2G1JA

Crystal structure of mycobacterium tuberculosis shikimate kinase at 2.0 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
166
structure length
159
Chain Sequence
APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGAGPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shikimate kinase
publication title Crystal Structure of Mycobacterium tuberculosis Shikimate Kinase in Complex with Shikimic Acid and an ATP Analogue.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 59
structure length 159
sequence length 166
chains with identical sequence B
ec nomenclature ec 2.7.1.71: Shikimate kinase.
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2g1jA00
3L43A 3OIWA 4NYMQ 1D2EA 3RYTC 5C4MA 4QJ5A 4X8OA 1G3QA 1S9DA 1K5GA 2G6BA 1GNPA 1XXHA 5LDDC 4XSHA 1VDZA 3V00A 1PUIA 3QKRA 1Z08A 1B23P 4JLVA 4TN1A 3GLGB 1JAIA 1PUJA 2I3BA 3K53A 4NYJQ 4NYIR 2OBLA 1NJFA 3CNNA 5FPTA 2JLYA 4G1UC 2BOVA 1N6IA 3O47A 3GEHA 4TTQA 3L8YA 1XD2B 3ZGXA 1CEEA 3A36A 3PUVA 3EIEA 1N6KA 4PO8A 4DLUA 4ZCLA 1XDBA 1NBMA 1RIFA 1OFHA 3BJIC 3CONA 3AEZA 2R6AA 3EC1A 2Y8EA 1N5JA 4L9SA 1NSFA 1ESMA 2ZSEA 1KHTA 3OEHA 1TAGA 2RMKA 3O8BA 5H1YA 2JGNA 3LO5A 2GILA 5TB5A 3OHMA 5KDDA 2C98A 1II8A 3KJHA 4LBWA 4O3MA 2WBLC 1F5NA 1VG9B 2VIIA 4V0OA 1IAQA 3FPAA 2ZRHA 4OHZA 3H0KA 3KXKA 1W49A 4OHXA 4BFZA 4K81B 4NBSA 2P67A 2O8FA 2I1VB 2N46A 2GVDC 4KLZA 5JSZA 1XD8A 1S3GA 3CRRA 4RD2A 5KUTA 1G18A 1QRAA 3AF4A 1KDTA 1US8B 2EU8A 3R9XA 1DPFA 3KJGA 2CK3D 1TMKA 2CJWA 4NYJR 2AFHE 2AD5A 1NMZA 4EJSA 3I5YA 4Q9HA 2CVHA 1WBDA 1KKMA 1KNXA 2IT1A 3A1SA 1YZKA 5TDHA 1S0UA 4A4DA 1AKEA 2OBMA 4GOXA 3TSWA 3EAQA 3X1YA 1N3BA 4BGDA 1IXRC 4WIAA 5FBLB 3F3YA 1VHLA 1GTVA 2QRNA 3L0SA 4KITB 4JJZA 1EGAA 2O5VA 4HB0A 1V5WA 3TUIC 2QAGA 3NC0C 3WMFA 4LJ4A 3NBFA 2GXQA 3NWJA 3VU9A 1F2TA 3QXHA 4CIDA 1CRPA 4TL9A 2P6UA 2Q0HA 1SXJD 2IYQA 4LX0A 1EK0A 4QHTA 1T3HA 2C9OA 4JL5A 1F60A 2XAUA 3W34A 4B3CA 5E7IA 1FX0A 4C4PA 4OI2A 3ZQ6A 3T61A 1RFLA 2XTNA 3SFVA 2XXAA 2W2XA 3ONWA 4AG5A 1Z83A 5EXSA 2EFDB 2JLXA 1UDXA 4A6PA 4LHVA 4DUGA 3P4XA 5DI9A 1E2MA 2CDNA 2O8BB 4F91B 1X1RA 3U7GA 1W46A 2KBEA 2VQSA 3BOSA 4Q1DA 2VP9A 3VX3A 4PPFA 3LXXA 3VR5A 2WIBA 3A4NA 2DPXA 2AXNA 1LNZA 1QHYA 3FE2A 4MH0R 2QAGC 2FV8A 1Q3HA 1J90A 3MWJA 1ZD9A 1GSIA 4Q5IA 4V02A 4C2TA 4B75A 1JXOA 2QTFA 3RS0A 1EX6A 2ATVA 1TQ4A 4ABYA 3THXB 3QQ5A 4PFSA 3FB4A 1RRCA 3RABA 4QM6A 1Z3IX 4BLOA 4PC6A 1KZGB 2HUPA 5D3MB 4A8JA 5ANRB 2OFOA 4N0EA 2J5XA 4DLVA 3U7FB 2OBNA 3A4LA 4WOPA 4HDOB 4B32A 4JVMA 1GWNA 3HJNA 3L0IB 2C03A 1D2MA 3RLFA 3G5UA 1X3SA 3PITA 2NMVA 1PLKA 1JNYA 3QF4A 4YQFA 3GJ6A 4YMUA 5E95A 2F9LA 1ZJ6A 2QL6A 4F4CA 2WTUA 4G5OA 4MKIA 1Z22A 1BMFA 1OIXA 2ZE8A 1W47A 3V4RA 4OKSA 2ZU6A 3U6BA 1W4RA 1XPRA 4D26A 1YHNA 3B82A 4QBGB 2VP4A 1D9ZA 3ADKA 3W6OA 1GL6A 4LYJA 3CBQA 1DTSA 1EG7A 2DCUA 4Y0AA 4CEIA 3V9PA 2GJKA 4LUCA 1DAFA 4QL3A 2XJ4A 5G41A 3DMDA 4RZUA 4PAQA 2V6JA 4US2R 3S1AA 3LVRE 1CJKC 2ZRIA 1E2NA 1P9NA 4A8JC 2VP2A 2WPDA 3C5CA 4A0FA 2ZRMA 2OM2A 2WMOB 1G19A 3KUCA 4KODA 4PANA 1SVSA 3DOEA 4C0JA 5KNCA 5JEEA 2AWNA 3RRMA 1TQ2A 1ZM3A 3EARA 1IONA 1VG0B 4XOIA 3ZZUA 1YRBA 5ELXA 2Q3HA 3BS4A 5FOWA 1E99A 4B35A 2JLSA 2WAXA 4BECA 3QE0A 3U60B 2FSFA 3K0AB 5C2JB 4QNRA 1KO4A 4R2IA 4W7SA 4R71A 4IVPA 5FH9A 2CHVA 1OHHA 3KTAA 3QKSA 1OH5A 3PFIA 3GFOA 4V0MA 3NH6A 4KXFB 1KZ7B 2FPKA 4JMPA 4LDJA 4WXRA 3ZS9A 4URVR 3JZMA 3X1XA 4PZZA 2IYSA 3CF2A 3AVTA 1EWRA 1NIPA 3GLIE 3IGFA 2KBFA 3E2IA 3IQXA 4GMXA 4NDZA 5G53C 4YMTA 2XZLA 2O8DB 1G3MA 4AK9A 3A1VA 5HPYB 3PR1A 4F93B 1R2QA 1W4AA 3BERA 1CR0A 3T5GA 4QFMA 2QSYA 4XVQA 3AGQA 1OLOA 4W5JA 1AZSC 3CX6A 1Z29A 2ORVA 4MRPA 4ERNA 6Q21A 5JJLA 2OESA 3T35A 1H8HD 3I73A 4FD2A 3QPVA 1XFAA 2D4HA 3AV0B 4TLDA 3Q9LA 4WZ6A 1FPMA 3CIOA 3P32A 3NBXX 4A36A 2O8EB 2IYWA 8OHMA 3JVVA 2OCYC 1W0KA 4QGGA 4FMBB 5C1BA 4P0TA 2ZJBA 4LJAA 1BS1A 2P5TB 2EWWA 4DCVA 3R7WB 2VO1A 3EG5A 3PEWA 5KDLA 2BEKA 2GWHA 2ZRAA 1DAIA 4JLJA 4M1WA 4JBYA 4R7ZA 3MG9A 4Q9IA 3DM9B 5KU1A 1IOZA 2B7BA 2O0JA 4LHXA 3TSZA 2QGZA 1E9AA 4GDFA 4PR0A 3ASYA 1FQJA 1HEIA 1X1SA 4D6PA 2BBWA 4DDUA 1IN6A 4Q9LA 3RWMB 5H70A 3IBGA 2OZEA 3SFZA 1E69A 3W3ZB 2B21A 2W58A 4S2EA 1VCIA 1DAEA 1OXXK 3TGPA 4IOJA 3W5JA 1R0YA 1XF9A 2LKDA 4JLAA 4ITRC 1GKIA 4PHTA 4TQAA 5FUWA 5GVRA 3QUSA 3N5CA 1UFQA 4G5QA 4IKEA 4MGIR 3ZZTA 4C0AC 2F1IA 4RD3A 1A2BA 4TYNA 1L4YA 3IIMA 2I1QA 1N6RA 2AKYA 1KDPA 2PT5A 4JLBA 2PJZA 2FWRA 2ZQ5A 4Q02A 3TMKA 3ICEA 4CEJA 1A4RA 3EW9A 3OIUA 2ODEA 1T91A 3AM1A 4QRHA 3SQXA 2NO1A 1XTSA 5DHFA 3ZIAD 2CEAA 2LWIA 4WVFA 1FMJA 4QGAA 3CF6R 1TEVA 2E1RA 2H18A 5AUNB 1E1RA 3NXSA 1TQ6A 4B6EA 1Z2AA 5JLJA 1YRAA 4OK5A 3ZVMA 5EXPA 1E2DA 4M9XA 4XWKA 3ETLA 1YR9A 1W4BA 4GI7A 2F55A 3G82C 4PHFA 4DLYA 1MT0A 3MGCA 1G3UA 2ONKA 2FDCA 3ND8A 4RD4A 2R6GA 2ZYWX 2A7QA 1DELA 1F2UB 5HE8A 3FKSA 5HTKA 1SVWA 3IILA 1ZNWA 4TMTA 1ZCAA 1VHTA 4LRWA 3D8BA 4ZDJA 4KO8A 4PC3A 1UPTA 2FPMA 2GXUA 1PJRA 3TBKA 2XSZD 2O8CB 2OFXA 1SKYE 3TUZC 2WJJA 1M34E 3P27A 3U44B 3PENA 3ZD7A 1MRSA 4BRWA 1KSJA 1JXMA 2JLZA 3MLEA 4M0LA 1D5CA 2F43A 4FI3C 3X1WA 4DT1B 4E22A 1OE0A 4OL0A 4Q1EA 5EUQB 1RC8A 1HQCA 4A0GA 2EFHB 2FPLA 4WBSA 1BYIA 1OW3B 4NL4H 5AUQA 2WV9A 5L3QA 5DLQC 1GRRA 4IFBA 5DI3A 1OJLA 3DL0A 2Z5FA 3TJZA 5FBRB 5LD2C 1UAAA 2PMDA 1AS2A 3EA0A 4UJ5A 2PCLA 4C0SA 5FPYA 2VHTA 4R98A 2NZ8A 1K8RA 4TMVA 1KKLA 4HATA 1J8YF 2H1LA 2IK8A 4KBGA 2ZITA 4M53A 3SR0A 2C8VA 3T1TA 4M9QA 1IY2A 3B9QA 3BORA 1H8ED 2QT1A 1XTJA 2ZSBA 1T9HA 1OPXA 5JBQA 3DZDA 1RW4A 2YWEA 3OE7D 4KV9A 4TMKA 1Z6XA 3C4JA 1X8KA 1P3JA 5CM8B 1E4VA 1G8GA 3ECCA 4MA4A 2JLVA 2FFBA 2B7CA 2J0QA 2G83A 1LS1A 3CRW1 3EA5A 1HH4A 2QZ4A 3QKTA 3AP2A 1DG3A 1OXUA 2NO0A 2QBYA 4L5BA 3U3MA 3K9HA 4YXWD 5KSYA 2NOAA 2AFIE 4EIWA 5BN3A 1TNDA 1FTSA 3Q5EA 2OT3B 3PEVA 4TSFD 1XJQA 2JLQA 2JJ1A 1PV4A 1G8PA 3CR7A 4Q9JA 1X8JA 2ZRDA 2DFKB 1UEIA 1KI1A 3HR7A 4E03A 2WSSA 2Q9BA 5AWFC 5P21A 4F4IA 1HA3A 1WQ1R 3THWA 1NP6A 1SZPA 2VP6A 2JJ2D 4M21A 3T15A 2W0SA 2CL0X 5E4FA 1KOFA 1GIAA 1J7KA 1CR1A 4QJ4A 3LX5A 4GL2A 5BYKA 3WNBA 4IOKA 1ESNA 1U99A 4HAYA 2H92A 2ZUBA 3N2IA 3C41J 4NONA 2P6RA 1TF5A 1L7VC 2OG2A 4GMDA 4Z8XA 3CB4A 3TLXA 1G4AE 2IYUA 2E9SA 2ZE7A 3AVXA 1QHSA 2ZI9A 1XWIA 3K0AA 3U3JA 2PL3A 1KIMA 1YZNA 5AJXA 1TTTA 2Q9AA 3TQFA 3WRYC 3X1ZA 4ZDIA 2VYFA 2R6DA 2X77A 1M8PA 2NPFA 1L2TA 1P9RA 1FOEB 1HUQA 2QMEA 1DARA 4URUR 2V6IA 3ZVLA 1WA5A 3J81k 1NLZA 4G5SA 1SQ5A 2ASEA 1XPUA 1T5IA 2GDJA 2ZJZA 1UM8A 5CYOA 1OFUX 4BZQA 3RS3A 4DSOA 1SXJB 1VG1A 5EE1A 4HZUB 5A0FA 3KFVA 3TNFA 1CLUA 2EWVA 2VF8A 4M22A 4XWAA 3VKWA 3B1XA 3BIFA 2MSDB 4PPGA 1E9RA 4RKFA 3K9NA 3SNHA 4PO9A 1C1YA 1AJEA 2WMNB 3OFND 1Z06A 1II0A 3N2EA 4XSGA 5J47A 1HE8B 1BIFA 4O0MA 1F6BA 2DHRA 3BK7A 4Q4JA 2BHRA 5FBVB 2P3SA 3B1ZA 4EAQA 2CVFA 4AKHA 1O87A 3CUEF 4WW0A 4H1UA 4RZ2A 1D9XA 1CS4C 2BBOA 4BZXA 4DHEA 2HV8A 2PX3A 2W2TA 2EVWX 2XNSA 3CO5A 1Z0FA 4LWZA 4C9BA 4JVLA 1IJFA 3VR6A 3HWSA 4JLOA 2ZM5A 4PC1A 2MMCA 1E3MA 1XJ0A 2PEZA 3WP1B 1P73A 2WWIA 821PA 2QT0A 3SBEA 3GLHE 4AWXA 3FVQA 3MUFA 1AKYA 1T4GA 4B33A 4AYWA 2WWWA 4C0KA 2CE2X 5TVKA 1E96A 5CK5A 2F6RA 2RGDA 3T5DA 2FE4A 3B85A 2QQ0A 3A1WA 3LQQA 4N1AA 5JS7A 3EPKA 1ZNZA 2QP4A 1E6CA 3K0FA 3LFUA 4TTPA 4WA7A 4DSUA 1LS6A 3GJ8A 3OAAA 2PZFA 4XTRA 3RAPR 1U90A 3I92A 1NMXA 1RRFA 1XCGB 5JJIA 1J8MF 4Z1MD 3C7KA 4V0NA 1AN0A 2ZPTX 4RFVA 2YOHA 5JZVA 3GCGA 1C4OA 1RPZA 2V8OA 1E9EA 3EC2A 3WP0A 4TMWA 4DLXA 1KI2A 2GAOA 1Q57A 1DEKA 3BH7A 5CDFA 1ZINA 3M1IA 1G6OA 3QEOA 1T3SA 4KJZA 2A5JA 2WJYA 1E4YA 4NH0A 2WWFA 3AH8A 1WBBA 2P65A 2PLFA 1CP2A 2A5DA 4HYYA 3ADBA 1ANKA 2Q6TA 4CZ2A 2FZLA 4HUTA 2QM7A 4DDVA 4M9ZA 2IWRA 3GLIB 5K8LA 2W0MA 1ZM9A 2KE5A 4A15A 1YZUA 2GEDA 4G0NA 4Q48A 3R9IA 1X86B 1U8ZA 2PZEA 2JLUA 1N0WA 2HCBA 2OAQ1 5IK2D 2G1JA 3UANA 3U7EB 2H5EA 1R5OA 1Z2CA 4P4SB 2QNRA 4G5RA 1G21E 4C0QC 5HR5A 3WMEA 1SGWA 3C5HA 1IXSB 1ODFA 4C0LA 1UBGA 1DAKA 2ZRLA 4DLWA 4EPVA 4ZDKA 3W5IA 4AY2A 4W5WA 1RJ9B 2F3RA 1F3OA 3CZPA 3VTKA 1I2MA 2OLKA 3CWZA 5AJVB 4LC0A 3VFDA 1MABA 4I81A 4Q7MB 1CKEA 2UVQA 1Y63A 4Q4AA 5GJCA 2LKCA 3SS8A 4KVGA 2CXXA 4HUQA 3CKLA 3P4YA 3QXCA 4NCIA 3KQKA 1ZC4A 3X1DA 4AI6A 1RVDA 3MJRA 1E2IA 1G3IA 4Q1AA 1U2RA 2ZI6A 1WCV1 3H2YA 5FOTA 4P4TA 1OFTA 4DZZA 2FA9A 2X2EA 1E0KA 3NVAA 4LBZA 2EQBA 2ZVPX 2J59A 3DMNA 1AZTA 1W36C 1KO1A 2VA8A 1BOFA 3FDIA 1XEWY 2NO7A 5FL7A 4XJXA 3VNVA 2IBMA 2GVZC 5LBIA 2IUUA 2W6JA 4MYHA 2IS4A 2FEMA 2JAQA 4CRWB 1IN5A 2N42A 2GAAA 2ZYUX 3X2SA 4Q1BA 1YQTA 121PA 3LA6A 4JBWA 2JA1A 1E9FA 4CEHB 2DFLA 1A7JA 2ANBA 2RB4A 2ZS9A 4OI0A 5HCIA 2ZE6A 1NBMD 3H4MA 4AKEA 3FFBA 3GJXC 1HURA 3OEHD 4DIEA 5GVSA 3KQNA 3QNUA 1FZQA 2Z6VA 2JLWA 2XTZA 3EASA 3B78A 4QM7A 3PIRA 3RC8A 3GJ5A 4YDHB 2ODBA 3C15C 1XXHE 4HDCA 4UNRA 1G7TA 1CR2A 2V55B 1W7AA 2X2FA 5F98A 5EE5B 2YWFA 3WYGA 1UF9A 4IEEA 3Q8XB 1AS3A 4HLQB 3GD7A 4P4UA 5H8WA 2D7DA 2BMDA 3TE6A 5DYIA 1RRPA 1U0LA 3FHCB 4JKYA 4A0RA 1VMAA 3B13B 4UQOA 1FL9A 3GLFB 1EWQA 5FPKA 2BC9A 3DVLA 1NBME 3EWSA 4GRAA 4G5GA 4PSKA 2YKGA 2QTVB 4TLAA 2GEUA 1Z6TA 2FNAA 4MRRA 3VKHA 1N0UA 3AQ4A 1SKYB 3QVVA 2VP0A 1QVRA 1P2UA 1XD9A 4DCNA 4JT4A 721PA 5B30A 1UBCA 1LB1B 1LFDB 1XU4A 3MCAA 3NHAA 1GKYA 4S35A 1G8HA 2ZREA 1U8AA 4GP7A 4C7OB 4LJ9A 1VKJA 4Q21A 1T8UA 1R0XA 3QXJA 1ZMXA 3FKQA 2AL7A 3CPHA 1XEWX 5FFMA 2EFGA 4BE7B 1SHKA 2K5UA 2PZGA 3I32A 5DNYB 1E2LA 3KKMA 1G17A 1SXJA 2ODWA 2QY9A 2HT6A 1TQDA 1ZD1A 3SEAA 1U94A 2QP3A 3Q72A 4EJSC 1XBTA 4D4KA 1GP2A 5DYGA 2FZ4A 3RVBA 1P75A 2IA5A 2CBZA 4IFEA 2ZETA 2FH5B 4DUGD 1UDWA 3TK1A 4B44A 1HV8A 4JL8A 1IY1A 3NDBB 2ORWA 3U2QA 2C78A 2GJ8A 5K8UA 4O2RA 2NPIA 3BE4A 4TL8A 2R8RA 1CU1A 1IJEA 1E1QA 1KAGA 3RSLA 3TUJC 3QIAA 4XTCS 1FUUA 5EE3A 2WKQA 4NP6A 4X8HA 1XEXB 1X8LA 2WAYA 3KKOA 5KSOA 5CJPA 1JECA 3MAAC 3NG1A 4GZLA 4HZIA 1PLJA 1S4QA 2RGNA 3K70C 1G7CA 3AKYA 4Y0VA 1P4SA 2CHGA 5JHHB 1EFHA 4KFUA 1XMSA 2IS2A 1ZYUA 4TLCA 4M1YA 4PTLA 1NY5A 1RYHA 2BVNA 4JZKA 3VX4A 3IEUA 3GEEA 2EW1A 4O2LA 5KSZA 4PQYA 2ZTSA 3WHLA 1D2NA 2JEOA 4B2LA 4BZPA 4BLQA 3DDCA 4HB4A 5JMTA 4OK6A 1E0JA 1KI6A 2IF2A 2P5SA 3CPEA 3AKCA 1BMFD 1PVOA 1J99A 2R9VA 3AKEA 5IDVA 1KI4A 2ZSDA 3AF1A 3SJAA 2QGNA 2D3WA 4P33A 3BD9A 4DLRA 3EZ9A 1KSFX 4A9AA 4KFSA 4PX9A 2QTHA 1VECA 1FTNA 3TIFA 4URXR 4QBFA 4Q4HB 1LW7A 2QQEA 1XCPA 2F7SA 3KJEA 3MFYA 1J2JA 4II7A 4TLEA 5DN6D 5CYPA 2QRZA 1I4LD 4A82A 3C16C 4DDWA 3FHTA 4Z54A 5KTYA 1WE2A 3A8TA 1OB2A 5FOVA 4U7DA 5FBQB 1R8QA 1P61B 4MGZR 2A78A 4OQFA 2JASA 1FUKA 1N5IA 2XX3A 3IQWA 2IYLD 3KKPA 1AS0A 3DOFA 5C4GB 1VIAA 4DLZA 2GCOB 1GRNA 2BKUA 3IEVA 1IY0A 2BCJQ 1KTVA 2JIZD 4EPYA 4FMCF 4JYCA 2QN6A 4GPTA 4AKIA 4DB2A 2J7PA 2IYZA 3GFPA 3IO5A 4JYBA 4LY6A 1DBSA 3BB3A 4Q03A 1FMLA 4US1R 3UIEA 1DO0A 3B6EA 2X8AA 4AIIA 5KO2A 4LV6A 5JEDA 3SHWA 1DE0A 1ZIPA 2WM9B 3KUDA 1ZNYA 3LW7A 4D4MA 3BB4A 3CF0A 3O8RA 1N25A 3K09A 4LPKA 1RKBA 4MGYR 1KK0A 1XJCA 2IF0A 4IVQA 1EFTA 4NCNA 3K0CA 1JEDA 3P1JA 4D81A 1XEFA 4I4LA 5SZIA 4XD7A 4OJKA 2GF9A 1QHNA 4BUJA 3BH0A 1JR6A 3UPUA 4D4LA 3KFXA 1D8TA 1YZQA 2GCPA 4DVGA 4JSYA 1OB5A 2VBCA 4Q9KA 2RCNA 3QF7A 4TQ9A 1OH8A 1G1MA 2ODNA 4U5XA 4ZIRB 4UXHA 3K0SA 2WJGA 4NCKA 1FW6A 2KSQA 2V7QD 3BXZA 3OESA 3RNLA 5KNDA 3SN6A 3GLGA 1Z0JA 3OIYA 1DO2A 2D7CA 1JQJC 2J7KA 1W0KD 4KFTA 4V0ME 3GLHB 1ZC3A 2F1JA 3RS5A 3K8YA 1XD2A 3JZAA 2GK7A 2IWHA 3WRXC 1E2FA 3NTUA 2VSOA 1JBKA 2WWHA 2J0UB 4JLMA 1KO7A 3B9PA 4Z8YA 4CEHA 4OI1A 3K0CC 1ZBDA 3B1VA 3HDTA 1KK1A 2GEVA 1QHHB 3A1UA 4TYYA 4EKDA 1CJUC 1ZU4A 4EPTA 2IYVA 2AKAB 3IIJA 4JJKA 2QUZA 1W44A 4TL7A 3BFKA 4DDTA 4A92A 1VCMA 4LV5B 3QOFA 1E9DA 4RCZA 3R9WA 2YVUA 2A2ZA 5F2EA 2JJ8A 1VG8A 4URYR 2QROA 3K9LA 1ETUA 5HKKA 2NIPA 2P2LA 1O3YA 2ZI5A 5J4VA 2WJIA 3ZQJA 3A37A 3BGWA 4RFSB 2UZ3A 1US8A 4D2IA 4EFNA 1RE0A 4POAA 3GPLA 1D6JA 2Q21A 4N0DA 4PSVA 5FOUA 2QG6A 3N70A 2IS1A 3CW2A 1ZUNB 2IEZA 3AB3A 4QBHA 4FMDF 3GLFA 1HTWA 3WYAA 4X8LA 1COWA 2YC2C 3GJ7A 3D7MA 1QVAA 1E1RD 4NE2A 3UK6A 4ZPXA 1P72A 5JWRA 5HZHA 2QI9C 4OQNA 2OFWA 2ZJAA 4QJ3A 3E5HA 4IDNA 2NTYC 3C14C 5AUOB 3HYTA 1MV5A 1NNEA 4FMCB 2F9MA 3MMPA 2A5GA 2HLDA 2DYKA 4ESHA 3FKSD 4A1FA 1IN4A 2AN9A 3NDPA 2RGBA 4MKGA 4BFUA 1JJ7A 4MYUA 1JPNA 3HYRA 2ZR9A 2QP9X 4W5HA 5E7JA 3NEYA 5EP4A 1X6VA 1P2VA 4OYHA 4GZMA 1L4UA 1NRJB 1Z8FA 4EQ6B 4JVNA 2FGJA 2O0KA 2ZAMA 1NF3A 3U3OA 2Z83A 1R5NA 2O8BA 3DKVA 2HCJB 5FTJA 3PUWA 1C9KA 1S96A 2WWGA 3SBDA 4XWOA 2C95A 4MGKR 4OK3A 5F3WB 3U4QB 1GVNB 2Q9CA 1AGRA 4AYXA 5JRJA 2VSFA 4DIDA 4EPXA 1LTQA 1N6OA 1WMSA 2FSGA 3LBNA 3SYLA 1XPOA 4BRUA 3THXA 2C96A 2TMKA 4RCYA 3LBHA 2ZI3A 2OHFA 4LHYA 3SHFA 2RAPA 1NL3A 3TAUA 2ORIA 5D3MA 3FMOB 4BEBA 1NN0A 3PUYA 3TRFA 4GT1A 1ZVQA 5B64A 2WWYA 3E1SA 2FU5C 4Q18A 3V4FA 1OYYA 2QM8A 1W2HA 2ZR0A 3PV0A 1E0AA 3AP3A 1W0JA 1ZUHA 2W6IA 1TADA 3IO3A 3AVVA 3CX7A 2WICA 4P32A 2H57A 4ESVA 2GZDA 4YMWA 1UKZA 2OSBA 4I1UA 3MWYW 3W6PA 4MITA 1RRGA 1JPJA 1MO6A 2QPOA 4NTZA 1A1VA 5FPSA 3F8TA 1FFHA 1FP7A 3A4MA 1W2GA 4FXPA 1ELOA 4ZI2A 2GXSA 1L8QA 1Q1QA 2J3EA 4HAXA 1E32A 4B3BA 1EFRA 4KVAA 1GFIA 2KI5A 3KXLA 4AURA 4QGFA 5KOYA 2ZYVX 1T5LA 1KYIA 2G77B 2ZRGA 2ZRJA 3KB1A 3QG1A 5JI3E 2WWXA 1DAMA 3LWNA 4URZR 4DJTA 2BCGY 2WSSD 2QAJA 3LY5A 1NVUQ 1S9HA 4FMDB 621PA 2G0TA 1GUAA 4LK2A 1II8B 5EXXA 5GJBA 5BN4A 3CZQA 2IL1A 4KFRA 2XGJA 1IN8A 1MRNA 1OT3A 2PBRA 2R44A 4M1KA 4TLBA 3BAFA 4AKGA 5E3HA 4NHOA 4M1MA 2O8FB 1HT2E 1T3LA 2OCPA 1JR3A 2BDTA 5KHOC 1E2EA 1NN3A 3W6NA 4AD8A 5JSZB 3EPJA 4IDHA 4UNSA 1Z0KA 1ZIOA 2HJGA 1W48A 2CLCX 4RVCA 4LPSA 4GSYA 421PA 2FFAA 2CHQA 2UKDA 4E07A 1AGPA 1MOZA 2CJWB 3GJ0A 3IBYA 1VPLA 1VYTA 4GOKA 4ASUA 1E98A 3FMFA 4MUAA 2H8KA 3D3QA 4TT3A 4DKXA 2ZI7A 5EP2A 3UG7A 4GOJA 4IVRA 2V1UA 3ZD6A 2EYQA 2IYRA 2Q3FA 2WJHA 3HPQA 2GJAA 1KDRA 1SHZA 2XOKA 3KB2A 4LHZA 1Z63A 1WB9A 1N6NA 4Q66C 1XTKA 4DCTA 2O8DA 2CCKA 1OH6A 3KX2A 1ZD8A 4QXAA 2QAGB 1R0ZA 1YZTA 1E2PA 4A6XA 3SU8A 4LSGA 4CT4B 4L4UA 3WYFA 3VU9B 1F2TB 2ONJA 1GKUB 5DE3A 1NMYA 1Z6YA 5FI0B 1M2OB 3EZ6A 3JVUA 1YR6A 1P6XA 1QBKC 4B48A 2CNWA 1U81A 2ZYTX 4TWZA 3FTQA 2WKPA 3PQCA 2O8EA 4JVSB 3VHXA 4TMZA 1FX0B 4FCVA 4BWYA 2WSMA 2MMGA 4HAVA 4D25A 4LJ8A 3IUYA 4HAUA 5J4YA 3B60A 4YMSA 2XXAB 2ZJOA 1I4TD 2JDID 4B2PA 1R6BX 3R7WA 3T1OA 3I3SR 3W9YA 1QDEA 3U5ZB 1TU4A 4LHWA 4PXAA 3Q7QA 5CLLA 1P9WA 1QF9A 4HI0E 1HT1E 4OHWA 2W83A 3ZZ0A 3VAAA 1KMQA 2NO9A 4LBYA 2YJTD 1NKSA 2D74A 2ZANA 3I1FA 2GJ9A 2RGEA 4LBVA 3EXAA 5K8IA 2REXB 5FTNA 3Q5DA 2GXAA 3PEUA 3RSOA 5BYJA 1SKQA 1LVGA 4N3NA 4D82A 2AK3A 2PT7A 5BQ5A 5A4JA 1YVDA 2O0HA 5G40A 4OQMA 4B3DA 1KJZA 3B8HA 4HEJA 4BEJA 1G4UR 5CITA 4D0NA 4NU0A 3TAHA 1GM5A 4PSAA 1G9XA 1LF0A 1OKKA 2QA5A 2CMKA 3WMGA 3QI2A 3VQTA 2B6HA 4KLNA 5DO9A 3ZS8A 4A8JB 3TKLA 4B6FA 1NVVR 1GL7A 4A2QA 3RS7A 2YINC 3RDPA 1P60A 3DPUA 5JHGB 1E9SA 1KJYA 2ZRBA 3AF3A 3I5XA 4A2PA 1Z28A 1E79A 2JCSA 3BBPA 3BFVA 1YJ5A 5J4LA 2KWIA 3H84A 1QHIA 3RANA 3QF4B 1G64A 3T12A 1W4CA 4MDFA 3FGNA 4IXNA 3OAAD 4IEIA 4ACBA 2IW3A 5J5CA 2FEOA 3QPWA 1CR4A 4ACAA 3K0EA 1G291 2REOA 2HXSA 2XNDA 4HSEA 3OEEA 2QE7D 4KBFA 3QENA 5IHPA 5LPNA 1ZNXA 1SULA 4E5UA 1S2MA 1SVIA 2ECKA 4Q1CA 3EPHA 1F2UA 4EFLA 3AVOA 1T6NA 4HDQB 5EJEA 4CEIB 4C0BA 3IPXA 3PUZA 1ZRHA 4I1OA 1V43A 2GKSA 4ZI3A 2PX0A 2PJRA 4R9UC 3FMPB 4M1TA 2A9KA 4DLSA 1GILA 1TEXA 3ZVNA 2LCFA 2O8CA 2VH5R 4Q01A 3U44A 4KSBA 2G1KA 3KJIA 4TYPA 1UJ2A 4YDSA 1W36D 3M0EA 4FIDA 4JLDA 3HPRA 3ZJYA 521PA 4DT1A 4BFSA 2HJVA 4ZCMA 2HT1A 4EQ6A 1UEJA 1PLLA 3GP8A 1W5TA 2FGKA 3FMIA 2XB4A 2QU8A 5BW8A 2QORA 1LV7A 4B76A 2QEQA 5CDFE 3KTAB 2ZR7A 3QKSB 4BLRA 2JATA 2OEPA 2ERXA 4W9MC 3QSYA 3BB1A 1A82A 3KZ1E 3QBTA 4XVUA 2EFEB 4ARZB 4FW9A 1GITA 1N6PA 4V03A 4DCSA 1ZCBA 3OIVA 4IHQA 3LVQE 3ZYCA 2OCAA 3IPYA 3TVDA 1XX6A 1P2SA 4LYFA 4ZCIA 1ZM4A 3BFXA 3I62A 3Q7PA 1OFIA 4NKRA 4DWJA 2JLRA 1NY6A 4UXJA 4BLTA 4B3FX 1DAGA 2DWPA 1E2JA 1KSHA 5G3ZA 3QBVA 2YOGA 5LB2A 4CT5A 4O25A 1BO6A 2GCNA 4F92B 2FOLA 2HYIC 5FL7D 4QGHA 5FOSA 2GHIA 5SZJA 1ZU5A 4DLTA 2W6JD 3RS4A 5AUPB 1OH7A 1M74A 4KSCA 2X19A 3HU1A 5JWOA 3LW8A 5FR2A 2REBA 3AF0A 1M1YE 3U6KA 2AD1A 4HB2A 3W8RA 2AXPA 3NHBA 3SDZA 5HZKA 1KMHB 4BASA 4RZXA 3THYB 3KQLA 4UKDA 4MYCA 3AKDA 4KI0A 3KKQA 2PCJA 2CLSA 2ZJ8A 4Q1FA 1G16A 1SVOA 1OXSC 3A1TA 3B5JA 2GZHA 4MRVA 5JWHA 5C46F 3CX8A 1U0JA 2J87A 1GRQA 3AGPA 1HY3A 3L82B 2PMKA 4P31A 2OLJA 3AVWA 5JFGA 1G3RA 1YE8A 5J4HA 5KYKA 3PXGA 4J0QA 5KPDA 2KJQA 2ZS7A 2NQ2C 1TUEA 3SC3A 1EFUA 2YNMA 4EPWA 5TXGA 4BQSA 5KDOA 2BV3A 2H17A 3K9GA 1Q1EA 4LJ5A 4GP6A 4NYMR 2F1HA 4BLPA 4F7WA 1CJVC 2A5FA 4I1SA 5AR1A 2P6NA 4L15A 5BXQC 3ADDA 2ZRPA 4PPQA 2WJVA 1Q1ZA 2ZXUA 1VCOA 2GZAA 4D0GA 2CK3A 3EZFA 5HE9A 2V3CC 1XNJA 2QPTA 2OUKA 1K5DA 4CEJB 1G5TA 2C9YA 2VHUA 3DZ8A 3HP1A 3CRQA 3L8ZA 2XEXA 2R6CA 3W90A 2WHXA 2J46A 1GNRA 2G3YA 2IYTA 3REGA 2C77A 2VF7A 2YHSA 5AJWA 1B0UA 1XTIA 2GETA 3GQBA 1Q21A 5EP1A 4DXAA 2BEJA 4G3XA 2SHKA 4V0KA 3AUYA 2VEDA 1AA9A 4OI4A 1G8YA 4DBLC 2C99A 2ZIAA 2Q3MA 4G01B 4ZKEA 2J41A 3LLMA 2H16A 4JLKA 1Q0UA 1YU9A 5LD2B 1R5BA 3ZH9B 3K70D 3IHWA 2V4ZA 4PQFA 1T0JB 4HZUA 3NC1C 1OSNA 1R0WA 4IW3B 2W2VA 5FOXA 2J0VA 5CB8A 5FUXA 2RH5A 5EP3A 4B43A 1NLFA 3LNCA 3KL4A 1Z0IA 1R8SA 4Q00A 5KNBA 2A30A 2FFHA 4PPNA 5AJYA 4C3ZA 2GESA 3L0OA 2OCBA 4Q19A 1G5PA 2ZRNA 5CIQA 5FBWB 1ONBA 1JI0A 1S1MA 5DGXA 2F43B 1R10A 2ZROA 3VR4A 3E70C 1NI3A 4PC7A 2IHYA 4FCWA 3C8UA 1ZM2A 2E87A 5F9HA 2EYUA 5G3YA 4E09A 2FJUA 4IOLA 3QXSA 2NGRA 3VMFA 4OQXA 5A5GA 1E1QD 4B3GA 4Q4LA 5JI2E 1JEEA 5L3QB 2ANCA 5AJZA 5DI3B 2XZOA 4DB4A 5FTKA 3EPLA 2ZEJA 1XP8A 1H65A 1SXJE 1Z5ZA 2A3RA 2QMUA 4KAXA 4Q47A 3MWKA 4R2HA 1P5ZB 1SXJC 4B34A 4YC7A 4H1VA 3WY9A 3QVUA 3WHKA 1KK2A 4FWIB 4PC2A 2QSZA 3H1TA 3LX8A 2XTMA 4JL6A 3WNDA 2ZSAA 1GDDA 1N0VC 3SYKA 3RRZA 1YZLA 1ZAKA 4DSTA 2DFNA 1G8FA 4D0LB 3MJHA 2CCJA 1HYQA 1CBUA 1WXQA 3AP1A 1M7HA 1W5SA 2B92A 4C0HA 3FHOA 3KDSE 4L9WA 3TVTA 1TF2A 1NVWQ 2QBYB 1CF4A 2J1LA 3R8CA 1U9IA 3IDQA 1IHUA 1NN1A 4IDQA 3TR5A 1MO3A 4OQLA 1VYUA 1E2QA 5B2ZA 3VNUA 3RS2A 2RGNC 4DSNA 2Z4RA 5H68A 4L8GA 4YMVA 2J0SA 1U0HC 1R4AA 3B1WA 3FFAA 3QY0A 1EFCA 1FNMA 2Z4SA 2WPDD 5L3RA 5TV2A 1OV4A 4UJ3A 4TMXA 2QPAA 1DS6A 1OIWA 3GLIA 5L8VA 3THWB 1XMJA 2IEYA 5TY0A 5CM9C 1Q44A 5DN6A 4LOAA 2GRJA 2CCGA 2ZRFA 2C04A 4PHHA 4JLNA 4P4SA 3UWKA 1NSTA 5DSZA 1Q12A 3SJBA 1MKYA 1Z07A 2HYDA 4RSGA 1KAOA 4D80A 3B1YA 3UMRA 4DEYA 2MSCB 2J7PD 4KU4A 1OHHD 5FUVA 1KJWA 2IUTA 3TW4A 2ZSFA 3LAWA 5CB6A 1Z47A 1FQKA 2JIZA 3FYHA 3W8NA 2Z43A 1RJ9A 5C18A 5L3SB 3HU2A 1KI8A 2B8WA 4HLUA 4I99A 221PA 4OBEA 3WNCA 1U9IC 1AM4D 4KYUA 5B57C 4AYTA 2PLRA 1XMVA 1N6HA 2BJWA 5EQTA 1JAHA 1P2TA 2NZJA 4PQRA 1CJTC 2EFCB 2N1BA 4NMMA 1GNQA 4XD7D 4ZKDA 1DVRA 2CL6X 4ARZA 2RGGA 1XRJA 2WOJA 3TR0A 4MRSA 1Q20A 1VIYA 3CNLA 4RZ3A 1WP9A 1KY2A 1Q3TA 4HAZA 3GEIA 3ICQB 4PZYA 1I2DA 1E0SA 5IF9A 2FMXA 4RKEA 1H8HA 2FSHA 2VHQA 5BWMA 1M7BA 2B8TA 2J9RA 1Z6AA 4JS0A 4URWR 4WZBE 2QENA 2YYZA 5CJ2A 2IX3A 3R20A 4JKIA 2WVJA 3NBZC 5EE0A 4GNKA 3D6TB 4IRUB 1KGDA 3I8SA 1HE1C 2QMOA 3QJYA 1EESA 1RZ3A 2V7QA 3K09C 3ZVRA 2IYYA 3PEYA 2IXEA 4DRZA 1AQUA 1BYUA 2H7VA 2P0EA 3BRWD 4HLCA 4HLUC 3F5FA 3QG5A 4DC9A 1NVXQ 1AIPA 4Q4JB 2WZQA 3I61A 4HB3A 1GZSA 3LBIA 4BFYA 1KO5A 1KDOA 4BLSA 1KMHA 5L3VA 4ZDWA 1SVLA 4M9SA 3THYA 1Q1BA 2IHBA 3DO6A 4LCBA 5FTLA 1TX4B 4TTRA 1N5KA 2OV2A 3ZDQA 4TL6A 3KQHA 4BFWA 1G7SA 2FF7A 5DIFA 1XZQA 1E2GA 3A6PC 1G5RA 3REFA 4QHYA 3O8CA 3GLGE 4UNQA 1W1WA 2RKOA 4B71A 5HKKD 3CLVA 4IJMA 3UATA 5GJWC 1CXZA 4HLDA 4MKHA 1DAHA 4D4JA 5DHAA 1R7RA 2BM0A 3CM0A 2BMJA 1YZGA 2V9PA 4H9GA 4WZAE 2FSIA 5EUMA 1WRBA 4OHYA 3ADCA 3F0TA 3TQCA 2QMHA 1SVMA 3K0FB 3MD0A 5CLQA 3WBJA 1QZXA 2DWQA 5FTMA 3LV8A 3ZIAA 4Q7LA 4CVNA 4PAMA 1COWD 1P62B 2X1VA 1LY1A 3CPJB 4TZ6A 3U3KA 2D2EA 1QHXA 4B74A 4AC9A 3SJCA 2ZJYA 4I1VA 4C7OA 2PEYA 3T1QA 3A58B 2ZE5A 2GTPA 4V0LA 2AX4A 1GAJA 3LH5A 1KNQA 3UG6A 4Z51A 3SQWA 2HLDD 1SVKA 3QEJA 3AUXA 1OYWA 3NKVA 2VLIA 2FN4A 1AK2A 2CE7A 1TU3A 2HF9A 3LDAA 2GBLA 2BJVA 3GJ3A 2DY1A 4IDPA 2R2AA 3HU3A 4LGMA 5FUYA 2XSZA 1E9CA 4MKFA 1HQYE 3GLFE 4A0HA 2O52A 4TYQA 1KK3A 2OILA 5F9FA 1E9BA 2NO6A 4NPHA 3TW8B 3AVUA 1W36B 3MRSA 5BN5A 4LV8B 2VRWA 3CRMA 2IXGA 4EPRA 1UBFA 4M1SA 3SOPA 4KHZA 5TMPA 3Q3JB 2D2FA 2HDNB 2RGAA 4EUNA 2ZJ2A 2VSXA 2HXYA 3O8DA 5FL3A 3VR1A 4TYWA 3I72A 3CH4B 3EIHA 5GADl 3FWYA 3CNOA 3U3RA 2DFTA 1XEXA 1A5TA 2YWHA 2ZUDA 3IKJA 5E7MA 1MABB 1G6HA 4AG6A 2AWOA 2BBTA 1DADA 2F1RA 4QHSA 4Q4AB 2DB3A 4LJYA 2KB0A 4UNNA 4HUQB 2I4IA 5EZ5A 1JQLB 1MO5A 1UKYA 2A5YB 3MSXA 2IC5A 3PCRB 2ZVQX 3VR3A 1XXHB 1H8EA 5FR1A 3VHLB 2GBLC 1OXVA 1XB2A 3QKRB 2BIFA 3OE7A 4LYHA 4ZO4A 2BMFA 4B3XA 2D06A 1S8FA 4RD0A 1G20E 1W0JD 2W6ID 3ND9A 1JALA 4DEXA 4Q7KA 4GFDA 2PH1A 5SZHB 4PZLA 2ZUCA 4P3YA 4B2IA 2GJSA 2R62A 4PAOA 1OIVA 3OZXA 4YXWA 2G88A 1T8TA 1YR7A 5J40A 2JJ1D 2RGCA 4XIGS 1ZM7A 3UKDA 1E94E 2D62A 1EFRD 1MO4A 4TSFA 2YOFA 4FWTA 4F38A 3B2EA 4Q4HA 1S1CA 2Z0MA 5IT5A 3UWOA 3U7HB 2GK6A 1CJMA 5EXTA 1U98A 4IOMA 4QOSA 2DBYA 1Z0AA 3K1JA 3Q85A 4K8OA 2OAP1 4QBIA 3QXXA 1RYFA 3LQRA 4WXPA 2G0NA 2WOOA 1F48A 1VTKA 1N2CE 2JJ2A 2IUSA 3BC1A 4JT2A 5FPHA 3DEFA 2VTKA 1NKTA 2BBSA 4CF7A 3CH5A 4RD1A 1Y3AA 4KCGA 5JJKA 3NEJA 4WAUA 1Q22A 4MDEA 2GCOA 4K46A 3SZRA 1A2KC 2VHCA 2BMEA 3PVSA 1JR3D 1TF7A 1YR8A 3AVPA 3EX7C 3G0HA 4EJSB 4U02A 4RJLA 1QG4A 3ASZA 2HF8A 4U00A 4LJ7A 3M6AA 1M6NA 3I4LA 2RHDA 3CRVA 1LF5A 3LD9A 4ASUD 1GL9B 2ERYA 2VP5A 4TT3D 1PZNA 4LJ6A 1QG2A 1KI9A 5L3SA 4M2LA 5J4KA 3NH9A 4UXIA 4MQBA 3EWAA 5K8TA 1WF3A 1NIJA 4QG7A 2C5LA 2XOKD 1XCMA 2ZI4A 4NCHA 1EX7A 4TQUS 3RWOA 4PHGA 2OXCA 1NLYA 2UZIR 3TSOA 4C30A 3HR8A 1KO8A 2DWOA 5UKDA 2YWGA 3UXMA 5EE9A 3SI7A 5SZKB 1GG2A 1NVVQ 4FINA 2YV5A 1XMIA 5IRCD 2GA8A 3EZ2A 1JR3E 3FOZA 1KI3A 3IHLA 4ON9A 3K70B 5DISB 3OF5A 2YZ2A 4ZIRA 4BFTA 5GJVC 3RC3A 1DG1G 1NJGA 2CNWD 1E2KA 2W00A 4C2UA 1NN5A 4B47A 4A2WA 3U61B 3B7GA 2R6FA 5JRZA 2IYXA 4M4SA 3LRPA 1VYVA 2XB2A 1QHGA 2AHOA 4JSTA 3EZ7A 2AK2A 1UKVY 3GJ4A 1IXZA 4IDOA 4MUBA 3GLHA 4L16A 3RRYA 2ATXA 2AR7A 1ZUIA 3OFNA 4M8NE 3UMSA 3WBKA 3PUXA 4LI0A 2FG5A 4NCJA 2RHMA 4MYTA 5KSPA 4BFVA 2FX3A 3VKGA 4OHVA 1CIPA 2JDIA 1M7GA 1ZP6A 2J0UA 1I4DD 1S3SA 3DHWC 4LC1A 2OXRA 4F4JA 3RHFA 2NG1A 3VR2A 1QHHA 3QPUA 2G9NA 1BKDR 1VCNA 3TH5A 4ZV4A 4LYAA 3LLUA 3AF2A 4CDGA 1G41A 3BWDD 4CW7A 1CRQA 2ZRKA 2FFQA 2V54A 5KPJA 1IBRA 4UNPA 1FP6A 4HAWA 5LB4A 2GNOA 3T34A 4US0R 1TL7C 1Z0DA 1MH1A 1K6MA 5JS8A 4XVRA 1OKKD 1UBEA 2BM1A 3LXRA 1XTRA 1P7CA 1N5LA 1II9A 5CIWA 2ZRCA 2F3TA 2V1XA 5D3QA 3AVQA 2DR3A 4RFSA 3SE0A 4CGZA 2C9CA 3CWQA 5HCNA 3KKNA 4RD6A 4MRNA 4YLGA 4EFMA 1XTQA 5M04A 1GOTA 3R8FA 4Q7JB 4QKQA 1KI7A 4YONB 1E79D 3W3AA 2ZJ5A 4PO1A 4RY2A 5AK0A 4NZYA 3DKPA 3SJZA 5FI1B 1XZPA 3D31A 2WIAA 3GFTA 4KYIB 3SYNA 2OE2A 4QNMA 1J70A 1KI6B 2VPPA 4Z1MA 2WKRA 1OF1A 4B73A 3KQUA 1FNNA 3UMFA 2XNDD 4OJQA 5CK4A 5EZ6B 3OEED 4JLPA 3WXMA 2J45A 4CYMA 2GF0A 1YKSA 3P26A 1G7RA 3PJRA 4IXMA 1JJVA 1NG1A 3BH6A 2QE7A 3S1AB 1NG9A 5JECA 3H86A 1CTQA 2BKEA 4BPBA 1TUIA 2MSEB 4FCTA 1Z6GA 2VHJA 2CL7X 4GBMA 1WDTA 2ZU0C 1UADA 2C2HA 3EIQA 3T1VA 1UKEA 2ZS8A 1N6LA 2RGXA 3RRNA 4TZ0A 5TARA 2BWJA 2L0XA 2ZAOA 3L2OB 3DM5A 3QKUA 5IK2A 5DH9A 3L0PA 3NBYC 1IM2A 4NYIQ 1ZW6A 4FN5A 3GMTA 3T06B 3AVYA 1EXMA 2HEIA 4M1OA 2IS6A 2IXFA 3U4QA 5JCZA 1IQPA 1CULC 5JCPA 1JB1A 1DOAA 2XZPA 1KSGA 2YC4C 3MWLA 3PG5A 4QC2A 1U8YA 4LZZA 4X8MA 4DCUA 4BFXA 4EDHA 1OXTA 1BH2A 4JBXA 3P20A 3THOA 2OO7A 2XITA 4XH9B 3NIBA 2R65A 3KXIA 4ILEA 1MR3F 5B58C 2VL7A 3ZLJA 3CR8A 3IIKA 2XJ9A 2CLDX 1IN7A 3M4YA 1TPZA 3I8XA 1E2HA 1AQYA 4JIMA 1T0HB 1KY3A
chains in the Genus database with same CATH superfamily
2VK4A 1CY2A 4L2IB 4RVFA 4H08A 2G07A 1UK6A 4UHJA 4EBBA 1N5RA 3RYTC 1B93A 1P0QA 1IZ9A 4DA9A 2PBLA 2G6BA 2XBUA 5H83A 5JSKA 1XXHA 3PNMA 4BN4A 4XSHA 3MBKA 1TEHA 1I3NA 3QKRA 5FLKA 3KEOA 3KUKA 1B23P 2LCIA 1C1XA 2EHDA 3R6WA 4KWCA 1JAIA 1PUJA 1UZNA 1NQOA 1ZUD1 4NYIR 4UUQA 1APBA 4KR3A 1NJFA 4G1UC 4CI9A 3VSCA 2AVDA 3WIEA 2J31A 1RLOA 3L8YA 3M3HA 1XD2B 1XWWA 4G6ZA 2HBYA 3OC0A 3A36A 5DT9A 3PUVA 1V35A 3SJ7A 1S8OA 4CU2A 1T9CA 2FX5A 2PZJA 4PO8A 5BRJA 4KH0A 3OOHA 1X14A 3A1DA 1KPHA 2WUDA 3EC1A 2R6AA 1TCCA 2GTIA 3GRCA 1UDCA 1QR2A 1JLKA 1ESMA 3IQIX 3MGGA 2IZZA 1O97C 3HWWA 1AGYA 4HWTA 2CVOA 4UBNA 3OFSA 2JGNA 1CE8A 3N2GA 1S01A 4UUMA 2DAPA 5TB5A 5DLDA 4WSOA 4LGVA 3EG9B 3H9QA 1VG9B 1P2DA 2YBEA 5CVVA 1LUAA 4V0OA 5BWCA 3OTHA 2ZB7A 4BP3A 2ZRHA 4OHZA 2Z08A 2OP1A 3O1HB 3H0KA 4PIVA 3RFCA 3ZEIA 9LDBA 5DB4A 4EFDA 2VNHA 4NBSA 4O4IB 1VBFA 4BO7A 2QD4A 1XD8A 1S3GA 4I55B 4RD2A 3L0BA 2B8EA 1KHHA 2V58A 5IN4A 4TZTA 1P39A 3AF4A 3E9EA 3NC4A 4JI2B 3SYMA 4PG7A 2SKDA 4V0RA 2EU8A 2GYVA 3HB4X 5CX1B 1TMKA 4NYJR 4EG5A 2AD5A 4EW6A 1YI8A 2E85A 1AUPA 4WLVA 1SFRA 3NHWA 4Q9HA 5EIEA 1KKMA 1ZZGA 4YBZA 5JNSA 3JSXA 1WBDA 4AY4A 3G7SA 4QOFA 4A4DA 2BFDB 4QPNA 1A76A 2CUKA 1H2ZA 2R68A 3WZMA 4QG3A 3TSWA 4YAGA 5AVXA 1E3QA 4UZFA 5I4CA 4AXBA 3N1UA 4W4TA 1EHYA 3ZTTA 4L4RA 1GTVA 4DXHA 4W99A 3L0SA 4MKXA 2HF2A 3DQPA 5ILGA 2OYRA 4KITB 1E92A 1EGAA 1B0PA 3GUYA 1V5WA 5HF5A 4DV3B 3RUDA 5LU8A 1QYVA 2V7BA 3PQ2A 1LPNA 2B4RO 1UZLA 3NWJA 1OBVA 4AMGA 2YNMC 5K01A 2P68A 1F2TA 2PUEA 4LF8B 5TS3A 1T1EA 1GEEA 4TL9A 4RC9A 1L5HA 4YMLA 1WKVA 1TM5E 1TJNA 2P6UA 1SXJD 2Q0HA 3F6YA 2FP4B 4ZMSA 5CTJA 5CG1A 4KR7A 3GMSA 3T41A 5HVNA 2WY2D 4LNUB 4HC4A 2HRRA 2O1EA 4BBZA 4N82A 4CLDA 4YRNA 2V4UA 1F60A 1K92A 1ZKMA 2OSVA 4FHEA 3E7XA 3ND5A 4CPDA 1UKAA 5U9CA 3FOFC 3KPUA 3LDUA 4C4PA 1JKIA 5DFAA 4UATA 3L93A 1PHPA 1PJQA 2XTNA 3C1UA 4EY4A 3AUKA 5IXJA 3OCYA 1UXIA 4K9NA 4A6PA 4DUGA 3LVFO 2PVSA 1F4VA 4B4WA 2O8BB 3O82A 4F91B 4YRRA 1DAOA 1X1RA 3CRZA 5ALQA 3OZFA 1W46A 3BOSA 4ZALA 1J49A 2Y2VA 1AHNA 1LSUA 1VP3A 2GERA 2LDBA 1E1YA 1WD7A 4PG4A 3I2IA 5E6RA 2UZ4A 3WLMA 2OV3A 5CFZA 2AOXA 1DKQA 2WIBA 4FS8A 1KQFA 1LNZA 1QHYA 1Z37A 2W6MA 3NHPA 2FKNA 1B1CA 2G8LA 3JVIA 1XMXA 3MW8A 3L92A 1PWZA 1Q3HA 3MWJA 3H5TA 1GSIA 4C2TA 1JXOA 3A2LA 3EVEA 3IIEA 3MERA 4M8IA 3VVBA 2TSYB 1CPYA 4ABYA 2FZKA 3QQ5A 1Z33A 4WGFA 1RAHA 3RABA 4F5WA 4QM6A 1P8AA 3C3MA 5CJJA 3D0KA 3PQDA 4KE8A 3DHYA 3H11A 3OE5A 1D4OA 3KVNA 2HUPA 2HPZA 4OJTA 2J5XA 3U7FB 3AZPA 4WOPA 2XUPA 4B32A 2AR0A 3CW8X 4BP9A 2C03A 5BYBA 3SNKA 2VG8A 1NRWA 1L4KA 1AO3A 3VH1A 3NKFA 4FNMA 3DOUA 2VQDA 4HN2A 2J08A 2B4QA 1ZA1A 1TVKA 4QUBA 1JWAB 5LP1A 2QTTA 2VF2A 3QF4A 4H7DA 4YQFA 2FDRA 2VJOA 3IELA 3E81A 1GDTA 4IZIA 1X13A 1PG5A 2F9LA 4CM9D 1ZJ6A 2D1FA 2QL6A 3BXFA 3HCFA 4FHCA 2Y0BA 2WTUA 3JAKB 4BQNA 1WDLA 1GGEA 5ALMA 3ERCA 4PTYA 1MB2A 1TU0A 1J21A 4OKSA 2GPNA 1QHFA 1OX4B 4QO7A 2A0KA 1IG3A 5K3AA 4BB0A 3U6BA 3G0CA 1ZOOA 1K4YA 1YHNA 3B82A 3LCJA 3FN4A 5DWDA 1XZEA 1BCRA 3KT6A 1FJGB 4W5RA 3W6OA 3V8BA 1Q77A 4I4TB 3I28A 3ET5A 3KKEA 4RUKA 4AG3A 5KWEA 1DIHA 1EG7A 4Y0AA 2FQYA 3NB0A 5M34A 2GJKA 4LUCA 4NU5A 4RZUA 3FLEA 4US2R 4FM9A 1X77A 3LVRE 2C8JA 4DY6A 1P1HA 2N3ZA 3DVAB 3KAJA 1X87A 4OJMX 4MQLA 5T7BA 5K2MA 4AP6A 1Y3CE 1P9NA 1IK6A 5EVCA 3CLTD 3B6KA 3C5CA 4RTNA 2NP7A 3H7IA 1QFYA 4A0FA 2WMOB 1G19A 1OBCA 4RV4A 1T1IA 4YRPA 3KQWA 2YWBA 2HRBA 4JXKA 4K6KA 2QX6A 3ZY2A 3E2MA 4TMFA 1EK2A 4C0JA 4XYLA 2X14A 4S04A 1N7GA 4UMEA 3T7CA 1ADFA 1C0LA 1TQ2A 3EARA 1Z3CA 4KZKA 2HMAA 1N92A 5CCDA 2Q3HA 5CM2Z 1E99A 2JLSA 2IZ7A 5B4VA 4H1WA 5C53B 2CEKA 1GA6A 2FSFA 4GSLA 1OWLA 3GFVA 4IWXA 4EKNB 5C2JB 2OZPA 3F47A 3VOBA 5JADA 4R2IA 5F2NA 3DQQA 4R71A 4MR9B 2JH9A 2CHVA 3KTAA 2X0NA 3JD3A 3TW6A 3IMCA 1EUZA 3T9AA 3PFIA 2ZIEA 2XCSB 1XE3A 3H2GA 3GU3A 1FQOA 4JMPA 1L4HA 4RZSA 3O2QB 5BQ3A 1EKXA 1WPGA 3EGIA 2R60A 4U8HA 3CF2A 2V7WA 5AIBA 1Q0ZA 1U7WA 2EGUA 3B38A 2Y6VA 4CI0B 3L4KA 3IQXA 1UIRA 5ARCA 1DKNA 2JGMA 2I8AA 1XAHA 2ZJ1A 3UOAB 1R2QA 4ZZIA 1W4AA 3HA7A 1VC2A 1OBOA 2QSYA 1XZAA 4MQEA 4N5HX 4JYMA 4U2EA 3W8DA 4YRMA 1OLOA 4UVHA 4HAOA 5J2UF 3WVNA 6Q21A 1XAIA 2OHVA 5KNDD 3WKAA 1ZN8A 4DMLA 2OESA 3UT0A 1H8HD 2P9EA 1PL6A 3I73A 3LFTA 3MTJA 4X44A 2G04A 1XFAA 2GPYA 2K7ZA 4GF5A 2ZYIA 2QIOA 3X2EA 4MUNA 1WCYA 4H4DA 4UDNA 4DR2B 2E48A 3JVVA 1SU4A 1UJ5A 3CVJA 4HNSA 3L4EA 1TFRA 1YQDA 2IYNA 4R69A 4RV5A 5HQJA 4EX7A 5C1BA 2NUTB 4LJAA 4DPLA 1Z26A 2DPGA 4JV5B 1IWPB 4DCVA 4FK8A 3R7WB 4AF6A 3AM5A 4IIJA 1USKA 4PBRA 2Z57A 2GWHA 2V7TA 1U6JA 2ZRAA 1DAIA 2P5YA 2WIFA 3H65A 3QNMA 5DLPA 2JFZA 4CF6A 3VZDA 4RMNA 3IA2A 3KZKA 3QVWA 2GM3A 3DM9B 1QP8A 3HL0A 4FT4A 1FS5A 2ZWVA 5FWXA 4ZVTA 3DPIA 1Y6JA 3F6SA 3DEIA 1YK1A 2FW6A 1FQJA 1HEIA 2FMHA 2E1PA 4UD6A 1MAVA 2BMAA 3C3WA 1EVYA 2JJYA 5KOIA 3ZY5A 4IRXA 2CXUA 3SFZA 2VRBA 4NJEA 4TV9B 1F4PA 4BJ6A 3TZBA 1R0YA 5CLFA 2QWXA 4ITRC 1GKIA 3U31A 2ZBPA 2FMKA 1EUCB 4RK7A 5GQSA 3TAXA 4A16A 3AKZA 3ZZTA 4MGIR 4X6UA 4RD3A 5GZ6A 4EI9A 4GPBA 1N6RA 2NP6A 4ENPA 1SQ0A 4JLBA 2P0YA 2XBLA 3IMEA 1W35A 3C7DB 3PICA 5K6RA 4BS9A 3V7FA 2P9BA 4YCCA 3L8DA 3M2PA 2PKEA 2ONCA 2WJ4A 4PLZA 3MQ2A 4EUSA 1I3CA 3P5SA 4IG4A 1T91A 5CAEB 4Y30A 3FWZA 2IUYA 4NXNB 2HBRA 4II3A 4O4HF 3UFXB 3UMJA 3SQXA 1Z4MA 3GRVA 3ZIAD 1W6UA 3N28A 2C1ZA 5CCXA 1P5RA 1TKAA 3NXSA 4LYGA 3QE4A 3IE0A 4B8YA 3ZPXA 5AUNB 5K7SA 3ZVMA 1E2DA 1Z5PA 3P9QA 4LSZA 4P5PA 3GFSA 3U9LA 3RUIA 4DLYA 1MT0A 2PKCA 4BL5A 2YYYA 3ROQA 4L5YA 2FDCA 3L18A 2AQIA 4CKEA 2MHCA 2R6GA 2W4QA 3EISA 1DELA 3HKCA 4I1RA 2O7RA 3FRIA 4QYIA 2WHPB 3QQPA 4RXTA 5THKA 4BWGA 1DDGA 4M98A 4NBLA 4C43A 4EY3A 4TMTA 2C8KA 4GLOA 1D03A 1YDEA 1OAAA 4X63A 5BSWA 1RABA 4EVRA 3D8BA 4DRYA 3KSZO 4L0QA 4NMXB 2FPMA 3ABOB 2VHEA 3DV0A 1MQ8B 2YUTA 2OFXA 1DIAA 4W82A 3MJEA 3RVRA 1AQ6A 1ZJ4A 2YJNA 1KYXA 3PENA 1KSJA 4HX2A 3ROFA 4A7PA 2JLZA 2WYWA 3MLEA 5C8YA 1ODCA 3DA8A 1XGKA 4M0LA 4JI4B 3JU3A 1N32B 2VYNA 4KE6A 1DT3A 1MJ5A 3X1WA 2FW9A 2LUOA 1TO1E 4V1CB 4PVDA 3IULA 4MZDA 3GBPA 1XCOA 3GV0A 3O8OB 2MCFA 4C6TA 1YDWA 4NXMB 3JSAA 1RC8A 3ECSA 4D3ZA 3OQNA 3MTQA 2WG1A 4R54A 1FS4A 5AUQA 4D1YA 3DTVD 2R84A 3QFRA 2AFIA 2GPBA 3B3QA 1E6WA 5L3QA 2FMFA 5IT9A 4OOEA 2W90A 1OJLA 3G5LA 1SY7A 3QM1A 3MJTA 5C5IA 3FCCA 2PMDA 4HDSA 4K6OA 1AS2A 3KLMX 5FYDA 4C0SA 2VHTA 1FRZA 4HWSA 3OT5A 2NZ8A 5E6SB 3DMTA 3UKOA 2JCGA 3GCDA 1YKGA 1NT2A 1V3QE 4HATA 3QUCA 3O0DA 4HNUA 3GELA 5BUCA 5I7OA 3BILA 1SD5A 1F38A 4KQCA 4IHJB 3T1TA 5IABA 2X9VA 3CZRA 3Q3CA 1ADBA 4FHGA 4D3DA 1ZN2A 1I30A 2I2WA 2PGOA 4O63O 4IQ0A 5FI5A 5LWQA 4BMSA 1KR2A 2A86A 4KXWA 2IVZA 4ZT4A 2VF4X 2HFJA 3MT0A 3C4JA 4KO4S 1NYQA 4MA4A 3SJUA 1OA0A 5F2OA 1LJUA 5EHIA 2FFBA 2H11A 2NUPB 3QH4A 1WOYA 2QZ4A 2RHJA 2W37A 4MUMA 1FSGA 2PGIA 5FWAA 4L5BA 4HNVA 5KSYA 1AXGA 2RGRA 4KPGA 2C42A 4RTLA 2OT3B 4WK4B 3WDLA 2OB2A 2WRZA 3PDCA 4OL9A 2WU0A 1U9CA 2LR0A 2BGWA 3QEBZ 4Q9JA 3LHKA 4W5OA 3DMTC 1TCBA 1UEIA 3KTDA 1XKXA 2NSYA 4MK4A 3O1IC 1BVRA 5D3KA 1KS2A 1PU2A 2CWDA 3FUTA 5IKPA 3EW7A 3THWA 1XHEA 3RU2A 2PA3A 2NYRA 1YNOA 2JJ2D 5CA0A 1E3SA 2BRUA 4ZYWA 3HEBA 4AZ0B 4LFBB 5JC1A 3KM0A 2DQYA 1KOFA 1GIAA 2GNAA 1I3MA 4GL2A 5BYKA 3VO2A 2O3UA 2IHVA 3B1FA 4J7AA 5AJTA 3AF6A 1HDXA 1WJGA 3QBEA 4HAYA 1X7WB 4G0UA 1TM4E 4WOBA 4NONA 2P6RA 2M6RA 5CB6A 4HXYA 3HP4A 5AHRA 4I1PA 4GMDA 1JEQA 4ENUA 3EGDB 5E3IA 3MOIA 1G4AE 5BWBA 3U7GA 1JKJB 1F8YA 1UZAA 4OUDB 1QHSA 4UHFA 1E3LA 3MVEA 1DJPA 2FWIA 4F0JA 2HW8A 3F9CA 2ZI9A 5AVWA 5KS2A 3NETA 3WJ1A 4I14A 2QR3A 4EKIA 4ZOQI 3FTPA 4DMKA 2LV8A 2Q3EA 3O8LA 4IIBA 4FIZA 4RM2A 1BXRB 2VHZA 2WILA 4G8CA 3TQFA 3OCCA 4H7IA 2VYFA 3M1LA 5F5LA 2JD2A 1X38A 4JOQA 1WMFA 2WIDA 3ICVA 1M8PA 3S2ZA 1XV5A 1P9RA 5IARA 4JJGA 3OJLA 3VC1A 3BWBA 2OLEA 1L4LA 2CD9A 1W19A 4ND7A 5T6MA 3R7SA 2ZTVA 4ES6A 3EY4A 5FIUA 4PS0A 3FPKA 5EKSA 2A14A 1XFDA 1RD4A 4OQPA 2GDJA 1UM8A 3BXXA 4FFBB 2AX3A 2BRUC 4ID3A 1MIOA 3ESQA 4HZUB 4JJ4A 5ALLA 3KFVA 1CVLA 5G2OA 4UEQA 4BNDA 3EUFA 2CNNA 6CHYA 4M22A 2J3QA 1L7OA 3B3JA 5TR9A 1TRHA 5D00A 4BNIA 4OLJA 2ETXA 1T3ZA 4O1MA 4CIYA 4K6GA 1E9RA 4M1EA 3AQIA 3SNHA 4GZ6A 2WMNB 5AI9A 4AUEA 3OFND 4L5CA 4ZV7A 1II0A 1I7NA 4RS3A 5H9WA 3IB3A 3NX4A 4O0MA 4V0SA 5JVDB 5AXCA 3ZCXA 4Q4JA 2BHRA 3RVKA 1X7ZB 4DARA 1VYHA 2HN9A 3O8QA 4RJ2A 2O5EA 3ZD9A 1DXYA 1XRMA 4M83A 3BHIA 1QGED 2Q8NA 3IBTA 3O74A 1I7LA 1CS4C 3MB8A 1RHKA 3QGMA 1FMTA 2PD6A 2PX3A 1V2GA 3OH8A 4G4SP 4W8HA 1R6XA 4LXTA 4C9BA 1D6MA 1C7EA 1ZCZA 4JVLA 4M0KA 1JPVA 3VR6A 4JLOA 1WZCA 3EEIA 2BE9A 3ZHOA 1OLUB 1TI7A 1EFVA 5DTRA 5AM5A 1CX9B 1HWYA 1E3MA 3WP1B 3GG2A 2C84A 4AWXA 4PEVA 3I9KA 1AKYA 1KJIA 5G4LA 4AYWA 5TVKA 3D4NA 3IUNA 1T6ZA 4FYJA 1HEYA 4NARA 4Y9TA 3T5DA 5CYGA 3FUWA 2QQ0A 1HNZB 3GC6A 4H6XA 1MDFA 4TWRA 4KL8S 4RPGA 3WBFA 3FF1A 4K05A 2QP4A 5JS7A 4WA7A 1POXA 1I3OA 1LS6A 1TAHA 1Z5OA 1L5QA 2NN3C 1N1DA 1JDTA 1NYTA 2HSDA 3AG6A 3GJ8A 3OAAA 3A31A 4R40A 2EZ9A 5JRDS 1GUYA 3LUAA 3WRVA 4U2KA 5KQMA 2I2DA 5JJIA 1LA2A 5T57A 3ABRB 2ZPTX 3PGMA 4PZDA 3VTZA 4RFVA 1U65A 1PVDA 3ASUA 3JQAB 4HFRA 4QVKA 1XHLA 8LDHA 1RPZA 4DLXA 1E9EA 2CW5A 3I9V1 5ERXA 3W77A 4B79A 4D45A 5B5SA 1U5CA 1DEKA 2G0AA 2OENG 5HRCA 3O3CA 1CJCA 1G6OA 3QEOA 5PNTA 2IH4A 2A5JA 4BXOB 3VO1A 4EY6A 3F96A 4IX9A 3PU6A 1E4YA 3WK7A 4ZMBA 3EMDA 5D6OA 1X1DA 4DMCA 1XNQB 1ULZA 2WTMA 1XIVA 3KOWA 3LDGA 5CD1A 1RACA 1TQ8A 3C1TA 1JWBB 4HS4A 1Y98A 4HEQA 1H4VB 2NYVA 4HT3B 5K8LA 5IH3A 5KYXA 1ZM9A 3DR3A 4Y2GA 3REOA 3H5WA 4JJ7A 1KP9A 1RYYA 2V5VA 2AN4A 2BM9A 1WXHA 4Q48A 5LYYA 2NT3A 3R9IA 5BPHA 5KJ1A 2JLUA 3P9ZA 2G1JA 2YXEA 2H5EA 1Z2CA 1ULSA 2J9XB 4HAIA 4LQCA 4P4SB 1THZA 3JWEA 1G63A 4Y6RA 1SGWA 3C5HA 2HA4A 5FHRA 3WMEA 3MWEB 1O95A 2Q5FA 4QJIA 1ODFA 5BSVA 5H7XA 3SVZA 1C8VB 1UBGA 1DAKA 2ZRLA 2YWRA 3I04A 2PRJA 1TZKA 3ZEAA 2FMTA 4EPVA 1ORTA 3DOHA 1NI4B 3W5IA 1P1IA 3G9XA 5K3OA 4KUGA 4DKJA 1GUBA 1RJ9B 3OCWA 1H2BA 1F3OA 2F3RA 4RVDA 1M6YA 2L42A 2O2ZA 5EAIA 1PR4A 2E89A 1I2MA 2O50A 2OLKA 1IMOA 1NQAO 4QBTA 5JYCA 1KH2A 2PVPA 2QTLA 4CKCB 3OOSA 4IF6A 1ZKDA 4UEKA 4DAOA 2CSXA 2ZIGA 4WDQA 1M1YA 4ENQA 2OWEA 1D2RA 1Y63A 4V3CA 1SU7A 1EIZA 1COZA 2CXXA 4GP9A 2GAFA 5GAJA 5C80A 3F67A 4QFCA 5LA6A 3KQKA 1OREA 1HSOA 1ZC4A 2PAAA 4EG7A 1RVDA 3MJRA 4N5DA 1U2RA 3LUBA 2ZI6A 1U7UA 2YHBA 3AB8A 3F8SA 3II6X 1VMEA 2FOXA 4ALLA 1OFTA 3WTCA 1MVOA 2X2EA 3NVMB 4YPFA 1VJ5A 5JZSA 2XYGA 4V0QA 4LBZA 2ZVPX 1AZTA 1W36C 1C7IA 1KO1A 4BMPB 2JFYA 5AVRA 4YV2A 4EF4A 1XEWY 2NO7A 5FL7A 4I2NA 4G97A 2WUEA 3C3XA 5HZKA 2GVZC 2YS6A 4MYHA 2Q49A 2EIXA 2JAQA 2FTKE 3CIFA 4RF3A 4CRWB 1O95C 1QAQA 3KB6A 4YJFB 2P90A 3PC3A 2AV6A 2ZYUX 3SQLA 3X2SA 1RPJA 4U7HA 3RGGA 3ID6C 4U7WA 121PA 3LA6A 5B6PA 4JBWA 3CVUA 4FHFA 3M8KA 3FBTA 3BBLA 4N3AA 3PTAA 3EFEA 2ANBA 3I9MA 2GRUA 2G1AA 3UJCA 1P29A 3ZV7A 3U9SA 3CB2A 5I7FA 1NA5A 2ORYA 2X22A 3H4MA 3KD2A 4MVWA 4DNFA 1MU0A 3HXQA 3C3YA 4F3YA 2WD7B 3LP6A 4YB8A 5ALRA 1KL7A 1MX1A 1VRCA 3OEHD 3QNUA 2AOUB 2BEVA 2XTZA 1T9KA 4QDXA 3PIRA 1SVUA 1T0BA 3DE6X 3GJ5A 4JX8A 2BONA 1ISPA 2ODBA 4K3VA 3JALA 4J94A 3RCBA 3OMXA 4CLXA 2LE0A 4MVJE 4UNRA 4R8RA 4UVGA 5I51A 1CEYA 4FGLA 4MRMB 4C2AA 4IEEA 5KI6A 1U2SA 3MTBA 4YAEA 3A7DA 3C45A 1XALA 3GD7A 3WB2A 4YRGA 5CCEA 5H8WA 4GKBA 4YACA 2RARA 2OAGA 1VSUA 3P9PA 2R96A 4IXDA 5DYIA 2WAOA 1U0LA 4YJ2B 4R1LA 4A0RA 1VMAA 3UEOA 4MGHA 1RXIA 4I9HA 5FPKA 3N7UA 4OVKA 1B8UA 2BC9A 3DVLA 1NBME 3ZWNA 4DQDA 1QRUA 3VPHA 4BU1A 4WY5A 2QLLA 4GI3A 1WZIA 2VLBA 4NE9A 1IOWA 5SICE 4L8YA 3LQ2A 1ZS9A 3ELUA 4M9RA 3S2YA 5IXYA 1XD9A 1RP7A 3CO0S 5KOJB 3H0EA 3D59A 1W581 5DGTA 5T4EA 2ECFA 4IKPA 5IAOA 1LFDB 1XU4A 3LQFA 4S35A 1K86A 4GP7A 5EWLB 4U2FA 1EBBA 3W8EA 3AUSA 4NFLA 5BWLA 1ZMXA 1VJCA 3OP1A 2A1UA 3B52X 2PE5A 4G5HA 5IJZA 1A0OA 1PD1A 1XEWX 5FFMA 1T1SA 1U5AA 4JEUA 4BE7B 1E1CA 3TIVA 3TQQA 2HQBA 1DKRA 3D3JA 1CP3A 1CQIA 4X71A 5JY6A 5DDIP 2R6R1 3I32A 5L45A 1E2LA 1XVLA 5JH7B 5FT9A 1W88B 1X2EA 4WCFB 2BZ0A 1YULA 3T99A 1WR8A 1CUXA 1U94A 2QP3A 4EJSC 1O94D 3PRYA 5A71A 3HMKA 5DYGA 4EO9A 3UYLA 4QOIA 1P75A 2YRXA 2CBZA 1NBOA 2PSJA 1W8IA 3KQQA 2Z6AA 3HRIA 4N7JA 1MEJA 1WUTA 2XMBA 1VMIA 5E1OA 1HV8A 5TJ9A 4B44A 1FFDA 5IAKA 3U2QA 4X1KB 2YZGA 2PSDA 3T3DA 5G1OA 3I3OA 2C78A 3ZHUA 2RKWA 3MB5A 3FSRA 2NPIA 4YP0A 2HDOA 4TL8A 1PNOA 4J1QA 3AMVA 1E1QA 1KAGA 4BEVA 3GHHA 1D5WA 4Y6LA 4KDEA 1FUUA 1HDOA 3STHA 1FDRA 1JZQA 5EE3A 2WKQA 5G0UA 3QX8A 4F5YA 4KK3A 2OFPA 2IEAA 4MOWA 2WAYA 1M2HA 2Y71A 2TRSB 5BYAA 3D1JA 1JZSA 4D0RA 1BWSA 1J7JA 1S4QA 3EXEB 3PFFA 1G7CA 4I3FA 4JJIA 4G4SO 3T9DA 1O2DA 4BE4A 1QFJA 1RQXA 2MYPA 3NT4A 2WINI 1OTXA 4NZZA 3UNXA 3CLSC 1CEXA 1T2AA 4D9GA 1ZYUA 4JB0A 3VM6A 1N8NA 1DCKA 2IPNA 4ARIA 1KFCB 4ZN6A 4YX9A 2W8BA 3EQ9A 1Z17A 3MYRA 3F6EX 2BVNA 3GVCA 2YZMA 4FDVA 5AJUA 3KVVA 4DV1B 1V3UA 3FB1A 4O2LA 2GA9A 2ZTSA 1J9ZA 1ZO8A 1K97A 1D2NA 1M5UA 2GKGA 4LC9A 4BZPA 2EP8A 1WCIA 1TT5A 3DDCA 2Z9BA 4HWOA 5CGZA 4IWYA 3AKCA 4P22A 4PZ9A 1BMFD 1LZKA 3G3EA 3U13A 2D3WA 1E1NA 4BQPA 1QONA 4CMAA 3AJAA 4INOA 5CB4A 4FGJA 3KSMA 3C6MA 4DLRA 1B8VA 5IDQA 1UMDA 2X5JO 1ILEA 4PX9A 4BVEA 2C2YA 4URXR 3TIFA 1Z4JA 4QDZA 2ZBEA 3LIIA 4AICA 1XCPA 2XQJA 3ETEA 1D3AA 1I1OA 1G8JA 3BX1A 1BFKA 5F12A 1J2JA 5DN6D 4B4KA 5CYPA 4AS3A 4ARBA 4L4SA 4PNEA 4N18A 5C1DA 4A82A 3C16C 3ER9A 3PDJA 2WD8A 2CVZA 4P98A 1X7XA 4WJZA 5IM5A 4N8DA 3KC2A 4RLFA 5ALIA 1R8QA 1BS9A 1P61B 4MGZR 3MPOA 1N5IA 1QYRA 2HV9A 1V71A 2XX3A 3AYXB 1AS0A 1E5DA 1I4EB 1THTA 3KOMA 2D1YA 2GCOB 1QJCA 3BRCA 1IY0A 4EEKA 4AKSA 2JIZD 4NQZA 4AKIA 2K4MA 3FTCA 1YRLA 3IVRA 1HE3A 3MGAA 5B7PA 4OU5A 3IO5A 4Q03A 1OWNA 1FMLA 4R1MA 2GAIA 1DO0A 2JFNA 1F0NA 2VNIA 2X8AA 1QORA 1QTRA 3FR8A 5JIBA 1T10A 1ZIPA 2HD4A 1MLDA 2WM9B 1QV6A 2ZDQA 3ADPA 3KUDA 5CURA 5THXA 3WRXA 1N25A 3LWDA 4OA5A 2IF0A 3STYA 2WM3A 1EFTA 4YUAA 2W48A 2Q99A 3EVGA 4IZ6A 2YZ7A 4NS1A 1GU7A 2BISA 1YE3A 4MCJA 1NNUA 1ADCA 2AUMA 1IDN1 2ECOA 2IXBA 2JEZA 3MJVA 4PIPA 1HF3A 5COBA 1R3UA 2IQ5A 5EXDA 4BGEA 4BX9A 1Q0HA 5AVSA 3BH0A 5LLDA 3DE2X 1NOKA 2HOQA 3TJMA 2GCPA 4BQEA 2COKA 5TQ2B 2NX2A 2VBCA 3UAXA 1QCDA 3QLJA 1LLDA 2HBZA 3B9RA 1A5AB 3AFIA 3WLEA 2WTBA 3LUCA 1AK1A 3DTYA 1GZ3A 5IC6A 2UVPB 4ZIRB 4GQBA 3VHXB 4BKUA 4BYGA 4G2TA 4NCKA 1S7CA 1VJDA 4B6QA 2V7QD 4JQZA 2AI2A 5D7BA 5JQWA 1FW6A 2ZK7A 5LFAA 1EVEA 3A4YA 4KMSA 3PXXA 2WQZA 5THQA 1DO2A 1ZGBA 2D7CA 4KFTA 1W0KD 4DILA 5BNZA 3Q7RA 1ZC3A 2F1JA 3K8YA 1E5VA 1A27A 1XD2A 2Q8QA 2HA7A 4IJQA 3BRWA 2GK7A 3VKUA 3WRXC 4YCAA 3LG2A 4H27A 5IBPA 3UJPA 3HJFA 1LV8A 3NW9A 4MUFA 2PUTA 1HETA 2J0UB 4DLPA 1YTUA 2Q41A 3ZGVA 3OBIA 1QHHB 2WSYB 3UJAA 1VHJA 4TYYA 3O4JA 2BT4A 3LKDA 1ZU4A 4XGIA 3BTVA 2GS9A 2Q3LA 4HDAA 4DDTA 1HT0A 1GNLA 3EG9A 3QOFA 1N5OX 3AL0C 3E6AA 4RCZA 2H2IA 2X4GA 3WR5A 3S1LA 1DBPA 3OIFA 3OPYB 4TWJA 4ZQIA 4DC1A 2V4MA 5AW8A 3HJCA 2OGSA 1CIVA 2QROA 3IJEB 4O4IA 3NWPA 1Y9AA 5KQPA 2HPAA 2JJMA 1JLSA 4KRYA 3L7DA 4RK5A 5ALHA 4WASA 2NIPA 4I55A 3C39A 1ZHFA 1KQOA 2WJWA 1O3YA 4L72A 1HYEA 1RM4A 4XX0B 1Y3DE 2WJIA 3KALA 4FEEA 4I8IA 3ZJ4A 5IKXA 1YMVA 3A37A 3BGWA 3CMCO 5EJ7A 4D2IA 2WFAA 5F7XA 1RE0A 5I9TA 4POAA 1L7AA 2F3SA 3MCTA 5CX1A 4NEQA 4PSVA 4AU1A 5FOUA 1IHOA 3DCIA 3Q10A 2YCBA 1ZUNB 2Z8YA 5GZ3A 1L5WA 4BCBA 2BFDA 3GLFA 4GPD1 4IIVA 1PWYE 2SNIE 3WYAA 4N7RA 4CKZA 3QUTA 5B53A 3VPFA 2XCRB 2VWHA 3ISVA 2QK4A 3OBBA 3ZVKA 5JNLA 2IIQA 1J22A 3D7MA 1GARA 1QVAA 3NWBA 4RQBA 1E1RD 1E20A 3M82A 2HZ7A 3ZY4A 4GICA 5JWRA 2OFWA 5INTA 4QXOA 5B3LA 4QJ3A 3L04A 3E5HA 4W6QA 3L8CA 5TQ0B 5HQ3B 4MGEA 2OGTA 2BGRA 2WPNA 2QXTA 2X7XA 4BNMA 4U7JA 3HYTA 5FEMA 4B8ZA 3DYVA 3GRKA 3PNVA 4IDCA 4DR7B 2F9MA 3MMPA 5CT8A 2A5GA 2FP4A 3N9IA 4LEIA 1JVSA 3A6LA 1DTWB 2BMWA 4IDEA 1IN4A 4LNUA 2I3GA 2BKAA 4MKGA 3CUYA 2H2DA 3ZR4B 3AJ9A 1JJ7A 4EG3A 2ZR9A 1SM4A 1D1SA 2QP9X 1ODTC 2VUUA 3KT8A 1ULHA 4GX0A 4W5HA 2FQXA 4XM1A 3N8IA 3VDXA 3K3PA 1Y7PA 1P2VA 1NUPA 4Z99A 4E2FA 1R66A 2YDXA 1NRJB 1NUQA 4MAFA 1VB5A 3O38A 1TM1E 2NUAB 1PJ2A 2O0KA 4EQ6B 5K8JB 1CQWA 2A9VA 1NF3A 2VZEA 3RIGA 4IMPA 1UPAA 3VXKA 4CE6A 1YFJA 2A94A 4AJEA 2O8BA 4E1VA 3OSZA 2ON6A 3PUWA 1SELA 1FLNA 1T1GA 1Q16A 4PM4A 4QX6A 4MGKR 3AIOA 3A6ZA 4M49A 3ROTA 1CQJB 1TLTA 3N6XA 4TWAA 5G02A 1AGRA 3WQSB 3IFSA 2MU1A 5JSUA 5JRJA 3IT1A 3DKRA 1OA1A 2VSFA 4U7PB 3E18A 1O7JA 4HH1A 1MVLA 4EPXA 5IVHA 1B4DA 1N6OA 1WMSA 4MQ4A 4V2IA 4YUWA 1E8MA 2B3DA 3SYLA 3HJRA 1UK7A 4K40A 2ZI3A 2FZVA 4LHYA 1TEZA 4FNAA 3JQPA 4HMOA 1HFWA 5D5QA 3WTBA 1P8JA 2CMHA 3KWLA 5DZSA 1X7HA 1CWUA 5AFSA 5COAA 4B7AA 1E4EB 4W1PA 4WADA 2H06A 5LQRA 1AE1A 3O9ZA 2J4DA 3E1SA 2WWYA 4CMEA 3UTCA 4Q18A 1HTBA 4KOAA 1C1HA 1OGIA 2G5CA 5LZ5A 1Y8ZA 5FOQA 4HVAA 3R3XA 4QOEA 3AP3A 1W0JA 3URKA 3AVVA 1I13A 4P32A 4CFYA 1S8AA 4ESVA 1TMYA 3WWYA 5F73A 1YVEI 2DOKA 4O2BA 3ZDAA 1B8OA 4QOJA 4NQRA 3JAKA 1O6FA 1RRGA 1JPJA 3DZCA 3S8YA 4NTZA 1DRUA 3LPNA 1WCWA 1PDVA 1SHTX 1OX4A 1W2GA 2A8YA 3CGWA 4F5DA 3AR4A 1PE0A 4JKOA 4Z4GA 2W2NA 4CODB 2J3EA 1KWKA 1WP4A 2VCYA 1EFRA 1T4DA 1GXSA 3GT3A 4I4TA 4D9BA 2KI5A 1EGHA 2G09A 5AM4A 1QSGA 2R8YA 4QGFA 1V8OA 1RXEA 4ZEOA 1T5LA 1OX5A 3BXOA 4HWRA 2ZRJA 1JEOA 2O5RA 3CS3A 4KACA 5BVGB 3F2VA 1UINA 2D5AA 1DIBA 1T2CA 4LSWA 4PYNA 1DAMA 2O3TA 2XWSA 1FFBA 2XMZA 1JDZA 1XQ9A 1Z4QA 2BCGY 4TTVA 4DJTA 4EHHA 1C7RA 4YV7A 1E3EA 1RQRA 2EV9A 2G0TA 4IILA 2J32A 4LK2A 1JP7A 2C20A 1CQPA 5EXXA 1FU7A 1Y3FE 5AOVA 5F7OA 4AM8A 1XZLA 4CMEC 3A2KA 3KOXA 2R44A 4AKGA 2R7MA 4TLBA 4A0QA 1S6YA 1SC6A 1E6EA 1F0PA 3W1VA 4F46A 1J5PA 1HT2E 5IUKC 1JR3A 2P30A 3GJQA 4NAVA 4AD8A 1NN3A 3W6NA 4R5MA 5JSZB 3EPJA 2W2PA 3ETGA 2AG1A 4U6QA 4U2CA 2G67A 3HNRA 3ME5A 1KEKA 2HJGA 3NHKA 4GPAA 4YDQA 3AU8A 4LPSA 2Q6KA 3OEWA 2FFAA 3TD9A 4CM8B 2UKDA 4MR9A 1AGPA 4FB5A 2JGRA 2C5HA 3IBYA 4QUIA 2GCGA 4R8KA 4ASUA 1K7EB 2O8NA 3BIWA 3LUFA 1DU4A 4GBED 2HHJA 2ZI7A 2FW8A 4Q3CA 1RWXA 2QRGA 2H7CA 2JFPA 4CFZA 4PY2A 4M1ZA 5A3SA 2WJPA 2GJAA 1WB9A 1SHZA 4LHZA 5A0VA 3DULA 4YJKA 1V5GA 2OP0A 3BD8A 2X0JA 4EYEA 3UGJA 1TYDE 1EIWA 1XNRB 2NU6B 3OCVA 4OUKX 4LSGA 2IDMA 2GCEA 3LO8A 4RVNA 3F9RA 3VU9B 5FRDA 2DEUA 3OA2A 2J3HA 4ZAFA 1SUDA 4K9MA 1NMYA 1Z6YA 1EBFA 1FA9A 4PRYA 1PQWA 4U9HS 2D5IA 1DBRA 2X8JB 5DCWA 4MV6A 1QBKC 4B48A 2CNWA 1TAUA 1EFDN 1U81A 2VJNA 2XYRA 2ZYTX 1UWLA 2HTFA 3I5UA