2G1JA

Crystal structure of mycobacterium tuberculosis shikimate kinase at 2.0 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
159
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Shikimate kinase
publication title Crystal Structure of Mycobacterium tuberculosis Shikimate Kinase in Complex with Shikimic Acid and an ATP Analogue.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 59
structure length 159
sequence length 166
chains with identical sequence B
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g1jA00
2W0MA 2QQEA 2F43B 1E0AA 1P75A 1TX4B 2CBZA 4FCWA 3I5XA 3SEAA 5JHHB 2NIPA 5FUWA 3EIHA 2UVQA 1COWD 4V0MA 2WPDD 1GRNA 5L3VA 2ZM5A 4XH9B 2OBMA 4TN1A 2QE7D 1WXQA 4M0LA 4AKHA 1W36D 2BEKA 4LRWA 3IIKA 4ZDKA 3I8SA 3OE7A 1J8YF 2GZDA 1G5RA 3K0AA 3H84A 4Q4JA 4PQFA 4D0LB 3ZD7A 3NWJA 3SR0A 4I1UA 1AJEA 2WJJA 3U61B 3NDBB 3PUWA 2QY9A 5G3YA 3HU3A 1OFUX 1C1YA 4W5WA 4JVLA 5JHGB 4NYJR 4FCVA 3RRMA 3VR4A 4OHZA 1RRFA 4L9WA 3VMFA 2WVJA 1Z0KA 1QHHA 2QTHA 1QBKC 2FFBA 4N0EA 1DO2A 1EFRA 2HDNB 1CU1A 1WCV1 2QP3A 5GADl 1CULC 1E2IA 5JEDA 1GOTA 4DEYA 4MYCA 2JA1A 3SNHA 4PANA 1W5SA 2AR7A 4BFZA 3SYNA 2DFNA 3FKSA 1GL7A 3FOZA 4JS0A 2ODNA 1TU4A 2IYLD 4W7SA 4DLYA 1D8TA 3DM9B 3TQFA 4KYIB 3QIAA 4XVRA 4Q9IA 1KI6A 1J70A 4QHYA 5EP2A 4EJSC 2CLSA 4S2EA 2REXB 2PLRA 1XMVA 1NJGA 4M4SA 1ESMA 3LY5A 4MKGA 1OFIA 4A8JC 1W0KD 4L16A 2VP4A 1S4QA 4JLNA 1AZTA 3EARA 5GJWC 1XU4A 5P21A 5BN5A 4NH0A 1W0JA 2CDNA 2ZREA 4KLZA 4Q1EA 4XJXA 1XFAA 2ZSAA 1XJCA 4C2UA 3EZFA 3KKMA 1LTQA 1EK0A 1YQTA 5G40A 1SKQA 1ONBA 3OE7D 4IDNA 2KBFA 4LJYA 1HH4A 1Z5ZA 2VQSA 3U3MA 2CE7A 1IN7A 4IOLA 1N6RA 2QL6A 2VL7A 5LDDC 2RGAA 4UNQA 5KO2A 5TB5A 3TK1A 1SXJC 2H5EA 3QBTA 4NCJA 1M7GA 4AK9A 1O87A 1P9NA 5DYGA 1YZKA 5IK2D 3G82C 1ZMXA 2F1RA 3UG6A 3THYB 1JXOA 5JJIA 1UPTA 5FTJA 5CM9C 1AQUA 1HV8A 2ZEJA 1HT2E 4LHZA 2R62A 2QSYA 1LF0A 2VSOA 1ZP6A 2AFIE 1ZJ6A 4XSHA 3E70C 1P73A 1KI2A 2ZJOA 3ZQ6A 2HF9A 1G6OA 1UEIA 3SJZA 4WZ6A 2VP2A 1A4RA 2PT5A 4A82A 1UBCA 4UXHA 2D2FA 4OK5A 4D4KA 5JS7A 5DN6A 1SVWA 1PLJA 2REOA 3KKPA 4Q00A 3P27A 2A2ZA 3X1ZA 2ZROA 1S0UA 4M9ZA 4HLCA 1KJYA 1U8YA 4I81A 4A4DA 5JBQA 5JCPA 1KO5A 3QENA 3BOSA 4A6XA 4E07A 2XNSA 1II8A 2BV3A 1U8AA 4F4IA 3HU2A 4ILEA 1Z0FA 3VNUA 3TSOA 1GRQA 5EXPA 3K0FA 4DT1A 2BMJA 2J7PD 2FEOA 3PUZA 1KOFA 1P4SA 1E96A 2DWOA 3D31A 1NG1A 4BLOA 1D2MA 1MO4A 3QXJA 1CIPA 1EESA 4Q7JB 1Z2CA 1T6NA 1I2DA 1AS2A 1UM8A 4A9AA 2DFLA 2J87A 4IDPA 1PVOA 5CLQA 3VHXA 4ZI2A 1CLUA 5JWOA 3RHFA 1FQKA 1GTVA 4YDHB 1TQ2A 4NHOA 2FV8A 1IXSB 3QXXA 5A5GA 2W2TA 4LC1A 4CT5A 2IWRA 3SFZA 1M34E 5KSZA 2W83A 3HYRA 4UNPA 5FOSA 5DISB 3PEYA 3RABA 3EC1A 5JFGA 2WJVA 2ZRKA 1HEIA 2N42A 4B76A 3SHWA 3NH9A 1SKYB 3AF2A 1NBMD 1N6PA 4TLCA 4QHTA 3B85A 3AVUA 1Q1ZA 4L9SA 2IYVA 2QTVB 5DIFA 2G9NA 1G8GA 4DLZA 3BS4A 2R6CA 1WQ1R 3BERA 2IS1A 3B5JA 2XJ9A 4K46A 5DN6D 3LVRE 4Q1FA 4BUJA 1NVWQ 2A9KA 2Q3MA 3RRYA 1G21E 4HAUA 4URWR 1FZQA 4JT2A 4KI0A 4PHGA 1KK0A 4JLDA 5TXGA 3RWOA 3BAFA 4AIIA 4DDVA 3QF7A 4LJ4A 5FR1A 3TUIC 3QUSA 2V9PA 4OI4A 2J0VA 1KJWA 1Z0IA 1V43A 2C04A 4FD2A 1E9FA 3MWKA 3K1JA 4TYNA 3UKDA 1KI3A 1P60A 4V0LA 1H8EA 5FUXA 2H92A 2FZ4A 1P72A 4AY2A 4QM6A 2ZE5A 2UZIR 1K8RA 5AUNB 4G5OA 5EE0A 3DZDA 4NYIR 1E0JA 4BGDA 3TE6A 2AFHE 1Q1EA 3DZ8A 3IO5A 2VTKA 3O8RA 4KYUA 4PPQA 1KNXA 2ZRPA 4A15A 1Q1QA 2EQBA 2ZRBA 5SZHB 2EWVA 1W49A 1VG1A 1YR9A 4P4SA 1VKJA 2PLFA 2ECKA 3W6PA 4JKYA 2R6AA 1Z8FA 3SOPA 2VF7A 3OIWA 1SVIA 4DLTA 2NTYC 1HURA 4V0NA 4M1KA 2IYZA 3QE0A 5AJVB 1G8YA 3BE4A 2ZJZA 1GG2A 3FMFA 2GRJA 4N0DA 5BYJA 1YR8A 1U94A 3AF1A 3J81k 1OH6A 4H9GA 621PA 1YZLA 4NP6A 4WXRA 1SVSA 3BFKA 5BW8A 4Q1CA 2QP4A 3KB1A 2ZRJA 3BGWA 3U44A 1KGDA 1S96A 2Q9CA 4URUR 3MAAC 2C03A 3OESA 1JQJC 4IDHA 4JSTA 4MYTA 1FW6A 4TWZA 4B2LA 4D25A 2FEMA 4OQMA 2ZS7A 1SULA 4B3GA 1CR4A 4CIDA 3MJHA 2J41A 4TQAA 3FMIA 1VYTA 3RVBA 3K9GA 1BIFA 3QKRB 3LV8A 3T15A 5L3SA 2F3TA 5L3QA 2D2EA 1SXJD 3KKQA 1N6IA 3ZZ0A 2BMFA 2XOKA 3AKCA 4TLBA 1NL3A 1II9A 1OYWA 2ONKA 2ZR9A 3RNLA 1XD8A 2RB4A 3ND9A 4LV8B 2YC2C 1E4YA 2BKUA 2GESA 4LJ9A 4KFSA 4D26A 4EAQA 3D3QA 3EIEA 4OQXA 2D7CA 1XPOA 1G3UA 4R2IA 5C1BA 4IVQA 2VP6A 1W36B 4KCGA 4WZAE 4UXIA 4CEHA 3UMRA 3ZVLA 4Q47A 5EP3A 2IXGA 4JBWA 3BBPA 1TNDA 4PZZA 4GRAA 4JJKA 3A4LA 2VP9A 5J4HA 3SBDA 3B78A 2WM9B 2V55B 1T3SA 1VG0B 1E0SA 1F2TB 2ZJ5A 4LBVA 1QVAA 2FNAA 3B8HA 1DAEA 2AKYA 4PQRA 3OIVA 4MGIR 4PR0A 4Q19A 5GVRA 3FMOB 3HJNA 4Q4HA 2NPFA 2GEVA 3JZMA 2A5FA 4BLPA 1A5TA 4B74A 3BXZA 5BWMA 1TPZA 2C2HA 1XF9A 2ODEA 2OM2A 2IUUA 1XTRA 1ZNYA 1II0A 4MRNA 3LBNA 3WYAA 2SHKA 2PJZA 4KITB 4UNRA 5F98A 4ZCLA 2YWEA 3GJ8A 3PEUA 4XTRA 4PXAA 4WAUA 4EKDA 2VF8A 4UNNA 4XTCS 2BIFA 3B1ZA 4A0RA 4ZIRB 3F5FA 5EE5B 2GZHA 5DSZA 4LYAA 1KZ7B 2OXRA 2XOKD 1P2TA 1IN8A 5E7MA 3FKQA 1ZCAA 3CF2A 2A5DA 4GZMA 2HLDD 3P26A 1DELA 2FMXA 2YZ2A 5FI1B 5EXSA 5C4GB 1VHTA 2EYQA 3GJ5A 3ZVMA 1R7RA 5FBVB 3IILA 5J4YA 3EIQA 2JLYA 2O8EB 1AZSC 2FGKA 2PCLA 2GJSA 4F7WA 1YR7A 3QOFA 5FPSA 4BFUA 3AVOA 2P6UA 2XB4A 1EWQA 1MH1A 1KHTA 1XMJA 1GL9B 3PENA 3U2QA 3BWDD 2ZPTX 3E5HA 5FBLB 3MD0A 3RS2A 1FQJA 3EC2A 4JLPA 5L8VA 3A1SA 3QJYA 2MMCA 1KDRA 2QTFA 4G3XA 3FFAA 5CIQA 1U90A 3LVQE 1Z07A 2CK3D 1MRNA 2F9LA 3CONA 4QRHA 4FMDF 1XX6A 2ZYVX 4C9BA 4DDTA 3EWSA 4DLSA 5EE3A 1WA5A 4RSGA 2QAJA 5EUQB 5C18A 1UADA 4F4CA 4Q4AA 1WE2A 2F55A 2EVWX 4MA4A 3IPXA 2G1KA 2O8CB 4RZ3A 2ZE8A 4MYUA 1YRBA 3SS8A 2CVFA 2P3SA 1TTTA 4KFUA 2JLXA 1GVNB 5CIWA 4XD7D 1C4OA 1P62B 1DOAA 1GWNA 3A36A 1XD2A 4B73A 3LQRA 1U9IA 2W6JA 1OH8A 1DAHA 1OT3A 2KJQA 4IFEA 1L8QA 2FG5A 2WZQA 2P2LA 4Z8XA 2XEXA 5EQTA 3CX7A 3VKWA 2QGNA 4ITRC 3I61A 4QBIA 1XDBA 5KNBA 3TW8B 4LJ6A 5UKDA 4GZLA 3LD9A 1CP2A 1QHGA 1R5BA 1Z6XA 1XNJA 1KZGB 3ZS8A 1Z22A 4KV9A 3O8BA 2HYIC 3SHFA 2PCJA 3TAHA 1G5PA 4IEIA 5HTKA 1PJRA 3QXCA 1KSHA 1MV5A 3R9XA 3CRQA 1QHSA 5DI3B 3T12A 1YZUA 2PMKA 1KI9A 1LFDB 3PV0A 4Q1AA 1W2HA 3CRRA 1SVMA 5G41A 2BDTA 4CF7A 1V5WA 1ANKA 3W3ZB 1LW7A 2Q6TA 5CB6A 1Q44A 2WOJA 3T61A 1QRAA 4M1WA 4A0HA 5F2EA 2ZRMA 2ZU0C 3BJIC 1YZTA 3TR0A 1X8KA 4JKIA 1DTSA 1DO0A 5CITA 2KB0A 1W36C 2IC5A 3EAQA 3KKOA 5EE9A 1OH5A 4EIWA 1ZAKA 1T4GA 2I3BA 1CJVC 1S8FA 4LPSA 4O2RA 5KSOA 1YHNA 4C0KA 3W6OA 5KSPA 1JPJA 4V0OA 4D4JA 2XNDA 121PA 1CRQA 4OK6A 1PLLA 4HAVA 1E2PA 4M1MA 5DO9A 5LB4A 2NG1A 4LBWA 1AM4D 3SJCA 3TW4A 2F6RA 4HLUC 3A1UA 2WIAA 4KO8A 1P2UA 1OFTA 1LV7A 1US8B 1E9SA 4MGKR 1PLKA 1ZU4A 2QM7A 2R2AA 2CXXA 3GLHA 1X1RA 2P65A 1SVOA 4YMTA 4QGFA 2V3CC 4M21A 4KSBA 4ZDIA 4GP7A 3K0SA 2O8FA 2OSBA 1ESNA 4LJ5A 4M22A 3TJZA 2ZQ5A 4A0FA 4GMXA 1IN5A 2GHIA 4A6PA 2QPOA 4LBZA 2O8BB 2GETA 3UG7A 2JGNA 1DS6A 4EPVA 2QRNA 3NKVA 3QKSB 2AHOA 4JLOA 1CS4C 3EX7C 3CNNA 3EPJA 2ZS9A 5FL7D 2P5SA 1S2MA 1RRCA 3SC3A 1SVKA 1TF2A 4WIAA 5AJWA 2QG6A 1CJKC 4A2PA 3SBEA 1JBKA 3N2IA 1S1MA 2FPLA 1NN0A 2JEOA 2WKPA 2RGNC 3GLHE 3OIYA 5FI0B 3B60A 4DCNA 3MWLA 2QZ4A 1R8QA 5H1YA 1GDDA 3CX6A 1M7BA 3DPUA 5TARA 1Q57A 1Z0JA 3T34A 2ODWA 1GNQA 1T3HA 3OFNA 4M1OA 4B34A 3U3RA 3DL0A 4LGMA 4NE2A 1NY5A 4PPFA 3EPLA 2ZSEA 2GCOA 3I62A 3NDPA 3REFA 1DG3A 1LB1B 4QJ4A 2LKCA 2ZR7A 4LBYA 2OBNA 2DHRA 2IYWA 2KSQA 3C41J 3FMPB 4JVSB 2YJTD 3IBGA 4MKFA 1DVRA 2QORA 4NTZA 2GF9A 3K0CA 4D81A 2QM8A 1AGRA 3IQWA 3GJ3A 1OIVA 3VHLB 4L4UA 1AA9A 1JR6A 3MMPA 2W00A 4U5XA 1VCOA 3ADKA 3HWSA 4LPKA 5EP4A 2VIIA 2PZFA 2BKEA 1L4UA 3QQ5A 1NKSA 3QEJA 2TMKA 4OJKA 3FHTA 3RANA 4LWZA 2GJ8A 2GTPA 1PUIA 2NO9A 4YMUA 3TSZA 1KKLA 2A7QA 2ZJ8A 4IKEA 3OEED 1M6NA 1T0JB 2VYFA 3NBFA 1UBEA 1Z6TA 4AYTA 1ZC3A 3K70D 1SXJB 4LHVA 4AWXA 2NO1A 1OHHD 1TU3A 4AI6A 4OHWA 3ZH9B 3IO3A 2IF2A 4DRZA 1S3GA 3RS4A 2J59A 1ZVQA 2Z6VA 3QSYA 4QFMA 4BLSA 4C0SA 3BD9A 1XBTA 1JI0A 1BO6A 1U98A 3EZ2A 1DE0A 5BQ5A 1KI8A 4ESHA 3VU9B 1UDXA 2YVUA 4K81B 4DXAA 4TSFA 2ANBA 4JLBA 4JLVA 1RVDA 2R65A 4B43A 3R9WA 3KFXA 5FUYA 2G83A 4XSGA 2J7KA 5B2ZA 4F91B 1HQCA 5F9HA 3A6PC 2ZRDA 1RZ3A 3VKHA 1JR3D 4O2LA 2KWIA 5FOVA 1U0JA 3OAAD 2N1BA 3EZ7A 4QJ5A 1N5LA 1N0UA 3G5UA 4Q7MB 4OYHA 1ZUIA 2YINC 2IS2A 2FFQA 3CB4A 1D9ZA 1M1YE 1ZNWA 2OCAA 3U4QB 4B47A 1E94E 3GLGB 4I4LA 4OI0A 5FFMA 3H2YA 3WNBA 4PPNA 2HJVA 4OK3A 3TUZC 2BOVA 1BH2A 4TYPA 3UMSA 3F0TA 2WSSD 1N6NA 4YXWA 1FUKA 3W90A 4X8HA 1B23P 3VAAA 4D80A 1ZM9A 4A1FA 3ZZUA 3VTKA 4ASUD 1DARA 2B21A 3PFIA 4OQLA 2XXAA 3W5JA 1T5IA 1X3SA 2PZGA 3DKVA 2J0UB 2ZRAA 3PITA 1ZD8A 2OO7A 2P5TB 5AJZA 4JT4A 3PXGA 1OXTA 3WNDA 3NG1A 1YU9A 4MRPA 5DHAA 5HR5A 2CL6X 3P20A 2KE5A 2QPAA 3KXIA 4EFNA 3CUEF 1VCIA 3GLFA 1NIJA 5GJVC 3NBYC 3FVQA 4V0ME 1KI4A 4RD2A 2Q21A 2Q0HA 1XXHA 2O5VA 3MCAA 3TH5A 1NLZA 1UAAA 3KXKA 4H1VA 4IOJA 4PC2A 3GLIB 1ZINA 1T91A 2EFEB 1OYYA 221PA 1G7TA 1BMFA 2XX3A 1E69A 4HUQA 4BFWA 1N0VC 3TSWA 4F4JA 3KX2A 2AXNA 2Y8EA 4TQ9A 1TQ6A 4JLAA 2BBSA 5KPDA 3GPLA 3V00A 4LCBA 4HEJA 3PEVA 2O8CA 1E2MA 1CR2A 3AQ4A 3N5CA 3O47A 1IY0A 5HKKA 3GLFE 3K53A 3AF4A 4BPBA 4EQ6B 3THWA 1XEXA 5FOXA 5CJPA 1RKBA 5KOYA 3KQKA 3EA5A 1ZIPA 1XXHE 2QAGB 2B7BA 4Q9LA 3NC1C 4LYJA 4UQOA 1Z0DA 3CLVA 1UKYA 1Z28A 3A58B 3GEIA 4HAWA 3Q72A 3B9QA 3CZQA 2JLSA 4OQFA 1J8MF 1S9DA 2JJ2A 1Y3AA 2R6GA 1MKYA 5SZKB 2XZOA 3VFDA 3WYGA 4C4PA 5B58C 5IRCD 4PSVA 1N5JA 1ZM2A 3K09C 2H16A 5ANRB 1HA3A 3AP2A 4YQFA 4G5QA 1IBRA 1YZNA 4NU0A 2J45A 3SZRA 1G64A 2VSFA 4TYYA 3OZXA 1XB2A 2G6BA 2NGRA 2WJHA 2WWHA 4RZUA 4HDCA 3RSOA 1E99A 4KLNA 4BEBA 4D6PA 3QPWA 2IHBA 1MABB 3B1VA 1Z6GA 1EX6A 3BIFA 1XJ0A 4BE7B 1EFRD 4F38A 4GBMA 1N6HA 4C0JA 1IJFA 1PUJA 2HV8A 4GI7A 4AKIA 4TT3A 5FTKA 1EWRA 4NL4H 4EPYA 4C0BA 1CRPA 2VHQA 2G0NA 1DBSA 5K8LA 3FKSD 1CR1A 1R0ZA 1ZD1A 1P2SA 4LOAA 1L2TA 4ON9A 3THOA 5BYKA 1FMJA 2NO6A 3B82A 5SZJA 1NF3A 3K9HA 3U6BA 5D3MA 5JEEA 1R0YA 3IIMA 1GAJA 5E95A 1W4BA 2E9SA 3KB2A 1LS6A 3CH4B 3L0IB 1WMSA 1JQLB 4QBGB 3AB3A 3DDCA 2FU5C 1HQYE 2QROA 4V02A 4NPHA 2GAAA 2OG2A 4US0R 1WB9A 1P6XA 2IXFA 1JNYA 1KSJA 1Q1BA 1DEKA 421PA 4B6EA 3AH8A 1J2JA 1RJ9A 5M04A 3V4FA 1H65A 1F2UB 1W0JD 3M0EA 1CBUA 4GFDA 4RFSA 2C95A 3VR1A 3S1AB 3WBKA 1N5IA 1U8ZA 1X6VA 4EPXA 2GBLA 2PEYA 4WVFA 4GSYA 2O8DA 2O8BA 3FGNA 1YJ5A 1OKKA 4R71A 2G88A 4RZ2A 2C78A 1E2GA 5EXXA 4V03A 5FL3A 1Q3TA 2V6IA 4Q48A 1OB5A 5J5CA 2EFDB 1G8FA 2YHSA 5ELXA 1D2NA 1LY1A 2WIBA 4V0KA 1OJLA 3I3SR 3TUJC 4HUTA 1LF5A 2A5JA 2YV5A 4J0QA 3I72A 4Q9JA 5AUPB 4NCIA 3VX3A 2ZRFA 4QJ3A 5JJLA 1XP8A 4BFSA 2AD1A 5L3RA 2YNMA 3QG1A 3L8YA 4Q9KA 1CTQA 1H8HA 2QQ0A 2ZI4A 1S1CA 2ZI7A 4B3DA 3SYLA 2W6IA 1AS0A 5A4JA 2ORWA 1YKSA 4NYJQ 2YKGA 2CJWA 1G8HA 2Z5FA 3L0OA 4M8NE 3D6TB 2H7VA 1WDTA 2QBYB 4PO1A 4EJSA 3FDIA 1GM5A 4YLGA 4W5HA 4R98A 4RJLA 3H86A 5FTNA 1ZM3A 4HAZA 4A8JA 3C15C 3A37A 2FZLA 1Q20A 3SQXA 4PFSA 4QGAA 1NNEA 2GDJA 5F9FA 1G291 2RKOA 5A0FA 4JBYA 2BCGY 1KY3A 1TEVA 2B6HA 2ZANA 1R4AA 3MGCA 4P31A 4IW3B 3GJ7A 3RS0A 3VQTA 4ZI3A 2XZPA 4TL8A 5TY0A 1VDZA 1W46A 1G17A 2ZYTX 4CEIB 4QGGA 2GK6A 1XTQA 4ZKEA 2QAGC 4DUGA 4EFLA 3T5DA 3B1XA 4LSGA 4IDOA 4MDFA 1N3BA 2CL0X 4PTLA 1UBGA 2WWIA 1IN4A 3HR7A 1UDWA 4ZKDA 1LS1A 1T5LA 2RGCA 3K70B 4QNMA 3B9PA 4P4UA 1E9CA 3TNFA 1IOZA 1TF5A 3CR7A 2B8TA 2DFKB 2X2FA 1C9KA 4QHSA 3QG5A 1F60A 2IYXA 1KKMA 4BZQA 3KTAA 2ORIA 2NO0A 4CEJB 3ZDQA 3D8BA 4BRUA 5KPJA 2MSDB 4PQYA 4X8OA 1FX0B 4C0LA 1H8HD 1XMIA 1IXRC 2BEJA 2GF0A 2OLJA 1E1QA 1JECA 3OF5A 2VHJA 2W6ID 1N0WA 2QA5A 1E32A 3CO5A 3DM5A 4KODA 3LLMA 3A1WA 3AF3A 5LBIA 1AS3A 2K5UA 3RRNA 4Z54A 4DCSA 4KBFA 2RAPA 1GUAA 1NMYA 3NBZC 3R9IA 3WRXC 4ACBA 3PEWA 1G7SA 2HXSA 1D9XA 1T9HA 3LQQA 3KUDA 1YRAA 5JECA 1BOFA 2WSMA 1T8TA 2OCYC 1N6KA 1KMHB 4OKSA 2YOHA 4DC9A 4QM7A 5GJCA 3UWOA 5B64A 4AD8A 1F48A 3R7WA 2F43A 2OXCA 3ZJYA 4B3BA 1YZQA 3N70A 4Q1DA 1P7CA 2CHVA 4ARZB 1E2JA 2HT1A 2GZAA 4YMSA 4A92A 2WWFA 5JS8A 1EX7A 4DSUA 1H8ED 3LNCA 1E1RA 4FN5A 4CVNA 4NYMR 1OH7A 2PT7A 1E6CA 2AK2A 5AUQA 2QT1A 4HATA 3CWQA 4UJ5A 3GQBA 2CCGA 3PUXA 4C7OB 1U81A 1NMZA 4B2PA 4ZPXA 4FXPA 1FP6A 5AJYA 2VRWA 3NTUA 4TLAA 3X1XA 3AVVA 2J46A 4FI3C 2N46A 1BYUA 4G5RA 4NKRA 2Q9BA 3FPAA 5CK5A 3TRFA 2JLRA 2V4ZA 3AVTA 5JJKA 5AK0A 4LZZA 3DOFA 2CNWA 2MMGA 1U0HC 3U3JA 1ZCBA 3W34A 2CCKA 3T1OA 1J99A 4A0GA 2LKDA 2YWHA 5J4VA 4HB2A 2QMOA 4YMWA 1G7CA 2GA8A 4KU4A 4RZXA 2J3EA 3IIJA 2ZU6A 3L0SA 2OV2A 3WHKA 4A2WA 2CMKA 4UJ3A 3WMGA 3PUYA 5JSZB 1ETUA 2GEUA 4RD0A 1IQPA 2ZJBA 2W2VA 1VYUA 2DBYA 2GK7A 3QF4B 2ZS8A 1JEDA 1GP2A 2LCFA 3TGPA 1EFUA 1VYVA 4KFTA 4N1AA 4HZUB 3VR2A 2VBCA 4MUAA 1TADA 3A4MA 2ZJ2A 1I4LD 2IEYA 2A78A 2O0JA 2CCJA 1ZD9A 3CH5A 3Q7PA 4NBSA 3BRWD 2OFXA 1R10A 1X8LA 4IOKA 4DSTA 2G77B 1XEFA 3OEHA 5K8IA 1E79A 1E1RD 4M2LA 2HEIA 5HPYB 4URVR 2IEZA 3I92A 3RWMB 2FE4A 4QC2A 4CW7A 1R2QA 4Q4JB 4C2TA 4IXMA 4PC3A 2Z4SA 2FWRA 3U3OA 1AIPA 3WMFA 1KDOA 4M9QA 3KKNA 5DLQC 2BBOA 3K70C 3BH7A 3AVQA 4Q21A 4NYIQ 4O0MA 3THYA 2CL7X 4LHWA 2IYYA 4XOIA 2JDIA 5BN4A 2C9OA 2FA9A 4IRUB 2ZR0A 5LPNA 4TQUS 4C3ZA 3CR8A 1DAMA 3P1JA 3GFOA 1QHHB 4JL5A 4DB2A 2W2XA 2F9MA 5FUVA 2GJ9A 3JVUA 4QOSA 1KI1A 4BECA 4Z1MA 2VLIA 3NEYA 3FHOA 1A2KC 4ERNA 1G3MA 4RKFA 1E2DA 2XSZA 2ZTSA 1NJFA 2ZUDA 2JLQA 1VIAA 3CNOA 4BQSA 4WA7A 3HPRA 1P3JA 4NMMA 4Q7KA 5AWFC 4AG6A 4ZDJA 3CX8A 3CRVA 1NVVR 2WAYA 1KI6B 3RSLA 3Q3JB 2JIZA 1JB1A 1OB2A 1AKEA 1E0KA 3UWKA 2FN4A 2EWWA 4DZZA 1RRPA 3LX8A 1TQDA 5FBQB 4BLTA 2IX3A 2WBLC 2HYDA 4Q02A 3BB4A 4F93B 2ZRNA 2WMNB 5KNDA 3BFXA 4D0GA 2VP5A 4U7DA 4YC7A 4MH0R 1RFLA 2FSGA 3AKYA 1A7JA 1KY2A 4Y0VA 4L8GA 4BFVA 4PX9A 1KDPA 4PC1A 1XZPA 4N3NA 1LVGA 2RHMA 2DCUA 1OXSC 8OHMA 1ZNZA 2VEDA 3VR6A 1JJVA 1CEEA 3ZYCA 4B3XA 2YYZA 4Z51A 3PCRB 4MQBA 2HUPA 2H17A 5JZVA 5KDLA 2BMEA 3I32A 2R6DA 1SHZA 2J9RA 2FX3A 1W4AA 2OCBA 5K8TA 1VG8A 4JL6A 2VH5R 2V1XA 3KJHA 2IBMA 1KK1A 2RGDA 3DOEA 1NVUQ 5IT5A 4IJMA 4DHEA 2WJIA 2QBYA 1TQ4A 4Z1MD 2NMVA 2W6JD 3AGPA 3UMFA 2F1HA 3ZZTA 1R0WA 2ZSFA 4L15A 3UK6A 4IEEA 3EASA 2G3YA 3EG5A 2IS4A 1U0LA 1FFHA 2V7QA 3B7GA 4MITA 4M9XA 4OJQA 3A1VA 3FHCB 1R6BX 2EW1A 3IBYA 3FE2A 4DLRA 3O8DA 3MUFA 3U3KA 1X86B 5JI2E 2JIZD 2FF7A 1SKYE 1WBDA 4EPWA 4WZBE 1DG1G 1IONA 4FINA 2UZ3A 3ECCA 1ZBDA 3SE0A 2WWGA 2C9CA 4TZ0A 3ASZA 1II8B 2GJKA 5EXTA 2BMDA 1GKYA 1KO8A 2QRZA 4PSKA 3E1SA 4TLEA 4A36A 2EYUA 3LDAA 4HDQB 1G19A 4Y0AA 1J90A 3KXLA 4AYXA 4E09A 821PA 3I5YA 1WP9A 4DT1B 2IK8A 4HDOB 3HDTA 3Q7QA 4RD1A 4LJAA 3TVDA 1NP6A 4IHQA 4DLXA 5HE9A 3KQHA 1EFHA 1QG4A 4NCNA 5CYOA 3BH0A 3A1TA 3JVVA 1G8PA 3LX5A 4KBGA 4OL0A 5E4FA 4YDSA 1ZUHA 1E9DA 2AN9A 4U02A 1NG9A 2D4HA 5E7JA 4B2IA 3I1FA 3NBXX 4CEJA 2O0KA 3CW2A 3ZIAA 4JLMA 4ZDWA 1IY1A 3RS3A 1X8JA 1XTKA 2CE2X 3B13B 3LBIA 1KDTA 1NKTA 2RMKA 2XNDD 3PQCA 5J4KA 1GILA 5KTYA 3A4NA 1DAFA 3QVVA 4IDQA 4TTPA 1KMQA 2ZAMA 4MGZR 4JJZA 4M53A 2J0SA 4Q1BA 4DCTA 4D0NA 2QENA 5DHFA 4BZXA 2BVNA 4RFVA 4DLUA 3BK7A 2RGBA 3CF0A 3L2OB 3QKRA 1QF9A 3MSXA 3R20A 4R2HA 2P67A 1W44A 4KAXA 4DBLC 1G9XA 5LD2C 3TQCA 1TF7A 1GL6A 5AR1A 1NSFA 2OBLA 3ZLJA 4RY2A 3CZPA 3KJIA 1Z47A 2AWNA 4LX0A 5DGXA 4IFBA 4ARZA 3BH6A 1UFQA 3EXAA 5KSYA 1COWA 5FTMA 2WPDA 3AV0B 3PIRA 5FPTA 4JSYA 4G5GA 3W6NA 2CHGA 2GXQA 2ZIAA 2QE7A 4JYCA 3W8NA 2J0QA 1VIYA 3NEJA 2XJ4A 3MJRA 2ASEA 5B30A 3RC8A 4TTRA 4US1R 3L43A 3KL4A 1RPZA 2ZRIA 3VX4A 1R0XA 4B48A 4JLJA 5D3QA 1I4TD 3OFND 3T35A 2YWGA 1F3OA 2F1IA 2ZE7A 4PAMA 1Z29A 3KZ1E 5C2JB 4H1UA 3DMDA 3DVLA 3CNLA 2V6JA 5EE1A 5IDVA 4OI1A 3W5IA 1F2TA 1VTKA 1W5TA 4P4SB 3AP3A 4DIDA 4HLUA 4MKIA 5HZHA 2OLKA 2RCNA 1E9RA 1SZPA 2BJVA 3H4MA 4GOXA 4BRWA 2WWWA 2FFHA 2JLWA 3I8XA 1KJZA 2WTUA 3NIBA 2DY1A 2VPPA 5FTLA 4CGZA 1JJ7A 1Q12A 2ZAOA 1RIFA 2IF0A 2GWHA 1DAIA 2ZI5A 4R9UC 4XVUA 5GJBA 2XTMA 3WP1B 1NLYA 3IKJA 4PO9A 4TYQA 5CM8B 3EW9A 3U44B 4JL8A 1KSGA 1UKEA 2YOFA 1E4VA 1DPFA 4TMKA 3ICEA 2WICA 2LWIA 4TMVA 5KHOC 1KAGA 3D7MA 2WKRA 4X8MA 3BORA 1DADA 3MG9A 2XAUA 3H1TA 3IPYA 4BLRA 1MT0A 2PBRA 4ZIRA 2IS6A 3Q9LA 1FTNA 2RGXA 5TV2A 2IW3A 2WKQA 5FPKA 1KYIA 5L3SB 3REGA 4B32A 5L3QB 1W0KA 2E87A 1UKZA 2RGNA 3CIOA 3EWAA 4BLQA 3GJ0A 3RAPR 4D82A 4FW9A 2F7SA 4EDHA 2CLCX 2O8EA 1MOZA 2OILA 3T1VA 4CYMA 1OSNA 1W47A 1CXZA 4MUBA 2QMEA 4FMDB 2IUSA 4G01B 4XWOA 1A82A 4GNKA 4UXJA 2ZUCA 1PV4A 4C30A 3T5GA 3QY0A 2IYSA 4TSFD 4XIGS 2FSIA 1YE8A 4UKDA 3WNCA 1KSFX 4LK2A 1GSIA 4CEHB 5K8UA 1JAHA 1KO7A 1XPUA 1TL7C 2GBLC 4GT1A 2V54A 4M1YA 2ZJAA 4PAQA 4C0QC 3U7HB 4QXAA 2ZE6A 4LI0A 5IK2A 2EFCB 5JWHA 1DAGA 1OFHA 3AVPA 4E5UA 4GOJA 3CRW1 4DLVA 2Z4RA 4PHTA 2B8WA 2GKSA 2H8KA 2OAP1 2H18A 2WMOB 1Z2AA 3QBVA 2W0SA 4MKHA 3WMEA 1AKYA 3X1YA 3G0HA 2FJUA 4Q4HB 2QSZA 3PG5A 3TMKA 4I1VA 4OHVA 3W9YA 1E9BA 1VPLA 4LY6A 3MWJA 2C99A 4PHFA 3M4YA 2VSXA 3KUCA 2QP9X 2QUZA 3GEHA 2VHTA 4YXWD 2I1QA 2GEDA 1MRSA 3AF0A 2WAXA 4TL9A 2FDCA 5CYPA 3TIFA 1VCNA 1ELOA 3AVYA 4D2IA 1Q3HA 1QG2A 1Z0AA 2XB2A 1G4UR 5DI3A 3HR8A 4EPRA 5FPHA 5H70A 1N25A 1W4CA 4XWKA 3QPUA 2D62A 3HP1A 1Q0UA 2OE2A 3SJAA 3PUVA 4BFTA 4US2R 2ZITA 1XZQA 5HZKA 1QDEA 4PZLA 2D06A 2WJGA 3LH5A 5J4LA 2J7PA 1JAIA 1AN0A 1G3QA 1XEWY 4Q01A 1AQYA 5FBRB 3E2IA 4TLDA 1RE0A 3F3YA 2ZETA 1G41A 5KUTA 4DCUA 2E1RA 1UF9A 3HPQA 1TEXA 1CF4A 3BC1A 1RRGA 2JLVA 5HE8A 2V8OA 4I1SA 5KNCA 2ZVQX 4URXR 3VKGA 1BMFD 2JCSA 4FCTA 2PL3A 3O8CA 3QKUA 3N2EA 2DFTA 1ZIOA 1FPMA 4DDWA 4C0AC 1KNQA 1UJ2A 3THXB 1WF3A 3GEEA 3LAWA 5G3ZA 1ZM4A 4ESVA 4Q7LA 3WHLA 4Q4AB 1P61B 5HKKD 4PAOA 4MRRA 5FH9A 1NBMA 1US8A 2IT1A 2WOOA 2XTNA 2D74A 4EUNA 1G20E 1G5TA 1KAOA 1XD2B 2HJGA 2PH1A 3QEOA 4IOMA 1NSTA 3WP0A 2V1UA 1GIAA 4B33A 3X2SA 4DKXA 2REBA 1EFTA 3IHLA 2PEZA 3QI2A 5DI9A 2JJ8A 2JJ2D 4C0HA 3RC3A 1ZC4A 3QKSA 4HAYA 1UKVY 2PX3A 3RRZA 2IYRA 3FB4A 3U7EB 2ODBA 4FWTA 1NN3A 1HT1E 1Z6YA 1P2VA 4NCHA 4K8OA 1EG7A 4WOPA 1NBME 1IN6A 4NDZA 4TTQA 1OXUA 4X8LA 4L5BA 2RH5A 3EZ6A 1NN5A 5SZIA 4POAA 1HUQA 2OZEA 5C4MA 5H8WA 4FMBB 4PPGA 2DR3A 1JEEA 1XRJA 1IY2A 1E9EA 1M8PA 4M9SA 1G3RA 3AVWA 2MSEB 2GCNA 2KBEA 2OESA 2ZRHA 5KYKA 3PR1A 2ZRCA 4TT3D 4KJZA 3V9PA 2CLDX 3U5ZB 3KJEA 2Q3HA 2ZVPX 4DWJA 5GVSA 2X1VA 3C5HA 4Q66C 4KSCA 1GZSA 1KTVA 3B1WA 1ZUNB 3P4XA 4BFYA 4BZPA 2B7CA 4RCYA 3SN6A 2ZRLA 4JYBA 1ZW6A 1J7KA 3C8UA 3FTQA 1GKUB 1K5GA 2WWXA 2GCPA 1I4DD 2WWYA 2VO1A 3MLEA 3TKLA 4B71A 1D2EA 2ATXA 1A2BA 4RD3A 4BWYA 5J47A 3ADCA 2BJWA 1NI3A 2R9VA 1ZNXA 3PJRA 3IHWA 2NPIA 4LJ8A 4TL6A 2R44A 3GLHB 4P33A 3K09A 3Q5EA 4URZR 3ZS9A 1UBFA 3RYTC 4AC9A 5G53C 2QI9C 1N6OA 4KFRA 4PC6A 4DSOA 1GNPA 4ZCIA 4G5SA 2CEAA 4B35A 2O8FB 2BC9A 2PX0A 3FFBA 4KVGA 1SXJA 2OT3B 5EUMA 4OI2A 4F92B 1YZGA 2A5YB 3AEZA 4JVMA 4TMTA 3P4YA 1OKKD 1W1WA 3U6KA 2EFGA 3ADBA 2EFHB 2QGZA 5HCNA 4DEXA 4HB0A 1Q22A 1GFIA 4MGYR 2ATVA 2P0EA 3VU9A 3EA0A 5FOTA 5FR2A 2JASA 1OV4A 1FNNA 2VHUA 4OHXA 1G6HA 3NHAA 3T1QA 3TAUA 4ACAA 2DYKA 4ZV4A 2GAOA 5BXQC 2ZSDA 4IXNA 1L7VC 1RC8A 3DO6A 4FMCB 4IVRA 2QMUA 3M6AA 4HZIA 4P32A 2OFOA 1LNZA 3OHMA 4WXPA 2ZJYA 5E3HA 5CK4A 1SXJE 2G1JA 1P5ZB 5JRJA 1EXMA 1G4AE 4OQNA 5CLLA 1TUIA 2GCOB 3ZVNA 4P3YA 1KK3A 3KJGA 4Q18A 4QG7A 4Z8YA 5EJEA 3OIUA 1XTJA 2HCBA 3CRMA 5DE3A 3U4QA 2VA8A 3AP1A 2P6RA 2OAQ1 2GVZC 3QXSA 1OIXA 3GLGA 4HAXA 2QN6A 5JRZA 1Z6AA 2JJ1A 2B92A 2BM0A 3A8TA 3KQNA 4DJTA 4Q9HA 1CKEA 3SFVA 4FWIB 1BS1A 1N2CE 1E2LA 3I4LA 1K6MA 1QHNA 4Q5IA 2QT0A 3IUYA 4GOKA 4E22A 1GNRA 2NZ8A 2FPMA 2ZI6A 1FOEB 1IM2A 2QU8A 3RDPA 1A1VA 2BWJA 2DB3A 4NZYA 4DUGD 1NRJB 2ERYA 1U9IC 2VP0A 2AX4A 2ZSBA 5B57C 3DEFA 1S3SA 3LFUA 3EZ9A 2FPKA 4II7A 2A5GA 2NQ2C 3WBJA 3FYHA 1KIMA 5TDHA 4E03A 5E7IA 2J0UA 4XVQA 3GLGE 4I1OA 3KQLA 2X2EA 5CB8A 1SHKA 1EFCA 2F1JA 1PZNA 2ZYWX 2XGJA 2QPTA 1E2HA 2HLDA 3L8ZA 5F3WB 4MRVA 3M1IA 3IDQA 5CJ2A 4HYYA 1W48A 4I99A 3ETLA 4JIMA 1Z83A 2ZI9A 5LB2A 2ERXA 5KDDA 2C5LA 2H57A 3VR3A 2XTZA 3ZGXA 3GJXC 1R5OA 1AK2A 1E1QD 1BKDR 2FFAA 3GLIA 4QGHA 3Q5DA 3B2EA 1W2GA 4DCVA 3BB1A 721PA 3C4JA 1FTSA 2CK3A 4NONA 2Z43A 5TMPA 2BM1A 1FP7A 1JXMA 4TMWA 4B75A 2ONJA 3LXXA 3MRSA 3C14C 1KI7A 1Y63A 1G1MA 1AGPA 1MO3A 2VHCA 1I2MA 4AG5A 3QXHA 3QVUA 4M1SA 3AKDA 4EQ6A 1KK2A 3IGFA 5DNYB 2JJ1D 4XD7A 1Z3IX 1F6BA 2QAGA 1M7HA 5HCIA 3X1WA 4RKEA 4HI0E 2XITA 1VG9B 1R8SA 1Z08A 5J40A 3VR5A 3GLIE 1OF1A 3AGQA 3VNVA 1P9WA 3LLUA 1IXZA 1K5DA 1XCGB 1E2QA 1XTSA 1T8UA 4OBEA 1D5CA 2X19A 1RW4A 4QBHA 4QL3A 3NHBA 4ZO4A 6Q21A 2BCJQ 5TVKA 2D3WA 1N5KA 3AUXA 3C16C 4TL7A 2KI5A 2IWHA 1CJTC 5EZ5A 3UIEA 5JCZA 3K0AB 2PMDA 2R6FA 3CM0A 2GJAA 3LRPA 3W3AA 4YONB 4GDFA 2XXAB 4DSNA 2GILA 3DHWC 3Q85A 1NIPA 2IUTA 3U7GA 1X1SA 5KDOA 4B3CA 1ZU5A 2ANCA 4U00A 4LHXA 4MDEA 1MABA 1W7AA 1QVRA 1DAKA 5C46F 3GLFB 1HY3A 5EP1A 3GJ4A 2CNWD 2IA5A 3WY9A 5IHPA 3AKEA 3QKTA 4P0TA 4Q03A 1XXHB 4QKQA 4MRSA 3KQUA 4RCZA 2GXUA 3LWNA 2AWOA 1O3YA 4RVCA 2OHFA 5JI3E 2QNRA 2RHDA 2WJYA 1XEWX 1D6JA 1OXVA 4B6FA 1M2OB 4PO8A 1CJUC 4AKGA 2W58A 5LD2B 3B6EA 4HUQB 2O0HA 4BFXA 4D4MA 3THXA 2AXPA 2FGJA 1CJMA 3BB3A 1E9AA 3CF6R 2NZJA 1T3LA 1TAGA 4WW0A 1GRRA 3NXSA 3R8CA 5FOWA 2WHXA 4TMZA 1SQ5A 3THWB 1XEXB 2RGGA 3LW8A 2IYUA 3L82B 3K0CC 3MFYA 1OW3B 2ZYUX 4AURA 1F2UA 4AYWA 1R5NA 3X1DA 1P9RA 2FH5B 3GFPA 3S1AA 2IYQA 3T06B 3WRYC 3LA6A 4DVGA 2ZRGA 4LJ7A 3OEHD 5FBWB 4GP6A 4G0NA 2AD5A 3FWYA 1E79D 4MYHA 1FNMA 1HE1C 1BYIA 1OXXK 3GJ6A 2P6NA 3JZAA 2JLZA 5FOUA 2C98A 2PZEA 4DIEA 5DH9A 1CR0A 1IHUA 4TMXA 5FL7A 1W4RA 2EU8A 1JPNA 1Z06A 1HYQA 4O3MA 3GMTA 3DKPA 4NYMQ 2H1LA 3T1TA 2Q3FA 2IXEA 3LXRA 3UPUA 1E2NA 2BBTA 1T0HB 1U99A 2JATA 3TR5A 2UKDA 1Z63A 1ZRHA 2JDID 2O52A 3BFVA 4LV5B 2AK3A 3R8FA 2BBWA 1E98A 1XTIA 2QMHA 4CRWB 1IAQA 2GXSA 1G3IA 2NOAA 4DDUA 4KXFB 3SU8A 2Q9AA 5DYIA 3K0EA 3GCGA 2OCPA 3MWYW 2WV9A 2ZI3A 3SQWA 2XSZD 5CDFA 1MR3F 2MSCB 2NO7A 2R8RA 4PHHA 5JMTA 2Z83A 5JLJA 2HF8A 1XD9A 1E2FA 1XMSA 4B44A 1HTWA 1QZXA 2J5XA 1OIWA 4O25A 3CWZA 2GXAA 4RD6A 3TVTA 4DLWA 3NH6A 3ONWA 1OLOA 1YVDA 1YR6A 5D3MB 2BHRA 2IL1A 3DMNA 5BN3A 1QHXA 5KU1A 3LBHA 4G1UC 3U60B 2YC4C 4LUCA 3H0KA 2C96A 2IYTA 2DPXA 1G7RA 4CEIA 1B0UA 2ZUBA 1VCMA 2DWPA 4LDJA 2I1VB 3AVXA 1WRBA 1ZM7A 3EPHA 1RJ9B 3LO5A 4URYR 5CDFE 3KFVA 1KO1A 3F8TA 4JVNA 521PA 3K0FB 3OEEA 2AKAB 4RFSB 5AUOB 1NY6A 1NVXQ 3NVAA 2FSFA 3WYFA 3TBKA 2O8DB 2Z0MA 3IQXA 4GPTA 2HCJB 1NN1A 1VHLA 1SGWA 3K9LA 3Q8XB 5AJXA 1OHHA 1U2RA 3HYTA 1WBBA 4OHYA 1XCPA 1GKIA 4LHYA 3SDZA 1VECA 1OE0A 1TMKA 4PZYA 3UANA 1ZYUA 4UNSA 1SVLA 4LYFA 3ZVRA 4LV6A 3ICQB 4HSEA 3C7KA 4TYWA 2ORVA 2OEPA 4CT4B 1FX0A 2D7DA 2IHYA 3UATA 3LW7A 4LYHA 1RYHA 3CPJB 1G16A 3CKLA 2GNOA 4IVPA 2OUKA 4DB4A 3SI7A 4HB3A 4AKEA 1E2EA 4HLQB 4JLKA 2CJWB 3TLXA 4TZ6A 3K9NA 1N6LA 1JR3A 4ZCMA 3SJBA 4NCKA 3OAAA 2C77A 2FOLA 3AUYA 4QBFA 3CPHA 3RLFA 4EJSB 3ND8A 1VMAA 3CPEA 2V7QD 1KMHA 4ABYA 4A8JB 1EGAA 1M74A 4FIDA 4PC7A 4R7ZA 1L4YA 2I4IA 1IJEA 3V4RA 4KVAA 3AM1A 1KO4A 2JAQA 2CHQA 3U7FB 2AL7A 2PJRA 3W8RA 1MO6A 1NVVQ 4QNRA 2JLUA 2OFWA 2L0XA 4HZUA 2WSSA 1XWIA 4BASA 1E3MA 1JR3E 5JWRA 3CBQA 2RGEA 3B1YA 2A3RA 4A2QA 2GVDC 4ASUA 3ASYA 2X8AA 3GFTA 4CZ2A 5H68A 4D4LA 4EPTA 2A30A 3HU1A 3QPVA 4Q4LA 5FPYA 4C7OA 3RS5A 4WBSA 3IEVA 4LC0A 2C8VA 3K8YA 4EFMA 2ZXUA 2CVHA 1FUUA 3NC0C 4XWAA 3L0PA 1GITA 4HLDA 3KDSE 2DWQA 1JALA 2G0TA 1G18A 3GD7A 2F3RA 1F5NA 5EZ6B 1S9HA 3ADDA 1XJQA 1XPRA 4HB4A 3ZQJA 3UXMA 2YWFA 3ZIAD 3KTAB 4JZKA 4GL2A 4KHZA 3WXMA 2X77A 1HE8B 1TUEA 4GMDA 4BEJA 2C9YA 2YOGA 4B3FX 3I73A 1MO5A 2HT6A 4PSAA 4CDGA 3QNUA 4W5JA 3GP8A 4JMPA 2FSHA 1FL9A 4JBXA 1QHYA 1UEJA 3PVSA 3P32A 4RD4A 2XZLA 3EPKA 3IEUA 5IF9A 5JSZA 2HXYA 3SYKA 2QEQA 4S35A 1NLFA 4FMCF 1NMXA 1OPXA 1E2KA 4M1TA 3ZD6A 2J1LA 3QF4A 1FMLA 4YMVA 4P4TA 1RYFA 1Q21A 3C5CA 4W9MC 1XCMA 1ODFA 1QHIA 3RS7A 3R7WB
chains in the Genus database with same CATH superfamily
2W0MA 2QQEA 2F43B 4AJ4A 1TB4A 1RJGA 1P3DA 2CBZA 4FCWA 2W22A 2XODA 1NASA 3SEAA 2JKZA 2NIPA 4NE9A 3I2IA 4WHMA 4BMNA 4E88A 1COWD 3ANXA 4V0MA 4IGFA 3O75A 4NXMB 3F7MA 1NC3A 3ORHA 4QQ8A 2QZZA 3P2JA 2QE7D 3WV4A 4LXQA 4M0LA 2PRIA 3BIXA 4MX8A 3WLSA 4GZ5A 3MRTA 4LRWA 1RQ7A 3IIKA 2VPTA 3UHJA 1LV8A 2GZDA 2G9UA 2ZT5A 2Z8YM 3OCZA 4Q4JA 3KDAA 2Y4OA 5T3UA 4OXKA 4ZOQI 1U2ZA 4D0LB 4S0XA 4UNIA 4EF5A 2YCBA 4I1UA 1HDZA 2OGSA 4KLRA 1OYVA 2AQ8A 4FHFA 5EIHA 5JASA 3U61B 5IDWA 5E0KB 2AXQA 4DMGA 2HIHA 4N6GA 3H3XA 3HU3A 5G3YA 4Z4GA 1BW9A 1C1YA 2B7LA 3D7KA 3P2MA 4DPKA 5EERA 1EXDA 2EFJA 3PA6A 4MDYA 1PKXA 3L0CA 1QHHA 2QTHA 4N0EA 4WKPA 1EFRA 2P2ZA 5H59A 5CAEB 3CH7A 1FMTA 1Z4QA 2QP3A 4P7GA 3WAKA 3AEXA 3IKLA 5EIBD 1V95A 1LK5A 4ZAXA 5JEDA 3EVDA 1GOTA 3NKFA 3SWWA 4U3JA 5ILQA 2MTBA 3ZX5A 4JCOA 4AY4A 3L06A 5JQGF 5HMLA 4PANA 1MXHA 2AR9A 1V96A 4KXXA 2DFNA 1GL7A 3O9ZA 1M0TA 4W7SA 3RVDA 5A06A 4LVOA 1F06A 3TQFA 2WDZA 2WSBA 4QDTA 3ZCUA 4Q9IA 3H9JA 4UAJA 4UMDA 4YAIA 4AJJA 1A9QA 4JUFA 2QIPA 3LE8A 3H2BA 2H0AA 4QHYA 5K6RA 2PFKA 3PWSA 3CNQS 4S2EA 1MH9A 3V4LA 3OIDA 3UYKA 5ISMA 3R2JA 2C58A 1V35A 3HCDA 4HDSB 3BUSA 1YBAA 3FSRA 4OU4A 1ESMA 2Z8YA 2RHHA 3MM4A 4PZ9A 5BRNA 3L7LA 2EC5A 3DL2A 2HSJA 4L16A 3L4SO 4XLTA 3VTZA 4M55A 1HDIA 4JLNA 4IX9A 1X19A 3HKDA 1L1RA 1ZI6A 3R44A 1JA0A 4J4HA 4I3GA 3CXRA 2YJGA 4QUKA 1ZRSA 1DDGA 4KWHA 2ZREA 1YACA 4KLZA 3A3NA 1FDRA 2V6MA 4XX0B 1RYMA 5A7GA 4DBLE 3L8CA 3W5BA 2IDZA 3OQHA 3GGDA 4OLFA 4X9XA 4XLZA 2O7NA 2Q6KA 3IKMB 3PEEA 4JR1A 5TE9A 3ZTWA 2EG9A 4BBZA 4OLHA 1DV1A 5H7XA 5ALVA 1EK0A 4KWIA 5IBCA 1X7WA 3KELA 1SKQA 1ONBA 3OE7D 1WZEA 4HNRA 2B35A 4RS4A 1Q7RA 2VQSA 3E15A 2AN1A 4G89A 4X94A 3U3MA 1XA4A 2CE7A 1IN7A 3EEQA 4BDSA 4IHJF 1AKVA 4UNQA 1QGOA 2X5NA 5KO2A 3FHJA 1EK2A 1SXJC 4AJ1A 4UTNA 2YZ7A 5DYGA 1YZKA 2IXBA 4AZSA 4J0FA 2BEUA 2F1RA 5A7FA 3ILHA 5JTUA 2J6IA 3TZ6A 1HGXA 4TZTA 2RBKA 5BN4B 1U28C 4AO6A 3D6NB 1AQUA 4D8VA 1YVEI 3OI7A 1HT2E 4W8GA 3GEDA 4EGQA 4HDMA 4YJGA 3W78A 3RTBA 3TFQA 3OKFA 4M8KA 2F1OA 1CEQA 3E70C 3OFVA 1GAEO 1YK1A 2Z8XA 3JQCA 2O54A 4R1TA 2GK3A 2ID4A 2HGSA 4P3NA 3V8VA 2PT5A 3MBOA 4BV9A 3CLTD 1GAXA 1A76A 4HWPA 1P4AA 4RH0A 2REOA 1NV8A 3RTAA 1P18A 3A9UA 1E5DA 1EP2B 1NHWA 3QYJA 2A2ZA 3AOGA 1S2OA 2ATIA 3DAOA 3U4HA 1EA7A 4DQKA 5TQ0A 3VPFA 4CE6A 1VJDA 1KO5A 3QENA 1Z4JA 3BOSA 4LWQA 5E1MA 3JWEA 1T6XA 2PGLA 3TI9A 5IJ0A 3G1UA 1NF9A 2XNSA 3MCTA 1GGKA 1I7NA 1GR0A 1JVSA 1U8AA 3UHOA 2P35A 4I4TB 1B76A 5IDYA 3S2IA 2OO3A 4ILEA 4F4IA 2NPOA 2G7ZA 3L7AA 1D6MA 3PQ2A 4XWGA 3RGWS 3K0FA 1DQYA 2Q3CA 2J7PD 3HJAA 5I9IA 4IM7A 2DWOA 4KC0A 4X3CA 1NG1A 4BLOA 4Y2PA 3ZE9A 1P17A 2IODA 1QNLA 1YGPA 2QLJA 1QNFA 3BMCA 1WV1A 2PZBA 1WBJB 1AS2A 4A9AA 3F3MA 3S68A 2FZ5A 4D8YA 3DKRA 5REQA 4R69A 1TKAA 4YDHB 1H85A 5EPOA 1SCAA 3ZXYA 1TLFA 2I4MA 3MT9A 3RQIA 4NHOA 1UBRS 5KNCD 2QRVA 3PI6A 1MQAA 2J5RA 1SC1A 4R8RA 4G5YA 1IU9A 3SFZA 4OEHA 1XC7A 4UHHA 3E81A 1JHUA 3H13A 4K0KB 5JFGA 1Y8QA 2WJVA 3LCMA 4GECA 5ITWA 4OKNA 2IEDA 8ADHA 3HYSA 3MJDA 4MP6A 3K5PA 1CF2O 5HMMA 3C87A 5A4FS 3SHWA 3NH9A 2EP5A 2VAPA 4N7BA 4GKKB 3LLCA 3LWDA 2FUNB 3GVCA 1RJEA 4TLCA 3ELUA 3SK0A 3B85A 1ZH2A 4F2GA 1ZLXA 2J3MA 3MUOA 1C4WA 2P6MA 4XPIA 3CUSA 3BXXA 2BSAA 2HH9A 3ELYA 1XTBA 2XVAA 1QPZA 2R6CA 1ZPDA 3BERA 4KPFC 3RUPA 2ZIFA 4K46A 3VKUA 1WOYA 4PYMA 2CDAA 3BHIA 1QGYA 1K6IA 3PFCA 3I6BA 2G40A 3RRYA 1DTEA 4B81A 3K2EA 4D43A 3R0XA 2FVXA 4ZC1A 4TVBA 5K3BA 1D3AA 1CQZA 5TS3A 1H0SA 4G5FA 3ZJTA 2JAUA 2DVMA 3RWOA 1HNNA 2JLCA 1G6KA 2BCEA 3I6QA 2QG9A 3KO8A 5CB6A 4C7XA 1OTXA 1EWVA 4QECA 3V7WA 1HL3A 2J0VA 2C04A 4MCJA 4FD2A 4K9QA 1E9FA 3MWKA 4A0SA 3JRNA 2FYTA 3ZD8A 4O29A 1GZDA 5EWLA 2IY9A 3PL5A 4XQ9A 4EUHA 3JY6A 2H31A 2H92A 5BSUA 2UZIR 2I3ZA 4NZMA 3WK6A 3D7RA 4N0MA 2E4XA 5AUNB 2B3TA 3C7CB 4BXOB 1AKTA 3UMVA 2DERA 1FP4B 3ZQ4A 4BGDA 1E0JA 3D2LA 4R1PA 1FUYB 3W05A 1U0SY 2AFHE 1J5EB 1RAEA 3DZ8A 3JD3A 2EERA 2I6GA 2R2GA 1HG0A 3EXEA 3JYOA 1KNXA 1Q1QA 2EQBA 5JD4A 2EWVA 2I4LA 1YR9A 3NASA 1KRXA 1Z8FA 4PLFA 1WEKA 4OREX 2V45A 3OIWA 3F97A 4FOPA 5TC4A 4M1KA 2IYZA 4DCPA 3BE4A 5TSDA 1GG2A 3FMFA 1CCWA 2GRJA 1IWPB 1GN8A 3WZLA 4H9GA 3VYRB 4F8JA 1QRSA 1BKSB 1DXQA 1UINA 4L9RA 4OP1A 4DA6A 5FXMA 4AECA 5HEKA 4BFLA 5L8VA 1S96A 1QG0A 3EXFA 3O3CA 1OWLA 3OESA 3IQFA 1C7JA 3D8NA 4URUR 5EJ8A 4D25A 3HGTA 2ZS7A 3KQPA 3ZHYA 1CR4A 4CIDA 1E9VA 2J41A 3ESBA 3FMIA 3FRJA 1UKAA 2X3FA 4LMPA 5A4MS 3LNTA 1F14A 1UBKS 2AA3A 3IJPA 1JHPA 1IHYA 3K9GA 3LT2A 2IOYA 4WZAA 3HR4A 4EW3A 1RFGE 3T15A 1FFBA 2YMMA 4NULA 1W0CA 4JXKA 1SXJD 4QUEA 4ND7A 1N6IA 3PFHA 2BMFA 2NVOA 4RWEA 1PL8A 4ZCPA 1I94B 3NT2A 4TRNA 3NC4A 4HT3B 1DSSG 2HM7A 3HA7A 2BLLA 4MP8A 2R86A 5JNRA 2RB4A 1BA2A 3HB7A 2QX4A 3HMQA 1SC3A 3ND6A 3ND9A 1LC0A 3PHLA 5M29A 2Q27A 2YC2C 3BRWA 3OE1A 4EI2A 1OA0A 2GESA 4FLMA 2RH8A 1C9YA 1USVA 3BIOA 4CDMA 3Q0TA 3F8SA 4QRIA 1CW2B 1YAHA 3ER9A 2HQSA 3A6KA 3VTFA 2PGJA 4Z9AA 4WZAE 4UXIA 2G0AA 2PZAA 3FM9A 1MX9A 1VBNA 3UMRA 4L8FA 5K01A 1WMFA 5CDGA 5DM60 3R5SA 1TNDA 3UJ7A 3VBEA 5JMWA 1MC4A 1R64A 2P79A 2AOVA 2VATA 4GRAA 2EQ5A 4JJKA 2QYSA 1DXHA 2WD7B 4GLOA 3AEQB 1T25A 2JFUA 3HZZA 1X1EA 4JUDX 4EJ6A 5K3AA 2OKGA 2EP7A 4HPJB 4YAWA 2CNDA 2Q6LA 3G0OA 1QVAA 3UY4A 2FNAA 3B8HA 4PQRA 3OIVA 1JDPA 1OWNA 4PR0A 4POOA 2I4OA 3FMOB 3M6IA 4EO9A 4KI7A 3UMGA 3DB2A 1OU0A 4CCAA 2Z2IA 3F3KA 3K71B 1P7VA 4RMNA 1R4MB 2A5FA 3NT5A 4B74A 5BWMA 2B4TO 1ODTC 5LQJA 1XF9A 5CXXA 2OHJA 2W11A 5TPZA 2YZKA 3R5KA 1II0A 1JILA 4MRNA 4EOGA 1IG3A 3LBNA 4PZCA 5IXYA 5KWSA 2SHKA 2PJZA 3PKIA 3QBEA 4IR7A 1QORA 3L0YA 2ZBUA 3O1JC 1SIOA 5ILGA 4KG7A 3GJ8A 3RU3A 5KYXA 4XASA 5H3LA 1WS6A 4EKDA 2VF8A 2QNBA 3B70A 3H5VA 1NR1A 3IAFA 3B1ZA 2Z6QA 5EE5B 3CZCA 2ZBGA 2FQYA 4LYAA 1KZ7B 2XOKD 2M1XA 2C94A 2N9UA 3U0VA 1ZCAA 1XQ6A 3CF2A 1MJGM 5K0BA 4OSEA 3B5IA 3CT4A 5F73A 4KPYA 1J1IA 3P26A 5KWEA 1V16B 2NZXA 2QXYA 3DBHA 5FBKA 3HH8A 1ZD4A 3SCZA 1NVGA 2EYQA 1S2NA 2ZQYA 3EMDA 1R7RA 4RXMA 1U8EA 3SEZA 3TSCA 4W8OA 5DN9A 2JF0A 3QLTA 1WWKA 4MV1A 1B3BA 2XB4A 5EEGA 1MH1A 3NHSA 4BHTA 4BJ5A 4FHCA 1GCOA 3BWDD 1HEYA 3VSEA 1QGAA 3TPCA 1I8TA 5CFLA 2ZM6B 2BH9A 1WW3A 3EC2A 1N2EA 4PBRA 2XLCA 1Y0BA 3QMWA 4HQ6A 2AZDA 1Y7LA 3CR3C 2O06A 2AS0A 3QJYA 4G3XA 4WFJA 2EGGA 3L18A 1T6BY 2XMRA 5IKMA 4WXMA 5TPWA 1MRNA 2MJLA 4HQ0A 4C9BA 4G0UA 3TRHA 1XJ5A 1YU6A 2ZYVX 3HQ4O 1ONPA 3D0OA 4UU7A 5EE3A 5C8YF 1WA5A 2IXTA 5CPBA 1R0CA 2XB8A 3ZY4A 5C18A 4C4TA 7ADHA 2EVWX 5BY2A 3F6YA 3PNOA 1IHXA 2O8CB 3L7IA 3DZKA 5JR3A 4HBGA 1CX9B 1ZEMA 2JI4A 4AZ0B 2CVFA 4EGSA 1KS9A 3ETGA 1TTTA 3QVTA 5JVDB 2B1RA 2C4WA 5BR7A 1GPKA 3PJEA 3A36A 4CQJA 1DOAA 3QEBZ 4W5RA 1XD2A 4B73A 1M72A 3ROEA 2W6OA 3LHDA 1OH8A 1LPSA 2R66A 3OZEA 2XE6A 2KJQA 2F3UA 2VDMB 3FYUC 1L8QA 3H2JA 2PU7A 3H0CA 1MJGA 3DQZA 2XEXA 2YHIA 3VKWA 2QGNA 3D0RA 3QPAA 4QBIA 5KNBA 1YDWA 3PLAE 1NBEA 1KRHA 3FRHA 4CMIA 1FA9A 4WN9A 3WSVA 3MB5A 1HE5A 2H07A 4YPFA 2IZ0A 2RAUA 4F72A 1P33A 1Z22A 3O8BA 4FN4A 1MBZA 4MVJM 4RA6B 3SYTA 1NYLA 4YMLA 1N57A 3L84A 4QIHA 1KSHA 3JVIA 5F7OA 1Y3DE 3QOWA 3R09A 4Z53A 3H0EA 2I2WA 1ODCA 5H02A 5A05A 3V5NA 1BC5A 3PV0A 1TA9A 1M2JA 1SVMA 4YNBA 3UMCA 1EVJA 1B41A 3GEPA 2CBXA 3F5SA 4CF7A 1V5WA 4TOIA 4UHBA 1LW7A 2ODAA 4IIHA 3GCWA 2ZJ0A 3H8JA 1Q44A 2R87A 2WOJA 3ANLA 3QM1A 1QRAA 2ZRMA 2ZU0C 1DC7A 4P2GA 3BJIC 1YZTA 3TR0A 4DILA 4ZHQF 3FSEA 4GSKA 4RLHA 4JXXA 1G20B 5G0WA 5CITA 1B93A 2L82A 3WGMA 1PFWA 4I4IA 4XEHA 3RFFA 1F9EA 1GGMA 3AY3A 1L7QA 3B2QA 3E6AA 3HJUA 4D9EA 3OKPA 4EIWA 1YRHA 4UAGA 4C2AA 2UVPB 3JAWA 3W6OA 1W30A 3IVXA 2IHNA 4V0OA 1X87A 1M8JA 1DC8A 5HG0A 1E5QA 1OILA 3EQ7A 4OK6A 5CT9A 3UW3A 4RTKA 5LB4A 1B6GA 4M1MA 1NW4A 4U39A 5T57A 4MVJA 1MW9X 2W37A 3F74A 3JQFA 3TLCA 1EDZA 3RD5A 1US8B 3BIJA 2VWHA 3K2BA 4KE9A 2JGIA 5JO9A 4YYEA 2OZKA 2BRUA 2QM7A 4YUAA 1D8AA 2AX3A 2HPZA 3K7EA 1SVOA 1ZW1A 5LOVB 1VRCA 2EJCA 3NFRA 3ZZMA 4YT5A 3DWEX 1M5TA 1GQQA 4XEUA 2H2IA 1UIMA 4GMXA 1P7ZA 2QPOA 1H69A 2N75A 3AUFA 5JS6A 1QYRA 3EEOA 3FLBA 2AHOA 1JU9A 2AN3A 3A1DA 4JLOA 3EPJA 3O82A 3EX7C 2ZXEA 2P5SA 2IEAA 1NW7A 2XDYA 3S2GA 1LPAB 4MVJE 5E7QA 1M5RA 3WI7A 3ORSA 3P9ZA 4B40A 2FEXA 1R6DA 1K8QA 4ME6A 4WIAA 1FRVA 1CJKC 1PVDA 1C9NA 1TYZA 2VKTA 3EEFA 4DM4A 1EESA 1MB2A 2RGNC 3ZJVA 3O83A 5FUBA 4L3WA 2QL9A 3MWLA 2QZ4A 1R8QA 2JFVA 4KDRA 5H1YA 1M7BA 1CC1S 2QHXA 2ZYRA 3GAAA 3QYPA 2ORED 1Q57A 2HJSA 1MB0A 4HJRA 1FFXA 4U7FA 1GNQA 4B34A 4YCLA 1PGJA 3REQB 2DT5A 1Y9DA 2QR3A 3BREA 3GWGA 2ZSEA 3IP8A 4ZV9A 3EPLA 2GCOA 1EHIA 1LB1B 4XM1A 3MHPA 5K4GA 3JU3A 2LKCA 1MTZA 4UUPA 2PUGA 4MV6A 1JG3A 2OBNA 5EFOA 3ZXSA 3H7AA 3I2YX 2IYWA 3C41J 4RDIA 4ZO6A 4RQTA 2YJTD 2J0EA 3IBGA 1DVRA 1S89A 5LUBA 3DC7A 2FP3A 2C54A 3WDSA 1RE1A 3KJQA 3K0CA 2FPSA 5IC4A 3PHJA 3UTDA 4P82A 3VHLB 3VPSA 4ZOAA 4L4UA 3DBVO 1ZD5A 2XVXA 2B94A 4K6KA 1VCOA 1EVIA 3TLGB 2PUTA 2VIIA 3WWZA 3H1FA 2PSSA 1I30A 1SA0A 3KD3A 2DBZA 3FHTA 3EG9B 4OJKA 4RIEA 5KOJA 1QYVA 4DSAA 2GJ8A 3T0GA 1ZGAA 3TSZA 4EJ2A 1KKLA 1PR0A 3EF0A 4DQVA 4KRFA 1W87A 4PSCA 4HH0A 4GOMD 3F98A 1NNI1 4IMPA 4UUAA 4R7TA 4MUXA 1YVRA 3C1OA 4GYJA 1YQ9A 4LHVA 5LP6A 2YICA 1TU3A 5AW8A 4WLUA 2B2CA 4CV0A 4AI6A 3AKZA 4OHWA 1KARA 1NRIA 1UJMA 3JYLA 3P9PA 2XUAA 2G25A 4I3FA 1HFWA 1O0SA 4IH4A 4S1WA 4RVFA 1XQXA 1DEXA 5FEMA 4O3FA 3QSYA 4QFMA 4BLSA 1MEJA 1D2GA 1I10A 5DYTA 5AW2A 4ALLA 5LLSA 5CFZA 1KVUA 4Z3DA 1KI8A 4I7EA 2VUUA 4ESHA 1TE2A 3T5PA 3ED5A 4EFDA 4ZI7F 4TSFA 3ORQA 4JLBA 2YL2A 1RVDA 3ZZ1A 3VDRA 3LY8A 1DWPA 1IEXA 1SKAA 1ZMRA 5FUYA 2ZCJA 1LTHR 2WJZB 3UV7A 2X23A 3G8DA 3ZCQA 1FUIA 2I78A 2WMYA 1X2BA 5GZ1A 1RVV1 1OMOA 2P41A 2PZMA 3I1YA 3EZ7A 4XR4A 1SBHA 1KR5A 4IZIA 3N2LA 5FORA 4EY6A 1N0UA 2XYHA 1IBSA 3KZCA 4AF7A 5AMXA 1IRIA 1B42A 4Y2QA 2QDXA 1JJIA 2FFQA 1D9ZA 1YB6A 2OCAA 2JIMA 3ZI7A 2AH5A 4R6XA 1XTUA 4B47A 4E4RA 5A0TA 3FPJA 3GOQA 1GSAA 1F51E 1OLSB 3WNBA 1J22A 1FMFA 5JTTA 4OK3A 1XMOB 3TUZC 2BOVA 5KIAA 1BVYF 3R7NA 1ECPA 1X0XA 3KCNA 2GCEA 3F0TA 2V7PA 4B31A 4FC6A 5CR9A 2DEUA 2WSSD 4R2MA 1TM5E 5LBUA 1LWNA 3E35A 2JFPA 1C3VA 1ND6A 3NBUA 2NQTA 4FZRA 4P35A 5ALGA 3VAAA 2D5LA 4OQEA 4D80A 2XT9A 2XCOA 3EEIA 1ZM9A 2NXEA 4GKAA 4OY3A 1MN6A 4ASUD 1SC6A 1CUAA 2VHWA 2PUEA 1NQAO 3GH3A 1W6UA 3D3JA 4P5PA 1DJNA 1DUIA 1G2QA 4MYSA 3D4OA 3W5JA 1HLGA 1EK6A 4L6AA 5AJZA 3TW0A 1OXTA 1Z34A 2RGUA 2V7TA 3EUFA 3IMKA 3LPNA 3U1VA 3NG1A 1YU9A 4B6RA 4P3PA 2CL6X 2YQ5A 1IH8A 1NM5A 3CEHA 4BU0A 2OMEA 2I4NA 3GNSA 2P5UA 3MB8A 2QQGA 4TVKA 1KEUA 1SOUA 1QS0A 4P80A 2YN0A 4S24A 4D6YA 4RD2A 2Q21A 2IZ7A 2Q0HA 1H05A 2O5VA 2P4QA 3JQAA 3K05A 3UHFA 4H7IA 1U5BB 4EHAA 1UAAA 4C05A 3KXKA 4IOJA 1QO0D 2Y77A 1JA9A 4HGOA 3NB0A 4MGEA 4YRCA 3WB9A 1M2OA 1OYYA 3QLUA 1G7TA 3USES 1BMFA 2C7VA 4MIYA 1OROA 3TSWA 4F4JA 2AXNA 2Y8EA 4NXNB 4H7PA 5KPDA 3PNVA 1PEAA 2X15A 1C3JA 3DZCA 3IAUA 3N5CA 4FVTA 1IY0A 4EKEA 4AO8A 5BWOA 2J09A 3NM4A 1TPYA 2LNDA 3I9JA 4I50F 5AVUA 4QODA 3NONA 5T6BA 3K53A 2R751 1K63A 1MIOB 3ESCA 1L6IA 1XEXA 2IDJA 1XTZA 1RKBA 5CJPA 3DXXA 5FOXA 4QULA 4LNUA 3LS2A 2B7BA 1ZDMA 1PK7A 1X1CA 2J3QA 4JOCA 3KYCB 1Z0DA 3AERA 3A58B 1O95A 3BWEA 4RHFA 5ALLA 5IW8A 3VOTA 3BWVA 3Q72A 4U7GA 3B9QA 3CZQA 1QU2A 3FTFA 1FBNA 4OQFA 3MTEA 2XCIA 4KN9S 1Y3AA 2ZWOA 1INLA 1Q0SA 3D64A 4TX1A 1P44A 2JAXA 3VV2A 1L3IA 2AJCA 4HL6A 2H16A 5LSAA 1HA3A 4YQFA 2J45A 1H2EA 1G64A 1BOOA 2VH2A 3CH6A 4LFAB 2NGRA 3EFOB 2Y2VA 4FKMA 5BNFA 4RZUA 2XQKA 3OZDA 1E99A 5E8JA 1BVUA 3TEMA 2IHBA 1NOJA 4IDCA 3L7DA 4JP1A 1JHYA 5EJ7A 2OXEA 3GBSA 1HXHA 5JLAA 1IL0A 4ITVA 1EX6A 4BO5A 2QD2A 3L01A 4HG2A 4HXGA 4NNOA 4QPDA 4F38A 5JH7B 3QUAA 4QTXA 4C0JA 1IJFA 1OI4A 1S7GA 2NADA 3P7MA 1IBCA 4NL4H 5LMZA 2NQ8A 1QFXA 1I4OA 3DMRA 3RW9A 2VHQA 3G9UA 4JC5A 2EZ9A 4B6QA 1HMPA 1DBSA 4IJ5A 3FKSD 1GNVA 2Y6UA 3O95A 1ODLA 4RNCA 2YFHA 4JOQA 4AMGA 1NI5A 3B82A 3OTIA 1QR2A 3AJRA 3HVJA 1E6WA 5D3MA 4DRXB 2QZJA 4EF6A 3U6BA 4V1CI 1IVNA 3ZCPA 3CH4B 3L0IB 5EYPA 1JQLB 3D5EA 3DFIA 4L8LA 3AB3A 4QBGB 4V02A 1V7PC 3WLMA 2GAAA 2OG2A 2ZIXA 1CQXA 2VCEA 5FJJA 2AFRA 1P6XA 1LDBA 3CLRD 4MQFB 1Q1BA 3IVRA 4B6EA 4RENA 1SUCA 4CMEA 2KX7A 4DGQA 3PQ8A 3W5AA 4PYJA 4KQ9A 1F2UB 1MOSA 1W0JD 3HKBB 5AK6A 1CBUA 4KACA 4R2LA 2ZB4A 3WBKA 5EPUA 1U8ZA 1X6VA 4EPXA 5ITZB 2GBLA 1Y1QA 2PEYA 4MPTA 4WVFA 1UPCA 5BYAA 4RH3A 2IIQA 2AMVA 1YJ5A 3BMOB 4WUVA 4WFIA 1ADJA 1OKKA 2JJYA 2LPMA 4XIYA 4DY6A 2EBHX 5FL3A 4V03A 3KZMA 4EGAA 1RT9A 5K8JB 3BXOA 4ND5A 1UK7A 2EFDB 1G8FA 1HYHA 2B8EA 4H0NA 4EHDA 1D2NA 2WIBA 2XNKA 3HP7A 4WXYB 3TUJC 3TIVA 4MULA 4Q9JA 2A5JA 2ZYHA 5FI3A 4ZEOA 3BQ9A 5SY6A 2QUJA 3VX3A 1EINA 2ZRFA 4ED9A 1F17A 3MJFA 4IQ4A 5JJLA 3ZX4A 1VFPA 3QG1A 1Z16A 2QQ0A 4J0JA 5EHGA 4PQEA 1VHWA 1DL5A 1P45A 5CNKA 4FIZA 3TYXA 4EG3A 2LD4A 4B9AA 1AZWA 4F56A 2YKGA 2Z5FA 1CF9A 1FYFA 3L0OA 3EXG1 1KEVA 3DAYA 4PO1A 2Z5GA 3L4KA 3FDIA 3H4VA 5ADHA 1V11B 3UOAB 3DE4X 4KNVA 4RJLA 5FTNA 4QVGA 4CPDA 2HNAA 2XVZA 4FGUA 4FR0A 3V48A 4AFNA 4HVLA 3SQXA 4QGAA 1NNEA 1C1DA 4PXYA 3R3JA 1IB6A 2FJ0A 4MWZA 1G291 5A0FA 4RIIA 1K7CA 2F8LA 4MLPA 5ESWA 4JBYA 4JMLA 1XN4A 3RRJA 1TEVA 2H1FA 3VYWA 4Q6WA 2BZ1A 2A5LA 4WK2B 3UJAA 4J0HA 1HZZA 3D6JA 3INYA 5I7WA 4EA8A 1XLWA 4ZI3A 3W1WA 2J31A 1SNYA 2XZPA 4TL8A 5TY0A 3SM9A 1NWCA 3THRA 3KAPA 2C82A 4CM4B 1K86A 3PQ5A 2RIRA 2E55A 3U3XA 1KOJA 3O2SB 5E3JA 3WRWA 2OZPA 4DUGA 4FHGA 3LP8A 3PQ6A 4LSGA 2WK1A 1USKA 4IDOA 1CDZA 1R15A 4MDFA 3ZLBA 3ACCA 4WBNF 1UBGA 4MQ4A 5KX5B 1IN4A 2I91A 3DR3A 4EX6A 3ENZA 5JNSA 5PGMA 1LS1A 3I58A 3TSYA 1ST3A 4CIBA 1OX6A 5AHWA 3V46A 5LQMA 1GR1A 1VJ5A 1XVIA 3DZHA 3HXTA 9MHTA 4B6SA 1WD5A 5DK6A 4QYWA 4UDNA 3CR7A 5K8UA 2X2FA 3DV0A 4J2TA 5DMHA 1E8NA 1U7DA 2AYXA 1O9GA 1XOIA 3PUJA 4OQPA 4OIMA 2RH4A 2X9VA 1GPDG 3KT6A 4MLCA 4NS1A 4BZWA 3D8BA 4GR9A 4C6SA 2ZWMA 4BRUA 5KC9A 4DJDC 1XL1A 4F4UA 3AIIA 3GMSA 5KYVA 1H8HD 1XMIA 2GF0A 2OLJA 4EY8A 1RR6A 5ED0A 3CO5A 4IH1A 1M33A 4PIVA 3COYA 3KOOA 3RRNA 2NXWA 3UGTA 2K5UA 1ONNA 3VXKA 2QD4A 3R9IA 4YROA 5DV9A 1J8DA 5BN3B 1GTRA 3VHQA 1WXGA 1I1NA 1T9HA 3LQQA 4R3WA 5CRIA 2OKCA 1RM5A 4LYYA 1SKUA 3W9BA 5EKDA 1KMHB 5EN4A 2YOHA 1EKXA 1H9BA 3UJ8A 5KKNB 2HQRA 4NECA 3EBOA 1L6RA 5ERXA 1F8YA 1JR4A 5AVVA 4CMAA 5H16A 4CM6A 4CMKA 2Z5LA 1KEKA 5K0SA 1YZQA 2Q5EA 3RG2A 4UTOA 2AVNA 4CQLB 4Q1DA 1P7CA 2WI8A 1E2JA 1EEHA 1TMGE 4J8PA 3RC9A 4FEGA 4J6FA 5T4EA 2VZEA 4BEWA 3T5AA 1Q84A 3HN6A 3KQMA 4KO3S 3WLJA 4AZ3B 2SCUA 4OAQA 1A8SA 4DSUA 1H8ED 1KZ4A 2FF5A 4TS1A 1E1RA 5JPDA 5JZBA 2W6MA 4EYEA 4JP5A 3CMMA 2QT1A 1XSEA 1Z26A 1T5OA 4ZGBA 3GQBA 3V4ZA 2NO4A 3PJFA 3PT9A 3QWHA 3E22A 4M86A 4P7FA 3GLVA 4C7OB 4GKJB 1AUPA 4B2PA 2B36A 4IQFA 4FXPA 1FP6A 4BX8A 3TIGA 2VYND 4GU5A 2VRWA 3DEIA 4WD3A 2OZLB 1YMQA 1DTWA 4ID3A 3FBTA 1N78A 1GQ2A 4FZJA 2N46A 2Q6OA 1BYUA 1SBCA 3SBOA 4BO2A 1T1GA 4NKRA 5TMEA 5IYZA 2QRPA 2X8JA 4I9HA 3AVTA 2CXOA 4G5HA 5AK0A 3QVLA 2GGSA 4FFVA 2MMGA 3QNWA 4CF6A 2BGNA 4UAUA 4MW2A 3QKWA 1ZCBA 3KUKA 4CLRB 3UAGA 3T1OA 3W34A 1PJBA 1EIWA 1QH9A 1U0GA 1B00A 4YJKA 3KSUA 4LF8B 1QOPB 3VDNB 3LCCA 1Q19A 2QMOA 4IDAA 1ECGA 4KU4A 2VK1A 3C0KA 4RZXA 3IIJA 3ZHZA 4JUCA 1DKNA 2Q6VA 1XYVA 2FZCA 4BC0A 5DGCA 2H00A 5K4HA 4IEFB 3HNRA 5IT9A 2FP4A 2CMKA 3GFBA 2OPBA 4UJ3A 5FBRB 2UXBB 3MMXA 3SC2B 5JISA 1JBEA 4KKVA 1IK4A 2JGDB 1M1ZA 4XVHA 2J3LA 1YDEA 2GEUA 4IJUA 2PAFA 4RD0A 2VCHA 2W2VA 2DBYA 4JQCA 2RK4A 3UTCA 2ZS8A 1JEDA 2GKOA 2O23A 4F6CA 4R8MA 3TGPA 1C80A 4KFTA 3C3KA 3DQQA 3IEXA 5ALEA 5LLDA 1STOA 4Q3EA 1TADA 1Q0HA 3V9AA 2CCJA 3CH5A 3Q7PA 5F78A 2D1FA 3GD5A 1S01A 1TKBA 1EE9A 1PL7A 2O4UX 3Q0IA 5KNDH 1TM7E 3IELA 4IZ6A 4X93A 3U3ZA 1PYOA 5KVVA 1V25A 4L1KA 2WVHA 5LJIA 4GRIA 9ATCA 1AMNA 4URVR 1QX4A 1M2GA 3I92A 2W42A 4KQHA 3D6MA 3FOAA 1YASA 4U8GA 2CGEA 3C3CA 4KZPA 2NLOA 4Q4JB 3GFQA 3MQ4A 3TX2A 4PC3A 2P69A 2FWRA 3RVNA 3AOEC 3U3OA 2QJOA 3QX9A 4PW0A 1EH5A 1Y1KE 2G1UA 2VNAA 4GDMA 4LCJA 1RM4A 4M9QA 4UPVA 2BGJA 1U7TA 5H3HA 2DJIA 2LR0A 2AMLA 3HYCA 3R3UA 4WNAA 3RFTA 4HGRA 4NYIQ 4E32A 2VZ9A 1XQWA 2JDIA 3GT4A 1BW9B 3VPCA 3WLQA 2C9OA 3CUYA 4DBZA 5LPNA 3CUKA 3WGQA 1T34A 3AEYA 4G6ZA 1E7WA 2WHQA 2IY8A 3KEGA 1DAMA 2C07A 2IDMA 4RVGA 5E0OA 4BNLA 2C5AA 5CNJA 3GFOA 1QHHB 4ISBA 3EEYA 3L6RA 1KR2A 2QR5A 6AT1A 1A77A 2HMVA 1NW5A 1XPJA 1QQTA 5LU8A 1QP4A 1OXKB 1UBHS 1EAYA 3FSGD 3KOYA 4U3JB 4X7MA 3VZBA 3VH4A 4RKFA 1UAGA 2J4FA 2NO5A 4IFIA 1GZVA 4U2BA 1T5SA 4OFWA 4ZYLA 4DV6B 3JQ7A 3CNOA 1AY0A 3HB9A 1PGPA 3FXAA 4ISCA 4E70A 5L4SA 2VK4A 1OZGA 4YRZA 4BQSA 1RD4A 1UOEA 3PYLA 1P3JA 3GWZA 4FGWA 1ZNQO 1UODA 3CRVA 1LSOA 3AFNA 1DV2A 1JDSA 1H42A 1KZYC 2IUYA 1JPVA 2JIZA 1ZRMA 1JB1A 1Q16A 2EW8A 3EF3A 4OOFA 1AKEA 2P1RA 3GO4A 3NHFA 4LC9A 3UWKA 2EWWA 3RARA 1RRPA 3LX8A 4FGSA 1A50B 2UVDA 1Z15A 3W2GA 1ZZGA 2LUOA 3K0BA 5LQSA 1ZH4A 4D0GA 3DL7A 3HKDB 2NSYA 4R4JA 1T9ZA 4Y0VA 1Y9EA 1KY2A 2P75A 4B3IA 1RXEA 1XZPA 3IR7A 4MUEA 2NUPA 4YP0A 1LVGA 3NHWA 1WCWA 1RXCA 1NBHA 2DCUA 3PLRA 2XE7A 2QTBA 2G07A 1OXSC 4JT9A 3WYNA 3EVTA 4N4AA 8OHMA 5C0OE 1K06A 2Q5OA 3NWBA 3RKSA 4B3XA 2YYZA 4Z51A 3MHTA 5T4HA 1X15A 4Y9RA 2CUZA 3AJAA 2A7XA 5A3RA 2XWJI 2H17A 1AQ6A 5JZVA 2BMEA 2DY0A 2CNOA 5LWHA 1SHZA 2B4QA 2G08A 3KV1A 4O4HA 2TMYA 4EM6A 4JL6A 4OM8A 3EYAA 4M7WA 4W1PA 3FVTA 1PZGA 2QG4A 4TWAA 2BEUB 1PTJA 3S40A 2R97A 2IBMA 2RGDA 2RI1A 3GT3A 3RKUA 3TRIA 4KAAA 3RFVA 5IT5A 4WZBA 2X0EA 3B8EA 3W06A 5DNUA 1J39A 1U04A 4YJGB 2FSSA 3FNQA 2QTVA 1LSUA 1X1TA 1N1DA 2UZAA 1TQ4A 4LMBA 4WCDA 4Z1MD 4BX9A 3AGPA 3BGOS 2H9AA 3Q40A 4D42A 5DNDA 2ZSFA 1KP2A 2X5JO 4A27A 4QPCA 2B4RO 3P97A 1DJMA 3T8YA 1EBUA 1U0LA 2Y3IA 1FFHA 2V7QA 1CVRA 3NBKA 3ROZA 4CI0B 5C3MA 4WJKB 3TWOA 1FC0A 1TRKA 3KPYA 1NOIA 4JGGA 2W6QA 2SKCA 3RTGA 3V4PB 1OFGA 1BTOA 1YWGO 3LXMA 4HH3C 5JI2E 3WJAA 3KBOA 3N8HA 5TQ0B 1DI0A 3NQ41 1SKYE 1U7PA 4ID9A 1M10A 3BGDA 3HMKA 4RPCA 4U7WA 2NU6A 3EQ2A 4JT8A 1GG9A 1A4XA 3WMWA 2PZ8A 4R1UA 4WZBE 1DG1G 4JOSA 1V7CA 3R3WA 4RA9A 5IJ0B 1HE2A 2HBRA 3SE0A 1X1DA 2O6HA 2WWGA 1CJBA 2C9CA 4FHZA 4YS6A 3DUFA 4X5OA 1X39A 4Q3OA 2BI8A 2Q4BA 3OSUA 5KNDD 5EXTA 2BMDA 3D4BA 2YN4A 3LQ2A 3MSCA 4TLEA 2DFVA 4A36A 4TVSA 4MVXA 1PUXA 1JL3A 1ZJJA 1G19A 2QJRA 4MQUA 4E09A 3I5YA 3K0HA 4HDOB 3HDTA 4WESA 1F12A 3Q7QA 4RD1A 4YO8A 3TVDA 4IHQA 1ORVA 1E8DA 1C2TA 1EFHA 1QG4A 1RM3A 3OQPA 1FK8A