4MZXA

Crystal structure of benzoylformate decarboxylase mutant t377l/a460y
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
525
structure length
525
Chain Sequence
ASVHGTTYELLRRQGIDTVFGNPGSNELPFLKDFPEDFRYILALQEACVVGIADGYAQASRKPAFINLHSAAGTGNAMGALSNAWNSHSPLIVTAGQQTRAMIGVEALLTNVDAANLPRPLVKWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLSVPYDDWDKDADPQSHHLFDRHVSSSVRLNDQDLDILVKALNSASNPAIVLGPDVDAANANADCVMLAERLKAPVWVAPSAPRCPFPTRHPCFRGLMPAGIAAISQLLEGHDVVLVIGAPVFRYHQYDPGQYLKPGTRLISVTCDPLEAARAPMGDAIVADIGAMASALANLVEESSRQLPTAAPEPAKVDQDAGRLHPETVFDTLNDMAPENAIYLNESLSTTAQMWQRLNMRNPGSYYFCAAGGLGFALPAAIGVQLAEPERQVIAVIGDGSANYSISALWTAAQYNIPTIFVIMNNGTYGYLRWFAGVLEAENVPGLDVPGIDFRALAKGYGVQALKADNLEQLKGSLQEALSAKGPVLIEVSTVSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanistic and structural insight to an evolved benzoylformate decarboxylase with enhanced activity towards pyruvate
rcsb
source organism Pseudomonas putida
molecule tags Lyase
molecule keywords Benzoylformate decarboxlyase
total genus 193
structure length 525
sequence length 525
ec nomenclature ec 4.1.1.7: Benzoylformate decarboxylase.
pdb deposition date 2013-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mzxA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mzxA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4mzxA02
3AHIA 2R8PA 3HYLA 2XT9A 1V16B 5HJEA 1KEKA 4KXWA 4RMHA 3EXG2 3IAEA 2H4FA 2BEWA 4FZ3A 5EJMA 3M6LA 1L8AA 5MGNA 3E9YA 3D81A 4JUAA 4KXYA 2BRUC 1DTWB 1TRKA 1V5EA 1EFVA 4WBXC 1T9CA 2BFDA 2H4HA 4V1CI 2OD2A 1W88B 1QS0B 2VK1A 3OE1A 4MQ5A 4QQ8A 2Q29A 1NGSA 3FSJX 2VBIA 2JLAA 3CLTD 2C3UA 2YIDA 3UK1A 2Q5OA 2VBGA 4RJIA 3LQ4A 1J8FA 4JUFA 1V5FA 1V5GA 5K2OA 1YNOA 4JU9A 2NXWA 5EJ7A 1POXA 4GPEA 4UU8A 1NI4B 3CLRD 5K6TA 2BFEB 4RMJA 3L84A 4KXQA 2J9FB 2YICA 1OZHA 1QGDA 3PKJA 1IK6A 1QS0A 1JSCA 5EJ4A 5D7NA 1NI4A 4D5EA 2C31A 1YBHA 1Z8NA 1TKCA 3M7IA 5BWLA 1DTWA 4JUDX 2AG0A 3EYAA 1Q17A 1ICIA 2W93A 1MA3A 1OLSA 2B4YA 1PNOA 2C3OA 2FRDC 1OZGA 1D4OA 1N0HA 2BP7A 2BEWB 2EZ9A 1UMDA 1UMBB 5I51A 1X7WA 1X7WB 3GLUA 1X80B 2FWNA 4UU7A 1POWA 2H59A 3GLTA 3AHFA 3LQ1A 4XEUA 3PDHA 5DGDA 1YHYA 3ZHTA 1T9AA 3ZGOA 1DJLA 1WCIA 1X7YB 4JU8A 5EJ8A 5ESDA 3ZHSA 3JR3A 1R9JA 4MPPA 2JGDB 2H2GA 3OOYA 2BFBB 2VK4A 2VK8A 5MF6A 2PGNA 1HZZC 3KOMA 1QPBA 3D4BA 3FLMA 4TWIA 3U31A 4FEEA 5EXEA 4UUBA 1OLXB 4KXXA 1M2GA 3HWWA 3ZGVA 3AHJA 5BWOA 5DEIA 1Q1AA 1O97D 2WVAA 3MOSA 5EJ9A 5K6RA 1OLUB 2JIBA 1XLTC 1PO7A 5HHTA 3AHCA 3EXHB 2BFFB 5ERYA 4MPRA 2QTCA 3AHHA 1UMDB 1WCIB 1V11B 2Q5LA 2QTAA 2G28A 2Q5QA 3DUFA 5I5GA 2WVGA 2C3PA 3DV0A 1YI0A 2OORC 5ERXA 1T9DA 4JSRA 1U31A 4K9NA 1S5PA 1YC2A 3UPTA 4ZZIA 3EXG1 2A1TR 5EJAA 3ZG6A 4GG1A 4BV3A 4I5IA 2OO5C 1U28C 1O96B 1YTLA 5EJ6A 1UMBA 4C7VA 2V3WA 1M2KA 2NYRA 4IF6A 2XT6A 1YHZA 1PTJC 2G67A 2BFEA 4JT8A 2QQFA 3AHEA 1OVMA 1YI1A 1PT9A 4KXVA 5MFPA 5FYQA 1M2HA 1V1RA 4KXUA 1YC5A 2IHTA 4K9MA 4Y6LA 3U3DA 2BFCB 1S7GA 5AHKA 1NM5C 3EXIA 4MZXA 1AY0A 2OZLA 2OZLB 1GPUA 4FEGA 2H2FA 1X7XB 2BFCA 2H2IA 1T9BA 4BV2A 3RIGA 4HDAA 4V1CB 1SZCA 4G1CA 4JUCA 3LPLA 3DV0B 4MPJA 3EXFB 1U2DC 5IMSA 4Y6OA 2E6KA 4BVBA 3GLSA 2VJYA 1YD7A 2BEUB 4K9OA 2X7JA 4UTZA 3LQ2A 3ZHRA 4TWJA 1ZPDA 2Y0PA 4K9QA 1MCZA 3GLRA 1V16A 2XTAA 3JWPA 4BVEA 3F6BX 4K9PA 5I5EA 2FSVC 4BN4A 4BUZA 3EXFA 2PANA 3EXEB 1UMCB 2C3YA 1Q6ZA 3EA4A 2QQGA 1U5BB 3PKIA 2WVHA 1X7XA 4GM0A 1UM9A 1SZDA 4FVTA 2G25A 3EXHC 1OLUA 4RMGA 4RMIA 2BEUA 2BEVB 1V1MA 4O8ZA 2BFBA 4IAOA 3EXIB 2JGDA 4JD5A 1EFPA 2O1XA 2IHUA 4C7BA 4X3PA 1X7YA 2AG1A 1OLXA 1X7ZB 1B0PA 1Y9DA 1UPBA 1X7ZA 2EZUA 2C42A 2R8OA 4UTXA 2C3MA 3RIYA 4UUAA 1TKAA 4GM1A 1PVDA 2JI9A 1ITZA 1W85A 2JI6A 4ZP1A 4D5GA 5EJ5A 1X80A 4BVGA 1UPCA 2R5NA 4J16C 1PI3A 3IAFA 1UM9B 3M34A 4KGDA 2H2HA 1E3TA 4C78A 1V1RB 4GM4A 1U2GC 1U5BA 5MFZA 3M49A 5I4IA 4RJJA 1M2NA 1UMCA 5HGXA 3ZHUA 2Q27A 4BVFA 1V11A 4QPZA 2H4JA 5EXDA 4X3OA 2BFFA 3EXHA 3AI7A 5K3SA 2OD7A 4UTRA 4R8MA 2Q28A 4Q9DA 3ZHQA 3ZHVA 2UZAA 5C4IA 3HWX1 2EZ4A 1W85B 2O1SA 2J9FA 2UZ1B 3DVAB 2BP7B 2DJIA 3D7KA 4JT9A 4Y6QA 3K35A 4IG9A 4J1TC 1OLSB 1RP7A 1UPAA 4UTNA 4RJKA 3DUFB 4C7XA 4BN5A 4V1CA 1PYDA 4BVHA 4UTVA 4KPUA 2PGOA 2EZTA 4F4UA 4HD8A 3EY9A 5DGTA 3AHDA 3CF4G 3CLUD 3FZNA 5FEMA 3RIMA 4COKA 2BEVA 4QELA 4K9LA 1PNQA 2OD9A 3F6EX 4L3OA 2JI7A 5HYVA 2JLCA 2Q5JA 1W88A 2PDAA 1OZFA 3CLSD 2BFDB 1Q14A 4JUBA 4GP9A 3AHGA 1BFDA 2FR8C 2VBFA 1M2JA 3EXEA 2EZ8A 2HJHA 2IEAA 2H2DA 1TKBA 4F56A 4L2IA 2JI8A 4K9KA 5BWNA 2FN3A 2IHVA 2UZ1A 1V1MB 3DVAA 2A1UA
chains in the Genus database with same CATH superfamily
1W6UA 1YB6A 3CKYA 5LZ7A 3WY9A 1KMHB 2DECA 1IWOA 4HNGA 4X0EA 1G38A 3L0PA 4A0RA 1C5KA 1DG3A 2GX6A 2NOAA 3R41A 4PYNA 1UJBA 3B13B 1K4KA 3AL2A 3GVIA 2ACVA 4QSMA 4PQEA 2D0PB 4XD7D 3QWIA 2Q4EA 2EKLA 3QJYA 3UWKA 2F4NA 3MWGA 2OY0A 1RHJA 1N92A 4DLWA 1WM1A 1J0BA 3DLCA 3NT4A 2OCIA 4BNWA 3K6SB 2B2XA 2F62A 3WRXC 5T7BA 5BN5B 3RYIB 2QL7A 3N86A 5MGNA 4JKOA 4JY7A 1VIVA 3BXOA 2C4VA 5TS2A 3Q7PA 4IMJB 4ZAFA 1M1NA 5BYBA 3DBRB 3FUWA 2FQXA 1O8CA 3TN7A 4EAQA 5FOVA 4DV4B 1QF6A 1SKAA 2FCRA 2HIMA 4CCYB 3UO8B 3WLFA 2O20A 5A0VA 3CIFA 4WJZA 4DT1A 3TZCA 1ORTA 1EE1A 2ZYTX 2VJQA 3OOSA 2ZJOA 1CNFA 2C8JA 4UPDA 5E7JA 5HMLA 2FSIA 1KY2A 3RH0A 4DY4A 4FHFA 2K5UA 2WIAA 1RCFA 3L6DA 4HGOA 1CUJA 1K68A 3AKEA 3DVLA 4JP1A 2WJWA 1QFMA 2C4KA 2AGVA 2A9FA 4U3JA 1NURA 3W6NA 2GN1A 4L4ZA 4M1OA 1QDEA 1G0OA 2YIDA 3QFFA 4MAAA 2O3UA 3DE3X 4QDUA 2PZ8A 4IX1A 1F1JA 2XGOA 3L0CA 1XEWY 4MUHA 4NAVA 1HEUA 1T3SA 3Q98A 2IUEA 4MB6A 5TMDA 1SRRA 4A27A 1TYEB 4ND4A 5AVRA 3RV4A 1YR1A 3DKKA 1HEIA 3D6HA 4IDPA 4G9EA 3TRIA 2HIAA 3ETGA 4GEGA 2IEYA 3QXXA 13PKA 4I50B 1DC8A 4P3OA 3D8RA 2JIZD 3H99A 4BV9A 2JJ1A 3GCGA 3Q9SA 2YTZA 3K4HA 3GAMA 3VR2A 8LDHA 1BEZA 1FNSA 1G3QA 1XJ0A 4AJ2A 1OAOC 2R00C 4B7CA 1T3HA 2HWXA 5B5SA 4IOLA 4FX5A 4L76A 2X9GA 3TXYA 1QGDA 1V3UA 2YJ3A 1IHOA 1XWIA 3C1UA 1NY6A 5E9QA 1C3OA 4Q6WA 2DP4E 3HDQA 3WLKX 4V0KA 4L5BA 4WE3A 5AI4A 2V74B 3R7LA 1YRWA 1DKMA 1QORA 1APBA 4MDFA 3HLTA 2REBA 3ZH9B 1Y3HA 2AN4A 1CBUA 1MQAA 3K73O 3R6TA 1QCCA 1HDEA 1PT8A 2EOAA 2J41A 1SUFA 3EA0A 3FYCA 1P44A 1IZZA 3G2MA 4IINA 4QYIA 4YI3A 4RE6A 4FWIB 1Q17A 4XFDA 3OZVA 3K92A 4DYHA 3KYCA 2ZRDA 3DZGA 2W93A 4HDSB 4U2CA 5DLYA 3X3HA 1G5RA 3DQPA 4ZEMA 1SUEA 1AKEA 1P91A 1XNHA 4H4EA 4OD0A 1JI0A 4MEAA 2REQB 5CG1A 1RC8A 1M2FA 1RRKA 1N7IA 5C8YF 5I51A 4E2ZA 3QVGA 2Q5FA 4KXFB 2C99A 4NY1A 3DP9A 5B57C 3M5DA 2BMJA 4AX4A 1BVYF 5C35A 4W4TA 1WZCA 2X9VA 3KD2A 5FF9A 1DKQA 2DFDA 4CM4B 1ODSA 3K9CA 4ZC1A 4EB6A 1DB3A 5DI3B 1CZLA 1RHUA 4MS4A 4FYJA 1NV9A 1KEEB 2XZDA 3ZZUA 1CS0B 1XMSA 1QWOA 1Y63A 4PFQA 4XEUA 2CZQA 4W9MC 4MOWA 3GFPA 4IJ6A 2NT4A 4I3FA 1UEIA 3FNHA 3OZWA 3SLGA 3H6GA 1MDBA 1ZDMA 2AF3C 1LTQA 2QUHA 2FJUA 1V9CA 3R3VA 4BB0A 1OX6A 5AW3A 5JS6A 3IXQA 5JRDS 3BH7A 2XYRA 2XR1A 1UZUA 3C3BA 5F1PA 3I52A 1O8BA 3TTYA 3BH6A 1OBOA 2BKAA 2CUKA 4C6HA 2ZBVA 4W5OA 1P7PA 1JDSA 2PX5A 1A2KC 2QL5A 5C18A 1VIMA 2EL7A 2Q21A 1GZDA 3SEZA 3C8MA 4BAGA 5HX7A 3TNLA 1WZUA 4MYUA 1KKUA 4G2TA 3W9SA 5AM2A 1VJDA 4M8IA 1DU4A 2DE0X 2Q3LA 3RW9A 4N48A 4A03A 4QGFA 1FCJA 1A9SA 1P2SA 1QXSA 3F6SA 3F96A 4IKPA 1EX1A 4LJKA 1H9CA 5MF6A 2JGMA 5AMXA 2Q6TA 4DQDA 5AW6A 3URMA 5KNDA 2YFHA 1K8ZB 1UDRA 3MTQA 2HL6A 3QF4A 1F0KA 1P18A 3EJWA 4BO7A 3EEOA 5TR9A 1TTHA 1FTYA 4X1IA 1MJFA 5B6IA 4FJ0A 3NM5A 1DQYA 3TSYA 4UNPA 6LDHA 1NXOA 4XVCA 2CJWA 2KBFA 2EFEB 3OT1B 2CL6X 2AOUA 4BFWA 2YX1A 1N2EA 2H7YA 3SBEA 1IQRA 1GPBA 1P2TA 1URPA 4RV4A 5H02A 1QHFA 5DF1A 3O0TA 2R2GA 4F4IA 2OCAA 2X8JA 3G0DA 3HUTA 3LDFA 4LHXA 4MMYB 4PHGA 1XC7A 2IYTA 1IB6A 4I1UA 4HAIA 3P97A 3H2GA 4II7A 2Q0QA 1A5TA 2ZAGA 4RIEA 4G8DA 1NMZA 2VNJA 2XRFA 3GLHA 2YJZA 2WWTA 4RKRA 1D7OA 1OLUB 4RF5A 4EKNB 1OH5A 4RZXA 1MX9A 1PO7A 3BRSA 1DFHA 4MO2A 4WXEA 4H1VA 3GRVA 3NM6B 1YE8A 4TRJA 4YMWA 1ZOLA 3F78A 5J43A 4KU4A 1UFVA 4ALNA 4IHJF 1M1XB 5GQSA 4CHTA 1NX6A 1U0FA 2CZCA 4YROA 4TL7A 1JHMA 1ICEA 4FMCB 4EW6A 4L9SA 5C2JB 3D1VA 4S24A 5ALGA 1TD1A 1F7UA 1QONA 5AVOA 3KQOA 2CXSA 2PQ6A 3E35A 1XTIA 4QVGA 3TRJA 1LPOA 1MQ8B 3KQPA 2BFPA 3AY7A 3OQPA 3PC8A 1JDZA 4J2OA 3TIIA 3VHXB 3W34A 4LMRA 5KOHB 3PJGA 1HRDA 1NVVQ 3JD1A 5HQJA 2GXQA 4N01A 3B1KA 1QV7A 1U3DA 1IN4A 1YVRA 4YO7A 5TQJA 1M1YA 1Z28A 3W5CA 1JR4A 1C3VA 4KL8S 4Q7JB 4UFNA 1A2OA 4F5ZA 1PV1A 2VKQA 3P2EA 4ICIA 2O8EB 1PS9A 3HU1A 4HEA6 4CLRB 1RVDA 3KQVA 3G79A 1S8OA 3HVIA 4QXMA 4DDTA 5E2BA 3T7SA 3O83A 5ETJA 1KAGA 2VDNB 1O7JA 1CFZA 1QV9A 2FYTA 4ZMBA 2FPGA 4QJ4A 1NBEA 2E21A 4H0CA 3D9QX 4J0JA 4YH1A 3O8QA 1PTJC 4QM7A 3CEJA 4NV1A 4R3UC 4DAEA 3P20A 3CY6A 5DV9A 3ESAA 4F60A 5ES4B 3WLIA 2YMLA 1NIPA 4UM9D 1EVEA 4E3ZA 3QKTA 4OJMX 4UULA 4ZHSA 3J80A 1HYBA 3C6QA 4MGIR 5K0CA 4N47A 1VIAA 3RT1A 4KFCA 1CDEA 4PLZA 4J7AA 1K0FA 1M34E 1ND5A 1OXMA 1SQ0A 1VYHA 1Y9AA 4MRMA 3GD5A 1XTVA 4Q6BA 2W0MA 1KEWA 3VX3A 2H57A 2QYTA 4ZDIA 4OQDA 3BWYA 3H19A 1CW2B 4TL9A 1MRSA 5AHRA 4F9EA 3D2AA 3FWNA 3VBCA 3WLTA 4BAZA 5CDFA 3FYTA 2GPSA 4C3OB 1EGQA 1LFAA 3KLBA 3X1YA 1GPUA 3BT7A 3HO8A 1DLIA 2RCNA 3I8OA 3KK0A 3KT8A 4BXOB 1C50A 4GKBA 1FRZA 1VYUA 2QLNA 3TLGA 2W48A 3DW1X 4WESA 1ZGBA 2H2IA 2QAGB 4PG8A 4O0MA 3GLFE 3EW7A 2A0XA 3HDVA 3OLWA 5J47A 4DLUA 621PA 3CB2A 1NZJA 1JTEA 1ZESA 1NTOA 3CX4A 4UDNA 1E3JA 1GLNA 3U49A 4DE5A 1XCPA 4U7PB 1S96A 5BO5A 5ICMA 2HI0A 3SVLA 1QCZA 2HSWA 3I39X 1CUWA 1M1YE 4X6UA 1TZ2A 4XM0A 3L6RA 3U19A 3N2ZB 1OBCA 4HDKB 3PX2A 3KZCA 5LOVB 3HE3A 3GO4A 1DC5A 1XTBA 1UOEA 3FDZB 4N18A 3WBBA 2AMVA 3PXAA 1SVSA 4FFSA 4TRMA 2AK3A 5EEGA 5H0IA 1MB2A 1XVTA 3O74A 3IT3A 3H8WA 3A4NA 4UVEA 2GDZA 1KYYA 4ABYA 3P4UA 2RH8A 2BHLA 3JYOA 3RT7A 1K63A 3Q8MA 5HQTA 1UQUA 1MW8X 2OV8A 1YGPA 3DB2A 3HR7A 2C2OA 4TQUS 3RVMA 1CUUA 1MJNA 2ZJ3A 4NH4A 3GVCA 1SC3A 1EP3B 2OV2A 4YONB 5L53A 1L2TA 4P08A 3VVBA 4IO0A 4ZT5A 3OEHA 1QC5B 3IMEA 4K46A 2FWMX 2CFIA 2HN9A 5AVYA 4XSHA 2QMZA 4KDFA 3KKQA 3L02A 2IYQA 1JHXA 3ZGNA 3ZX4A 3ICEA 1B4DA 1JKFA 2G5TA 2ZBDA 4QBHA 5DBHX 4X41A 2BBOA 2IY9A 5L7WA 5I7OA 2YXEA 3MJSA 3WNVA 2WK1A 1C9KA 1W4AA 4U2DA 1MO5A 4WY8A 1IUKA 1DOHA 4Y8VA 5JS7A 3QKRA 1HFWA 3DCNA 1RXCA 1YA4A 4MB0A 4OGFA 1ZONA 3SS7X 4CMIA 3UYLA 4LQCA 2HK7A 5D87A 1DXOA 4P4SA 3SYRA 4BLVA 2ZJZA 4KE9A 1R0RE 4ZVTA 4DV2B 2IXAA 2PH3A 2WZBA 3E23A 1YB1A 3NHSA 3ORHA 3ONNA 4RMGA 4RMIA 3TGWA 4E2XA 2F9FA 3TB4A 3O7MA 3AVYA 2G9VA 3LKDA 4R8VA 4BRWA 1H0SA 1GP2A 2VH2A 1WVIA 4GI5A 2WWVD 2RGGA 2IS6A 1TT5B 5CJ2A 2PWPA 2JAOA 3KRTA 3DOJA 2Q6IA 1GZSA 3C7TA 4IHJB 5K7SA 3PX7A 4RVUA 4DA4A 3OICA 4TZKA 4X1YB 2HGSA 3UICA 4Z8YA 3EDMA 3DHNA 3QPBA 3ZLBA 5KSOA 1UPBA 1X7ZA 3NNDA 4BJ6A 3LJKA 3TX6A 1ZITA 4KVAA 3MUNA 4J0KA 5KOIA 4JC8A 4KWCA 3EGWA 4URWR 1XJ5A 3CRNA 3B48A 4RGYA 3R44A 1GZ5A 4ZMRA 4WLVA 3SHVA 2CCJA 3SX0A 2IQ5A 3UWPA 4EKDA 5L3QA 3KQYA 2CXQA 4XTRA 4D9BA 2B35A 2GJ8A 1RZ3A 5CBPA 3GB9A 3TKYA 1Z35A 4BVGA 2HXYA 5TJHA 2ZB3A 3RRBA 4YV2A 1YKSA 3FCSB 1BQ3A 1MV8A 3H5OA 3FCEA 4TLCA 4XPIB 3T95A 1V1RB 4CCAA 3OJLA 4GR5A 4IIBA 4A5OA 4H77A 3ZCUA 3PE4A 3FUTA 5I7RA 1N36B 1I1QB 3DYBA 4X24A 3GJTA 1T36A 1LX6A 1N9GA 1NZFA 3SZLA 3D3WA 3T5AA 4AJPA 3R24A 3SEAA 3KR0A 2COUA 4UUQA 2IS2A 1NAHA 2HUPA 5HG0A 2B98A 2X3YA 3CT4A 2O23A 3LC7O 3ZDAA 2JFGA 2QRJA 3CZRA 1Z2NX 4HG2A 2OVFA 4UU0A 1I5RA 2XMPA 3IR5A 2JIRA 1D6NA 2ZIEA 4X97A 3I6BA 4PSDA 4S2UA 2Q4DA 2Z8YA 3OQIA 3RWBA 3TNYA 3VTFA 2EW2A 4B44A 5JXJA 4P0PB 3OP4A 4BTVA 4HAWA 2CYAA 4Z4CA 1MABB 1NT2A 2PBFA 3SKYA 1SVMA 3RSZA 1BE1A 1P1CA 3FNFA 3NVMB 2GMWA 2KBEA 1RMQA 4IYRA 3KXPA 4AWAA 2FG5A 4W5QA 4ZYUA 1ZKMA 4HFRA 1Y4SA 3I8XA 3VPAA 2WSYB 4H17A 4FMCF 3T7CA 4YUWA 1HDZA 1VIYA 1WA5A 3DGEC 4JT4A 3GFOA 1XE3A 2IJGX 3AIOA 3OY7A 2FUEA 4B5LA 1WHSA 4A0HA 4BCDA 4D26A 3FUXA 3QV1A 3N07A 3H83A 1YL5A 4HQLA 1G64A 5FO0A 3RASA 3WAKA 4PSAA 4YT5A 3S4YA 4FSXA 3W77A 2I7CA 1U1CA 5KYUB 2W8ZA 2PZBA 3FW1A 4OREX 3WRYA 1FUEA 5C8YB 2V7VA 1C1XB 1N8SA 1PK7A 3VZCA 3WMWA 5KQPA 3SVTA 3LXUX 1RJDA 2XVZA 3CLUD 1H6AA 3QLEA 3ZS8A 1JR6A 3HJGA 1A69A 1KYTA 2GEDA 2FDXA 3HDGA 4L5YA 5DNAA 4DN6A 1W0KD 1M0EA 2FEMA 1PNQA 3L8HA 2C9DA 3AEYA 3IO3A 3MJEA 3NHBA 4DB2A 3CJTA 1VOTA 2W22A 2JCVA 3RJ5A 3N8NA 2GAOA 4DTIA 3CRZA 3DL4A 3A1NA 3VOAA 3R7WB 1NUPA 3BE8A 1FSGA 2ISQA 3ELYA 1G3IA 1N6OA 2CVOA 2XUZA 3TW8A 3PPVA 3TW6A 2AX4A 5DP2A 1J00A 2GPWA 2XPCA 1GG5A 4TKVA 1QHHB 1TYAE 5B3LA 5CYGA 1SURA 3TGPA 1GZUA 4RHCA 1OZAA 1SB9A 3C6YA 3EXEA 1ML3A 3R8FA 1NC1A 1QP0A 3BZUA 2H2DA 2V5AA 2B25A 4KG7A 1GITA 5ALIA 4ILKA 2JI8A 1VCMA 2I3ZA 2UZ1A 1YA6A 2V4UA 4WBNA 2CLOB 5A03A 2B2NA 4CM6A 1AHHA 5DI3A 5B1DA 3CLRC 3FE2A 3REOA 2F43B 2R8PA 2EJTA 3UAGA 2IVFA 2Q1SA 2CLCX 3PK0A 3X43A 3U40A 3IL2A 1CUIA 2CFCA 3O6VA 1EVJA 4LTDA 4O6VA 4R84A 5JCJA 4DTCA 2FV8A 4EPTA 2EF1A 4BDTA 1VCOA 4TUYF 1MOSA 3IAEA 5DTQA 1L3BA 1HGXA 2R6JA 3T94A 3HYNA 3KPJA 5K3AA 3CT6A 4RZIA 1FFGA 2WWXA 1JFVA 1U0RA 3QNUA 4YV1A 4LYFA 4HQ6A 3TOSA 2JGRA 1MNQA 1AGRA 1JSLA 4P4TA 4HPJB 2VZEA 3T54A 2V6JA 4GICA 2G8NA 1HTBA 3D8NA 4LV5B 2EKDA 1LDMA 1EB8A 2H1SA 1QVWA 2I80A 3NHMA 4DLYA 2ADFA 1FP1D 1WIWA 1U63A 1R8SA 4EBBA 3DXXA 3NO4A 2BAGA 3G0CA 2AKYA 3LUJA 1O89A 1TM1E 4KAAA 2Y1GA 4WBXC 3G2HA 4V1CI 5A3JA 2CVPA 3IE2A 1QO0A 1C3OB 3M8KA 3RFCA 1GU0A 4PLCA 1V9LA 1IZ9A 3S2UA 4CUZA 4F8YA 3C43A 3TVDA 5IH7A 2O8CB 5AI9A 5B7PA 2C3UA 3MINB 4BLPA 2HPAA 2ONJA 2D4AA 1SH7A 2QMOA 3DB1A 3A26A 1XT6A 4J9UE 1KP9A 2Z58A 2R11A 1AQIA 4PLPA 1TYCA 2R44A 3K0BA 4IHQA 5P8WA 5G0SA 1B3RA 4KN6A 5AVVA 4BFSA 3OOJA 4RTOA 3AVUA 5KNDD 4U8HA 1RMTA 4JEIA 3PDJA 3RAPR 4TKVB 1XDWA 1DC6A 4B3MB 3R7BA 4Z4GA 4GPD1 2AUNA 4D9KA 4AMVA 3VAZA 3OESA 1LBHA 3HBLA 3IHKA 4JIGA 4MUIA 1FOEB 4MMZB 3WK6A 2JVIA 5AW4A 3WL4A 3MBKA 1ZD4A 3KWMA 4C7JA 5K45A 3O75A 3Q9LA 2UYGA 4V0OA 3WLEA 5HTKA 1XPRA 1RLUA 2J9FB 2ZBEA 3BXFA 4FHGA 1JIQA 4U3JB 1ISJA 4ZVSA 2YXBA 4KYVA 3AQIA 4PPYA 3NANA 1L8LA 4U2GA 3KEGA 2R5WA 3T4EA 3JWEA 1VL2A 3DEHA 4LKOA 1B6SA 4EO9A 5CNIA 1NI4A 2Q45A 1NUHA 5AVKA 3SXUB 1FS6A 1QLJA 1KS2A 2C31A 4IZIA 4B9AA 1KH3A 1PJLA 1AKYA 2NN3C 1Y5RA 2XB2A 4FW8A 4ZV4A 3VZDA 4DMGA 1II9A 2XE6A 3ZDRA 1XLWA 4HY3A 1Z0JA 1GLVA 4FHZA 3OHPA 4XQCA 5HE8A 4EG8A 2R48A 4KQEA 1PNOA 3P5SA 4MP8A 1KAEA 3IV6A 5BNTA 4DPKA 2HK6A 3PDIB 2NU9A 5D3KA 2LP4Y 2QMUA 5JAIA 4BX3A 2ARKA 1ZIPA 2RGWA 3MINA 4JZYA 3H2IA 3LIIA 1CJBA 1B6TA 3H2SA 3WL7A 2VDRB 1LK7A 2NXJA 4FFDA 4L72A 4UKDA 4UBKA 5C5DA 2D7DA 1QZZA 1X7WA 3GUVA 1JQKA 2KE5A 4IIYA 2DBRA 2VN8A 3A70A 4L15A 2VS1A 4MVJA 3UK6A 1PT7A 2V7QA 1G8SA 6GPBA 5L4NA 1M7BA 3NPMA 1P3DA 3R0VA 4DDKA 1EWKA 5HM8A 3I37X 4PO9A 4WRRA 1MVNA 2ZT5A 1L5MA 3DZDA 3C8DA 3LT4A 2WILA 4RXMA 3VO9A 4F46A 4FIDA 1OLOA 4KJZA 2Q9CA 3KOYA 3TCNA 4RTLA 4DA6A 1RACA 2YCLA 2P9HA 3ZIUA 1YHYA 3WDKA 4KBGA 4UOZA 2D2FA 1LC0A 2XYPA 3B3AA 3WYEA 4POOA 5JAPA 3CNNA 3M33A 2NNWB 3JQ8A 2QZ4A 3FUVA 6REQA 3DMDA 1MFZA 2H1WA 4F2WA 4DBLE 2HGZA 4XPIA 1E2FA 3FFBA 4BNXA 4F1JA 5H9WA 3IPCA 4KXLA 3X1JA 2YL2A 4AM8A 1M2VB 4MKRA 5AXBA 4KN8A 4MW2A 2OCYC 3CUEF 2JIZA 1ZM4A 4U7TB 4EMSA 5IXSA 3HR4A 4QBIA 4PXAA 4A8JB 2WT8A 1FB5A 2HA4A 3GZNB 3RK0A 2VDWB 3KOMA 5HJ7A 2ZJ7A 3GDGA 2WV7A 4D6PA 5B2FA 5LNK6 2G76A 2JIMA 3ANTA 4IQGA 1COWA 5A6VA 5J4HA 1RP1A 1JXOA 5AJWA 2YZ2A 4WZAB 3K9GA 4QASA 3K0SA 1NVFA 1NWHA 4NENB 3QXHA 5I7HA 3K2IA 3K1AA 2XYHA 2HLDA 3C6BA 1NQTA 1A4UA 1N6HA 4TTQA 1R66A 4KXXA 5T67A 4OHPA 3OQNA 1MB4A 2J9YB 3W6ZA 4POAA 2AN3A 2P9GA 3DTYA 4G9GA 2VLIA 4NNJA 5COBA 1L1FA 1UAYA 4EMTA 4EO7A 1ANKA 1YAJA 2O8NA 4S1PA 1BCRB 1UFRA 4D92A 1JALA 1VBFA 5F12A 1U9IA 4UVHA 2CLMB 3H6HA 2PUEA 2GO7A 4K05A 3LLCA 3IP1A 4TPKA 1XRPA 1XLTC 5TNXA 4L08A 1N9ZA 3UA4A 4BCCA 5JQGA 1LGYA 4BNNA 4Z1MA 5ECWA 2OMKA 3EVBA 3HV2A 3GFFA 1Z4OA 2OG1A 3GD7A 3KZ1E 4M6WA 4Q1VA 3HJHA 5F7OA 3ER9A 5TXGA 2PPVA 3W4KA 4A6EA 3BGWA 1UP7A 1UMDB 1O0SA 1GUAA 1KR2A 1G7CA 2OT3B 3A2MA 3N53A 1YKFA 1JDJA 1RS0A 3RJMA 1JFSA 4LC1A 3F2VA 3PQ7A 2R60A 2CY0A 1A5BB 5GZ6A 1SD2A 1I7NA 4HOYA 4LJ5A 3TKAA 5DO9A 3TQHA 1G8PA 1WB4A 2OORC 3JVIA 3H5WA 1B8VA 4KPYA 2JFPA 1R4MB 2Y9MB 3A9RA 4NESA 3C3YA 2H17A 3BD8A 2OFXA 5D01A 5E9JA 2KHZA 1VKJA 2A7QA 1KMNA 2QLLA 2Y1LA 1EJ6A 1SK8A 1Q57A 3FOCA 3PD7A 2PSHA 1OU0A 4M0EA 5H16A 4DUPA 4IIGA 2F3SA 2HDOA 1DWPA 4RHUA 4GG1A 3UOGA 2WM2A 3V33A 1XZNA 4AVYA 3TLGB 2HDNB 5DLPA 5CB4F 2OO5C 2OKGA 4ZVKA 2GJ9A 1XCBA 1YQQA 2V7UA 1RQNA 1ST3A 5JEEA 1IBSA 1AS2A 3GLGA 1AO0A 1EGAA 4RESA 3OQOA 4EL5A 1VHTA 3LRTA 4KXMA 1ORHA 2W2LD 4J0QA 5BSRA 5IJXA 3RTEA 4MITA 1YUMA 4MUNA 1UXOA 2A0KA 2I6XA 3P9PA 3I2HA 4CF4A 4PF1A 1JFLA 1AKUA 4W7SA 4DQXA 3U6KA 4FFVA 2QW8A 3HCFA 5A06A 1C30B 1EGHA 2V9PA 3PJFA 4RVDA 5CT9A 5TJ9A 1AHNA 1E4OA 1X1TA 1T8SA 2C4UA 2FFBA 2VWHA 1EGVB 5E1OA 5AI0A 1I32A 5MN4A 3CG4A 1IDN1 4CLOA 5KNBA 1RT9A 3MWDB 1E2PA 3IAS6 1OA1A 4IGAA 3T0IA 2ERCA 1TUIA 3GZNA 4KHZA 1GTL1 5BNWA 4A8JA 1XAJA 5DM4A 3A10A 4CMEC 4MQFA 1IJEA 2VUSA 2ZYAA 3E9ZA 3GMDA 5LDGA 4HC4A 4U02A 2AOVA 1M76A 4K6FA 1GNQA 3A2NA 4BWGA 4JJKA 5ENDA 4C0HA 2RB4A 1IG3A 1O5OA 3W4IA 3LHSA 4XR4A 1ZK3A 1GHTA 1PZXA 1NG1A 3Q2OA 5DHQA 2V59A 3URKA 5HW0A 2ILTA 3HA3A 1F2VA 4IVPA 4EB0A 5TQ0A 2ZAIA 1BJTA 4KUGA 7GPBA 4JK3A 2ID9A 4F96A 2IH4A 2CHVA 3ANMA 3C1OA 1RHRA 1N77A 3OPYI 1F8GA 4PRYA 1FFSA 4CDGA 2WJVA 3FOBA 2Y1FA 3PPYA 4FONA 5I4KA 4J8PA 1E1MA 3EEFA 1C0KA 2O57A 3VJMA 1VJTA 2PE5A 2C5HA 2ZSHA 4ZIRA 4IMIB 4ZQGA 2OAQ1 3EFHA 1S01A 2Z3ZA 4MUYA 4TWJA 4Y30A 5AW7A 4BNMA 4TTSA 1TC2A 3NBYC 4UBNA 1F2TA 2RGRA 5B1YA 4ENTA 4HQNA 1AKVA 4B82A 1YIAA 2WBLC 4LXIA 4PANA 5A1JA 1XD2A 3OO0A 4ESVA 2R47A 3UMBA 4YAKA 4RGBA 2ZZMA 3J7TA 4JMPA 1E1RD 4B80A 3L6CA 5DLDA 5GADl 5GM2A 5BN3A 4V03A 2JA2A 4WN3A 5C81A 3VPHA 4BUZA 4UFPA 5I5EA 3EXFA 1M2WA 2PBZA 3VVLA 1DCTA 2V4ZA 2FSSA 3I9NA 4M98A 5TDHA 1NJ1A 3WGUA 3HR8A 2Q7DA 2F1OA 3OH8A 3UK7A 3VR6D 3Q41A 3VR4H 4ME6A 1K9VF 4C0AC 3MRTA 4N8SA 2OBLA 3D7LA 1J8QA 3AJ9A 3V1TC 4R1OA 1V8PA 9GPBA 4MI1A 1QQ6A 2GERA 3FTDA 3STTA 1J97A 1SZDA 1XU9A 2VDPB 5B2ZA 2IYNA 2GZDA 5DTRA 2VTBA 1OLUA 3QYJA 2IDZA 1T6BY 1SVNA 3JARA 1NYQA 3GJ0A 4PS1A 3DMRA 1VL1A 2QM0A 5DM2A 4DBVO 3FETA 4BNZA 2V7TA 1MFPA 4I3GA 3THRA 4D96A 3J81k 3HEBA 1FNBA 2ODPA 3WK5A 4BKRA 2NZ2A 3ZD6A 4BL5A 3TIGA 2F7SA 1RYMA 1GLGA 4WFIA 5I3CA 1PDWA 3AESB 4XFKA 4CKCB 1E4VA 3B5JA 4W82A 3I5XA 4RSMA 1OLXA 3OA0A 3I0MA 4RA6B 4AULA 4LF9B 1QGZA 2L82A 1P8AA 4AMZA 4AS1A 1O4WA 3KWJA 1Z18A 3F7OA 4G4SO 5CM8B 4CQMA 3RUPA 2V7WA 3WGOA 4IICA 5ANRB 4EEXA 4UD6A 4YAOA 1U7DA 4BO5A 1KPHA 4MTLA 3MYYA 1G4AE 2BGJA 4OKNA 1V5IA 3LECA 4KKXB 4J03A 3RBZA 1GTSA 3ASVA 4F84A 1L5SA 2JCXA 1L4NA 1U6IA 1SQFA 2Y4NA 3KV1A 2D2EA 3BMNA 5K8VA 1HX7A 1XNGA 4QPPA 5H68A 3N2IA 5ICCA 5K4GA 3PDWA 1EWVA 1UM9B 5DJ5A 2HKIA 4ZDKA 2ZS9A 2J67A 2ZANA 2ZR7A 4HSEA 5GONB 2OCGA 4TM8A 2GETA 5I01A 1ZN9A 4LOLA 1ZYUA 4B4KA 1E1LA 1GTVA 1EUCB 3LRXA 2FW9A 3G2QA 4U7WA 2ACKA 1F06A 2AQKA 2G09A 5KOJA 2OG2A 3U3KA 3VKWA 1JHVA 4BBZA 2DB3A 3PQ4A 4R69A 3UHOA 5JSHA 5JSZA 5J2TB 4QDXA 4I6GA 1YO6A 5BPFA 4KN5A 1U8YA 5AT1A 4OFXA 1JYSA 3MJ4A 2RHWA 3PT5A 1ZBQA 2X9QA 3G0HA 1OH8A 1ZL2A 1MAUA 3RUFA 1MR3F 1YUNA 3HP4A 3VVMA 2WSSD 3ODPA 2WAAA 3UN1A 5FV4A 1DT3A 1P0MA 1WS6A 2PLNA 4UM7A 3U62A 4EB6B 5CDUA 1MZPA 1RXSA 3JQAD 3H16A 4UATA 2F3PA 5J2UB 4RWEA 4CM8A 4F9GA 2O0JA 3PNOA 4D99A 1WBBA 1NJSA 3BX1A 4I55F 3CJRA 3D64A 4M7PA 5IAOA 3OZAA 2UZAA 3BPSA 2ZB8A 3QFRA 5HFNA 3ER8A 5T4BA 5CXQA 1E3SA 1DQNA 3ZE9A 5AW0A 2HU5A 4AUMA 4C76A 2W9XA 2CK3A 1M8JA 3OCVA 4BGVA 2DWCA 2MTBA 4L8LA 4XI9A 2VHJA 1QH8A 1FUUA 1JN0A 3GU3A 4HXGA 2PS9A 4TV9B 4X5OA 1EXVA 4I1IA 3U5ZB 3D3KA 2Z2KA 3GPIA 3BWBA 3LVRE 4UTNA 2PH1A 1IUPA 4EFDA 1J2RA 5IAAA 5ECDA 5K8LA 3G13A 2V7QD 2ZI3A 5CHEA 2OHXA 5ER9A 4B46A 3PXGA 3M83A 4B48A 4KR3A 5JW6A 1AB6A 2GGSA 4AWXA 4UD2A 1RWMA 3RTGA 1Z0SA 2VPXA 5F3RA 3R3SA 1A0OA 1L7EA 1F3OA 3IDSA 3MJVA 1OFUA 3ZIDA 2IYPA 3X44A 3PV0A 1PAUA 2LE0A 2OXEA 4W6ZA 5EPUA 1ID1A 4YJ3A 2ZR9A 3X2EA 3ZZ0A 3R77A 4CM9D 4Q48A 3RUIA 2XUKA 3TPFA 1DC7A 2GN6A 1LF5A 1ECJA 3O94A 1XD8A 1SXIA 3OQJA 2GCEA 4NFLA 3IIMA 5EJFA 3LHKA 3CLSD 5KSWB 2O3QA 4B3DA 1R64A 4M89A 3NGLA 2VNIA 2ZBPA 3KP1A 4CIXA 4BJ5A 2JLWA 1K97A 3QKIA 2GZ1A 4IIXA 5FDFA 2PUDA 3A05A 4PLTA 5E8JA 4ML3A 4N3BA 5CVJA 4X7PA 4GIBA 2JGKA 4PW0A 3BB1A 4GL2A 3TSAA 4FDMA 1C9JA 1CY7A 3GCZA 3H5TA 3BL8A 3WJ2A 5HE9A 1HDGO 2I33A 3I9FA 3VJLA 4Z2AA 5HK9A 3IAS1 2FX5A 1SQ5A 1J42A 3IEXA 2JGLA 4WQMA 1UJMA 5LQDA 4XWTA 1P80A 2EFYA 2J5QA 5F5XA 2NXEA 3K1YA 1QUEA 4K81B 5DPMA 4R98A 1Z73A 1KOJA 5ERGB 1QFXA 3F9CA 4G9BA 1RYHA 5MN5A 3LHIA 3VHQA 3KEFA 1RWKA 5FPSA 1XKTA 3L0ZA 1XELA 1KEKA 1OX4B 2FG7C 4KXWA 4J94A 3F5SA 1FDWA 4GD3Q 1FYEA 2WMNB 1B6RA 2ZRQA 3ND8A 4FZ3A 4HWTA 2QX8A 3VH4A 3HABA 1KZ4A 1U0GA 2P68A 3N8GA 4RVCA 5EJMA 2P2SA 3KXDA 2P77A 4RK6A 3G7UA 5TRTA 2GN8A 5FI3A 4Y2SA 1Z07A 4EI7A 1MDFA 3HCEA 2WTEA 2BGGA 3BMOB 1GZHB 3BFJA 3VHLB 2W8BB 3PWZA 1JSZA 3EZ7A 5ED4A 4UM9B 2QP4A 2YS6A 4R8SA 2BFDA 3PRKE 2QT0A 3IV9A 4WWHA 3LPDA 5KYYB 5D3MB 3ASZA 2HCJB 5F78A 1BX1A 1YU9A 3G7SA 2PL3A 2NO0A 1NGSA 4TQ9A 2FX2A 5ICEA 4M0CA 3FUUA 4XYEA 1THTA 5LWHA 3CW2A 3LK7A 1Y0BA 1OYYA 3ITKA 5HVNA 1W5AA 1EWRA 1X9GA 4KYTA 1XZGA 4KQFA 1YVPA 1PRYA 3BGDA 3D4IA 4XVQA 2ZCJA 2I34A 5CFMA 4KHPB 4Z54A 1SOVA 1JEDA 4M1TA 5IW8A 2R8RA 4KK3A 4RELA 1BWQA 1FYFA 1X1RA 2HHHB 3AK4A 3WKCA 1G42A 1LS6A 4X44A 3S5UA 2BGRA 4FOTA 5TGZA 4R4JA 5E6RB 4NK4A 2NO1A 2QYSA 5JEDA 1AUXA 5JZSA 2IBSA 3CSSA 3OWHA 4AN4A 2IY7A 5FUBA 4JN6B 3O9VA 2Q3EA 2VZ0A 1Q2UA 4MZDA 5EQJB 2FVXA 2QTZA 3L84A 5IARA 2UXBB 3U1VA 5P21A 2ZS7A 2C77A 2FEWB 4U4AA 4EQZA 1ZGZA 1EFHA 3R5JA 3UJBA 4DWOA 2FB9A 3DAHA 3A1WA 3S2FA 4JKYA 4J2HA 3ZDCA 4DR1B 4J0IA 1E2UA 4QUHA 2X4GA 2PBLA 2IHZA 3FKSD 1BN7A 1U99A 1O95A 2QYOA 5GOTA 4U7DA 3EFBA 3G8CA 1DBWA 4MW0A 5KQRA 5C1PA 1QIJA 5LR6A 4GYKA 4KQIA 5FO1A 5KO2A 4RLFA 4WA7A 1DBQA 3IBCA 2H0QA 3ZDXB 5A4IS 1OLSA 1PLJA 2I1WA 2ZUDA 1JQJC 4OP2A 4WERA 3G6KA 3OCXA 1JU3A 1OREA 4N1AA 2RARA 5SZHB 4F3YA 5I3ZA 1OKKA 2MYTA 4FCWA 4IFBA 3MAGA 4LVCA 4NYMQ 4X3CA 2YS7A 2PKEA 4R1LA 3SJCA 4ARAA 1E2QA 5JBIA 2VJMA 4TMFA 1YR9A 4N6OA 4CLXA 3I9V1 1T24A 2ZYIA 4DSOA 5LBTA 4DLXA 4HX5A 3KALA 3B5EA 1OFIA 1SWVA 3W78A 3OHSX 2RONA 3ANYB 1Z3IX 3QYAA 2RFLA 1NOIA 3MWEB 3R6WA 1W581 4CCYA 3UOWA 3OLQA 5AHWA 1R8QA 3QMWA 3TOVA 2XUOA 3UKOA 2VL7A 4EF6A 4IQ4A 1T3LA 4ZYTA 1AKQA 1GIAA 1UK7A 2IDKA 3WIOA 4EKYA 5FAKA 4MICA 4FGSA 1D0SA 4MUXA 3PQCA 4JJAA 2ZWPA 4E1VA 3T12A 3FROA 4IDOA 5ICFA 3UY4A 1NBMA 4B47A 5TQ2B 2AC4A 4REQA 4TTIA 3G6WA 4AN0A 4DNQA 1QR6A 4FR5A 1OCEA 1A7KA 1WEHA 4H3HB 5T4HA 2BTQB 4M6WB 3T99A 3JR3A 3FNGA 5JQGB 1YBFA 5KPDA 3RHZA 2HB6A 2NZXA 4UZEA 4WEQA 1RBMA 2IELA 5DN6A 4BFLA 4YP9A 3DO6A 4MV5A 1VKNA 1H2RS 5TT1A 3EVNA 3EQ8A 3KL4A 1DC3A 3DULA 3B38A 4B74A 1CUXA 1N2CE 2J1LA 2NAPA 2WWFA 1FFHA 2G82A 3HJCA 4IXNA 1PEYA 4WN9A 1OGJA 2GBLA 4R68A 1DCMA 4G5XA 4RHYA 4TV9F 3KJQA 4TWIA 4EHAA 4QWWA 5C1BA 2GPJA 2VF8A 3QLVA 1JG2A 1KU6A 2R86A 3ZY4A 2NUTA 2OAEA 3D6JA 1PP4A 3KLNA 3PC2A 4J29A 3HXMA 1HQCA 1YOVB 4CIYA 1BDIA 1P60A 2QY9A 4E08A 2D1TA 1NHGA 2GA9A 3L7DA 2MU1A 3A14A 4HFNA 2O6HA 2P6MA 1Z2OX 3V7UA 2WVAA 1XQXA 1QMPA 2OGUA 3U44B 5JOQA 1X1SA 3UJHA 1F60A 1RRPA 1Q1EA 1W87A 2Q99A 5EHQA 3REQB 1R8YA 1II8A 2K2WA 5HKBA 5D3MA 3MXOA 5LJLA 5DZSA 4P3XA 5HHTA 2WWHA 4C7OB 2AL7A 5AKHA 1E1NA 3L49A 1ONBA 2DWUA 1M6EX 5K3DA 3AW8A 3AF2A 3C5EA 1NKTA 2JCYA 5JCXA 4KW7A 3IQWA 1U7OA 1E79A 1WB6A 4YJGA 5LBIA 3IA2A 2PKQP 3JPWA 2Z6AA 1FP4A 2OO3A 2YJ5A 1GO2A 3GN2A 4V3BA 4LVOA 1C9NA 2B82A 3MJDA 3A36A 3PXDA 4AG5A 1KSHA 3SF8B 1JQLB 2HEGA 3QTLA 3V7WA 3DTVB 3W5BA 3AR3A 3HEAA 3KD3A 4A8HA 4QPCA 2A1TR 3O8OB 5EJAA 1YJBA 1W35A 3H9BA 4DWJA 4FJ2A 4BFXA 4BNIA 2FP3A 4JLKA 4KUHA 1CR1A 3QVOA 4PC7A 1CLEA 4J6EA 4JFAA 1TB4A 2X4LA 4AKEA 2FR0A 4RL4A 3ZBQA 5KYVA 1J2JA 1TVEA 1FBNA 2POQX 4KO3S 2Q5IA 4YRLA 3T6KA 5GTDA 3HO1A 1BMQA 4D25A 1ISPA 2B1RA 4ZYLA 1R5OA 2EWWA 4PPFA 1SUIA 3D3JA 1D6MA 5FUQA 1Z8FA 3MYRA 1WD7A 1LZKA 4NICA 4D74A 1R4ZA 3RO7A 3N2KA 2J87A 1CZKA 3F6RA 4LI3X 3UPUA 4CQMB 1P5FA 3FLAA 2B6HA 4GF5A 3WP0A 4ASUA 2AYXA 2OCKA 3IMGA 3QX8A 5EJ6A 3C3MA 5LC1A 1B6GA 2VXBA 4KXVA 4P4NA 3SU8A 1PFKA 5C4GB 1KY5A 3HJRA 5DLQC 1PJZA 3HBAA 4WUTA 4O3FA 4CJXA 2K2QB 2OZVA 3ZE2B 2VJNA 2JL1A 4URVR 3QLJA 2EKPA 4X1IB 2AG8A 4RZ2A 1VA5A 2QV0A 5DNWA 1XJWA 4PYIA 1NKSA 2ZAOA 2ZXFA 3EXIA 3L05A 3MJHA 4XRGA 4YT2A 3COZA 4TTTS 2FMKA 1I1OA 5ILGA 2HXGA 4V0MA 2C0QA 3I2GA 3ACDA 3UK0A 3G2KA 3RYCA 3UT5B 2ZQYA 4OH1A 4B3JA 5LZ5A 2IOQA 3COYA 1G5HA 1XP5A 3OMLA 2H2FA 3CC8A 3GUHA 2Z83A 3WGYA 3F6PA 3I9MA 1W8IA 2HM7A 3X0DA 3G1WA 3B7GA 1HK7A 2E18A 4E32A 1T26A 1KU0A 4FDTA 3WGTA 4PYOA 4MV1A 3DTVA 1ZGGA 2X0IA 2VT6A 3FMIA 4P4UA 1LTKA 5IP5A 3QVXA 1CIPA 4G1CA 1CRWG 1ZY2A 1MJGM 2PGXA 3BGSA 5AHOA 3V8BA 1FP4B 3O31A 2WQ7A 2QTHA 4UDYX 3F49S 1GUDA 1IPFA 3AERA 3JVUA 4NYJQ 4PGHA 1I1NA 4J0EA 4U0JA 1TEZA 4JLOA 2QRPA 2PJDA 2W71A 5IYZA 1ZG3A 1DVRA 1F2UB 1E9AA 2FG6C 2RHDA 3TINA 3H0KA 1F4PA 3LQYA 2PZMA 5HZHA 3IVRA 4P53A 5DI9A 4R31A 4BQRA 1I8TA 1EM8B 1H6BA 4RIFA 4XEHA 3GEPA 4HP8A 1CY0A 4ZHQF 2QE7A 3V8PA 1C1DA 1R6XA 2QN3A 2D8MA 1V16A 3GLRA 5DULA 1B42A 3V32A 3KL2A 2GUWA 1KMCA 2IOHA 3BAZA 3WLAA 4PQFA 4CTOA 1U0OC 1ZL0A 4DMUB 2JGAA 3SK0A 1CEQA 5CURA 2RC5A 3FX2A 3OF2A 4XWYA 4MVJD 1KDRA 2YV5A 2MMCA 1VP3A 3GL9A 4PCAA 2FZEA 1NBME 1TPZA 3N2GA 4OSPA 3RJ9A 3TAHA 1J1UA 1G20B 2J9XB 2RI1A 2I4NA 1WSAA 4OXQA 3MMXA 5EIXA 2WU8A 2IEBA 3MMSA 3KOUA 3VR1A 3E03A 2VHXA 1U3WA 5AICA 3GEEA 5HF8A 1FSPA 1GPMA 4NOMA 3VXKA 2PUBA 2BHTA 4PAWA 4CKXA 1UM9A 4C0WA 3GA5A 4OQFA 3L01A 3NWEA 4EHKA 3TIXB 2Q1XA 4B4VA 1RM3A 2OHHA 2AXEA 5CM2Z 5LQNA 4MQFB 4RYLA 1KHHA 1IH8A 1Z6XA 4K9DA 1F1BA 1V1MA 2ZUUA 5ALKA 1F48A 4QQNA 4X84A 5BWCA 3SYLA 1XLTA 3K8OE 2H1FA 1LDEA 3PNYA 3DOUA 3CUSA 2IPXA 1PIWA 4JBYA 4KIWA 4ALMA 4B6JA 5K3FA 3HSYA 3PJEA 3PNLA 1L4KA 3DDWA 3D4LA 1XVAA 2MSKA 3OF5A 4XGIA 3EGDA 1KOFA 4N40A 3NT2A 3QBDA 3SBOA 3PRHA 4BTLA 2JHAA 3IA7A 2NUPA 2Q9BA 3UW1A 4W8OA 2BJHA 5CB6A 2HPHA 4P92A 5DP1A 3PFGA 1QF9A 4RM2A 3EVTA 3HFRA 3L1IA 3LFTA 3SX4A 4RK1A 1U8AA 3H1EA 3LRPA 1GGVA 1E8DA 1NBHA 1PFGA 2Q7OE 1Q21A 1GGNA 1C7FA 1T2AA 2NO7A 4N8DA 4RTMA 4CEIB 1CZUA 4MEBA 2IP4A 3K4PA 1UPCA 4GOKA 3RAJA 4G6ZA 5KSPA 3ZVLA 4DIEA 3OM0A 1VPEA 4ECEA 1CRZA 1KORA 4Q47A 1JA0A 3Q7RA 1VHJA 3RBAA 2QPOA 3EIQA 1GPAA 3OZIA 1LVUA 3RKRA 2OXRA 2G8LA 3KOOA 4ZOEA 3M4YA 4F97A 1OH7A 1CR4A 4PFSA 2ZSBA 3D2CA 1N7JA 2I62A 1F38A 3LDGA 3RQSA 4EPYA 4NLLA 2RH5A 1ESMA 3HCCA 4RY2A 2JAWA 4ND8A 3RYFA 3R0QA 3B1FA 3CCFA 3IUSA 4PXYA 4U8GA 1NR5A 1T4BA 5BYJA 5ARBA 3PTAA 2XXAB 5HQ3A 1R37A 1KDOA 3PEFA 2PRZA 4FE7A 1TVKA 3TSOA 1WP9A 4REOA 4HNVA 9LDBA 721PA 2J3MA 3NHWA 3LQQA 2A84A 3U09A 3AR6A 4HR7A 4X3OA 1M8GA 4Q3NA 3EXHA 3WLHA 2FPIA 2O54A 4JI8B 5MDHA 5I7FA 3O90A 1ZLXA 2Y4OA 1J2TA 4HLNA 4RHFA 4BQEA 2PHZA 2GT1A 3FYUB 1O58A 3OUTA 3NKLA 1ZZEA 5AVUA 4PBSA 1FNMA 3TJMA 1NSYA 4ZQEA 2X42A 2OQ2A 1Z8HA 2C97A 1X0VA 2HA6A 3BICA 1GDTA 3BFXA 4IIVA 2X8LA 2AMFA 3TNDA 4RWZA 1DXHA 2OSBA 4FZRA 4GSKA 5H1YA 4CM7A 3CVUA 1KTIA 1NJ6A 3CF4A 3GMTA 5K0LA 1NMQA 5AJVB 2XOXA 4PZEA 3OUUA 5CVDA 1V7QA 4C4RA 1RAGA 1DX4A 4FBGA 4EELA 5C8XA 4DSAA 1NVWQ 2LCIA 4YRIA 5DBFA 3C1TA 4KQ6A 5LP1A 1KHTA 2HO5A 1QQ7A 5CRIA 3U1TA 3ELUA 3RYTC 3KUXA 1RM4A 3EY9A 4PC1A 4KOEC 1GR0A 3ANLA 3V1MA 3CLSC 3B6JA 5HIMA 2I03A 3REQA 5IAEA 3RLIA 3FDIA 4E07A 4IZOA 3BWVA 5AJZA 1NUUA 4L3OA 1UOQA 1UMKA 2WQZA 5E4YA 1GEGA 4Q39A 1I3CA 1FRNA 1V47A 3D4PA 1GAEO 1A8HA 4GI7A 1JJIA 2Q6KA 2ODWA 2P2NA 2XVMA 5DSXA 5LZ8A 3C3WA 5BN1A 4CT4B 4OHVA 4YJKA 2V6GA 4C21A 1VI2A 3U60B 4B76A 1JJ7A 4FOLA 3RVDA 3JYHA 5LL6P 1IZ0A 2ZT8A 4S12A 4GI2A 2WZCA 3F73A 1Y8QB 3I73A 1YBAA 4EI2A 2RHOA 3CFYA 3MSXA 1YRBA 2FPRA 4IHKA 2B8JA 3WWOA 1QYXA 4F56A 5LXTF 1D1QA 4UMDA 4EA7A 4LHSA 1Y9JA 2IHVA 2IH5A 4TSRA 4Q9AA 4QOJA 3ABQB 3OZEA 2H0AA 3U3OA 4AAYA 3H84A 1T15A 2JASA 4MRVA 1DJQA 5EMLA 1VRWA 2JATA 2Y1KA 4B6FA 5CLFA 2QLBA 1BDMA 3A8TA 4YCDA 2BHSA 2XDAA 3AIIA 1HETA 3CB4A 4KIJA 2CCGA 4UTOA 4A4DA 5K8JB 4C6TB 1T2CA 4RTKA 4DXHA 1W5FA 1JAIA 1Z75A 3OJXA 4YAJA 1TT7A 5E3HA 4DCOA 4MKIA 1TNDA 1H69A 1SIWA 3VTKA 4P3PA 1IU9A 1T9KA 3OT5A 1VI5A 3IUBA 3QE0A 5KQGA 3ZOZA 4J4BA 1J6UA 5IRCD 2WZQA 4M1MA 2XD9A 3GNTA 4D3XA 4UUMA 3BTOA 1CK4A 3E84A 4BB9A 2VYNA 2DR0A 4R7ZA 1MAHA 1H85A 1V25A 1XYYA 1VL8A 5AXCA 3RR2A 1THMA 4KLNA 2IYAA 2JDIA 2A0YA 3OOWA 1L3IA 2ZS8A 4WXMA 2BRUC 2V8BA 3EAGA 1RIFA 4L28A 4YP5A 1Z45A 2FEPA 1IEXA 4S1NA 1X3SA 3RVPA 2H4HA 2PKWA 2ATEA 2XRMA 2YBEA 4JBWA 1GPKA 4DNXA 1U8UA 2B69A 4ZI7A 1UWKA 2LPMA 2CUTA 3B3JA 3PE3A 3WSVA 4GX2A 3ZWAA 3ZCPA 3B6EA 2QW0X 1J22A 4YYZA 2J46A 4HZUA 1QDUA 2DHQA 1YZUA 3GZTB 3QNWA 3CCCA 4UXHA 3QE4A 4BMCA 2FMIA 1W59A 3PDUA 2BRUA 4RKWA 3MUOA 3KLOA 3H65A 3OI7A 5BSUA 1ZK4A 4A1FA 3EUEA 3UV7A 2NV0A 3F7TA 1OUMA 1A9ZA 3EGDB 4PLHA 3W8DA 5LIRA 2WD7B 3T15A 1PQWA 2V98A 4OQZA 1QFYA 3VSDA 3K1AB 1RKQA 3EIWA 2VJLA 4ZI3A 3N0XA 3LL7A 1RPZA 1PT6A 5K3FB 1W1WA 3H8JA 4GPEA 4KIUA 2DPGA 4KKVA 1PZMA 3JZFA 4QUBA 2EP8A 1T1JA 2A5LA 1OAOA 1E94E 1N2IA 3C4QA 3CLRD 1P1JA 3B6MA 3BG5A 1TOAA 4N7MA 3ECCA 2QT9A 1EWQA 3DAYA 2JLYA 1Z3CA 3FB4A 1WY7A 2FLWA 3NTUA 5IC5A 1OYWA 5AQ1A 2V3CC 3PI7A 3DG9A 3IBYA 3UBTA 1AUPA 1Q0HA 1P4JA 3ADKA 5EKUA 1ARZA 2PZKA 4ZAZA 3UJDA 1IZ8A 3WLQA 5AW2A 3L8MA 3V55A 1IWBB 2W98A 3VAYA 3O91A 4JP8A 2A9RA 2XCSB 2C7QA 4C05A 1NF3A 5G02A 3LO5A 1RAHA 2EFDB 2Y93A 1BQ4A 1SU4A 2XB8A 3QSGA 4D4HA 2IX3A 1YMQA 3B52X 3DAOA 3EPPA 3VMFA 1VTKA 4ZJYA 4FEYA 4X7BA 1TDJA 2F1IA 2WM8A 4BYGA 2YJGA 2H7XA 3B89A 4QHSA 1WTCA 1D4OA 4ILEA 2E4AA 2ZSJA 1OXVA 3IALA 3FGNA 3VDMA 1Y6FA 4P34A 5BSTA 1E2HA 1W7AA 1IVSA 1E3WB 1X87A 2QSUA 4WXHA 3IAAA 1W4LA 5EIFA 1Q6YA 4ZXPA 3KKPA 3NPAA 2DKOA 1RPNA 2QUAA 4LKRA 4A73A 4BMXA 5CFLA 3UGKA 5KYYA 3ONEA 3TYXA 4CXMA 1EM8A 1XN4A 4G4GA 4NBRA 3BMNB 4GLBA 3K6SA 1SD5A 1X77A 3PHIA 4AIIA 1K6MA 3FN4A 2P9YA 1XKLA 4BQQA 3KELA 3RYHA 1JU9A 3N05A 3NHJA 5T8KC 3TG2A 2ZSFA 3PUKA 3ZK8A 1BIFA 4XVUA 3IKMB 1XALA 1WG8A 2UUOA 1SKBA 1NJFA 3LO8A 4HGZA 4UJ3A 3T7RA 4TV8A 1I4OA 4G5FA 3SQNA 3DS8A 3OE4A 3C98A 1EWTA 4I9UA 4ESOA 4EL0A 5FH9A 3ZX5A 2XBMA 3G9UA 1AZWA 1R00A 3QK7A 2XNSA 4EYSA 5UKDA 4N39A 1U7HA 3R7WA 2HA5A 3ZHSA 4CUJA 4DHWA 3HNRA 2XQFA 3JD0A 3N7TA 4AF7A 5AUOB 1ZZGA 1VIDA 2Z3VA 5B4UA 3FYUC 4I55A 3GV0A 4NBWA 4KV7A 5AOBA 4ZK6A 1RKBA 3KX2A 4ALIA 3NGXA 4EFKA 4R71A 1HEYA 2WDZA 4OMDA 4W1PA 1IZ7A 1QPBA 1WHTA 1SVIA 3AM5A 4YRRA 4F1WA 3NYIA 4YI5A 1NXWA 3BZBA 3NHFA 2LKCA 3WRWA 3OIYA 4MLCA 1U0EA 2QPAA 4QYXA 4ZJPA 3OKAA 2OYSA 4PWZA 2C5EA 3MEQA 2G7MC 2Q3DA 1Q5PA 3AZPA 4C4PA 1R7RA 4NMHA 1VSBA 1MB3A 3QYPA 4E5UA 3U3MA 1TEXA 3KFVA 2CWWA 2PMEA 1N5RA 3REFA 5JAZA 1IEWA 3SHFA 4M76B 2WC1A 4G81A 4MHSA 2HSJA 3H42B 4NZZA 1D09A 1NM5A 5FBKA 1M5UA 4IG4A 2OHFA 3WNBA 2UU9B 1ZVQA 2H08A 1Z4MA 4DEVA 3GPCA 2BI8A 3BIXA 3G9TA 4AJ4A 4F72A 1BH2A 5KTYA 1YCGA 3IIEA 2PJRA 1SAYA 1A4IA 3GG2A 4FE4A 2BVNA 3C41J 1P0FA 4GSLA 4L74A 1H4TA 4MO9A 5GVSA 3BDIA 4P83A 1A98A 3WL3A 4NU5A 4JOSA 3HPQA 2H1HA 3MGAA 4MRPA 4DIBA 1J2EA 1DG9A 2FSHA 5F9FA 1WUTA 3BHMA 3KEMA 1WWKA 7ABPA 1T36B 5JXWA 3RS8A 1ISHA 1E0JA 1GPLA 1FLDA 1T9DA 1E89A 1RXYA 1ZN7A 3I12A 3AEXA 3I2FA 2Z9CA 3OX2A 4QRHA 4WLUA 4AI6A 5HSGA 4CTJA 2NXNA 3IQEA 4Y1RA 3TI7A 1BG6A 2IP2A 1G2PA 3IAHA 1NBAA 1JAXA 1NDUA 3HDYA 3NASA 4G1MB 3ZD9A 2QAIA 3FIUA 3QPUA 4P31A 4PQRA 4ZQBA 4FLFA 1YQDA 3WGQA 4OYYA 2WHXA 3AP1A 2F43A 1YTLA 2AJBA 3GQBB 4XARA 5KINB 1AMOA 4QUIA 1RZUA 1XMPA 1NLFA 1C3JA 2HRZA 3FPLA 3KUCA 4IXWA 3UG7A 1FZQA 2P7HA 4JB2A 2R85A 4XDZA 5AVWA 1TC1A 1LDGA 3EDYA 3IEUA 2FMTA 3FPCA 3JWIA 3OTHA 4XGNA 1H4SA 3Q9UA 1W0JA 4A0GA 3UMYA 5TPZA 4K3VA 5LA6A 4YREA 1TYZA 3A1EA 3QU2A 4ZIRB 2D1QA 2G71A 2JKVA 3FGZA 1VSTA 2EHJA 5DNYB 1DRWA 1G8MA 2IUFA 1S2MA 3WHIA 4I3HA 4KB5A 1LK5A 3KQWA 1WB5A 2PZJA 4LC0A 1YK0A 3RABA 2BUCA 1T1RA 2NU6A 4Q1EA 1ZM2A 3T9BA 4YRKA 3U61B 1N34B 4J3FA 4OLJA 4Y6LA 3AG6A 1Y80A 2H51A 2PR2A 2PSFA 3OZUA 4XOIA 1W1IA 2XEDA 3FR7A 4AB1A 4DLKA 3PE6A 4D8YA 3DF7A 4HDNA 3UV3A 4D46A 2G0TA 4RVFA 1EBUA 4TWRA 1Z7BA 2HLNA 4Q16A 4YACA 1PK8A 1QHYA 1Z6AA 3D7NA 4I4TA 1D8AA 3FF4A 2OO7A 4G1VA 1K3FA 3X1ZA 2ONCA 2BFCA 3Q7SA 4DDVA 2FZLA 3RB8A 5KTMA 2NW6A 4K6GA 5BOSB 2VA9A 5C80A 2P2DA 2PV7A 3C6XA 4DNOA 4E4RA 1LSSA 4RENA 1ORRA 2VDLB 1A76A 4YLYA 3VSBA 1W48A 3A6ZA 3EQ6A 5K3CA 3O8RA 5JXGA 4DUZB 2ZE8A 3LPLA 3TMKA 3VISA 4A15A 2V6BA 1OC4A 1B93A 4KYUA 4KH1A 5ES3A 4D45A 2YR0A 1T0BA 4OB7A 1A95A 1PSZA 3NH9A 5SY9A 4BZWA 4IPTA 4BP1A 3QIVA 1VRVA 3JARB 2Z4TA 5JWRA 1PEDA 4G5QA 1ZJZA 4I4TF 4K26A 1P29A 2JLBA 1GEEA 2NU7A 2G72A 2N42A 3VKFA 3CW9A 2JGNA 1UT5A 2VHZA 4S1WA 2HH9A 2L2QA 3BWEA 5CT5A 2WFLA 4D4IA 4LF4B 1M73E 4AF6A 3P4XA 2FF7A 4XGRA 4YAGA 3LP8A 3T1OA 4Q1AA 1M1NB 1QCYA 3C4JA 2OWEA 4WK4B 5INTA 2XF8A 4YMLA 2QGFA 2WA1A 1XDUA 1YQGA 3UYKA 2X2OA 2GRJA 3BL6A 4YEDA 2OILA 3V8QA 3FVQA 2QROA 2BMFA 1UBGA 1E5DA 5C5IA 2PR7A 1ZISA 3UM9A 5AUPB 2VJKA 3A6GA 4N5MA 4C0BA 3IDOA 3MQ4A 5EMHA 4EHNA 4FZ5A 5HRUA 1C7EA 2PU7A 3QLUC 4PPGA 3HXLA 4XXHA 2VAPA 2VEDA 2QJOA 3NWOA 4MP3A 4OQPA 4OFWA 2I66A 4C07A 4CQMD 1R4AA 3EBOA 3L1HA 3ZN2A 1ODJA 3A1FA 1O3YA 3LWZA 3IQGX 3OLZA 4HHEA 5L3QB 1M6VB 3L6BA 4KCGA 2HRQA 4LCBA 4BEVA 4QOSA 1Q1GA 4JD5A 4NS4A 3IGFA 1JB1A 1PVVA 1PNVA 4TMXA 3E9NA 2O1XA 3HY4A 3I3OA 1BMFA 4YR7A 3IKVA 1ZOPA 4KZKA 4H7FA 2X3FA 1PJ2A 1FRQA 5ALQA 5H9VA 1KZ6A 1FFWA 2WB4A 1J0DA 2WVJA 2QK4A 5FULA 1D4FA 1JYFA 2LCFA 5MN6A 2NV6A 2ZG6A 4ZO9A 1Q91A 2FDRA 1G21E 4V0ME 1ZM9A 4GM1A 3H86A 4GXQA 4B6SA 1U2PA 1EHYA 1JLRA 2JI9A 3NT5A 4L27A 4EFNA 4TWBA 3CXUA 5KTNA 2NYAA 3S8EA 5CXUA 4XM2A 3RC1A 2H1RA 3O3OB 4P4SB 2QP9X 3KYJB 1NL3A 1SVLA 1ZCBA 2JGFA 4FT4A 4Y2TA 5BV7A 2EWMA 3C15C 2H2HA 1NOJA 4KMRA 1QYRA 2ZSUA 5LUBA 3BUSA 4IIFA 3ABSB 3U7QB 4P33A 1QFJA 3ZHCA 1A72A 5JAMA 3OX4A 1C80A 3ET4A 1FTNA 3F46A 3RRMA 2HBRA 3VV3A 3WQRA 4G09A 5BQOA 1JR3A 1SQSA 5HWSA 3ENWA 2PY6A 3OA2A 3KS9A 1VG8A 2HD4A 5I7VA 3EEYA 1DCKA 2NZ8A 1X15A 1E9BA 4WCFC 4WFQA 3U7FB 3QELA 3ENVA 1KP3A 1NQOA 3BILA 3K9LA 5LMCA 5FBZA 1YT5A 1LLUA 4AMBA 4EYOA 3EEQA 3UGJA 4NZOA 5AI8A 2VATA 3G0IA 3IODA 5EZQA 1TEHA 3BJIC 1KE1A 4D3DA 3H2BA 2QSZA 1Y81A 3PIRA 5BV8A 3AL0C 2DOKA 2ZYDA 4I8IA 4RS4A 4NEHB 3U9SA 1N5DA 5LQKA 1YQTA 3V9AA 5C4IA 2HQ1A 3HADA 3IJEB 2J9FA 1WUJS 4O4IA 3U7EB 3S55A 4PBRA 4YRFA 1NG9A 4QFCA 3WL6A 2QVXX 3KKOA 2AE2A 4MV7A 5EHIA 2DLCX 5KVSA 3IQZA 1SK9A 3IVMA 4ND8B 3JW8A 1N25A 5JFTA 2GXAA 4GPTA 4P84A 2JD0A 3CRQA 3DUFB 5CX4A 2WY2D 4TMYA 1MEEA 2WJHA 3CZ5A 3FMVA 4LS3A 4MYDA 1W9MA 5SY4A 4EIWA 1AN9A 1JQ5A 2PV0A 1FUIA 4H0NA 4LN1A 2OBYA 3EY4A 5C5EA 1Y1PA 1T34A 1V95A 3JRXA 1XZDA 3VTZA 3TZLA 1A1VA 1EQAA 2CL5A 2EERA 4HD8A 4XOUA 3HQ4O 4J3NA 2UYCA 1X0XA 5DGTA 2LZ0A 1PX2A 1U0LA 3D5QA 3DE5X 4PC3A 4A1OA 4B2LA 1WF3A 5DM70 2EP7A 3JVEA 3TZEA 5E1MA 4NU8X 4UEOA 4AKIA 1SBNE 2XA9A 3CZ4A 3NW9A 2Q5JA 2ZYWX 3E70C 3OZGA 4FFPA 1OZFA 4ZARA 3SSAA 4BRZA 1VBNA 1A82A 1ISFA 1KJIA 1Q14A 2W2LA 2XA2A 4QXPA 5CHYA 4GP9A 5EERA 5JSUA 2NSDA 2Q4BA 3G8AA 1JEEA 4MW4A 1KAOA 1LJLA 2WF9A 4O02B 1CDDA 1E6UA 3HL4A 3HXTA 3IEKA 4CPDA 5C51B 1YJXA 1KJWA 2XUPA 4HYQA 3T9DA 2QD4A 1NVUQ 2DYKA 4Q34A 3JQBA 4EX6A 4EUSA 3S5JA 1AOXA 2XNKA 3KDAA 1E9RA 1LWOA 1QGAA 4JP3A 4WKCA 3KAKA 1K7EB 2WABA 4L0MA 2E4ZA 4WVLA 4PSKA 2V5VA 5CM9C 1M75A 1V1MB 2J3JA 2HO4A 1CUVA 3AB3A 4KTTE 1SUPA 4GZLA 5A9SA 7REQB 1IPHA 3B9PA 1PZEA 4IKOA 4E13A 4G26A 3TZKA 3HGMA 5EZYF 3E3NA 4AY4A 4LHYA 4R0VA 1H2FA 3KTFA 3QXCA 3KYDB 1K89A 2FAXA 4HEHA 5CJPA 3HS3A 1AU9A 1KSFX 3P27A 4RXTA 3TDMA 1O95D 1P7YA 2Y1DA 4RK5A 2C54A 4NNOA 1UBHS 1OT5A 3EZLA 2NZVG 1Y34E 1DELA 2P40A 4NMWA 5A9SB 5T8KA 4R51A 1GXSA 1UK9A 1GGJA 2G5GX 4UJ5A 1O95C 1UK6A 1CVRA 3H18A 2GZAA 2W43A 5DM60 4TYPA 3CVXA 3ZY6A 1ZRMA 3ORFA 1L4YA 2Q46A 3AJ8A 3VDNB 1O6FA 4MWOA 3E9YA 4BB5A 1HE5A 2PQMA 1E20A 3MQ2A 4OU4A 2ZI4A 2FN9A 4JITA 3BB4A 3MK31 4UUOA 1B1CA 1FEZA 4CIDA 1OWNA 1M10A 5DNDA 2AN9A 4LWQA 3SPXA 1TVCA 3N0TA 1EX6A 2W83A 4PG7A 4AZWA 5REQA 3OD1A 4BKQA 4CODB 2ZRFA 3P1JA 5FOXA 4XAQA 4UNIA 1CIVA 2E9SA 1ZI9A 3FYSA 2I4MA 1BW9A 2CHQA 2XTZA 4I6JA 4QQ8A 3WRYC 1KIFA 5DTIA 1MQ9A 3FSJX 4MUJA 2JLAA 2X7XA 3CLTD 2QM8A 4U63A 4XDHA 3ZDEA 1CQPA 5JMTA 2Y1CA 3LT2A 1MG0A 2Q5OA 4IILA 3DMNA 4QGAA 3TMYA 5IJZA 3BQMB 4MINA 2F1KA 5CNKA 3QUAA 4YQEA 4JX8A 1KYZA 1T2UA 2NAFA 3ZW9A 4H7HA 5CA0B 2VDOB 1ADGA 2JVKA 1YQEA 3GFBA 3K1JA 3KEOA 1ZUNB 1HNXB 3A3KA 1U3VA 2WM9B 3ICWA 5HMMA 4DDMA 1SOAA 1YBVA 2H1LA 1JLHA 1ZIDA 2ZWVA 4I2NA 3Q0TA 4MA0A 4PR0A 1JVNA 5IVKA 4WUVA 1SGWA 4LOHA 1V48A 2I4OA 3V8RA 3AUYA 5EMKA 3L6OO 3BVPA 3ENNA 3O4FA 3NC0C 1JHYA 3RFVA 4D9NA 2QRQA 1T0JB 1J39A 4YUAA 5B3JA 2YICA 1Y37A 3PFFA 2VOJA 5JASA 4WOPA 3CN9A 3IKLA 2P4QA 4KQCA 1GN8A 1O96A 4IOJA 3WYBA 5EIEA 2CXNA 5JCOC 1DNPA 4X90A 4BN0A 1TQHA 4HH0A 2GCNA 1NNEA 2O2YA 4X7RA 3SEQA 1ILEA 5B6JA 2BGTA 3OM1A 3BB3A 4WOKA 4A2CA 1UDAA 3AL3A 2GWHA 2QTFA 3LL4A 4I99A 4KN9S 1N6NA 2W4MA 1S3SA 2QNRA 3W1EA 2Y0BA 3BRWA 3CLKA 3KZXA 4DNFA 4DMCA 5EHXA 1PJQA 2WHQA 4M3NA 2B4YA 4Z0PA 2SCUA 2XLBA 2R0QC 1H2XA 4RNDB 3O1HB 4RZHA 4HDRB 4MI3A 4DUYB 1Q3TA 2RD2A 1VM6A 4EUHA 3PDCA 3EZ9A 4Q7LA 3AM4A 5BP7A 3KC2A 1YS4A 4JLPA 1GQSA 3RF6A 2PSSA 3O8DA 2GLTA 3A3PA 2IXBA 1LRKA 1SCAA 3MCZA 1ENYA 4G01B 4KDEA 4WNCA 3LCMA 3ZDZB 2YV3A 3KB1A 5CB4B 2G1KA 4AY2A 2AD5A 2WF7A 1XQWA 2B37A 3J7AC 4LYGA 2DHRA 4PO1A 3GCWA 1L9KA 1RKVA 4O4LA 4CF5A 3DXFA 4TTVA 2P5TB 4ZOBA 4CQJA 3AHFA 3H1PA 2A35A 4JT2A 3ZNPA 4AJ9A 3H1TA 2HRRA 4UHHA 4JBXA 2CVZA 2HA3A 4NATA 4KEAA 1SHUX 2WU0A 2BD0A 2FETA 3HFJA 3DLAA 5ENZA 1P73A 2PEYA 1MU0A 3RS5A 1DEKA 3TD6A 4HGNA 1WCIA 4AF8A 5T6BA 2DERA 4R3NA 4IUDS 2IE8A 4JU8A 5TF0A 3T7EA 1R88A 4O4LF 2JRLA 1CE8B 2LWIA 3NBMA 4MROA 4Q12A 3F5FA 1K9SA 5ELLA 5JR3A 3LUHA 1AH2A 1TMGE 2DMRA 4BP8A 1KFBB 5E3IA 5ALJA 5HKKD 7REQA 1J20A 2O8BA 2EW1A 1J9EA 2OV6A 1RI1A 3DDCA 4I81A 4ZKDA 5C7YA 3KZMA 4Y2RA 5IJ9A 3K0AB 3VA7A 2YVAA 1UDCA 1ECGA 2QGZA 1XGKA 3DBLB 3RRNA 2FWJA 3D4BA 3KKEA 2LRHA 1GTZA 5L6MB 2B5VA 1Z08A 1BWPA 1USIA 1Z2EA 1EJ2A 5F7ZA 2I22A 4M86A 1WMEA 2GK4A 4I5GA 4JBGA 5EXEA 1FY2A 2GLXA 4WLEA 2VT7A 3P9ZA 2ZB4A 4C9BA 2C07A 2V6IA 3HB0A 3MB8A 3U13A 3U37A 2J0EA 1XDGA 1I4LD 4JL6A 1AV6A 1S8AA 5F5NA 1A5ZA 2GF0A 3GK3A 3HJTA 5BQXA 4TGLA 4DJEC 4UCQA 2KJQA 5BWBA 1R9NA 1VLMA 3MFQA 3V8MA 3WQHA 3GEHA 2ALJA 1AD2A 1QGUB 1O6CA 4V38A 1CB7A 1MA0A 5ELXA 1ZHHA 3TR5A 1BJRE 4LZNA 4M8LA 1D03A 4G5YA 4A5SA 5A02A 4WH0A 4DV1B 5IK2D 3AHCA 2ZZNA 1QK5A 3DPUA 3VU9B 4B87A 3W3ZB 1PNTA 5TVGA 5CDYA 3ED5A 2QTCA 5L95A 4Y0AA 3ABIA 2OHIA 2FE1A 2I3DA 4FMDF 1N57A 3NUQA 5AQEA 2C1ZA 1KSGA 5B4VA 4GXTA 1AMNA 1ZK1A 5FNVF 1I80A 4EZIA 3D1LA 5JTUA 2O1EA 4DLAA 1EVQA 1IM8A 4R8KA 1BNCA 2C58A 4XB6B 2C3PA 2NTYC 2PT6A 5K2MA 2RIPA 2C9OA 3WMGA 1WPRA 5A4MS 2NTVA 2YFKA 4B2YA 1NFFA 5KDLA 5CLJA 2AMYA 3DMTC 1YC2A 3O21A 2G5PA 4D1YA 2PBRA 3VGPA 1TQDA 1SQGA 4UDOA 3GJXC 3Q6NA 1M8KA 1MIHA 2GAJA 1IRXA 2AVNA 1LA2A 1IJKA 1ESZA 2EVWX 3JQ7A 1JZTA 4BFTA 4D57A 1ATZA 4B3SB 1ACMA 2NQ8A 4HVCA 3L0DA 3P26A 4Y9RA 4DV0B 2JGIA 2PX3A 3IDQA 4IW3B 5DMHA 2GYWA 3LWBA 5IVIA 2ONKA 1EINA 1KXZA 1KKLA 1NONA 1UXJA 4E0BA 1N1MA 2WNSA 4NULA 1B14A 1AQUA 3PZRA 2E48A 2IGBA 4IS3A 4YECA 5I9SA 3U16A 5SY6A 5KVAA 4NU0A 1A9OA 2EGHA 2TS1A 4E21A 4G2NA 1E7YA 5G4KA 1OV6A 2OQIA 1GDDA 2F2TA 1U2DA 3FI0A 2NWQA 4OXRA 2OO5A 4DUGA 3GP3A 4EG1A 3U3DA 1ZUHA 2Y0CA 4FX2A 1DV1A 4JLWA 4NAUA 3WAJA 4RIGA 1UKEA 5F33A 3WRVA 2P9TA 2I65A 3R4CA 1TVMA 1JGTA 1NVXQ 5IJ9B 2PT7A 4A23A 3OIFA 1FNCA 4FCTA 4ALLA 1Y6ZA 3M81A 2FDCA 1YBMA 2EEPA 4R1MA 1SPBS 1BXKA 4JWKA 3IJ5A 1TU0A 2MOKA 2RHBA 2V8OA 1LRJA 3UK2A 1BE0A 3IOMA 4H18A 3NKVA 1C3XA 3GJ7A 3K0EA 3W8NA 2Q8PA 1LZLA 3WL8A 5C3MA 3I6QA 4E5NA 5M2QA 4FWTA 3RVJA 2D0OB 3ZTYA 4HDAA 1W5BA 3AR9A 4NMLA 5E2IA 5IU6A 1XU4A 1YFLA 3BMOA 4KPGA 1SBCA 5JQWA 4M7OA 2ACEA 4DPLA 3VHXA 5I7WA 3PJRA 4ZT2A 1QMGA 1VYVA 3ZQJA 5D7BA 1IBRA 4Y6OA 4ZD6A 3KSRA 1QVAA 3PICA 5D1NA 4QSHA 1KE2A 4KJXA 4MVJH 5A5VA 3LPCA 1AE1A 4N9QA 5DKFA 4B3FX 4YRSA 4ZHQB 2XKKA 3VUEA 3JV7A 4YDHB 1NW3A 4DB4A 1NLZA 1PJ3A 2GRUA 4N9WA 5GV8A 1KR5A 1ZPDA 3H7AA 3Q5DA 3AFGA 4OCZA 5AKGA 3RHSA 4C5CA 3L6UA 3SXPA 4DA0A 2Z1DA 2ZSKA 4YXWD 2VF4X 3EJ6A 5JUWA 2IIPA 2X15A 3B6ZA 3IXLA 5CPBA 4M22A 4MUMA 3VKVA 1DAOA 1J1IA 3Q12A 3PFCA 3KHTA 3LVBA 5CDGA 4OYHA 2FZ4A 3D2BA 3OU7A 1OXUA 3NRBA 2W90A 3DT6A 2J4DA 3WQQA 4JI1B 2OCXA 3Q85A 2I7DA 4B3XA 2QRLA 2Q7XA 2X5NA 1VDZA 5KREA 4E11A 2GYUA 1KRHA 1IJFA 2B3DA 4CV0A 2P41A 1E5VA 1BH6A 4NE9A 2AOUB 3U7JA 3I9LA 5B1SA 3ZBPA 4CF7A 3K0CC 2HWYA 2QZPA 3DUWA 5KOYA 2QTLA 5EE3A 4E51A 3T34A 4O08A 4B84A 1U9JA 2XMCA 1WVMA 3ZLUA 4LXUA 1G5TA 4MA4A 2B20A 5L3RA 3VPCA 4OI4A 1J1ZA 3DOIA 1MTZA 2EJWA 5KX5F 5L6LB 3IEVA 2ZATA 4YRTA 2HRDA 2DZDA 1NDQA 1Z2DA 2PAFA 4RK7A 1CF4A 1JAYA 1PL0A 3B1ZA 3NTXA 3TEMA 1BX0A 4EH1A 4L73A 4Q4LA 2JLRA 1IUNA 4IH1A 5I6DA 4PN7A 2BY4A 1P9WA 2J5RA 3R9IA 1FXUA 2IHBA 1OZ0A 1IN6A 1U3CA 4PSVA 1QLHA 4RY8A 5DGCA 2R8OA 4NSNA 2VRNA 3OX3A 4OHBA 3E6AA 4U2FA 2C3MA 3K5IA 4LDAA 4TV9A 1UC8A 1VXRA 3E15A 2O05A 3AETA 1DXQA 1CEYA 1N8KA 2V65A 2E37A 3QU5A 4B3BA 2GI4A 2Z9BA 3WYFA 2W6OA 2YXNA 1XWWA 2JARA 3GFQA 4LECA 3UCFA 4B0PA 1X14A 5G3ZA 5B6PA 5L9AA 1GG2A 1HL3A 4DQVA 4CKWA 1FFCA 1OD6A 1XTRA 1WV1A 3AI2A 2QTRA 1K0UA 1WCXA 2YRXA 4RFSB 3DDHA 1BGWA 1BYIA 1PGQA 1UJ2A 1YR3A 2PA3A 2XUDA 3PXEA 4RXUA 5KSYA 1S3FA 3KAQA 1T4CB 4EHIA 1H3NA 2GLUA 1TJPB 3GDOA 3K6RA 3N5CA 2C03A 3G59A 3QOFA 1UIRA 5I4IA 1K92A 3HK2A 4YT8A 1YR2A 2QTGA 3OQ1A 5AOVA 1W52X 3GARA 2JS7A 2OFFA 2VVTA 3HP7A 4Y9TA 3IUYA 4N12A 5B4TA 4YXWA 3F6CA 3DE2X 1DLJA 4LYEA 4Y2HA 5FBQB 4KIGA 1A2BA 4MA5A 4BVFA 3BBPA 3ND6A 4LHZA 4GKJB 3GFVA 1UBCA 1V8ZA 3NBQA 4IJKA 4B3HA 2PS1A 1R12A 2QX7A 4KE7A 2R1UA 1JG1A 1UOOA 2BFFA 4MWDA 5EE0A 4ESHA 3QE9Y 1TRHA 3KWLA 3W04A 3SZ3A 3AI7A 5DX1A 4R8MA 5HEKA 2XW6A 2RB5A 5DHRA 2GRAA 4OLAA 4WOJA 2AR9A 1KMQA 1UKYA 3KXKA 1IY8A 2CEKA 2VO1A 3UJ6A 2UZ1B 3M6XA 1RBQA 1ADYA 1QHIA 1RI4A 3BS4A 4YRQA 3RSOA 2UUPA 1LRLA 5FTKA 4MW5A 3T52A 4EJ0A 4F2GA 4NARA 1BHO1 3DCIA 3RVLA 1LK0A 1NYRA 1TYDE 2NQ2C 3ISVA 4RPJA 1RQGA 2Q3CA 4TMWA 3ZW7A 2X0NA 5AW1A 3NBFA 3V4RA 1E6EA 2LIVA 4P32A 4QBTA 4MDHA 2WWRA 5EYPA 1HFEL 5EPOA 5EC8A 4CMBA 1K6JA 1Y9ZA 2EQBA 3NTQA 1O97C 1QE5A 1RLIA 3UJ9A 2IPMA 1JAHA 1GL7A 3HVHA 2IF0A 3PL5A 4RVSA 3AW9A 3ZJVA 3FPAA 5JSFA 3EZYA 1JHDA 1E98A 1FU8A 2UAGA 3FFWA 3FVVA 2ZRCA 4GFDA 1J4AA 4IWXA 2C83A 4EECA 1FDUA 1QTRA 4L5IA 1T5HX 3GNSA 3Q2KA 4JLDA 4RGVA 1J25A 2ROQA