2G1JA

Crystal structure of mycobacterium tuberculosis shikimate kinase at 2.0 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
159
Chain Sequence
b'APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate kinase
publication title Crystal Structure of Mycobacterium tuberculosis Shikimate Kinase in Complex with Shikimic Acid and an ATP Analogue.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 59
structure length 159
sequence length 166
chains with identical sequence B
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g1jA00
1UKVY 1A7JA 4NCJA 3S1AB 1R10A 2EFEB 5TXGA 1M2OB 1RYFA 4MGIR 2ZI9A 1N5KA 1G9XA 4K46A 4M9XA 5HPYB 3ZD6A 2OILA 2GZHA 1XD9A 4HLUC 2EYUA 2PCJA 2B21A 3NHAA 1DPFA 5BXQC 1Z6YA 3QKSA 3OHMA 2Q9CA 4OI0A 4LSGA 3QPUA 3Q3JB 4PSKA 4LJ5A 2WOOA 4PPNA 2IXGA 1Q12A 4CRWB 4LC0A 3ADDA 5J4VA 3Q9LA 4GBMA 1J8MF 5JECA 1I4LD 4B32A 1JECA 1M7HA 1XB2A 4R2IA 3U7HB 1CR0A 121PA 2ANCA 5L3VA 3R7WA 2J0QA 3T5DA 2ZR7A 1E4YA 4L4UA 4TQ9A 4QHTA 1XNJA 2FX3A 1HT2E 1WE2A 4ABYA 4DUGD 4C0LA 1EFTA 4LJ8A 1HY3A 5DISB 4D4JA 3WYGA 3ZVRA 3DVLA 2OXCA 4URUR 4PC2A 1OIWA 2F1JA 2IYWA 2GK6A 2IF2A 2WSSD 3BH7A 4HUTA 2AKYA 3VHXA 1U9IC 1Y3AA 1M1YE 3AH8A 2VF7A 3EZ2A 4LJ6A 1LNZA 4B35A 1OJLA 2KSQA 1QVAA 4TT3D 2JDIA 3B1YA 1GSIA 2QORA 3A1WA 4C3ZA 2H8KA 4OKSA 3MGCA 2XTZA 3Q7QA 3GEIA 4TYWA 2D62A 1TX4B 3BH0A 2GTPA 2FSGA 3GJXC 5DO9A 1NLFA 3K70D 4NL4H 1KKLA 3KKMA 4QNMA 4FMDB 2IYZA 3NVAA 4BGDA 2BVNA 2WMOB 1RE0A 2GESA 3TAUA 5KO2A 1Z0JA 4PC3A 3CRMA 3W34A 2VHCA 4HDQB 4HZIA 4QFMA 5CIWA 1S1MA 4A15A 1NSFA 1AA9A 1HH4A 4FD2A 4FCWA 5C46F 3QIAA 3KQLA 1PV4A 4C0SA 4U00A 4PPFA 3NH6A 1OT3A 4JVNA 1EFHA 3AKEA 3W90A 2O0HA 4NDZA 4A4DA 2YOGA 4FXPA 5FOXA 4G3XA 1YR8A 5L3SB 1UAAA 3DL0A 4MYCA 4EPRA 1OXUA 4DWJA 3AVQA 5FI0B 2WMNB 2P5TB 4DB4A 1II8A 5LB2A 3C7KA 1ZCBA 1ETUA 4BLRA 1KAGA 1G8FA 2BCGY 2G77B 4TLAA 2FDCA 3T1VA 3IIJA 3ADCA 3CR8A 1KY3A 5EE1A 3VNVA 2QPTA 1E6CA 2ZI5A 1XEXA 5BN3A 4OQXA 4EKDA 1ZD8A 4HB0A 2V7QD 1OKKA 3G5UA 1NVXQ 3VKGA 4IKEA 4MKHA 1MR3F 1A4RA 4GRAA 1W48A 4N1AA 4ACAA 1FUKA 4TL9A 1GFIA 5FUXA 2ODBA 4IDHA 5L3QB 4O3MA 2O0JA 4KITB 2WJGA 2KJQA 3DO6A 3CLVA 3I1FA 1Q22A 3B2EA 1SVOA 3LD9A 1GRRA 5HCNA 3T06B 2NGRA 2J7KA 4NBSA 3EIQA 3H0KA 2X77A 3GEHA 1EXMA 2D06A 3KX2A 3LXXA 2ASEA 1BO6A 4C7OA 3BWDD 3QUSA 3F8TA 4B74A 3PJRA 2G0NA 1D8TA 3C14C 4NZYA 4F91B 1XMJA 4Z1MA 3R20A 2DBYA 3OAAA 3CONA 1IQPA 2YWFA 3LDAA 3CF0A 3L0PA 2XNSA 3SFZA 3QBVA 4P3YA 3TK1A 4JLMA 1IBRA 4URXR 3QQ5A 3VR6A 5KDDA 3GP8A 2QROA 2ZUCA 4JJZA 1KNXA 3TUIC 1DAGA 2VRWA 1XTQA 2B92A 3GLFA 4IFEA 4JZKA 3EC1A 3ADKA 3VR4A 2VP2A 3NDPA 2BBWA 2WVJA 5IDVA 1XCGB 1SXJA 2ZU6A 2V8OA 2CJWB 4ASUD 3V4RA 3CKLA 5FUVA 2XNDD 4QGHA 1MO6A 2PEZA 3W3AA 1CF4A 4V03A 5AJWA 2OSBA 2ZUDA 1HT1E 4UJ3A 3VFDA 3CF2A 4EPWA 3THXA 2G0TA 2ORWA 5C2JB 2JAQA 5H1YA 3GJ0A 2YC2C 3GCGA 2NO7A 2V6JA 2IYLD 3THWA 1J7KA 4D4KA 1LS1A 1R6BX 2GK7A 4UNSA 3M1IA 4B3DA 1ZJ6A 3RC3A 2FA9A 5J4HA 3EX7C 3I62A 4ZDIA 1ZCAA 5SZIA 4Q7KA 2ZEJA 2IUSA 4LV8B 5HE8A 4ZCMA 4OQMA 1EGAA 1GVNB 1R0YA 1Z6AA 1JNYA 621PA 2NPIA 4DXAA 2BMEA 1WRBA 3UWKA 4IVQA 3RS2A 1TUIA 2A2ZA 3W5JA 1G17A 1CBUA 4OYHA 1KK0A 2AN9A 4XTRA 1CP2A 1D2MA 1G4UR 1JR3D 1JJ7A 2P6UA 1OHHD 2XTNA 2ZYUX 4ZDKA 3QXHA 1Z06A 3R8CA 4UKDA 1XDBA 3W6PA 4ACBA 1ZYUA 2LCFA 3QVVA 5IT5A 5KPJA 1P73A 1Z6XA 2Q3MA 2OLKA 1YQTA 1Q20A 2VO1A 2YVUA 1LW7A 3NBZC 4NTZA 4QKQA 4HZUB 4U5XA 4QHSA 3N2IA 4TWZA 3EARA 1W2GA 3ZIAA 2XGJA 4EFMA 1I4TD 1XX6A 3HYTA 3NEJA 3C5HA 5HCIA 2W00A 3OIYA 1KSJA 1X6VA 1IN4A 2AXNA 2OE2A 4OK6A 2IWRA 2ZJ5A 4ESVA 1T5IA 2F9MA 5IK2A 1MO5A 4AD8A 1TU4A 4B75A 3UMRA 2GJAA 3K0CC 2V4ZA 4OQNA 2JLSA 1UKZA 2JEOA 2QSYA 2FPKA 1XZQA 3CX8A 1US8B 1XMVA 3KFVA 3MSXA 4LHZA 4M9SA 1NY6A 3KTAA 4D80A 1T4GA 3ONWA 1YZKA 2ZI4A 4UNNA 3U3KA 4DLTA 1W0KA 2J41A 2FG5A 4B6FA 4TLEA 4V02A 1CLUA 4DLYA 3LWNA 1E79A 2QMOA 4TQUS 2WWYA 1FQKA 3UMFA 4M53A 1CKEA 1NBME 3RRYA 4BFXA 5EE5B 1NVVR 3D6TB 2GEUA 3VTKA 1KHTA 4LZZA 4AG5A 2JJ2D 1ZM4A 3OEHA 5JCZA 1P9NA 2G1JA 2ZI7A 4CT4B 4RD3A 3EG5A 2ZJOA 3ZQJA 1YRBA 2N1BA 4DLXA 4BPBA 3W8RA 2H5EA 3VR3A 2XZOA 3ZDQA 3TJZA 5IF9A 2ZVPX 3LX5A 3CRW1 4JVSB 3KB2A 1BH2A 2HLDD 4CVNA 4U7DA 1G7TA 1O3YA 3R8FA 3F5FA 3RHFA 2ZIAA 1OLOA 3GJ8A 2OG2A 2ZSAA 2ATXA 4PTLA 4TL7A 2DCUA 2B8WA 2GCOB 2GBLA 4OQLA 4TL6A 3OFND 1I2DA 2VLIA 2J0SA 2Z4RA 1OXSC 3HP1A 2RGXA 3QOFA 4NYJR 2W0SA 2Z43A 3O8BA 4AWXA 3WY9A 2IK8A 1KMHA 1ZNYA 1YRAA 1NMXA 3LVQE 4DT1A 3G0HA 4URWR 2P3SA 1ZC4A 4QBGB 2R62A 1Q1ZA 2XAUA 1IJFA 1KSFX 5KTYA 4MKGA 5GJBA 3X1XA 4WXPA 4DSOA 2I1VB 2WM9B 5JSZA 3QKSB 2PLFA 1II9A 3CWZA 2SHKA 2GZAA 2CE2X 2A30A 2W6IA 2VQSA 2DYKA 4XD7A 2OLJA 4ZPXA 1MH1A 1S1CA 2V9PA 3CNLA 4US2R 2ZYWX 1A82A 3ADBA 3TR5A 3VKWA 2WHXA 1Z2CA 1OSNA 2Z5FA 1CXZA 3ETLA 4DKXA 2ZYTX 3R7WB 3TGPA 2A3RA 3DM9B 2QPAA 3SYKA 4DDVA 2Q3HA 2HCBA 2IT1A 3L82B 3T35A 1DAHA 2Q9AA 4G5OA 4AIIA 1E2PA 4H1VA 2JDID 2FFAA 3RRMA 1HA3A 1ZNZA 2RGNA 4HAYA 5J4LA 3AB3A 1G8HA 2GWHA 4Q9LA 2ZRAA 3AF3A 2BBTA 2QN6A 3MRSA 3DOFA 2F3RA 4IW3B 1TF2A 4PHFA 2KBEA 5GVRA 1AQYA 3ZZUA 4ZDJA 3AV0B 5KUTA 1WDTA 4NP6A 3AVTA 1EFUA 3FMIA 5JRJA 5JI2E 3CWQA 1TF7A 1E94E 1ZU4A 2ZAOA 4B3BA 3CNOA 2VP0A 3ZZTA 3BD9A 4PFSA 2WICA 4M9ZA 4AKEA 4KBGA 5LPNA 2WJVA 3LFUA 2D4HA 2IYVA 5JLJA 1VG0B 2W2XA 2VP5A 4G01B 5HR5A 1GIAA 4G5GA 4DC9A 2QBYB 4LJ4A 1QHHA 1DAMA 3BB4A 3KZ1E 1MT0A 5JCPA 2FEMA 2V1UA 2O8EA 1KI2A 3NG1A 4CDGA 3MFYA 2RHDA 5JEDA 1KY2A 2VSFA 1FNMA 1KDRA 3K9GA 2Q6TA 3KDSE 4KYUA 4BE7B 1GNRA 4KXFB 3NC0C 1A1VA 2OBLA 1PVOA 2ZPTX 1XEFA 1AK2A 1NMZA 3FKQA 2BJWA 2Z6VA 4QC2A 4QL3A 4RD6A 4P4SA 1TQ4A 1U98A 5CM8B 4M8NE 4JVMA 2IYSA 4AG6A 1OKKD 4LBWA 4Z8XA 3H84A 2EYQA 4A6PA 3SBDA 1II8B 2AL7A 3KXKA 1ZBDA 2IXEA 3BS4A 3NXSA 3GJ3A 3NBXX 2BDTA 2HXYA 1QVRA 2DY1A 4PC6A 1ZM2A 2MMCA 2ZRCA 3U7GA 1QHNA 3H4MA 1XEXB 2WKPA 1G7SA 2I3BA 4PAQA 5AWFC 4P4TA 5EJEA 1G3QA 4QXAA 2MMGA 2WPDD 2ONJA 5K8IA 2MSCB 1KI6A 5JS7A 2ZJBA 2QG6A 4B44A 2N42A 1OV4A 2ZRDA 2H18A 1WBBA 2NO0A 2ZJAA 3EPHA 3CRQA 4CIDA 4Q1BA 5GJWC 1Z6GA 1W49A 1VECA 3ZVNA 4Z1MD 3CPJB 2E9SA 1W4AA 2FSFA 2V3CC 1X8KA 3QKTA 2B7CA 1YJ5A 2FPMA 5EE3A 4DCSA 5BYKA 2IBMA 1AN0A 3B82A 1OF1A 4YQFA 3WNCA 4ZIRA 5JWHA 2H17A 2RB4A 4UNQA 4F4JA 3FKSA 3VQTA 2QQEA 1T5LA 5JJKA 1FTSA 2BV3A 4DLUA 1ELOA 2QT0A 1IY0A 4M4SA 1G8PA 2WOJA 5FTKA 4NPHA 3WYFA 4C7OB 2CLSA 5G53C 2FPLA 2O5VA 4BRWA 1F2TA 2E1RA 2JIZA 2DFNA 4G1UC 5FPHA 1ANKA 2PZEA 4JSYA 1H65A 1UADA 2ZRLA 2RGGA 3FPAA 5JS8A 4C2TA 2F9LA 4E07A 1WBDA 2NMVA 1SXJD 4HLCA 3D7MA 3ICEA 4RZUA 3A4NA 5IHPA 4OK3A 4GDFA 2F7SA 3FDIA 5FPTA 3RS4A 4JSTA 3KQKA 3DHWC 4LBVA 1VDZA 3VR5A 4UXJA 4JLDA 3GLFB 2RGAA 2B6HA 1F2UB 4JL6A 1P61B 5CK4A 1GNQA 1PJRA 1HE1C 1JAHA 1KOFA 5BYJA 1L4UA 3SI7A 3TRFA 1SXJB 3B60A 5KYKA 1W36D 5JI3E 4BEBA 1KI1A 5HKKA 2UZIR 5C4MA 2JLZA 4IDPA 4Q19A 4Q9JA 3SR0A 1Z63A 5EXSA 1U94A 4N0DA 2QI9C 2ZM5A 1SULA 3CPEA 3PVSA 3THXB 1M74A 3U6BA 3RS0A 4RKEA 4R98A 3ZS8A 3THWB 1KNQA 2QM7A 1E2MA 1P9RA 1W36B 5EP2A 3CH4B 1UF9A 4PC7A 4RZ2A 4OHZA 4Q02A 4K81B 3NIBA 1FPMA 2VP6A 4R9UC 3TBKA 2ZRMA 1ZM9A 1P3JA 4Q00A 2PJZA 1JALA 3SQWA 5CITA 1LTQA 3HU3A 5ANRB 1JPJA 2BEJA 4RVCA 1COWD 1XD2A 1WXQA 1E1QA 4DHEA 5JJIA 2W6JA 1ZINA 2HV8A 2QA5A 2NZ8A 2WV9A 1KJWA 5IK2D 1II0A 4JKIA 2P2LA 3IQXA 1EFCA 2BMJA 3LW8A 4FCTA 4R7ZA 3FB4A 4IFBA 3TIFA 4A2QA 4IOMA 5FTJA 4A8JC 1KO8A 2NQ2C 5FUWA 1YZQA 1Z0AA 2BMDA 2FZ4A 3AVYA 2O8BA 4PQYA 1W0KD 4D4LA 3DMNA 2GRJA 1E79D 3LV8A 1FFHA 2J3EA 3HU1A 4ARZB 4PPQA 4DLVA 3P20A 4HLQB 1DAKA 1SQ5A 2ZS8A 1CJUC 3C4JA 1DE0A 1X8LA 1G20E 2QSZA 5LDDC 3K0CA 1H8HA 1KDOA 2DWOA 3D31A 1Q44A 1UEJA 1XWIA 2OBNA 3PUWA 5EXPA 2QP3A 3O8DA 1TF5A 1GL7A 3SDZA 2FGJA 1PLKA 1Z6TA 2GBLC 3UK6A 4G5RA 4I1VA 2YWEA 1Q3TA 4UNRA 4B71A 3TSWA 2BCJQ 4CEHA 1NJFA 1NBMA 3PUZA 5FL3A 5KDOA 1KYIA 2FEOA 4LV5B 3UXMA 3L0OA 3GLGA 4UJ5A 3AF1A 1N6IA 4KFSA 4Q1FA 1SVMA 1KI7A 2JLRA 4PO9A 3BXZA 4RFVA 1OXTA 4ZI2A 3I8XA 1L4YA 2GVDC 3U60B 3BB3A 3O8CA 4IRUB 2KWIA 1YE8A 2HCJB 4ZKDA 5A4JA 4TTRA 4RD2A 1G5TA 4LJAA 5CLLA 1KO7A 4LV6A 1IXZA 1D2NA 1ZRHA 1AKYA 3LNCA 4BLSA 3C16C 2CK3A 2RAPA 1ZD9A 3RVBA 1E2DA 2W6ID 1UKYA 2AK3A 3AP3A 1YZNA 2KI5A 2BBSA 3DMDA 3K8YA 4PAOA 2E87A 1E9CA 1T3SA 4DT1B 1W5TA 3AF2A 1SKYB 3I32A 4M1WA 1DARA 4HAXA 1M7BA 3PIRA 3FVQA 2EU8A 4MGKR 1NVUQ 2F1HA 1S0UA 5P21A 1YZTA 4B3XA 5TVKA 2OAQ1 4BFSA 2QUZA 5JSZB 3KJGA 1V5WA 4QRHA 2RGNC 1XFAA 3NHBA 4MKFA 3CBQA 4V0LA 2W2TA 5LBIA 3BC1A 4GFDA 1KK1A 1OXXK 4ILEA 4E09A 4WZ6A 1T3LA 4EFLA 2FH5B 2ECKA 3P4YA 4JT4A 1NG1A 2GHIA 5H70A 1E3MA 1H8EA 1MABA 1IN5A 3QENA 1E98A 2BEKA 3W5IA 5D3MB 4ZCIA 4W5JA 1MO3A 1CRPA 1BKDR 3GLHE 3EZ9A 4OHWA 3MAAC 5FOVA 4Q9IA 1IN7A 3MJHA 5DN6A 1VHTA 4Y0AA 4D6PA 1YZGA 4RFSB 3P32A 3A37A 4OHXA 4AKHA 4KSBA 4DLWA 3SS8A 3AVXA 4AK9A 1T6NA 1BMFD 4QG7A 4LHXA 1L2TA 1VCNA 2WWGA 3TLXA 2VYFA 3VR1A 5FBLB 1RJ9A 3G82C 2QMHA 3ECCA 3MG9A 4V0ME 1KO4A 1IONA 1G6OA 5B2ZA 1OH5A 1KI8A 4EDHA 1CEEA 4IDOA 3DKVA 5DLQC 1E1RD 2GF9A 1R0WA 2JJ1A 3A6PC 1YZUA 1R5BA 1VIYA 2V55B 4Q47A 1JB1A 2HT6A 1FNNA 2Z83A 5FBRB 3K70C 1XCPA 1ZIPA 3C41J 3TSZA 4B34A 2GA8A 2HJGA 4DDWA 3KXLA 3OE7A 2ZQ5A 1XMIA 2VTKA 4R2HA 5E7JA 1F6BA 3TNFA 3IPXA 2W0MA 2C98A 5M04A 2L0XA 3SU8A 4HLDA 1G18A 2VIIA 3QJYA 3ZS9A 2XITA 3NWJA 2FOLA 3B78A 3W6OA 3QXJA 1P75A 2REBA 1DAEA 2O8CB 2IWHA 2ZJYA 3BK7A 2JLUA 1NJGA 5AUOB 5GVSA 5F98A 2O52A 2GJSA 2TMKA 1LF5A 1DG3A 2V54A 421PA 4K8OA 1ZW6A 2O0KA 4G0NA 3A1VA 3T15A 1G8GA 3L43A 3BFKA 5GJCA 4URYR 3PEUA 5SZJA 1PUJA 4P4SB 3O47A 1OFHA 1Z0IA 4NCHA 3EZFA 4JBYA 5CK5A 2HF8A 2W58A 4C30A 1JJVA 4CGZA 2ZJ8A 4D0NA 5A5GA 1W47A 1X3SA 2J0UA 4CEJB 3UMSA 1Q1QA 2GKSA 4LHWA 3DEFA 4TMVA 1UEIA 2KBFA 1R4AA 3AM1A 1E2NA 1F48A 1WCV1 2PX3A 1R8SA 4ZCLA 5EP3A 2EWWA 3A36A 3AVOA 3KQNA 1OXVA 1KIMA 3B1XA 2C03A 1XRJA 1YR9A 1XBTA 3A4MA 1KI6B 5JBQA 5KOYA 3K53A 5FFMA 3QBTA 4WW0A 3WP0A 3KXIA 1NVWQ 1R0ZA 3A4LA 2V1XA 4L15A 3H86A 2DWPA 4ZV4A 2PEYA 4XWKA 1S9HA 1Z29A 2A9KA 1DS6A 2MSDB 4JS0A 3SBEA 721PA 5J4YA 4TYNA 2PMKA 1EWRA 2A5JA 3U4QA 1JBKA 3KJHA 3MCAA 4J0QA 3BBPA 1E9AA 1U81A 1JQJC 2EQBA 1R5NA 1N6PA 1A2KC 1G19A 1PLLA 3RS7A 4EIWA 2FNAA 4YMTA 1E0AA 4ZIRB 5CDFE 4H1UA 2UVQA 3A1SA 5DHAA 2CMKA 1DO0A 5F9FA 4DEYA 3K0SA 3D8BA 5DNYB 1ODFA 5H68A 2DHRA 4US0R 3R9IA 3L0IB 3TVTA 3P27A 4BLOA 1GITA 2RGEA 3BFVA 3GPLA 3KKOA 2VSOA 1TEXA 2CVFA 1AZSC 1V43A 2YC4C 2VSXA 2XOKA 2D7CA 4FW9A 1K6MA 2R9VA 3BOSA 3DOEA 3M0EA 4BLTA 2WIAA 4TLDA 2IF0A 4XVQA 2YWHA 2GJ9A 3REFA 4B48A 2R2AA 1FQJA 5LB4A 1M6NA 3TH5A 4RD1A 3VMFA 3THYA 4OI2A 3IBYA 4TSFA 1KZ7B 2EVWX 3ASZA 2AR7A 2IS4A 2GXQA 4LPSA 3MD0A 2WJHA 2XEXA 2R8RA 3BFXA 2RGDA 2EW1A 2QTFA 1ZM3A 3EIEA 3CB4A 4PPGA 1R5OA 2AWOA 5J5CA 4UQOA 2ODEA 2IEZA 2BKUA 4QBIA 5KHOC 1ZUHA 1IXRC 2C9YA 5KSZA 3UG7A 1NRJB 2VH5R 2C04A 2XSZD 4UXIA 1AS2A 3QEJA 2AK2A 1W0JD 4BFWA 4EJSA 4B3GA 2ZRGA 2PT7A 4IDQA 3ZVLA 3CM0A 3JVUA 2D74A 4W5HA 4KFRA 5C18A 1AIPA 2XB2A 1JR3E 3P26A 4Q1CA 2OXRA 1LVGA 1Z8FA 4Z8YA 4Q7MB 4D4MA 1S3GA 1SGWA 1T0JB 1EX6A 1DTSA 1QG2A 4WZAE 1XTSA 5FL7A 1N6RA 3F0TA 4B2LA 1HEIA 2RHMA 4M1MA 4DDUA 1E2LA 4IEIA 3TQFA 1XD2B 4BFUA 3ZVMA 3P4XA 2XZLA 3L2OB 4B33A 2CLCX 3HDTA 2JATA 5CYOA 1N6KA 4LOAA 2RH5A 2VHJA 3RC8A 3JZAA 4WZBE 4GMDA 1HTWA 1E0JA 2QM8A 3QXXA 4DSTA 4A8JA 2QAJA 2QT1A 4FN5A 3VX4A 1EFRA 2O8BB 4NYMQ 2IS2A 3VKHA 1UDXA 5DGXA 4BZPA 4QOSA 4R71A 2VL7A 1MV5A 4RZ3A 3VHLB 2QTVB 4ARZA 3QKRA 1NIPA 1JEEA 1F5NA 2C77A 3U3OA 1YR7A 4Q1AA 1U99A 3UIEA 2JJ8A 2NOAA 1D6JA 4A82A 4DIDA 3T1TA 1N5JA 1LY1A 1U0LA 2R6CA 3OIVA 4JYBA 4B3FX 1XXHB 1F60A 2OCAA 1KGDA 4NU0A 3GLIE 1Z83A 1E9FA 3I4LA 4NCNA 1EESA 1W1WA 4DZZA 1OPXA 4PHTA 1NN1A 1E9BA 4CEHB 1YVDA 2VPPA 1UM8A 3Q8XB 4KAXA 4Q1DA 2FV8A 3ICQB 3GLGB 2NO1A 1TPZA 1KDPA 4PXAA 5FR2A 1E2FA 2CK3D 5CJ2A 1S96A 4ESHA 1HV8A 2QNRA 1GOTA 3AQ4A 4JLKA 2QE7A 1D5CA 1KKMA 2BM0A 4NMMA 3CR7A 4CEIA 5F9HA 3KKNA 2GEVA 3I73A 3OF5A 4HEJA 4DB2A 2H1LA 2FU5C 2GETA 4MYTA 5CM9C 3AEZA 1VG1A 2ZE8A 1SVWA 2GJKA 4DLZA 3PR1A 3FGNA 4MRPA 3AVUA 2HXSA 3NC1C 1JR6A 5FUYA 4KLNA 1BYUA 3EASA 1WP9A 1HQCA 4IOKA 4LYAA 5AJZA 4KFTA 3AF4A 3I61A 1QDEA 1Z0FA 2ZSBA 2ANBA 4Q4AA 4BQSA 4HATA 2GNOA 1CIPA 1NNEA 1SVSA 5TY0A 4B6EA 4B2PA 3RS5A 1C9KA 4DRZA 3AKDA 2VEDA 4WA7A 2WJYA 5KNCA 1UBFA 2OFOA 1N2CE 4M1KA 3QVUA 5G3YA 2ZSFA 1K5DA 3PFIA 1AM4D 1GZSA 3CNNA 3EWSA 1GL9B 2QQ0A 4EPYA 3KUDA 3SQXA 3SN6A 1N6LA 5FTNA 4O25A 2VF8A 1SKQA 3OIUA 3LW7A 1BS1A 1Q3HA 4GSYA 2YNMA 3OESA 5D3QA 3RSLA 1EWQA 3CZPA 3PUYA 1ONBA 1N25A 2XJ4A 1ZP6A 2DWQA 1WA5A 4XIGS 4FMDF 3QSYA 2C9OA 4RCZA 3ZYCA 2C8VA 3U7FB 3EWAA 2WWWA 1PUIA 1E0KA 3CUEF 5L8VA 3R9WA 1QHSA 3QPWA 3ASYA 5BQ5A 3GFPA 4QJ3A 3N5CA 4IVPA 1P7CA 3OEEA 3U44A 4GL2A 3GLHA 1CS4C 4Q9HA 2ZI3A 2AD5A 5FBVB 1MRSA 4DSNA 4V0NA 5ELXA 1KJZA 3W8NA 4JVLA 3TAHA 4DSUA 2J1LA 3WHKA 4BZQA 1N6HA 3OE7D 3FMPB 3H2YA 4TT3A 3U2QA 2IYXA 1TNDA 3E70C 1FX0A 1ZMXA 3K9HA 3BE4A 1RJ9B 1E99A 1O87A 2QENA 1Z22A 1Q1EA 3T1QA 1DADA 1VMAA 3WHLA 2CL7X 4OL0A 4GP7A 2IW3A 2GILA 3RLFA 1SVLA 2H16A 2J87A 2IYYA 2KE5A 1AS0A 4CT5A 1W4RA 3A58B 1XZPA 5SZKB 2ZRFA 4LBYA 3CRVA 2G6BA 3IBGA 4URVR 4FMCF 5KNBA 2OCYC 4LX0A 1TTTA 4JLBA 2P5SA 4PHHA 2R44A 4C0BA 1DAIA 3EAQA 4H9GA 1GKUB 2BKEA 3EIHA 3KJEA 4KJZA 5UKDA 5CB6A 1J2JA 1X1RA 4YC7A 2ZRIA 3NH9A 4QJ5A 2ZVQX 3IGFA 4TLBA 5DHFA 5EE9A 5FOUA 4TZ6A 5LD2C 2QP9X 4WXRA 5DI3A 1OB5A 2IUTA 2ZRPA 1Z08A 3PUXA 3QXSA 1S3SA 2RCNA 3GJ5A 2O8FA 4XJXA 1FMJA 2GXUA 1S8FA 3U6KA 2CE7A 1YU9A 2QY9A 3KJIA 2DPXA 2ZSDA 2QRNA 1RIFA 2YHSA 4LHYA 5AUQA 4Q01A 4L9WA 2FFBA 1HUQA 2VA8A 3MLEA 1AS3A 1C4OA 4OK5A 3TUZC 2J0UB 4DIEA 3F3YA 1JEDA 3OAAD 3EZ7A 3A8TA 1E2GA 1ZNWA 1L7VC 2V7QA 4AKGA 4KV9A 4WVFA 2OESA 1Z5ZA 4M21A 2YKGA 4DEXA 2I1QA 2YOHA 2XB4A 2QMEA 4JBWA 5CLQA 1E9DA 4A0FA 4F4IA 1GUAA 4UNPA 2ZRHA 2HT1A 4Q18A 4W9MC 2XXAA 2K5UA 1R0XA 2C9CA 2EFHB 4DVGA 3LQRA 5JZVA 3V9PA 3GEEA 1PZNA 4L16A 2EFCB 4B2IA 2BHRA 2QL6A 1DEKA 1G5RA 2X1VA 3SZRA 2F1RA 3I8SA 4I1SA 3MWYW 4A1FA 3GLFE 2AFIE 3HJNA 5FOTA 1FL9A 1KI3A 2ONKA 3K0FA 2JGNA 3WRYC 4FINA 1KI9A 1NMYA 2BOVA 4M2LA 5EE0A 4TMXA 3AGPA 1CTQA 1KMQA 4D82A 4NYJQ 4OI1A 1SXJE 3SYLA 1G5PA 3QE0A 1E2KA 4C4PA 2J59A 3SJBA 2CJWA 2QAGC 4TSFD 3KB1A 4PZZA 3SEAA 2ZR0A 3UATA 1WMSA 1KSGA 4PANA 2CDNA 4XVUA 2QEQA 2EWVA 2OEPA 4LGMA 3FOZA 3B13B 2WAXA 3PENA 4NONA 3EPLA 4HUQA 4MKIA 2QMUA 4JL8A 3KFXA 4AYWA 4GT1A 3FHCB 1KSHA 3T5GA 4D0LB 1N5IA 3K9NA 1XTKA 1Q21A 2ZR9A 4LY6A 4EJSC 1XCMA 2JLYA 3B1ZA 3NDBB 1M8PA 3THYB 2RGCA 4DCTA 2WIBA 1HE8B 4M9QA 4BWYA 3DKPA 2A7QA 4Q4JA 3EA5A 5CIQA 4XWOA 2IS6A 5G40A 3TQCA 1FUUA 2IHYA 4KYIB 5FTLA 4BFVA 1P2TA 1EG7A 4BASA 1DVRA 4KI0A 4KLZA 2F43A 3MWLA 4BLQA 5KSOA 3GJ6A 3ZIAD 4XTCS 1Z0DA 5FBWB 3QXCA 1A2BA 3PG5A 1KJYA 4I1OA 1FMLA 3BORA 3EW9A 1DOAA 1ZUIA 2CHVA 2Q0HA 1N0WA 4RSGA 4HYYA 3VNUA 3MWJA 4XH9B 2HYIC 1IY2A 3H1TA 1UFQA 4TL8A 1VKJA 2P67A 2ZE6A 5E7MA 4HAVA 4GZLA 3GFOA 1E2EA 3L8ZA 1GP2A 2CCKA 4XSHA 2JLQA 2B8TA 5IRCD 1JR3A 3LLMA 4TN1A 1G7RA 3CH5A 3UG6A 1EFRD 1NN5A 2CHQA 4MQBA 3LX8A 1AGRA 2BMFA 5DSZA 1CJMA 8OHMA 4AYXA 3I72A 2MSEB 3X1WA 1FW6A 5DYIA 3N2EA 3VU9A 3PITA 3GJ7A 3OEHD 2HF9A 4M0LA 4RJLA 4RD4A 1U2RA 2OBMA 4WBSA 4NE2A 3GFTA 3LO5A 3RDPA 1GKYA 1AQUA 2DR3A 3SE0A 3KTAB 2ODWA 1K5GA 4L8GA 3WBKA 5K8TA 1TEVA 2F6RA 1J70A 4GOJA 4A8JB 2IXFA 4GMXA 1GM5A 3WMEA 1M34E 4AKIA 4YDSA 1IAQA 1KZGB 1VCIA 2I4IA 5BN5A 4MUAA 1YHNA 4GI7A 2OHFA 4HDOB 4YMUA 3LY5A 3WP1B 4MDEA 3Q5DA 1GL6A 2C96A 3TE6A 3SHWA 3I5YA 2A5FA 4OBEA 5GJVC 1P2VA 1YZLA 3L0SA 1J99A 3V4FA 4S35A 4JYCA 5EQTA 1SHKA 2OV2A 4N0EA 1G8YA 1QHGA 3SJCA 5GADl 5G3ZA 3X1ZA 2G1KA 4DLSA 4Q03A 4QNRA 2CCGA 2G3YA 4TMKA 1P4SA 2C78A 2ZITA 4JMPA 4FIDA 5JHHB 2KB0A 1E32A 1XJ0A 5F3WB 1Q0UA 1QF9A 1SKYE 5FTMA 3GLIA 3B9PA 2HLDA 5FOWA 4XD7D 1KMHB 3I3SR 4II7A 2IHBA 4KO8A 4GNKA 3M6AA 2A5GA 3WYAA 4DLRA 1NLZA 5EUMA 1NG9A 4Q4LA 4CEIB 4JKYA 3OFNA 4GPTA 1XEWY 3HPRA 2QU8A 2B7BA 1RFLA 4PZLA 1GWNA 3B1WA 4OHVA 1JXMA 4PO8A 4POAA 2ZANA 2F55A 3ZD7A 2A5YB 3K9LA 4NH0A 3W6NA 1HYQA 4CZ2A 1G64A 2FN4A 2J5XA 3A1UA 1FP6A 2G83A 2QGNA 5KNDA 4Q4AB 2ATVA 2X8AA 2WWHA 3LH5A 4GOKA 2ERYA 3IEUA 3FFAA 4BFYA 2FJUA 4TZ0A 2REXB 1X8JA 2YJTD 1JPNA 2AKAB 1DO2A 4MGZR 4QHYA 1UBCA 4KBFA 1Q1BA 1NP6A 1M7GA 1T8UA 2NO6A 4LI0A 4I81A 3QF7A 4X8HA 1VYVA 2X2FA 2BIFA 5FPSA 5JWOA 1XPRA 3OZXA 3OEED 1OH7A 2Y8EA 1T8TA 3L8YA 1HURA 4GOXA 1KTVA 4LJYA 4QBHA 5EZ6B 4F93B 3KQUA 3FHTA 1XF9A 3C5CA 3C8UA 1NN3A 3CO5A 3FE2A 3NBYC 2GCPA 4G5SA 4MRSA 2VP9A 3KUCA 3Q5EA 4CF7A 4TMZA 4JLVA 2G9NA 4HI0E 4X8MA 5B64A 2P0EA 2XX3A 3MUFA 2WKQA 4TQAA 2DFLA 4YMSA 3U44B 2RMKA 4DCVA 3K09C 3GLHB 2IUUA 3U3MA 5CB8A 2CHGA 5TMPA 4NYIQ 1TQDA 1IM2A 2H92A 4FWIB 3KQHA 2QTHA 5FH9A 4X8OA 2QBYA 1G41A 2J0VA 2H57A 5DE3A 5C1BA 5J40A 1VTKA 4A92A 1QHHB 5DH9A 3PCRB 3BB1A 821PA 1G3RA 4LJ7A 1FX0B 3BRWD 1N5LA 4LHVA 1D9XA 1RZ3A 2CNWA 1UJ2A 2O8EB 4MDFA 2IEYA 3ZZ0A 1XD8A 4P0TA 2FE4A 3GJ4A 4NYMR 1ZVQA 2OUKA 5JHGB 4C0AC 4PSAA 2FSHA 4Q7LA 4Z51A 4LRWA 2WWFA 4A2WA 3LBHA 3TMKA 5BW8A 3K70B 1LF0A 2IYRA 3SFVA 2WTUA 1GTVA 2CL6X 1SZPA 3TW8B 3PUVA 3QPVA 1RRCA 3ZJYA 2A5DA 4C0HA 3WRXC 1RRGA 2AX4A 3NBFA 4PO1A 221PA 1DG1G 2WZQA 5JRZA 2R65A 1MOZA 4IXMA 3LLUA 1NLYA 1OH6A 1S4QA 1ZUNB 2ZJZA 4QGFA 4I99A 1RC8A 2PCLA 4ZO4A 1B0UA 3DDCA 3UWOA 1Z47A 3HPQA 2OFWA 2P6RA 4MRNA 1SHZA 1GNPA 3T12A 1AZTA 1NIJA 4ERNA 1CRQA 2FWRA 3FMOB 3PV0A 1TUEA 1L8QA 4CYMA 4US1R 3B9QA 3EXAA 4EPXA 1LB1B 4XSGA 5DI3B 4BZXA 1P9WA 4LBZA 1OFIA 4C0QC 3B6EA 1UBGA 2O8FB 4PZYA 3FKSD 4FMCB 3EC2A 3K0AA 5KDLA 2ZRKA 5K8UA 1UDWA 2ZETA 1KAOA 1N3BA 1NF3A 2AHOA 3FHOA 2OO7A 4JBXA 2D2EA 2OFXA 2JIZD 2XZPA 1KI4A 2ZREA 4HB4A 3TKLA 1OFTA 2C95A 2WJJA 5J4KA 1E2JA 1T3HA 1G16A 3OIWA 4PC1A 4MITA 1W4CA 2DFKB 2WPDA 3IILA 4N3NA 4A36A 3CZQA 3AUYA 1ZD1A 5G41A 1J8YF 3P1JA 2WSMA 3LXRA 1YR6A 2YWGA 1VYTA 3QF4A 2GCNA 1WB9A 1W2HA 3K1JA 4AC9A 3IEVA 3AUXA 4ZI3A 2HJVA 5AJYA 1RW4A 2ODNA 1CJVC 4HSEA 3TW4A 3X1YA 1TAGA 2OAP1 1IOZA 3GD7A 1E4VA 1IY1A 4DBLC 5AJXA 2XXAB 2YOFA 4Q5IA 1U8YA 1F2TB 1RYHA 1UBEA 2FGKA 2FZLA 3SJAA 4YLGA 2HUPA 1HQYE 4S2EA 1GRNA 2C5LA 2VBCA 3LBIA 3WMGA 2YINC 2G88A 3B85A 5HZHA 5FPYA 1MO4A 5L3RA 4EQ6A 2QRZA 5HKKD 3K0FB 2RKOA 2PMDA 4OHYA 5KPDA 1XTIA 1XJCA 2ZTSA 1U8ZA 5TDHA 3U3RA 2IS1A 4P33A 1F2UA 1ZC3A 3LA6A 2ZSEA 1YKSA 2JASA 4M1OA 4DJTA 4ON9A 4XOIA 4CW7A 1B23P 4MA4A 4Q1EA 3FFBA 1S9DA 4AI6A 4NCIA 1Z07A 5FI1B 2QAGA 5E3HA 4F38A 2ORIA 4QGGA 4EFNA 1D9ZA 5KSYA 3VX3A 3C15C 4HUQB 5B30A 3HR8A 2ZRBA 1D2EA 4F92B 1IHUA 3KL4A 3E5HA 1G3UA 2BM1A 1AGPA 2ZAMA 4IXNA 5J47A 3ZQ6A 1CU1A 1U90A 4BEJA 2XJ9A 1E1QD 2WWXA 2W6JD 3AVPA 2LKCA 4Q4JB 2GDJA 2J45A 1QRAA 4MRRA 1AJEA 4KODA 1G21E 4A0RA 3PXGA 3R9XA 1Y63A 3QG1A 2ZE5A 3NKVA 4IOLA 3SOPA 2PJRA 2PX0A 3BAFA 3QKUA 3J81k 1WQ1R 2F43B 1ZIOA 1E2HA 1GRQA 4URZR 4BFTA 2NZJA 1G291 3K0EA 4YONB 2FF7A 1ZAKA 4MUBA 2UKDA 4O2LA 5E95A 1MRNA 1N6OA 4Z54A 1XEWX 3RANA 2C2HA 1H8HD 4M22A 4X8LA 4AYTA 1U0JA 1NSTA 2VHTA 4Q48A 4YMWA 4PR0A 4EAQA 3UKDA 4HAUA 1COWA 4JIMA 3W3ZB 3SC3A 2GAOA 1NKSA 4JJKA 2BBOA 2QGZA 3LAWA 2EFGA 4JLPA 5F2EA 5DYGA 1X86B 2J7PA 4YDHB 2QZ4A 3TUJC 3VU9B 2DB3A 4O2RA 3VAAA 1NBMD 1P2SA 1QBKC 1VCMA 2PT5A 1XXHE 2VHUA 3BJIC 3BIFA 3QEOA 1KO1A 4LYFA 5KSPA 3N70A 4E03A 4HAWA 3IQWA 4WOPA 4HB2A 4Q4HA 3PEWA 1BIFA 4MYUA 5AR1A 3AGQA 2H7VA 3IHWA 4PHGA 4M1TA 3AVWA 3GLGE 1E2QA 3BH6A 2HEIA 2J9RA 4PSVA 2HDNB 3S1AA 4LWZA 2ZE7A 1P6XA 5AUNB 1P5ZB 1QHIA 1VIAA 3CX7A 3PQCA 1KO5A 3CRRA 4LUCA 3E1SA 1JXOA 4YXWA 3NEYA 1NY5A 3T61A 4Q7JB 1N0VC 1S2MA 2PL3A 1Z3IX 2FMXA 3JVVA 4B47A 2D7DA 4QM6A 1I4DD 2PZGA 1SVIA 2X2EA 5FOSA 3FYHA 2Q3FA 2JCSA 1OE0A 1E69A 4I4LA 3I92A 4U02A 5C4GB 4IOJA 5JWRA 2WWIA 1NKTA 4NKRA 5HTKA 4DDTA 4D25A 3LVRE 3GLIB 4HDCA 3IO3A 2Q9BA 4D81A 1VG8A 3HU2A 2IX3A 2IYUA 3DPUA 2VP4A 4KSCA 1FZQA 1W4BA 4TTQA 2ZU0C 1ESMA 3AKYA 2ZS9A 1H8ED 1E96A 1CULC 4DCUA 3JZMA 4HLUA 3LBNA 1KDTA 4JLJA 3DZ8A 5DN6D 3RWOA 3U5ZB 1KK3A 5H8WA 2V6IA 2FFQA 3BGWA 1XTRA 4B3CA 3THOA 4A6XA 2AWNA 2FFHA 2GXSA 4NCKA 2Z4SA 1VYUA 1SVKA 4RCYA 2N46A 2GAAA 3QNUA 4V0OA 5D3MA 5EXTA 1XPOA 4E5UA 1TQ2A 1MABB 1CJKC 4QBFA 2EFDB 3FTQA 1P62B 4ITRC 4DUGA 1WF3A 3DM5A 1OH8A 4RFSA 2LWIA 1VG9B 2OZEA 3GMTA 4TMTA 4L5BA 2GJ8A 5FPKA 1CR4A 1OFUX 1VPLA 2JJ1D 3CPHA 4MYHA 3WNDA 2WSSA 4TYPA 5K8LA 4E22A 2Z0MA 4LDJA 1I2MA 2GF0A 3Q85A 2JLVA 5B58C 1BYIA 4YMVA 1Z28A 1U9IA 2OCPA 4MGYR 4EPVA 3RRNA 4TMWA 5BN4A 1G6HA 3ZH9B 4P4UA 3U61B 3RSOA 3QI2A 2CNWD 2ZRJA 4V0MA 4QJ4A 2OT3B 3TR0A 1OYYA 1XMSA 1BMFA 4XWAA 2ZXUA 3K09A 2X19A 1K8RA 4LCBA 2IL1A 4JLOA 4JLNA 3UANA 1DAFA 1ZNXA 4Q66C 2YYZA 2IA5A 3BERA 4RD0A 1W44A 4WAUA 1QZXA 1GAJA 3EZ6A 5L3SA 1E1RA 1VHLA 5EZ5A 2AD1A 1QG4A 1R8QA 3RNLA 2LKDA 1MKYA 1BOFA 3RAPR 2O8CA 2QP4A 1N6NA 4AY2A 3T1OA 1EX7A 1LV7A 2J46A 4PQFA 3U7EB 4BLPA 4BECA 3B7GA 3AKCA 4ZDWA 3EA0A 4HB3A 1FOEB 1ESNA 4M1SA 5A0FA 1ZU5A 2A78A 1U0HC 5E4FA 4L9SA 5KU1A 3DZDA 4BUJA 4WIAA 3ND8A 4OI4A 2CXXA 2ZS7A 2CLDX 2CEAA 2AFHE 5TARA 1VCOA 4KCGA 3HWSA 2R6GA 5EXXA 1W7AA 3FMFA 4CEJA 5L3QA 1Z0KA 3T34A 4AURA 4LYJA 4C2UA 3WMFA 1OYWA 1PLJA 2ZUBA 3B8HA 1IJEA 4KU4A 1UPTA 4OJKA 2GEDA 4Q21A 2F3TA 2HYDA 4C0JA 4GP6A 2WJIA 5AJVB 1NVVQ 4BRUA 3Q7PA 5CJPA 5AK0A 3SYNA 5LD2B 2OM2A 1P72A 4OQFA 5E7IA 4D2IA 4LC1A 4QGAA 3U3JA 2GXAA 2YZ2A 4XVRA 4KVAA 3SHFA 3K0AB 6Q21A 4D26A 1OB2A 2FSIA 2WKRA 5JEEA 1A5TA 1R2QA 3MJRA 4LK2A 4B43A 3O8RA 4W5WA 5SZHB 1T91A 5AUPB 1KK2A 3UPUA 1NL3A 3QG5A 3LQQA 3U4QB 4PQRA 1JQLB 2JLWA 2W2VA 4FMBB 4LPKA 521PA 3IPYA 3KKQA 4G5QA 2XOKD 1RVDA 3I5XA 2NG1A 1Z2AA 2ZRNA 1W5SA 4RZXA 3QF4B 4QM7A 3HR7A 2NO9A 2CCJA 1GG2A 3IHLA 1CR2A 4JLAA 5BWMA 4MH0R 1Q57A 1XJQA 2REOA 2R6FA 3RS3A 3B5JA 5CDFA 3AP2A 1SXJC 3W9YA 4TYQA 3WBJA 4EPTA 5EUQB 1XPUA 1CR1A 1LFDB 4Y0VA 3SJZA 1XP8A 2R6AA 1CJTC 1JAIA 4IHQA 4B76A 1OIVA 4W7SA 2BJVA 2CBZA 1DBSA 3TSOA 2CVHA 2CL0X 2ZYVX 1RPZA 3GQBA 4EQ6B 4A2PA 1E2IA 3RABA 3KKPA 1TU3A 4TTPA 2OCBA 3SNHA 4IVRA 3A1TA 4KFUA 3VR2A 3FWYA 3M4YA 3MMPA 2JA1A 1ZM7A 5JFGA 1W36C 3ZLJA 3B1VA 2R6DA 4P31A 4ASUA 2JLXA 3CIOA 3V00A 1X1SA 1G7CA 4A9AA 5HZKA 2XNDA 1GKIA 3CW2A 2ERXA 2PBRA 3IIMA 4UXHA 4EUNA 1RRPA 1NI3A 5DI9A 2QAGB 3IDQA 4RKFA 1W46A 2P65A 5TV2A 1G3MA 3ND9A 1GILA 4NYIR 5EP4A 4OJQA 1IXSB 3RYTC 3WXMA 2O8DB 1N0UA 5JJLA 3IUYA 4A0GA 3RRZA 4ZKEA 1R7RA 2PLRA 3IO5A 1G1MA 3MWKA 4F7WA 4TLCA 5FL7D 4EJSB 1XU4A 4GZMA 4TYYA 1QHYA 2ZROA 4RY2A 3REGA 3E2IA 4C0KA 5HE9A 2ORVA 4O0MA 2QPOA 4JL5A 4Q9KA 4DCNA 4HZUA 3QY0A 1LS6A 2PH1A 4LYHA 3RWMB 1TL7C 3TVDA 1P60A 4F4CA 3EPKA 1F3OA 2DFTA 2XSZA 3D3QA 4PX9A 2YV5A 3ZGXA 4FWTA 1TMKA 1OHHA 2W83A 5EP1A 1FTNA 1T9HA 1W0JA 2O8DA 3AF0A 2ZI6A 5DIFA 1J90A 2C99A 2D2FA 2IC5A 1U8AA 2BC9A 4V0KA 4LJ9A 2P6NA 3Q72A 4A0HA 3AVVA 1XTJA 3HYRA 1US8A 3X2SA 1EK0A 5CYPA 2WBLC 1OIXA 4FI3C 2J7PD 2GZDA 1OW3B 2ZJ2A 1UKEA 2UZ3A 4D0GA 1IN6A 4KVGA 5FBQB 3PEYA 3LRPA 1TADA 4IEEA 4PAMA 2D3WA 2F1IA 4IDNA 1RKBA 1T0HB 2Q21A 1JI0A 3CF6R 4NHOA 2GVZC 3IKJA 4I1UA 2AXPA 1P2UA 3WNBA 1G4AE 1FP7A 3CX6A 2PZFA 1DELA 4FCVA 4C9BA 3EPJA 1GDDA 3AP1A 1IN8A 4BFZA 4P32A 1E9RA 1TQ6A 4IJMA 3QKRB 4JT2A 4B73A 3IIKA 3PEVA 2VHQA 1E0SA 5JMTA 2XTMA 2NIPA 2RGBA 4MRVA 5TB5A 2NPFA 1AKEA 1QHXA 1XXHA 1NN0A 4Q4HB 4YXWD 2QE7D 2GCOA 2IYTA 2JJ2A 2NTYC 1E9EA 4HAZA 1C1YA 1RRFA 5B57C 4KHZA 2WAYA 1G3IA 4M1YA 1E9SA 3NTUA 5FR1A 3X1DA 2BWJA 2IYQA
chains in the Genus database with same CATH superfamily
1UKVY 3D2CA 3JQRA 4M83A 2XUFA 3S1AB 2BZGA 2WWRA 2Y4OA 2J07A 3BJRA 3VUFA 3F3KA 1RAIA 1UWCA 1M2OB 1RYFA 1HYEA 5DYWA 4K9RA 3SCZA 5L40A 4G36A 1PW5A 2H8GA 4MUNA 1O8BA 3U39A 3ZD6A 3GYBA 5AVRA 2VPYA 4HLUC 5AOCA 2EYUA 2PCJA 2B21A 3NHAA 4EO9A 3HVRA 5BXQC 3ULKA 2P9HA 3QKSA 1H6DA 1WTCA 4L3VA 4MAFA 5KNCD 3Q3JB 1LU9A 4LJ5A 5DOZA 2WOOA 1A9XB 1VJ0A 3LY8A 4PPNA 2NYVA 4PN3A 1Q12A 3NYRA 4XLLA 1Z6PA 4Z0PA 5JAMA 3DL7A 5J4VA 3Q9LA 3FLMA 4EUFA 3KVYA 1V16A 4B32A 2CFTA 2UYGA 4L6AA 2G4VA 4CG3A 2CHUA 4KBYA 2R8ZA 1NHGA 2F2TA 3JR7A 2CXOA 2L42A 2YVAA 3T5DA 1BEZA 1C30B 1H23A 2BEUB 1E4YA 2V9CA 3ESXA 3TIXB 4QHTA 2FX3A 5HKBA 4JFAA 3GNSA 2BFFB 2YY7A 4HNAB 1WE2A 1LA2A 2GN4A 4MPPA 4BN4A 2GKGA 3R3UA 1EFTA 4BNVA 2QLNA 1DT3A 2Q07A 3SVLA 5DISB 4D4JA 3DVLA 4R1UA 5EWLB 1AHPA 3BILA 5K0GA 3K9WA 5I7RA 1HDEA 1Q7RA 2QTNA 1JQBA 2G9UA 1OIWA 3WGYA 3UGKA 3ONNA 3I76A 2IF2A 2WSSD 3BH7A 4L3WA 3N2NA 4XWWA 3W06A 2OP1A 2PL5A 1ZVMA 3N59A 1U9IC 3OP1A 1SBIA 1U04A 1Y3AA 2WSBA 5TF0A 6REQA 3DOUA 2IVFA 3S2SA 2CLIB 2WSLA 2F3SA 3K6RA 4P35A 1Y3FE 1F9AA 1A0OA 3W5BA 5FWXB 3V4OA 1QVVA 4X64B 4QU8A 3ZWNA 2H8KA 4YWHA 3MGCA 2XTZA 2JAUA 4KH1A 3GEIA 1ULZA 4C3ZA 2ZG6A 4TYWA 1QGAA 4X54A 4PE5B 4KPUB 5FQNA 1WD5A 1DQRA 2Y1LA 1G0OA 3HB0A 3DFFA 3RVJA 3ZBTA 4CUKA 4RJKA 3NMUF 3R6GA 1RC0A 1ZMRA 4PCAA 1UXIA 2XOXA 1E8NA 3D2AA 4Q7QA 2JZOA 4Y2PA 4LXXA 1QP0A 2BR5A 5AKHA 3EDRA 1VLLA 2VDMB 3CVOA 1EA7A 1N2XA 3D3WA 3NVAA 4FMDB 3TAUA 1RE0A 4AAYA 1D4FA 4PC3A 2W4QA 3SX2A 3VZPA 2QTZA 5CBKA 4ZVKA 2XE6A 2VHCA 1TTQB 5DFAA 4HZIA 4OQDA 3WOHA 4DQDA 1LPPA 3ABOB 1X7YB 4J4TA 2GBFA 2Z9BA 4P3OA 4A15A 2JIQA 2CV2A 1AA9A 1WABA 4RL4A 3S1SA 1JWLA 1AZWA 1ESDA 1QR6A 4C0SA 5TGTA 5LJLA 1INLA 1T2CA 1O0BA 1GAWA 2IIVA 3DWFA 5GY7A 3TBHA 1EFHA 2HA4A 1PGPA 3DDOA 3OSUA 1WSAA 4MWTA 4BQFA 4DWWA 4G0VA 4A0QA 4FXPA 1FBTA 4B7CA 1Y3DE 3HKCB 2KPOA 4EPRA 3FPKA 5FI0B 3DS8A 2P5TB 1PK8A 2B78A 2QYOA 3P2MA 1MTOA 5ELLA 1II8A 2NXNA 5LIPA 4E4YA 1MT3A 3N7TA 4XIIA 2IOHA 3KHTA 1N36B 4F5EA 2WP8J 1SG6A 3WBFA 5BNTA 1DAPA 1YVPA 4O8ZA 1ZMOA 2R25B 4YCBA 5EE1A 1DBVO 3RCBA 5JFOA 2ZI5A 5I9SA 1EB8A 5FP0A 5BRJA 2R00C 4MKZA 3S81A 2O48X 4EKDA 3DC2A 5AKJA 5ALSA 1MPXA 3QVOA 2C2WA 3P2YA 3JASB 4HYQA 3ZLVA 5ECYA 4PGAA 4AZVA 1OKKA 4CI9A 5M3BA 5C9ZA 3G5UA 1JQDA 4MRAA 1HT0A 4U0JA 3CLSC 2GX6A 2JCXA 5EVJA 2R5FA 5TQ0B 1PR5A 4FHEA 3AR6A 1D2AA 3U48A 1ZK0A 4N1AA 5E2IA 5AM3A 1FUKA 1WEHA 1YT5A 4TL9A 4EA6A 5JIBA 2V4MA 1T3ZA 3UOAB 5I7WA 4U7GA 5L3QB 3MUNA 4W1QA 4MQUA 2C5BA 4HH0A 4MZXA 3A7EA 3CS3A 3O82A 3VAAA 2ZT5A 1GPWB 2KJQA 3DJFA 4FDAA 4HNSA 1U0OC 1SVOA 4XM0A 1GRRA 3ICOA 1R5JA 1KC3A 4RQAA 3T06B 2BRUA 4CL3A 1ZLXA 3EIQA 5CFOA 4WBNA 4FR5A 5KJ1A 3RNOA 5AVQA 3IQIX 1Q14A 3WKBA 3GJZA 3IESA 1VLVA 3KHUA 4FX2A 3BWDD 4JA0A 2FKNA 3F8TA 4K5QA 1IIRA 4MJXA 4UC0A 4B74A 3A6FA 2JJQA 4F91B 3PJRA 4KQ2A 4NMLA 4TV8B 3S2FA 3RQIA 4H6WA 4LCEA 3R20A 4R40A 4Y8VA 1WTAA 5KOIA 5J3JA 3KTFA 3U4QA 2DF8A 3E03A 3LDAA 2KHZA 1I6LA 4PLVA 3WGTA 1QH1B 2O2ZA 3SMQA 4YUWA 2WB4A 5HW0A 4MZDA 3QBVA 4JD5A 3IOCA 3VC1A 3L1VA 1HF3A 4EEXA 4ARUA 3L0DA 4A6EA 4URXR 1NBOA 3GP8A 1F51E 2WQ7A 1BXGB 4Q9AA 2ETXA 3ZV3A 2QT9A 3WRVA 3QM1A 5ALOA 3V33A 4GOMD 1XTQA 4C08A 3GLFA 1MW8X 3KB8A 1G8AA 2X3YA 4S12A 2H1SA 5E4JA 3EC1A 1TVMA 1USVA 3C6KA 1U2ZA 3DZFA 1B14A 3PEEA 1MNAA 2C59A 1N2GA 4LDAA 3ZWYA 3ODPA 2BBWA 2WVJA 1UMDB 3E0QA 4PTZA 4X7MA 2Q8PA 5DT2A 5IDVA 2VZ9A 3TCKA 4ASUD 5EQFA 3K1YA 3QSGA 4B5LA 1JR2A 4QGHA 2I7DA 1CF4A 1ICEA 1KH3A 2I22A 2P91A 1I36A 1O94D 5AJWA 3W7AA 1AMUA 3FPJA 5DSXA 4NU8X 1T4MA 4CCSA 1W6RA 1H4VB 3A4TA 3HXKA 2C57A 4MW5A 1MHPA 1PT8A 2JAQA 2M6RA 4RANA 2YC2C 4QDZA 5ALEA 5FI3A 4TKZA 1LS1A 1WP4A 2GK7A 3OJLA 3P8ZA 4JBHA 3EX7C 4Z4CA 3IAAA 3U4AA 3FCYA 2JCGA 3LFHA 4BMOB 4RTNA 4LV8B 2C29D 5K0TA 3MS2A 1R3UA 5HE8A 3V1KA 4XEUA 1Z6AA 2Q99A 1GFZA 1LPAB 3H9QA 4ND5A 3ILXA 2XWSA 3TD9A 4CF5A 1PJQA 3W5JA 4DNOA 1Q15A 4BMVA 4IL5A 1CBUA 2I76A 3FDZB 5IVIA 4XTRA 1BA3A 1CP2A 1NUTA 1YHYA 4S24A 2WRZA 2ZYUX 3JSXA 4MNTA 4IS2A 1E6MA 3I2YX 2Q2WA 5B4UA 2ZIXA 3S5JA 1E1LA 2GM9A 4X61A 5D5QA 3WGIA 2H7CA 4XYBA 4O4HB 5NULA 3NT4A 4ZYXA 1SRQA 2BM9A 2DUNA 1JHDA 1EUCB 5BPHA 2AOWA 5ICSA 3IPCA 1RXWA 3ZHBA 3UJPA 1L7XA 3OT4A 2XH8A 4QKQA 3P52A 5KOHA 4HZUB 4BXOA 3VNBA 4DMMA 3JQCA 2C4WA 3EARA 1RTTA 5CHEA 1SG0A 4HXGA 2XGJA 4V1CI 1DIGA 3E3OA 5DX1A 1JAYA 3LSYA 4MW4A 1J06A 4Y0NA 1IBKB 5HCIA 1G98A 2W00A 3O75A 1KSJA 1Q7BA 2QHXA 4OK6A 5JCOC 2C7RA 3GNTA 1PL7A 2VJMA 3PJEA 5EJ9A 3U56A 2NYAA 4GSLA 1NMEA 2XODA 4B75A 3G79A 3K0CC 4PRYA 1S02A 3DAHA 1M8JA 2NUTA 4OQNA 4DA8A 2JKZA 2JLSA 4K6GA 4MTLA 1P44A 1SD5A 3A6JA 2FPKA 3CX8A 3GIDA 4MWSA 2Z57A 4HYEA 4JKOA 3ZW9A 1A50B 1DXHA 3ONWA 4MHSA 4UNNA 1W59A 1TKCA 2IEDA 4TN5A 3IUMA 5CT5A 1VQ1A 3T3DA 3V3TA 3D7SA 3VPBA 1F14A 3ZU4A 1GRVA 2JB9A 3LWNA 4LTNA 5AXAA 4TQUS 2WWYA 1FQKA 2J5KA 4LE1A 5H59A 4NIMA 1YDWA 5TVGA 3RRYA 4MUMA 2RD2A 5EE5B 1TZMA 4TUYA 3VTKA 3QLEA 3NQ41 3OEHA 1RHRA 2ZI7A 4HRAA 1FTGA 5FNVB 4OHBA 3SS7X 2VH1A 2ZJOA 1DC3A 2ZT6A 1SXQA 2XWQA 3DAGA 4ZVLA 4BPBA 1Z3CA 3W8RA 3FNEA 3VR3A 1XQXA 3AY0A 5TQ2A 2JGDA 4AMYA 3NGMA 3AG6A 1SWVA 5D7NA 2HHHB 3HY3A 1BH2A 4F9EA 2D2IA 1P1KA 4L50A 1BXRA 1KY5A 3F5FA 2IV7A 1OLOA 3B2NA 3KTOA 2F8MA 4N49A 4NFSA 3U31A 3R44A 1WB5A 1EVKA 3FM9A 4O1IA 2BI4A 3QNWA 5E9QA 3T7RA 3OFVA 4G97A 2GBLA 3PTZA 4DSZA 4TL6A 3DBRB 3OFND 2Y66A 3T95A 1IZ7A 1I2DA 4G5XA 1AKNA 3OKFA 1E6EA 4NYJR 2RGXA 4HNQA 4IVNA 4F8EA 3CTMA 1OXKB 3SBXA 3WA6A 3IALA 3WAJA 2F4VB 2F3UA 1KZ1A 1LQUA 3G2QA 2C1XA 4YB8A 1WMAA 5ECGC 3UB2A 3REOA 1UKCA 3UWPA 4TTAA 1YRAA 2X2PA 1JA0A 4LECA 1WSDA 3HSYA 4LNAA 2R1TA 5JSKA 1G5IA 2Z2YA 4DT1A 4OLBA 4URWR 4X6YA 2P3SA 2Y3IA 3T3IA 2FG7C 1ZOLA 3IT0A 4QBGB 4RVHA 3ZV7A 3PGVA 4GYYA 4H59A 1IJFA 4YWJA 4C7XA 3T1HB 3DTVD 4ID9A 2K87A 5KTYA 3X1XA 3DMGA 5U4XA 2B61A 2WM9B 4RVNA 4WGGA 1UC9A 1UZMA 1VMDA 1H0HA 4D0RA 5E1BA 5ERXA 2DYKA 4RA9B 1L9XA 5KIAA 1D4ZA 2ABWA 5LOVB 3MT7A 2ZKIA 4PAWA 1F6WA 4US2R 2H11A 4IX1A 1A82A 5EIOA 3ZE2B 3MTIA 5ARBA 4DUPA 3ADBA 4DMHA 1JH9A 1FS4A 3PDJA 2Z5FA 1CXZA 3ETLA 4IXTA 4CUZA 3OM0A 2F67A 2C58A 1THMA 3R7WB 3DTVB 1ZONA 3HUUA 3P9RA 2Q3HA 2HCBA 4MDHA 1GY8A 3NP7A 1SXPA 2WTXA 2Q9AA 2VK2A 3HN2A 4G5OA 1DWOA 1T9AA 4E46A 2HIAA 2XDQA 2F3QA 1L5QA 1Q7EA 2JDID 1HA3A 1MLDA 1ZNZA 4MEAA 2DETA 5D7BA 1KEZA 4CMGA 2FTKE 1TK3A 1KAEA 4HAYA 4RORA 5J4LA 2Q1SA 5EPEA 3SHQA 2Q50A 3QA3E 1RAAA 1UAGA 2ZRAA 3HLKA 3MRSA 4CMAA 2A9PA 3L77A 3THSA 1GZ3A 3Q0EA 4QXQA 5BQPA 4PHFA 2HQSA 4LF8B 4Y9DA 2X4DA 2AMYA 4P3KA 1ZJWA 4B46A 1XWFA 1P1BA 4PLFA 3D3EA 3KAPA 1M2JA 4ARIA 2BGUA 3CLUC 1N78A 4EJ6A 3KJXA 4ANFA 3BHNA 2D0OB 5JRJA 3CWQA 1NJ2A 1E94E 1YBFA 2ZAOA 2WUWE 3TXAA 3CNOA 2PGIA 1UK9A 4R1NA 4QVKA 2IV2X 1PJLA 5EWMB 5AXBA 4DANA 3BMCA 3IKMB 1LC0A 4C06A 4Z1OA 3AM3A 5JLJA 1VG0B 3ZH2A 2VP5A 4LKOA 4BNUA 2QBYB 1N0HA 2PUBA 3MCWA 4FHCA 2CC2A 3KZ1E 1M83A 2ECQA 3GELA 1PGJA 3QBEA 4QAQA 4D8VA 4HT3B 4B6JA 5DEOA 5B1SA 4KR7A 4DM4A 3NG1A 2PFKA 3PHCA 4R9SA 1Z82A 2I4MA 3U0VA 2IGBA 2YZNA 4RSHA 4FNOA 3RS8A 1USGA 3OT1B 2VSFA 4OAOA 1FNMA 1KDRA 5IXSA 3ROGA 1HQKA 2BFMA 3AJ9A 1IG0A 4EKYA 1LDMA 4JBIA 5KU7A 1A1VA 2I66A 2P40A 3K35A 4IZ6A 1PVOA 4P54A 3JRXA 2YHBA 4UQLA 1AK2A 1H0RA 1RI1A 2EGUA 2BJWA 2Z6VA 3BMXA 3FKQA 4M8KA 3F3MA 4MUJA 4QL3A 1YFJA 1TQ4A 5DU2A 3MGGA 2VWHA 4G9EA 1ZOIA 1YKFA 4JVMA 4AG6A 3CVJA 1RADA 2FEAA 2Q6KA 4BWVA 4Q34A 3W2GA 4I6JA 4P0QB 1NV9A 2EYQA 4PG5A 5LUBA 1XNGA 1RYDA 3UMCA 2AL7A 1GNTA 3KXKA 4BJ1A 1ULHA 4YIHA 3BS4A 4O0LA 3NXSA 5TEVA 1RLMA 2BDTA 2OXEA 4HEHA 2DPGA 5B6JA 1ZQ1A 4PC6A 2RHGB 2VSYA 3RYFB 4IRMA 4HDSB 3H4MA 1XEXB 2WKPA 2QTBA 3ICPA 4C6RA 2WF6A 3R0VA 2RGWA 5DV9A 1QYIA 2DHDA 3PQ3A 3S44A 3UJBA 3DCNA 2WTAA 5IKOA 2Z1MA 3ETJA 4CN8A 1ULSA 1WBBA 1L3BA 1ZZGA 2NO0A 2ZJAA 3HM2A 2O5RA 1YZFA 3CRQA 3LU1A 1H2AS 4PR3A 2DUWA 1CZUA 1Q0QA 2VN8A 4CIDA 1V9LA 1Z6GA 1W49A 1HTBA 4IH4A 1AKTA 2XMZA 4Z1MD 1Y81A 3CPJB 2DGDA 1ONPA 5KYXA 4MR7A 1W4AA 1X8KA 4LW8A 1MO2A 2B7CA 3ND5A 3PGLA 1LRLA 5BYKA 4GNRA 4YQFA 1SIUA 4G37A 3T38A 4PICA 5BSGA 2H17A 2CVZA 3VQTA 3RAGA 2BV3A 1P8AA 2H9YA 1ELOA 4A03A 4RIGA 1K66A 3REQA 3JVIA 1CNEA 4XE5A 2ZIUB 5FTKA 2AV6A 2RHTA 3BSYA 1XKLA 4HXFB 9LDTA 1R12A 4J16C 4Y3UA 3SSMA 1CZNA 1COZA 3I9KA 1ANKA 2BY4A 5KKNB 3NEAA 5CUQA 4KREA 2W11A 5EKUA 2PL9A 1VPDA 4O4IB 3WYDA 4EVSA 5JS8A 4MULA 1CDOA 2VYND 5D5PA 3V8RA 5JPIA 5K4AA 1ZY2A 3LFTA 4RZUA 5IHPA 2NZVG 4UULA 4XR9A 3PD0A 2VBGA 2F7SA 2JGMA 3FDIA 3IAFA 3W3AD 4BP9A 1K06A 4FMPA 5F7ZA 1QE3A 1QGED 5EMJA 3R8XA 5FYDA 4KXQA 4UXJA 2CMFA 1FJHA 3ANYB 1C8LA 3SVTA 3PB3A 4HWOA 4JLDA 2JKVA 1OX6A 1SK9A 1XRRA 1VA5A 2AFIB 1VYHA 2PKWA 2Q0SA 1EBUA 2PH5A 4I1YA 4WN9B 5I9TA 4D92A 3WRWA 3LZ6A 4IIJB 3TRDA 5CK4A 1GNQA 1LJUA 1PJRA 4G2TA 4DR4B 3N6RA 3TRFA 3B60A 1W36D 1EE2A 4UD6A 1I32A 2ZCUA 3V46A 3F4BA 3EVZA 5JATA 2YYAA 1VE3A 4N7MA 5CNIA 1WNFA 2NU7B 2E49A 3N8IA 1V4BA 5EXSA 3GD5A 1QRDA 3LWZA 5IG2A 1L4LA 1VKRA 1JIIA 2K6GA 1ACLA 2PKQP 2SICE 3CPEA 3VH4A 3THXB 5T6BA 4JY7A 1EG2A 4UQPA 4AX8A 1J1UA 2YV3A 1MZVA 3D8HA 1BRMA 4X1KB 2OFFA 1W36B 1MB9A 3MTGA 3O8OB 3RK1A 5KQGA 1QIEA 5DT9A 4PC7A 3RPEA 1EFPB 4Q02A 2I62A 3FCCA 5FXMA 3NIBA 5CNKA 2XQFA 4GAEA 5TGDA 4E1BA 1HFJA 3OCXA 3O31A 3W5SA 4EF4A 3TBKA 2PVPA 2ZRMA 2VHWA 4HGQA 4MQ6A 1GZDA 1NVEA 2PJZA 1X13A 2A1UA 4UHHA 3SQWA 3I4CA 3KTDA 2PUGA 1ACJA 5ANRB 2ZIEA 3V8QA 3PI6A 3MTBA 5HBGA 5TMBA 1KGSA 2Q46A 3KOWA 3RGWS 4OGWA 3TD2A 3I4FA 4CFYA 4E2YA 2FUCA 5HGXA 2G9QA 2WQZA 1E5XA 1VB5A 3LRXA 1NE2A 2DFPA 2NZ8A 3HJGA 5IK2D 5K20A 3OX2A 3ZJTA 1EFCA 4E5PA 2BMJA 4ZOLF 5E4TA 3IDZA 2Z8ZA 1SVNA 4MR9A 1QUEA 5FTJA 5FUWA 1DOZA 1X0XA 4AZSA 2O20A 2P75A 4MJLA 4BLVA 5EKXA 2WHQA 5JXJA 2ECPA 2P9QA 3N0WA 3BMNB 3DBVO 5JZOA 2PDAA 3UEOA 5LYJF 2J3EA 5AXCA 3ZHQA 4U0KA 2EFYA 4JI1B 4HLQB 4Q12A 3PX2A 1Z35A 1CJUC 1JAZA 1L9KA 2C0QA 3IKTA 2HQ1A 2QSZA 5LDDC 3K0CA 3WIDA 1TCBA 5BW6B 1PX2A 2AN4A 1IK4A 1U4NA 4LYDA 5IJ9B 5JQWA 2OBNA 3COZA 4G67A 4WDQA 1TI7A 1TF5A 5BUCA 3G89A 3SDZA 3ACCA 2OCLA 4UMVA 4DRXA 4GECA 3OE1A 1OZ0A 1VL2A 2IIQA 2NNWB 3L7OA 2AOTB 3NHFA 1SPXA 4HQKA 4QOEA 3WTBA 4YRDA 3ONEA 2YWEA 1Q3TA 3OX1A 4REMA 2COKA 4GKVA 4UNRA 2ZUEA 3TSWA 3AWDA 4U39A 2BCJQ 1J9ZA 2B1QA 1LNQA 1NOKA 3VBCA 2WNIA 3FVRA 1FS5A 3E61A 3TPFA 3V4PB 2FEOA 2JJYA 4JLWA 2C4UA 4MV1A 3GLGA 4UJ5A 1UIRA 1GZ6A 3NBKA 1N6IA 2X8JA 1LQTA 5C3UA 1SVMA 2BGKA 2I9KA 3ZW8A 5FLYA 2NUBA 2JGJA 4QPZA 3CJRA 2PA0A 3L8MA 2EKQA 1TM7E 3GBPA 1QANA 1I7SB 5I7HA 1UDCA 5A3VA 1ITZA 2KWIA 5DBIA 4G1MB 4BKUA 3O2NA 2WJ6A 3F6EX 3IB6A 3H83A 1SKBA 4KLAA 3JD1A 4RD2A 5TPWA 1G5TA 2C7VA 4UBMA 5CLLA 4LV6A 4Z53A 1V3UA 2XNCA 1J0EA 2RIPA 1J21A 3U0BA 2O8NA 2BKVA 2RAPA 4N65A 5FWAA 1E2DA 3IEKA 1YZNA 3DMDA 2BBSA 3DLBA 4F5YA 4YMHA 1D4AA 1T3SA 2TECE 1ZUWA 1X39A 1JSRA 3ZHCA 4QUAA 4GKAA 4OXKA 3FVQA 4H27A 3ETNA 3RADC 1BSVA 1WW3A 1TEZA 2WZBA 1A9TA 1NVUQ 2F1HA 2XECA 5C8YB 4EY4A 5ALQA 4D9BA 5LKRA 1YZTA 3BWMA 1W1UA 3SSOA 4OHPA 1A98A 1V5WA 4X95A 5LDGA 3H5OA 1ZOOA 2ZJ3A 3GPCA 3AIOA 5AKXA 5FJJA 1KK1A 1OXXK 1U9CA 3VSAA 4WZ6A 3HMQA 4HVTA 2XBUA 1NI4A 1F3LA 2B2NA 3IA2A 2ECKA 4JT4A 5DNAA 1NG1A 2GHIA 3O90A 5H70A 1E3MA 2HWYA 4KE7A 1H8EA 4S0ZA 1IN5A 3QENA 4QRIA 3TLKA 1E98A 5MGNA 1H4QA 2BD0A 2PMCA 1MO3A 2YMQA 1JDBB 3FX2A 1S5PA 2XQIA 3GLHE 3EZ9A 2CNNA 3SC2A 5FOVA 3M6WA 4KIFA 2JHAA 2DTEA 5DM70 3NANA 1RRKA 5ICCA 3UFXA 3M81A 3WK5A 4EOGA 1PP4A 2AUTA 2R68A 3A37A 4PZDA 3A31A 4OHXA 4R01A 4YAOA 5C7YA 4DLWA 4NJEA 2O50A 1G42A 1WXDA 1H1LA 2OCXA 2PT9A 5H02A 4AK9A 4LF5B 3CJTA 4FXOA 3M6FA 3IAEA 1NF9A 1VOTA 2DWUA 2Y1WA 3L7IA 3I9V1 3M5CA 4ZALA 3VVCA 4X66B 2JZNA 4OGGA 2IJGX 1U8XX 2RGUA 1FYEA 1SO8A 2L19A 3ECCA 2OHXA 5JPDA 1G6OA 5B2ZA 3G5LA 1VKNA 4EDHA 4IDDA 4G8CA 1PNRA 5AKGA 2GF9A 1ISIA 1OR8A 2JJ1A 1KXJA 1R5BA 3SBOA 1THGA 3EJ6A 2CDAA 3AUUA 1FNNA 2PYDA 5TSDA 4EHAA 2PZAA 5E8JA 3C41J 4MGHA 4GPBA 1RQXA 2GA8A 2CWDA 2HJGA 4AZ0A 4XB6B 1G2QA 3OE7A 4JGBA 3WGOA 4RE6A 3TYXA 2E6UX 2W0MA 3BCHA 4U2KA 1A8IA 2QMQA 2LNDA 2P4UA 4HLDA 1KZYC 3I42A 3PQ5A 3USES 3OCCA 4PIVA 4TKVB 3RFFA 3WADA 3QJYA 3UTDA 4EUSA 2XYGA 2FOLA 3W6OA 3FNIA 1E3JA 3KNZA 1X7XA 1CJBA 2VDWB 3DV0A 4PINA 4LQDA 2OD9A 5DM0A 5T8KC 1UM9B 1MVLA 3BK7A 3DT9A 3EIUA 4XUDA 5DDIP 4B7AA 2JLUA 2O52A 5HF6A 1CUXA 1IY9A 3KOXA 2IDMA 3UFBA 4LJRA 4K8OA 3QPAA 4WFQA 4YAFA 3NWOA 1G8GA 4ENSA 1SOWA 4ECAA 1X7ZB 3HBAA 4LN1A 1X1BA 1QB7A 5KQLA 2MR5A 3LT0A 1YS2X 5CCEA 1Z0IA 3KC2A 1Y8QB 3DZBA 3FUTA 3QELB 3HA7A 2G4CA 4RPHA 2W58A 4C30A 4LWPA 1TO6A 4KQ6A 4PTYA 4JQCA 4BVAA 4ES6A 3QE9Y 4LNUB 2C1ZA 4IS3A 2GKSA 3CHYA 1IMJA 2AFHA 4WCDA 5CH3A 4TMVA 2GK4A 4BN5A 5JVDA 4MWEA 3CX4A 4ZO6A 2VHZA 1HDGO 2Y1FA 3OZ7A 4YUZA 4HFNA 5MDHA 1F48A 2PX3A 2BUCA 3GRUA 2E6KA 2X40A 3JQ6A 5BUQA 3MMSA 2CVOA 4ZCLA 2F8SA 5FA6A 4DGSA 3MUOA 3MEQA 4LYGA 4MI6A 4LFCB 3CEJA 2P9GA 5E38A 4ZOBA 1VGVA 5IKEA 1EP3B 4H2DA 3MSCA 3RV3A 3TRHA 5JBQA 3ILYA 3HHEA 5LMCA 1YACA 4XQGA 2HQOA 3H9GA 3N87A 3MZ0A 3JD3A 4QFDA 4IP0A 4XWGA 1R0ZA 1Q0PA 1K97A 4R69A 5JNLA 4UPVA 4I50B 2V1XA 2BZSA 3H86A 2DWPA 4KQHA 4L15A 4PYMA 1S9HA 2A9KA 2RH8A 1I6KA 1MFZA 3GAZA 1WCIA 3N74A 4XDGA 1EVLA 1PR2A 2ZBGA 5KOJA 4HWGA 4CCYB 2F00A 3IR7A 5EUCA 3GUHA 3MCAA 1GXSB 3GHHA 4ZA2A 2HMAA 5PGMA 2PMBA 4N3BA 1XFDA 3RK4A 3RAFC 1LX7A 4XWYA 5K0FA 4YRGA 1R5NA 3MTQA 4TM7A 1PLLA 1CT9A 1VBMA 1HBJA 4ZIRB 1WEKA 4M46A 3T7TA 3DQZA 5BVHA 5DHAA 2HDHA 2ZIFA 3QFFA 2VBIA 3U3ZA 4DQLA 3D8BA 4KVFA 3NC4A 3PVZA 1N2ZA 4BLOA 3AJ8A 2VUSA 2VSOA 4MQLA 2UXBB 1AZSC 2C00A 2H59A 1DJLA 2VJKA 2YC4C 3DBHA 2GQ0A 3BE5A 2D7CA 3H17A 3Q15C 3Q40A 4FW9A 4S2UA 3L7NA 4UASA 4H7JA 1P5FA 2M98A 2NXJA 3L8GA 4WLNA 3UT5A 2BGTA 4BLTA 5AFSA 5KREA 1Y48E 1ZJYA 1HEUA 5IYZA 2BFDB 4K6CA 2R87A 4O08A 5AP9A 3JQFC 5HF5A 2IF0A 4EELA 5BY2A 1CDDA 3OTHA 4XVQA 2W6OA 2GJ9A 3REFA 2PWBA 1M6NA 3N0RA 1JT9A 2AC4A 3F6YA 4GL4A 4MIEA 1KDZA 4UPEA 2G1PA 1RM3A 1TZKA 3R24A 1CRZA 5ALFA 4R5HA 4EB3A 2EVWX 1QQ6A 2YZMA 1Y5IA 3ASZA 3BXFA 2BTQA 1CUFA 1KVUA 2GO7A 2W6CX 3KDAA 3MD0A 2V5AA 2XEXA 3MT0A 4LPSA 5EIWA 2Q5HA 3ZBQA 5E9AA 4NU5A 4G0QA 4AP9A 2EHDA 4XA8A 3EIEA 2ZWVA 3CB4A 4B4VA 2GPWA 3IEIA 3DDNA 1KOJA 1CNFA 1QDLB 2R6ZA 3OT5A 1I1HA 5KHOC 3GVCA 1IPFA 5KSZA 2EZTA 1I3MA 1ISHA 2C04A 1K7YA 5FA5A 2GUWA 3NWPA 2WM8A 4UXIA 3QEJA 1GTRA 1EGMB 2A0KA 2JC3A 4GZ5A 4HTAA 3HNRA 5F77A 2OOSA 2PT7A 3AFIA 4AY4A 5INTA 4ZYLA 4BVHA 4KWTA 4MQEB 5DJ5A 4W5HA 4KFRA 4ENPA 2A35A 5C18A 3VO9A 3P26A 4IJVA 1LX6A 1OYVA 1SUPA 4EP1A 1QFJA 3V7YA 5LLTA 4IXDA 1IFXA 3BL8A 5EJGA 1BH6A 3OZIA 2G1AA 3FF4A 5JSYA 1R66A 4Q7MB 4D4MA 4YRNA 2C5GA 1SGWA 3UB3A 4CG1A 3AUKA 1DTSA 1QG2A 3W79A 1XTSA 4AN1A 1W1IA 3F0TA 2AT1A 3HI4A 1HEIA 2RDMA 2RHMA 2HRCA 2VK1A 4LVNA 4DDUA 4PIMA 2HPZA 1YRHA 2I7VA 2YWCA 1CVRA 1RXSA 1UFVA 2XZLA 2YBDA 3WNQA 4B33A 3HDTA 3IXQA 5TPZA 1D2CA 1SC4A 2ZATA 4OHCA 5D3ZA 3TLGA 5AO9A 1DBRA 5JNSA 4G63A 1V7QA 3CT4A 3RC9A 1BGWA 4GMDA 1ZL0A 1HTWA 1PFVA 5L6LB 3NKFA 1FNDA 4BQRA 3Q88A 2C20A 1N8NA 2ODTX 4NYMQ 4O1MA 4KJXA 1VPTA 4M6WB 2QYHA 2IS2A 3VKHA 3HR4A 4ZAGA 2I7CA 2FWMX 3EVCA 1FFYA 1QGZA 1GQRA 1PYGA 1UOPA 3LLVA 2X0RA 4CKWB 2IDJA 3E3MA 4ZV9A 1NIPA 4WADA 2I7XA 5LWQA 1Y0BA 3OC0A 2OAGA 4WX2B 1F5NA 5DP1A 1Z62A 2F59A 3JWHA 3ELWA 3P94A 4BBJA 4CHGA 2HIGA 1M0WA 1U99A 3KETA 4BNJA 2OFPA 3CC8A 3UIEA 1BXZA 4R1LA 1Y3BE 5AQEA 1ZH4A 1BW9A 4FSDA 4X20B 1EZZA 2J5BA 1ZXLA 4CGYA 1XXHB 4ER0A 4EWLA 5LQAA 1F60A 2LBPA 4EI8A 3B20A 5IDWA 2WJ4A 1J0XO 4NOJA 2OKCA 2M9MA 1Z83A 2IHJA 3UMJA 1HNZB 1RQLA 4NCNA 4RXTA 3LL7A 1W1WA 3BHJA 3D8RA 4XUGB 3HVKA 4KPYA 2EEZA 4KMOA 1E9BA 1YVDA 3FPLA 1UM8A 2WPNA 4QYMA 4YRAA 4KAXA 3RUAA 3F96A 4Q1DA 1HDIA 3ICQB 3KT8A 5DYYA 5FR2A 3CV3A 3R9KA 1E1NA 2BFWA 3PNKA 4ESHA 3ZHOA 4F2PA 4KN6A 5ADVA 4PY2A 5F9HA 1KKMA 3ILHA 3WHIA 2FW1A 4MQ4A 1KZ6A 1L5KA 2OKGA 5ALNA 3OF5A 4NX2A 1CQZA 2FU5C 1CY6A 3IQDB 2Y1GA 4ME6A 4QO7A 3RSCA 2DG2A 2HMUA 3AEZA 4J2TA 4KRGA 2ZE8A 4WPGA 6NULA 4ZVMA 4X63A 4ZQCB 3FGNA 3WJAA 3AVUA 1UT6A 1LI5A 1JR6A 2X0JA 5FUYA 4KLNA 4B83A 1OXBB 4HG2A 4IOKA 4G0OA 4ZT7A 1P7YA 2ANBA 1F17A 4HL6A 1UEXC 2R3SA 3RIEA 1NUSA 1CS0A 1NULA 1NT2A 3RVLA 3RS5A 1TFUA 1XAIA 4FOOA 4MP6A 3WGGA 1C9KA 4B2PA 4V1CA 1U1FA 3I01A 2I3GA 2WJYA 1UBFA 2WAOA 3C1UA 4RIFA 1G66A 3N05A 3GUCA 3IV6A 4DA9A 1ATZA 1C0PA 3JYLA 1K2VN 1NJ8A 4HQRA 3EF3A 4JX8A 2XMPA 3AM5A 3SN6A 1N6LA 2BFBA 1PE0A 3GVXA 4L4YA 1KS9A 1ZG3A 2CJYA 3IEPA 4E5KA 2YNMA 3OESA 4NZPA 2WD8A 4NE9A 4G07A 4Z7JA 5CFMA 3OQNA 4RM2A 4K9DA 3PC6A 5G0TA 1N25A 2P2SA 1ZP6A 1JLHA 4NV0A 4BC0A 3GL9A 3AHCA 2J3JA 2VEOA 3SX0A 4O2AB 1JQAA 2HDOA 2FR8A 2QTGA 2H06A 3EWAA 2WWWA 1VXOA 2EIXA 2ZR8A 2BYTA 3OPQA 1MX9A 1QRTA 3ICWA 2AG6A 1XRNA 2XWPA 3GMIA 2XZDA 4OOEA 3U44A 2C97A 2XCUA 3GLHA 1CS4C 3V1LA 2FUNB 2ZI3A 4R2WA 2C54A 4A7PA 3VO2A 1WZCA 4IYJA 3UJHA 1N7IA 3MOIA 1LDYA 4ISBA 2VJPA 4V0NA 3PKIA 1RHJA 4ZQGA 1MDFA 2J1LA 1ZOPA 2HA2A 1BMDA 4J1QA 3RTGA 3VYVA 4IV5A 1EE9A 4TT3A 1FCJA 3H2YA 3U2QA 4YV2A 4ZMSA 2HO4A 4DPLA 2IYXA 3K9HA 1FP2A 5LU8A 1E1MA 4LHSA 3KYCA 1ULTA 4FNAA 1Q1EA 3T1QA 4C7MA 1UT5A 4CF4A 3PYMA 1CQIA 4CKXA 1CD5A 5JFTA 3LT2A 2BZ1A 4FC7A 1Y1KE 1CHDA 1KMCA 1J0CA 3BQMB 1Z4OA 4I1RA 4IJ5A 1KPHA 2H16A 1C3LA 1EFAA 2BSXA 3L41A 2P8JA 4RVDA 3GLSA 1W4RA 4L07A 5SZKB 1V5FA 4PZAA 5CTJA 3ZDEA 3NW9A 4DYVA 1WB6A 3AJEA 3IVRA 4X60A 4Q3NA 2YL2A 3K6KA 1X7GA 4WK0B 4WVLA 5KNBA 2NO4A 5T7BA 3M6XA 3L1HA 4EFKA 3D6HA 1DAIA 1V1RA 2NV0A 3KJEA 4F6LA 2A67A 3PHHA 4AQ7A 1K8XB 3A3YA 4D3ZA 1KYXA 3FAKA 2PK3A 2E55A 4C7BA 4QJ5A 1P5RA 1VE5A 1SXHA 2GYUA 4TLBA 5DHFA 3GUVA 5EE9A 2FWPA 2WFZA 4DR3B 5FOUA 2DKOA 3T9FA 4BMNA 1BJRE 2A9JA 3B6IA 2QSJA 1TA9A 5A3QA 1I5RA 1LVUA 3PUXA 1GQSA 1Z08A 3B1KA 4Y2RA 2WYUA 3L40A 1ZLYA 4X3OA 1ZN9A 3ZCQA 1PQYA 5K3DA 3T5MA 4KTVE 1X74A 1S8FA 1Q0SA 2CE7A 5BN1A 4AM8A 1YU9A 5F23A 2QY9A 2JH3A 3O9VA 4LOIA 2WHRA 5AUQA 2DBQA 2YJGA 4BU1A 5AESA 1JSZA 3F98A 1I7DA 3C5WP 3BMOB 3TUZC 3BRCA 1X9IA 3LBYA 5I8PA 1IATA 4WWHA 2GBGA 1GYRA 1DC5A 4PFKA 1ZNWA 1U0NA 1VE7A 1L7VC 4BVKA 4YS6A 5CB4F 2XCLA 4MV4A 4H7FA 4YK7A 5ALYA 1UDAA 4AKGA 4KV9A 1LZKA 1PJAA 4M21A 2I1QA 2YOHA 2OB1A 5FDFA 4JBWA 5CLQA 3HYCA 4ZZ0A 2AVDA 4E13A 2RGRA 1E9DA 1PEAA