3AJ9A

X-ray analysis of crystal of proteinase k obtained from d2o solution using peg 8000
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title High-resolution X-ray study of the effects of deuteration on crystal growth and the crystal structure of proteinase K
pubmed doi rcsb
molecule tags Hydrolase
total genus 104
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3aj9A00
2TECE 2SECE 1GTL1 1SIBE 1KDYA 2SBTA 3HJRA 3VHQA 1NDUA 1GTJ1 3F7OA 2QTWB 1KDZA 1BJRE 2SICE 1Y4DE 3UNXA 1AV7A 3EDYA 1PTKA 2Z2YA 3GT3A 1AF4A 3CNQS 2ZRQA 4WOBA 2ZWOA 1TM4E 1SUEA 4ZARA 5AQEA 2ID4A 2W2NA 3A3NA 1NDQA 1DBIA 5FBZA 2WUWE 4I0WB 3DE2X 1SELA 2W2PA 3LPCA 3VV3A 3PRKE 2DUJA 1PJ8A 3WHIA 1GTG1 4JP8A 1GNVA 1Y9ZA 1YU6A 2IY9A 1EGQA 3TI7A 2WV7A 1Q5PA 3AFGA 1Y4AE 5ARBA 3SICE 2G4VA 3AJ8A 1GA6A 4CFZA 1TECE 3A3OA 5JXJA 1SIUA 1SN7A 5CW1A 3WIVA 1BFUA 4OMCA 1Y48E 2Z58A 4MZDA 1TMGE 2WUVA 4H6WA 2ST1A 3VTAA 1WVMA 1BH6A 4LVOA 3I2YX 2B6NA 3DYBA 1AVTA 1BFKA 5ARCA 3DVRX 2ZWPA 2PMWB 4AKTA 3PTLA 1C3LA 1TO1E 1SH7A 1Y33E 3I34X 1SBIA 3CO0S 3D9QX 1MEEA 4HVLA 2IXTA 1NLUA 1WSDA 1PFGA 1Y1KE 3DE5X 5I9SA 3GCXA 4Z2AA 1SCNE 5ARDA 1C9JA 1CSEE 4H6VA 4OMDA 1LW6E 1SCAA 1TM5E 3Q5GA 4B5LA 1IAVA 1THMA 2E1PA 5FFNA 1T1EA 3DE3X 5SICE 1AK9A 2PRKA 1ZVJA 1JEAA 1SUPA 2PYZA 1V6CA 3I37X 3LPAA 4H6XA 5JXGA 1WMEA 4DWWA 1PEKE 2P4EA 4CFYA 2XTJA 4BWGA 2HD4A 1YJAA 1EA7A 1SUBA 1V5IA 1S01A 2Z30A 3Q40A 2W2QA 4RYDA 1SBTA 2SNIE 1ST3A 3F49S 3I30X 3ZXYA 1GCIA 1XF1A 1DUIA 4C3UA 2DP4E 4AKSA 4DZTA 1S2NA 4NE9A 2WWTA 1Y3CE 2W2MA 1SBCA 3DW3X 5JXHA 5AVKA 3TECE 2GKOA 5AMXA 3DVQX 3DWEX 4GI3A 4OV6B 1P7VA 1AQNA 3P5BA 4WOCA 4KPGA 1C9NA 1BE8A 4KG7A 4CG0A 3ZXXA 3OSZA 3F7MA 1TK2A 4M1ZA 4J94A 1GA4A 4NMXB 1KDVA 3BGOS 3DVSX 3T41A 1SBNE 2PWBA 3TI9A 1GA1A 1IC6A 1YJBA 3DE4X 3QFHA 3EIFA 1UBNA 3VYVA 1VSBA 1TO2E 3BX1A 1SUAA 4NE7A 3VSBA 4KB5A 3WIUA 4DJ5X 1A2QA 1C9MA 1YJCA 1SBHA 3GCWA 1P7WA 1ZVKA 1SIOA 1SUCA 1MPTA 1SVNA 5FAXA 1BE6A 2Z57A 3DDZX 2V8BA 5B1EA 1R0RE 1T1IA 3L1KA 3GT4A 1AH2A 3AJ9A 4YN3A 1GT91 2HPZA 4K8RB 1OYVA 3LXUX 1TM7E 2PQ2A 2W2OA 3D43A 3QTLA 1R6VA 4FONA 3LPDA 1KE1A 5B1DA 4ZOQI 3VV2A 1ST2A 3DE6X 1SUDA 2XRMA 1SCJA 3DE7X 1Y3FE 1KE2A 2PKCA 4LVNA 2Z2XA 1TM3E 5JMOA 1T1GA 3DE0X 5AVJA 3DW1X 2X8JB 1GNSA 2ID8A 5JXIA 5K7SA 1Y3DE 1Y34E 3A3PA 1SCBA 3SQOA 1R64A 4HX2A 4C3VA 1WMFA 2X8JA 3QMPA 2PWAA 1OT5A 1P8JA 1S02A 2DQKA 2Z2ZA 2Z56A 3DE1X 3WQBA 1SCDA 1OYOA 1AU9A 3H42B 3EE6A 1Y3BE 1TM1E 1SPBS 1WMDA 1HT3A 3BPSA 1CNMA
chains in the Genus database with same CATH superfamily
3ZE1B 1X0VA 2XWQA 4JBWA 3S7ZA 5JI2E 2PX5A 1NVUQ 2EL9A 4G89A 4IOKA 2YXNA 2BFDB 2WF7A 2XECA 3UKJA 5EZYB 3Q7EA 4Y2HA 5KYWA 4BRUA 2ZAOA 1H9BA 2QLNA 1ML4A 2WWIA 4EI2A 2IDZA 3KXLA 1BKDR 3HU2A 3IJPA 1QE3A 1H4TA 1Q1BA 2PGLA 3MJCA 4KGDA 2ENWA 4OAPA 4D02A 4DQVA 4FYYA 4OKIA 3GUHA 5FV4A 1E20A 1C3VA 3AR3A 1UDWA 2XGJA 4MJLA 1N33B 1HZZC 2P5UA 3EMBA 2WINI 4R81A 1KXZA 2AVDA 3K35A 4J0HA 4KK4A 5BQOA 1GZSA 4DHEA 3JR3A 1MABB 3ENWA 3GT3A 2IHJA 1FRNA 3K5IA 2BP7A 1VA5A 2WSSA 4RIHA 1DTWB 3BHIA 3G2JA 3OPVA 1P0CA 3OG9A 1Z7BA 4KIGA 1JDBC 3GX1A 1KDRA 3IKMB 4MQLA 1TCVA 3UUWA 3V7NA 4JSYA 4I55A 3B53X 4RADA 1WD7A 3KOZA 4OHMA 3VR6H 2E4VA 4N3GA 3VJRA 4C0KA 2GO7A 3HJFA 3VKUA 4CTOA 4BO7A 1SGWA 2WWXA 3LTEA 4NOLA 4XSGA 1EG2A 2HXYA 4E11A 2A4MA 3ZBQA 2PUFA 2WMNB 1YNSA 1OFUA 1P2BA 2XJ9A 1JDSA 1OWNA 3INYA 2FEXA 1C9KA 4TPKA 5AOCA 3OLCX 4IQ4A 4H1TA 1C3EA 1IBSA 4YFYA 4ZAFA 1N1DA 3WTBA 3ZQUA 1FLAA 2AR0A 2AEEA 4L76A 2AYZA 2G04A 2W00A 5EQJB 3DR3A 4AP6A 5ICEA 1HFKA 2D5LA 5KYXB 1Z2PX 4MULA 5DGCA 3IP1A 5JMWA 3MLEA 4R8LA 1A88A 3C6KA 3IKVA 5DYWA 2B1GA 3R6DA 4E2WA 1RLTA 1W93A 2PLRA 3FD8A 2A5JA 3LLVA 4C7BA 1FP6A 1LUAA 3K94A 3OJWA 3QU9A 2HLDA 3F2IA 3QPBA 3PRKE 3KT3A 2W7TA 5I45A 1NF8A 3LMKA 1FSZA 1NXOA 2QD5A 1ENOA 3SC2B 3HWWA 2JIDA 1JLMA 1K6EA 2H18A 5HW0A 2EP5A 3E0XA 3PC6A 2VP6A 1ZITA 1GLNA 4H59A 4MRPA 5D01A 4EH1A 1JG6A 3AY0A 3OD5A 4IM7A 1Q1EA 2XKAA 1U3UA 3EH2A 3TTWA 5HR5A 3O5AA 3OX1A 5GWXA 5IS2A 4R83A 3GEEA 4ZI7B 1CEXA 2H92A 3EQ9A 3ME5A 5ARBA 5I7HA 1U3TA 3KJHA 1ZNYA 3EZXA 2PH1A 4WKOA 3H5WA 5IARA 5F77A 1MB0A 5GZ3A 4YPVA 4WERA 3WXMA 5FHRA 4YHBA 4X9XA 2PX3A 1ZMOA 2FPPA 3GMDA 5CAEB 4EKEA 4UE6A 3FRHA 3VDXA 3FKSA 1NQTA 4LNHA 1J8FA 1Y48E 5HQJA 4F1KA 2VJKA 4QICA 3X43A 3ZHYA 2O7QA 4XYBA 5L9AA 4IUBS 1OSNA 1JTFA 1USWA 2WU1A 2AYYA 5ILOA 1GO2A 3CEMA 4XQCA 1UBSB 2QP3A 5FTWA 1KI9A 4ZT2A 1VPVA 1G41A 2PPVA 5D3KA 1W47A 3I32A 3LLMA 2W6NA 3CKKA 1TX4B 1GRCA 2PL1A 4BVEA 3ZVNA 4OLBA 2YNMA 1PG0A 3LKVA 1IRIA 3D8RA 1RAGA 4FSDA 1LRKA 2BV3A 3HCNA 1BFKA 3A4TA 5EZYF 3OIGA 4Z0TA 2FWIA 2DH6A 4CMIB 3WAGA 2JD2A 3VZQA 1TCCA 4M88A 2FE4A 3PWZA 4TMTA 1NDHA 3F67A 4G07A 3TRKA 4AKTA 4KSCA 4WEOA 2VYVA 2WAAA 1AC5A 5EZQA 2QSUA 2V7EA 4XJVA 1RXWA 4JOBA 2R8ZA 3R9WA 4K7JA 2D4AA 1QHNA 2QL7A 1W0KA 3AHIA 4KTVE 2AFHB 4AMBA 2WJJA 4IWXA 3A4NA 1ZRHA 2NNWB 1YKSA 3E9RA 4M87A 4A6PA 1QG4A 2JGJA 5LOVA 4RK1A 1RYBA 5CJ2A 4BDSA 5K0FA 3R8FA 3KL2A 1XLUA 2K4MA 2GM3A 4P2BA 3RSSA 1W85A 3BD6A 3JRWA 1OXTA 2L69A 2VOEA 4JBHA 2PUHA 1U9CA 3O2QB 2C5BA 4RBNA 5HMMA 2YJNA 4CHTA 4ZVTA 1JHYA 1UK8A 4C76A 5JAPA 1AGRA 1NLUA 1YHZA 3QSYA 1GQRA 1WSDA 2J1LA 1JGTA 2C2XA 4BY9E 2CMHA 2ZE5A 1XU9A 2NUTB 1PWYE 1X70A 4U2DA 5AKGA 4P1ZA 2B20A 2F9MA 2R66A 2JFOA 4QQFA 5ARDA 1O4WA 3WK6A 2QQGA 1NN1A 3DTVB 1VBKA 4QYWA 1IM5A 4MVJD 2R6R1 1L5MA 5TEVA 4L0MA 4G26A 2JZOA 2FZ4A 3RS3A 4CR6A 3V6MA 4G1EB 5F3DA 4AFNA 5IJAA 4A2QA 1E99A 2Y8EA 4KITB 4LVUA 1YQDA 1KH3A 3HVRA 4M1EA 4DA6A 1GCGA 1GEGA 2PNFA 5C8YF 3NEPX 2A57A 3ZHXA 3C3MA 4O2LA 3LX5A 4YMUA 1PE0A 1L1EA 1WLYA 3HEBA 3K73O 4V03A 5FFFA 2EAUA 1KR5A 4KGZA 1S4QA 2CBGA 2J5KA 4UCWA 1TVMA 4Q1FA 4FVTA 2P5SA 3D8UA 3PYMA 5E6UB 1UBGA 4H3VA 1M34B 4JT8A 5JZMA 3HDTA 3ONWA 1JX6A 4Q4CA 1G6OA 3UAZA 4Z4GA 1M0TA 4YAWA 1OXMA 2XB4A 3ITDA 1SQ6A 4E2ZA 4ZO4A 3ZQKA 1P3DA 1DKNA 1ZCAA 2P78A 3VO2A 1SXJD 3W77A 1NHGA 1HGXA 2AE1A 4QGFA 4L6CA 3LI2A 1EKXA 1OCEA 3TINA 3HVHA 2CJWA 4BFWA 1RTTA 1X1EA 2PEZA 3FX2A 1EFCA 3LUCA 4FS8A 3VSDA 1Z63A 4S04A 2GEVA 3RSGA 3RYFA 2ERYA 4F5YA 3C0KA 4ZI7F 2XRYA 3CXRA 5JJCA 3LKDA 5EWMA 2V7BA 3TO5A 4FNAA 4UBMA 3WLIA 2JI6A 4PQGA 1TF5A 4GKJB 4C5AA 1I6KA 5DM70 4G0ZA 5I9MA 3QW4B 4KPYA 3NHUA 1UJ6A 2BHNA 1SG6A 4JHLA 4X94A 2RGWA 1QQ6A 4WFIA 4J8PA 3MSXA 1PNTA 3TOZA 1NQAO 1PEKE 4AJ2A 2B1IA 3KHTA 1S8FA 1V41E 3FNIA 4LBYA 5F52A 2J85A 4CLRB 4GR4A 4UNIA 5CG2A 2XBUA 1T5TA 2YN0A 3O91A 2IODA 4XR4A 4GE3A 3HEMA 3WMXA 3EMDA 3RYIA 1P9WA 1R6XA 3U13A 5K03A 1S1MA 2XZDA 4EENA 1YVPA 4TS9A 1F8XA 4XX0B 1UKAA 1YR2A 3PNQA 2AKAB 4L5YA 1S01A 2R7NA 3AW8A 5CH8A 3MJDA 4GX0A 1OYWA 4O63O 3GJRA 4ZI3A 2HZBA 3ZBPA 3V33A 3CNNA 3MXTA 5IXYA 2PEYA 5AHWA 3VNSA 1FNSA 5CT6A 5ALZA 4PM4A 4D9HA 3F6CA 3TQOA 2Y2UA 3DTYA 3OJOA 5BSRA 2HPHA 1D2EA 4IHJA 8OHMA 2FPUA 1ST3A 4XM1A 1XIVA 3JAKA 4HXEB 5KMGA 4MWBA 1KAMA 2QTZA 3H2SA 3PK0A 3IXQA 4HWOA 2H1VA 3F47A 2QE6A 3QKRA 4OIMA 4Y6PA 2PMEA 4ZFNA 1BW9A 1OTHA 2FOLA 3QX7A 1CERA 4DLLA 2L42A 4UOZA 4HWSA 5DBGA 3FMPB 2F3RA 3A9RA 5HZKA 4P54A 1NZDA 3OZVA 2X40A 4WTOA 2BKEA 4IHKA 2O14A 4K9KA 5B55A 4JBNA 1P77A 1MVOA 1ADCA 2CZGA 2XNHA 3BXGA 4RVUA 3CCBA 2L18A 2JRCA 2Z3ZA 3AUJB 4BQOA 4AI6A 2DE0X 2IUFA 2WWYA 2AFIE 4NZMA 2WHXA 3TF5A 4WK4B 3IP9A 1QUEA 5LUAA 2HCRA 3ZDYB 2P2GA 3IV9A 4AO7A 4WZBA 3RVRA 1S1CA 3EARA 3NBFA 4D45A 2ZZNA 4RTNA 3QU5A 1QFYA 2P6OA 3L0OA 3MUFA 3OZ7A 5I9BA 3NH9A 4HDAA 3U3XA 4JR0A 2HSJA 5CUQA 3BYZA 2G9UA 4YWJA 3NKFA 4GBMA 3N2GB 5G4KA 3CBQA 4MW4A 2RKWA 4RHYA 4V39A 3RYTC 4GECA 4LDAA 2F4VB 3DQQA 2VP2A 2GN9A 1YBHA 2PT6A 4OFBA 3K0BA 4XOUA 4QPCA 1KQFA 2QR2A 3L04A 1IXKA 2A2ZA 4HSEA 4QO8A 5FIUA 1YB7A 4DCOA 2QGNA 4QGAA 3RVBA 3LA6A 4J0GA 1MX3A 4QGBA 4Q9NA 5KTKA 3EPLA 4LFBB 3L5OA 4Y8VA 5AKEA 2FQWA 1FNBA 4CDMA 3OEED 3FETA 5EJ5A 3ONDA 1ZUWA 1AHHA 3SU8A 3VUEA 2X41A 1TQ6A 1XTRA 3HJHA 3TTTA 1ZRMA 2OY0A 3PDCA 5AW8A 2C5SA 4TGLA 2O0LA 5C5CA 3WZMA 1HOXA 1P4HA 2WRZA 1BN7A 2CEKA 4PO9A 3NKLA 4YLGA 1KMHA 4HN4B 2FSVC 1D8AA 3HJCA 1ZUNA 3DAPA 5JI3E 5AOAA 2Q5JA 3O8RA 2XUPA 4URZR 4LJ5A 1KRHA 4O8ZA 1G98A 3QKWA 5JE8A 2HJSA 2B37A 3IVCA 3RWOA 2YJ5A 3EEQA 4JU8A 3K5WA 2X9VA 1D03A 3OCCA 1DMSA 1VLQA 5IJZA 4DUZB 1Z3IX 3ETEA 4L28A 1C7ZA 4I50A 2D1SA 3L8HA 3DEAA 3GAAA 4LCJA 4TROA 2ONJA 4YAUA 4TRRA 4WUVA 3D2BA 3PHBE 3LQ4A 2FDXA 3W2TA 1U3GA 2J48A 1GG9A 1UPUA 3H5RA 3QVGB 4RFSB 4MUYA 4QATA 4JENA 3SKVA 3U7JA 1Y6GA 4Y9RA 2K2QB 2HT1A 2YFKA 2CVQA 3A7DA 3WAKA 3AC0A 3IAFA 1G8JA 3OLQA 4Y2XA 2N1MA 3IVRA 1ISIA 2XYHA 3AUTA 4G1UC 3RU9A 1NNLA 4BWYA 5AJHA 4I9UA 3FOEC 4D97A 1WDMA 1I1HA 2QRNA 1GUBA 2RH5A 4JWTA 4Y1EA 3FYHA 2V7GA 4QREA 1TCAA 4NYMR 5L3ZA 3T5BA 5JWHA 1ZXLA 1BVUA 1T9GS 2WQ6A 1KYTA 3EAQA 3CXUA 3EF3A 3JYQA 3HI4A 4PC7A 3OEHD 2CJYA 4NFHA 1ACLA 3LT2A 3UFXA 3HI6A 1HQCA 2WIDA 4AP9A 1STOA 2I1QA 3WICA 1D5WA 4Y6RA 3WMRA 3QHPA 1KIMA 1XA3A 3TEFA 5IFLA 3AF6A 3KXDA 2GJ9A 4DSUA 2FOXA 3ACDA 4M22A 4M2LA 2IF0A 3UK7A 1MDFA 2E4WA 3VAYA 3RYCA 3LGSA 3WKAA 1Z7EA 1J5PA 2QPAA 2FHSA 2AOVA 3P9QA 1GGMA 4LHWA 5J2TA 3EF1A 3PS9A 3RFVA 2GN0A 1EVIA 3KLNA 1E3WA 4ETNA 3R6WA 4RVHA 1L7RA 4Z8XA 3CVVA 4YMHA 3GLKA 5AK6A 5J2UB 3L43A 1IB0A 4F3YA 1GZDA 5EXXA 2LPMA 1U8XX 2Z98A 1FFHA 2NV6A 1JDPA 2VOJA 1G20B 3HR8A 3OCWA 2J9RA 4KQXA 4KMOA 5SYAA 4JI0B 1FU4A 2Q2NA 1DT5A 1P5FA 1DOZA 4PANA 4QQRA 3TRHA 3VHLB 4U0JA 3RRNA 1WZUA 5KPJA 4RF3A 5TS3A 3G68A 4LSWA 5COBA 2ID8A 2YV3A 3OZGA 4HS4A 1MOPA 3RIXA 3TUZC 2VH5R 4H60A 4HDNA 3SIWA 3AMVA 1EINA 2Q4DA 4M0UA 2ESRA 4AJNA 4ZOLB 3RV3A 1T9KA 3WGLA 5JECA 3IQXA 1GGHA 4S2EA 4H1VA 4CM3A 4OBWA 1D07A 4WLEA 5EJMA 3LDFA 2I5PO 5B1IA 2WY2D 2OA0A 4F7DA 3RVDA 2BONA 3H05A 5G02A 2WC1A 1PFKA 1SPXA 4UMDA 5DTJA 1Z4PX 2WT4A 5DI9A 5C2JB 2DERA 3FZNA 4NARA 2B4AA 2QM8A 3A2KA 1UC8A 2G36A 2DECA 3DEZA 3A58B 2XWBF 5L7TA 3PHCA 4YDQA 1P1IA 2W48A 2NTJA 3DULA 4HBZA 4UHHA 4GMGA 3NBAA 4ZV9A 2G06A 1TTPB 4MQFB 1FNDA 1SCDA 4H1UA 2QTHA 3L7DA 2SCUA 4M1SA 1HBJA 1Z35A 4Q7LA 4QU0A 3SLKA 4Q9DA 4LPKA 4RTQA 1AU9A 2HU8A 2BHSA 3DL4A 3FBGA 2W70A 3O21A 4BAGA 4D9MA 3TYXA 5D6OA 4AF6A 3D2LA 1JHDA 1F8UA 2FMFA 4R0NA 1KI6B 1KSJA 1FMCA 1JHMA 1SHLA 3GRCA 2Q4OA 1WDKA 5K3DA 1M2OB 3EC1A 1Y5RA 2YXLA 4LJ8A 4ZZ2A 1OLUA 1SVKA 2FRDA 2VCYA 3VTZA 4EHKA 2RAPA 4ZVUA 3V80A 5ALQA 2RI1A 3LXXA 5B2EA 3Q15C 4GZMA 3S55A 2SBTA 3QBEA 1I10A 3BICA 3I01M 3PG5A 2CDRA 2W6MA 2KE5A 3F7OA 1G60A 2AMJA 3A6HA 1KEEA 4F4HA 1EFRD 2FEOA 3HVIA 5JU6A 2HXGA 1F2DA 3ZE8A 3K9QO 1YKGA 1HE1C 4Z51A 1YCHA 2UZAA 4BLRA 1PQWA 1VBFA 3PFKA 4MGYR 4UBKA 4ABYA 4DXAA 1VDZA 2FRVA 4DRYA 5B7PA 1K3UB 4IDNA 1MEOA 4Y2JA 2BI7A 3RT9A 4R8RA 4H18A 3PPVA 1HRKA 3GBSA 3RPEA 2O5CA 3G5LA 4ASUD 5BV8A 4LC9A 3TNDA 3SYKA 1Z6QA 3KCQA 3REQA 4B3SB 1PJLA 2QAGB 2ZLBA 5ER6A 4F8JA 1DAMA 1VE3A 3B6IA 3FUTA 4GPD1 4IFIA 5FO1A 2VDKB 4WOBA 2VYNA 1DSSG 1PWEA 3LPNA 4NIMA 1I24A 1E4EB 3X1DA 1WTCA 3KM0A 3W5UA 2G28A 2CL6X 1GQYA 3NU1A 4ILEA 5AW6A 3LCCA 3Q87B 1H1DA 5HXAA 3BQ9A 1KF0A 2XTNA 3HLYA 2ZPTX 3S5JA 1GVNB 4OA8A 3SJCA 4DYVA 1XI2A 2PGJA 3QELB 4XGNA 3ZHUA 3AEKB 4OBBA 2ZYAA 1E6CA 4MR9A 5DKFA 3GCZA 3NHAA 3D4IA 421PA 4RETA 5AQEA 3C3DA 3DV0A 3JWIA 3R4CA 5JYCA 4NCJA 5J4KA 1EH5A 2OPBA 3OQ6A 2VUUA 2IW3A 4Q37A 5HE9A 4BMVA 5KDOA 2PVCA 2VHXA 2AX4A 5FD8A 2ZTSA 2ZSUA 4DRZA 3PEWA 1SCQA 2GX6A 2HCFA 4JLNA 2F8LA 1YI8A 4KJZA 3TOSA 3I6MA 5J2UF 1G7CA 4MW0A 5BNFA 4D42A 1KOGA 4QNNA 3PB3A 2FZGA 2V6MA 3C6ZA 4C6TA 3CEAA 4QQKA 3GZNB 3NFYA 4DDVA 1JDJA 3CUVA 4GPBA 2BKXA 5GQSA 5ER9A 4II7A 4CLDA 3BTUA 3EQ7A 1CJBA 2R751 1ZN8A 4HLCA 4JP8A 2EC5A 4MUJA 2VHYA 4MYRA 4IQ0A 1O57A 3R5JA 4KXFB 1MO6A 1CZLA 1J42A 2FUG6 1W4CA 1XYYA 5B37A 3AVWA 1KJ8A 3GQBA 2D4HA 3QVSA 4AJ1A 4DQXA 1Y4AE 1JSZA 2P0AA 3N0XA 5THXA 3NO4A 4ZOLF 3HO8A 1XHLA 2GCOA 4MV5A 3I9V1 4ZCLA 4U0KA 2Q27A 1JJBA 5CEEA 5ED4A 3DAYA 3IRVA 3RBAA 2R48A 4KR2A 4TKUB 3JYPA 5LB2A 5JVDA 1H5UA 4DKJA 1ZJ4A 5BSMA 1ORWA 2ASVA 4RA9A 2WM3A 2O0KA 3NUZA 3SFZA 3LO5A 1XNJA 1UOQA 3MBKA 4EVRA 2O8FB 4N8SA 2VZ9A 4LN1A 4F12A 4E1AA 4EUSA 5JS2A 2Z58A 2IPAB 4YT2A 4LZZA 3M0EA 3NV9A 4CKZA 1U0LA 2QSZA 2QNBA 3E7WA 1ZM3A 4TLDA 1FFBA 1RWKA 4QPPA 1SEPA 5FPPA 5JD4A 4RORA 3DOFA 3B7GA 3QXJA 4G41A 4GOJA 4QJ5A 1C7RA 3TQIA 2HOQA 4EPVA 2N75A 2W93A 4HLUA 4CU5A 3DNFA 1H6DA 2DC1A 3NHPA 5CX1A 1QMGA 1NUQA 2PH5A 2X22A 5JPCA 4UBJA 5B1SA 1JG7A 4J4TA 1VIMA 1US8B 3OJ0A 4JQOA 1I0ZA 6REQB 1OI7A 1JHPA 5IYZA 4EMSA 3NHMA 1O94A 2J0EA 2EL7A 621PA 3WGHA 5F4BA 1FMLA 2FETA 4RZUA 1HNXB 2VXOA 3C3KA 4FMBB 2P6MA 3LIPA 1UMCB 4P7GA 4BQSA 2IJGX 2EWWA 3L6CA 4U3JB 3W2HA 1YQWA 3AV3A 3OF5A 3S2IA 5HSGA 4IMIB 2BCGY 4RF2A 4FB5A 1EU1A 4CZ2A 2LUOA 3O3NB 1SH7A 2WAXA 3K15A 4KVAA 1Y33E 2PRZA 2DKNA 3D59A 5FI0B 5KQSA 3CYFA 3KEMA 1XDWA 4DG9A 1YR9A 2POQX 2WU8A 4V0ME 1NWCA 4HK4A 4FGKA 4RC9A 4A5OA 5TY0A 2B8NA 3FSJX 3C4VA 1SCUB 1NKVA 3PNPA 1KJQA 1XD2A 1X1DA 1QGAA 1SAYA 2VHUA 2WJAA 4IMRA 4M83A 1V5GA 1LPMA 2FUCA 2GD0A 2JW5A 3UMVA 5DH9A 1U0NA 3KHSA 3QJGA 3ZR4B 4NONA 1CQJA 4MQ5A 4HVCA 1SOVA 1Y1KE 2KJQA 3D7KA 4G0PA 4G8BA 4GSYA 3MFYA 2C3MA 4H27A 4HN9A 1NVBA 9ATCA 3SVLA 2VJOA 2V97A 1YL6A 1FU7A 2WABA 4NS1A 2P68A 3AI7A 2QJTA 3DCIA 4RXUA 4DSZA 3EX7C 1RM4A 4LZWA 3FTFA 4UXHA 3L07A 3GYGA 5FWNA 4OGKA 3ZOKA 2A58A 1Z0KA 3WYCA 5JISA 1HMYA 1Z8NA 3WRXA 3SQDA 3TAHA 1MB9A 5KVSA 1TGYA 3ETHA 1PHRA 3OVMA 4OATA 4YJDA 4CEIA 1IOLA 3GFGA 2ZGVA 3FWYA 1PIWA 1MTZA 1Z5VA 4WCFB 5TX7A 3BERA 2ZIFA 3HRHA 2ZEJA 3OKAA 1CT9A 5CURA 2HRQA 1J0AA 5FQOA 4HRXA 2B61A 3SJUA 3GRVA 1THMA 2UZ0A 4XDHA 5HYVA 3BG5A 2ZE7A 1XZKA 1Y6JA 2PMFA 3DBRB 5EJ2A 2X4LA 2FFHA 4Z4FA 1CRWG 1YS4A 4P7FA 5DNEA 5P21A 3LGXA 1H4SA 1VRCA 5C3MA 4Y2YA 1AY0A 2BEUB 2JBAA 3KQQA 1CP2A 2C3UA 4QA9A 4YDHB 5DSZA 2D3TA 2FDRA 4EJSA 3STVA 5B53A 1Q16A 5BVGB 3KOOA 5JW6A 3AETA 2MYUA 4HT3B 3FOCA 3ISJA 3O93A 5DO9A 4AXBA 1YJQA 5EMJA 2Q5HA 3CC8A 1RKXA 3MMSA 1E96A 1MC4A 4WMLA 5BXQC 4QU5A 4K81B 4P4LA 1P75A 3ORFA 4K9LA 9ABPA 1GR1A 3LDHA 1NUHA 1Z62A 4JL5A 3OC0A 1UBUS 3V2GA 2XIQA 2DCMA 4D0LB 3U4MA 1XXHE 2YV1A 3THOA 2EJBA 3NHSA 5FTMA 5DFAA 1CUCA 4HGOA 2BR5A 4O33A 1ZNZA 5LQMA 3MNFA 1E0JA 4CQLA 4M1TA 2OGZA 1UJCA 1RC8A 3RK0A 1J8VA 2QT9A 3DYVA 4IH4A 4UBLA 2O8BA 3CMMA 4Z3KA 3W2FA 2HWKA 1WD5A 2J9YB 2PUTA 3N2NA 2QL6A 4V0OA 5EWJA 5FTJA 1G18A 2F2TA 3P20A 1KQGA 3Q3HA 4FTWA 1DC3A 5F78A 3MJEA 2CNDA 4ND8B 1KVSA 3TRFA 1KFJB 4WWHA 3BCHA 2Q21A 2C2MA 3F49S 2A9PA 2QMEA 1NJ5A 1GCIA 4P3PA 4E7PA 4PPGA 1MX5A 221PA 3KQUA 1UDXA 4HGRA 5IMBA 2BGTA 1ATZA 1PP4A 2NXWA 3OQHA 2YH2A 2OVBA 4LYFA 2WT8A 1PJ2A 1R7RA 4PGMA 3MT8A 1JEYA 2XXJA 1AKEA 3T7SA 1QHXA 2P2CA 1Y3CE 1BFDA 2PV7A 5DXAA 4R16A 2QA5A 4FS3A 2CCJA 4CMHA 5HJ7A 5F3WB 3N5KA 4FNOA 5DCWA 1V35A 4BO6A 2PX8A 3F3KA 3WE7A 1I4EB 5LIPA 1Q1QA 3JX9A 4KUEA 4OBEA 4MI6A 3TSCA 3LQ2A 4IS2A 4PAOA 5CJPA 1RHQA 3WGYA 2GEBA 1JHOA 3SG0A 4DJAA 4M3NA 1R1DA 2IU6A 2Q5FA 2B0CA 2R2GA 3I9MA 4J7XA 4RSGA 3TFOA 4BMXA 4W5JA 1QZ3A 3EQZA 3UGQA 2I8AA 4K0RA 4PCLA 3M4XA 2DAPA 5SZJA 5F5XA 4DLUA 3WYNA 2VJLA 4MWDA 2XZPA 3B89A 4KXMA 2OHFA 1P62B 4JYMA 2TYSB 3MVEA 3SQLA 5F2OA 1NI4A 1XL1A 2QRKA 4Q24A 5ELLA 4MSUA 1W75A 4J0IA 2XVZA 4HF7A 4MA5A 1KO8A 3ABSB 2Y92A 4IIXA 4N8EA 3RQIA 3ZXXA 3SPXA 1EJ2A 5KYGA 4EEZA 3U44B 2X2FA 2CFTA 3EUAA 2WU4A 3EZ6A 2ID9A 2ONZA 1HY3A 2ZR0A 2YYSA 1CS4C 1PBTA 1IMOA 1USGA 4JX8A 5FOWA 3UENA 4OHBA 5T3YA 4UHJA 1YKFA 2DU8A 3CTPA 3WGJA 3WZLA 3ZLUA 4WJLA 4Z1OA 5L4LA 4UVGA 1BCSA 1ZS9A 3DB1A 1EGMB 3JQ7B 1UFOA 4PXSA 1UWKA 3S2YA 3ZZNA 2XMGA 3ZD6A 2BGGA 2CSUA 3TOXA 3SE7A 2ZRIA 5ALOA 5JRJA 1MB3A 2NSHA 2WMDA 2OXFA 3ZK7A 2FUEA 4ZYLA 1YGYA 5BMVB 5JZBA 2OG2A 1SUAA 2JIZD 1FTYA 4CIWA 3U3OA 5EIWA 1SHUX 1XE3A 2GBIA 5TPWB 5EJ7A 3MWDA 3VQTA 2HDNB 2ISSD 4IDPA 3FPSA 4DLXA 2EBWA 1D2GA 1JHZA 1ZJJA 2CVFA 3BD9A 1IEVA 1K08A 3KL4A 4BLOA 3M6MD 5I51A 4NCBA 1TDJA 1NAIA 3SNKA 4N39A 4EKIA 1NTOA 2ZJ0A 3LQFA 1FP7A 3DFKA 3PTZA 5ILQA 3PR3A 3M9LA 2VF4X 4PR0A 4ARBA 2ZJ6A 1A5ZA 3UB2A 3E61A 3W05A 4FDUA 1PRYA 3AOEC 1CJCA 2VWHA 4P7BA 1YQEA 1E9AA 4GGMX 4URYR 5AVOA 5AK0A 3WL7A 1VLHA 4RFVA 2L82A 1JH8A 3U3MA 1T36A 3PNYA 5D86A 5C4GB 4A8JA 2OG1A 3B13B 4QGGA 1RXYA 1Z5UA 2ZAMA 3VGPA 3U60B 1Y7IA 4JK3A 4N6GA 3L7CA 3HXTA 2JAXA 3WLOA 1EBUA 1YUBA 3L40A 5LLDA 3M4YA 3WDMA 2B5VA 5AM3A 3KD3A 3C3BA 4AY4A 1XTSA 4INPA 3CRVA 1BS2A 4LXGA 5FT9A 3TCKA 4D0SA 3OPYB 2WSMA 2PXAA 2RGEA 3IODA 3W8EA 1Q91A 2C82A 2ZUDA 2GHIA 3SSNA 3DDSA 4XGKA 1TU3A 2COUA 4BMNA 4WL0A 2G9RA 2C3YA 1I6WA 1L3BA 3V2HA 4U8HA 4WI1A 3WMGA 4JJZA 4Z7OB 2OQIA 2XODA 5FOQA 4P3YA 4BEBA 5FPQA 1DKUA 6ADHA 1O9BA 2A9VA 2GFQA 3D43A 1X9IA 3V1YA 1J20A 1C7QA 3K9HA 2JVKA 4FFPA 1ZPDA 3CH5A 1VFPA 3CNEA 3FLEA 1L4YA 2DPGA 4IZ6A 1M1YB 1G8SA 3GQVA 2I4LA 2GH1A 3PC2A 2WU0A 4MV7A 1PZGA 1E6WA 1F6BA 3MRSA 3Q8XB 3PUVA 3L7MA 1TYEB 3MWLA 4Y0VA 4LF7B 2FZLA 4TLMB 3IURA 3CLTC 4MB2A 4Y2TA 1JQKA 1Y3FE 5AVUA 1RW4A 1VYUA 2VQSA 2ZJFA 2YWFA 5AJXA 3BREA 3SFVA 4KDEA 3TMYA 5LQJA 1F2UA 2BHTA 2Q50A 3CKMA 1PT5A 2A5FA 2EZ8A 5ALVA 3EIHA 2GVZC 2MYTA 4REQA 5JH7B 3L84A 3OPYI 1BGXT 1G19A 4QT0A 2H4FA 5JPDA 3LYLA 2CXSA 3U7HB 1QF7A 1VE7A 1C9DB 4OHXA 3WIOA 2AVNA 4AKHA 1AK2A 2B21A 3QF7A 2C5LA 3PQ8A 4M99A 3IOBA 4IVRA 3KQNA 4DNOA 3GLVA 4JJFA 1J9ZA 4BXOB 2J46A 1V6AA 3QPUA 1Z0AA 4U7WA 2JJYA 3VGJA 1OD6A 3G8DA 4GYKA 4ZT7A 5AIAA 2Z4TA 1T5BA 2RFLA 1VLZA 4LI0A 3UJNA 1Q1GA 1NJ2A 2FSFA 4G4GA 1PLKA 1R10A 1T2EA 2KBEA 4PLVA 2H65A 2QD2A 3KVNA 2C7PA 3IPYA 1JR4A 2PBLA 2PSHA 4DCSA 3RRMA 1W1UA 1U9IC 2Z56A 3QXHA 4PYIA 4MUIA 5BQ3A 3NBQA 3QEAZ 1F7UA 1Y8CA 2PKQO 4UUAA 4Z53A 4MNTA 4V0MA 2QN6A 3FFTA 3OTIA 3D7NA 5ALGA 2Q7OE 3L8YA 4G2TA 4Q9KA 1KTVA 5H68A 3EZ9A 1UAYA 5AW7A 1JFLA 1F2TB 2AJDA 2IOYA 3HKEA 2P4UA 3CE9A 3BIJA 3WK5A 4RTMA 4BV3A 4KIWA 1WMDA 5DLEA 4OJTA 4UHBA 5BMVF 3K1YA 4NK4A 4CIBA 1HT3A 2W58A 3GGJA 3QEBZ 3UJDA 3ZX4A 1RXIA 5AFSA 3HSYA 2A9OA 1KGDA 4WOJA 3UT5B 3QKIA 5A4IS 3SHOA 2V8OA 4LQCA 2HF8A 4FGWA 3Q8WA 3TNJA 3GLTA 3L92A 4KWIA 1HC7A 4AG3A 4BNNA 1NFRA 4UQLA 2J3HA 1BJRE 2IHKA 1ZVQA 4GBGA 3MCUA 4JV5B 2V5AA 3Q5EA 4DJDC 3BULA 2OR3A 3FB1A 2CL0X 4D57A 3CUSA 2WQ7A 3G9XA 4WNAA 4NJEA 3NVAA 4MP6A 4D6XA 4RQTA 3MT9A 1J00A 4J2HA 4J7AA 4HKTA 1LX7A 4DMMA 1YDHA 5E6SA 4R2WA 1LZKA 3I8XA 4KVZA 2ZB8A 2X5XA 1C8KA 2VEDA 3WLQA 1CLEA 2VXCA 4CV1A 2Z5VA 4NV1A 1AOXA 3HGMA 2QV7A 4OHPA 5DN9A 5LFAA 2H11A 2HDWA 4RSHA 3I23A 4HLNA 2I65A 4G65A 2ZJ1A 2B78A 4HPJB 2WG0A 3BD8A 1GEEA 2DCUA 3GLSA 4NLLA 1QB8A 2ADMA 2OO3A 4I7EA 1L5ZA 2C96A 4KI0A 1Z16A 1USVA 4KN5A 4H7PA 2YC2C 4CM5A 2DPMA 2YQ4A 4G2NA 3L4BC 4DA9A 2QE7D 4OXKA 3KB2A 2NVUB 2F3TA 5GVRA 1SOWA 4IJKA 3W9SA 4CNBA 4C4XA 2VTBB 3FCXA 5IP5A 1FX1A 5F7JA 3FN4A 3ZV3A 1MP0A 1SC6A 3ZV5A 5U4XA 3VYTB 5B7NA 4XVHA 1CLUA 2QTVA 4WKGA 3LZDA 3ROFA 3K2EA 1J07A 4FFLA 1TT5B 1PR0A 2BFMA 2ECFA 4X7RA 2VIIA 1EUQA 1E2UA 3DAFA 1COWD 2FWJA 4OQFA 4QXQA 3RT7A 5FBZA 1XAIA 4EA8A 3NHZA 2PUBA 4IG9A 2RHTA 1XU7A 2A84A 1ZOSA 2VJYA 3B2QA 3CN9A 3GK3A 4HWRA 5ECYA 2NO6A 4YY3B 1IPFA 1CRPA 4LXTA 3REFA 1WOYA 3OQ1A 1XRJA 4MW6A 2BBSA 2P9FA 3N76A 4MQ6A 3HYSA 1NFQA 3AFIA 5JH7F 2OT3B 3B78A 1NKSA 1YCGA 2PY6A 5KKAA 1XYGA 3TLGA 3TVDA 3T1YB 1UIRA 3U1VA 2ZUTA 1B93A 4ECEA 4PPQA 5CB4B 5I4CA 3AINA 1JQDA 1QPGA 4DV5B 4BE4A 3FPGA 1B4DA 3TI7A 4GWGA 5ITSA 2QTTA 1OGIA 2P9QA 3R5TA 2J3JA 3H75A 5HTKA 3KT0A 4DLKA 3AOGA 4EELA 4UTOA 1GLVA 2B98A 2QTFA 2GETA 4AZ3A 2J9GA 2CDNA 1UMBA 3C16C 1NMYA 4DMHA 1P29A 3WLEA 5BV2P 3NI2A 3JQAA 3GFBA 1N75A 1TM2A 1R5JA 4BC1A 4MGKR 1HYEA 3TLKA 3IVAA 1YZLA 1DQRA 1WCYA 2Y9PB 4X1IA 5CW1A 3ENKA 1E6EA 3RQSA 2AN3A 5L3SB 5C52B 2WTUA 4JJ7A 2QKYA 4XWKA 1Q21A 3D3QA 1XZMA 3RCBA 2VDWB 5AW2A 2NXEA 3C7KA 3HC7A 5K0CA 1UL1X 1FZQA 4DYHA 1KAOA 2QRGA 4H6WA 1ZD4A 1KK1A 3DO8A 4GR9A 3TFWA 5B4UA 2QMYA 1E3TA 2CD9A 1QVRA 4CMAA 3AVVA 1FEZA 1CDOA 3B9BA 4S35A 5CLGA 1GNLA 3INGA 4LF6B 3VH4A 1O9GA 4MR7B 4F84A 4RMJA 3I09A 4Q00A 4ARVA 2VSXA 1PV2A 2OP0A 3WNVA 1SIWA 4GG1A 1ZIOA 1Q57A 2WF9A 4NNOA 1K3TA 4LGMA 3T38A 2CYBA 3GFPA 3TR6A 4OJQA 2O59A 3Q2OA 1J49A 4KO8A 4MW9A 4DEXA 1QOQB 3MS2A 3H83A 1ZI9A 4MB0A 3ZH9B 1XMIA 5JNSA 4JU9A 5JO9A 2AN4A 2GN6A 3LSTA 4EUEA 1EWKA 1F48A 1J1IA 2QGZA 5E2IA 1DEKA 3UATA 3ZLBA 3Q1KA 1KU6A 4CDGA 3GLFE 4OQ4A 2HYIC 1UDAA 2X3YA 4PG8A 5ENZA 1OU0A 3Q3VA 4OHFA 1NASA 5ES3A 2Q5IA 3PGVA 2D2FA 1U90A 3DBVO 2GQ0A 2XT9A 5EHZA 3ZN2A 4LTDA 5AD1A 1AMOA 2VF8A 3UJ8A 4Y2UA 2UVPA 4DZZA 4EW1A 3BTSA 1EDZA 1OREA 1VLVA 5FF9A 2HLPA 2I67A 4QULA 4BJ6A 3I34X 2GN4A 1JF8A 5LYJB 2ENUA 4I4IA 2DTEA 3OCZA 3E0QA 1TIKA 5HZGA 1OIVA 1YWGO 3B8EA 4P4TA 3UJ6A 2G3YA 1MEEA 5DTRA 3DVAA 5JUWA 4DJFC 1H8HA 4QDUA 5LQKA 5JSQA 4YV7A 3GMIA 4B80A 5JANA 1PFGA 2HA5A 5I7OA 4DV3B 2IEBA 4JLJA 2DOKA 4OU5A 2ZBUA 3EY4A 5H3CA 5I7RA 1VGRA 3LC2O 2R8XA 1IWBB 1YFLA 3T3GA 5CEJA 3HACA 3LFTA 4XRRA 3GMSA 4O2BA 2WJ4A 4EG6A 3D3WA 1DKPA 1KI8A 5CFNA 3PFWO 2WF5A 3MOGA 1NM5C 2XOKD 3LTNC 2XCSB 1MQSA 4GMXA 3HJUA 4N4AA 3C6YA 4E94A 2F3UA 3C97A 3QP9A 1E3QA 4UVDA 2C9YA 5HBRA 2OBMA 1TM5E 4G0NA 1UWVA 1YQXA 1EBFA 1RI3A 4BCBA 4LBZA 5DBEX 1T4CB 1WUIS 3GEPA 4B5LA 1R88A 5BSGA 1IUPA 2CWWA 4MCHA 4GE0A 3CA8A 3G0DA 2AN5A 3GJ0A 3I2KA 3OJFA 5GVSA 1NSYA 1WUKS 2QLMA 1F14A 1Z6XA 2JJ2D 2X0EA 3T54A 3SZGA 1WPXA 1G64A 1M8PA 4YFVA 4DUGD 3FSGD 3KT6A 5IXSA 1R5NA 1J97A 1RZVA 1E9VA 3PP8A 1YBMA 3H4IA 2IHVA 3NJRA 1IVNA 1B6GA 2E85A 2ZCUA 4OL9A 3B8HA 2HQBA 3WGQA 3OWHA 3DAHA 2PYDA 4IG4A 4YK7A 2HJHA 4Z99A 1AK9A 1JQEA 2MSWA 3AI1A 3ISVA 3VO9A 3QFFA 3DJFA 4MLDA 3EWNA 5IVHA 5CB4F 1JHVA 3A1FA 4CT0A 1ZD1A 3F5SA 3B6MA 3Q9UA 1FUEA 1Q77A 2X4DA 3FNBA 2OWEA 3N74A 5BUQA 2N1BA 1A77A 4E3ZA 4PFSA 1YA4A 2VYQA 4IIBA 2JAOA 1H2HA 1YL7A 4IDFA 4LZPA 4A0HA 1KS9A 3KG2A 3R8XA 3WWDA 2R11A 5AVVA 1XLTC 1X80B 1WMEA 1N9GB 1YZFA 3H87A 4HOYA 1DC8A 1EK2A 2LNDA 4KQHA 3STHA 3N6VA 4HUQB 2Q41A 2PRIA 4OLAA 2VHTA 3EEBA 5DM1A 1UXIA 1X3SA 4PG5A 2KPOA 5K2OA 3OZXA 3UY4A 1DPGA 3DEYX 4QOIA 4DCMA 1EUDB 1ZD3A 2NO0A 3L6RA 3N8KA 4HAOA 2JJ1A 1V1RA 4Z0NA 3TQCA 3HUTA 3TZQA 2MSLA 5EXTA 1FS6A 4G0UA 2RB5A 1DQPA 2HHCA 5FLYA 3AI2A 1H3NA 1MO5A 2HRDA 1EE9A 3EIEA 4YMIA 1PYGA 2J59A 1UMDB 5EP4A 3MGGA 4RJLA 4N5MA 3CLTD 3N8NA 3EEOA 5FHQA 1PF7E 3H1BA 2IX9A 3ZW9A 3JALA 4UU0A 1VIVA 3JPWA 1GZVA 3OY7A 1Q6ZA 2FUKA 1MJGM 1D2HA 3H4MA 1M5TA 1WTAA 3HZZA 5TGZA 3FDZA 1N9ZA 1ZU4A 5GOZA 3RAJA 1IN4A 3QBVA 3Q7SA 5L95A 4KE6A 1ECLA 4N3AA 5JFGA 2WWHA 1BVYF 1YUMA 4DZTA 2H4ZA 3KLPX 2EJVA 1HYGA 5DSXA 4MUXA 1ZN7A 3EGIA 2PU7A 5DHTA 3EDQA 2ORYA 3FLBA 3T4UA 1POXA 4B3RB 4UNQA 4CEHA 4L5JA 1E2FA 4XR9A 4M1OA 1DBSA 4LQLA 3USZA 3V1KA 2HBYA 2LE0A 4MR8A 3L1UA 1M75A 1OROA 1ORDA 4OAOA 1GPDG 2WB4A 1VHDA 1E2IA 3QXXA 3NHYA 2PZ8A 3HA5A 1TQHA 4QUKA 5AWFC 4MEAA 3L6BA 3P2JA 1AQ6A 3CBGA 1VDMA 3LOPA 1HT0A 4WBSA 4E5DA 2J7PD 4ZANA 3N2ZB 3L6DA 4RAOA 1N6HA 1E1CB 2V4MA 1EJ0A 1ZAKA 1A2KC 1TD9A 4M49A 1UJ2A 1MG5A 5KNBD 2PFGA 1PT9A 2KW5A 3KKZA 3VTFA 3QYFA 1AUXA 1XC7A 3W7AA 4W8HA 5E2BA 1KSGA 3FF1A 1Y98A 3H3XA 2M6LA 5BXYA 4NFLA 1DQNA 2HU7A 4UDOA 5ICFA 1S8OA 4MUKA 1GY8A 3B38A 1GAJA 4Q3CA 3OSZA 2X1VA 5IKEA 1ICIA 3I5YA 2IUTA 2VPTA 2IHUA 2MHCA 4AJPA 1XLVA 4BV8A 3WV4A 4J94A 1ULUA 4NABA 2PRJA 2FPRA 4JOSA 4RDHA 4RZXA 4Y98A 4B9EA 4GP9A 4FCCA 2V96A 2QRVB 2DG2A 4WPGA 3S2UA 4BFVA 2X6RA 1VHJA 2VDNB 3L0YA 3BTOA 4KXWA 3X1WA 1IM8A 1NZFA 4XIJA 1BA2A 1PU2A 1Y82A 1YJBA 2YRWA 2DWCA 1W9MA 1QH0A 4Q4JA 3UJBA 1U3FA 2GSWA 2RGNC 4MPRA 1JIQA 2W6ID 3A6ZA 2D1YA 5A6VA 1IYZA 4CQMB 3BX1A 4FX5A 1RLMA 3E5NA 3MWFA 5KKNB 2QLTA 2BFDA 4XEUA 2O07A 3IUSA 3ER6A 2P41A 3WIUA 1E2JA 1ZMXA 3A9UA 3R76A 4Q4HA 4H6PA 1EWVA 4QG7A 4BO3A 2BC9A 4B3HA 1BX1A 1WLSA 3R44A 4I14A 5LZ7A 1UJ4A 3NPMA 1GQQA 3A36A 2HCBA 2JKZA 2O5EA 1YZUA 2V7UA 4KX3A 1E2LA 3MJRA 3PHJA 3QUSA 4Q3BA 5BR4A 3S70A 3JQ8A 3H4TA 4JUFA 4UZFA 3KDSE 3F6RA 1M67A 5EVJA 4KFUA 2PWYA 4PG6A 4KPFC 2MCFA 3OIFA 4TV8B 2Z6UA 3NTUA 3PNVA 1G8AA 2HBZA 4HHEA 1QIJA 2FF5A 4WSOA 1I4LD 3IT0A 4FGZA 3HCAA 3QPCA 5TPZA 1OXKB 2J9ZB 2Y0DA 3OQPA 3UOWA 3MN1A 4CI9A 4KGVA 2Y99A 3L1KA 1WMSA 4MW2A 4X20B 1ONNA 1DV1A 5ESRA 2GPTA 4QTXA 4KWTA 4ZQIA 1TKCA 3ZH2A 1Y7PA 3QBTA 2FP4B 2HW8A 4N65A 1O0SA 2H2IA 3VNVA 3UAOA 1N1MA 2ZBFA 3PPXA 4QBGB 4TS1A 3H5OA 4A8PA 1W0CA 1C4WA 1VJGA 4D9BA 4AJ9A 1DWPA 2ZE6A 4QEZA 1W1IA 1BDJA 1IM2A 3EVDA 3GJ4A 1ZINA 3MG9A 5CTJA 2PQ2A 5EZSA 4YJ3B 4ZC1A 2IYPA 4AZVA 4BLVA 4DR2B 4IEEA 1II8A 3QTLA 1YT5A 1CZRA 1VGVA 3PNBA 4GUAA 5C8YA 5JSUA 4RULA 3VV2A 1TYCA 3KTAB 5DNUA 5DHRA 2B1JA 1NW4A 4PYLA 3A6DA 3KRTA 1MJFA 2QQ5A 4CR7A 3DE7X 1QH9A 2FX3A 3A06A 3HKBA 4V0LA 1D4ZA 1KE2A 3PD0A 1GYPA 2G4LA 2O0JA 4BGVA 6LDHA 2Q9BA 3ESQA 4XWOA 4AG6A 1EDBA 2BY4A 3AHGA 4C0SA 5JMTA 3QSGA 3IPLA 5K0BA 2FVYA 4PLGA 3DE0X 4HYQA 2F1IA 4J0FA 2YRFA 1SVLA 3OTGA 4IICA 1J0BA 2IIQA 3B51X 4S2UA 2HADA 4BMDA 4CMKA 5LZ9A 1K7EB 1RQPA 5U9CA 3STYA 1GPMA 4E1BA 2X5NA 2ZULA 1NVAA 3SZLA 1GNSA 3TLZA 3EGVA 4ZT5A 1BIFA 4C1NA 1WW2A 1ZLXA 3D6UA 4D4GA 1E32A 4ZI7A 1QH1B 5JXIA 1AZTA 1DQZA 1IEXA 4N8DA 4LKOA 5T64A 3H6KA 1LWNA 2EOAA 2PRYA 4I1PA 5JASA 1JFVA 2FEKA 1ZGGA 4IINA 1F4LA 1ZKDA 4R1SA 1SCBA 3ZZMA 1BAPA 2HEGA 1UF9A 2CXTA 5EJ9A 5DEIA 4ARZB 3OWOA 2XQIA 2GBLA 2GPBA 4EJ0A 2KBFA 5TJHA 4ESOA 4J43A 3CX7A 1UXJA 4DCUA 3GLFA 4MVJH 4NHOA 4IP0A 4WECA 3V1LA 1U0EA 2RGAA 3UPTA 4CM4A 4ZI5A 2ECKA 3G1WA 3GW8A 4KQMA 3ZI0A 4F86A 1C50A 5DBHX 5BSHA 1JVNA 4TX1A 2OKCA 3AIOA 4YCAA 2I4RA 4C29A 4ZYWA 1Z4KA 1JJVA 5ES4B 2QBYB 5D8DA 4AO8A 3LH5A 3RTDA 2QRHA 3FNFA 1TZMA 4GOOD 3MMPA 3D0RA 1PK7A 2OLEA 2NTYC 4FGSA 4JLSA 4YT8A 1U9YA 2BSQA 3QV2A 1UCFA 4XUGB 3KR1A 2J45A 4RKYA 2XQVA 5C1BA 2RHBA 3KZVA 3ZBTA 3CF4A 2QXYA 1L3CA 3ZHZA 1AF7A 2GZDA 2CV0A 2G9ZA 1SBYA 1Z25A 3EVTA 3SXUB 4BRZA 4CMIA 1TO6A 2DFKB 2IXDA 1WAMA 1KDTA 3AHCA 4GF5A 2O8EB 1EX6A 2YHAA 2OHGA 5HZMA 4DV0B 3T9FA 1OUMA 3NBUA 1UIMA 2QTWB 3W3AD 4YV0A 2CY0A 1Z7GA 2I3AA 1PVOA 4F92B 2UZ1A 2AG8A 3EQ2A 5CIQA 3FUUA 4AN0A 1NONA 1MU0A 1MX9A 3GGCA 4ITUA 1JB1A 1A82A 4JDUA 4L3VA 4M1WA 2BUAA 4MIYA 4TV8F 3SD7A 1DO0A 2Z2YA 5HE8A 5CVUA 5E6RA 3ICOA 3BWMA 1ND5A 5EPEA 3FFXA 1FLNA 3WVNA 4DDHA 5AHRA 2CKDA 2E49A 4KYUA 1EJ6A 1B8PA 3BIWA 2JKYA 1TF7A 4MVYA 4YT5A 1O96B 4BJHB 4D9JA 2J3LA 4EUKA 2DWOA 1OXVA 2RK3A 2NUTA 4CTJA 1ECGA 5FWAA 1Q7GA 2BGKA 3R8CA 4W7HA 4BLWA 1SA0B 4LTMA 1RHJA 4IDHA 4OQQA 1C7IA 1P0MA 3DMYA 4HDSB 4JXKA 3B1FA 4IIHA 1KEUA 2OCIA 3GHYA 2XA9A 4NYIQ 1U2EA 3TL6A 1Z0DA 3AQ4A 4DCCA 5CFPA 4CI0B 1CFJA 1V95A 4ERXA 2ETXA 2ZYRA 4DRXA 5I7AA 4DV7B 3QRWA 1FBNA 1ZGHA 1D9XA 3AK4A 4DL9A 4YJ3F 4A0RA 1J9EA 4AL4A 3T3OA 5EZ6B 3KYJB 1XEWY 2ZE8A 3N2KB 4FD2A 2RG1A 4NBLA 1EXDA 3BFKA 1KZ1A 5GJVC 2QUIA 4NYJQ 4IXDA 3E6AA 3FVWA 2IH5A 3H8SA 3OLZA 4EGSA 1PLJA 1I2MA 1GV0A 2OAGA 3F71A 3H8WA 3GIWA 3ADDA 4RGVA 3W8FA 4W5NA 3MTBA 2G8NA 4GPAA 4TLEA 3AEZA 3WWZA 4UNNA 2OUIA 2OAP1 3EIUA 3KU1A 4GGOA 4LRUA 3RWBA 3S6JA 1NW7A 3K6SA 1HLGA 5KOHA 2AL7A 4IWYA 1P18A 4Z2YA 1G2IA 4MI9A 1R3DA 4P98A 4B2IA 1TLTA 2CXOA 2RGBA 4HFNA 4E31A 2OB2A 3W78A 2XLBA 4PQFA 4KIFA 4H1HA 4TMYA 5JHGB 3AJRA 2HA6A 1U8CB 4MGZR 3ORYA 2IEDA 5DWQA 2G80A 2PH7A 5JPIA 4B75A 4ACAA 3MCWA 3MELA 2JJMA 2D5AA 3EDCA 4PFKA 1GN9A 3QTTA 5DVZA 1CHDA 1JBKA 1ZIPA 1N6RA 3L1HA 4A7PA 3MTJA 2UZ4A 1QAOA 2LIPA 2C5GA 3UYLA 1YJXA 3KYCB 2WP8J 1G7SA 1Q74A 4UMFA 4YBRA 1T1JA 2HO4A 4E3WA 4HAIA 5BW5A 2FWAA 5F1OA 2OORA 3JZIA 2YKGA 2RKBA 2BTQB 1TKAA 1FQJA 1P0IA 2YS7A 1LSJA 4JN6B 3W4JA 4C4ZA 4ZMBA 1M0EA 4ANFA 2FSVA 3KELA 5DW0A 3C1TA 1ZM2A 4D4LA 1ZGAA 3UYKA 2VTEA 1NC1A 1OX6A 5K8CA 2C98A 3EGXA 4F4DA 3ZY4A 5DV9A 5HM6A 5KVCA 2E4UA 3CVOA 4D8YA 3AB7A 1CNEA 3LUHA 5DNAA 5EESA 2ARKA 1G21B 5KU1A 3I9NA 4LY0A 5A5EA 2WHQA 5LP6B 2UUAB 2BBTA 3C3XA 3MMNA 4PPYA 3H5AA 1JALA 3PD7A 3RKRA 3O2SB 3IULA 1N5IA 4MO2A 3VTAA 1GV1A 3GLRA 2Z6VA 4NU8X 2ZXEA 3SF0A 3WGVA 3K0HA 2WB2A 4M8LA 2GLTA 4MYSA 2CFCA 4ZYUA 3N6XA 2ODPA 1M73E 2Z8XA 3KX2A 1JU4A 3DS8A 3U3DA 3E22A 1JKIA 5AXDA 3E1GA 1VPWA 4ZCSA 1QGUB 4RK5A 1HLFA 1COZA 1EFPB 1SWVA 4GSLA 1IPHA 4Y2SA 5AVTA 4NYMQ 4G9BA 1H4QA 1BNCA 1M7BA 4B40A 4PVDA 3AKEA 4Y7CA 2KHZA 3O4JA 2CHQA 4JCCA 4OEHA 5BUCA 2OCLA 3O7MA 4AF8A 4YP7A 1ZCJA 1QIFA 4GM4A 4R7TA 4Z4EA 1QO0D 4G67A 3I6ZA 2FQYA 3D3NA 5JIBA 5KDLA 4TRNA 3MOIA 2H1LA 3P9XA 3OLYA 3AF2A 4UU7A 4BFZA 1SXQA 2V4ZA 1ONBA 2XF8A 4ZDWA 1F6WA 2YMPA 1MB4A 4EZIA 3A6JA 4IEIA 4JL6A 4WA7A 4JROA 5EP1A 4X45A 1BJKA 1CIPA 1FU8A 2PJDA 3ZZ1A 1LV8A 2V98A 5JCJA 2FMIA 1Y8QA 2F6RA 3BD7A 1UODA 4Y30A 3LZ6A 5BORA 5DYGA 4YP1A 3VHRA 3DYIA 3N2GA 2IHBA 2J3IA 4I19A 4CL8A 3E18A 1KFEB 1IZ7A 3IPCA 1GKUB 4NH0A 3RRFA 1NNSA 5JSKA 3ZHBA 4CEJA 1P6XA 2DSNA 2O7VA 3T0FA 4M7OA 5DN6D 2HI0A 1AKQA 3MYYA 3FXAA 1NW9B 1A98A 1P9RA 1PHPA 2X1HA 3GVIA 3NIBA 5CA0F 4KAAA 3FA2A 4W5TA 3CUTA 3WLFA 1E3JA 1L4BA 3LDUA 5HQ3B 1F0NA 2I6FA 1NV9A 5TNXA 3V7WA 3QE9Y 2H08A 2NN3C 3OX2A 3ZWVA 5MF6A 5IN5A 5E9JA 1HYQA 1SUSA 1WG8A 2BKLA 4N1AA 4OJYA 1S2DA 2C2BA 2CLFB 3JYLA 2P6UA 1R4MB 2R97A 3ZU5A 1HNZB 1TMKA 1A4IA 1N2SA 1RE1A 1LW7A 1MD9A 1N1EA 1REQB 1TMOA 2HCTA 2Z5LA 2ZBPA 5CDGA 4LJRA 1F2VA 1G5HA 2R6CA 3DE3X 2FW6A 4X7BA 2JFNA 3N58A 3QIAA 4JOCA 4M8IA 4V0SA 1I4TD 4AWAA 1FFWA 1OXUA 1T2VA 1OTXA 3O74A 1IONA 1QGOA 4MPTA 2J30A 2PMBA 1T4BA 1QFJA 4LHSA 2O2JA 1OT3A 2WIBA 2A5GA 2MINB 2BL4A 3LFUA 3GLHE 4R41A 3KKEA 4B87A 1VBMA 1D4AA 1KVTA 1JSRA 3UWSA 5GONA 4B2LA 1KEWA 2O2DA 3BH7A 1PS9A 4LJ9A 4LTNA 3UUGA 1E2EA 2HAEA 4MMZB 5D7BA 3I37X 3B12A 3L3BA 3VVMA 4CL3A 1N32B 2DRIA 1X1CA 1XVVA 4LAFA 1RWVA 1X2EA 3CEJA 3QVGA 4RFSA 4IUDS 5HJ5A 3GHHA 4D4JA 5ELMA 2BRUA 3T7CA 2O0HA 4O2AA 3QA3E 5KOJA 1UC5B 3TLCA 5BRJA 3B1KA 5BN4A 2O3RA 3GRFA 4JXZA 4HQNA 4YC7A 3TG2A 1UK6A 2YZMA 3MFQA 2Q45A 4YRQA 4HNAA 4RV4A 4BS9A 1NBEA 3BK7A 4W1SA 3DMHA 4TOIA 1BOFA 1L7DA 2BTEA 2BYTA 5LP6F 1P2UA 2V3WA 4BU1A 4M38A 1FLDA 2NZUG 3B82A 5F7ZA 3DPSA 1K4MA 1NXPA 4A6DA 4CJXA 3G2NA 3PQDA 3DKPA 1G6KA 3ZWBA 2WKPA 2G5TA 3KPYA 1MKYA 1OIWA 1VHQA 3C3YA 3SEZA 4RTRA 4YRSA 1S9DA 5HTOA 4HH4A 2BIFA 1VI5A 4AICA 2MT9A 2J4FA 4X3CA 3T7KA 4LY6A 3M2TA 3I30X 2WZQA 2GCIA 3CT4A 2GOYA 1CDEA 2A3NA 3AJAA 4OHVA 4U5XA 2GRUA 2GPNA 5F9MA 1KHHA 3T3EA 3AGQA 4CKWB 4D8VA 1Z5WA 4CHGA 4OQLA 1LPOA 2YN4A 1WCIB 2XPCA 1NWHA 4M8SA 2F3QA 4L1KA 1SBCA 2FGKA 3DZ8A 3HUUA 4OCZA 1QIIA 5CXQA 1YONA 4FN4A 4GMKA 2IDKA 3B6EA 4XB2A 4J75A 3FYDA 3MQFA 2C2ZA 3Q7IA 3V8MA 3IUPA 5AI6A 1YR8A 3DH0A 1YFKA 1VIAA 4ZJYA 5C8ZA 2KB0A 3DXYA 3I9LA 2XWSA 4C7OA 4UEOA 5KJ1A 3S2ZA 2A6PA 4R9RA 2NSJA 4OI1A 3RV4A 3UO8B 3VKFA 3NXKA 3FYSA 4GI3A 5I01A 1CTQA 4OX9B 2BFNA 2QEQA 4BEVA 3EA5A 3GZTB 4DBVO 2FA9A 2VVTA 1PWZA 4HEJA 1QIKA 2JLQA 1VYTA 4ZOLA 3GEBA 1QCDA 1YHNA 3DZIA 2X9GA 2JVJA 3K0CA 4TTSA 4DMRA 2O8DB 3IEVA 4IQ8A 4M37A 2IUYA 3GJ6A 4ZQBA 3PDUA 4ZAGA 4X1YA 2PSDA 5FUXA 4JL8A 3FYUB 5B1HA 1F1JA 1LDMA 3HKCA 3OJEA 3OECA 2ZIVB 1GL9B 1E9SA 4ND7A 3X1ZA 5KPDA 5HRUA 4F8YA 5KVAA 2OV8A 5DF1A 1WY5A 5AI4A 4BQIA 1U99A 2BFBA 3GYBA 5AO9A 3BGOS 1KYVA 4TN5A 2B8WA 3T4XA 4CM8B 1USKA 3HB0A 1XVIA 5B2FA 4OHRA 3PUYA 1YIAA 1MAAA 3GFTA 4EI9A 1J99A 3NWPA 3WHLA 4HY3A 4JI2B 1TZBA 4U00A 3C8HA 5FOSA 4Z0HO 2HJVA 4KREA 1KI6A 1P8AA 2XXBA 3AL3A 4HGPA 3HXLA 5TQJA 4KHPB 5HF6A 1GOTA 3WYDA 1V71A 3BKXA 1F8YA 3I9JA 3FWNA 4EG3A 2XX3A 7MDHA 4YCLA 1MQ9A 4DMGA 3ED5A 2PKEA 4L27A 2VWGA 3A1EA 3K0FB 2NYUA 3UKOA 1A2QA 4GSKA 5HIMA 4QIHA 3WQSB 3ZWYA 1CG6A 2I76A 4A36A 2R1VA 2CL7X 3PX3A 2C29D 1AZLA 2BM8A 2J5RA 1J2JA 3R0VA 2BFFB 1AZWA 1PN3A 4DQUA 3K31A 3OQMA 4JA0A 3T3NA 2ES4A 2AYXA 2C7RA 1A4UA 3NNDA 1DS6A 2VQ3A 5I47A 3C70A 1D2MA 5I5GA 3GA0A 2EJTA 1SVNA 4X85A 2E2WA 1SU6A 1X7HA 1GNPA 3LYHA 4MWSA 3RS4A 2Z57A 3VR3D 5BPFA 4LE0A 4UC0A 1L7MA 1X8LA 4DGSA 5FBWB 1L5NA 5C4IA 1AXEA 2Z5GA 3EG5A 3PF9A 2HLHA 1YBFA 3FKQA 1GL6A 3TNYA 3ROQA 2QAGA 3V4RA 4E13A 1V8PA 4D5EA 5LNK1 1OLSA 5IHPA 3BS4A 1RXCA 2JD1A 3PBKA 4YCJA 4A91A 2Z8ZA 2AFVA 5JCOC 1MIOB 2ZSKA 2HV9A 1Z18A 2D0OB 5FWDA 5FOUA 2E21A 4IIEA 3WADA 4PG4A 2QW0X 3LF1A 3FMIA 4G1VA 4MCAA 4UBNA 1YZNA 3WC4A 3DR5A 1NSFA 3LCVB 4YMWA 2WYVA 1TYDE 3PXUA 4ZZ3A 4ECAA 4TS4A 1CWUA 4G8JA 5TF0A 1TM7E 3GEIA 4K9OA 3IGFA 3L8DA 3JZMA 1OI2A 3JQRA 2VYCA 3L77A 2W2OA 1BGWA 4FR5A 4G37A 4JNKA 4NENA 2IHNA 1HX7A 1FDOA 2XDAA 2VR1A 3QBJA 4RJTA 4BO8A 1PBNA 2MR6A 1EK5A 4HYTA 3WK8A 5FNVB 2NYAA 1E7SA 2BFEA 1Q7EA 2DETA 3K1AA 1HEIA 2I78A 4OY3A 4UNSA 5F2NA 1HE2A 2XRMA 3K92A 3OU7A 2ACWA 3D54D 4J3JA 1HI9A 4D8UA 4D9GA 4OYHA 1G1AA 3M5CA 4LVNA 2NU7B 1GXSA 5CW2A 1BROA 5JBQA 3GZNA 3LHDA 4W1QA 1YACA 2CYAA 1JPUA 3COYA 3CVXA 1MUUA 1TM3E 1XBTA 3DTVD 3E9CA 4FZRA 4DQ0A 1E2QA 3JRXA 1QV9A 1M6HA 2JIMA 1B0PA 2QPTA 3H4VA 2C7BA 3L49A 5FWXA 4D1YA 2Q1SA 3LRPA 2JFFA 2VSNA 2D1RA 3PZBA 3STTA 2QLBA 3UMCA 1ZVVA 4TTIA 4JXJA 3M5PA 3NYWA 1JHQA 3GBVA 2FKNA 2G0NA 1T1RA 1XB2A 3KLOA 2BVNA 1KK0A 2QL5A 1T8PA 3FTCA 3OHSX 1ZXXA 2GN2A 1O5IA 2ZTLA 1JNYA 1PFUA 3O8LA 5BOVA 1D04A 1PFWA 5J1SB 3CRMA 3CISA 4P34A 3A3PA 5JLAA 2V03A 3IO3A 3M6XA 1K27A 4DREA 5A6SA 3OIWA 3DLIA 2FXVA 3BAFA 5T3UA 1UFKA 1FB5A 3EZLA 4PYNA 2QE7A 3AR9A 4RZSA 3TX2A 3DLCA 3AFOA 4LDQA 4TL7A 3ESCA 3ENNA 3M5WA 1R6TA 2VNJA 3OQBA 2W8BA 4Q4AB 3GGSA 1GFSA 2RHDA 3NOVA 5KSYA 1ZBDA 2I80A 4HJXA 2J6HA 2H59A 1T0PA 4WOKA 2I34A 3VOSA 1GLGA 1LBQA 3DE1X 5E4FA 3ZCPA 4CGYA 4EFNA 1A5AB 2G76A 4ID3A 4I6GA 5EPOA 1FDRA 1G7TA 3TW4A 4R2XA 2C8LA 3I01A 3QLJA 5E1OA 2I22A 4KR7A 2UYGA 5KYWB 2OD9A 4N9QA 2W83A 1PZHA 3MTDA 1PK9A 1VTKA 4W1PA 4XUEA 4EARA 1A9TA 1CRQA 5JSFA 2PO7A 3RROA 4J0EA 1ORVA 1JRLA 1Z5OA 1JVSA 3LK6A 5ICGA 1SC3A 3A05A 3CPHA 4AJHA 3WZ2A 4ENTA 2VJQA 4IBOA 4XQEA 2O3TA 3AVOA 2Q1XA 2JDIA 1SC9A 2BDTA 2F1OA 3EB9A 3Q98A 5LYYA 4EGJA 1M0SA 2Y68A 5AHKA 4IIJB 1OV4A 4DANA 4UEQA 1BXRA 2Q8QA 2JH8A 2YMLA 1KKUA 2ZETA 2GBCA 3IHWA 4UBOA 1FNNA 1V16A 4CG3A 2QYHA 3MAGA 5F2KA 4D9IA 2O54A 3HG7A 3RTCA 1KP3A 4G1FA 5ERYA 1EX7A 1IBRA 1KOFA 3E27A 3Q9LA 1DXQA 4TT3A 1HQKA 3L1IA 4KXXA 2HRZA 1SZCA 3HZHA 3FTNA 3MWYW 4W5OA 5E3IA 1PX0A 2PS3A 2PQ0A 3QG5A 1DC6A 1RWNA 2X9QA 5CM9C 3QWBA 1OE0A 1ZNXA 5HRCA 2GS9A 1TU4A 4PBTA 1UINA 1X77A 2P9CA 2P1DA 3ELWA 5K3CA 2D54A 1QORA 1NUUA 1V2HE 1SQGA 3GDFA 3HCBA 4L8WB 4YMSA 2EYUA 3R0QA 1SQ0A 4P83A 4YP9A 1T5HX 4D5GA 4EFMA 1HDYA 1OX5A 4UD2A 4Q18A 5IDVA 1U3DA 4ZAVA 1Z12A 1BHJA 3U9SA 1W5AA 5JC1A 3IR5A 5BT9A 4ZYZA 2FN9A 3GLHA 4CN9A 2APJA 1Z5PA 2WUDA 3BWCA 3KSUA 4O4IA 1R4AA 4N3NA 2Q3CA 5FLEX 1JQ3A 2E37A 3W5SA 1SC1A 3L7LA 4BIIA 5BR8B 4I9HA 4WEQA 1U6IA 3UV7A 3OLWA 1A97A 2Y6UA 5FNVF 4GL4A 3VYWA 4Y2PA 1L7QA 5JTUA 3PVCA 5DMXA 4F3RA 1RWXA 3HB4X 3V1MA 5JCPA 1E5QA 5BW6B 1MW8X 1O87A 1Z6AA 1M1ZA 2EX4A 2GUGA 1NQWA 2A35A 3KZOA 1DBIA 1V7CA 4P33A 5CK5A 2DHRA 4GL2A 1JR6A 3K2QA 2JEOA 3G2LA 2B7CA 5HF5A 3RRJA 2Q1YA 4Q9IA 5HDQA 1C9EA 5JD5A 1PJAA 2X0FA 2YX1A 2LXNA 1PW5A 5JDIC 2A7QA 3PDIA 1TZCA 1XQ1A 3ZJTA 2MOKA 1QV7A 2NUPB 4HS9A 4C2BA 3ZI7A 4X64B 1OH7A 1EFVB 1G0OA 1HTTA 3W4IA 5C4MA 4M9CA 4HB3A 5BVGA 2AGVA 1FOEB 1QG2A 1Y42X 3KV1A 1XT6A 4GWKA 1EESA 1T2CA 1OIXA 5JJIA 3GJSA 2FPPB 2WV7A 1F4PA 3FIUA 5AXCA 3ZCSA 3CR3C 4LE1A 8MHTA 1C4XA 3ZVKA 1BX0A 4TKZA 3WQQA 1RWPA 4D92A 3ZU2A 3VR6D 4ER5A 1JEOA 3U4GA 2XE4A 3I4LA 4CCYB 5A3VA 1LNQA 4U7DA 2EKZA 1Z22A 1JEQA 2P5TB 5EIXA 4EK9A 4EY4A 3AF4A 3CKLA 4KQFA 3B3FA 4EF6A 2ECOA 5K4AA 4YAGA 2IS6A 2RE8A 3WIVA 4KSYA 2EP7A 3HP1A 4BVFA 3AVQA 2EW1A 2QY6A 4DR3B 2VEOA 4WCFC 1TMGE 4LZNA 3ZXIA 3DMTA 1PVDA 2B3TA 4FD3A 3MGAA 3KUXA 4LDRA 2WM8A 3HV0A 1KSFX 1T13A 4R5MA 5LR6A 1QQ5A 4BZWA 3TLBA 1T3ZA 4ND8A 5IPFA 2ZWMA 3F1LA 4XQGA 2E4AA 4N9WA 1WXIA 4TYWA 4FHCA 4NSNA 1W4RA 3BWDD 4IIUA 2OZLB 1QRDA 1GPBA 3BFPA 3M4NA 5DISB 3AOEA 1DAPA 1B43A 3OZIA 5T8KC 3PRYA 3W5HA 4A23A 1C8VB 3ZYZA 4BO1A 1LSUA 3DWIA 2VF5X 1JA1A 4A3SA 5HILA 2PX2A 1IXZA 3DOOA 4F6CA 3D3EA 3RU7A 3P2IA 1KVRA 1RR6A 4ID9A 1W85B 3ANTA 3PTLA 4IIJF 1TJPB 4X90A 3S27A 1WDLA 1OJLA 4O1HA 4JH0A 3EA4A 3PQ3A 3FMOB 1MNAA 3LBIA 2UXDB 1A72A 5F21A 1HSZA 1NU8A 5JQWA 3TIVA 3R1IA 2E87A 4W9RA 1PTJA 4TYMA 4WZAE 4ZAYA 2I6XA 1XZNA 4QHTA 1CXZA 1DTEA 2LCIA 2R6FA 3JVVA 4HWGA 2HJWA 2IZ6A 4I1YA 3E5RA 1UPFA 3V1TC 1XK6A 1NC3A 4MRVA 3RM3A 4N41A 2B1QA 3H3JA 3RIMA 1B73A 2Y1LA 1J90A 3ETGA 5AUOB 3NG1A 2PT7A 4JBGA 3G17A 1XJ0A 5KTOA 4ZVPA 1OAKA 5DT9A 1V4VA 5EE5B 1UZMA 2I03A 2NXCA 3DA8A 2BZ0A 5EMNA 2H4HA 4U4AA 4L7VA 1SOMA 2ETVA 1YVDA 1QP7A 4L6IA 3QJ5A 2OPHA 2EQ5A 3KJNA 4KH1A 4EEXA 1HFEL 4R68A 4RVDA 3W4KA 4H6VA 1QYRA 4NY1A 3D5TA 1LTKA 3KKKA 2YJGA 5U1PA 1H9AA 5KTMA 3RUCA 2R00C 1DWUA 3EG9A 1E0DA 1XROA 3U16A 3H0KA 3BGWA 5KAPA 1N8KA 4DIUA 4BPRA 5KNCD 1ZLYA 4W9MC 2C7VA 1Z4NA 3I6IA 2C8JA 5J5AA 1KQPA 2GNOA 3ZCQA 1D2CA 4LDJA 4DVJA 5TB5A 2RCNA 1YQUA 3GI1A 1R0ZA 3RFXA 4MPDA 4Z9XA 4D74A 1H2WA 2CJWB 2WUFA 3C4JA 1TVCA 4HDMA 4LZOA 5FFNA 3G5AA 5A3RA 4UAUA 1C30A 1GSOA 4MO9A 3IJEB 4KUHA 3IAHA 1R50A 4JASB 2IYSA 2PL9A 1ZG3A 3FDIA 4GNRA 5EWMB 1QIMA 1YIDA 2HQOA 4OBXA 5FPSA 3K72B 5CYFA 1X19A 4L3OA 4AMVA 5TPWA 3IP5A 4ZC8A 2Q5LA 5G0SA 1QTRA 2R7LA 4FUTA 3GXBA 3K16A 4D8XA 5CG1A 1ZVJA 4HAYA 1T3SA 2QRQA 2EYQA 2VPXA 4J29A 2ZCJA 1PFQA 1Q3TA 4R1LA 1M2KA 2J7PA 3T7IA 1JVBA 2GA8A 1SUPA 2V7QD 5BQFA 1CEEA 4OLJA 4HQKA 3L8EA 3MD9A 3RRZA 1ZGCA 2PTGA 3NHWA 3TKAA 3HN7A 3PVSA 3DHWC 4EI7A 3OU2A 4ZEOA 3K9GA 1RRCA 3RYIB 4H6XA 2EZ4A 3BVPA 2P9ZA 3A6EA 3MSCA 3RIHA 3DXFA 4GUDA 1EQUA 1GPJA 4S3MA 2FWNA 3AEQA 5HWSA 3OEWA 4RZ2A 5SYNA 1KBZA 2PIDA 2YS6A 3D2AA 2QX4A 2YHUA 4LOJA 3PHIA 3ZHQA 1A1SA 3O9VA 4MJ3A 3N5CA 1FYWA 1NN3A 2GERA 3UGJA 2AF3C 3FUVA 2YOFA 1XTTA 4MJXA 2WDZA 3A4VA 3AZOA 4Y0NA 1Z0FA 1M6WA 1CUVA 1L7NA 1MRNA 1OKKD 2R25B 1QLHA 3KBBA 3NS7A 4IHJB 4K9SA 3T4PA 3VAAA 4MV4A 4LWOA 3JAKB 4PV7A 3RVNA 5FPKA 2Z30A 1AKYA 3QFTA 4HN2A 2P90A 3M1YA 4LRYA 2R6AA 5H1YA 3DPIA 3QKRB 2RIRA 3EQ8A 4KAXA 2YOGA 1BW9B 1XCBA 4EGQA 4I1UA 1P44A 4ZGGA 1Q3HA 4MV9A 1QNLA 3TIIA 5IDWA 3U5TA 5K0NA 2Z95A 3D4NA 1S3SA 3DGFC 5CNMA 5AICA 4KODA 4QU9A 4LOLA 4O2RA 4FINA 1LSOA 4NF2A 4X93A 2M9MA 3NBKA 2ZYTX 1OH8A 2JI8A 1T0HB 2CJFA 3PU6A 2CVHA 2LVBA 2ZYHA 2VK8A 4Y1RA 2OB1A 3V9AA 6CHYA 3ETNA 4LX8A 2H4JA 3AM5A 4X3PA 2A9FA 3W0LB 4AKSA 2EF0A 5BSEA 3VVLA 1W4BA 1N0IA 2CNLA 5FUBA 2W2MA 1QH8A 3KYDA 4WZBB 4MYCA 4DWJA 1LBHA 3CZ9A 3IOMA 1ZK0A 2XAUA 3ZX5A 4EZEA 5KU7A 1V3UA 2Q4TA 1B15A 5A7HA 4CKCB 2JFGA 2G1UA 5EXPA 1ZK4A 1R3UA 5IEJA 3ZWNA 1Y1SA 1BVRA 4MJ7A 2W4MA 3EC7A 1RNLA 5G4KB 2FZKA 4OV6B 1M7GA 1M0WA 2C4TA 4PSVA 1P7VA 5EKDA 4O02B 5B3JC 3KR2A 4FJ2A 2B5WA 3EW9A 2QUBA 3NIGB 4E6PA 1IBLB 2PJRA 2X42A 3TQFA 4MWGA 4K9RA 4RL6A 3UW1A 4CKEA 1DBPA 2B8TA 4JR1A 3WLJA 2PGDA 4U7JA 4FWTA 3QTBA 2BEKA 4G63A 1PGJA 4RY9A 4XKJA 4MV3A 3UXEA 1KJWA 4KGXA 4C7VA 4ZO8A 2HWXA 5EUQB 2C88A 3G7SA 3NM5A 4J6EA 4H0NA 3C8DA 3DMDA 3NIWA 4K6HA 1RC0A 1OLOA 1HQYE 3BMOB 1JUDA 1UANA 3F7MA 5CP8A 4EO7A 1ULAA 1JT2A 1QHFA 4TZ0A 1UJMA 1KMHB 3SIPA 3PXAA 4LIPD 2A94A 1UZUA 2H4WA 3EVZA 1GA4A 3FWPA 5TSDA 1ZUNB 3ZGXA 5C8DA 2O23A 5ALHA 1NY6A 2HNBA 4GLLA 1QBKC 4D0RA 3A1NA 1SBNE 2UUBB 1EYZA 1KAHA 3E8XA 3KQPA 5BY2A 1NVXQ 1JQLB 1S8AA 1R9NA 2Y93A 2XMQA 2IV2X 2H4YA 4BHTA 3Q5DA 3TCNA 3VR4H 4KLCA 1VLLA 5CFOA 3OA0A 3BRQA 4I50B 5EE3A 5ENVA 1UBNA 2QK4A 3VYVA 4G36A 3QG1A 3OT5A 1XZFA 1SXPA 1W34A 3MINB 3PSAA 4EP1A 4TKMA 4BFUA 3VSBA 4JYZA 1TYZA 2C1EA 2WLTA 4BKOA 3PYLA 1G8KA 1SM4A 2DBYA 4GC9A 3WJAA 2G9QA 3KXPA 4GMFA 4MV6A 1ICEA 1VG0B 1L4UA 3O73A 1A9SA 1PJQA 4JR2A 5TF4A 1WETA 1HDRA 5BNTA 3LY5A 4KTTE 1E6MA 4EWLA 2C94A 4Z54A 1P3Y1 3IUNA 3T5MA 4YMVA 2NOAA 1W7AA 1UAGA 3I6BA 1A9QA 1FFYA 8AT1A 1BE6A 3SC4A 4INAA 3RVMA 4TZ6A 4JYPA 5JALA 3CWCA 1VE5A 2QRUA 2YIJA 3DDZX 4NAHA 5HK8A 1G66A 2FQXA 2HF7A 3TRIA 2F9FA 2JI9A 2OK7A 3QU2A 4BKRA 4CKYA 2JFUA 3GC6A 1OHHD 4HR7A 5B1EA 1T8TA 4QU8A 1T1IA 4C05A 3UFXB 1ETHA 2E7ZA 1ANKA 4L8YA 4MKGA 2PTHA 1UUFA 1QCZA 3IQHX 3LUFA 3CUWA 1RXSA 3GJTA 4YDRA 2Z09A 4DNFA 3E1KA 5ADUS 2BH9A 5CDFA 3OE7A 5L4SA 3JARA 4ESHA 1IY9A 4ZCMA 1GFWA 1X7XA 4TKVA 5IT4A 2ZBVA 3LOUA 3UA3A 4DIKA 1KEVA 5HVNA 3O03A 10MHA 3ETJA 5EUMA 4QUIA 1LPAB 3HBMA 2A4KA 5TS2A 4QPJC 3ZCTA 3RYCB 1GM5A 5C81A 4J7UA 3N59A 1P1RA 3S2FA 3BSWA 4JB8A 2ZPUA 4HD8A 4BNTA 5J2TB 2R8RA 5G53C 1E3WB 1JH9A 3OIVA 4OP1A 4BKMA 1RI5A 3P9CA 1L5RA 1N34B 3LPDA 3ZDBA 1TT5A 4JKYA 3T06B 3HWX1 2XMBA 4F3KA 2BH2A 3WWYA 1RKQA 3QPWA 4CT4B 3EOBI 3C3WA 3W3AA 5T57A 2OBBA 3S8EA 1E8MA 3VI3B 2G8LA 2PIAA 1GTSA 1FP4A 3ESZA 3HVKA 2I4NA 4IOLA 1LY1A 3BTVA 1DOHA 5EJGA 2CF6A 4AKIA 1IQUA 2WD7A 4G01B 1BDBA 2B92A 2P2YA 5DP2A 3P0IA 2J3EA 3NLLA 4CMGA 4EUHA 2H1CA 1N6IA 1K5HA 2QLLA 3V4ZA 4PLWA 3ZHVA 2O2HA 4LDZA 2X5OA 4HDNB 4BZPA 2H2GA 3OZAA 1GQ2A 2Y71A 3QX9A 2VA8A 1ZM7A 3D4OA 4FSXA 1BEEA 1UM9A 2EFGA 4EUNA 1HTBA 3F4BA 5CGZA 3BHJA 3RC3A 5BRAA 1OPRA 1O3YA 3TRJA 4G6ZA 4BV9A 2PCJA 4GOMD 2VK1A 3BFVA 4LRTB 1W5SA 4O4JB 3RTEA 3G2PA 1VKHA 2GNPA 3U4QA 4AYXA 3TPFA 3CB4A 4C4SA 2O06A 4MDHA 3KOXA 1HG1A 3P9RA 1W0JD 2Z6QA 1RM3A 4MKXA 1RQ2A 1OC4A 3IT2A 3E8SA 3URKA 2D3WA 1E7RA 3EVAA 2P4SA 4QGSA 4Z1MD 4UMVA 4BNGA 5K8JB 2FK8A 1K8RA 4W5WA 3I0NA 1G8FA 4K88A 1TXGA 1YVEI 1F60A 2FPKA 2O7SA 2GB4A 4MUEA 4RH1A 4C3ZA 1G2PA 1S9HA 2SCUB 1YRHA 2IHYA 4LYGA 3TXXA 3E9YA 4G0WA 1WKBA 3FDXA 1QGYA 3HNRA 4HFRA 1A7KA 2JGKA 3VHXA 2PUGA 3VYSB 1XD9A 3K1ZA 2ZWAA 4IYJA 1A71A 4MV0A 3TBFA 4D3YA 5E7QA 3VYUB 4Z4QA 2W6JA 2JCBA 1OLUB 4WZAA 5INTA 4H7IA 1RCTE 1K68A 4WUTA 1N2EA 2DR3A 3SZ3A 5EY5B 5C32A 1I01A 1U2ZA 1J24A 3IJRA 2QMHA 1BMFA 4IWNA 2JS7A 2EFYA 4B6SA 1N78A 1UP6A 3A70A 1JS1X 1Z13A 4AECA 3PA6A 1CNMA 4RPGA 2QTNA 5A0TA 2SECE 5TJ9A 3RVKA 5DDIP 4XRGA 2FAXA 1GL7A 1I3MA 1X1SA 2X6QA 2ZAIA 3C8UA 1U31A