3AJ9A

X-ray analysis of crystal of proteinase k obtained from d2o solution using peg 8000
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proteinase K
publication title High-resolution X-ray study of the effects of deuteration on crystal growth and the crystal structure of proteinase K
pubmed doi rcsb
total genus 104
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2010-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3aj9A00
2X8JB 1S2NA 5K7SA 2SECE 1SPBS 4WOCA 1ZVJA 5ARBA 3CO0S 3VTAA 2PWAA 1C9MA 2W2MA 1TM7E 1Y3BE 1GT91 1SCBA 3QFHA 1R6VA 2W2QA 3DE4X 4NE9A 2WUWE 2G4VA 1AV7A 1MEEA 1AH2A 3EDYA 4BWGA 1IAVA 4CG0A 3LXUX 1P7WA 2HPZA 3D43A 4K8RB 3AFGA 3GCXA 2V8BA 1BFUA 1GTL1 4C3VA 1Y1KE 2ZRQA 1SUPA 1SUAA 4ZARA 1SUEA 4LVOA 4HVLA 3AJ8A 5JXJA 1A2QA 3QTLA 4AKTA 1SIUA 1AK9A 3VV2A 2Z30A 1GCIA 1SBCA 1JEAA 3QMPA 4RYDA 3ZXXA 3WIVA 1CNMA 3A3OA 5JXGA 4JP8A 2IY9A 3CNQS 1R0RE 1ST2A 3DYBA 1BFKA 1Y34E 1CSEE 2IXTA 1SBHA 1SCAA 2DQKA 1KE1A 1AF4A 2SBTA 3DDZX 1VSBA 2ZWOA 5ARDA 1GTG1 1TMGE 1GA1A 3DVSX 1GA4A 1Y3DE 4H6WA 2ZWPA 5JMOA 1DUIA 5AVJA 2ID4A 1V5IA 4OMCA 1NLUA 5CW1A 1T1IA 1SUCA 1SCDA 3I2YX 2SICE 3OSZA 3VYVA 5JXIA 1C9JA 1R64A 4C3UA 1DBIA 3F49S 3AJ9A 5FBZA 3EIFA 3WHIA 3DW1X 4DZTA 2WUVA 1C9NA 2Z2YA 1SH7A 2W2OA 4LVNA 3TECE 1Y4DE 3L1KA 1SBNE 3DE2X 2ID8A 3GT3A 3T41A 2Z58A 1LW6E 1GNVA 1TM5E 2QTWB 2Z2ZA 1OYVA 4H6VA 1S02A 1Q5PA 4I0WB 1SCNE 4Z2AA 2Z56A 1TM1E 3LPAA 3WIUA 3LPDA 4FONA 4B5LA 3VSBA 1SN7A 5I9SA 3DVQX 2PRKA 5B1DA 1NDUA 2W2NA 3ZXYA 1SIOA 1XF1A 4H6XA 5FFNA 1P7VA 1SCJA 1Y4AE 4OMDA 1T1EA 4M1ZA 4OV6B 2PQ2A 1PEKE 3DE1X 1SBIA 3TI7A 1AVTA 1T1GA 1EA7A 2X8JA 3SICE 1THMA 1WSDA 3DE3X 5AMXA 1WMDA 3DWEX 3F7MA 1S01A 2WV7A 5AVKA 2Z57A 3A3PA 3Q40A 2E1PA 2P4EA 4KG7A 3I37X 1P8JA 3DW3X 3UNXA 2PWBA 1MPTA 3DE6X 3P5BA 1TO2E 1Y33E 5AQEA 1SUDA 3PRKE 2WWTA 1IC6A 4ZOQI 4NE7A 3GCWA 3D9QX 3GT4A 1YU6A 1EGQA 1WMFA 3H42B 2TECE 1TM3E 1SIBE 4DWWA 4DJ5X 5B1EA 1TK2A 4WOBA 3A3NA 4GI3A 1TECE 1TO1E 2XTJA 1BE8A 4NMXB 2XRMA 4MZDA 1SUBA 1KDYA 1SELA 3DE7X 3VHQA 1GA6A 3BGOS 4J94A 1PJ8A 1TM4E 4CFZA 3DE0X 1V6CA 4KPGA 1Y3FE 2PMWB 3VV3A 3HJRA 1AU9A 2W2PA 3LPCA 1ST3A 2SNIE 5JXHA 4AKSA 4CFYA 1WVMA 1Y9ZA 3BPSA 1GNSA 1PTKA 1BE6A 5ARCA 3SQOA 1GTJ1 2Z2XA 4KB5A 1HT3A 1KDZA 3DVRX 1UBNA 1ZVKA 1C3LA 2ST1A 1AQNA 2PKCA 1OYOA 1Y3CE 1NDQA 3EE6A 1YJCA 5FAXA 1BH6A 1WMEA 5SICE 3F7OA 2PYZA 3Q5GA 1YJAA 3I34X 1Y48E 3I30X 4YN3A 2DUJA 1BJRE 2B6NA 1KDVA 3DE5X 1KE2A 3WQBA 2HD4A 3BX1A 1PFGA 1SVNA 4HX2A 1SBTA 1YJBA 3TI9A 1OT5A 2DP4E 2GKOA 3PTLA
chains in the Genus database with same CATH superfamily
2DCMA 2X8JB 3NT5A 1EFPB 2WA2A 3ZUPA 4LMRA 4CM1A 4YJ3A 5EC8A 5AOBA 2IV2X 2O8VA 3KSBC 3K70B 4ESEA 1YQ9A 4L0QA 2H2FA 2XWPA 3M6FA 2Y9PB 1ZINA 4UJ5A 4PZAA 5CT9A 3RYFB 6ADHA 5KSWB 2WAXA 1O5OA 1JHYA 2ZTMA 2BFOA 4R8RA 2XUKA 1IVYA 3R44A 3CNLA 2PSJA 4F60A 4GQAA 4OSEA 3ZOZA 1OLOA 2IOFA 1K5GA 2QX9A 4D4MA 1OTHA 2BI8A 3INYA 2F2TA 5JEEA 1NVVR 3QMWA 1E1NA 4D25A 3BIJA 2E5LB 3EGOA 4UMEA 3WLAA 1M0SA 4BDTA 5K3BA 3GFOA 3SYMA 2GRJA 4GGMX 4M7OA 4AJNA 2I3BA 2X0DA 4NARA 5JADA 1BYUA 2PSFA 2WDZA 2Z0MA 1KC1A 1Z12A 4LCJA 3CONA 4X7BA 1H22A 4DLYA 1GPJA 1IN7A 2XE4A 4RWZA 3AERA 1IY8A 2ORVA 2O50A 4UKDA 5JG7A 1S89A 4JKIA 1P9LA 3L40A 2FVXA 1EQUA 2YZNA 3PYLA 2ISCA 3VMMA 1TRHA 3QHPA 4Q93A 1DBVO 4EDHA 1CZHA 3SXPA 4EX7A 4W9MC 2IH5A 1PEDA 2HU7A 4H7KA 3KTDA 3R3YA 3NDBB 3C7DB 1B43A 1NF8A 4IWYA 4CEIA 3RV3A 1WZNA 3BULA 3L8CA 4LBZA 1DKPA 5ESDA 2VHYA 4R0VA 4UNQA 2IPAB 3G17A 2ZBQA 4UDYX 3FYUB 4EG0A 4X8OA 5AJHA 1OH6A 3Q88A 5FEUA 1DBPA 1OU4A 1YC2A 3R41A 3S1LA 4K1LA 1NBME 1ZK2A 3L4EA 4JNKA 1JP7A 3FPHA 3LLVA 2VDLB 4IHKA 4NE9A 4NZ9A 4RKRA 5AJWA 1P61B 5HK9A 1YKGA 3K1JA 4PEVA 2XA2A 3NHZA 1QV6A 3HR8A 3ET4A 1U2SA 3BRQA 5DSTA 1U65A 3DNFA 3UMVA 3KE9A 1QG6A 1Z2NX 3OJ0A 5DYWA 3ZTTA 4C76A 2RARA 1FY2A 1ZJ6A 1W19A 4OOFA 4AJLA 5KJCA 5LKAA 1GZ5A 4TT8A 3KCQA 2QYHA 3TS1A 3M6MD 4GLLA 3GLGB 4JVOA 4RABA 2JIDA 5LWQA 1WEHA 1ECFA 4KQWA 1HEYA 3G5MA 2A3NA 3EPLA 2C92A 2CLOB 2FMXA 4GMDA 2WF9A 3C43A 2CXUA 3GLUA 1NRIA 4ZI5A 5KNDA 4NL4H 3JVEA 5F3WB 3L0ZA 5CFNA 5BORA 221PA 2ZWIA 1WUHS 1QANA 3PJEA 3AY3A 1V11B 1VIVA 1XTTA 2HEGA 3H3JA 4YRGA 1K68A 3E3OA 1H2AS 3WB2A 5DYGA 3WKCA 4EHAA 5EJAA 3GRFA 7AT1A 2OD7A 1XMOB 1RRVA 4GM0A 4C4XA 1XHFA 5FPHA 3P0IA 3NH9A 2YCBA 5COQA 1CE8B 3TTYA 1H2ZA 1NYTA 4PRKA 2GKSA 3GHHA 1GLVA 5HKOA 1E9RA 2OXTA 4B6OA 1A88A 3HRHA 3PR3A 2WFZA 3AJ8A 1I80A 1NUQA 5A5EA 4AC9A 2B7LA 4IICA 1TKCA 4BB6A 4EGFA 1S96A 4EVRA 5EWLA 4FEYA 1VJDA 1NHGA 3C5CA 1QTNA 4TYMA 2R65A 1CXZA 2W6QA 1PGQA 5K3DA 3VR2A 4A8JB 3LXMA 2NIPA 3U4DA 4LTNA 4X92A 4F5YA 1QGOA 1NVGA 1OKKD 1P39A 1PNTA 4V0LA 3ZNNA 4UPEA 4O5AA 4LNAA 1EGVB 3FNHA 3UMGA 2JLCA 2W48A 4UD6A 4ZOLB 4B81A 1ENOA 1EVJA 4B6JA 4D4HA 1WTAA 1XXHA 3HFRA 1KOLA 2IS6A 3C70A 3ZW9A 2X0KA 3CCBA 4UCWA 1T2EA 2AD1A 3IULA 1J0XO 5HJ2A 3BXEA 5GPBA 5IT0A 4ZMSA 4AZSA 1CNMA 3KXIA 3BFXA 3L0BA 3B3FA 2IFTA 3AHDA 1DL5A 4NATA 4XB2A 2WFLA 1T25A 1CQWA 3B1FA 2BTOA 3JQ7B 2BMDA 4DAOA 1N1DA 1WR8A 4G41A 5GADl 4MI6A 1FNSA 4U7TB 2MTBA 3CZ5A 1B8NA 4G8BA 3V7YA 1NZDA 2CVOA 2Y0EA 4FFRA 4KXVA 1W5TA 4MV8A 3ZLJA 1V8PA 1COWA 3OJCA 4MQ4A 3HUEA 1QH9A 4MV4A 3M4ZA 4GBMA 5U9CA 1YR1A 2XCRB 4LDRA 3HUDA 3RVOA 4MUHA 3BIXA 4G5FA 5GTDA 5E38A 3UAXA 4B7ZA 4Z9BA 5ARDA 4P4TA 3U0BA 3FNFA 4OLHA 1GA1A 1QFJA 1LI5A 3QLVC 1M1NB 2AI2A 4B9AA 3J7AC 1PR9A 3V8NA 3HCRA 4IHAA 3S2GA 3GLFA 5IX8A 2E5FA 3KT0A 4AZVA 3AIKA 4CNBA 1QE0A 1X2BA 2QUZA 4MVYA 4WLFA 3GLFE 2FN8A 1WZIA 1LZKA 4M86A 4EJ0A 2C58A 4DLTA 4O59O 1CRLA 2HHLA 2Q8PA 5HILA 4D6YA 1OZAA 2QL7A 4W5QA 3N05A 1RDFA 3O4VA 4G5HA 5AVTA 1X8KA 2NYAA 4X85A 1SCDA 1TGYA 2JKYA 3GQBB 5EQJB 2BFMA 3G8BA 2D0DA 2WQZA 1DV2A 2R6ZA 5KSYA 1W7AA 3R5JA 1OY1A 1C0PA 1ZH8A 3E23A 1J0CA 3LY9A 5JEDA 4R05A 1UZAA 1N2ZA 5JDIC 4BLPA 1V16B 2ZI9A 4JY7A 3ZV7A 2GERA 1EE2A 2ZT8A 3SEFA 4EY7A 4HT3B 3SOZA 3EGXB 3JALA 2UZAA 3KQPA 3RAPR 1C9JA 4YUVA 1IPFA 1NY5A 1Y6ZA 2C98A 2W0SA 4C3UA 2XTNA 3LBAA 4Q9NA 3H9BA 5FBZA 1NUTA 3QVMA 3WHIA 4PXYA 1DKMA 3DSRA 5ALLA 3JVUA 2EGUA 2VF8A 1K6MA 2ZSJA 1Z16A 4NAHA 2FGKA 1TAUA 1EMDA 3ORYA 3I9FA 4INAA 3ZDDA 2FX5A 2LTAA 1RP7A 1K75A 3DZJA 3SVZA 1W9MA 3KLOA 4G8JA 4PIPA 1XMXA 1SH7A 5T57A 1GPKA 3FOCA 2RGUA 2OGTA 3MCUA 2NYRA 1NQWA 5B2ZA 3TECE 2XADA 1QGAA 3I9MA 2O8CB 4ZVMA 3LT0A 5EZ5A 5ALUA 4E3ZA 2OGWA 3NHYA 3KBBA 3PUJA 3ULKA 4WASA 5A9SB 2ZUBA 1RWPA 3N28A 3VC3A 1YKSA 4LOHA 3OE7D 5EESA 2PUHA 4Y0AA 5LD2B 1WIWA 1EFHA 3UZUA 2EEPA 1JKFA 4QULA 1OUMA 3UGKA 2OV4A 4GC5A 1IIBA 4RTMA 4MRVA 2OFWA 2P5SA 2ZP1A 1DV1A 1TIPA 1SVMA 3F9CA 2FG5A 3LOQA 3M83A 1Q5PA 4J7AA 3AQ4A 4I0WB 3UATA 2ZI7A 1N7JA 1SEPA 2Q9AA 3R8CA 1AA9A 4J7XA 4EKIA 1PT9A 1QH8A 1L4YA 3C6ZA 3VTFA 3TAXA 1RW4A 1SBQA 3OICA 5FYDA 1FRVA 4O6VA 2XXAA 3IQXA 2E87A 3E27A 4JJ7A 3BQMB 4BQPA 5JWOA 1FP7A 2P6RA 1MW8X 5B1YA 5CURA 5B1DA 3ZHQA 1CZOA 3ZCUA 2VNJA 4EG6A 5CYGA 2HK7A 3NFRA 4BMXA 4JJEA 4DDTA 4R2MA 3RKSA 1KR2A 4CYMA 1M3SA 2ZR7A 4RQTA 4DBVO 2IEIA 4PYKA 4P5EA 5F33A 3C3DA 4L9WA 2VHWA 4KE7A 4LQ4A 5FFNA 2BTQA 4GLOA 4C0JA 5J4HA 3S2YA 1N5RA 2Q5HA 3QVSA 2C7QA 1JA1A 1Y1RA 3RSQA 1U90A 2QNIA 3FVQA 4Y2YA 5KYYB 3CPJB 1ZZGA 3N9IA 1CW2B 5F1YA 3TG8A 5KVSA 3GH3A 4AG3A 4CL8A 1LRJA 5LP6F 3O74A 4HAVA 2QR2A 4RA9A 1KMMA 3CKLA 3N6VA 4IY1A 2P3QA 2XTAA 2ZYIA 3ADKA 4RANA 3VPSA 3Q0TA 1G3MA 3FM9A 1JLRA 4HX5A 4Y2JA 2VZ9A 2YXDA 5AKZA 3WRXC 2RIRA 1E63A 3G2KA 3ZBUA 4EB8A 5KWEA 2R11A 5NLLA 1FIUA 2CJYA 1VTKA 5IVHA 4LX0A 4Q9LA 4ZN6A 2ZUEA 1E7YA 2HCRA 1E3QA 1QV9A 2L19A 3NV7A 4LZPA 4OHKA 5E7IA 1JMKC 4CV0A 5CAEA 5L6LB 2IOQA 2IYEA 1EBBA 3FDZB 3RNLA 3UXEA 5J1SB 4C4TA 1XA0A 5ES3A 5EHXA 1T0JB 1HZJA 1KSFX 1MOZA 1Y8QB 2J6CA 5AD1A 1J8MF 1QUFA 4OXQA 5GJVC 5CIYA 4ZHQB 5KMGB 4WH0A 2OHIA 4H7FA 5CPBA 3RC8A 3JYHA 3MTBA 5H4GA 1P8JA 3CCCA 5EUCA 1NW5A 1MPTA 1TOAA 2JH3A 4ZAZA 2JGDA 4C08A 4HWOA 3H9JA 1JZQA 1TKRA 3RB8A 2BELA 2ZS9A 2CXQA 3PXDA 4MCJA 3R74A 1C29B 3OEYA 2XB2A 4X1YA 3VM6A 3IDZA 5C5DA 1W25A 2FDXA 2AJBA 3BXOA 4H7DA 5HK8A 2E21A 3CE9A 3KU1A 4FNAA 3WB9A 1Y7HA 3HVKA 1U3UA 4HYYA 4I50A 5G0TA 2N3ZA 2CLLB 4UOQA 2OO5A 3SS7X 2AXEA 1SWVA 1XTPA 3RUIA 3VR6A 3RROA 1Z4PX 4M49A 5LU9A 1NLYA 3ZE0B 1T9AA 1NRJB 4CM7A 2MT9A 4BX0A 5B3LA 3A3YA 1Q2XA 1E1LA 3ZY5A 2PXXA 4HLUC 1OTXA 1QGDA 2Z5LA 4ZT7A 1XNGA 1TO1E 5EKDA 1BN6A 1XDUA 5EKTA 3R7DA 2P4UA 1FC0A 1M10A 3JQDA 4WMLA 2CFIA 1RYBA 2P8SA 3FLMA 4LYAA 2CLEB 3TRFA 1D4FA 3HEMA 4Z1MA 3H5AA 1QFMA 4Q3AA 2IQIA 1YUMA 1PYGA 4DQLA 1ZQ1A 4WLOA 3ZS9A 1P1CA 2JHFA 1UT8A 3K1TA 3KB1A 3AY7A 3UG6A 4I8IA 2TS1A 3RVBA 2OEPA 1PV1A 3FAZA 4Q03A 3OFSA 3WICA 2I6QA 4AJ9A 1HQCA 2FSSA 2WB4A 4L2IA 3TFOA 2JB9A 4V0KA 4KDEA 1GL6A 1T2DA 2O2HA 4KXYA 4S04A 4EABA 1IEWA 3W78A 4QPDA 1E9EA 4UNSA 1V6CA 3ZI4A 4DMRA 1HR0B 2Q3LA 3WAJA 2OV8A 3PI7A 3G0OA 4EA7A 3TIVA 1NJ8A 5ERGB 4K7JA 4D43A 2WF7A 3ZH2A 4EJSA 1CUHA 4NI5A 2RHCA 3UM9A 3WX0A 1QG0A 3C6MA 3GA0A 3GDHA 3HMQA 3PIIA 5DTRA 4CMGA 4EFMA 4R71A 5JS1A 1WVGA 4XQEA 4JLJA 1WHTA 1JHMA 1K4KA 4OGGA 2JLXA 1Z26A 3HE3A 4Q16A 1RWNA 2QV7A 4IIVA 3TW8A 3BPSA 4FCTA 4BZQA 2CWWA 5A5VA 1T3SA 2Z9CA 3NORA 2F4VB 5A2GA 1JKIA 4ABTA 1U02A 5F5LA 1QHHB 1T3LA 1IXZA 1C4OA 2XCTB 4XCVA 2JIZD 1N5LA 1ECJA 4HWGA 3FUUA 4A23A 1F8YA 2V6JA 1VIAA 1TYAE 3AIIA 4NESA 1QLHA 3JWGA 4NCXA 4TGLA 1DZIA 1UR5A 4R1SA 3DL4A 3I92A 3DGFC 3CZAA 2DECA 3R6WA 4QX6A 1YS4A 4D79A 3AKZA 1K6IA 3QLEA 4NZMA 5A0TA 3UWDA 1OD6A 1BVRA 2CFRA 2G63A 2OG1A 1UINA 1Y3CE 3ZD9A 3FYSA 3GEIA 2CN1A 3MGKA 2H92A 4KNWA 4FILA 1E2JA 1XCPA 4GMXA 4PBRA 3OCZA 3AL0C 2IZ0A 4O8ZA 1QHSA 2P2GA 3KEMA 2AFIE 3DFZA 3NAMA 3OHMA 4HH4A 1JDZA 2NYUA 4YR9A 1ILEA 3U9LA 3OY2A 3W3AH 1KEUA 2PKRA 2RHDA 2Y93A 3I8OA 3WLMA 4DARA 2ZZMA 4O4HF 1DAGA 2XUZA 2MIIA 3KZNA 2YYZA 4QLOA 1MRSA 3PU6A 3GPIA 1X7YB 2R96A 3NEJA 1HTTA 4QTUB 3WBKA 1W4CA 3V6MA 3KQKA 2IGBA 3OQMA 3PZBA 3ZVMA 4BKRA 3CX6A 5DLQC 4WK6A 3DE5X 1KBQA 2PZKA 4IIUA 3F46A 4R68A 2M98A 5CFPA 4FKZA 2QL9A 5G3ZA 4CHGA 3WE7A 1YK0A 4FJ0A 1VLLA 1DQRA 2WF6A 3AF0A 4LXYA 4JEUA 3L05A 1T5TA 3LGXA 2NO1A 1EVYA 3FZQA 1FLNA 1PBTA 3TSYA 4LV6A 2BGWA 3MAAC 2VYVD 1FZQA 3HKDA 3Q12A 2V6GA 2JAQA 2GJAA 4OFWA 4W9NA 1ADFA 2G1AA 3W2EA 4AN4A 4KAFA 3RS7A 3TSAA 1JJAA 3G0DA 1V1MA 5EJ2A 3JPWA 4YRPA 4AYWA 3NYRA 2HA0A 4YC7A 3B9QA 1HE5A 3KNZA 3Q3JB 4H4CA 2GMWA 2P1RA 1D2RA 5DLYA 1SXIA 2Y0BA 4EW1A 2BTEA 4N6GA 1PJ2A 3MOGA 1S2NA 2EZUA 4K6CA 1LVHA 2QG9A 3K0CC 3U9TA 4PX5A 3RLFA 4J0CA 3UJBA 4QYIA 1D2GA 2PGLA 3WQRA 1U8AA 1Q7GA 2DUUA 3PGLA 2LV8A 2ADOA 3L9WA 3SEZA 4FWTA 2IUYA 2XODA 1L7VC 3AR5A 1AZSC 3KAJA 3ON5A 3B13B 3EJ6A 4LF8B 3UG7A 1DC7A 4TKMA 1T4GA 2EJTA 4UTRA 2QTLA 3R6LA 4PO1A 5A3RA 4EYEA 2RGDA 4ZVRA 1JS1X 2V1XA 4GWKA 1EUDB 3T61A 3BDVA 1FSSA 5C1IA 5L51A 5CB0A 2FN7A 4MIYA 1BHJA 4R8KA 4UNPA 5KQPA 1JF8A 4IQ8A 4FPXA 1U3FA 2QK4A 3BCSA 4ENSA 1X8LA 2OLEA 1FW8A 1UODA 4HYQA 5BVHA 2NQ8A 3TN7A 4RU1A 5JRJA 3K2BA 2ZSIA 3FPKA 3F6EX 1Z6ZA 2AVNA 4U8GA 4YMIA 2UUBB 1L7NA 5CNJA 4RORA 2A9OA 2FETA 2VH1A 3GC6A 3ORHA 4QU0A 5AIAA 2VDVE 5TEVA 3SC2A 5MF6A 1Y98A 1YB6A 2X0EA 2EBFX 3DYVA 2QRPA 3PQ5A 4QEDA 4D46A 5AW3A 3VJRA 2WHYA 2JLSA 3D4PA 4L6CA 5HEKA 4ZYLA 1YACA 1Z5UA 4UMFA 3SZRA 3C8DA 4YT2A 2F67A 1U8EA 1F12A 4CMCA 3CSSA 2JJQA 3CSDA 3ZCQA 3IP7A 4XE5A 3ZCVA 4HAWA 1TD1A 4JJGA 5KOHA 3FHCB 3K0EA 5ESRA 1T43A 1CUBA 1QIMA 2GA9A 2IYNA 3C97A 3DBRB 2CNKA 2FXVA 3TOCA 4XIIA 1V8OA 1DI0A 3AFNA 3PIRA 4HUQB 4YCDA 1PG5A 3A1DA 4IO0A 5FTWA 3CNOA 4NU8X 3G85A 3LXUX 3P0EA 2QHXA 4GQBA 4X3CA 2YY6A 3KZKA 4V0NA 3W79A 1IBKB 4RVFA 1QDUA 3L6EA 3UQZA 2Q1UA 2O8EB 3D4NA 4J1SA 2VLIA 3HL0A 4WWHA 4F46A 4ENRA 3R3VA 1MC8A 4FM9A 2DWPA 2IGTA 1HDCA 3OFKA 3F6BX 1Z68A 4LSGA 4X94A 4F1JA 5BSVA 3GCXA 4BQOA 4M0PA 3ZDQA 2V8BA 5CLGA 1L4EA 4ONEA 2XBUA 5C18A 3KV3O 1U8TA 3BC1A 4LRSB 3NHRA 4RFSA 3BGWA 4Y2RA 5JS8A 2J0SA 4KO1S 3TCNA 3BZBA 1N4DA 2EZTA 5B7PA 4RIHA 3T1OA 4OHFA 1VKOA 2BR5A 2VDWA 1AOXA 1C7FA 2FZ4A 2WVJA 3I42A 3FUCA 2KPOA 4AIIA 3PFGA 1YL7A 4XDHA 3WGGA 5CFOA 1RCTE 4UE2A 2IEYA 3HO1A 2ACWA 3KOOA 3LDUA 2BFWA 2A1UA 2EEZA 4GNKA 1GZUA 1EFVB 3VPGA 1E2GA 1JDSA 4JC4A 4DN6A 5AVXA 1W2GA 3CBQA 3EIHA 4M0EA 5C37A 2QN8A 3CJRA 3IAFA 4PS1A 5EE5B 5FFMA 1U8XX 3AXSA 1C1DB 1LTKA 1OJ7A 1YL5A 1X87A 3W4IA 2YJ6A 1E3MA 3C3KA 1JZSA 3IC5A 3NEAA 2AQIA 4F5DA 1U2PA 3ZY6A 9ABPA 1SFRA 2XZPA 4DB2A 1K8XB 2J3EA 3EZFA 2F43B 2MSEB 3EY4A 1CUWA 1WDMA 4P98A 2FFRA 4IQFA 4MRMB 4L8YA 3GIDA 3TOZA 2X6QA 2P7IA 4TS9A 2XEXA 3JYLA 4J3FA 4YH1A 4ZC8A 5KVVA 5CB4F 4YUAA 3PQFA 1PT6A 4DIMA 3CZPA 2FSPA 3I32A 4IDHA 3NDJA 3G2OA 1P3JA 1W0KA 4I4NA 5FUQA 4J1TC 4DS3A 2FGJA 2C3PA 2Q1SA 3FETA 3LSYA 3OWXA 3UK2A 1LPAB 1MZVA 4CKEA 4S3MA 1GNRA 1RMTA 4G8CA 1Y1TA 3D4LA 4RF3A 5DULA 5JT1A 3EGIA 1T9CA 2HSDA 4P3OA 3F9IA 4BAGA 4OLBA 4PLGA 4HNUA 2HAEA 4YDRA 2R4TA 3A14A 3W5JA 5AIBA 4FIZA 2OBMA 3L4BA 4AG6A 3RHZA 4M1YA 2MSNA 1IVNA 1SEVA 2WT9A 2IOFK 2B99A 4NC9A 1XYYA 2FP3A 3LPNA 3QXJA 4BE9A 1FP4A 4WLNA 2QE6A 3VXKA 1RBQA 2NACA 5K8JB 1EA5A 3C3YA 1RYFA 1VGRA 4YMWA 4B84A 4ZYTA 3C14C 5IDVA 5HKAA 2QVYX 2GPNA 2G6BA 2O9JA 3PUZA 5KAMA 3U61B 4M89A 1RBMA 2OZLA 5EPUA 1K7SN 1SUCA 3HN6A 3LT2A 4Y2UA 5A05A 1J5EB 3B1KA 4G5RA 2X58A 2FCRA 1IBLB 4XUGB 2Y1OA 4J9VA 1H4SA 1XDSA 4PC2A 1BG6A 4BX2A 1XTJA 2QV0A 3ACDA 2V55B 5JZOA 4MR8B 3TBKA 1XLWA 1QC5A 3D0OA 1XJ5A 4M7WA 3D5EA 1AQJA 4D6PA 1ZBQA 4BO4A 1G8KA 5CHYA 4HZUB 3PX7A 3ILYA 4AUMA 3T7AA 1DRJA 3AJ9A 3IBTA 4JSRA 3B53X 4HRXA 3WLPA 5BSMA 3ZKAA 1H1TA 3GT0A 3SD7A 2CB0A 3E9YA 4UTPA 2ACVA 4WZZA 4KYTA 2PA3A 4D97A 1DIAA 1LPSA 2IUTA 3DDWA 4KYVA 1A7KA 1YOVA 1E64A 3L02A 2D2EA 4JC5A 3ZGXA 1E0AA 3WZMA 1K86A 2B4AA 3E9EA 3L8ZA 3MT8A 1HNWB 3GLKA 1I3NA 3ENZA 3HCFA 3ORFA 1TU4A 4RMNA 3AG5A 3OX4A 3QUAA 3U1VA 4D8WA 2GWRA 5AW9A 1W49A 2J7PA 4IS2A 2PG3A 3PUIA 1H1LB 4HVAA 3BD9A 1MT0A 3B3JA 1PFWA 4QUIA 2RBGA 4RV4A 1NMXA 1IM5A 5DLEA 1S4QA 4Q7MB 1IUKA 1CLEA 4RCVA 1P44A 2AI1A 4N7MA 4OK6A 5ADWA 1LBEA 5HP4A 5A0VA 4AN1A 5E6RB 3OF5A 2YZGA 5EXDA 4R40A 2P7HA 1QO0A 4EUKA 3ELUA 2I62A 2YDYA 4WNAA 3OCJA 3IAXA 3DMPA 1QK4A 1WO8A 4RD3A 4ZWNA 5BYBA 4BVHA 3VBEA 3VO8A 2M1ZA 2FCAA 2QMEA 2AB0A 4EUFA 2H4WA 4GMHA 4AQYB 5SZJA 1HZZC 2A4MA 5GINE 1JI0A 5GV7A 1NVTA 4EZBA 2IXFA 4MGYR 3IKLA 4YPOA 2GK7A 2REBA 4RFVA 2EWMA 3FSGA 2A14A 2XH8A 4DM7A 3A6PC 5L45A 4XM1A 1C1YA 1JJIA 1NMYA 2DULA 3DR3A 4HNSA 1JTFA 3UGJA 2XKBA 3AV3A 3VR4H 4DV3B 4R1NA 2GI4A 2N1MA 4TWZA 4BNHA 4CKBB 4E30A 4G4SP 1E2PA 3JY6A 1S2IA 3QU5A 4TV8A 5FI1B 2WLTA 2CF5A 4RL6A 1GTMA 1YHNA 5LBTA 4ZEOA 4IXMA 2Q3MA 4GP9A 2IRWA 5EWJB 3RE1A 3QVJA 1KOJA 2FSGA 2XKJE 5C9ZA 4LHVA 1JR3E 1A8SA 2EJCA 3R75A 3U7QB 1F5SA 4YI3A 5TQ0B 1IN8A 2ZWMA 3CG4A 3F7NA 3GG9A 4WY8A 4ABYA 5ICEA 1T1GA 5A3SA 2NZXA 4AY4A 2WHEA 2MJLA 1LUAA 2HRDA 1XZCA 2VP5A 1IUPA 4DMMA 3EZYA 4GOND 4S12A 2XWQA 2N42A 4L7QA 1JQAA 2XE7A 3ER6A 5BR8B 1E9SA 2VNKA 1KZ7B 1S01A 4UFNA 3PC6A 3A2MA 4KN6A 3S8EA 4LF5B 3NKVA 2H18A 4ZAGA 2PKQP 1K5DA 1AGPA 1CP3A 5ALNA 4P2BA 5JAUA 3PK0A 2E1PA 3DKKA 2XVZA 3EHEA 1J4AA 3ZE1B 3QRWA 2W6JA 5JYEA 4BFSA 1QU2A 3OETA 3E1SA 1Z2PX 2ZR0A 3FVRA 3AR8A 4AJ2A 1T4MA 2P40A 3VX3A 4EI8A 4L72A 4Z86A 3NDRA 5JY6A 5HGXA 2XD4A 2O14A 2FMTA 4QELA 4ZXFA 5DCYA 5DGXA 4RKFA 4DUGD 3CNEA 4J0KA 5D00A 1JW9B 4PCUA 4YWHA 3WIBA 4BGDA 5BR7A 1L1QA 3H9EO 4BZWA 1GKUB 4DREA 3ZWQA 821PA 3AI2A 4IIEA 3H2JA 1QIKA 3R0JA 3R23A 2DHDA 1KSHA 2J0EA 5ECYA 5FA8A 1KRWA 2WUEA 2AI3A 3QVTA 4JI7B 1TIKA 3LL4A 3LYHA 3WK9A 4QBIA 2Z1MA 5MFZA 4JXXA 4LRYA 2D74A 2FK7A 1U2DC 5JRZA 4JGGA 4C4OA 1U8ZA 3A4MA 3EWIA 3TK1A 2QBYA 3KJEA 3H5TA 2ES4A 5G3YA 4DC9A 1XPUA 2XZOA 1J8DA 2B8EA 2FX3A 3COPA 1R6AA 3FKSA 4GPBA 4JK3A 4NKRA 5ICGA 1PV4A 3RTCA 4BX8A 1N7GA 1ZGBA 3P2YA 3A2NA 2XTJA 3NPAA 2AZMA 1CD5A 2Y3IA 4RZSA 4E12A 1GY8A 4KBGA 1JB1A 2XB6A 1U98A 2XNDD 5HM8A 2LBPA 1YJ8A 3KKZA 4FFSA 5H59A 4JMPA 2H00A 3TL2A 4EJMA 1KEEB 4X45A 5HDQA 3STWA 2PSEA 3GAMA 1Y6QA 4DPKA 1KTVA 5FJIA 2IOHA 4RK4A 2Y1EA 4NAUA 1YR8A 2LKDA 5DNVA 4Q18A 1N92A 4KK4A 3ZWMA 2PS3A 4A92A 4DEVA 5J5VA 3MHTA 2FZEA 3RWOA 3VR1A 4R2LA 4XWOA 2NO4A 3QTBA 2VCEA 4P92A 4PTLA 1S0UA 2JBAB 4RE6A 5JDCA 3GELA 2DPYA 4PSVA 3G88A 3HWWA 2FQ1A 1F0KA 4WFJA 1BWPA 3ZJVA 1M6YA 1YDGA 4I9UA 2JA2A 4JKYA 3IP9A 4GW3A 4UNIA 2QVBA 1JR6A 4PLVA 4XGNA 4B3IA 3OLWA 3SIXA 1XDGA 3L5KA 3C3JA 1M2EA 3O75A 1AZTA 3IQFA 3OOHA 3WLNA 4C89A 2ZEJA 1KR5A 2C1XA 3KOWA 2OGZA 4PPNA 3UK0A 4DYDA 3QPCA 1QO0D 3TIIA 1Z6XA 2G1JA 3E05A 4RZ2A 3NHMA 2OB1A 3A7DA 1IB6A 2WYWA 1CQIB 3M89A 1RI1A 4E21A 3BK1A 5I5GA 1W2HA 2VFAA 3H1BA 1VA4A 3NB0A 2JEYA 1SQ5A 3MW8A 3ZK7A 5JRDS 1O9HA 2Y99A 2VTBB 3RQIA 3D7LA 3EQZA 2ZDQA 1YHYA 3O95A 2CMFA 4KB5A 5SYAA 3SHQA 1P7PA 2Q27A 3K5PA 1TEHA 4IJ6A 5ECDA 4C0HA 4DLLA 1Y63A 1Z2AA 1I7PA 2BEUB 4B17A 4DNQA 3ZHCA 3IOEA 3G1WA 1HBJA 5DEOA 5IC4A 4B4KA 5I9MA 1ZGJA 4IS3A 4P36A 3R9XB 2Q29A 2YOGA 3W7VA 5TQVA 1OU0A 1ZM7A 4K03A 3Q9SA 4MRAA 1KA9H 4J4BA 2JFPA 1EVEA 2JLVA 1WE2A 1YRHA 1ID1A 3DEIA 4BZPA 2K7FA 4K0KB 1GSAA 4ZXPA 4Z7OB 2X23A 3IAS1 2BONA 2C96A 3QFRA 3CJTA 3CLVA 2BLNA 1TKBA 4LXIA 4AJPA 3HCWA 4HYTA 5DGCA 2H07A 1IY1A 1ZM2A 3KB2A 2PLFA 2AA3A 3IVMA 1TK3A 3NJRA 3OWHA 5LN1A 1I4EB 1XPJA 1YZQA 1T5BA 4ID3A 2YJNA 2VJCA 2VZEA 2W4IA 4F2PA 1JZTA 4ZV4A 4RMJA 4R9VA 1N6RA 4F9GA 1AK2A 1FS5A 2XQVA 3WLKX 1IUOA 5JTTA 2KI5A 2XSZA 4DDWA 2WVHA 3LLSA 4LKRA 4QVIA 1H23A 2G28A 4WESA 2DPMA 3TBFA 4DZZA 3THWB 1SVNA 4CN8A 2W6CX 4KPYA 1PQUA 4F93B 1T9ZA 2QR3A 1M1UA 4ZO6A 4GM4A 3P4XA 1VYHA 4IV0A 1MQSA 2OBFA 3L0YA 4Y67A 3SF8A 1IATA 4BATA 4Y9SA 2EF1A 5P8WA 3ME5A 1ZJZA 1Y37A 5ALPA 4JA0A 2QW1A 2VPXA 4LTMA 5K2MA 2P9JA 2V9ZA 2DF8A 5IJ9A 1EM6A 1MDFA 2F17A 2PYDA 4KO2S 1N2HA 4N9QA 1GAXA 4H0NA 1M8PA 4ZEMA 3OJEA 4FOSA 4HEA1 4KR3A 3TSOA 1DRKA 4P7GA 1A8IA 3LVRE 4PCAA 5GMOA 2YKGA 1D1SA 3IRVA 4J0JA 5TX7A 2W2XA 1X8XA 3CF6R 1ODKA 3NBQA 3MFYA 2BMVA 1ND6A 3HV2A 4LYDA 5CDFA 3PPWA 2WQ6A 3W6PA 5CFMA 3HACA 2VQDA 4MV0A 1HQYE 4Q3OA 1KAEA 4ZQIA 1OWNA 3PQEA 1U1EA 2ANCA 2ZR9A 2B61A 4EG8A 4ARIA 2JFVA 1IONA 4OQPA 1N2IA 4M9QA 4RA6B 2BFBB 4PW0A 4AVYA 3B6KA 3K2EA 2YWCA 3ER9A 3UA4A 4JBLA 4OQLA 4L75A 2IK8A 3MAGA 3PFIA 2J32A 1OREA 1V1RB 1FYFA 2NQTA 2O1EA 4PLHA 4V0RA 1LGYA 1X1RA 3KHTA 4TVBA 4WK0B 1CRZA 1DKUA 3RT1A 4MR9B 4U6SA 3C5WP 2F1KA 3GUUA 3HADA 2C3UA 4JLSA 3C3XA 3R09A 1XV5A 3GJ5A 4UC0A 1Z5WA 2V7UA 2QE7D 1A9QA 1TM7E 2IHZA 3NAZA 4RVUA 3RU2A 4CDMA 2YW2A 4AXXA 2PV0A 4N8SA 3EYAA 2BT4A 2RAUA 2D1YA 4IUCS 5AXDA 3Q9NA 2ARKA 5FUVA 1U1FA 2VWPA 2VSFA 1PHRA 4XZ3A 1B26A 3UJAA 1G98A 2WSIA 5AXBA 1R10A 3DLTA 4UREA 4HEHA 5CM9C 1UKBA 3S2FA 2E55A 1P1RA 1WMSA 1UP6A 3O94A 1PGJA 1YGYA 3I2GA 4PFSA 4G0ZA 3GNTA 4MGIR 4YRJA 4DIUA 5HIIA 3CWZA 2XB4A 4CM9A 1HDIA 2AQ8A 1VE6A 3H5NA 3I1JA 3PKJA 1E3TA 5C7LO 4TWAA 1PK8A 3CUKA 3WNVA 2I6SA 5JZBA 5H4HA 6CHYA 2GKGA 2H2WA 1V6AA 1EK2A 1AKQA 2I4LA 4YAIA 2PT5A 3LQ4A 5IKEA 1M74A 2EBHX 1GTRA 5JSZB 1N36B 4K3VA 3I01M 1IN6A 4TZTA 4FOPA 1X7XB 3GEEA 4BXOA 5FBQB 2C3YA 1JIVA 1U7TA 3D7KA 4CT5A 1Z08A 3PT9A 1JYFA 2VPPA 1H93A 3IYLW 4LGMA 5DRTA 5EZYB 1FFGA 3VKUA 4C6TB 3WXBA 4DMFA 1GTZA 3IEKA 4IW3B 3D6UA 1YB2A 3EFOB 1GRCA 4FMPA 4JASB 1OLUB 3PWZA 3BJIC 1YE3A 4N03A 4NBWA 4I4LA 4YP9A 3Q5EA 4ZDWA 4N41A 4XGKA 1EM8B 1MT3A 2P90A 3RDPA 4UCXA 3IGFA 5IBRA 4MMYB 2P77A 3QWBA 4YRQA 1EK6A 1GGKA 2BSQA 1HMYA 4YHHB 2QS9A 1H2WA 4DV1B 3KPWA 3SBEA 1KJIA 3RHSA 1QFZA 2VATA 2A1TR 2C54A 1S2MA 1E9VA 1D6NA 1TUIA 3O7MA 1XZLA 5KCMA 3FTNA 4IYRA 1BFUA 1ELOA 2Q8QA 4TXMA 4A0FA 3WA7A 5F4BA 3A11A 2WFAA 1WU8A 2W6PA 2OYRA 5LQRA 1P1HA 5ELLA 5F1PA 3IX7A 4YQFA 1YC5A 3I9KA 1SUPA 1W35A 2Q6OA 3JRWA 2V7XA 4DR4B 2B3DA 2WJAA 2ZBFA 1TYBE 2JIOA 2MR6A 2PRJA 2VPZA 1Z5NA 4ODIA 4Q0MA 4RHTA 4CV2A 1SU4A 1I7SB 1YR7A 3KHUA 5FT9A 1DKOA 4BFXA 5KIAA 4N7RA 2B1RA 4C7OB 1UWKA 3F5SA 5E95A 4Z0NA 2ICAA 1NG9A 3UOWA 3OMWA 1E20A 1F0NA 2UUOA 4QIHA 3TF5A 2G70A 4XYEA 1M83A 1ZSNA 1YGPA 3N2NA 3FOEC 1E2NA 4LE2A 5B1SA 2P30A 1SBCA 1U5BB 4FNMA 4NOJA 4PZ9A 1W4BA 1ULUA 2AZTA 3THXA 1J24A 3OVMA 5BN4A 3HB0A 4WI1A 1Y8ZA 3DM9B 1M2WA 1N5DA 3EOZA 2C42A 3I04A 4BO2A 4WXEA 4YRNA 2PE5A 2OAQ1 1JG6A 2ONZA 1IPHA 3DP9A 4HNTA 5IJXA 2UZ1B 5J2UB 3KSMA 5KZMB 3T7SA 1VLQA 5DM0A 2G0AA 3FCXA 4J7CA 1Y1PA 2WSMA 2CNWA 4HFRA 4RF4A 1E3WB 2IBSA 3ZBTA 5ALYA 3TRIA 5LMUB 3AONB 3KJZA 4L0CA 1ST2A 3DOIA 4RIEA 4QYTA 4EVIA 1VCMA 4ZKEA 3EASA 2FPKA 1CUIA 2GEVA 2ZYSA 2EAUA 1JPVA 3SFTA 3PQ8A 3MXOA 3F1KA 3GAFA 2QL6A 3EG9A 3ZNPA 4H08A 1EQAA 1F4VA 2IITA 3RODA 2Y4OA 1PRYA 3DR5A 1UMDB 1O8BA 2NUTA 4UU8A 1QUEA 5T4FA 3PQ4A 1EFDN 1AF4A 3T7DA 3ENQA 4EO4A 3AVTA 4Z7JA 4DR5B 2VJNA 3C41J 3HNRA 3U4HA 3HVUA 3D6TB 3LK6A 4ND4A 4BE7B 1OR8A 4Z3KA 1Q0PA 3CW9A 5CLIA 8GPBA 2NM0A 1GARA 4DQDA 1N5KA 4D81A 2XR1A 1GA4A 3R2JA 4JFRA 1TT7A 5LBUA 3T95A 3KKQA 2YS7A 3F4KA 5IJAA 4BRWA 5AJUA 1LBHA 2ID4A 2I6UA 2DBYA 4HJRA 3DD5A 3E6AA 5IDYA 1CBUA 2R7AA 2RIPA 2O8DB 1OFGA 3KOMA 5CA0F 1XOIA 2POCA 3X3HA 4G07A 4WBNF 1Y3IA 3OEWA 2A9RA 4NP6A 1XRMA 2XF2A 4I6JA 4NYMR 1ISGA 2O5RA 3OFND 4PZZA 3WR5A 2OPBA 5B7QA 3AR3A 3W2FA 2RAVA 1SY7A 1UBOS 2JCBA 3MTEA 2HMUA 6REQA 3TRKA 1XYVA 1K2WA 2ZYAA 4X91A 1Q17A 2GTHA 3D4OA 3PA6A 5EJ7A 2HU2A 4RTSA 3FOFC 1HOXA 3NHJA 1VOTA 2UV8A 1E9BA 2VHVA 3EZ9A 3O4FA 4G4IA 2ZIGA 2GCOA 4HVTA 3EGWA 5KHOC 1ADYA 3NJ8A 1RE0A 3KR0A 4BMOB 4GYWA 3BHMA 3VDQA 3RWMB 3WK5A 5HZKA 1ZD3A 5EOVA 2NUAB 5THXA 2GCNA 5L3RA 1K27A 2YY7A 2YWDA 1PR0A 4C0QC 4HB4A 2ZRBA 1ONOA 5IKOA 2DU8A 3IIJA 4QVKA 5E1OA 4IGEA 4EUSA 5J2TB 2Q5OA 4Q66C 2OK7A 4WOKA 2IJGX 2HWWA 4YGYA 3KWMA 1ORRA 2NXCA 5HS6A 4A10A 2FMKA 4CM9D 1XVLA 4H18A 1N8NA 4AYXA 4C06A 1VJTA 2X19A 3FZYA 2VHEA 4HXYA 5M34A 3U7EB 3T54A 3VKFA 1E1YA 3TR5A 1CDZA 4KRGA 4B3JA 3DB2A 4C2AA 4UXIA 3B1ZA 1BA2A 5J40A 1Z75A 2R79A 5DCWA 1Q95A 4R5MA 1UANA 5L95A 2LPMA 4PC6A 3EVCA 1RJ9B 1ZJ4A 1D1PA 3OWOA 4HRYA 4JYCA 4BNLA 1Z6TA 4AWXA 3TH5A 3VNRA 4DG9A 1N77A 3ECAA 1BMQA 3LX5A 2E1RA 2IU3A 3JASB 4QWMA 3VHRA 1X3LA 3JU3A 4RENA 2UYYA 1USWA 3AK4A 2F59A 3A31A 3HVRA 1CB7A 4Y2GA 2BI4A 3WIUA 1IFXA 4U02A 5DVZA 1FEZA 4TV9B 4ZQFA 2PANA 1QP0A 3KHKA 5KYXB 3MJTA 3FSJX 4OQEA 3VSBA 1YKFA 4EA9A 2IYYA 2WILA 1VG0B 2P0EA 3K31A 4XD7A 1PGPA 1SKAA 3SHFA 3T0FA 1TJYA 4R9SA 3IH5A 1QVRA 3F71A 4OHCA 4OKIA 3JV7A 4MUGA 1XC7A 3PNMA 3R5TA 4H6XA 1PEAA 4S24A 3ZXSA 2ZREA 2J5KA 1ZIDA 1GKYA 4R1QA 4XLZA 4AMBA 2FEXA 2QUHA 5HZGA 2IEAA 1OPXA 1CC1S 5JAMA 5FTMA 1WZUA 1OF1A 1XSEA 1P7VA 1TFUA 4YVFA 3AEUB 1ZR2A 1AQIA 2VJPA 1RM0A 3Q11A 4Q4HA 3D8BA 3W2HA 5JC1A 3VU0A 1TMYA 3HY3A 5K1ZA 2R6JA 3G0BA 4NBNA 2RC5A 1MA0A 3L6OO 2YMMA 3OJXA 5CW2A 1T1EA 3UHAA 4YAFA 3W8FA 4DMGA 2B20A 2DKNA 5MGBA 1JECA 4BMPB 3U6KA 1P2UA 2HGSA 4O1MA 1A4UA 3EC1A 1KP3A 1ZD5A 3D7MA 4RYLA 4UEJA 1A8HA 3W6ZA 5FOUA 4PBTA 4BVGA 3PF8A 4FUTA 3K0FB 2QLFA 2YIVX 4EMSA 1AMNA 2V6BA 3DOJA 2QW8A 3Q2KA 4FYHA 2C03A 2BGUA 2QL5A 3G9TA 4KR6A 3TWOA 3IPXA 1GV1A 1X74A 3NT4A 3O8OA 5EUMA 3GNLA 2GJKA 3BWCA 3IILA 3HUUA 3LIPA 1RKVA 2BEWA 4NBLA 5A0FA 4KZPA 3RRXA 3TEJA 4GICA 3NIDB 4B31A 4LF6B 3BZUA 2D0IA 1EEXB 2JI9A 3P9CA 3U56A 4CMEA 4WXHA 1LBTA 1XMPA 2GZHA 2ZQYA 1IRXA 1J5XA 1V3TA 2NXNA 1MFPA 3DLAA 3Q40A 4EUEA 5JY1A 1ZI9A 2P4EA 2GM5A 1DIOB 2ZI3A 1YB4A 5JQGB 4BBAA 1CUXA 1L7OA 1ZLYA 5DGHA 3VYRB 4KFCA 1FFXA 2WD9A 3AJEA 5EQTA 1PS0A 5HOQA 4KGZA 5BR1A 4AJIA 3RRFA 1XWIA 4P3PA 4DJFC 1WX1A 1Y6JA 2DB3A 1Y82A 2BCEA 3CSUA 3SHVA 3EPJA 4BMNA 2BKUA 3TW0A 2G4LA 5J9FA 4PQFA 4BYGA 1QRSA 4XTRA 1LSUA 1JLLA 4LC0A 3NYQA 5GONF 1FYXA 4E31A 4ZDJA 4OXYA 1K3UB 3BMOB 1PVOA 2V5UA 3GCWA 1ZW1A 3R7AA 3AG6A 4PTZA 1ADBA 4J6EA 3PPXA 3RTGA 1QGZA 1P2VA 1RI3A 1M1YB 4XVUA 4I4TF 3SR4A 4HWPA 4O4LF 3ZE2B 4LJSA 2IHTA 5DWQA 4RPKA 2M32A 3IB6A 2VHTA 2BKEA 1F60A 1YTLA 2BKVA 3IKMB 4PR3A 2YZKA 3IRUA 3TIGA 1V4VA 3G13A 4U3JB 3F6SA 4RK1A 2CYAA 2AJCA 2C2YA 2HCJB 1F20A 1FCJA 3FFBA 5EJGA 4ZIRA 5JHGB 3LRTA 2NTJA 1ZD9A 2QP4A 1KJZA 4MW7A 1U6JA 5EZ6B 3LGSA 3E5MA 4GAEA 4HGZA 4E14A 3WHLA 4YMTA 4JYAB 2H17A 2QQFA 4Z2YA 3JD2A 3HEAA 5BWLA 1SR8A 1MC5A 2BMEA 1FSGA 1GKIA 1REQB 1VB5A 3OIUA 4M76B 4O2BF 4XCQA 3A1EA 1VE3A 3OP4A 1AN0A 3GV0A 3SYLA 3UENA 3U3JA 3CEJA 3UT6A 5CA1B 2NG1A 4JI3B 3GT7A 4F3RA 2R2GA 5AW2A 5JQWA 2PZGA 1GA6A 1KU0A 4MXDA 3NATA 1N2EA 4FT2A 4MS1B 4LHZA 4A1OA 5B5SA 1XDDA 3VHLB 3OTGA 4UOEA 5AVUA 3WLSA 3NRBA 2OUIA 5E8JA 1P81A 1Y3HA 5DBIA 4EYGA 2RHHA 4F8YA 5IULC 1IY0A 1Z2DA 3HSKA 3NU1A 2NO0A 2P6UA 4DV2B 1NVMB 3CY6A 2WU1A 5IARA 1E1CA 1ST3A 4QGGA 4CHTA 3ITNA 1TA9A 2ZR8A 4CFYA 4JT2A 3ILVA 1O3YA 3DBLB 3HNOA 3STVA 4GX5A 5JXWA 5B2EA 4F6RA 1R4NA 2OENG 5KQLA 3DMDA 5JWRA 3R3WA 2QRNA 3X1JA 1VXRA 3EVDA 3WRYC 3D6MA 4QFCA 1G41A 2H9IA 2QTHA 4HTFA 4L3WA 1L5OA 5HUQA 3DKPA 1YMVA 4E51A 3T3OA 3SDZA 1O94A 2XT6A 1QWSA 1UBJS 3R0ZA 2X9NA 3VPBA 3FN4A 5KQRA 2XI4A 3ZBQA 4CODB 3BL8A 1CQZA 5KYTA 4BO8A 1QGED 3GOQA 3GGDA 5COAA 2NTVA 2OILA 2P2LA 3ANXA 3QLUC 1TYDE 2ZRNA 3W34A 4KN5A 2WM3A 2VJQA 5AW5A 5LR6A 1XQ6A 3BE6A 4UCFA 3UT0A 2PY6A 5IHPA 4IH9A 4J0GA 2AQHA 1BKYA 3BK2A 2HHAA 3RKUA 3MJHA 3G68A 4NWIA 1GYRA 5JCZA 4BS9A 3G1UA 1NMQA 3ZGOA 2LXNA 2H0AA 3H2BA 4JS0A 4ARCA 4EHJA 1LDNA 2COUA 1SIWA 3M9LA 2BHLA 1PVDA 3T7RA 4DQKA 5LM3A 1C8VB 3PLNA 3HR7A 3U4IA 4Z9YA 3LNCA 5H1YA 4QDTA 5F2OA 7MHTA 4WZAA 1IXYA 1G6OA 2AN9A 4U1RA 1LLQA 2KWIA 3GP3A 3ICPA 4RGBA 4KN9S 3I30X 5CVCA 5LLDA 1NWCA 4KREA 1FQJA 3AV0B 1AQUA 3HGMA 1GZHB 2NU7B 2QGZA 5EVJA 2PBZA 3SG0A 3VH1A 1M0EA 4FR5A 4JYPA 5EY5B 5EERA 2NU6A 1M5RA 1KE2A 4DLXA 1IN1A 2WC1A 2XLCA 5DW3A 2XUAA 3RYTC 2D0PB 4GO1A 4AJOA 1JFRA 1JEQB 2QLLA 3DNPA 1CNFA 3KDAA 1QJ4A 1B93A 3N7TA 2Z8ZA 2P0AA 3LAWA 1T0HB 2Y0CA 3NETA 4R69A 4BPRA 5J4KA 3IQDB 1EBUA 1X14A 1XZGA 5LPNA 2PFGA 3COWA 5E6UB 4KXQA 2AR0A 4QWWA 2CL7X 3CLKA 4FZ5A 4DCVA 2HDHA 1UC4B 1NFRA 2J9FB 4UUBA 1NF9A 2IXGA 4QPJC 2DQYA 3KB6A 4LY6A 4CQLB 2V1UA 3O1LA 2NT4A 2AR7A 5TPWA 1QFXA 2WTNA 3K09A 4OJNA 4EA6A 1YBAA 4I3FA 4JODA 3FFTA 5JYCA 1HV8A 3MBOA 3DDHA 2OHHA 3HVJA 1XJ0A 3LFTA 4MIOA 2IUUA 1S3FA 1VYUA 3PCXA 2ZS8A 3ZWXA 3BREA 1XA4A 2PMFA 2Q5JA 3G8DA 3UAGA 3ASYA 3H4TA 5I9NA 3T1YB 1G8MA 1F4LA 2OOKA 2WMDA 3D31A 3FGNA 3L84A 3NC1C 4I9FA 4MUEA 3GGGA 4PCVA 2WJ4A 2ZFUA 4ZOBA 2CEAA 5DX0A 1N9GB 2Q62A 3KDSE 2DMRA 4Y0VA 4BO6A 2B4YA 2IZ5A 1NIJA 3DXYA 2IE0A 2ZBPA 4MVJP 1RQPA 4PGAA 5C8ZA 2ZTHA 2H59A 3DNMA 2DG2A 4UUQA 3SEQA 1OIVA 4IHJB 4MWBA 3BB4A 3F4LA 5K3EA 3L7BA 1JYSA 3PXUA 4PXAA 1IOVA 4WK4B 2SCUA 4H3KB 3O83A 2AKYA 2WKSA 1H65A 4OJYA 1R9MA 3MMPA 4I36A 1X80A 4KQGA 1P80A 1RHJA 4RJKA 2GAFA 2ZJFA 3FX2A 2IS4A 3C3BA 1DRWA 4XA8A 3SBDA 5DBFA 4CTJA 1JALA 2OSVA 1I4DD 4Q3DA 3H6HA 1A5ZA 3E1KA 3K9GA 3OY7A 1VI5A 1CUVA 1PZFA 4NV1A 2PJRA 2GPJA 4UU0A 5DDIP 5TR9A 1KTIA 3O92A 4QODA 3QKWA 1SO8A 2OKGA 2IDKA 2SHKA 3L0OA 4GSKA 3W9BA 2FSVC 2XUPA 1H85A 4CMJA 5TGDA 4C04A 4K86A 1ZO8A 2JLWA 4O4HA 1Y1SA 1CY8A 3JQFC 1QQ5A 2W2QA 1JH8A 4GOMD 3THOA 2R8YA 5D8DA 2G17A 3FMIA 1SXJA 2O0MA 3SSNA 3JRXA 3SM3A 1NBHA 3S81A 1JBEA 1RKXA 1BU5A 2YWHA 3NHUA 1K1EA 4DNPA 4FP9A 2NVUA 4EPYA 2ERXA 4F5EA 4P3KA 4PONA 3ISVA 5ALGA 1PD0A 5D7NA 2GYUA 2OYSA 4WGGA 4ND6A 1P62B 2MINA 3LJKA 2NZYA 2Q9CA 3K1AB 3OLVA 1XDZA 2Y1KA 1KQ3A 3PJDA 5G40A 1OYYA 5KSPA 4QDUA 1M1YE 3BIFA 2CJWB 1AKTA 4CL0A 4HR7A 2EW8A 3KSRA 2O52A 1LC3A 1U4SA 2V5VA 1XIVA 1C9YA 1G4HA 1IJEA 2QIPA 2RGCA 3O9ZA 4GKVA 4HGNA 4ZO7A 5JISA 1EXVA 4QSHA 2ZRAA 3ETDA 3VKGA 2H4ZA 2FEAA 3L4KA 1P7WA 1UMBB 2UVPB 2VYND 4L4XA 3JAMA 2M6SA 1CS0A 3UAVA 4E11A 1O77A 1UXHA 2VPIA 4LRXA 2YWGA 3NPMA 3NBMA 3RSGA 3VOSA 5EIXA 3UHOA 1KFEB 2EV9A 1MJ5A 4UCQA 1VCOA 4B9EA 2O5VA 1Y6GA 1K8YB 1EFAA 2Y8EA 5E0OA 3X1ZA 3LXRA 4MNTA 4DUYB 3HP7A 3TCKA 2WB2A 5IFLA 2FW1A 4DR1B 4YRRA 1PJTA 3AVXA 4FD2A 3ZDXB 5C53B 4KDRA 3SXUA 4BLTA 2IC5A 5JCJA 3D1JA 5SY9A 2NPFA 5F76A 1T6ZA 5A71A 5T3UA 3O4RA 4AICA 4MQUA 4X63A 4HUTA 1FTGA 1J0BA 1N75A 4K9PA 4AKTA 3IJ5A 1YBHA 3W06A 3KR9A 5FWYA 3U7FB 1O5TA 2GYWA 3RLIA 3WO0A 1SVSA 1YOBA 1D04A 3MWDB 1CX9B 3KEGA 3MWFA 2ZYHA 1B14A 1EX7A 1OX5A 3C1TA 2GM9A 2XT0A 5DTJA 3VSEA 4HF7A 5CLHA 2OZKA 4FGWA 4M0LA 1NYLA 2BDUA 5JFTA 3QJ5A 5HFNA 4AZWA 4Z7QB 1O6BA 5BNZA 2PNJA 1MB2A 1QTRA 3KOUA 3OM0A 4D0RA 1M8KA 5KVAA 1WBBA 5IW8A 4GZ6A 1NJ6A 1WV0A 1NI4B 3CTMA 3DMTA 3GGSA 3H0EA 3GF4A 1KMHA 4IJMA 4Q1DA 3B6MA 4WRRA 3GLIE 1KY4A 2ZUFA 4U8HA 4Y9TA 2IY9A 5REQB 2G82A 2QMZA 5HF5A 4ZD6A 3EXIB 4YEDA 1TAQA 5HRCA 3S4YA 3A1VA 2ZTUA 3TTTA 1GCUA 1XTRA 3FHJA 1K6EA 2O3TA 4R4JA 4JUCA 1YIOA 5TMBA 2WU3A 2BHSA 1E9FA 2OA0A 4BLUA 1IQUA 4WGFA 1XVAA 1RYHA 2CE7A 1SCAA 2DQKA 2GPAA 3QFCA 4MB2A 5FYQA 1CQXA 5BNFA 5BRJA 1YF3A 5CB6A 1G16A 3JQAD 4A15A 3HO8A 3LKVA 1Z5OA 2CB9A 3IO5A 3NNDA 2IF0A 1PFYA 1DKNA 2JAOA 5AW1A 3ZJTA 1GTG1 1WXDA 3FPGA 4ICIA 4R8MA 2J3HA 5H0IA 4DCJA 4J29A 3TMYA 2OO7A 5EJ8A 4M60A 4DGSA 5JMOA 3CISA 1X15A 3ESCA 4MP8A 2X4IA 3VAYA 4CLRA 4NZNA 4OX9Y 2KHZA 2NTEA 1I10A 5DWVA 5AI0A 3A0UA 2O7QA 3BORA 2HUNA 3AT1A 3AHHA 3EW7A 1XTZA 4PYIA 1MAWA 1PNRA 1CYDA 4Z0TA 5JSYA 3GZNA 2FB9A 3CUUA 1GSHA 2IYWA 5EGSA 3W5CA 2ZDHA 4A2QA 3L04A 2ORWA 4WD3A 4B8ZA 5ETJA 4IYJA 3GYBA 3P94A 1I9CA 2CL6X 4EX6A 2LDBA 3JQBC 4MJ3A 1BROA 3W7AA 3UMYA 1Y6RA 2MMGA 3BL6A 5BOVA 1AQYA 2I76A 3H9CA 4R0NA 2DTDA 3UHPA 3C39A 1N34B 2CXTA 2R5WA 2XVYA 1S7CA 3PNPA 4G81A 3VYVA 4D57A 3IUYA 3M6WA 5HS4A 5CFQA 1M72A 1MB0A 3ML1A 5JXIA 1T9GR 5GQSA 1MJNA 3TVDA 1NW9B 4M83A 4ZOEA 5EIFA 3T5GA 3TTVA 4HGPA 4KQMA 4IG4A 5ALWA 1BCRB 3P9NA 2GAIA 4FTWA 1VPDA 3KYDA 5EIBD 3HFSA 1I1QB 5FPTA 2X0FA 4E4TA 2X1LA 3II6X 5EHQA 5IVDA 2EQ5A 3REQA 4C4YA 4QU9A 5IKMA 4B74A 1Y9JA 4A27A 2YHIB 2W2OA 2A9JA 3AP2A 1UJBA 4GYYA 4H1UA 1TADA 1HLFA 4TKZA 3K6SB 4Q6WA 3OIWA 1C9EA 4KODA 1FRQA 3SMQA 1ZY2A 4KGXA 5CB4A 1TQ2A 3OPNA 4DABA 4QBGB 3I2JA 3AFHA 4HRAA 4D0LB 4YLYA 1CJVC 4DA6A 2BM0A 3GT3A 1LDMA 2DC1A 1FNMA 3ZIAA 3ZJYA 5BVGA 4WOPA 1E3JA 1ZMTA 1A9OA 1ZXXA 3H17A 3HBLA 4H6VA 4P31A 5JJBA 3HPQA 3Q4GA 2WPDD 1WBJB 2XYGA 5EXPA 2LVBA 1E3IA 3HY4A 4D56A 2EKLA 1N3IA 1EP9A 1YDEA 4Z2AA 1EUYA 1NQXA 1PD1A 4DDMA 1YZHA 3DB1A 2VAPA 2C84A 1IXKA 4YRZA 1DBQA 1KP2A 1ZEJA 5D87A 4FONA 2XF8A 2H52A 1CIPA 1EPUA 1PGOA 3FTEA 3DDCA 1SN7A 3IVXA 3K5IA 1BW9A 3INTA 4NY1A 5DCUA 1RRPA 5LZ2A 3H5LA 1K66A 3M34A 1M1ZA 2ZBVA 1KIMA 2G4CA 2R8PA 3D6VA 2ODTX 3HXLA 3GWZA 3I9OA 4GECA 4N39A 3PEFA 1P1BA 4MGKR 5EI5A 4YRIA 2W2NA 4NSNA 2CDCA 2MYTA 4UHFA 1P19A 1NMEA 3LZDA 5FO1A 1E79D 2G9VA 1R12A 1ARZA 2IYUA 2GEDA 3M5WA 5JZSA 3VSAA 2HQ1A 4CKCA 5T4BA 4V03A 3AZQA 5AK3A 3IPCA 4IXDA 4D3ZA 2BKAA 4B3CA 1UFKA 4A0GA 1MIOA 1QONA 1XU4A 4HX9A 1HORA 2P9CA 3PEWA 4QVGA 3IPLA 4LTDA 3L06A 3IELA 3C8MA 4WLUA 4DLSA 3TI7A 3HWSA 5DH9A 3IIKA 4R2IA 4MGHA 2Y92A 1YIAA 2JJ2A 2Z8XA 3S68A 1I2ZA 1E7SA 1U9ZA 2J08A 3SICE 2BE7A 3SLGA 1UPTA 4DCNA 1THMA 3KG2A 4CMIB 5C8YB 3ISJA 3FIJA 2PUWA 3TPCA 4MWZA 1IK6A 3U3KA 1GADO 4F45A 2ZCVA 3A9CA 3SC4A 1OB2A 3JWHA 5ABPA 1RU3A 3IQGX 3LBNA 4MVJE 1O6FA 1U0RA 1XBTA 1E5VA 1NASA 4W7SA 4NX2A 2YZ2A 2JLBA 4L0MA 4BJ1A 1L6IA 1KAQA 2W2LA 3AGQA 1Q83A 3LP8A 2FG7C 3G5LA 3PP8A 1PT8A 2IIVA 1DEHA 2DFLA 2WKQA 2P4SA 4BLVA 4WFIA 4BQQA 2X76A 3LWNA 2QLNA 1RXWA 5E9JA 2J41A 4N0QA 1NC3A 2X2EA 1BX1A 4KVAA 1YRQA 3WADA 2NU9B 1ML3A 4INPA 3RI3A 1QLJA 2ZBRA 5C0OE 2H29A 3OT1B 2NGRA 2OUKA 3G8YA 4I1RA 4Q3NA 3OZIA 4BVFA 4TMFA 1BDJA 1XQWA 2VHCA 4IMIB 4OHBA 2DGDA 5K3SA 4CMBA 4KMRA 2Z83A 4ZOLF 1GSOA 1W4AA 3D6AA 3HB1A 3WSWA 4G5OA 4AJHA 4H4DA 4OMUA 5FA6A 4C78A 3NHLA 4AUNA 3VA7A 3MS4A 1K0FA 4IXNA 4G1VA 1YR2A 3SJ7A 2JIPA 3W77A 1GG8A 4PZ0A 1XTSA 2JGAA 1FVXA 2XMZA 1VECA 3AM4A 3DBOB 3OEEA 4RETA 5FR1A 1LK7A 4EATA 10MHA 4OHYA 4U7HA 1U2TA 4B7XA 3COYA 3PQ2A 3KX2A 2HJRA 1ZHOA 2O8FA 1LD3A 4R9UC 2P91A 3BMNB 1R8SA 2PN1A 1XZBA 1ZQ9A 1EEHA 4Z0PA 4CEJA 1I6KA 2G77B 2VHUA 2C4WA 3IV7A 3PXGA 4KIJA 1A98A 2OC4A 2ZUSA 3F96A 3U62A 1I4WA 1L4GA 3SCZA 3JVDA 1BCSA 2WI8A 3A6JA 3ZLUA 4M8NE 1JDTA 5ITZA 1OHHD 4KL8S 1CJUC 1FJXA 1U4NA 4CE6A 1H2RS 3DCYA 1P1KA 1KDYA 4ND2A 1YXMA 2X6RA 4KBYA 3L3BA 4II3A 4YJHA 2P3SA 5ALZA 3ZWKA 2CUZA 4PY2A 4Y6LA 1GYPA 3JYPA 4F3KA 3LVQE 2CY0A 4CIBA 4GL2A 3M1AA 1KH2A 1DZ3A 2EXXA 4UUMA 3KAPA 3PHGA 1NU8A 2P9YA 1VP9A 3PHJA 5AESA 3GAZA 4M38A 4O8CA 5HX7A 1AXEA 3EZ2A 3H8SA 1YAHA 2I4IA 1L5WA 2O20A 4C0AC 3IQIX 3VV3A 4FDUA 3ZUGA 3ZC3A 2C0CA 4IRMA 5FA5A 3N0TA 1QQAA 1A9XB 3V5NA 5HOEA 1MC1A 2V7PA 3UGTA 4NJMA 4IJWA 4AS3A 4NQRA 4UQLA 4TYNA 1U3VA 2P62A 1B76A 1MQ8B 1P3Y1 1G42A 3PFNA 1B00A 4TKUB 1P60A 1BE1A 4YJFA 4FQ7A 4ECAA 3U19A 4EPTA 5JTUA 5IVKA 1PTKA 3K72B 1EDOA 3S1AA 3X1DA 1NQVA 2WDPA 1KRXA 1NW3A 4PX2A 3USCS 2F1HA 2GASA 2X7HA 1YFLA 5DHUA 1Y9EA 1ODLA 1G2OA 3KFXA 3NTLA 1JU4A 2OXEA 3UVEA 4WACA 5FBLB 2VS1A 5MN6A 1U7DA 2JI6A 3WRXA 2QMHA 1HT3A 2E9SA 5EIOA 4CTNA 2UU9B 2PUAA 4EKGA 1K7XB 4CI9A 3RG8A 4CNQA 4M0UA 2VRCD 1KDZA 1EUCB 1TQ6A 1TEZA 4F3TA 5CT6A 4L76A 1PTJC 4NMWA 2HHHB 4AY5A 1NC1A 1Q22A 2VBIA 4R8LA 4K6MA 4H0CA 2J3KA 3LLMA 3P1JA 1MX3A 3PNOA 2QTFA 2IIQA 3EE6A 1U0EA 5DHTA 5CTAA 5SZHB 4JI6B 4TTTS 3V9PA 1U99A 4JUDX 4N5MA 2FWRA 5D3QA 2JRLA 4MVJH 3D0QA 2PYZA 4U2KA 5LZ4A 2HYIC 1M2KA 2OV1A 2DYKA 2OCGA 2R66A 5BW5A 2FKNA 2Q5LA 2ZXFA 3CVUA 3LT1A 4K9MA 1E2UA 3GFFA 4JSTA 1OMOA 4M0KA 3MD9A 1C1HA 2PX0A 3EGEA 1RXIA 4ZU3A 1J2RA 4DR6B 2DPXA 5F73A 1ZNXA 2DY1A 3T1QA 2D4AA 3H4VA 1CEXA 4G9EA 1II8B 1GPUA 2G5PA 3OOEA 1G6KA 1LJ8A 4EENA 5LDHA 4P0TA 3SVTA 4HX2A 1A8PA 3ZZMA 4LHXA 1X70A 2HSEA 2QZSA 4ACAA 1O96B 3NIFB 4E2ZA 3UKJA 1WETA 4XRGA 2OG2A 4B3FX 4Y9UA 1BH2A 4JA2A 1TYEB 3TNYA 4PANA 4YK7A 2CYBA 4KFTA 4OO3A 5KBYA 2VF7A 1J0DA 2A5YB 3HEBA 3EZ7A 2X5JO 3CU5A 4FYKA 4OYYA 2WSBA 4RH1A 2J0UB 4JJ8A 3RSZA 1UC8A 4NNOA 4YAKA 4YRCA 5GP1A 3I2HA 4O5OA 2D5IA 5F23A 2XD9A 1HUQA 4XJVA 2WNIA 3NO4A 1RXCA 3IIMA 4M6WB 5JO0A 5LZ9A 1N8KA 5CLLA 1N2SA 2DTEA 3QEMB 4LI0A 4OYLA 4IIHA 2CBGA 3SZ3A 1KI6A 1K4MA 4NMHA 5DI3B 2WM8A 4E5YA 2HIAA 2YVAA 1RWOA 4RDCA 4ND3A 3TW6A 2JGRA 1L3IA 3NHFA 4DHEA 4E6EA 5F21A 4Z51A 1DWOA 1DO8A 4A6XA 1Q19A 3OTWA 3VYWA 3FFAA 2FNAA 4Q4LA 3S7TA 3P0HA 4EKNB 1YVUA 4NCHA 2OP1A 4KWIA 4CM4B 4IZ6A 5B58C 3BCHA 4GDMA 1J97A 2ZYRA 5FNVB 1L7PA 1W93A 4FYWA 2VBCA 1WXHA 4IKPA 2Z6UA 1ODTC 5HRUA 2VUUA 1J07A 4P4SB 3M9WA 3DF7A 1JQ3A 1J0AA 1MENA 3VPXA 3WYEA 5C1DA 1SD5A 4K5QA 3L82B 3U4MA 1Z6GA 3KE8A 1RWMA 3C4JA 2RGAA 2RH8A 3ABRB 4OHZA 2H5JA 3I5AA 4E5PA 5TARA 4ZHQF 1NBAA 1YFKA 2QXUA 4R31A 3M33A 4X7MA 3N75A 1CDOA 2FW7A 4FSDA 1OLXA 1KY2A 3AINA 4O2AB 2HF7A 3CA8A 2JBHA 3EVTA 3H2YA 4CG2A 1KSJA 4GQIA 4M1QA 1KEPA 5AOVA 1BMDA 4FFBA 2REXB 3KKKA 3O8DA 4HDSA 4OXKA 1USUA 3A1FA 5DPMA 4CLOA 4Y6OA 1JQLB 1L5FA 3C87A 5CDTA 1DAMA 1SHTX 5IEBA 1AMOA 2QTVA 2KW5A 1YCFA 1AB5A 2XNCA 4FE7A 4GVXA 4XX1A 3AZPA 2OO3A 3H11A 2LCIA 2VSYA 3B36A 4QHYA 3Q3HA 4CEHA 1N7IA 2EBUA 4MA4A 2PLNA 8AT1A 3O8CA 4ESVA 3L6RA 4FEAA 2GTIA 1BYIA 2GYYA 4G5YA 2EBWA 3IR6A 5E4TA 1KORA 1Q0TA 1J9GA 1JHXA 1LS1A 3H3FA 3IAM1 4PZEA 1GUFA 2A58A 2MR5A 1Y5LA 4TL9A 2DEUA 2I7DA 1FSPA 2DE0X 3HKBA 3VDRA 1GGMA 4H9GA 2BM1A 4KQ9A 1G1MA 2PX4A 4YT8A 1G7RA 1P6XA 1SA0A 3BRSA 4BJ5A 1QRDA 5BPHA 1VYVA 1HOTA 1VBNA 3PFFA 4YAEA 1FK8A 5DYTA 1JEJA 3AIOA 4WJZA 4WNIA 5FPSA 3UBMA 4BNDB 5A4JA 1JSLA 1PP4A 4FINA 3VVMA 2OQ2A 1G8GA 2J6IA 3E22B 4QOSA 1EGHA 4B73A 2C4HA 1XDBA 1XD2A 2L42A 1WW3A 3DF9A 3IE1A 3PDWA 1ISIA 1DAOA 4MQMA 5K8LA 2WYOA 1BGVA 3UAWA 4BP3A 4X95A 1ZSVA 3C3AA 3HCNA 4R1LA 2C07A 1JSRA 2B1JA 4IDPA 4RSGA 2QLTA 4C0LA 4D74A 5IN4A 2GPBA 2YJ3A 4DV0B 2YXPX 5JANA 5CVDA 3LBFA 2YXEA 1J2JA 3I8XA 1F51E 1Y80A 2EKQA 4BIIA 1ESNA 1PJRA 1YA6A 1EFRD 3OKCA 4QAQA 3QTLA 1SQ0A 1VRCA 2BZGA 3D3WB 4ZANA 2GFHA 2XXAB 1G5QA 4JUFA 4TTJA 4HDNB 1NV9A 5FQOA 3ELDA 1MC4A 1J6UA 1PZXA 2AN5A 3PVZA 1TLLA 1Q92A 1Q77A 1T0PA 3INNA 2Z09A 4TKLA 5KKAA 3RVMA 2C7BA 5ELXA 4WE3A 1VGVA 2X1MA 2XMSA 4L8WB 2G08A 3CF2A 3CKYA 5A62A 2PXHA 1C3OA 2WG2A 5CT4A 5G0UA 2JIQA 2PBFA 4PYLA 1UM9A 3B2QA 5FOQA 3JVVA 5DYIA 2XCOA 1GCGA 2H0RA 4AP5A 4OUDA 5ADHA 4B4UA 2RAFA 5EJIA 1H6BA 2IKQA 2BGMA 3DPSA 4I6EA 2AT1A 4JBWA 4QDJA 4QOGA 4Y98A 4XM2A 1NLZA 5BV8A 4G1FA 3QJGA 2R751 3RIYA 1AB6A 3OESA 4FDAA 1ESEA 1Z5VA 2RI6A 1KJYA 4W5JA 5CCDA 3I1IA 1RJGA 1U8CB 1RQ2A 4PVDA 3ZWCA 4F72A 5KNCD 2DR2A 1M67A 1T2VA 5I9IA 3NXSA 3KZMA 4Y2PA 4DY4A 1RAHA 2YMLA 4I9HA 1YB5A 5LLSA 4LPSA 3RSFA 1JFVA 4QQRA 5E4YA 3LUBA 4PR0A 4BB0A 2ZRMA 4BJHB 3DEJA 1RI2A 3G2JA 4L5AA 4UTOA 2IV7A 3VH4A 2XBMA 3GEDA 1G6Q1 1TMGE 3K6RA 3OZRA 3WDMA 8ADHA 1OWMA 1TMOA 3DWGA 1Z0ZA 4TRJA 4YV1A 5C51B 4FXOA 3WBFA 5I5EA 1TVKB 4KO3S 5HJ7A 4GNRA 2B1IA 3V48A 3AXTA 2ZYDA 1T4CB 1LS6A 1NG1A 1G59A 4JGIA 1L7DA 3BCUA 4F4JA 4AKIA 2EWWA 2ASVA 4MPRA 5I7HA 3D2CA 4DR7B 2EVWX 2DBRA 1G7SA 4X1IB 1DOAA 3MIZA 3HJNA 3F98A 4HHEA 1GJRA 1H0RA 2TRSB 4D9CA 4K05A 2LWIA 3UB2A 3PFBA 1IDN1 5DGDA 3UAOA 5KYNA 4TVKA 3RRMA 2WVGA 4YAJA 5JNUA 4KC0A 1UPBA 1UKZA 5CJJA 3OSZA 5IN5A 4MR7A 2OXRA 3GJ8A 5I4IA 4ZI7F 1QU3A 1IQPA 2JIMA 3PDIA 2DHCA 4QEZA 5LQUA 2P9HA 2WE8A 4R81A 4NU5A 1KEZA 4NPCA 4BX3A 3IVRA 1I5RA 4MCHA 1C14A 5JNRA 3F9RA 3EXHA 3PC8C 4II2A 2EQBA 5JBIA 2HHJA 2R68A 2NZ2A 3R7FA 3TB4A 1YK1A 5BNWA 3RJ5A 2EX1A 2IHNA 4TYWA 2VP4A 4E4RA 4LWZA 1V96A 2YV5A 1I1HA 2HJHA 3QITA 4ILKA 3TMKA 3IS3A 4MZXA 4QTZA 4RL4A 4B6RA 1D6MA 3TTXA 2W2KB 3EZXA 4ASUD 4B2YA 4P8RA 1ISFA 1E69A 4F71A 3TUZC 4TYQA 2PBLA 3OOYA 2A5DA 3A0RB 2VJKA 4DRXB 1UZUA 3H2SA 2OV2A 1H9AA 5A5FA 2I67A 4IIFA 3T3NA 2BGJA 1EYZA 3OZSA 3TR0A 1UT5A 2I9PA 2P3OA 4U6QA 2VH5R 4G89A 4QBKA 1WQ1R 1XZHA 3U3DA 3PEVA 3M49A 4ENWA 3N2GB 1O03A 3CXUA 1FFDA 1TCBA 2ORYA 3FUWA 2M6LA 2DT8A 4CCAA 5CD9A 1ZITA 2CXHA 2V9CA 3JATB 3CVXA 3JD1A 5F9FA 1JAHA 3FB1A 2BHNA 2ECFA 1I2CA 1Z15A 2XDQB 1SUIA 2Y76A 2Z56A 4RTJA 2O19A 2F1JA 4W1QA 3DOCA 5IP5A 5HA5A 1FUYB 1PT5A 5IWCA 3MGBA 4IMJB 9MHTA 1MO2A 4BFUA 1GPDG 3LPDA 2YN0A 3OECA 1T6YA 1N4AA 1MO6A 1E0SA 5FL7D 5B64A 1QDEA 3G2HA 3ZK9A 1OQAA 2PD4A 4CTKA 4U0KA 2VJDA 3MTJA 3QE3A 3T4PA 1NDUA 3HBAA 4YUWA 2AFVA 1EZ4A 1CFJA 4MQFA 2UXBB 3PTZA 1PSWA 1OROA 1W36C 1RRMA 4XKJA 5CA0A 1KETA 1MO3A 1DKQA 1V43A 2HKIA 3U7RA 1CQJA 5FOWA 1UP4A 4WBNA 3LWBA 2O1SA 3B1JA 4HNAB 4J2TA 4V39A 1P5FA 3QWFA 1I3OA 4JJFA 2ONJA 3EC2A 4B3SB 2C83A 3A1UA 4BV8A 1OAKA 5IM4A 3C6KA 1O97C 3I12A 3U48A 4PG7A 1HE3A 3Q9UA 3CQ9A 3GO4A 4KGVA 1HE2A 3PA8A 5I45A 4W63A 1A5SB 4L5YA 1GTVA 4GSLA 3UMMA 4HQOA 3S6JA 1NIPA 1ADCA 5FF9A 5EJ6A 2C9BA 3A3KA 3RS9A 2V7QD 1EWVA 2ZJZA 2H1WA 2DY0A 4PYNA 2ZSFA 3W4KA 5EP2A 2DFPA 1P9WA 4GLFA 1QBGA 1ZJJA 3TNLA 2Q46A 4Q4AA 4NZPA 3DE3X 3V8EA 5B2FA 3A6DA 5TS3A 1MH9A 3TLGB 3WGIA 2VJMB 3H05A 4FWBA 1LBQA 1WMDA 3MD0A 3OTIA 3ZYZA 2X5XA 5FV4A 3TKLA 4LXXA 1KMCA 2WWGA 5F9MA 2OHVA 2VTKA 3KSUA 4KNYA 1P5HA 2ET6A 4OVKA 2OHOA 4ITVA 3A36A 2MSLA 2QRGA 3MWEA 4Q1CA 4M8KA 3R8XA 3RAJA 2WZCA 3MOIA 4NAVA 1TTQB 4TWJA 4ALKA 2VQ6A 1S6YA 5E3JA 1OFUX 2H2DA 3VMFA 4HAUA 2ENUA 1KSGA 3VHXA 4WZ6A 2GO1A 4QOFA 3V4VB 4ZEVA 1CEQA 4KAJA 4L8LA 2BZSA 3DPIA 2VI5A 1MXFA 4ER3A 3ANTA 3AR7A 3KTAA 4NOMA 2XHZA 2BH2A 1S3IA 5C7IO 2GVDC 3REGA 3KQTA 3JQGA 4Y3UA 2XUFA 2A88A 3OQOA 4JCOA 4U0JA 4GPEA 2AHOA 3P96A 5FDFA 1OH7A 5AKYA 1K92A 1ZUWA 2O07A 2J4FA 2WT4A 2D6FA 1F1JA 3RIXA 5DHRA 5KVCA 1XEFA 2PGAA 1ZIXA 3FKJA 3P97A 4GOKA 1YCHA 2ZRPA 4GX1A 1GRQA 3G0CA 1XA3A 1E6CA 2FN3A 2YRWA 3FBTA 1YT5A 3OOSA 3M3DA 3V8BA 1FA9A 2BKXA 2HL6A 5AHXA 2G0NA 2QY9A 3SJZA 3WYGA 2IH4A 1V1JA 1AM4D 5DNDA 4DJJA 1JB9A 1JILA 4R01A 1PWZA 3B8EA 3KSAC 1VI6A 4P22A 2Z9BA 4FMCB 1LWOA 1SOUA 1VMAA 2O3UA 3F67A 1N2CB 3OIFA 5DKFA 1TUBA 5EFOA 2RG7A 4UMVA 5BUCA 4NBSA 3A9RA 3UWMA 1AZLA 4O4IB 3ELBA 3T52A 2ZJAA 4WDRA 4D5GA 4OJMX 1QVZA 3IAM6 5EHZA 2VP3A 3DE7X 4K8OA 3K9CA 3SXJA 2CLCX 5JAOA 1O95A 2P35A 2H1FA 4F3CA 1DBWA 2B2CA 1HFWA 3JPYA 3KIPA 1DRVA 2QM3A 1TCCA 3DEFA 3VZDA 3HGQA 2I55A 2BUAA 1KY5A 4LUCA 1RD4A 4IRUB 3K0BA 4RKYA 3DAFA 4XH9B 1L5RA 2OFOA 2ZJYA 2D5BA 1D2EA 1KGSA 1XP8A 1ZUHA 1Y3FE 2HMSA 4GIBA 4RPCA 5F5XA 5HDBB 5ISMA 3HJRA 3DV0B 3K20A 4JJZA 2YWFA 3L8YA 3E18A 3LPCA 3OFVA 4FK8A 1B1CA 2P5YA 2R7MA 2QJWA 2ZYGA 2ZVDA 3GLSA 4LOJA 5M7EA 2J6BA 3ZQ4A 3KAKA 3QENA 4MARA 1J00A 1U2GC 1IEVA 4XCXA 4DJDC 5AVOA 1P91A 2Z43A 3IT3A 5K8IA 3MGGA 3O38A 4RXUA 2CV1A 3D3EA 1L5GB 1GNSA 1K63A 4LI3X 1GG9A 2ZAMA 3JD0A 2FE4A 2ZUWA 1H9BA 2EJBA 3QYFA 3UKDA 1CCWA 1W48A 3TX2A 1DOZA 2ZPTX 1WKVA 1U2QA 5K03A 1JIJA 2OLJA 3OJFA 3WL7A 3E35A 1OI4A 3GDWA 2IZOA 3ROQA 2PX3A 3QV1A 2AEMA 2BVNA 2HBQA 3N07A 5IXYA 2C2XA 1MGPA 3T1NA 2IUEA 5AKXA 3JTMA 4KSCA 3DP7A 3N0WA 4Q9JA 5GONA 5T7BA 5TDHA 4OKSA 5CH8A 3QM1A 2WAOA 4MV7A 2XA1A 4PPQA 3QX3A 2JATA 1QXSA 3F3MA 1DMRA 3K8OE 3PLAE 2PKCA 4I4TA 4O4LA 1BXGB 1SKYB 5BOSB 4QUEA 4YCMA 4EIWA 5CD1A 3RK1A 4Q37A 3FHTA 4N6OA 2Q6LA 1ENZA 4X20B 4ZZ0A 4UM8B 2XYRA 4BFTA 4D4GA 3NP9A 4D3DA 4LV5B 4CUJA 4QOJA 4LDPA 3T7KA 2IBTA 1RSZA 1CTQA 4B46A 5LIPA 4FBGA 4M8IA 2YV3A 3RAFC 4ZVUA 4MLZA 3DMRA 5AOCA 2CVFA 1GZ3A 1A76A 2VBGA 1N32B 1E6UA 3WGKA 5JO9A 4EY5A 4O2BA 4KQ1A 3EODA 2A1UB 4LZZA 1I1NA 2BGIA 2QAGC 1NONA 2ZIAA 1E2EA 1KDVA 3LM8A 5DTEA 4WZBB 2P2YA 3W7BA 4YBRA 1HTWA 3HWX1 4TLCA 5L3ZA 1OILA 2I3AA 3QELB 4RMGA 1YJBA 1TA0A 1XWFA 3GLVA 1MQ9A 1NVUQ 2FFQA 1GGEA 4WT7A 2O7NA 3QWIA 3FY4A 4EFDA 3MEQA 4RCZA 1EJ0A 3L8MA 3QBVA 1C1XB 1LPNA 1SU8A 1E3SA 1TT5B 1YA4A 4LWOA 3TLCA 3FOZA 5CXUA 1PJLA 3OQJA 1US8B 4ZT2A 4XIGS 1SG9A 1MVNA 2B83A 3FZNA 3HYLA 3UJ8A 1UBRS 2R1TB 3CVVA 3AJDA 3CX7A 3F5QA 3GA7A 3MUOA 4GWGA 4R3WA 4DCOA 5TQ2A 3MVEA 1VIMA 4MP3A 3NDIA 1LZLA 3DMNA 3M82A 5G4LA 2VJOA 5ALKA 5A1JA 5GWXA 2QQEA 3F6CA 4WEQA 3VR3D 4ROSA 4UHHA 5HTKA 3VQTA 1W0JA 4MOWA 4PG6A 4L07A 3B78A 1QS0A 1UUFA 2YTZA