0A 3FOEC 4EKIA 1WB9A 3WGTA 1ND5A 2YXBA 5DNDA 1QS0B 1DPFA 2AG8A 1C9MA 3IX7A 2AD1A 4HH4A 5D84A 1Z29A 2G07A 3A1SA 2IYLD 1SUBA 4IGAA 3SZUA 1K5HA 1GPLA 4JKYA 5HIIA 4EG6A 1UMDA 3X1ZA 2D7DA 1X86B 3ZXYA 1FFDA 3G2LA 3IKMB 2AR0A 2V55B 3LQ1A 5JZ9A 1AVTA 1IY2A 3G2HA 2VTEA 4WKGA 2FRVA 1RAHA 2IUFA 2ZCUA 1VL8A 2WJGA 1NX6A 1H4QA 2NGRA 1TKBA 1W52X 2E87A 2W98A 4R2MA 1GTMA 2DSTA 1LY1A 4YQYA 4TXHA 2AT1A 2JGDB 1XTTA 3QEJA 5JSFA 1RMTA 1XC7A 4G41A 3ELWA 1M0EA 3IO3A 4B45A 5K8CA 4CMKA 1DEAA 4AUNA 1GGMA 4GNKA 4QAQA 3WB2A 4BBJA 3IR5A 4MYSA 3PNSA 4TM7A 2NZ2A 5FI5A 4D2IA 4AFNA 5K8TA 2AN5A 2VTKA 3EOAI 2UXBB 3DCJA 3RBZA 1H9AA 1NBEA 5AVJA 1WHSA 3GVIA 4MVXA 5FFNA 4KPFC 4I4CA 3I28A 3KAJA 3MTIA 1C4WA 4BLSA 4M1KA 3KEOA 1LJ8A 1XK6A 2EERA 3GFVA 4TTIA 1SXJB 5EL0A 5L40A 3AERA 4O1HA 4KQGA 3AHDA 5EE1A 3RG2A 4D96A 5B7PA 4WFKA 5I4BA 5L4NA 4RABA 4BZZA 3IQEA 3ECSA 5ECYA 1KGDA 4AD8A 1LPPA 4M0LA 2E6UX 2EV9A 2H59A 1G3QA 3F8TA 1KFKB 4NMWA 1TMYA 3GPDG 4QYMA 5T3UA 1EDEA 1N7JA 4NENA 5HZGA 5K4GA 4PU0A 1WF6A 5C0OE 1EJBA 2ZYVX 3HWRA 4GUDA 4QRIA 2AG1A 1XVLA 4N7JA 1PR4A 3I9FA 4H7JA 2EKZA 5DLPA 5TY0A 1N2JA 4UXJA 1YBVA 1ML4A