2G1JA

Crystal structure of mycobacterium tuberculosis shikimate kinase at 2.0 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
159
Chain Sequence
b'APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate kinase
publication title Crystal Structure of Mycobacterium tuberculosis Shikimate Kinase in Complex with Shikimic Acid and an ATP Analogue.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 59
structure length 159
sequence length 166
chains with identical sequence B
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g1jA00
3W34A 3F3YA 1HTWA 1G20E 3THYB 5JEDA 2CXXA 4MRNA 1OYWA 4QL3A 5HTKA 4UNSA 1X1SA 4C0LA 4I4LA 1SKYB 1N5LA 2OV2A 4LJ7A 1S3GA 2YC2C 121PA 1R6BX 3CR8A 3MUFA 3TVTA 1FUKA 4ZCLA 2FX3A 3T1QA 4DWJA 8OHMA 1CJKC 3EIQA 3UK6A 2OT3B 3KKOA 1SQ5A 1SKQA 3RABA 3UMSA 3LFUA 3SFZA 3RVBA 4QG7A 2QG6A 1XTSA 3BOSA 3DEFA 3UMRA 2BC9A 5JJIA 2FE4A 3KUCA 3WP0A 1ZD9A 4MGZR 5CB6A 5FI0B 2GVDC 4ASUD 4FCVA 4U00A 2WJHA 4XVUA 2WKQA 2K5UA 2BCGY 4URVR 3AVWA 1XCMA 4PPNA 4CT4B 3CKLA 5CYPA 3QNUA 2MSCB 1FUUA 1E2EA 4QC2A 4AYWA 1W7AA 4I99A 5F9FA 2DFTA 2FMXA 3CX8A 1ZM4A 3PIRA 2O0KA 3OAAD 4QBIA 3ZVNA 1KI2A 1W36D 5F9HA 1US8A 1W0KD 3R8CA 4DDTA 1KAGA 2ZR0A 1NY5A 221PA 3AUYA 1II8A 1P9NA 5FTLA 2RMKA 4E09A 3IDQA 1KK2A 5EE9A 1KI6B 1F2UA 3NH9A 2ASEA 2JLWA 4RZ2A 1XDBA 2DWQA 4B6FA 3ZVRA 2Q3HA 5B30A 2ERXA 3PQCA 1Q57A 1P2SA 3AF4A 4BZQA 5KNCA 4OHXA 2JCSA 2JDID 3CNOA 4A0HA 3UPUA 4EJSC 4D6PA 2RGCA 4L9SA 4KYUA 1RFLA 2WSSA 2F6RA 2ZETA 2GCNA 2ZRMA 4P4SA 1TQ2A 4PPQA 1QF9A 3FHOA 1W46A 1S1CA 1DE0A 1GG2A 5CJ2A 2OESA 3K9HA 3ONWA 1GL6A 1IOZA 4Q9JA 3G0HA 5A4JA 2QNRA 1YRBA 4LV6A 1W49A 1K8RA 3WXMA 3BXZA 3EW9A 5GJVC 4DEYA 1F3OA 1EFCA 2J7PA 5B57C 5JJLA 3U3OA 1I2MA 1PJRA 4PHHA 4Q4LA 3VHLB 1E0SA 3H4MA 4TL6A 5BN5A 1N5IA 3QXJA 1KYIA 1AQUA 2YVUA 1H8ED 2V4ZA 3AVVA 4LHVA 2BEKA 2DY1A 4RD2A 4C2UA 3PG5A 1U0LA 1GRNA 1VG8A 3T61A 1RJ9B 2Z0MA 4PR0A 2E9SA 4G5RA 4LK2A 5D3MB 3WNCA 4I1SA 1NBME 2IHYA 2QPOA 3BWDD 3N70A 3I61A 5K8TA 4MYCA 1ZCBA 2BMDA 1ZU4A 1SXJA 5DYGA 1JAIA 1RYFA 4KSBA 4R2IA 2ZTSA 3SQWA 5JWOA 5CJPA 2DYKA 1EFHA 1UDXA 2IW3A 4QHYA 3KB1A 1OH6A 2ZRGA 3ND8A 3RWOA 2ATVA 4D0LB 2OZEA 4MH0R 4LYHA 2AKAB 2P0EA 3DVLA 1IXSB 1TUIA 2R9VA 3KFVA 5FUVA 1KOFA 3C7KA 1YKSA 3TLXA 4BRUA 1XMJA 4W9MC 1II8B 1HQYE 2X1VA 1KK0A 4QBFA 3ETLA 4P3YA 2R6DA 3CM0A 1F2UB 1UM8A 2Q0HA 3TW4A 4BFVA 4RD3A 1VHLA 4G01B 5E7MA 1NLYA 4JT4A 4Z1MD 4M9ZA 2QT0A 3BBPA 4M9SA 1MRNA 1KMHA 2BBWA 4XOIA 1W4RA 2B6HA 1W36B 1R0ZA 4PQRA 1DEKA 1D9ZA 5JS7A 4C7OA 4GZLA 4PO9A 5FOWA 4HLDA 3KUDA 1M2OB 1ZVQA 5H68A 3T35A 5J4VA 3CONA 2ZJ5A 4PHGA 4M9QA 4RSGA 4B44A 4XIGS 3HP1A 3MG9A 4TN1A 1TX4B 4BFWA 1DO0A 2GK6A 3LAWA 1ZU5A 2ZRKA 1KZGB 4WIAA 2IWRA 2L0XA 3GJ5A 2PZFA 4GFDA 1VIAA 3CW2A 3EZ6A 4UJ3A 3DMDA 1GVNB 1GDDA 4D2IA 3DL0A 3BH6A 1DPFA 1N6OA 2F43A 2ZREA 3HPQA 4ON9A 4QGAA 1OB2A 4HB0A 1J70A 1L4UA 2FG5A 1FFHA 4Q7MB 4RFVA 4PSVA 3REFA 3ZZTA 2DFKB 2QGNA 3AKEA 2FFAA 1SXJB 1KJWA 2ZRLA 4LUCA 5AR1A 4IFEA 3F8TA 3TAHA 3DPUA 3KJHA 2P6NA 1XJCA 5GVRA 4OI0A 2A30A 3E1SA 3MRSA 1QVRA 4DUGA 2IYXA 3RNLA 4B35A 3THWA 1AS3A 2FZ4A 4CEIA 1N0VC 4RD0A 2JIZA 1Z3IX 4LYFA 2ZRHA 2ZR9A 4F92B 2VBCA 1D2MA 3ZS9A 3MWKA 2IUUA 5GJCA 3RLFA 2B8TA 2J41A 4QBGB 4CYMA 4HEJA 3VQTA 3K70C 4XVRA 1P3JA 2C99A 4BFSA 5JMTA 2V55B 2WVJA 3REGA 1KMHB 2RHMA 3D31A 1DARA 2DWOA 2ZRJA 3OEED 1E69A 4LI0A 421PA 1AJEA 4C7OB 1DO2A 3NVAA 4AC9A 4DDWA 4JLJA 4KVAA 1N6RA 4W5WA 4TZ0A 4HDOB 4K8OA 3CWZA 2AK2A 4JVNA 4PHTA 4JKYA 4M1WA 1Z0FA 1XMSA 1E0AA 4NYJQ 3QUSA 2H8KA 4DLZA 3TR5A 4DSNA 1I4TD 1NSFA 2A5YB 4A8JC 1W2HA 3U4QA 3B13B 2HXSA 4MKIA 4MDFA 1TQDA 1ZM2A 5TXGA 1FTNA 3W8NA 1UADA 2F43B 5SZIA 2IS6A 3VFDA 4G1UC 1ANKA 1AN0A 4PQYA 1FX0B 1OYYA 3P20A 3VAAA 2D4HA 4US1R 2AK3A 4NCIA 1P2TA 3A4LA 5A0FA 1XBTA 2GZDA 2NZ8A 3GLFA 1G5PA 1XCPA 2OCAA 2E87A 4O0MA 3A58B 1E9DA 1NI3A 4IRUB 2XOKD 1T8TA 2R65A 5H1YA 621PA 3THWB 2CJWB 2WAXA 2WKRA 2DBYA 2G9NA 3RSLA 1G17A 5F98A 1EWRA 3NHAA 1OXVA 5J4KA 2ZUDA 2J7KA 5CIQA 3BS4A 2H16A 4OHYA 1EWQA 2VRWA 2OAP1 1T5LA 5KNBA 4OK5A 1ZNXA 1SKYE 1N5KA 3Q7QA 1NN1A 3M1IA 1F6BA 3QXHA 5DN6A 3VR4A 4A0RA 1LY1A 3BFXA 4XD7D 3IEVA 4WBSA 1T8UA 1ZD1A 3ZDQA 4V02A 2VHUA 1IXRC 3RC8A 4LBYA 5CK4A 1WB9A 4FIDA 4Q4JA 4HZUA 1XRJA 2WMNB 3Q72A 1Q3HA 2GHIA 1I4LD 5LD2C 1AZSC 1KZ7B 1XJ0A 1E2KA 3QENA 1N6IA 1PUIA 1G6HA 3BJIC 3LNCA 1UDWA 4ZDIA 3CF2A 1GAJA 2WJJA 1DAGA 4KV9A 1S2MA 1XB2A 1PLJA 4IVPA 3U4QB 2GDJA 1OHHA 4LOAA 4PANA 1XX6A 4GDFA 3LBIA 5EE5B 4PHFA 2TMKA 2F1HA 2IK8A 4KFSA 4LC1A 2HF8A 3R7WA 2GCPA 5FTMA 4DIDA 4B3XA 2FZLA 3RAPR 3BERA 1Z2CA 4RJLA 3K0FA 2IA5A 2Q3FA 2IEZA 2KE5A 5J4HA 1J8YF 4OQNA 4QNMA 1FNNA 3D7MA 1VTKA 3K0CC 4XJXA 3K0SA 2MSEB 2PMKA 1E32A 1XD8A 3SYKA 4TT3A 4C0JA 2WTUA 5FOUA 1E1QA 2C78A 5E4FA 2IT1A 1Z0DA 4GT1A 4RFSB 2D06A 2KJQA 1Z0AA 3O8RA 2QBYA 4Q1FA 3RRYA 2ONKA 1OKKA 4RD1A 2V54A 3PUVA 4Q9KA 5FOXA 1W4BA 3NC1C 3PJRA 3FHTA 3B78A 1NN3A 1OFHA 4ZI3A 2V1XA 2CVHA 3GEIA 3A1UA 4PC1A 1A1VA 5JJKA 2NOAA 4Q4JB 4ZPXA 2WWWA 2ZEJA 4G3XA 4BZPA 2IXEA 2CLSA 2IUSA 1NLFA 3OIWA 3QKUA 4EFLA 2MMGA 3DO6A 1T3SA 4IOMA 1KI9A 2V7QA 3IKJA 4QJ5A 3VR3A 2VSOA 2AX4A 4TLBA 3GJ7A 3M0EA 5UKDA 4C9BA 3IIMA 1R0YA 1NBMA 2BBSA 2QY9A 4M1OA 2YNMA 4WOPA 1WDTA 2AKYA 5AK0A 4CT5A 1ZRHA 2WWXA 4ABYA 3AVUA 4C0SA 3TKLA 1QHHA 5KSZA 5FOTA 1BMFA 2ZXUA 1P72A 3FWYA 3O8CA 1NLZA 2WMOB 2QEQA 4RD4A 1OIWA 2VIIA 3HJNA 4GL2A 4AURA 1W44A 2IF2A 1AGRA 1YZKA 1D9XA 3KKQA 5G41A 4MDEA 3BIFA 2XZPA 3GQBA 3QQ5A 4Y0AA 2DB3A 2OM2A 2GXQA 4FWIB 1R0XA 3W6PA 1XPOA 3TBKA 1TF5A 2OEPA 5EUQB 3K0FB 3HU3A 4ZDJA 4M0LA 1DTSA 3IILA 1H8HA 3KJEA 4A4DA 3WMEA 1U81A 2CK3A 3DOFA 2Y8EA 1XF9A 1Y3AA 3NH6A 3BGWA 1E2GA 5C4MA 5DNYB 3ZD6A 4ACAA 2CE2X 1T6NA 4X8HA 3EPJA 3CNNA 1VYUA 1CS4C 4LPKA 3MSXA 4HLUA 3VKGA 1YR8A 4O3MA 1DAIA 1WCV1 1E2FA 2BWJA 1OT3A 5C18A 2JLSA 5AJZA 1YHNA 2ZANA 4QM7A 1RRFA 3QG1A 4TYQA 1XP8A 5A5GA 5CB8A 2V8OA 1EFUA 3CF0A 3HU2A 1TMKA 5AUNB 4A15A 3GLHE 3CRRA 3DM5A 1QHYA 3WNBA 4H9GA 2EFHB 5DHAA 2B21A 3ZLJA 3SFVA 1X6VA 2ZYUX 5DO9A 4DDUA 3O8DA 4TMKA 3Q7PA 3KQNA 3W90A 1KK1A 2ZI7A 4RVCA 4TYPA 1NMXA 1JI0A 1KI8A 1OIVA 4LV5B 5FTJA 3UWOA 1FW6A 4HSEA 3LA6A 2I1QA 2Q9AA 3NC0C 2X2FA 1NG9A 1EFRA 1T0JB 4A0FA 2CL0X 5JFGA 1R10A 1KKMA 4RCZA 4HUTA 1N0WA 2A3RA 1XTIA 4JT2A 5D3QA 2F1JA 4EDHA 4XVQA 1JPJA 3ADBA 2IF0A 1HURA 1J90A 4ILEA 2IYVA 4F91B 1G291 1G6OA 1HQCA 1R4AA 2EWVA 2PEZA 5EP3A 2CNWA 3OESA 2A5FA 1IN5A 1WE2A 2WPDA 1ZMXA 3B1XA 3OEHA 3TNFA 5KSOA 3RRMA 1A2BA 2VP5A 2SHKA 2VO1A 3DMNA 2WWIA 2BKUA 2BV3A 2OBMA 5FOVA 3JZMA 4NZYA 1G41A 5SZJA 1KO8A 3A37A 1DVRA 4LWZA 1ZIOA 3PXGA 4BLPA 4E5UA 4GBMA 3MLEA 3WHKA 3FFBA 2OFOA 2PZEA 3AB3A 3SYNA 4F38A 5SZKB 2J59A 2PCLA 3IO5A 1JALA 3EA0A 5FPTA 3QF7A 2JLYA 3L8YA 3LXXA 3LLMA 3EIHA 3AV0B 2ZI6A 3FKSD 5HKKD 2JJ1A 1PVOA 4FW9A 4ZI2A 2ODBA 2XX3A 2C9CA 2IX3A 1XEWX 5TV2A 4LSGA 3TR0A 2G0NA 2QM8A 1XPUA 3EPLA 4D4JA 3MCAA 3H1TA 4BFYA 4ZCIA 3A6PC 3BAFA 2CE7A 4MKFA 3VTKA 4IXMA 1KSFX 3QXCA 1NKTA 3B2EA 1JEDA 2XSZD 4B2PA 3IBYA 3KDSE 3THOA 2VSFA 4N0DA 4C4PA 1NRJB 4Q02A 4TL9A 1NN5A 2WICA 1QHGA 5P21A 1R8SA 4LY6A 1JECA 4P31A 2PH1A 1G3IA 2IYWA 5JZVA 4DZZA 2QT1A 3BH0A 1RVDA 4JLAA 4MGKR 4XSGA 1E79A 3R20A 2CBZA 1KSJA 4IKEA 2JJ2D 5IK2D 4Z8YA 2VP6A 4Q4AB 3LX8A 1XXHA 1DBSA 3UKDA 1GTVA 4BFUA 2KB0A 3E5HA 2VF7A 1P4SA 2W6JD 1N5JA 4TL8A 1MABA 1W4AA 4TZ6A 1G3QA 3QXXA 1OFUX 1ZCAA 4DLTA 2VHJA 1TAGA 4DSOA 4PC6A 1J8MF 4ZDKA 1Z6YA 2ZS8A 3OFNA 3Q3JB 2HLDD 5BW8A 2N42A 1MO3A 4HB3A 4Q48A 3IPXA 1GKYA 4YDSA 2QROA 5LPNA 4TQUS 3TMKA 4P4TA 4JSTA 1R5BA 2AL7A 1RE0A 4EPXA 5HZKA 5FBQB 2WOJA 3T5DA 1OV4A 2NO7A 2ZS7A 2QE7A 3QF4A 5FUXA 2W83A 1CJMA 1XJQA 1A5TA 1M8PA 2NIPA 2FOLA 2H17A 3CUEF 4DLRA 2CMKA 3GEEA 5EXTA 3RS4A 1IBRA 1NIJA 2NO6A 1QHSA 1ETUA 3LD9A 4NDZA 5DH9A 1HH4A 4YXWD 3U6BA 3TVDA 2ZJOA 4LHXA 2GEUA 2D74A 4WA7A 2FA9A 2BCJQ 3I4LA 1SHKA 3RANA 3T15A 1P2VA 2XEXA 1NP6A 2GXSA 4BECA 3BFVA 3EX7C 2O8CB 3EWSA 4P32A 1I2DA 1E9EA 3FMFA 4A92A 4D26A 3GLFE 3DDCA 5FR1A 1HA3A 2XGJA 2W2TA 4XSHA 4Z51A 3GP8A 4EQ6A 4JLNA 2OCYC 2J87A 2VP9A 2R6AA 4BLSA 1A82A 1GITA 5AUQA 2A5JA 2CCGA 4Y0VA 1VCOA 2EYUA 1N3BA 2REXB 3FTQA 5B58C 1E4YA 2EFGA 2DFNA 4TLEA 1JJ7A 3L8ZA 3RSOA 3TAUA 2V6IA 3NG1A 1TUEA 1NVXQ 2ANBA 3CH4B 2R62A 4FXPA 4NKRA 1FP6A 2NO9A 1G8YA 2BKEA 2BMFA 2HF9A 3QJYA 1GKIA 4DKXA 1UKYA 2GBLC 2J45A 1NNEA 3AP1A 1KHTA 4B3CA 1MABB 3QKRA 4Q01A 1PV4A 1F60A 3UANA 3B8HA 1DAEA 3D3QA 3A4MA 1SULA 2D3WA 2JLRA 3BRWD 2ORWA 2RH5A 3FHCB 1KSGA 4KITB 1ZINA 4BEBA 1GOTA 4M21A 3V4FA 3AP3A 1HY3A 1JR3D 3HPRA 2GAOA 1KO7A 1GNQA 2IXGA 2ZJ2A 3BD9A 3MMPA 4EJSA 4HUQA 1FL9A 2OAQ1 3QF4B 2VP2A 1KDOA 2QP3A 3B60A 5HPYB 2FDCA 2GEDA 4JJZA 4YMWA 2O8FB 2HUPA 2P65A 1XNJA 4YMTA 3SI7A 1W5TA 2WSSD 2QP4A 2FF7A 3IHWA 4Q4HB 4QM6A 3KL4A 4S2EA 4MYHA 4H1UA 2NMVA 2VSXA 1YQTA 2FSGA 1LV7A 1RZ3A 1E2LA 3KQKA 1V43A 3EZ2A 1E2NA 4B3GA 1E9AA 2J7PD 2X77A 4CEJB 4R71A 4Q03A 2QMHA 1QG4A 2JLZA 1NKSA 1GNPA 4Q18A 4IDQA 1FP7A 3RS5A 1P9WA 1XU4A 4CF7A 3TQFA 4BFZA 1COWA 3FMOB 1VG1A 2GAAA 1OXTA 4YC7A 3KZ1E 1CU1A 5CLQA 2A9KA 2AD1A 1VPLA 2J0QA 1XD2A 2HCJB 3QKRB 4TMXA 1SXJD 2ZE8A 1T0HB 3QPUA 3MJRA 5EZ5A 521PA 5BQ5A 4AWXA 4ESVA 2G6BA 1ZNWA 1KI1A 2WBLC 2ZE5A 5EUMA 3W3ZB 4BGDA 4Q21A 3J81k 3GLHA 2P2LA 1S3SA 1Z08A 2QI9C 2RCNA 2QSYA 4Q7JB 1YVDA 1CP2A 1XTRA 4DLXA 3SBDA 4AKIA 3DHWC 3CNLA 1QHIA 4L8GA 2MSDB 5CIWA 2BHRA 2JDIA 2NPIA 4EJSB 2ZI5A 3LV8A 4OL0A 2XAUA 2ORVA 2EFEB 2ZRAA 5FPHA 2NO0A 3CRMA 4LYJA 3VU9A 1LS1A 1CULC 1XEXA 1SHZA 2IYTA 5LDDC 4EFNA 5GADl 2XXAA 1CLUA 1E98A 1JQLB 3AH8A 4IFBA 3P26A 4IXNA 2FSIA 5E7JA 3WYAA 1UF9A 5EZ6B 1US8B 1P62B 2W6IA 2F55A 5DHFA 4U7DA 1TEXA 4IDNA 1NVVR 2P67A 4LX0A 1G3RA 4CDGA 3W5IA 5JI2E 1W4CA 1R2QA 3CZQA 2PLRA 1U94A 2CLCX 1UKZA 3LX5A 3AF3A 4GMDA 3LXRA 4IEIA 5KSYA 1T91A 3SE0A 3OF5A 4JMPA 2Q21A 4JJKA 1WA5A 3NHBA 3OIVA 2OXRA 1KO1A 4P4SB 4UNRA 1X3SA 4Q47A 2ZQ5A 2OSBA 2OXCA 2BMJA 3AF2A 3B1ZA 1XD9A 4HAZA 1KAOA 3G82C 1KK3A 1OE0A 3L0PA 4HATA 1BO6A 2IBMA 2OBNA 3K9GA 1FQJA 1LTQA 4MKHA 4TSFA 5FL7A 4C2TA 2WJYA 3P32A 3SHFA 4PXAA 2FN4A 4XH9B 4CIDA 2IYZA 1KI4A 4ERNA 3PCRB 2PEYA 1G8PA 2VHTA 5EXSA 3VNVA 3U60B 2ODEA 3GLHB 3B6EA 4IJMA 4M1KA 1M6NA 2Z83A 4TMZA 1NMZA 3SJAA 4U02A 1E99A 5K8LA 2IYYA 2JIZD 1SGWA 4HAVA 1ZNYA 3FE2A 3A1WA 2IUTA 2A7QA 2VEDA 2YOFA 3FOZA 2VPPA 5BXQC 2X2EA 2XXAB 2CEAA 1SVSA 3HWSA 2ZRFA 4DBLC 1NMYA 4TYYA 5HCNA 4NH0A 4R98A 3EPHA 1U8YA 3NDBB 1M74A 3I73A 4AIIA 1D8TA 4D80A 1XEFA 1QDEA 2BEJA 4QFMA 5J5CA 2D2FA 4TLAA 1W1WA 3UATA 4A8JA 5G40A 3NBFA 1GNRA 4LYAA 3EA5A 3EG5A 5F3WB 1RIFA 3I92A 4M4SA 2PL3A 4MQBA 4B2IA 2H5EA 2P6RA 3SU8A 3ZIAD 1M1YE 4BLRA 3U3JA 4AYTA 2EYQA 3I5YA 2J0SA 3U6KA 2C8VA 2BOVA 3BH7A 3RRNA 1XWIA 2GF9A 2XNDA 4PSKA 5TVKA 1GWNA 2MMCA 2ANCA 4I1UA 1SVKA 4FN5A 1NJGA 4ZCMA 1M34E 3QPWA 2KBEA 4KO8A 2O8EA 1D5CA 1ODFA 3I3SR 1YE8A 4Q1DA 5BYJA 2ZR7A 5BN3A 1WMSA 1PUJA 2P5SA 4OHZA 4A2WA 2A5GA 1CJTC 2QAGA 3CIOA 4H1VA 5JS8A 3KXKA 3GLGE 4Q7KA 3TW8B 4ZKDA 3KKNA 1VYVA 1U0JA 3X1XA 4KFRA 4A82A 4RD6A 4YMSA 3AVYA 2WSMA 4B3DA 3DZDA 3B1YA 4DJTA 4QJ3A 2YWFA 4P0TA 1JB1A 3K70B 3A1TA 4EPWA 3LQRA 1TPZA 3N5CA 3KQHA 3CH5A 3VR1A 1GRRA 3JZAA 1TQ6A 2FNAA 3AVTA 3UWKA 2RGEA 4AK9A 1E94E 1KDTA 3ND9A 3OEEA 4WZAE 2FEOA 1J2JA 1FZQA 2YZ2A 1YZQA 1UJ2A 4IOLA 3CLVA 5IT5A 1ZM7A 1BIFA 1E2QA 2QAGC 3AGQA 3QY0A 4PX9A 1IAQA 4QHSA 1G8HA 4DSUA 4CEIB 4O2RA 3Q5DA 1LS6A 4FMCF 4M1YA 3TUJC 1Z0KA 3Q9LA 4AD8A 4DC9A 1XXHE 1YZNA 4L16A 2VH5R 4D82A 4EPVA 3TRFA 6Q21A 1QBKC 3SYLA 3CO5A 4A8JB 3W6OA 3AVXA 2HJGA 2IXFA 3B9QA 2H92A 3KFXA 1R5OA 3QKSA 4G0NA 2REBA 5C2JB 4O2LA 4NL4H 2FEMA 1Q0UA 1BKDR 3GLIA 4JLBA 2QP9X 1Q1BA 2EVWX 1XTQA 4JLPA 3G5UA 1OHHD 3U61B 2P5TB 2GZAA 3P4XA 2ZIAA 3T34A 2JLUA 2NPFA 3MD0A 4GOKA 5CLLA 1S4QA 3AUXA 4NYMR 3OE7A 3SN6A 3W9YA 1N2CE 3M4YA 2YKGA 2O0HA 3ASZA 5EP4A 2ZE7A 1P75A 3K0CA 3OZXA 1LW7A 2HV8A 1EFTA 5F2EA 2ZU0C 1WBDA 3Q85A 4LJYA 2WM9B 5CM9C 3ZD7A 4WXRA 5TDHA 1TTTA 2RGNC 1DG1G 2CHQA 2QRNA 2W2XA 4GOJA 1YZGA 5BN4A 1Z6TA 2ZI3A 2QQ0A 4TT3D 4FCTA 3W8RA 1XEWY 3ZQ6A 2ZRBA 3I62A 1HE1C 2X19A 4IVRA 1E9RA 1VDZA 3SS8A 4KFTA 2WWYA 2B92A 1GIAA 3R9IA 2YHSA 2G0TA 3EAQA 2J1LA 2LKDA 1HT2E 1U8AA 1OKKD 1ZP6A 4PPGA 5C1BA 3GLFB 3SJBA 2ZSBA 1ELOA 1R5NA 3BK7A 3ICEA 1MKYA 1AKEA 4KFUA 5J4YA 3TUIC 3GEHA 3ASYA 3FYHA 4AKGA 2DR3A 5LD2B 3ZJYA 1G8GA 2H7VA 2IYRA 5EP1A 5KNDA 4RZXA 1I4DD 3NTUA 5CM8B 2AR7A 2RGXA 4IDPA 2AXNA 1KI7A 3PEYA 1E4VA 4LBVA 1JQJC 3ECCA 4Q1BA 3U2QA 4DIEA 2V7QD 5L3QA 1WP9A 4UXHA 4DXAA 4JL6A 4WVFA 2AWNA 2XTMA 4BLTA 1F2TA 4JL8A 1NBMD 3K9LA 1N6LA 1QVAA 2YYZA 2AFHE 4IDOA 4OJQA 4N3NA 5BWMA 1JR6A 2KSQA 1CRPA 1OPXA 3L0OA 1II9A 4KYIB 3RS0A 4S35A 4HZUB 1G7SA 2A5DA 1Q1EA 5L8VA 1BMFD 4Q5IA 3E70C 5HCIA 4MUBA 1VCMA 3U44A 4OK6A 3CB4A 1NSTA 4EUNA 2GTPA 3A8TA 1S9DA 2PCJA 3KKMA 1RKBA 3PUZA 2OO7A 5HE9A 2P3SA 3GJ6A 5G53C 1G7TA 3A4NA 4JVLA 4MUAA 3UG6A 3OHMA 4FINA 1CF4A 1G21E 5L3VA 1CKEA 1RRGA 4RCYA 2XNSA 4O25A 4JBWA 1KO4A 2Z5FA 3NIBA 1WXQA 3UXMA 5BYKA 2CK3D 2ZYVX 2WJVA 5EJEA 1ZJ6A 4EKDA 1S8FA 3F5FA 3R7WB 4G5OA 4GOXA 4B71A 2WAYA 4EPTA 4UNPA 1KI3A 4CZ2A 1R8QA 1DAHA 3P4YA 1HV8A 1YU9A 4MRRA 3P27A 4V0MA 2D2EA 3C8UA 4A9AA 1KMQA 2W0MA 3KTAA 3W6NA 3L43A 2QSZA 4PQFA 1U0HC 4C0KA 2WWGA 2QM7A 4M1TA 3KB2A 1OXSC 2FGJA 2ZM5A 5JHGB 3RWMB 1E2JA 1YZLA 4WZ6A 2BBOA 5G3YA 3I8XA 1VYTA 2BMEA 2JATA 3MWLA 4X8OA 3WRYC 2WHXA 4GZMA 2QBYB 2NO1A 4Q1CA 2RGDA 1R0WA 1U8ZA 2J3EA 4KHZA 2D7CA 5FBWB 2R6CA 2F9LA 5JEEA 4LPSA 3E2IA 5KDDA 2KBFA 4XTCS 1TF7A 1Z8FA 4UNQA 3V00A 2NQ2C 4URUR 4TMVA 1B0UA 1HT1E 4TQ9A 1EFRD 1HE8B 4IHQA 3U44B 3RS3A 1GM5A 1IONA 5FUWA 4HB2A 1XMVA 4M22A 2XZOA 5AWFC 3WHLA 3KJGA 3IEUA 1Z0JA 1G8FA 3A1VA 3QXSA 3RYTC 4CEHA 4KODA 4AY2A 2PT7A 2BIFA 5KDLA 3U7HB 1QHHB 2GF0A 2CNWD 2G83A 2I4IA 2WV9A 2CDNA 3LVRE 3LVQE 2GCOA 3KKPA 5KPJA 3OEHD 3CRVA 2JLXA 4QGHA 5AUPB 4HYYA 4TMWA 3EIEA 5TARA 2FPLA 1C9KA 2F1RA 1ZM3A 5FFMA 4P33A 2XITA 3H2YA 3O8BA 5KSPA 1OSNA 3HR8A 2FJUA 4M2LA 5AJWA 2QGZA 2F1IA 4JKIA 3HDTA 4IOJA 4DLYA 5JHHB 4ITRC 2AXPA 3LW8A 4URYR 4P4UA 3H0KA 4Q9HA 4NYJR 4WZBE 1GZSA 1ZUNB 2QPTA 3QEJA 1MRSA 1V5WA 4GI7A 1CEEA 3AF0A 2JJ1D 2ZJYA 4TLDA 4JLKA 1EX7A 5B64A 3R8FA 1UBGA 4QNRA 1XFAA 4PPFA 2BDTA 1KJZA 2CVFA 3FDIA 2Q6TA 1GUAA 1CXZA 4JBYA 4UXJA 2O8BA 2ZJBA 1E0JA 2JASA 2RGBA 1WQ1R 3BB1A 1KY2A 3HYTA 1AIPA 1PZNA 2P6UA 1O87A 1CR2A 3GLGA 1DELA 2CHGA 1EESA 1CIPA 3ICQB 3Q5EA 4DT1A 1W47A 1ZW6A 4HAYA 4WXPA 3JVVA 1X8JA 1Q1ZA 1XTJA 1NVVQ 1L8QA 3WMFA 4RZ3A 4Q00A 2I3BA 1E79D 1E2MA 1MO6A 5G3ZA 1OXUA 3AM1A 2BM0A 5FTKA 2WIBA 4ZIRA 4HDCA 4QRHA 3TSWA 4FMCB 1P5ZB 4DCNA 5FBRB 3QIAA 1DS6A 2W00A 2QRZA 1P2UA 1QHXA 4JLMA 4EIWA 3SBEA 2V1UA 4FCWA 2AN9A 3TE6A 2N1BA 2D7DA 1TQ4A 2GKSA 1CR4A 4W5JA 5KTYA 3EPKA 1L2TA 3EZ7A 4IOKA 4JYBA 1MT0A 4YQFA 5EXXA 2AD5A 4OK3A 5CDFA 4A2PA 4LV8B 3T5GA 3FKSA 2B8WA 2CL7X 2ZRPA 2QMOA 1VMAA 1ZC3A 4LC0A 2JGNA 3L82B 5TMPA 3QI2A 2QE7D 3SOPA 1WRBA 1OJLA 1LF5A 3LLUA 2ZYWX 4HLQB 1KDPA 1SVIA 2G1JA 4NCNA 3UIEA 2JEOA 1OIXA 4QHTA 2R6FA 5FI1B 2HCBA 5JLJA 2R6GA 4OI4A 3RHFA 3D8BA 2XSZA 1G3UA 2F3RA 4PO8A 2OFXA 3PEWA 3KQLA 3LDAA 3X1DA 4NE2A 2ZJAA 5ANRB 2F7SA 4HZIA 5EE3A 3ZGXA 5J4LA 4URXR 1BH2A 5CITA 1YR9A 5FUYA 2EQBA 2NGRA 2HT6A 2XZLA 4ZDWA 3THXA 2OCBA 4V0LA 1F5NA 4KVGA 3GLGB 1Z5ZA 4NP6A 2C95A 2I1VB 2RHDA 2IYQA 4DT1B 3EZFA 2Z43A 4NPHA 5E3HA 3IIKA 1N6KA 2QMEA 2GBLA 2IYUA 4I1VA 2UVQA 2ODNA 4PSAA 4OI1A 5DISB 4DCVA 3SNHA 1Z6GA 3NEJA 4ZIRB 2W2VA 1TF2A 4QGFA 3CR7A 2EFDB 2OG2A 2FGKA 5DI9A 2EU8A 2KWIA 4NYIR 4K46A 4C0QC 2AHOA 4BWYA 2GESA 3CPHA 3NXSA 2EW1A 4Q9LA 1CR0A 4URZR 4X8MA 2GA8A 5E95A 1W0JA 1ESNA 3DZ8A 5TY0A 4UXIA 1TL7C 3I1FA 3QEOA 4B2LA 3B9PA 5DI3A 4A0GA 3QBTA 1AA9A 1P61B 1NVWQ 1XXHB 2ZI9A 1FTSA 1E1RA 1VCNA 4BFXA 4NMMA 2C96A 2OLKA 3RDPA 2FFQA 1LF0A 3KQUA 4PAQA 3GLIE 3BE4A 2J5XA 4N0EA 2Z4RA 1WF3A 3MAAC 1QG2A 4JYCA 2C5LA 4OBEA 4V0KA 5FPYA 4C0AC 1GL9B 1VCIA 2ZUCA 2Q9CA 5EP2A 4GPTA 2C2HA 3SZRA 3JVUA 1E9BA 2QTVB 5LB4A 4TQAA 3IGFA 4DLSA 1L4YA 3I5XA 5FL3A 1KTVA 4YONB 1Q12A 1NVUQ 3K0EA 1OXXK 3CRW1 2HJVA 3DKPA 4R9UC 3AKDA 1AGPA 5IF9A 2ZPTX 3THXB 3DOEA 2GJ8A 4XWAA 1EGAA 1R7RA 1GL7A 3CRQA 4II7A 4DSTA 1JBKA 2B7CA 1Z6AA 1LVGA 2ZSAA 3IQXA 3BB4A 3NDPA 2NZJA 1P73A 3B82A 1N25A 4KBFA 1RJ9A 2ZVQX 3PUYA 1YRAA 4EPYA 5D3MA 1BOFA 2GXAA 1NJFA 1ZIPA 2ZAMA 1G1MA 2YV5A 5HZHA 1SVMA 4OQFA 4UQOA 5J47A 4D4MA 5AUOB 3FVQA 4A6PA 4M53A 1COWD 2WIAA 5L3RA 2C98A 1G7CA 1KY3A 2GETA 4D25A 1JXMA 3IBGA 1KKLA 3FMPB 4EPRA 4EQ6B 1UEIA 4F4JA 2GJSA 1Q20A 4PC7A 4AI6A 3SHWA 4ZKEA 1JR3A 3LWNA 1SZPA 1MOZA 5DYIA 2BVNA 4DLVA 3PFIA 1YR7A 1G19A 2IYLD 4NYMQ 2FFHA 4PAOA 4ASUA 5DI3B 2IS1A 1IN7A 3OIUA 4HI0E 3AQ4A 4FI3C 4K81B 5CK5A 4AG5A 5JECA 5JWHA 4D0NA 2RGGA 4PFSA 4OHVA 2FPMA 1OB5A 2ZSFA 1ONBA 4XWOA 3GPLA 2WJGA 1DAMA 1Z07A 3PENA 1YZTA 1RRPA 3L0SA 3OAAA 2OBLA 3A36A 4RKFA 4PC2A 3FKQA 1W0KA 2GJKA 4G5GA 4KCGA 3CX6A 1D6JA 2LWIA 4DLUA 1PLKA 4JZKA 4OQMA 2ECKA 4TTQA 2Q9BA 4KJZA 1E3MA 1TNDA 1P60A 2PX3A 3T1VA 3I8SA 2PJZA 2FSFA 4JBXA 2W6ID 2JA1A 4B74A 2VF8A 2ZS9A 4HUQB 2ZAOA 3VX4A 3GJXC 5KU1A 3SEAA 2A2ZA 4L5BA 3MWYW 3MWJA 2F9MA 1FMJA 1E0KA 1IJEA 3IIJA 4TTRA 4IDHA 3QBVA 5HE8A 2YOGA 1AS2A 1W36C 3HU1A 1EK0A 2QUZA 3LH5A 4W7SA 4V0ME 4NCJA 1FNMA 3FMIA 1IN8A 2GRJA 4C0HA 3LO5A 1G3MA 1OW3B 4WAUA 4E07A 2XTZA 1AM4D 1E2PA 1AS0A 1H8EA 1Q1QA 4TMTA 3OIYA 4LJ9A 4TSFD 5FL7D 3U7FB 2VHQA 2PJRA 1GKUB 1B23P 4PZZA 3K9NA 3TH5A 2OUKA 3IO3A 4L9WA 4LHWA 4M1SA 4TLCA 3V9PA 2GEVA 3FFAA 4FD2A 4HLCA 5H70A 3TQCA 2G77B 1II0A 1RW4A 3GFPA 1XPRA 1W5SA 4YDHB 2D62A 4MRVA 2BJVA 3LW7A 1EX6A 3K70D 3I72A 2OHFA 2ZVPX 3N2IA 3WYGA 1P7CA 3WBKA 1XD2B 3VKHA 1SXJC 2YINC 4B6EA 5GJWC 4JVMA 3UMFA 4DHEA 1PLLA 2GJAA 2DHRA 2ZJ8A 4D0GA 2W58A 2WWHA 3AKYA 1G5RA 1GSIA 1DAKA 3WY9A 4DUGD 4CW7A 3L0IB 4BQSA 1MO5A 2IC5A 1Z47A 2CHVA 2RKOA 3NKVA 2G88A 4Z1MA 1N6HA 1ZM9A 1IJFA 1AZTA 2FSHA 1DG3A 3B85A 2QQEA 3IPYA 3U3KA 2HT1A 3VNUA 1L7VC 3B1VA 3X1YA 3RS7A 2JAQA 2Z6VA 3VU9B 2GXUA 1XEXB 3N2EA 4B34A 3LQQA 1LNZA 2RAPA 4J0QA 3T1OA 5EQTA 1CR1A 1Z2AA 4GP6A 4JIMA 2XNDD 4GSYA 1FX0A 1E2IA 2ZRIA 2CL6X 4MGYR 1WBBA 2CCJA 4BRWA 2J0VA 2ZSEA 4B3FX 4BZXA 4LGMA 4OQLA 3SJCA 5DSZA 4MYUA 2CJWA 2NTYC 3S1AA 3TGPA 1P6XA 1HUQA 1SVOA 1UBFA 1SVWA 1TADA 2OCPA 5KHOC 3AVPA 4R2HA 2J9RA 2IYSA 3LBHA 4NCKA 4IEEA 4CVNA 4RY2A 1E9FA 1OH7A 3WMGA 2OFWA 4OJKA 3ADCA 4M1MA 4DRZA 4DCUA 1VECA 5DLQC 2QZ4A 2RB4A 2E1RA 3BB3A 3P1JA 1UKEA 3VX3A 1JEEA 5JWRA 1LFDB 4RZUA 3RC3A 1NN0A 2VYFA 4FWTA 4BLQA 2XB4A 1OLOA 3ZH9B 2PT5A 4ACBA 1JAHA 5CYOA 3U7GA 5FBVB 3ZIAA 2XTNA 4Q66C 3TIFA 3SDZA 3U3RA 1MO4A 2H1LA 4NONA 3T12A 4MA4A 1E2HA 5DN6D 1YR6A 2X8AA 1T3HA 4FMBB 4LJ4A 1CBUA 3K53A 1VG9B 1RRCA 1OH8A 1VIYA 4LHYA 1X8KA 1TEVA 3C16C 3VR2A 1OFTA 4QOSA 1UKVY 3B1WA 4LJ5A 5CDFE 4L15A 4HDQB 4KI0A 1CJVC 4Q19A 2HYDA 3WRXC 4ARZA 3SQXA 3X2SA 2XB2A 4DLWA 5LBIA 3OE7D 5KOYA 2RGNA 4LCBA 2Z4SA 4F4IA 2QA5A 1KGDA 4MGIR 4LZZA 3S1AB 3L2OB 4OQXA 2FH5B 4BLOA 4PZLA 2ZITA 5FBLB 4LHZA 1Z06A 1ZAKA 5KO2A 3QVUA 5AJXA 2KI5A 4RFSA 5GVSA 5K8UA 2G3YA 4NTZA 2HYIC 1AQYA 3C5CA 5J40A 4NU0A 2ODWA 4R7ZA 4BFTA 1SVLA 2QMUA 4YMVA 2O8EB 2J46A 1Q44A 2F3TA 2YWEA 2XOKA 3EZ9A 1M7HA 1DOAA 5DE3A 2QAGB 4KSCA 4QBHA 3EASA 5LB2A 4RKEA 2VL7A 1YZUA 4KU4A 4LJ8A 1NG1A 3QE0A 2FWRA 5IRCD 4JLDA 4C0BA 1E1QD 2BM1A 1H65A 2YWHA 3DKVA 2QN6A 3FPAA 4B3BA 4XD7A 3VHXA 2PZGA 1BYUA 5JI3E 1KJYA 1IM2A 1CTQA 1X1RA 2JJ8A 1W48A 5FPKA 2UZIR 3PVSA 4U5XA 3C15C 3RS2A 4JSYA 1ESMA 2QTHA 4KBGA 4F4CA 5GJBA 4PZYA 4LDJA 4XTRA 4N1AA 2O5VA 4A1FA 3X1WA 2PLFA 1U98A 3PEVA 1C1YA 4TTPA 1Z29A 1OF1A 1Q21A 1ZYUA 2N46A 4B32A 5ELXA 2Q3MA 3IQWA 4F7WA 1YJ5A 5KUTA 3NBYC 4ARZB 4FMDF 2QU8A 3QKSB 3MGCA 4B76A 3R9WA 4DCSA 4E03A 1XCGB 2JLQA 3GLIB 5DIFA 2O0JA 4PC3A 4AYXA 1A4RA 2GK7A 1ZUIA 3HR7A 4BE7B 1NY6A 3B5JA 1T4GA 3GJ8A 2OE2A 2A78A 4C30A 2XJ4A 4KLNA 3TSOA 3WYFA 3TUZC 5FTNA 1G4AE 4IW3B 2ZJZA 2QORA 3QKTA 3T06B 3TSZA 1GILA 4YLGA 2NG1A 4CGZA 1KNXA 3GMTA 3QPVA 2QAJA 2HXYA 3BFKA 2VA8A 5M04A 4URWR 1KO5A 4LJAA 1G5TA 4A2QA 3GJ0A 1EG7A 2DCUA 4NYIQ 4B75A 3O47A 1XMIA 1JJVA 2IWHA 5B2ZA 2C03A 3EARA 2R44A 4GRAA 1H8HD 5AJYA 5HR5A 3IUYA 1AK2A 3K0AA 5KPDA 3FB4A 3W5JA 1RC8A 1O3YA 4Z8XA 3QSYA 4PO1A 3VR6A 1HEIA 1MH1A 4V0NA 4BASA 3KXLA 5JCZA 4MRSA 5JSZA 3CPJB 2YJTD 4KAXA 4L4UA 3AVOA 3WNDA 3CX7A 4V03A 3AVQA 1T5IA 2WZQA 2FV8A 1BYIA 4GMXA 5C4GB 3AP2A 1JR3E 3TJZA 4NCHA 2GNOA 3C5HA 1NL3A 1XTKA 2FFBA 3AF1A 3MFYA 4TL7A 4AKHA 2GILA 2VQSA 1EXMA 2DWPA 2LCFA 4HB4A 4UNNA 1X86B 1P9RA 1UFQA 2B7BA 2VHCA 4MYTA 2IHBA 4DEXA 3EC1A 5H8WA 5L3QB 3LRPA 1RYHA 5KDOA 1F2TB 1S1MA 1IN4A 2AWOA 1ZBDA 4BPBA 1U99A 4I81A 1G7RA 3NWJA 1JXOA 3GFOA 721PA 821PA 1IY0A 1XZPA 4HAWA 5JBQA 2QPAA 1VHTA 4MITA 1S0UA 4JS0A 4B73A 4GP7A 4E22A 3HYRA 3GCGA 1N0UA 1JNYA 1Y63A 2O52A 3W3AA 1TU4A 1GP2A 4QGGA 2OILA 3EXAA 3CF6R 1ZC4A 1ZUHA 4LJ6A 4GNKA 4JLOA 1KDRA 1G4UR 3RRZA 4DCTA 2REOA 2IS2A 3Q8XB 3R9XA 3FGNA 1IY1A 4NBSA 4TYWA 5EE0A 5DGXA 3BORA 2WPDD 1FQKA 1G18A 3K0AB 1IXZA 4M8NE 2G1KA 4WW0A 3ZYCA 2O8DA 2GWHA 3C4JA 2FU5C 1ZD8A 4W5HA 1IQPA 3EWAA 2VP4A 3ZS8A 4Z54A 1ZNZA 3LBNA 1TU3A 4QXAA 5EE1A 1SXJE 4ZV4A 4HLUC 3KX2A 3C14C 1E96A 1UEJA 3KTAB 4G5QA 4BUJA 5JSZB 1NIPA 2R2AA 2QL6A 2VP0A 1QHNA 4A36A 5AJVB 3KXIA 1OH5A 3NBZC 2HEIA 4I1OA 3K09A 1D2EA 2ZROA 1VKJA 1KIMA 3SR0A 1IY2A 4A6XA 4DB2A 2DPXA 3U5ZB 2C9OA 4AKEA 3CPEA 5FH9A 1Q3TA 3QVVA 4V0OA 2GJ9A 3QG5A 2ZYTX 3C41J 4Q4AA 4OHWA 1KNQA 2ZU6A 2J0UA 2IS4A 1S9HA 2ERYA 2W0SA 1VG0B 2C04A 2HDNB 2ZE6A 2UKDA 2ZSDA 5E7IA 3ZVLA 3NEYA 4TYNA 4HAUA 1MV5A 4IVQA 4OKSA 1X8LA 2DFLA 2ONJA 3CZPA 3K1JA 4DB4A 1UPTA 3GD7A 2YC4C 5L3SA 2ZI4A 3ADKA 4ZO4A 2RGAA 1Z28A 2GVZC 2ZRDA 3K09C 4D4LA 1G9XA 3I32A 1C4OA 2V9PA 1U9IA 3B7GA 2H57A 5JRZA 1BS1A 4POAA 1LB1B 3U3MA 2ZRCA 2CLDX 2GZHA 2QTFA 4M9XA 4CEHB 1FOEB 2C9YA 1E9SA 1DAFA 2BBTA 1M7BA 2GCOB 3CWQA 2YOHA 3PUXA 2EWWA 3WBJA 3PEUA 2R8RA 5K8IA 2O8DB 4JL5A 1Q22A 2ZRNA 3GJ4A 3H86A 3PUWA 4US2R 4PTLA 3OFND 2IL1A 4Q1AA 4UKDA 4QKQA 2VTKA 3V4RA 1HYQA 1T3LA 1G64A 3ZZ0A 3VKWA 2O8CA 3WP1B 5KYKA 1OFIA 2H18A 2WKPA 2OLJA 5EXPA 1Z63A 1U9IC 4G5SA 5HKKA 1S96A 2CCKA 3D6TB 1JPNA 1D2NA 5JRJA 3DM9B 1N6PA 3ADDA 3LY5A 1Z83A 1T9HA 3H84A 3KJIA 4F93B 1A2KC 4B43A 1K5GA 1E9CA 4JVSB 4KXFB 5SZHB 2V3CC 2JLVA 1CRQA 2C77A 4YMUA 4TWZA 2AFIE 2ORIA 3THYA 4CRWB 4D4KA 1AKYA 4OYHA 4ESHA 1UAAA 5C46F 1G16A 2J0UB 2O8BB 4KLZA 4LRWA 2ZUBA 1J99A 4MKGA 4PAMA 4EFMA 1QZXA 3U7EB 1UBCA 5JCPA 1QRAA 4MRPA 1RPZA 4QJ4A 4Q9IA 3F0TA 2PMDA 3TK1A 1N6NA 2WOOA 3IHLA 1XZQA 3ZZUA 3PITA 5L3SB 2JJ2A 1FPMA 2VLIA 3PV0A 5IK2A 1E2DA 3SC3A 2ATXA 4XWKA 2PBRA 2WWFA 3GFTA 5FPSA 2W6JA 3PR1A 4B33A 1FMLA 3M6AA 1W0JD 3T1TA 3CBQA 1W2GA 1NF3A 4D81A 4Q1EA 3EC2A 4HAXA 4Q7LA 1J7KA 1KSHA 5TB5A 3AKCA 3AGPA 3SJZA 1E1RD 1E6CA 4B47A 1UBEA 2HLDA 3AEZA 3GJ3A 5IHPA 1GFIA 1GRQA 1MR3F 2XJ9A 2O8FA 3NBXX 2EFCB 2YWGA 4FMDB 1IHUA 3BC1A 4X8LA 5FOSA 1K6MA 1K5DA 1U90A 2PX0A 2UZ3A 4LBWA 4NHOA 4JLVA 4Q4HA 3VR5A 5IDVA 1CJUC 2V6JA 3K8YA 2FPKA 3QOFA 1U2RA 2WJIA 1IN6A 1Z6XA 4US0R 4C3ZA 1KI6A 1DADA 1Z0IA 4OI2A 4AG6A 4B48A 4BEJA 2LKCA 3A1SA 2BJWA 3X1ZA 1A7JA 3VMFA 4LBZA 5FR2A 2QENA 1M7GA 4DDVA 4CEJA 4YXWA 1Z22A 2IEYA 3ZQJA 3MJHA 4UJ5A 4EAQA 3ZVMA 4DVGA 1F48A 3UG7A
chains in the Genus database with same CATH superfamily
2LDBA 3NGXA 3O31A 4OP3A 5EMHA 1YZFA 1SFRA 1JIJA 3A1FA 3M3HA 1V35A 1BZYA 2J33A 1V0JA 4MV5A 4UBNA 4KE8A 3L7DA 2HTEA 5E6RB 1WP4A 3RHSA 4WL0A 2C58A 1G20E 3OZFA 1YAJA 1GCIA 2CXXA 4MRNA 4QL3A 5HTKA 4JROA 4UNSA 1X1SA 3L1JA 2HWXA 5CX1A 4XYBA 2NVOA 3FD8A 3UAZA 7REQA 3CG4A 3W5AA 1CUDA 1B14A 1EYZA 4XOUA 2QJWA 1I3OA 2OV2A 3H75A 1S3GA 4PU0A 4ALLA 2YC2C 3MUFA 2C84A 3KQWA 3IHKA 2E85A 3FYDA 1KIAA 1LNSA 1FUKA 3VPBA 1GGVA 3LZCA 4KQ9A 2JIRA 1SQ5A 3EZYA 4P4NA 3U9TA 4E1AA 5BR8B 3G17A 4H2DA 3PHIA 1KR5A 1HTTA 1PGJA 1UOOA 2BC9A 5AKXA 3WJAA 4BUZA 4YPVA 1LWOA 3KZOA 3U19A 3RK0A 1C7FA 3NMUF 3HDHA 5ITWA 2AC4A 2WKQA 1SVUA 1T1GA 2K5UA 2WYOA 4J07A 5HKLA 2REQA 4NE9A 4PPNA 5DVZA 3CKLA 1A5BB 4Z9FA 3BQMB 3HYNA 1BWQA 5ULLA 2B4TO 3T3NA 1VFPA 2AT1A 2LIVA 3CSSA 3H1PA 4QC2A 4W1SA 1W7AA 3IAUA 5MHTA 1RHKA 1XJ5A 1ZM4A 2C2GA 2NZ2A 2PKCA 2Q0SA 3W5HA 1Z6ZA 3OAAD 5K6RA 1SZDA 1I33A 4N6OA 4XGNA 3V8VA 2Y92A 5CEFA 1P9NA 5AW5A 2CNLA 2WZDA 4E09A 1C0KA 3OPYB 5EE9A 4HNVA 4W5NA 4FQ5A 3NH9A 4LVUA 4P2BA 4RZ2A 1QV6A 4Y7CA 5ELLA 4UZFA 5ALLA 4B6FA 2ERXA 4MRAA 4KPEC 1P2SA 3AF4A 4BZQA 1GQYA 2Y9PB 2JCSA 4OHXA 3MCTA 2NSDA 2QZJA 4KP7A 1B43A 3HJAA 1RFLA 3I42A 4MPRA 2F6RA 5DBHX 2W4MA 1ZY2A 2ZRMA 3AM4A 3C8DA 4J0CA 4LRUA 4PPQA 4EJMA 3FHOA 5D1NA 4TV9B 4DZTA 1R1DA 2KPOA 2NXEA 3ENNA 2XUJA 3CEHA 5LYYA 4Q9JA 1Y1LA 3QUQA 1PDWA 2IKQA 3H9CA 4EHJA 5A4JA 3IJRA 3EXG2 5CX1B 1YRBA 2J5RA 4LV6A 3N2LA 1W49A 1K8RA 3Q1KA 3BXZA 4UHDA 3X2EA 4CMEA 5GJVC 4DEYA 2J08A 5BNZA 1SA0B 1Z4LA 2O06A 3PSHA 3U3OA 4KZPA 4YP0A 4PHHA 4Q4LA 3F6PA 1MVOA 1FX1A 3GXOA 2JGKA 1Y5NA 4UTOA 5BN5A 1ZA2A 2NO5A 1SCUB 2II6A 4DAOA 4EF5A 1YGPA 3HBFA 1UMCA 1CNFA 1H8ED 1TJ5A 2ACWA 3DPIA 3HGMA 4XB1A 3VAZA 5CA1F 3JZDA 3PNMA 4H7PA 3UXEA 4G0WA 2KMLA 1GRNA 1VG8A 4CUZA 1C5KA 1W581 3KZXA 4PR0A 4G5RA 3A4IA 4H6VA 4LK2A 4I1SA 5TVGA 4CQMB 2P2SA 5FBHA 1DRKA 5LZ4A 1WDKA 3AU9A 4NY1A 4D0SA 5K8TA 4LF8B 1EE9A 2DVMA 2CJXA 1C2YA 2Q7XA 3CJTA 3DQQA 3I9KA 1F8GA 4RIHA 4ZCMA 1XAJA 2REQB 5ILOA 4G0QA 4BVHA 5JWOA 5CJPA 3ZE1B 4CU5A 2IW3A 4QHYA 1V5GA 1NM5A 2AJCA 3KB1A 4OGWA 3ND8A 3RWOA 1VXRA 2ATVA 2GN1A 4G0PA 2OZEA 2GD0A 4PLTA 3JWHA 1M5UA 2RK6A 3KFVA 1HTBA 1F0YA 3DE2X 4W1QA 1Z17A 3TLXA 5A7HA 2X1VA 1KK0A 1XLWA 4HDMA 4QBFA 2VWHA 3MCZA 4KQCA 4N8SA 1A3CA 3TZ6A 2AUTA 1H94A 3ESXA 3OUZA 4OD0A 2VFAA 5A1JA 4LC9A 5B6PA 4WCVA 4BFVA 4Z1MD 1VHLA 5E7MA 4QEDA 4M9ZA 2QT0A 2IJGX 2B2NA 4K6FA 4YT4A 1MRNA 3ETEA 1J22A 2B6HA 4FE4A 5ENDA 1DEKA 3EK2A 1QQTA 4WXHA 4FZJA 3DC2A 4ALKA 2FI1A 3KE8A 1AXEA 1QRRA 4FSXA 5AO9A 3I09A 3KUDA 1P9OA 4WNIA 4AB1A 4OEHA 4BQOA 1EFAA 3TSCA 3DTNA 4X71A 1H2RS 5J4VA 3CONA 2ZJ5A 4PHGA 4B44A 4F6CA 4U0KA 3ZE9A 4TN1A 4B6PA 3DE6X 2GK6A 3GCWA 5CH3A 1NP7A 3LAWA 1ULTA 1ZU5A 1PT6A 2ZRKA 1OWNA 5AVXA 2L0XA 3BXOA 2BSXA 3N2ZB 1JFTA 4GFDA 1KYYA 2JCGA 4R8VA 1UMCB 5DX8A 3DMDA 4OFXA 1BRTA 5I7SA 4QIHA 1GDDA 5DBOA 3SIWA 3OLXA 3AEKB 2CMDA 3EUWA 1Z82A 2AOXA 3OBIA 4AO7A 3ROEA 3ZJVA 3BH6A 1DPFA 3PQ8A 5IKOA 2ZREA 4Q3KA 4ZICA 5JPCA 2NYUA 1V5EA 1TXGA 1Y1KE 1NW3A 4HB0A 5HF6A 1I6MA 2UUCB 2HQOA 1N33B 1FFHA 2H2GA 4RFVA 4PSVA 3VNSA 5LDHA 2CKMA 4PG5A 3ZBUA 4EG0A 5JNTA 2FFAA 3ZNOA 4II3A 1WXDA 4MO9A 3LUAA 3TAHA 1XU7A 3PQ4A 4RXMA 3KJHA 3JALA 1N7IA 3FWNA 3KEMA 3L5OA 1UDBA 4IDFA 1QVRA 4P92A 1JYEA 1MAHA 1T5HX 1AC5A 1YDGA 4XCXA 4B35A 1XALA 3I5AA 4D3XA 1HZZC 5JV5A 3S1SA 4UAVA 5IHXA 4MUKA 2B69A 2JIZA 3QA3E 1H6AA 4OHPA 1Z4KA 3SF8A 4B81A 3E81A 1AU9A 4F92B 2X8WA 3QVOA 1U2DC 2XYQA 4HDMB 4KK4A 4LOJA 4O4HF 1GHTA 5EPUA 3RLFA 1MW9X 1U9ZA 2J41A 3INYA 4IQ0A 1GGKA 3TAXA 3VGPA 4XVRA 3NAGA 1RYEA 5DCYA 3K6SA 2V55B 4J3FA 1NA5A 2G63A 3B38A 2XWQA 1ZICA 1DFHA 3D3WB 1MJGM 3RSCA 3UW1A 3PD7A 4E5MA 4E3WA 2XDYA 2JS7A 3H4IA 3OU7A 2Q2VA 5I9NA 2G09A 1QE3A 2QLTA 3KIPA 3IVMA 4AC9A 1GZ5A 4DDWA 4JLJA 3FDFA 3H04A 4KVAA 1N6RA 2E48A 4G8DA 5KTPA 3NIDB 3VV2A 1OWLA 4K8OA 4KE7A 1W35A 2XXBA 2G4VA 3AEUA 3O9VA 4KIJA 1FXWF 3CZRA 4RV9A 1NXTA 1XMSA 3H1BA 1QPGA 3QUSA 4HFJA 4NYJQ 4PX2A 3NJRA 3ZLTA 2JPDA 1RWMA 1GGEA 1I4TD 2XUKA 3E9DA 4A8JC 4CKBA 5KHLB 3B13B 3C3PA 4EZEA 1WUYA 1K1EA 2C20A 1B0ZA 1H0KA 1J8VA 2H31A 2M9MA 2ZT7A 4WOKA 1JFFA 1FU8A 1FTNA 1A2OA 3DT8A 1EIZA 4XIIA 2IS6A 1T0PA 3GLRA 1ORDA 3AHHA 1ZUD1 1UJBA 1ANKA 1AHPA 1FX0B 3ZWAA 1IUKA 2VNHA 4FYKA 1YA4A 2QIPA 4L5AA 3DEYX 2HIAA 5K3DA 5EZQA 1Q0PA 3I9JA 3HZRA 3JALB 1DKRA 2NZ8A 1G5PA 4YCSA 2OCAA 1HMYA 3QEMA 2WYIA 1MVNA 1C3OB 1E8NA 1SD5A 1XZHA 3QE3A 4RE6A 5HF5A 3W8EA 3AR5A 4ZCSA 2XOKD 3ZHBA 4CMIB 621PA 1JEYA 3EZXA 1FFDA 4IWXA 1T8YA 1EJ0A 2WAXA 2WKRA 4PWZA 4U8HA 4ZXFA 3IMEA 4X90A 2VJDA 2VQ3A 4ZT6A 3WKAA 5F98A 2GS9A 3DKRA 3A26A 4R84A 3RAJA 3GT3A 2FSVC 2ORED 3MB8A 2PJUA 3HA5A 1L4EA 2APJA 5CIQA 2WF5A 1Y5IA 1XPJA 1FLNA 1BXZA 2VRWA 1DBQA 4LRQA 4EMUA 3CLRD 5ALTA 1MGOA 1ZNXA 1E1NA 1N5KA 3Q7QA 1EDDA 3VR4A 1F6BA 4GLJA 1YJBA 1JWBB 2VZ9A 3K6SB 4WBSA 2CKDA 3ZDQA 3Q3VA 2IE8A 1RI1A 5IP5A 1AHNA 4P7JA 1U11A 5CK4A 2XCRB 1WB9A 1T1IA 4HZUA 2EXXA 5KREA 5EHNA 3OIDA 1LKZA 1X15A 1L9KA 4E21A 3Q72A 4N4AA 3N53A 4MR8A 3LKBA 2GHIA 1R3DA 2PXHA 3FYUB 4PGHA 1AZSC 5A6SA 5LD2C 1CS0B 1P0PA 1H9CA 1YCHA 1N6IA 3QENA 2C61A 1UL1X 2VAXA 5GGXA 1UDWA 2PWPA 3DPSA 4ZDIA 5KKCA 3CF2A 3VPFA 1JG1A 1E1CA 3CX3A 4OOEA 1GAJA 4I2NA 4R01A 4RJTA 2OQIA 2PH7A 5D2CA 2HLPA 4IY1A 4CKBB 1S2MA 2ENWA 3G8DA 1PLJA 4IVPA 3BSYA 1AXRA 1DIGA 2GDJA 2X76A 5TPZA 1WV0A 3GA0A 3H6HA 2MT9A 4PANA 4EKEA 2XA9A 4PHFA 4ZAVA 1JHMA 1HEYA 2IK8A 1ULUA 2HNBA 2WM2A 4OYLA 2GCPA 4KQXA 1FU4A 3ESQA 3R7WA 4DIDA 1QPZA 2ZYIA 1I6WA 1LCIA 3HCOA 2IXTA 2I4NA 3HMKA 3VOBA 1CRZA 5C5DA 3VJRA 2GD6A 2IQIA 1RHQA 3K0FA 2IA5A 5FO0A 5JS1A 1EK2A 1Q15A 4UD6A 3A1CA 3ICWA 1Q0TA 3IDZA 1J8YF 2BFOA 3FRJA 3QEMB 4HAIA 3D7MA 3ZPXA 2I9PA 1PNOA 2V45A 4D3FA 4CIWA 4IEFB 1E32A 3SYKA 3AJEA 1K97A 3U1BA 2WTUA 1E1QA 1QTNA 3KCNA 1ZGCA 2W4QA 2RSLA 3LBYA 3QYAA 1ADFA 5KVCA 1Z0DA 3FBTA 3KWLA 1R88A 4KMSA 5ER6A 2C7RA 2XA1A 4G4GA 2V6GA 4ML3A 4Q1FA 5AYVA 3RRYA 4KOEC 3QYJA 2GT1A 3GAFA 4Q9KA 5KQPA 5CA1B 4XGIA 1W4BA 4IIJF 3PJRA 3IQGX 3FHTA 1AUQA 1OFHA 3DFMA 3TLBA 4BVEA 2XRYA 4F04A 1KOGA 4UE2A 3VR6D 3HCEA 3AI3A 3GEIA 4BJHB 5I9TA 2AJBA 1K3UB 4UPDA 3QE4A 2BGWA 2B36A 2WUVA 4AZVA 1T4DA 1AUOA 1S89A 2C0CA 1JU3A 1NQ5A 2DGDA 4HWSA 2IUSA 2PT6A 3BFJA 4R83A 1NLFA 3OIWA 3QKUA 4ALNA 3NVKI 4ZK2A 3SDSA 4EF6A 1YB6A 4IOMA 1KI9A 2ZM6B 4QJ5A 2AX4A 5E3IA 4WZZA 1HMPA 4PGGA 4U0JA 4E2FA 1U6JA 2CLFB 1A72A 2AW5A 2WE8A 4U7PB 4LNHA 5CNMA 3SC2A 3IP8A 4D8XA 4YYZA 3HBMA 4HDRB 1NX9A 1TD1A 2PMWB 3M1AA 5JD3A 2BH2A 1H1TA 3OM8A 5SICE 3TKLA 1QHHA 4IO1A 1LBHA 2WSLA 4O4HA 2ZKLA 4CKEA 4RD4A 2VJMB 1OIWA 1FUIA 2M98A 4PF1A 4GL2A 3V80A 3KEFA 1W52X 1YDFA 1FDWA 1D9XA 3D4PA 4P08A 4C3VA 4MDEA 3V32A 3MS2A 2GXQA 5F76A 1FDOA 3W6PA 1T1JA 1I1OA 4NZOA 2OEPA 3L1VA 3K0FB 4CJXA 4BVBA 2C7PA 3WGVA 1DJLA 2WWTA 3G88A 2DKNA 1PTKA 4M0LA 1DTSA 3UT5A 2O7NA 1XN1A 3K2QA 4EFKA 4ZHSA 1U81A 5DNYB 2Y8EA 1XF9A 3KYCB 1ESZA 1XHLA 1WB5A 3LL4A 4ACAA 2BGRA 3GOHA 3LT2A 2XVZA 3R5JA 1CY8A 4LPKA 5LQSA 1FXWA 3ITNA 2G17A 2DQSA 2HH9A 4Q3LA 3WJ7A 5JISA 3MSXA 3NCHA 1W75A 4JR1A 2YWCA 5TMEA 4G0OA 2XZTA 4R3UC 4YJKA 2BWJA 1OT3A 1AB5A 4NPCA 1YHNA 3OJWA 1RRFA 4GSLA 1G66A 1NBOA 4M8SA 1DEXA 2EW2A 1GZHB 1YOVA 3QPBA 3K3PA 2B3DA 1CF9A 2PBLA 4E33A 3AHIA 5A3QA 4A15A 3GLHE 4YRLA 2VJOA 1DJOA 5GTDA 3DM5A 2AJ8A 4O8ZA 1T8RA 4DLKA 4P35A 1F7VA 3CVVA 4FC6A 3FJ1A 3NBAA 3ZV3A 3A10A 2FZGA 4KOAA 3TE7A 4TZKA 1OYOA 1EWKA 1S2IA 2ZYUX 1BX1A 5ALMA 5DO9A 2OXIA 5DMHA 1ZA1A 3W90A 2D2VA 4RVCA 4RORA 1KI8A 4FIZA 1LPBB 4NMXB 2O3RA 5H59A 2G7MC 2WUDA 2QQFA 2Q9AA 4L4YA 4BNIA 1DJNA 5K9ZA 1M6VA 2CDRA 3PSAA 1NG9A 4BB5A 4O4HB 2LRHA 3D8RA 4G4JA 3NDRA 1LI4A 3DYVA 3U40A 4BN0A 1K6JA 1KJJA 3AXTA 3B9BA 1N0WA 1MT3A 1XTIA 2NUBA 2XUGA 4MIYA 3PC8C 1CQJA 2F1JA 2LIPA 4XVQA 5KWSA 3ZOKA 1KA9H 1V7CA 2IF0A 2R1ZA 1WM1A 2Q4TA 2ZJ7A 3KSMA 2P2DA 3O0TA 2IHUA 3JYOA 3ABSB 2AI2A 4ILEA 4WTOA 3WGKA 4AUKA 4CTMA 1E3WA 1G6OA 1R4AA 4B4DA 4F97A 1WXEA 2B99A 2IOFA 4PYQA 5DRTA 3SNKA 4BLUA 3OEHA 4KDFA 3B2NA 1NRXA 2GZ3A 1R6DA 2IEAA 1Z16A 1RJFA 2VP5A 3L6BA 2JJQA 4FZ3A 3GT7A 4B4VA 5TLSA 2SHKA 2LXNA 2VO1A 3COPA 4KVZA 3DMNA 3IH5A 3IKMB 4LOHA 3UICA 1MQ8B 4ZYLA 2BKUA 4JI5B 3IMKA 3RNOA 3JZMA 1NZFA 1G41A 3E84A 4P82A 3ZIDA 3VYWA 3HH8A 3BIXA 4E5UA 1JILA 2ONCA 3DVSX 4FFRA 3KUKA 3WHKA 1LLFA 2OFOA 5LWQA 2ZUFA 5CD9A 4F38A 1U7WA 1H22A 5SZKB 2J59A 4TVKA 2OORA 2W2PA 2QD2A 1GQSA 2XGMA 4M98A 5CVUA 2OYCA 5FPTA 1M34A 5M34A 1QVZA 2JLYA 1VA4A 2FP4A 3D8HA 5DM2A 4LFCB 3ZHOA 3LXXA 3TCKA 1YOVB 2ENUA 1IPHA 1TZKA 1O6BA 3EGCA 2Y66A 1P18A 4ER6A 1MBZA 4KQFA 2E89A 2OGUA 4FOSA 4BRSA 3D2BA 3JQ8A 1KORA 4ZI2A 1QF6A 2W2MA 4KYVA 3DZJA 2X40A 5TV2A 3V3KA 1XRQA 4LSGA 2G76A 2C54A 1BE0A 2QM8A 4HXYA 1IHXA 3EPLA 2ROQA 1TRHA 2NZUG 5ER9A 1WWKA 4G56A 3OG9A 3VTKA 2G70A 1KSFX 1A8UA 1TU0A 1NKTA 5K3FA 3UENA 1ZAYA 1VI6A 3THOA 2VSFA 3EXEB 4Q02A 2JD0A 3WL6A 1GARA 1MVLA 2YUTA 5BWNA 1M6VB 5AM3A 2WICA 1AY0A 1R8SA 4HN4B 4LY6A 4P31A 4XVHA 4C7VA 1NVEA 3HXQA 4ARUA 2IYWA 4OAPA 5JZVA 1GAEO 2QT1A 2BR5A 3I9V1 2OMKA 4IIJA 4MARA 2N47A 5JIBA 3T3IA 3BGIA 1PL0A 5HWSA 3PDIB 2V7TA 1M0WA 4X3OA 1WMFA 2JJ2D 3IP5A 3LLVA 4BTLA 2VP6A 2I7XA 3GAZA 3MTBA 4FS8A 1FSGA 1XXHA 1E3WB 4OB8A 1DBSA 2EFJA 3FPCA 1GTVA 4YUYA 1N4AA 1SBZA 4WFJA 1P4SA 4HQNA 3SVZA 1JSLA 3S2IA 1NUPA 1LQTA 1MABA 1L7BA 1G3QA 1KEEA 1ZCAA 4P34A 4W4TA 3WB1A 1WUTA 2C3MA 2KQUA 2Q3CA 2YZGA 1J8MF 4O2AF 3PR2B 4PC6A 4ZDKA 2ZS8A 3USCS 3Q3JB 2RG1A 2HLDD 3WV5A 5BW8A 4JI8B 2QMZA 3RCBA 2A1UA 5CTAA 1Z74A 4ZYZA 2O59A 1POWA 3TG2A 4IO0A 5L9AA 4HB3A 4MVJP 1EAMA 1GKYA 5DCUA 1EVLA 5PNTA 1AQ6A 4JSTA 1R5BA 3WTBA 1JJFA 4KRFA 4EVQA 3E5MA 2AL7A 4BUCA 4EPXA 1HI9A 4DV0B 3AW9A 1OV4A 5ECDA 1ML3A 4DNQA 1H2XA 1Y6FA 2QE7A 2W83A 2PNJA 5B3JC 1XJQA 3MTIA 4C88A 1A5TA 4FYPA 4EHDA 3JQ8B 4GM1A 3WV4A 4PICA 3V6LA 5EXTA 1ETUA 2X5OA 1HH4A 4JXJA 4XPIA 1D2AA 5LMCA 3PQ6A 1IOWA 2FSPA 1SHKA 4MQUA 3RANA 3C7DB 1P2VA 4ZQEA 2GXSA 3BFVA 3EX7C 3T1YB 1K08A 5K3FB 4A92A 4D26A 5ALSA 1OJ7A 1YCFA 3B9RA 5KVSA 2HC9A 2HQSA 4N9WA 4ZRMA 1DHTA 3OPQA 5IH7A 2XGJA 2W2TA 4XSHA 3OD1A 4DCOA 4E5NA 2CC2A 2A9JA 4JLNA 4EQ6A 1V8OA 4Z51A 1CUYA 3M34A 1YFLA 4G41A 2R6AA 4BLSA 1VPTA 1A82A 1GITA 2X4LA 2MDTA 2NN3C 1XZLA 3AY3A 4HG2A 3ROXA 3THYB 2E4WA 1PNRA 2OZPA 1VP3A 1GT6A 3DL2A 1Y9AA 2PSJA 3VM6A 1TGVA 1H85A 4FGKA 3RSOA 3NG1A 2VLBA 3SZ3A 1A7KA 2GF2A 3G7UA 1NUSA 5D84A 2XE4A 1N7GA 2CXPA 2VPXA 3WB2A 2PMEA 1K7CA 1N9GA 2BMFA 4XWYA 4KREA 2J45A 1KDVA 1AKUA 3AP1A 1KHTA 2BHNA 1NF8A 1Z2DA 1MABB 3CKKA 4LVNA 4N6GA 2NVUB 1KEEB 4QGSA 3FJOA 3B8HA 1DAEA 1IVSA 2C4HA 2F1KA 4EGQA 3A4MA 4RHYA 5D00A 3KRTA 4BX3A 4M6WB 4V1CB 2HDWA 4J6FA 1Q19A 3BRWD 1L9XA 1U2QA 2ORWA 2RH5A 3LP5A 3OMXA 4YTEA 3TQRA 3ZE6A 4BEBA 1GOTA 4M21A 1KC1A 2GH1A 2WDPA 3BD8A 5TE9A 1GNQA 1D1QA 1TMGE 4DV5B 2B9VA 4K7JA 3FPJA 1IDOA 3BD9A 1Z8HA 3M2TA 2C5HA 4HCJA 1FY2A 1VE9A 1MFZA 1OAAA 2PGDA 1S6YA 4HUQA 3NHPA 1JMYA 4ZJUA 1KDOA 4KXMA 1G21A 4LYDA 3W7BA 2QP3A 4INPA 1JIKA 4GECA 2VBIA 3I53A 2GEDA 3ZXIA 1U02A 4ES6A 3ESBA 4C7BA 2MHCA 3VVCA 1D0SA 1Z5VA 2P65A 5ESWA 4YMTA 1K7EB 2CY0A 3OC0A 1W5TA 2JFBA 3QJGA 5K20A 1E2BA 1VIMA 3IHWA 5G0VA 2YS7A 3V7WA 2VPTA 1A8PA 5CYGA 4B0PA 3BTVA 5K0LA 1QO9A 3W78A 2NMVA 2VSXA 3DEJA 1ORIA 2QTBA 1GLGA 1A5ZA 4FSDA 4JASB 4X7MA 5ECGC 5B2EA 2FSGA 3T9AA 2CGEA 4CCSA 3KQKA 3WGZA 3NUQA 3INTA 4Y2VA 4BS9A 1KEVA 2BKLA 3O8OB 3ZW7A 1E2NA 4AJJA 2IY7A 2J7PD 1DQNA 4ME6A 5DXAA 1N2EA 3QHPA 4M87A 3ROFA 2QMHA 4JP1A 2JLZA 2P7IA 1GNPA 1RYBA 3NYWA 3LQFA 4WV3A 3VDNB 3OFJA 4BFZA 1SUEA 4P3XA 1EZ1A 2I6FA 5CVVA 2EGGA 1OXTA 1P3DA 3MIIA 3QBDA 3Q3EA 4YC7A 2P90A 3ZY6A 2A9KA 1RR6A 1BA3A 2AD1A 2FQ1A 1O54A 3EEQA 4TMXA 3OZRA 1SXJD 1T6YA 2F8SA 5BQ5A 521PA 4PAGA 4ZT5A 3T7IA 3S2FA 1XL1A 3X44A 1UBSB 5I3ZA 5EHGA 1ZNWA 3V4LA 5EUMA 3V7UA 4KFCA 4IP0A 1UKBA 2RCNA 3H3FA 4L73A 1UBTS 1X7HA 1XZJA 3LHKA 4N40A 4QO7A 1OX6A 4ZT2A 4DLXA 5CIWA 3CNLA 3GAAA 3KYJB 2MSDB 5DT2A 1YUNA 1LTKA 3B6KA 3KLOA 2HA6A 2IP4A 3OPXA 2CV0A 4XSVA 2ZI5A 4BZWA 4FDTA 4IKPA 2ORVA 3OTQA 2ZIEA 2CLIB 1WOYA 1CULC 5LQNA 1DEAA 1DEHA 1G21B 4EFNA 5BSVA 5J5AA 2XXAA 3AH8A 2FX5A 1T2UA 1LC3A 2AEFA 1JLKA 1XZFA 3P26A 4EO9A 2OB2A 4HDAA 3UJBA 3C3JA 3F71A 8ATCA 3O7WA 2FN7A 2DSTA 3WGUA 3DVQX 3NAQA 3PZBA 4RJIA 5KAPA 3ZWNA 2MOKA 4RTQA 3LWZA 2F55A 4XEUA 1USIA 5SV2A 5TMBA 1O95D 3LDHA 3O74A 4O2AA 1O9GA 2C07A 2O2DA 5T6BA 3FDZA 3KVNA 2IHZA 5BUSA 2XB8A 5HGXA 1G8MA 2WLSA 1V9CA 2ISQA 4CDGA 3NTQA 4FFDA 4QG3A 4IEIA 2CLCX 2WYVA 3LX5A 1L4BA 4GMDA 3WICA 1SG9A 2C2YA 1RTKA 1T91A 3W4KA 5KSYA 5IT9A 3SE0A 4JMPA 3BA1A 3D4BA 4DGQA 1VLLA 5AVVA 2OXRA 1KO1A 2WM3A 4P4SB 5T5QA 1NUHA 1X3SA 2XADA 3ZIUA 2R5NA 1CEYA 1KYWA 2YQ4A 4UHBA 2A4MA 4UTZA 1PGNA 3Q9UA 1VSUA 2YYAA 3GZ4A 3RTGA 5DPMA 5AVYA 2VEOA 3ZXYA 4BFCA 3AXSA 3SBXA 2EIHA 2IBMA 1XL0A 2OBNA 2PRSA 2XLCA 4G97A 4HPJB 4JJ4A 2R8YA 3ROTA 3HNOA 2WJYA 4PXAA 3H2SA 3MOGA 5INTA 5LBUA 1VLHA 3NFYA 5KYNA 2EP8A 4D92A 1WMBA 3UK2A 1JG6A 2JAXA 1UWVA 2ZUWA 4LMAA 2PM8A 3ZGOA 4MUMA 3RF6A 3VNVA 2ODTX 1T1EA 3U60B 3J7AC 4IJMA 1USUA 3FI9A 1WCIB 4NDAA 1RMQA 3SJAA 4OBWA 4FFLA 4U02A 4M37A 4X61A 3RC9A 3DTVB 4A23A 5JE8A 3AFIA 3N2GA 5CLIA 4F06A 4CKWB 2A7QA 2VEDA 5PGMA 3FYCA 4YEDA 4DV2B 4YMIA 5BXQC 1M2HA 2EAUA 1H23A 2XKBA 4FFBA 2XXAB 4BIIA 2CEAA 4O4JF 3HWSA 3NRBA 2PGIA 1P7YA 2WJ4A 4PNEA 1NMYA 1DOZA 1JDVA 2RJOA 3EPHA 4W5OA 3FUVA 3NDBB 4MA0A 3GELA 5I7RA 2Z2XA 1PJSA 2HDOA 1RXWA 3FN4A 3EC7A 2I91A 3WXBA 1VJCA 2BEJA 1Y5LA 2Y0PA 3A0UA 4GRDA 3K2IA 4O2AB 4QFMA 1F9EA 3FDZB 1W1WA 3KDAA 2CLEB 4FDAA 1H2HA 3FOBA 3NBFA 1RU3A 1QE5A 1CZLA 3EG5A 3UAWA 1FUEA 1DC8A 1UJCA 1HOTA 1AUVA 1DC7A 4INOA 4OFWA 2VHXA 4YBZA 4DIOA 3AR6A 3QLEA 4KO4S 5T4FA 3ZIAD 2B98A 1E5QA 2DBQA 5AW9A 1C50A 2Z2KA 3BSSA 5B7PA 2HBRA 4AYTA 1M73E 2Q1WA 3DMTC 1U5AA 4NJOA 4WEOA 1M8GA 1X19A 1U0SY 3U6KA 2C8VA 3TYXA 3JRWA 1XWIA 2XNDA 5TVKA 3GUYA 4I6EA 2UUOA 2ZULA 4QWWA 1GA6A 4PFJA 3LCVB 3P0RA 1GEGA 1C7EA 2VJQA 4FN5A 5ILQA 3C3MA 1LI7A 3D3KA 5HIAA 3DSRA 1FS6A 1M34E 1L1QA 2GBIA 2H3HA 4G89A 4HWGA 4JCCA 7ADHA 5I01A 3CX4A 2YVQA 5FNVA 4IFIA 4GQAA 3ZCTA 1V26A 4OHZA 2I03A 2JFOA 1K4MA 2P5SA 4ZHQF 5CJJA 1PWZA 4H1VA 1RHRA 5ALQA 4O2BB 1OAOC 4Q7KA 3RVRA 3HV2A 1F1JA 4NDNE 3KKNA 1TK3A 1L7XA 1KMNA 1U0JA 4FBLA 3RSHA 4RD6A 1T35A 3I2YX 4YMSA 3X1XA 3TNDA 1L7AA 3ILYA 3RM3A 3MAJA 4B3DA 4QJ3A 5IJ0B 1UOQA 1JB1A 3DV9A 3DFIA 3NYRA 1DDOA 3P0HA 2V0NA 4IMJB 4DTIA 5HZGA 4RTNA 4RYDA 5CVCA 1I24A 4AM8A 4DMHA 2AR9A 2GNPA 3C3BA 1VDMA 1GRRA 2RARA 3JZAA 2MJLA 3O2QB 4H3HB 3FY4A 5KB3A 4LJRA 1QC5A 2WUGA 4ZZ3A 1UPCA 4YUXA 5F35A 1E94E 3KYDA 1LDYA 3ND9A 1WSWA 3JRNA 1CV2A 2QN9A 3EMKA 1A98A 2KS6A 4JU8A 3TW0A 4ZZ0A 1YZ3A 2ID8A 4Y2YA 4IOLA 2QQGA 1ZM7A 4UBJA 4PX9A 4DTCA 1MZPA 4CEIB 4HJRA 2FHSA 1NT2A 4O2RA 4KAAA 3TUJC 4C89A 2JFXA 3ODPA 1Z0KA 2MTBA 3IDSA 5KYUB 3JS5A 4DC9A 4QOFA 1XXHE 3UFXB 4BO3A 3D6JA 3GGOA 3RSZA 3VGJA 3TRFA 6Q21A 5AXDA 2NNLD 3CZ5A 3L8HA 3SYLA 5FEUA 4YAEA 4X54A 2P2CA 2V9CA 2HJGA 2F9FA 4LXGA 2BHSA 2H92A 4WPGA 1O94C 4XWWA 2B2CA 3UXHA 3SP1A 5C2JB 3M5DA 1MB2A 1MHTA 3N87A 3TLEA 4HFRA 3GLIA 4QX6A 4UFNA 3UCEA 4CLRB 1UXJA 4E31A 1BVUA 2OYSA 1QGZA 2ZTLA 1UIRA 2QLLA 3CW8X 3ZKWA 5GOZA 1H9BA 4ND8A 4DM7A 1WNFA 2WUWE 4EITA 4M1ZA 4RLHA 4CM9D 5HM6A 2C5BA 1Y9JA 3IT3A 2JEZA 1TT7A 1Z7EA 2NLOA 4XDGA 5CLLA 1S4QA 4YX9A 3W9YA 1ZMRA 1L5NA 1JIIA 3ROPA 2O0HA 3ASZA 1J9ZA 4XUEA 2J6IA 3TXYA 5LL6P 3OZXA 4DV4B 4S1WA 1EFTA 1QO0D 6NULA 1MB0A 5KBYA 1SOWA 4LJYA 1SB8A 1TVKA 5CM9C 6YASA 3HN7A 1Z2EA 1TTTA 3D6NB 1JKJB 1DG1G 1GUDA 2XLBA 4H6XA 2W2XA 1PG5A 3JQAD 4N3GA 5HCUA 1QGUB 2DUJA 5AI9A 1R18A 3WL5A 2ZI3A 4F1WA 2QQ0A 5BN4A 3LT1A 3W8RA 3PXUA 4FCTA 2J85A 13PKA 2IELA 3E61A 1JMVA 5EPOA 1HE1C 2X19A 3U3XA 9MHTA 3G9ZA 3SS8A 2LCQA 2VUHB 3QLVA 3ZWWA 4LYYA 5E1MA 3R9IA 4RTMA 2YHSA 3VU8A 2G0TA 4XZ3A 4BMSA 4LFBB 4PPGA 1ZP6A 3FNEA 3TF5A 3OHPA 5C1BA 2XKAA 3D6VA 3P2IA 1DKNA 1OR8A 1X7XB 1ZO8A 2C3PA 1LLCA 3KYDB 1SCDA 3FDJA 4R40A 1R5NA 4X85A 3BK7A 5H9VA 4YWHA 4YRMA 2QJTA 1VBNA 2JLBA 3ES9A 3GEHA 3SF0A 1QGED 2CMHA 3FYHA 5ED4A 4AKGA 3DB1A 2NTEA 1ZLXA 2H7VA 2IIBA 4R2MA 3TVYA 4DQ0A 5FV4A 3I76A 1W73A 2QMYA 3PDWA 4JJGA 1ZMTA 2NU7B 5KNDA 4RZXA 3W2HA 5CM8B 3MWDA 4IDPA 2R5FA 4O63O 3G5TA 1YZYA 2P4HX 3I45A 4B82A 5AVZA 1JQJC 1VC2A 2JGAA 2H51A 2X8JA 5EKUA 1NXVA 4NFYA 3PD1A 4JL6A 2XTMA 2PGNA 4WVFA 4S1TA 2OHOA 3KM0A 3T7AA 1RYZA 3K9LA 4OJQA 2ECFA 2VKTA 2AFHE 3WLLA 3RYHB 4GOMD 1P29A 2W6QA 3DAHA 2KSQA 5FJIA 5TEVA 1CRPA 1II9A 3V4SA 4YACA 3AHCA 1N0HA 1KC3A 3MELA 5L8VA 3ZKWB 2W93A 5JADA 5KJFA 4EYOA 4OK6A 2HK7A 2GTPA 1UT6A 1VJ0A 1E4EA 3G9UA 3PUZA 1CJCA 4O4JA 1NC3A 1YAHA 3GJ6A 1R37A 2Q3JA 4LI3X 3U7QA 4QPPA 3RODA 4YRGA 1ZKDA 4OTZA 1JQ5A 3UG6A 4MUAA 3OHMA 2OZLA 1G21E 2QVYX 5L3VA 1RRGA 4RCYA 1N9ZA 2XNSA 3Q7SA 5F51A 3J7TA 1QQBA 3WYDA 1TVKB 1RT9A 3A11A 4KUEA 3F2IA 2CK3D 1C29B 5E1BA 3QVWA 3U62A 3VPHA 4I9UA 1YR3A 4PYIA 1GV0A 1XZNA 5ESRA 3LGAA 4G5OA 3M1YA 4GOXA 4KQHA 2HREA 1JFSA 1RCFA 4RO0A 2Q0XA 3P4YA 1YU9A 4MRRA 2Q4RA 3P27A 3C8UA 2IXAA 4CDNA 5JZMA 1HEUA 1LBTA 3KTAA 4JUCA 1MUUA 1NVBA 1J1ZA 3Q0EA 4PZEA 4B6JA 3INRA 2FZVA 1W4ZA 4C0KA 4M1TA 3KB2A 1XVIA 1OXSC 1CRLA 3E82A 3VVLA 2ZM5A 3U9SA 4GO1A 3ESCA 2HLHA 3FOEC 3RWMB 1ITZA 4NS4A 3D0KA 1FLAA 1E2JA 2B9EA 2AOUB 2OAEA 2PZKA 2BMEA 2F8MA 2JATA 2QTNA 3MWLA 3NAZA 5EXEA 5JD6A 3JQCA 2QBYB 3MWDB 3G2LA 1U8ZA 1AH2A 4LXYA 4V0SA 3M33A 3WLTA 4KHZA 1LDMA 5C5IA 3NNDA 1QAOA 1BE1A 1XNGA 2X8JB 5JEEA 3JARB 4YJFA 5KDDA 3ICOA 3MIZA 4ENTA 4EY6A 4AG3A 4N5LA 2ZAGA 4UU1A 4E12A 1QX4A 1E8MA 1G2OA 1TF7A 4RETA 1Z8FA 3N8DA 3V00A 4DXHA 1A4XA 3ZQUA 2I6UA 3JXEA 4URUR 3VZPA 4TMVA 1BAPA 1MPTA 1B2LA 5KYVA 1EVIA 2AXEA 1HGXA 2RHTA 4NARA 5T4HA 2WFZA 1H6DA 1UMBB 3RS3A 5JAIA 5CBKA 1RSZA 1WBJB 5U4XA 2NV2B 3QBEA 4WCFA 4BVJA 4M22A 4K9QA 1N8NA 1V95A 1BHJA 2ZAYA 4LTMA 3P9IA 5JSYA 3WHLA 3EF1A 3ORSA 4EB0A 2O20A 4NSNA 1DCKA 2OZLB 3A1VA 4KODA 4AY2A 2PT7A 3U7HB 2VJKA 1CZHA 2CL5A 3NYIA 3KWMA 1JAYA 3GGCA 2GCOA 4KGXA 3ZH2A 3CRVA 1L4MA 5AUPB 1BD3A 1SBNE 3EDQA 4HYYA 4ZC8A 2FPLA 1FSZA 1O08A 4HP8A 4MVJM 4L5JA 3V55A 2L2QA 1KF0A