1XQYA

Crystal structure of f1-mutant s105a complex with pro-leu-gly-gly
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSAYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 88
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xqyA00
1MNQA 3FVRA 4Y2TA 4FKBA 3G0CA 4Y2PA 2WUEA 1GKLA 5E4TA 1VXOA 4G4JA 2XUOA 1TIBA 4G8DA 4LXHA 4HZGA 1QO7A 2O2GA 1QTRA 3S2ZA 3AIOA 1LPBB 1MO2A 1UOOA 3ESDA 5LKRA 2VTVA 1MNAA 1LPSA 2ONCA 4ZV7A 1CUHA 4IH1A 2O2HA 3ZLVA 2WIDA 1HLGA 1Q84A 2WLSA 1XFDA 4OUKX 3UUFA 1E3QA 4H35A 4WFKA 4RNCA 1T4MA 4K6GA 1XZDA 5CT4A 3ZLUA 4A16A 3L1HA 1ODCA 4ROTA 4XJVA 2GZRA 3FLBA 4ZWNA 3PF9A 3DOIA 3EQ8A 5LZ4A 4N8DA 1LPMA 4BE9A 5AK6A 4QLOA 3FYUB 4FLEA 1WCYA 3LLCA 1W6RA 1F6WA 2CJPA 2JGLA 5DTJA 4IHAA 2J4FA 1C7JA 5AKXA 4FTWA 5EIEA 1DWPA 1XLWA 4DNQA 4X93A 4E14A 1P0QA 5ALFA 2XB6A 4J0CA 1DQZA 5DYYA 3AZPA 1Q0RA 4XVCA 5K3CA 4EUSA 2VEOA 3R3UA 1AURA 1HDEA 3WA7A 5HF6A 4Y7DA 3STVA 5EIHA 4LYEA 2Y6VA 1PJAA 3ANTA 1DQYA 5HF9A 2HA5A 5LZ5A 4CFSA 3R0VA 5AM5A 1LPOA 2I78A 3V1NA 1XRQA 1EK2A 2XMRA 1HQDA 5AK3A 4DYHA 3WK9A 4KJXA 1TRHA 5C81A 5AKEA 2AJDA 1XZJA 1BROA 4BP9A 3ZPXA 3EQ9A 1ZD5A 4QLAA 5CTAA 3NOXA 3KD2A 2QUBA 4U2CA 2JGMA 3PUHA 2Y2VA 3QPDA 3HACA 2HU8A 2XMQA 3M83A 3D7RA 3BXPA 1DT3A 4WCVA 1MX9A 3IB3A 4ETWA 1G5FA 5D3ZA 3EF3A 3QMMA 2VT6A 1CLEA 2WU3A 4ZGBA 2QM0A 4DMHA 3WLAA 4CCYA 5AM4A 2JGIA 1IUNA 4UUQA 1EA5A 4XWGA 4BB0A 1EDBA 4MXDA 3D5EA 4HVTA 3ZWQA 4RE5A 3UUEA 1GT6A 1FFDA 2PKYX 4OU4A 1ZIYA 4PQEA 3A6ZA 5HQ3A 4GBGA 2GYVA 4B0PA 3WMRA 1IUOA 1I6WA 5EGNA 4L9AA 2XUPA 4CG1A 1GGVA 1CVLA 2GZSA 1QLWA 4FOLA 1CIJA 4UBMA 2DHEA 1H2ZA 2ORYA 4AXBA 5LP1A 4I4CA 5JD6A 1R9MA 4L0CA 4BDSA 1VE6A 3YASA 2OG1A 4OB6A 4UHCA 1MPXA 5AI6A 4BCBA 1EHYA 2PL5A 3TRDA 3DOHA 5DTIA 4J0HA 1UWCA 5EIAA 1AX9A 5FV4A 3N2ZB 4EY6A 4X6UA 1LGYA 2ZYHA 1ISPA 1FFBA 2IITA 3I6YA 1A7UA 1DX6A 1BN7A 1LPPA 5AIAA 1XRNA 1CUUA 1QE3A 5HK8A 2WFLB 4UFOA 4BE4A 3ZI7A 1XZCA 5AM0A 2WHRA 2PSJA 4AQDA 2WKWA 5JANA 2ECFA 1JKMA 4HAIA 4AMZA 4ARAA 3C43A 3C45A 4BBZA 3G0IA 5CH3A 4BAZA 2FJ0A 1NU8A 2PU7A 4OB7A 5ALXA 4GECA 3PUIA 1UZAA 4H7DA 3QVMA 2YASA 3WKEA 3WK4A 3PFBA 2XMSA 2JIDA 3AJAA 5AOAA 3VVMA 5A6VA 3IIIA 2G63A 3AFIA 3DDUA 3W06A 4ZV9A 4X00A 5ALOA 3ESBA 2WM2A 4PSDA 1YASA 2XLBA 3HLKA 5EI5A 1GPNA 1SFRA 4M0FA 5AHXA 5EHNA 1YB7A 4AZ3A 4DGQA 4OYLA 2H7XA 4D9JA 7YASA 4H7KA 4YK7A 4JUIA 2WJ3A 4I3FA 4HRXA 1S8OA 1O6FA 3A2NA 4G8CA 1J07A 2BUAA 3WK7A 3WA6A 3I28A 1U65A 2UZ0A 4DMKA 1MX1A 2C0PA 3WWOA 1CQWA 1AMNA 1VXRA 1DINA 2O2IA 5T4BA 1ZI9A 3H18A 4AB1A 2PPLA 3OC0A 4IH9A 4BC1A 2QT9A 3A70A 4DIUA 4OU5A 5E4YA 3KXPA 5IH7A 2WG0A 4FDMA 1EH5A 4J0GA 5AKIA 1T2NA 2XUFA 4DMCA 3BF7A 1LZKA 1JI3A 5FPQA 1TAHA 2PBLA 4BRSA 2ZSIA 3AIMA 1LBSA 1HPLA 5K3BA 3SC2A 1ZGCA 1YR2A 4RE6A 4ZI5A 4KE7A 1CUZA 1H2YA 3MGAA 3WYDA 4J03A 1E8MA 3IUQA 1PV1A 2DHCA 3WKCA 3FVTA 3Q0TA 3FWHA 4X6XA 5CT6A 1A8QA 1J06A 2WTNA 2WHPB 4Y2RA 4XIIA 2B4KA 4MEBA 1CQZA 5DJ5A 3F8SA 2O7RA 1U4NA 5E4JA 3H2GA 2C7BA 2Z8XA 2WUGA 1M33A 3DJYA 2VSQA 4HXGA 1MTZA 2J4CA 2PUHA 1QIMA 5LZ8A 2XMGA 4B9AA 1IVYA 1EVQA 2XQGA 1JJFA 4EY8A 1ETHA 4JYMA 5JAOA 3O4GA 4H7JA 4BVJA 1CEXA 2VJDA 3ILSA 4W1QA 4WY8A 4LIPD 3WJ2A 2AJBA 2FJPA 2XQIA 5JZBA 4IQ4A 4J0IA 4QEKA 1AUOA 4U2BA 3RK4A 3C6XA 4IO0A 3STUA 5H3HA 4U2FA 3QYJA 2HHAA 4FLMA 1JT2A 3H17A 3ZV7A 3V9AA 2ZJ7A 3W05A 3AINA 5HZGA 3BDIA 4PSCA 1C7IA 4X85A 3JW8A 1XQXA 4B9EA 1XQWA 2DQYA 4RGYA 3WK6A 2WQZA 4YASA 2RONA 1DWQA 3G02A 4QWMA 5AKHA 4F5ZA 4K6HA 1IUPA 2HA3A 4U2DA 3I2GA 2X5XA 4B0OA 4L3WA 1ZD4A 1K63A 4B84A 5KWJA 2QKYA 3STXA 4X7BA 5ALEA 3C5WP 2XT0A 4LYDA 3DL4A 1EVEA 1XKTA 4BAGA 4C4XA 2XMCA 5FXMA 3X3HA 3HRHA 5AM1A 3RM3A 1Z68A 2NW6A 5DLPA 4TGLA 2WJ6A 1Q83A 3QM1A 1CUCA 4K2AA 3CXUA 4PV7A 1WPXA 4H7IA 5DNWA 2J3QA 1CUAA 2PM8A 3ZLTA 4JNCA 1GQSA 1YS1X 3FYTA 3EIOA 2XUQA 1W52X 3E0XA 3AZOA 5AI4A 1TCCA 2WFLA 1F0NA 2C5FA 1X2BA 2RIPA 3IUJA 2AXEA 1E89A 1X2EA 1ZOIA 4AO8A 1ACLA 2H9YA 3BL8A 1ZICA 2XUAA 3DYIA 2OCIA 3T52A 5K3AA 4LKOA 5HKAA 4BDTA 3D2AA 5AP9A 4Y9SA 4E46A 4EY7A 3E4DA 1QIJA 1XLUA 3OPMA 3O4HA 3SX4A 5EHZA 3PE6A 1XZFA 4OYYA 2W6CX 3C8DA 2HA6A 1UT6A 2XUDA 3DD5A 4P93A 5AI0A 1IZ7A 4G5XA 5AKZA 3O9MA 2JEYA 2GBCA 2WG2A 1UXOA 2CZQA 3QH4A 2H7YA 2QMQA 2E3JA 1W4LA 3WZLA 1XLVA 1VKHA 4A5SA 5ALPA 1E8NA 1XZEA 3WWEA 1XZAA 5JATA 1TQHA 5KWIA 4WJLA 4G9GA 5FUMA 1H2XA 4X90A 1CUWA 1QIIA 1QIGA 2OCGA 3WIBA 2WUFA 5JYCA 1BU8A 4QDOA 1R50A 3G9TA 2V97A 4WFIA 2VQ6A 1W1IA 3W04A 3DYVA 1P0IA 3WKAA 1QJ4A 3OM8A 4QZVA 5HF8A 4BYMA 5D3KA 5ALWA 1XZHA 2Q0XA 1K8QA 2VJCA 4KAJA 3H1BA 2D5LA 4FWBA 1LZLA 5I8PA 1LLFA 4LHEA 2PSHA 1AGYA 2BCEA 2HDWA 3WL8A 2K2QB 4H7FA 2HA7A 1OILA 4CIAA 3DL7A 5ALMA 3O9VA 4X3CA 4A23A 2EEPA 1H2WA 2X8BA 1VZ2A 1ORWA 1H23A 3VVLA 2JGJA 5AOCA 4Q05A 1SC9A 1UKBA 3NWOA 5T4FA 4F0JA 5T4EA 1FFCA 1ZI6A 5LIPA 4BRZA 1QZ3A 1LPAB 1HBJA 2R8BA 3BIWA 4Q34A 3WJ1A 1J2EA 2JEZA 4GI1A 4JH0A 1MT3A 1UK8A 5LYYA 4WFJA 4DMFA 4G1FA 1W76A 4W1SA 5KBYA 1ORVA 3DKKA 5ISMA 3T4UA 2HA4A 3E1GA 5JIBA 5ALHA 3I2KA 2C5GA 3HYSA 4N8SA 5AI5A 4AO7A 5K3EA 4FFVA 2HRRA 4FLFA 1SCQA 3QZUA 5ESRA 1JMKC 4PNZA 5LZ2A 2ZYRA 2VAVA 5AICA 1R9NA 3BIXA 3CCCA 5CRIA 1R3DA 5EHQA 3G9XA 5JALA 3F96A 2GBGA 2PVSA 1CUVA 2GYWA 3D2CA 2G5TA 3G0BA 1SCKA 2XE4A 1GKKA 5FKJA 5CT8A 3I6MA 4KRYA 4HXEB 6YASA 4EY5A 2WHQA 2DQZA 5JAHA 4L72A 2OQVA 2BJHA 5F4ZA 5AKGA 2B61A 1TCAA 1L7RA 5JAPA 2HM7A 2BUCA 2GBFA 4FNGA 4S0XA 4ITVA 3ICWA 4H77A 2YYSA 4CCYB 5AH0A 1XQVA 3KSRA 4J0JA 1WB5A 3DNMA 4E15A 5ALTA 2VAXA 1A8SA 1N5MA 4N5IX 1WOMA 2XLCA 3VISA 5BWBA 3W2TA 5JASA 5HQ3B 2PSFA 4W9RA 2XMDA 1UK7A 2RI6A 4K5QA 3TJMA 3O95A 4QWWA 3FSGD 3C6ZA 4M0MA 2Z3WA 5FDFA 4MQMA 5C8VA 3I6ZA 1OXMA 2WG1A 3D3NA 3H2IA 5T4HA 2BGNA 2QXUA 2JGEA 1YSCA 3F67A 5K5EA 1GXSA 3ICVA 1QTIA 5ALQA 1DU4A 3DEAA 4U2GA 3STWA 2ROQA 1ZIXA 1RP1A 3R3YA 3V1MA 4B80A 5IKXA 1N1MA 1N5RA 1KU0A 4F21A 4UHHA 5ALUA 3G0GA 1CUYA 1BEEA 3U0VA 4BVKA 4H7HA 4Y2YA 1L7QA 4EY4A 3C6YA 1WM1A 4C01A 1PFQA 3R3WA 3WYNA 1QIFA 1W75A 4C89A 2DHDA 1MAHA 4DLNA 3D4LA 1YB6A 1P0MA 3K9BA 5ALNA 4PW0A 3I2IA 4CI9A 1BE0A 3VDXA 1QFSA 3HXKA 3JWEA 4H7EA 1XZLA 3S8YA 1XRLA 3GA7A 2XUJA 5FRDA 1CUBA 2QRUA 3FNBA 2B20A 3GROA 4QDUA 4J0KA 4I19A 4OSEA 4UHBA 3DS8A 2OAGA 1BCRA 1JU4A 1UK6A 2WHPA 4UHDA 4GLBA 5K3FA 5A2GA 4U2EA 3DCNA 3HABA 3BJRA 1UOPA 2V96A 4ZXFA 3IVMA 1AC5A 1YS2X 3R40A 3B12A 1EB9A 3Q8WA 3D0KA 4N8EA 3TGLA 4GW3A 3WL5A 2PX6A 4GHWA 1R4ZA 3OURA 4X91A 2ZYSA 4FBMA 3MUOA 2WJ4A 5HF5A 3FYUC 4CCWA 3C8HA 1DTEA 1Y37A 2JBWA 1R1DA 4GDMA 4PSUA 4KE8A 1XRMA 3QMWA 1ACJA 4BP8A 4DSAA 5KREA 1E8DA 3HZOA 5IVKA 3F97A 4P08A 1YAJA 4TVKA 5AKYA 5AI8A 3D59A 3WIOA 4FFWA 2G4LA 5LLSA 3V1KA 1MJ5A 5AM2A 5ALDA 5CT5A 1CUFA 3FLAA 4B6GA 3C70A 4Y2QA 4NZZA 2OLEA 3EQ7A 3G0DA 5CT9A 4PO3X 4QA9A 4HS9A 2IIVA 4BVLA 3AIKA 2Z8ZA 4QDXA 2R11A 4TPKA 3O0DA 4FNMA 4J3JA 1UK9A 2DR0A 1G42A 4KRXA 1G4HA 3PICA 2D0DA 2XUIA 3GUUA 3F9CA 3H2KA 4DM7A 1A8UA 2ZJ6A 5JZSA 2HA0A 3I1IA 4MWTA 4QDZA 1XRPA 1TCBA 4DTCA 4BCDA 1P0PA 4KACA 3DKRA 5HFNA 1WHTA 4P9NA 5DNVA 2Y2UA 1VA4A 3C5VA 3R3ZA 2RAUA 1ZD2P 1MAAA 5ALSA 3WK5A 1YCDA 5CXXA 1JJBA 3PF8A 2XUKA 1VA5A 3V48A 4Q1VA 1ODTC 1AKNA 2XMZA 3I1YA 2OAEA 1CUIA 1H22A 2HIHA 4ZRDA 2XDWA 4C4YA 4F60A 3TEJA 1UFOA 4CG2A 4HTAA 5ALGA 5AO9A 3STYA 1K4YA 4W1PA 1AZWA 5A62A 1FFEA 4C87A 3VJKA 1FFAA 4G4IA 5FP0A 2HFKA 1EXWA 1GPLA 5D7BA 4GWLA 2WILA 2DFPA 5JARA 2QJWA 1U8EA 2H7CA 3KWJA 3WWDA 5CH8A 2OXEA 3PDCA 1F0PA 1TKRA 4EBBA 2IX9A 3M3DA 2JGKA 2VT7A 2HL6A 2AJ8A 3OG9A 1QFMA 3BE8A 5JZ9A 3PI6A 5K3DA 4HXFB 2OCKA 3H1AA 4UBLA 4KAFA 1L7AA 3HI4A 5C7YA 2PU5A 1KU6A 2BKLA 2WIFA 5ALRA 5I9IA 3KWFA 2GYUA 1SCIA 2OPHA 4WDRA 4DNOA 3W9BA 3WI7A 1JJIA 4Y2XA 1DX4A 5ALVA 3WQHA 5YASA 4B85A 1VLQA 1BCSA 3WKBA 3FCXA 1RWQA 3WL6A 1BN6A 4XX1A 1ODSA 1JMYA 2Z3ZA 1X70A 3OOSA 3LP5A 1QIHA 2PSDA 4UHEA 5FLKA 1UKCA 2FUKA 4BTLA 4E11A 3ESAA 2Y1KA 5HKBA 5AOBA 2PUJA 4QDTA 4NS4A 5LZ9A 5IVDA 4C88A 1XROA 1RYYA 1EK1A 2I3ZA 4MWSA 3H2HA 3IUNA 1ZGBA 2PSEA 2HU7A 2I03A 2AJCA 4G8BA 1UKAA 4BC0A 3RARA 4X92A 2OQIA 5ALKA 4X97A 3ESCA 4X71A 3R3VA 4UHFA 1B41A 3AUKA 3STTA 1N8SA 3QBJA 5SYNA 1QO9A 3C87A 3AZQA 2VJAA 1VJ5A 3W9UA 1WHSA 2QS9A 4GEGA 4MYSA 5ALYA 4BAUA 1E5TA 4B82A 2OCLA 5EHXA 3VJLA 2YH2A 4UBNA 1EI9A 5AK5A 1ZI8A 2OGSA 2Z5GA 3H0CA 3O4JA 2CEKA 3ED1A 4BZWA 5DWDA 2CMFA 2VJBA 4UBOA 2V9ZA 5C8XA 3NGMA 3I2HA 5CW2A 5AKJA 5ALZA 2QUAA 5CXUA 1HKHA 3SK0A 4NVRA 3K2IA 3BJMA 2RGUA 1XZIA 1OCEA 2XQJA 5HFAA 1GQRA 3LCRA 3BDVA 2GBIA 1XZBA 1QIKA 3IUMA 4FBLA 4JYPA 4Y2SA 2H1IA 2WU4A 4UFPA 5ALLA 4AN1A 3M81A 2CBGA 2CUTA 2QZPA 3L1JA 4J0DA 3PFCA 4KEAA 2I3DA 2AJLI 4UPDA 2QOEA 4GXNA 1ZD3A 3A2LA 3OTQA 2XUHA 3EBLA 3IURA 4Y2JA 4MEAA 4X6YA 3SWWA 3A2MA 3QITA 1GZ7A 2G5PA 3FSGA 5BOVA 4O08A 1A88A 2OGTA 2B9VA 2P8SA 4DNFA 3KDAA 1D07A 5D6OA 3BWXA 4H0CA 1R88A 1EB8A 5SYMA 1CPYA 5AI9A 5HCUA 4Y2UA 4WDQA 4C4ZA 3WKDA 2HADA 5I7UA 1QOZA 3H19A 2Y6UA 3HEAA 3HSSA 5JD5A 2DSNA 4X95A 2CB9A 3FOBA 3FAKA 2LIPA 2EDCA 2JGFA 1JFRA 2WIGA 1LPNA 3I2FA 3GBSA 3MUNA 3D2BA 4C6HA 4RPCA 1G66A 4P92A 3E3AA 3G7NA 3VKFA 4NMWA 3FLEA 4Q82A 1K5PA 1IMJA 2BAGA 2O7VA 4EHBA 2HFJA 2ZVDA 1XZKA 4KYVA 5A7FA 1THTA 3NUZA 3FCYA 4Q3KA 2WTMA 2C58A 2ES4A 2BFNA 1HL7A 2OGZA 5HK9A 1MU0A 4DNPA 1YA4A 3H2JA 4EA6A 3GZJA 2ACEA 3IDAA 1YAHA 4G9EA 3WL7A 5AK4A 3O4IA 3B3QA 1XZGA 2EDAA 1CV2A 4W1RA 3V1LA 3HJUA 2VATA 1E66A 4KE9A 2W22A 4JEIA 1USWA 4QE3A 2WIJA 2XMBA 2DCMA 5IVHA 4W63A 2FX5A 4Q3LA 3G9UA 1XKLA 3GFFA 5LKAA 1QGED 3WZMA 4CG3A 1QIEA 4H18A 1GPKA 4N5HX 3N0TA 4EB0A 1WB4A 4UFNA 3CN7A 2XQKA 2C4HA 5CURA 4MYDA 2WFMA 3DQZA 3QPAA 4V2IA 1EDEA 4AMYA 1YA8A 4KE6A 3VJMA 1CUXA 4BTVA 4X94A 4AX4A 1MN6A 4IH4A 1B6GA 3K6KA 1EINA 3HC7A 4AO6A 5JADA 4MQLA 2WUDA 5K3FB 1CR6A 1BRTA 4OPMA 4UBIA 5CBKA 3IULA 4CIBA 3KOOA 1DT5A 4FMPA 2C0QA 4Q3OA 5AKLA 3RLIA 4INZA 1DWOA 1Y7IA 4YX9A 1SOMA 4UBKA 2CKMA 5AJHA 1XQYA 5BV7A 5JAUA 2XI4A 5J3JA 1U2EA 1LNSA 1VE7A 2XQFA 3QPCA 3G8YA 5AKKA 3M82A 1NX9A 1MX5A 3VXKA 5JD4A 1WPRA 2BGRA 3WWPA 1CFJA 2QVBA 2QXTA 4KR0A 5LZ7A 2XUGA 4B7ZA 2RHWA 3QMVA 4B83A 3CN9A 1THGA 4FHZA 4ZREA 1KEZA 3BF8A 3U1TA 4OB8A 2ACKA 5IVIA 3ANSA 3I2JA 4B81A 1UOQA 3IBTA 2QTBA 4DSZA 2J3DA 3MVEA 1Q0ZA 4EZIA 3LIIA 4YPVA 5A71A 4K6KA 2QR5A 3FBWA 1XRRA 5C8ZA 5DYTA 1QIDA 2ZSHA 1CUGA 4BZZA 1IZ8A 2WFZA 2RHTA 3WWCA 4Z49A 2VA9A 3H04A 5E2IA 3AILA 1TK3A 2ZJFA 1EDDA 4BCCA 3P2MA 1VZ3A 1K6EA 3JYHA 1J1IA 4BATA 5DNUA 5A7HA 3B5EA 2VF2A 4OCZA 2ZYIA 4HRYA 3RKSA 5A7GA 5FOQA 4LXGA 1LBTA 3R41A 4WY5A 4Y2VA 3R3XA 5ALJA 1BEZA 2HA2A 2QJRA 4KAAA 1FJ2A 3C6BA 2X76A 2HRQA 4OD0A 1AQLA 1CUEA 1XZMA 5ALIA 4J7AA 1ZJ4A 5CMLA 3L1IA 5CH5A 5DYWA 4QNNA 3G9ZA 3LS2A 5FPPA 2WSLA 4ARBA 2V98A 4M0EA 1EX9A 1ZJ5A 2HU5A 1WB6A 1C4XA 3FYUA 4PF1A 4LXIA 5AIBA 1CRLA 3UMJA 3WK8A 3LIPA 1VOTA 2BUBA 1FSSA 1CUJA 3CCBA 1O6GA 1F8UA 1CUSA 1JU3A 4AN0A 1NU6A 3IA2A 1QONA 3GELA 4MJ3A 5BWCA 5EFZA 4G4GA 2WIKA 3DLTA 1Y7HA 5AM3A 2YXPX 4AZ0A 2JF0A 1BS9A 1CUDA 4UBJA 3F98A
chains in the Genus database with same CATH superfamily
2VPXA 3FVRA 1SUSA 4F2HA 3ISVA 4AJJA 4L5JA 1MEOA 1EHIA 2Q1UA 1GGHA 3G0CA 1IK6A 4XYMA 5DGIA 4DQVA 4ENTA 3SX2A 4ER7A 3QW2A 2LWIA 3BA1A 1A76A 3LCMA 4Q1DA 1TF5A 3AFHA 5CK5A 5AUOB 2MYTA 5J1SB 3FPGA 3G1TA 3Q3GE 5E4TA 2NP6A 4AKEA 5JNUA 1WR8A 1RYNA 3DDSA 1IXRC 2I62A 3BB1A 3OJFA 4I6EA 1L7DA 2DPYA 5K0TA 1O4WA 3AVYA 1BYIA 1J49A 2PZAA 3C5EA 1WMAA 2ERXA 1C3JA 2J30A 3DFUA 3HMQA 1KYXA 4G0VA 2H07A 4Q24A 4Z4FA 2L82A 3OZTA 2AI2A 5CNKA 1DCTA 1SY7A 3KQMA 2NSYA 1QUEA 2RJOA 4YDSA 2XWJI 3KAJA 1Z74A 1ZRMA 1YZ3A 1DQSA 2FFQA 1ZGAA 3D3QA 4P54A 1TYAE 2QMOA 3AIOA 3RSLA 1T6BY 2D1SA 3U7RA 1YNSA 4PSAA 2Y0DA 4C22A 4PG5A 2FN3A 1SVSA 2VTVA 2GARA 5LB4A 4M8NE 4JYBA 4PHHA 3JY6A 1T4DA 1FFWA 4X1KB 4E88A 1NC3A 2ZWMA 4P5EA 5HJ2A 5KYXA 1TVMA 1ENOA 1SG6A 2AMJA 3OZVA 2V55B 4IH1A 4QUEA 1YJQA 2QN2A 3ZLVA 4X7MA 3I83A 2WIDA 3OT1B 3ACBA 3UFBA 4AMVA 3BQ9A 3MUFA 4GL4A 2JHGA 2WLSA 4G0XA 4M9UA 1B16A 3GF4A 3UGJA 4OLHA 4UU7A 1G0NA 3DHVA 3ODPA 1G8PA 4M1SA 1VG0B 3K1AA 2C2WA 4RDHA 3PQDA 1P2VA 4GI2A 1GEGA 4GPBA 1N2JA 4RNCA 5FR1A 3R7SA 1ZS9A 4TROA 5CT4A 3ZLUA 2PO7A 3DOUA 1J7KA 3HDVA 4WCFC 3IQIX 1R8SA 2MU1A 2B1JA 5EZ6B 2GZRA 2XF2A 3FLBA 3QPBA 3N1UA 4IFBA 4UZSA 1DKRA 3D8RA 4ZWNA 5LZ4A 1KDTA 1KOJA 2NSDA 3LW8A 1ECPA 1KH2A 3CRRA 4JSTA 3FYCA 2VQ3A 1V16A 2BEWA 2GTIA 3ZDDA 3COPA 1EFHA 4F2PA 1Y6ZA 4OYHA 3P94A 1JB1A 1W6RA 1WEHA 3GJ8A 3DE4X 3IMFA 4GBMA 3J81k 3VQTA 2AOVA 3VR3D 3CH4B 3EIEA 2A5DA 2WWVD 2RMKA 4IHAA 4YAFA 3GJ0A 3LDFA 3ONNA 1NGSA 1QH8B 3WR5A 4F3YA 1OPRA 2IOQA 2VCEA 2BBOA 1Z8DA 2QRVB 1ST2A 2V5UA 2A8YA 3GAZA 1JR2A 4UTXA 5EMNA 3VHXB 5EIEA 3OIVA 2H0AA 4AVYA 4F38A 1XLWA 2WM3A 5FWNA 1LI4A 4L75A 2VSXA 4J29A 2P9TA 3SY8A 2H5EA 2I1VB 4KQXA 4J4HA 2PEZA 3ND7A 4I8IA 4LBVA 2ZAMA 4O63O 5ALFA 4GKJB 2XB6A 4J0CA 1QX3A 2OBXA 2EFHB 1DQZA 1Z29A 4V0SA 3AZPA 3BEDA 2HMAA 4U0JA 1Z25A 4E70A 4KW7A 5GM1A 2H2DA 2VEOA 2G6BA 2VI5A 4YT2A 1PBTA 4RV4A 5HZMA 3GJRA 2G7MC 3ORYA 4K03A 3USZA 1AURA 4QQ8A 4XSVA 4ILKA 3VBCA 4P32A 3PWSA 2VP0A 3OFKA 3STVA 3VR5A 1G8AA 1RAAA 2EU8A 1NLMA 4XUGB 3ITNA 2CXSA 3OT5A 4LYEA 4QRHA 3S70A 4ACBA 1M1YE 2OFXA 1ZK0A 3WV5A 1XMQB 2XHZA 1R9JA 1IHDA 4MRNA 4E5MA 3AEKB 2W9XA 3WLQA 3DUWA 1ETUA 4QQFA 4MIKA 1EAYA 1LPOA 1DLJA 2FE4A 2OORA 3SR4A 3NIGB 4BIIA 4YJHA 5BN1A 3DE6X 1J8YF 2PT7A 1EK2A 3EG9A 4TRMA 3VPCA 1P2BA 4DYHA 3CRNA 5DASA 1TPYA 4FMDB 3PENA 3WK9A 3H6GA 5KJCA 2VYND 3NC0C 3PLRA 2XYHA 2RARA 4GRDA 2UDPA 1BHQ1 2WT4A 3HWRA 3KOXA 5KPDA 4PGGA 1KSFX 2WMYA 3PTZA 4FFSA 4OGGA 4QPJC 1XZJA 2RH8A 3N8IA 1WUHS 1RQRA 3HCCA 4PYKA 1YQGA 2V7TA 3TR5A 5E6UB 4C3OB 4Z4EA 1L8LA 5E0OA 2WF6A 2Z6AA 3MINB 3M70A 1DKNA 3KVOA 2XOXA 3EQ9A 1XXHA 2YVAA 2Q27A 3GRYA 4OI2A 2CL7X 5CTAA 5LXTF 3DHWC 3K70D 2QUBA 3F2VA 3E5NA 2VJPA 1N6PA 1VJ1A 2BJVA 2BKVA 3JR7A 3PUHA 4ZHQA 3O8QA 1FB5A 3HACA 4EHHA 2W93A 2BMAA 3UAZA 4E6EA 2H1VA 3KZOA 3DBIA 4AWXA 2PK3A 4KQ1A 1AF4A 4D3ZA 4DSUA 4HYTA 2RAPA 4WCVA 5H0IA 1PEAA 5TS3A 1AXEA 1R64A 2I3AA 5BMVF 1VRCA 1Z08A 4RJKA 3RT7A 1OWNA 3EF3A 3FWZA 2O3RA 2HWYA 2ZT7A 3QMMA 6Q21A 3MBKA 3RR2A 1Y5LA 3MAAC 1JG4A 2QQ0A 1Q0LA 3D54D 1NPTO 1W47A 2WKSA 4NAVA 3PGLA 1GUZA 2NUAB 1P72A 4R2MA 1PJLA 1VPEA 1M8GA 3WLAA 3ZI4A 2VPPA 5JZVA 3CVVA 3CKKA 1AZLA 2IXGA 3E9EA 4MKHA 4MUEA 4Q15A 4DRZA 1OYYA 4IDGA 4KR2A 4PGHA 4HTFB 3SHTA 3ZHXA 4EVIA 1A77A 2F6RA 2F4VB 3RVLA 2VR1A 3BXHA 3GRFA 4MWBA 5GJCA 4B4UA 3BL5A 2V7WA 3DT8A 5K3SA 5T41A 3LO8A 4M88A 4PRYA 4UUQA 4B3RB 3FGZA 4XWGA 1FZTA 4FR2A 3EODA 4QU0A 1M2GA 4MXDA 2BFDB 1RC1A 1G6Q1 1E9CA 2XUZA 1NTRA 1UPCA 3DG9A 2PX5A 3IHKA 4ON9A 3UJDA 2ZRMA 2VHUA 3D5EA 3SSAA 2VF5X 1TZMA 3KR0A 1Y6RA 5KTTA 3ZWQA 2AX3A 3OETA 4LOAA 5H80A 3ECSA 1GT6A 4ZOEA 3UUEA 4DWOA 3NTXA 3D0OA 2ZFUA 4LJ4A 2BGLA 1I51A 1NW7A 3VDRA 2PKYX 3BMQB 2GN4A 4IDNA 4FN5A 3I6IA 4EHNA 3R7NA 4G67A 5HQ3A 1CJTC 4ZGGA 1U0TA 4B0PA 3WMRA 1OD6A 1IUOA 4Q9JA 4TYMA 2Y0PA 1WCIA 2F3RA 1I6WA 5CGQB 4L4XA 1FNBA 3RYFB 3JZDA 3KD3A 1VPVA 4ZQCB 4UU0A 3KTOA 4EYOA 1BMQA 3C41J 1Z16A 3DBLB 4RTKA 4DY6A 1R3UA 1G7TA 2Q9BA 3EPHA 2GZSA 3TRFA 5L3VA 3OQPA 4PFKA 5ETJA 1JSZA 4C08A 1CIJA 4UBMA 3KPJA 1FSZA 1RLJA 2GNOA 1IG0A 2G9VA 2IGBA 3HG7A 5JDCC 1M8JA 3LUBA 4K9KA 4L4YA 4D6PA 3I9LA 1PSDA 1J0DA 1AS0A 2ZIAA 4U1RA 5K2MA 4HRAA 4L6CA 2C31A 4LRUA 3RIMA 3L8CA 3LBAA 3IE1A 1KO1A 4PQYA 1VRVA 1M2NA 1XL0A 2B37A 3CNEA 3GP5A 4YDQA 5JD6A 4L0CA 1KZ9A 5JSQA 3I42A 3ZS8A 3B1FA 4RDCA 5TPZD 3ZX5A 1EP3B 3CTPA 1V7QA 3WBFA 1G3QA 1HDGO 1JXQA 1YWGO 1ZCAA 3GFBA 3NDPA 3PRHA 2ONYA 4KFSA 4MS1B 4ZVKA 1MPXA 1Z38A 4GNKA 4FIZA 2QRZA 4GVLA 3QNMA 2FLVA 2GN1A 2WV7A 3ZK8A 4XQ0A 3UB4A 5A4IS 3U61B 4WL0A 4O2BB 1ZX1A 3UXYA 1GTL1 1UWCA 5EE9A 2RHJA 4ZT5A 3BMOA 4IZOA 1G5PA 1N75A 1JZTA 3A7DA 4RVFA 1P9WA 1F7VA 4DJDC 1ZLYA 3WGHA 3MTGA 1QR6A 1T8RA 2K4MA 3DZKA 1SUDA 3H5AA 3IEIA 3BGOS 1FYWA 1UEIA 1FFBA 2C5LA 2VN8A 4YGYA 4DC9A 1K5HA 1H4TA 5LOVB 4JJAA 3W2HA 5IM5A 4ICIA 3ET4A 3ILHA 2O0KA 1T8UA 2OHIA 1QE3A 4OMCA 4O4LA 2IA5A 4N3CA 3ZCQA 4TMVA 2HK9A 4BNYA 2DSTA 2WFLB 1QRTA 4XGIA 4M0UA 4ZOCA 3N6VA 4XEUA 4UFOA 1VB5A 2ZJZA 3EXAA 1EFUA 5LN1A 5JV5A 3UB3A 1I2AA 821PA 2XD9A 1WP9A 4BE4A 1T2EA 4EBFA 3D8NA 3NV9A 1PR6A 5A4KA 1XRSB 3DBOB 3WIUA 3KTFA 1VJ0A 3ONFA 1TU3A 1V5EA 4TZKA 4ZCPA 4IV0A 4AYWA 3S8EA 3ROGA 4MO9A 4Q01A 1QOPB 2IYSA 3EVEA 2PSJA 1ZL0A 1FQWA 4GSYA 3F1LA 2FEPA 3QEJA 4F1WA 1OFIA 3KB2A 3TGPA 5JANA 3OKFA 1QHHA 1YZQA 1ZUIA 1G0OA 4UAGA 2F55A 2CMHA 3PA8A 1M3SA 1NT2A 1Y3DE 2Z9BA 3IJPA 3GBPA 3LM8A 3RC9A 1E3EA 1QDEA 2C4TA 1VMAA 1FRVA 1TT7A 1NU8A 2P0YA 2XZTA 2OBBA 4RSHA 3I01A 2VL7A 3CS3A 3O1IC 4RIEA 5ALXA 4A82A 3LRTA 3PUIA 4KI0A 4B4VA 2C7PA 1GPDG 1UZAA 1V39A 3B38A 4H7DA 5COAA 4I6GA 4Q47A 1UC5B 3T61A 4OY3A 4LYHA 5A04A 4N0DA 3A37A 3L1VA 2IEIA 1QF7A 2JIDA 2C4UA 2ZBDA 3UENA 5LD2B 1YE3A 2J7PD 5CPBA 5DP2A 3HXLA 3PQ5A 4AW9A 2IOFA 4A5OA 4F9FA 3FTEA 1UJ2A 3UG6A 2HZ7A 4MVYA 4NLLA 4RKEA 2ZRKA 3EFBA 1P9LA 4JLUA 4Y0NA 2OYCA 1NL3A 1JTEA 2ZIEA 4X00A 4GP7A 2F1JA 1XA4A 2BKXA 2NV2B 3Q4GA 3RV4A 1L4UA 3HQ4O 4S2EA 4EHJA 3E7PA 9LDTA 2F62A 1QGZA 2ZTLA 4XYGA 5C46F 1FRNA 4BX8A 4XWOA 1ZWLA 3QBTA 1YASA 2G36A 1XQ9A 1C0IA 2EJTA 2XLBA 3BRSA 4ZVTA 3B1XA 5IZCA 2KQUA 1PKEA 4MR8B 3UAXA 1R9GA 1GUAA 3VC1A 1SFRA 2FVYA 3GVHA 5H59A 4M0FA 3AHEA 5I6DA 4HWTA 4N5NA 3AEQB 3T4XA 3ZD8A 1YB7A 1MQSA 3AHIA 1ZHOA 2L42A 2J48A 3U9LA 2MSKA 2V7QA 2IHKA 3FPJA 3I64A 4X5OA 4CQJA 2H7XA 3NM6B 4LWPA 1NONA 4H7KA 2FPIA 4X1YA 1TA4A 3IESA 3OJXA 1GLNA 4V0RA 1PI3A 2X4LA 3DZBA 4JUIA 4K6CA 2EWWA 1F14A 1VDMA 4X63A 2BFBB 1Q6YA 1S5PA 2CNDA 3ID6C 1TM4E 2GUWA 5DWQA 3FPAA 2BBWA 2V7XA 5M3BA 3K9GA 1O6FA 2FF5A 4BMCA 3CNBA 1UKZA 4A3SA 4GM4A 4RAOA 1AH2A 1T6XA 3W8RA 3BYZA 3KPWA 1XOIA 1Y1KE 2C83A 4BIMA 3BGVA 5D2CA 4A8HA 1OX5A 4XDHA 2VQSA 1AMNA 4W99A 2J3KA 3OPNA 3LYAA 2BWJA 2X77A 4WE3A 4AZTA 1DINA 4K1XA 2Q99A 3H18A 3LT4A 5T4BA 2V45A 1WXEA 1YJ8A 3K5IA 4Z1OA 1QUFA 1O5OA 2FEXA 2P2DA 4ZHQB 4L7VA 4O2BF 3H0KA 2XSZA 3DAGA 3F3MA 4AKHA 4DUZB 4A0RA 2EP7A 4ISBA 3L0IB 3A6HA 3DVQX 4MA5A 5DMXA 2OWDA 3EDQA 3G89A 3PR2B 3THRA 2XRZA 2GK3A 3C7DB 1ZUD1 1N2SA 2CXPA 2H17A 3EN0A 4OU5A 5FJIA 3CO5A 4DIUA 2O2JA 3KXPA 4OHFA 5IH7A 2DT5A 1YZNA 3TW4A 2HPAA 1WZIA 2QLBA 4S1WA 4UVEA 4HFMA 1RAIA 3PV0A 1XMJA 3UXMA 3P9XA 4PFJA 2WAMA 2EEZA 4G5GA 3B8HA 4CQMA 2CCGA 4DMCA 1LZKA 1FNNA 1UANA 2PMDA 2LZ0A 2XGOA 1ZMOA 1J8DA 1QR2A 3L0SA 3OESA 4IHQA 5EZYF 7REQB 1HPLA 3EASA 2WDPA 3H65A 3L6OO 1ADBA 3FOWA 3D64A 4NCIA 3ASYA 1YR2A 4ZOLF 4RE6A 5CB0A 1P7VA 3PXGA 3DJFA 3EA5A 3GG2A 1AS2A 5H5JA 1XA3A 4GZMA 5BYJA 1EJ0A 4ENWA 2GN8A 5DLQC 3WWZA 1SEVA 4KE7A 1YL5A 3PZBA 2OILA 3ONEA 4JB8A 4ED9A 4J03A 5LLDA 6CHYA 1GOTA 1Q7EA 2R4UA 3OEWA 2X0DA 2QRNA 4WUVA 5IN4A 2MR6A 3IUQA 5BN5A 3PWTA 1SC1A 2DHCA 2UZ3A 2VHXA 3WKCA 1N5OX 2GPBA 4YRCA 4RDXA 1J9ZA 4C0XA 3EX7C 3GYBA 2VDKB 3FWHA 1AK2A 4X6XA 2N9UA 3OHMA 3SKVA 1J06A 3GJ3A 1RHJA 1SEPA 2GM3A 5FQNA 2PUDA 5DW0A 5TQ2A 3K1ZA 1NRJB 4XIIA 3TD6A 3TTSA 1JHUA 3NRCA 2CWWA 4DFDA 4O8ZA 1T15A 3A4MA 5LUBA 4HN2A 3F8SA 4MAFA 4X84A 1Y1QA 1MO4A 2V58A 5E4JA 2HYDA 2PUWA 1VKJA 3H2GA 4Z0TA 2C7BA 3SM9A 1PYOA 5JVDB 4D79A 4AY3A 4FW9A 2B1GA 2QTTA 2PCJA 5EZ5A 1JBKA 1U1EA 1QGUB 2PS1A 1WJGA 4YCDA 1M33A 1UZLA 3KJHA 1WB9A 1PGQA 2DX7A 2NQ2C 2VSQA 4HXGA 1ACMA 4O4JA 2I71A 4QVKA 1XCOA 3BH7A 1XPJA 4BRWA 1WX1A 5KQSA 2HKIA 1AQYA 1LTHR 1BCSB 2XVAA 1F60A 3K5HA 3DBVO 4JOCA 1MF7A 2RHOA 1C1DA 2Q0HA 4B9AA 1CNEA 1EVQA 1UH5A 1Z5GA 2WJVA 1Y3IA 3R0XA 4FDTA 5EA2A 4GMHA 4BNGA 2WIAA 4M1WA 3EH2A 2QTVB 1MFPA 4I9NA 4JYMA 3RU3A 3UHOA 4CEHB 1XTKA 3LH5A 1IEVA 3RVDA 4R8SA 1ZUNB 3OY7A 2VJDA 1HYBA 3U3RA 4B74A 3ILSA 2E1PA 5IXSA 4HAYA 2YJGA 2I67A 3CF6R 1QFXA 4WY8A 4R69A 3T41A 3OMLA 3GZ4A 4BLVA 1B43A 1FRZA 4MV1A 4P4TA 4WBNB 4LBYA 4X61A 2AJBA 1C3XA 4RIIA 3NBXX 1QYDA 1X13A 3FF1A 3UHAA 1VL2A 2MJLA 4M6WB 4AYXA 1Q0TA 2VQDA 2AL7A 3IKLA 2C1XA 1BXGB 1NHWA 3MWDB 1AUOA 4HDCA 4QEKA 3A04A 1SQGA 2O5RA 3FFAA 4U2BA 1OSNA 1TMOA 3C6XA 4G84A 2AB0A 4IO0A 3AB7A 4WGGA 1GFZA 4U2FA 4B6OA 4L76A 1HNNA 2JCYA 2UZIR 2HHAA 2NTJA 4MI6A 2GETA 3DV0B 1NUUA 2G88A 2E0IA 3PEUA 1NURA 2IYZA 4WCDA 4D3DA 3OCXA 5CDGA 1N57A 2MINA 3FBGA 2Z6QA 5DBFA 3JU3A 3WXBA 1WQ3A 3OQIA 3F5FA 3ZV7A 1C1XB 1TEXA 4OUDB 5BOSA 1TI7A 2ZGVA 4UE2A 4KPYA 2FWRA 4J7CA 4XIYA 4HEJA 1A5BB 4WA8A 5HZGA 2P9JA 3L7YA 1F2UA 1QH0A 2IV2X 3I5XA 1V6SA 4XDGA 3JW8A 4L27A 4F71A 4B9EA 1XQWA 3T34A 3CWZA 1C7RA 2X0JA 3LQRA 2WQZA 3P0EA 4F1KA 2DRIA 4D81A 1JDZA 2YYYA 1U7XA 1GQQA 2W6PA 3GIDA 4IEFB 4BNFA 4CHGA 1PBNA 4NJEB 5G02A 4E5SA 5IAOA 2Y1FA 1E9BA 1XKXA 3MBOA 5I3CA 4FGSA 4W9NC 5AKHA 1ESZA 1UBLS 2CHUA 4EPTA 2CFSA 4Q02A 4KK4A 1QOQB 5FNVA 5GADl 2QTHA 4YC7A 3VOBA 2WNIA 2XE7A 3D8BA 4U2DA 3I2GA 5T57A 3ZWXA 2ZATA 3LQKA 3E2MA 1CERA 1ZD4A 3FGPA 4I2NA 3W34A 1TX4B 5C7LO 4B84A 1VLHA 3OZRA 1QYXA 2QKYA 1VPWA 3STXA 3NAGA 2F43A 4J2TA 2XT0A 2EC5A 3DL4A 4LYDA 1C0EA 3GR6A 4WXPA 5IAAA 3PIIA 1AKTA 1KETA 1I7LA 2OKGA 4WERA 4C4XA 2WF7A 3R24A 4LEIA 5K20A 3X3HA 6LDHA 1J20A 3ENKA 1UM9B 4G2TA 3HRHA 3RM3A 2PV7A 3PCXA 5DEOA 1T1EA 4O02B 5KOHB 1KVQA 3HCWA 3KFVA 3KZKA 3M2TA 1HRDA 3O2JA 4ND5A 2ZRDA 2WINI 3R7LA 1Q83A 3CR3C 3ELYA 2CUZA 3QM1A 2FG7C 1EKXA 3UJ6A 2WE8A 1Z4NA 3V8QA 2XCTB 5EJ8A 1XWFA 3W5HA 2BGKA 1XDBA 3HY3A 4BFCA 4C29A 4K2AA 4IF4A 4OGLA 3AF1A 1ECGA 1Z37A 1E5XA 5IKOA 1SWWA 1CDZA 5JAMA 4RQUA 4H60A 2J3QA 2HMVA 1YS1X 3DOEA 3ZH9B 3RD5A 3FYTA 3HZRA 1LLUA 1G4UR 2GEJA 4F2DA 4LC0A 1BQEA 4O4IF 1C9JA 3REGA 3S99A 2MMGA 5HP4A 3TIXB 3BD8A 4B3MB 2R3SA 3WIDA 4ANFA 2OBLA 3AZOA 2FW1A 2IS2A 2ZB3A 4ENSA 1VL8A 1CCWA 5A5EA 2BTOA 1Z5VA 3ZWNA 1IZ9A 4GYJA 3ZD6A 1PK9A 4XQEA 3IUJA 4I5IA 2FSVC 3H9JA 2X9LA 2QEQA 4FOTA 3SOZA 5HIMA 1E89A 3G2OA 5CNJA 1TUEA 1ZOIA 4MQBA 3IQXA 3CISA 4F5YA 2VBCA 2O59A 4C04A 2COEA 1MJHA 5EVJA 2YXDA 5CVDA 5DO9A 2BFBA 3BL8A 3E22A 3DYIA 1T43A 5HRCA 1ZL2A 1PGJA 1NDHA 5HKAA 2PMCA 4NULA 1BH2A 2BCGY 2LGJA 4K9DA 5AP9A 4CNBA 2Z4SA 1P44A 4WLVA 4L5BA 2ZWVA 4EY7A 3IGFA 3IMGA 4EKYA 5DSTA 5K0FA 3N7AA 5BN3B 1XLUA 5EJFA 3OPMA 3LUGA 5DI9A 4DCSA 3I4FA 3N8DA 4DUYB 3C8DA 3DTYA 4CM9D 3B6MA 3JTMA 4LYYA 4P35A 3IR7A 3VFDA 3PC7A 1U2DC 2VXYA 3IEXA 2NZ8A 3E8MA 1OKKA 3PBKA 2ZANA 3CRQA 4W6ZA 3OCZA 3B9PA 2GWHA 5EJGA 5LYJA 1U8AA 3ZV3A 2QYSA 1JIQA 4IVPA 4L8LA 2JW5A 2Z04A 4MRAA 3O2SB 2X42A 4HWKA 1E2KA 3CVUA 5DNCA 2FSFA 2I7VA 2VXOA 3TAUA 2CB0A 1S7CA 1Z7WA 2I29A 3SG0A 3E81A 3O47A 3E5MA 3WRYA 1RQLA 2QN6A 4N49A 3CJQA 1DHTA 2GEUA 3QH4A 5EP2A 2IUYA 1MTOA 3QNWA 3RRJA 2QMQA 4BZQA 3UAGA 1KXZA 2E3JA 3CX8A 3EDYA 2GDJA 3IPLA 3K0BA 5EZQA 5HIIA 4QUGA 1XLVA 3ZCPA 4ESVA 4U6SA 2OXTA 1GUFA 5AJVB 1V71A 3L84A 3AC0A 2WFAA 4KITB 4D3YA 3WYBA 1W4AA 1E8NA 1XZEA 1ZN8A 2MYUA 2WYVA 1J2UA 3CLVA 1G3UA 4HZUA 4L6IA 4RSGA 4YJ3B 1DOZA 4JI3B 2V6IA 2VNSA 4BO7A 3KSBC 2DZDA 2CL0X 3BMXA 4PPFA 1LQUA 3IP9A 4CKCB 2EGGA 3L0YA 1TQHA 3JD4A 4FXPA 3HUDA 5JATA 2NU8B 4WNCA 3TQSA 1IUKA 4ZOLA 2X1MA 1IY8A 1CNFA 1H2XA 3LY5A 5DE3A 3SYRA 4UTRA 2OCGA 2PGXA 3KDSE 3VZPA 1EWYA 1BU8A 5JSZB 4C0AC 2A9JA 4JUFA 2YWJA 2QNRA 3VX3A 1U90A 1RI3A 1R0CA 4GO1A 4QDOA 5E6UA 4OXQA 1LWOA 4K6OA 4X9XA 2VBIA 4X24A 5JAIA 1SOUA 1FS5A 2BGTA 2C2GA 2GSWA 2V97A 4TMYA 2X0EA 3F4BA 1W1IA 5H3LA 4ALLA 4CVNA 3DYVA 4QBTA 3GDWA 3RVMA 4X44A 1T29A 1DPFA 4JBXA 4BZXA 1TCVA 2RHBA 3MMXA 5IM4A 2AG5A 1QJ4A 1YOBA 3H3JA 4DV2B 4LISA 4B3XA 3P27A 4QZVA 2G25A 4FYYA 4WKPA 2NT3A 1PKXA 2R4TA 5D3KA 4NC9A 5IS2A 4QOEA 2J45A 1ABBA 4QFCA 2RHHA 4DLPA 1KP3A 2BONA 1D04A 4BFXA 5F3WB 1H0RA 5M7EA 5DOZA 1E2JA 2CHEA 5LQNA 2GWRA 1V8OA 3B6JA 2E89A 1OE0A 1TYBE 1XZQA 3D02A 3FIJA 3JZIA 4BKMA 5JAZA 2DKOA 4FOSA 4Y9TA 1P1IA 3GEMA 5I8PA 2HK8A 5LMZA 1LLFA 4LHEA 2QBYA 1B6RA 4NE7A 4PXSA 1ZR2A 4L2IA 2FW8A 2BCEA 4G07A 5CDFA 3JV7A 3KVNA 3WL8A 1PFUA 2HK6A 1UOEA 2RBKA 1I3CA 2XODA 3AQ4A 1JLLB 1E5DA 4EYEA 3T3MB 1G55A 3RABA 4B17A 3UVEA 4R1TA 1PIWA 3BB4A 2F1KA 4X3CA 4RZQA 1GPAA 1XHEA 2RDMA 3MC1A 1VZ2A 4OAPA 4Y2HA 5F21A 5MDHA 1ORWA 3PWKA 4Z0NA 2YVUA 1RM0A 2EKLA 2QTLA 3HBMA 4JR2A 1GFWA 4URVR 3LF1A 4FFLA 4RTOA 4F0JA 4IX9A 3RNLA 1FLNA 2A92A 3SIWA 3OTGA 3VX4A 3WADA 1DAOA 2IEGA 4JLVA 4Z7QB 3RNOA 5HKKA 5L3QB 4YLEA 3CURA 1QZ3A 5DU2A 3IL2A 2J32A 1JFVA 4X1OA 1FLDA 1INLA 3A3YA 4ECEA 3ZHVA 3T1VA 3WX0A 1T24A 1IY2A 1N0HA 3W8FA 2QTNA 3OIYA 3PQ8A 4HAVA 3WJ1A 5I9NA 4DWVA 4O5AA 1MT3A 3OPQA 2CNOA 4HDSA 4YAOA 4YMUA 2NTYC 2HNKA 4K7JA 4YCNA 3QEBZ 3KO8A 4CI0B 3DE5X 5DWVA 4F4UA 1KY5A 1YDMA 2BYTA 2QVCA 3H11B 3TOVA 4BNHA 4DMFA 5HR5A 4CKEA 4G1FA 4RZ3A 4D99A 2JGDA 1KJ9A 1M2OB 2Q5IA 2VP5A 3KJXA 5F78A 4LWZA 3BGDA 1B93A 1Z0SA 1B15A 2FTKE 1IDN1 1TGYA 2FP4A 3DKKA 4Q9NA 5JCJA 2IEYA 3KQUA 3G88A 5ISMA 3K0CC 3ES9A 4KC0A 4TYPA 4KH1A 5CLIA 3E1GA 1AUXA 3NOVA 1RWVA 1RYZA 2H2HA 3K4PA 2C2HA 3R7AA 5FWYA 1QHIA 2C5GA 3BXGA 3HHPA 4N8SA 1SQ5A 1CIPA 2HREA 3VO8A 2ZBVA 3HEBA 4TMFA 4CM9A 4FFVA 4L57A 5CVUA 3SI7A 3AKCA 5FNVB 3M4NA 1E5QA 1HE5A 4OQFA 1HE3A 1JDSA 2HRRA 3OF2A 3FRIA 4TKVA 1B23P 1R74A 1EVIA 3QOYA 2PX0A 2DE0X 3ZHCA 5EXTA 3UXEA 3I9NA 4RIGA 4EJSB 2J85A 5K8UA 1OY1A 3IB6A 4TUYF 3GBVA 2E55A 4NBWA 4WKCA 2ZSEA 2GRUA 1L4NA 2ZR7A 5GM2A 2D5AA 3F49S 4G0UA 5LZ2A 3C16C 3BMOB 2LDBA 1Z4LA 4K86A 1ARZA 2VAVA 4A73A 4BV2A 4KHPB 4OGKA 5EQFA 1Z0KA 3IS3A 2WU1A 2CNWA 3Q12A 5T6MA 1R9NA 1ZGJA 2ZT6A 3KCNA 1K8XB 5SZJA 3ANMA 4UM8B 2JFNA 1F1JA 4PYRA 5EHQA 1P91A 1T4CB 3PKJA 4H4CA 2B5WA 2PEYA 3THYA 1Z6PA 4R9SA 1E7QA 4C43A 2AQIA 5B57C 1JKFA 5LDGA 5A3SA 5JDCA 4I9HA 4TV9B 4BO8A 2JCXA 4GM0A 3U81A 2XDQA 3D2CA 1R5BA 5FV7A 4LDAA 3G0BA 5IMSA 1SCKA 4IFIA 3WHLA 2Y0EA 2KSQA 2XE4A 2DPMA 2I0FA 1JXOA 3DTVD 2QM7A 2ZUBA 4A27A 4GZLA 1NYLA 4KRYA 6YASA 1IDOA 1WRBA 4K3VA 2WHQA 1YTLA 4JVOA 4MV6A 2VSOA 2I8LA 4R81A 4W5TA 3X1KA 4Q4AA 1H5UA 3FFXA 2R8YA 4BQIA 2FQQA 1Z5OA 1Z6QA 3DZDA 1PDOA 1XPUA 3OQHA 4L72A 4PICA 3X44A 4FCTA 1K9SA 3LA8A 1TB4A 4A36A 4NMXB 1DJPA 3RVJA 1H6DA 2B61A 2DF8A 2GCGA 3EH1A 2WE7A 3F7OA 1AO0A 4X65B 1RYHA 4DARA 2HM7A 1PNOA 2AFRA 4QULA 3AY7A 3FNHA 3DLIA 4S0XA 4F1JA 3A4TA 1I0IA 1N0IA 3F6RA 3ICWA 3ON5A 1XJWA 2YYSA 4WVLA 1XVAA 5AH0A 2Y1LA 4FYPA 2IUSA 2UUBB 4HGYA 3KSDO 4LXYA 1WV0A 2D59A 3M9XA 2X5NA 4PINA 4U6NA 2OK8A 2G08A 1BIFA 4P7JA 1TT5A 5JNVA 1TADA 2JK1A 2YIMA 1W36D 4J0JA 5JQGA 1W85A 4J6EA 1U7ZA 3SLGA 1WB5A 1XMVA 3H99A 2A57A 2AEJA 3DOFA 4HDKA 2EWMA 1H93A 4BKQA 1CQJB 3N7UA 4QRIA 3LTEA 2PKEA 1VMIA 3BAZA 1SCAA 1SQFA 2MT9A 3L8YA 1OI3A 4K9NA 5D3QA 1T0PA 3VISA 1IWPB 3IIMA 4A8PA 2YJNA 2F3QA 3BZUA 3PC4A 4BKPA 4POOA 2UUCB 1WF6A 1LY1A 1XN4A 3FMVA 2Q07A 2VPTA 1I5EA 1KMHA 1Q77A 2RI6A 3L43A 1B3RA 3KQWA 4K5QA 4GL2A 3LW7A 2JFZA 3WNCA 4BMSA 5L9AA 6ABPA 2J31A 4TV9F 4UM5A 2CDAA 3HL4A 1YZGA 3J80A 2Z3WA 3SBOA 1ST3A 2R85A 4RMIA 4MQMA 5C8VA 3I6ZA 3HKEB 2IPLA 1HEIA 3Q9NA 3IERA 5BV8A 1ZESA 4U6QA 5K5EA 1WMBA 1GXSA 4CMEC 3ICVA 3L7DA 1QTIA 5KYWA 1D5WA 5CM2Z 2ALJA 2D8AA 4FDLA 4MVJA 3TZEA 3AU8A 4E5YA 1FBTA 2QN3A 2WTEA 1EGQA 1SCNE 4OMUA 4PYOA 1DAEA 4KWTA 2B92A 4U2GA 1P19A 1GJRA 1ZIXA 4ODIA 3OQMA 4RPGA 4X7RA 3ZCUA 3R3YA 4HF7A 3PEEA 3HUFA 5F7JA 3WGYA 3CEPB 1KC1A 3A14A 3COSA 4ZJPA 4GR9A 3KEGA 4KGZA 5IKXA 1N1MA 1N5RA 1GG9A 1KU0A 1Y5NA 1UBCA 2KBEA 4HX9A 4GRIA 2YIVX 4K6FA 5FUWA 1GU1A 4F21A 4HYEA 4C1NA 5KOYA 5ALUA 4MQ4A 1NG1A 5JNLA 2P4SA 4FOOA 1DO0A 4A2PA 2ID4A 1JN0A 2PD4A 2YBEA 1FJHA 1T0UA 1QBGA 4BVKA 1N2EA 2DP4E 2GLXA 1C9YA 1ZH0A 2WA1A 1VIMA 2JFBA 5FPKA 3JD3A 2YTZA 3KRTA 1UJMA 2QD5A 4M7WA 2UVQA 1EZZA 4LZJA 4FVTA 4EY4A 1W0KD 4MR9B 5BYKA 4LYJA 4MVJF 2D6FA 3O8BA 3OPYB 2BTQA 1DCMA 1ODJA 2EJBA 4QDKA 4X60A 2Q5LA 3K0AB 3D7SA 4PHFA 1NVAA 2WSIA 5EP3A 5CFMA 4NZPA 4PLGA 3V8RA 1UC4B 2C96A 3WYNA 4ZCRA 3ZHBA 2HWWA 3GOHA 2ZRNA 3P8ZA 1W75A 1II8B 3JYPA 1LH0A 3DR5A 3K2EA 1E0DA 2TSYB 3KLMX 4ZAYA 1NF3A 1UMDA 3FCAA 1MAHA 4E12A 1BMDA 1ZO8A 2Z2ZA 2JJ2A 3D4LA 1GLVA 3C0KA 1ADCA 2X7JA 4PQGA 3TQTA 2JCBA 2JLCA 3D4PA 2FPUA 3JWEA 4CW7A 3R9XA 4CMCA 4N9WA 3H97A 4AAYA 2W8BB 5JI3E 3AKYA 1XRLA 2RK6A 3CTMA 3ZDBA 2CDNA 3A0UA 1FX0B 4EHFA 3HM9A 2BTEA 2J0QA 5JSUA 3WJ7A 2B83A 4XTRA 2FDXA 3GN2A 3CUEF 1CUBA 1F51E 2CYAA 3FNBA 1KP2A 1XR3A 4A0FA 3PQ3A 3VRHA 1F4LA 1ZOSA 3OZEA 1AE1A 5LP6F 1JT9A 2JGAA 2QMEA 1GTRA 4J0KA 3KB6A 3IKTA 1T9KA 1PZFA 1XVUA 2NWQA 2Y92A 1IZ0A 4XUEA 3PGMA 2R2AA 4JI2B 1GNVA 3GFGA 4UPVA 1KO4A 1UBKS 3GV0A 3FDFA 2Q9CA 5ILOA 4UW9A 4DLUA 3REQB 2OAGA 5KQMA 2IWHA 2OSVA 4KQMA 5CYPA 2WHPA 3PNLA 1UP4A 1K7FB 2YOHA 3BB3A 2QI9C 1A4IA 2Q7XA 4GLBA 1PJTA 4WUTA 4GPTA 1WIWA 4U2EA 1DO8A 5IKMA 4MWOA 4YCCA 4JT9A 1OTHA 3GPCA 4ZXFA 4DJFC 1AC5A 4C0HA 4ADSG 4DG8A 1DBRA 3R40A 4UEWA 1L5HB 1I0LA 1VIYA 3OTOB 1A7AA 4FEYA 4NS1A 2OP1A 4D3XA 4C30A 3RSGA 3Q8WA 1CJMA 4N8EA 5I9TA 3GH3A 4JL8A 3RHSA 1X1CA 3FM9A 1NLUA 1VECA 3L0PA 2O8BB 1KZYC 2RFLA 4BLTA 4TMTA 1KEEB 3NVMB 4XYBA 3HFJA 4FILA 1ZMBA 1FE8A 3U3KA 4ZQBA 5KQRA 2AG1A 4UUNA 3OURA 4HXYA 1C1DB 4QXAA 1W87A 3DXYA 4X91A 2I9KA 4Y6RA 3T3DA 1HRKA 4M60A 4C5AA 5TSDA 4BNTA 4OHYA 2EW1A 3C5HA 2PZMA 3R2JA 1ZUHA 3T5MA 3CX7A 3VU8A 3TSOA 1HNZB 3RUPA 2BFWA 2O7QA 3ZWMA 4E5DA 1P4RA 3UO8B 4EF4A 1WXIA 1PN3A 2AFHA 1DTEA 5IDVA 3LQQA 1DJOA 2FEWB 3NEYA 1IBKB 4HH0A 2XTMA 3M6UA 1DQNA 1O58A 4EJFA 3RSZA 4DQLA 1S4QA 2GASA 4FNOA 1J8QA 1IOWA 2WUVA 5KNDD 2C3YA 4MHTA 3ENZA 5EXSA 3SR0A 1XQ6A 4MITA 2QD4A 3GWGA 3KYDB 3OI7A 4INPA 2FETA 4QHYA 1U3VA 5H16A 2QW1A 1OYOA 4TTVA 2D1QA 3IALA 1GM5A 3U9TA 4QPDA 1J33A 1ZM7A 2P2NA 3JQQA 1YAJA 5SZKB 4E30A 4FFWA 4NDNE 4DSNA 1UMCB 4RYLA 2EWVA 2JAXA 5AM2A 3K0HA 3LECA 3ZHTA 2BHLA 3HB1A 3JVVA 3GEIA 3FLAA 3AR5A 3EDMA 5BV2P 2X0RA 2BR4A 3OQIB 4ZT6A 2W2TA 5AW3A 1P8JA 3RHTA 1GUYA 3N53A 4IR7A 5DNAA 4GVXA 1HXHA 2D62A 2GN9A 4EMBA 4PFSA 4OP2A 4MMZB 1E5LA 2RJNA 2QVYX 1XU9A 4QDXA 2Z8ZA 4E1BA 3E9MA 2R11A 3ABOB 3C4JA 3SJUA 4EGJA 3UMVA 2O14A 1Z26A 3BFPA 4IJ6A 2XYVA 2QJTA 4J3JA 5G3YA 4CQLB 3QUTA 2P91A 2PKRA 1G42A 4LBWA 4CM3A 1N6RA 1HQKA 2XUIA 3AESB 3GGGA 1HDOA 3H2KA 3G2HA 1P75A 4Q39A 2X7HA 4YI3A 3VPFA 3ZTYA 1VHQA 3ZDCA 3G2QA 2XRYA 3R0QA 2EOAA 4GC5A 5JSKA 3RAEC 3NYQA 2GHIA 1HE1C 2Q7OE 5I7SA 1N7GA 1RFGE 4FGWA 3I04M 3KALA 4UNIA 3O31A 3O2NA 2BI8A 4HFNA 2DWCA 4QOJA 5AHKA 3EMDA 3SD7A 3UAYA 3V2UA 2PQMA 2O4CA 3F74A 1BDHA 1CVIA 2ZB7A 1TCBA 4QC2A 1PR1A 3G0OA 3TLKA 5HVNA 3VR5D 4B1FA 4V0MA 3V7UA 1MGPA 4ZYXA 4BCDA 4MGYR 1DO2A 5LBUA 2QM3A 1GZ3A 3DKRA 1JW9B 3M9LA 4BZPA 5KOJB 4N0PA 1YRBA 2X9NA 3KXIA 3PNMA 5FL7D 2DLDA 2NN3C 4GZ6A 4XD2A 3AEZA 5DNVA 4F2GA 4HO1X 4BGEA 1VA4A 1XVLA 3C5VA 2EL7A 1XMPA 4LXUA 3K1YA 1G8JA 3RVKA 3K8QA 5A0VA 4ESHA 1YR9A 1RLMA 2V3VA 5ALSA 1KHTA 2ZJBA 3AEQA 2ODPA 4UCQA 1RPZA 3KEFA 4DM4A 1PQWA 5HRAA 4HR7A 1ZA2A 1IEXA 1X3LA 4RCVA 4REOA 2XUKA 1SUFA 3V48A 2GKGA 1OTXA 4ZJZA 3MHPA 4M36A 4JENA 3INNA 2GHQA 2HAEA 2FH5B 3ESQA 3JATB 4JP5A 4YT8A 3RROA 4YMVA 2IF0A 1S1MA 2EFGA 5IJAA 4RK5A 4V0KA 2OAEA 4PHTA 4DJAA 1MB0A 4MQEA 3VPSA 2DWOA 1NLZA 3HA2A 4YJ2A 3HU3A 4C4OA 4C4YA 3FUXA 1YOVB 2NGRA 2WF8A 2DQKA 5UKDA 3WYAA 4F60A 1UKEA 5IG2A 2FNAA 3TEJA 1UFOA 4UEJA 4BOYA 5KDOA 5DHFA 5DXAA 2WV9A 2R62A 2C9CA 3STYA 3VC2A 1AZWA 3ZWBA 4BN4A 4WZBA 3W77A 3D6UA 4DQUA 2R44A 1L5SA 1E9VA 1JQJC 1RJFA 4NBUA 4R71A 3EOBI 3N8KA 3VTKA 4OQNA 3G8DA 4QPCA 2BHSA 4DN6A 1P4SA 2AZMA 4LGCA 2IRWA 3FKSD 1N25A 3BXEA 2B4RO 3UC5A 2BSXA 1EK5A 3GFTA 4ESEA 2PKCA 3GJ6A 2ZM5A 1KFKB 2FWNA 3BQMB 1CF4A 1RHQA 2KW5A 4HUQB 1NBOA 2X0IA 1ECJA 1F6BA 1XDZA 3MELA 4KIJA 4NG4A 5J59A 1X7ZB 2H7CA 4OK5A 2J07A 2OXEA 2PRZA 1F0PA 1KMMA 3C8MA 4EBBA 3HFSA 2IX9A 2JLYA 1C14A 3GNSA 1QGYA 2GPAA 2HD4A 2X22A 1FSFA 4I08A 3GNLA 5KZMB 1WSWA 1PD1A 3DVAA 1NQ5A 1Y7TA 1KPIA 2X0KA 4X45A 2VT7A 4IW3B 1Z2DA 5CB4B 2LXNA 3F47A 5EGSA 2PQ6A 2VJOA 3LC7O 1NXOA 4HN4B 4K2HA 4RL6A 4B44A 2HO5A 1AXGA 1O9BA 2EKPA 1DS6A 2EP5A 2WC1A 4RVHA 4N7BA 3CVYA 3BE8A 1RAEA 3EMVA 3JS5A 2Q1WA 3X1DA 4URFA 3PI6A 5ENDA 4L8YA 1M10A 4PS0A 1XO1A 2FPXA 4DQ0A 1ZFNA 1U98A 2C5BA 1JR4A 1SBNE 4FGJA 2P2LA 4G0QA 2JEOA 2HF7A 4JHXA 2XKKA 2V1XA 5LOVA 3FTQA 2PGJA 4ZPXA 2DECA 3L8HA 2XNJA 3FF4A 4MUJA 1C4WA 3HN6A 3GPLA 2H16A 1EFVA 1QGDA 2XIQA 3AKEA 3NBYC 4F9GA 5L7WA 4QBFA 4YAWA 2J3HA 1L7AA 3FUVA 1UBFA 1QU2A 3FKSA 3LX5A 3OJCA 2V7BA 4HLUC 3QE2A 4Y6LA 3WGGA 2BKLA 2EKDA 2VUIB 3ZCTA 3SHQA 6AT1A 2ZJAA 2I33A 1GNQA 3AVOA 4PHCA 3T9CA 2Q49A 1VLMA 2Y4NA 1U6IA 1ZRHA 2XRMA 3T38A 1HORA 1C41A 5B3JC 4Z8XA 1E1QD 1CB0A 3PNKA 5AXDA 3U60B 3U39A 3KAPA 2VRCA 1VCMA 2JH9A 4DPLA 2PFSA 3NT5A 1E9EA 2IUFA 1Z0AA 1ZOLA 4TKUB 5DLEA 2AD1A 3W9BA 3NHKA 1LDYA 4BVFA 2XGMA 1NSFA 1JJIA 1VE9A 1WOYA 2FPGA 2AYYA 2HSJA 2JD1A 1Q2UA 1DX4A 2OUIA 1JQEA 2YUIA 3DB1A 4M98A 4ZOLB 4OM7A 3ULKA 1IYZA 3H8JA 3I9OA 1K68A 2YVKA 4D43A 4YRMA 1E7YA 1MQ9A 3K9WA 4FUTA 1E20A 4C0BA 5I7OA 4R9UC 1UXHA 1L4EA 5FFMA 4B85A 2VHJA 4I55B 4D2IA 1VLQA 3TRIA 1BCSA 5CBPA 1XNGA 1FP2A 2XCLA 4XRGA 1QNLA 1QYRA 1AKEA 3WFIA 1R0RE 4MUFA 1KJ8A 1RWQA 2IYWA 2VYCA 4NDAA 2I34A 1BN6A 3CX6A 4R8LA 3WL6A 4QODA 4XX1A 1Q0PA 1ODSA 2OSBA 3OQOA 3C6MA 2Z3ZA 2O5CA 3OOSA 3LP5A 2QL6A 1KEVA 3ELUA 3MT7A 3RU9A 5AW4A 4JXXA 2PSDA 3JQ9C 1CE8A 1ONOA 1KSJA 4QSHA 1F5NA 4BKUA 1U3GA 2G1KA 2YFHA 1UKCA 3OOWA 1RE0A 4E11A 1QG4A 1G5RA 4GXTA 3F3YA 5JG7A 3SIRA 1HYEA 1Z4QA 2YMQA 2I6FA 3MWKA 5KSPA 2DETA 4JI7B 2W6JA 5ICCA 1QF6A 2J67A 3QX7A 4TMWA 3DZJA 4CF4A 5IC4A 1ZW1A 1O94A 3U4CA 3Q3EA 4KXVA 2VT3A 4EFDA 5MFZA 4BL5A 3U4GA 1VFNA 3LX6A 1ZNYA 4NS4A 3VAZA 4KO1S 3TINA 4KDFA 1JLLA 2FZLA 2IXAA 3ESRA 3LCCA 3QVLA 2BEUA 4R2WA 1TW2A 1U0RA 3E15A 4A6EA 4B6QA 1BKDR 2QA5A 1YZFA 2ZI6A 3EWNA 2BM8A 4B6JA 5I01A 1YBVA 2R8RA 3CBGA 3RQIA 2Q3CA 5E8JA 2H1RA 3B1JA 3BMCB 1ZHHA 2ZUSA 1ZGBA 3OWXA 1CJUC 2QSJA 4JLBA 4M9CA 3I9FA 3OLXA 5F98A 1WETA 2FMHA 3M6FA 2NU7B 5KVQA 4OEHA 4EDHA 1RXWA 3R4CA 2YHBA 4Z4GA 4BC0A 4TYQA 1TDJA 4E08A 1RLOA 1OB5A 3ZU2A 4EHIA 3DFZA 3AEYA 3GFRA 1GEEA 2CLEB 2QRHA 3SZRA 5A5GA 8AT1A 2CV0A 2V65A 2G17A 3U6KA 1N8SA 121PA 1EVKA 1MRSA 4Z9YA 1EEHA 4PR3A 1JFTA 2V9CA 3G7UA 1II9A 4AP9A 2NPIA 5B64A 3GVXA 1J00A 4KPEC 1PZXA 4UJ5A 3SS9X 5G1PA 1NQXA 2Q1SA 1L4KA 1B4DA 4MRSA 4MWEA 3SIPA 4L8GA 2DBYA 2PV0A 2V4MA 1O6ZA 2GN0A 1PVVA 1L2TA 2GK7A 2DC1A 3R23A 4LJ5A 4I5FA 4BAUA 1IBLB 1O03A 4DR6B 4FHFA 3M1IA 1PFKA 4D26A 4FYWA 3PUXA 4RENA 1KBOA 5EHXA 3OTWA 1P9NA 3DWEX 1YNOA 3UTDA 4EB6A 4EJSC 4PG6A 3GJQA 3OU6A 3B7GA 4BWYA 2OGSA 2Z5GA 4F8JA 2QGNA 3GLFE 1AK1A 2OO5C 4RSMA 1CS0A 1H5QA 1E1KA 1AQJA 3C3KA 3ZE0B 1XVIA 3MA0A 3SHVA 2EBFX 2A9RA 3PU6A 1OZAA 2RJ3A 2J3MA 2V5AA 4ARUA 1AJEA 2NTNA 3B6IA 3QG1A 2REBA 4U00A 3VR6H 1U02A 2VJBA 3CUUA 3WLSA 5B55A 2ID8A 4GBJA 4TUYA 5LQJA 2IS4A 1EFLA 3I9KA 3I2HA 2A30A 3MJDA 3O73A 4YFYA 3ZU4A 2UYHA 4M0DA 2BI7A 4ZVSA 1NOIA 4WKNA 3CLKA 3EC7A 1N0WA 2A67A 2B78A 2QRGA 1QKIA 4NVRA 3K2IA 3NI2A 3T12A 9LDBA 4CPDA 4G01B 1XZIA 4GM1A 1VKRA 3VR3A 3UN1A 4ETMA 3TKLA 2XQJA 3HDJA 3ZTWA 2QBYB 2I1WA 2R84A 1PQPA 5KOJA 4QRDA 4MKGA 5DK6A 4UASA 4N47A 2V6BA 3L6RA 2R7MA 4HLDA 3E9NA 4TTPA 5DHRA 3GLTA 5DH9A 2O20A 4EVSA 4FDVA 4DYVA 2IHTA 3GFVA 1PGOA 3RTEA 4W5RA 2BRUA 1E3LA 3TLEA 3TCNA 2GZAA 4FBLA 1AD2A 1GTMA 4I1UA 1JHYA 2QZ4A 3WLIA 1N2BA 3ZY6A 3O2QB 1DL5A 3A6DA 4RJLA 1JUDA 2EYUA 5C35A 4MGIR 3CY6A 2GCOA 4FC7A 4K3UA 4RGQA 3RAFC 3HP7A 1WAMA 1RXSA 1SUPA 2J5KA 4WA7A 5ALLA 3BJEA 4HGOA 4AF8A 2F2TA 3A6EA 3H6KA 4H1VA 4AN1A 1BE8A 1M1YB 3FCEA 1GGMA 4AKTA 4D8XA 2BRUC 3PGXA 4EJ0A 2D4AA 3PFCA 3N0VA 2I3DA 3H9EO 4YV2A 8ABPA 4GGPA 5IHPA 2J87A 4UPDA 2RD2A 4GXNA 4MQFA 2BDTA 3IT3A 5JFOA 4UEOA 3HKBA 4ND8A 4DDVA 4DT1B 1P1HA 2OBFA 2XUHA 3EBLA 4Y2JA 2QUHA 5CFPA 4XH9B 4WK6A 3B89A 5KNBA 5TRTA 4IMPA 4UNNA 4DLRA 3QITA 1ENYA 3JRXA 1OT5A 2X6RA 1YKFA 1I9GA 3CINA 4HDNB 2YWEA 5EC8A 3C7TA 3DXFA 4B4DA 1NY6A 1P1JA 1WU7A 1J0CA 3FSGA 5I7VA 2ZRAA 3H84A 3L02A 4O08A 5H4GA 3GA0A 2O8FB 5CX1B 1L5RA 1X7DA 3QENA 3D81A 1O96B 1R0YA 1UJ4A 4IZ6A 5IFLA 3U09A 4ZC8A 3NT2A 5GGXA 4KIFA 1RP7A 4EUEA 2IXBA 3IIJA 5EJ6A 1HTTA 2RHRA 2ENWA 1ECFA 1O94C 2OE2A 4R68A 1ZMRA 1GZHB 4K9OA 3UK2A 4XFKA 3MT8A 2O3SA 3COYA 3NAMA 4EX7A 5AI9A 3BCHA 1AHHA 4G4SP 3UFXB 1VKOA 3CLRD 3WKDA 5ITSA 1IE3A 2FW0A 2Z8YM 4IRUB 4D9KA 2GOYA 4FFRA 1QOZA 2E18A 1Z18A 1VCIA 2YJ4A 1XG5A 2Y6UA 3GHYA 3NBMA 5CAEB 5CLFA 5JVDF 4DLVA 2NVUA 3WGZA 3KKNA 4MA0A 3R5KA 3U7QB 3TLBA 3UH0A 1YZHA 3WLLA 3FOBA 3C24A 4NH4A 2OHJA 1Q7GA 2ZI7A 4X8OA 1NWHA 3ZNOA 4FJ1A 1Y7LA 1Z4MA 1XD2A 5I7RA 3FAKA 1PT5A 3RIHA 3T1YB 2JGFA 2HXYA 1BMTA 5T3YA 2WIGA 4UD6A 1LPNA 3P52A 4ZO6A 2GXQA 3GBSA 2JARA 3GT4A 4FMDF 4OFWA 2QP3A 5KAMA 3AGPA 4MRMB 3JR3A 4WOBA 4UTZA 5EINA 1JYSA 1N3LA 4YMIA 1KY2A 3Q3CA 2H9IA 5EWLA 2WWHA 4Q82A 3W78A 4CLOA 2OZEA 3NRBA 1UJBA 1K5PA 3OE7A 3D7LA 1P18A 3BKXA 1Y3BE 3MCWA 5LR6A 1AZTA 4QPPA 5BYBA 5FA6A 3QA3E 2OMKA 4Q4CA 2V7VA 5JCJD 4EHBA 2I91A 4FWTA 2GJKA 4IBOA 2ZVDA 4BJ3A 1E4OA 4IIFA 4LVNA 3JVDA 5TMBA 1N4AA 3UMYA 1XZKA 4KYVA 4U02A 1SCUA 5A7FA 1LQ2A 4EWLA 3D4NA 5BSRA 1THTA 4XA8A 4JL6A 3OJOA 1I8TA 1VFPA 3FCYA 1Y42X 1DAKA 3AUXA 4YALA 3QF4B 4WJKB 3NEJA 1G2OA 2BP7A 2RCNA 4R8RA 5CUQA 3I0MA 1HL7A 3JARA 3K4QA 3VNQA 2CL6X 4IYJA 3EFEA 1MU0A 1P1RA 1SC4A 1I30A 2A14A 2NXCA 3A9SA 3EQ2A 3FJOA 4Z9XA 2IWRA 4BGUA 3EVZA 4CGZA 1YA4A 5BMVB 5AVQA 1ES9A 1RJEA 4GR5A 1UFKA 5KTPA 3KLNA 2VJNA 4NV0A 2IYOA 1SNYA 3SCZA 1OGJA 1RKVA 3QXHA 4D57A 4Q9DA 1HDXA 3SYTA 1QH1B 3CSDA 2A5JA 1ULZA 1CJBA 2CFOA 4EW6A 3V1LA 2LVBA 3HJUA 5AJZA 5ESDA 3FN4A 2PH1A 3HVJA 2VK1A 3MFQA 1CRPA 3C3AA 5HE9A 3LBIA 3SYMA 5IWAB 4PNEA 1PZHA 1GKYA 2JCSA 3LLMA 4KIUA 5TR9A 1P9OA 5A9TA 4F9EA 3T1HB 3TVDA 4KN8A 4HQFA 1YTUA 4EM6A 1CW2B 2RHGB 4LZLA 3VHXA 3EJ6A 4F4HA 1XHLA 4YMTA 3UKOA 4KNYA 4C05A 2MSWA 3ZYCA 1KMQA 5JJKA 1V95A 1UXIA 3IP8A 3HU2A 1OVMA 3V1TC 1BU5A 4Q3LA 3B3JA 2VPWA 1LUAA 3AJDA 3VPGA 3KSAC 2JAUA 1QYWA 1SQ6A 1XKLA 2IEBA 2Q8NA 1QGED 1S3FA 1Y4DE 2VWHA 2ZR9A 3GFFA 4II2A 2DEUA 4O0MA 1QIEA 4GT1A 3U7GA 2QD3A 4JSRA 5FYDA 1JEQB 3TE6A 4EB0A 2O0HA 1EYZA 2YNMA 4XOUA 5DLYA 1G41A 1SIOA 2ASVA 3QWIA 1EGHA 3MXOA 4GAEA 3QV2A 4UFNA 2AD5A 5FOXA 5KYUA 3B51X 2AHOA 2CV2A 3VNRA 1R6UA 1NJSA 2W8ZA 1BJKA 4L0DA 5H9WA 4MW9A 3C7CB 4PC1A 1EDEA 4V2IA 4IQ0A 5SYAA 3VSEA 3NQ41 5I9LA 3TSYA 4AJIA 4B7UA 2G1PA 1RMYA 1YA8A 2FZVA 5F5XA 1CUXA 1G7CA 2WVJA 4M89A 2E4VA 4X94A 4AX4A 1IAVA 2QTGA 2R48A 3BHIA 1UZNA 1EXMA 4RA9A 4MV5A 4V39A 4BNVA 4IH4A 3CZAA 2LCQA 1APBA 1P5HA 3HC7A 4DTIA 2IIQA 3RIXA 1WSBA 3F3SA 3II6X 5KYVA 4AO6A 3GLIB 1IZZA 2B1IA 2WUDA 4MQLA 1SPXA 5HRUA 1E2UA 4MW6A 1GRCA 2RHCA 3NVAA 2BGWA 1NOKA 2CVFA 3LOQA 4L4SA 4ZYUA 1QQBA 1IQRA 1ZN9A 4L85A 4PC2A 5C8YA 1AGXA 1MIHA 2R7KA 2VVTA 2OO7A 1TTHA 4GMKA 1DT5A 2QMUA 2G06A 2XHEA 2BFAA 4FSXA 4ZT3A 3LXXA 1D2HA 3FRHA 4INZA 4D8TA 3EAQA 3M6LA 4LHYA 3T7JA 1QU3A 2I6SA 2H7VA 1I6MA 3VR5H 4YX9A 1Z2CA 2FZGA 2JFQA 4UBKA 3KZCA 4IDOA 4XJTA 2WZBA 3ZGNA 4MHSA 1PWZA 1Y9EA 1XJQA 4HNUA 3GPDG 1EUDB 2ZWAA 3QPCA 3G8YA 4IWNA 1VG1A 4OQEA 3BJIC 1WLYA 2IH4A 2WY2D 3PFNA 4JUDX 2W4QA 5AUNB 3H2YA 2BH2A 1B7GO 3LMKA 1MX5A 4RH0A 1YACA 3JQAB 2AXPA 4I4NA 1G19A 2XWPA 1WBDA 1L7XA 3A0RB 5H68A 2XQVA 3D2LA 4EZBA 3PDIB 2B2CA 2BKEA 3F6YA 5IUKC 4EEKA 5KNLA 3T1NA 3PEFA 3MGBA 5IT4A 3VNAA 2O8DA 5HIJA 2XUGA 3L2OB 4PYNA 4EEXA 3H4MA 3QU7A 3D1VA 2C8VA 2XBLA 3NIFB 1I4EB 3QVKA 4MPDA 2V0CA 5FD8A 3SKYA 3ZXYA 3HBJA 2CXHA 4DMUB 1NVEA 1EMDA 1Y8RB 1THGA 2C2OA 3AR3A 4ZREA 5FCDA 3E8XA 4CEIB 2AQ8A 3LVQE 3ZDZB 1R0ZA 1RZRA 3CVXA 3U13A 5FHQA 4EITA 1EM8A 3CR7A 1D6JA 2CMDA 1C0LA 3IV7A 4Y7CA 3RC2A 1A3CA 1QYCA 4MHOA 5L8VA 2A1TR 2ZZKA 4CF5A 1EGAA 1ZCFA 3IOMA 5DTEA 2WJZB 1PZGA 1SVWA 1X0XA 2JAOA 2HO4A 4WIAA 3IBGA 4MUNA 1A2KC 1P6UA 3QJGA 4D4GA 3I2JA 1KMCA 4FW8A 3LKVA 5EJ2A 3NNSA 1IBRA 2BD0A 3G13A 3A9CA 1DKMA 1W96A 1KK0A 1ZP6A 4MJ7A 1SVKA 3M5PA 4ZVQA 4DSZA 1XIVA 3MJVA 1C8BA 2J3DA 5FPYA 3FCSB 1U5BA 3MVEA 1BKSB 1YZKA 3T7RA 1EQAA 3H86A 3PFGA 1C0KA 2ZBUA 4JI0B 1GQYA 4ID3A 4P3NA 1PW7A 2FW9A 3B2EA 2HY7A 4NIMA 3FE2A 4EG0A 4HEHA 1Y34E 2PNJA 2Z58A 4Z4CA 3IXQA 3FBWA 4DT1A 1BDIA 1ADYA 2FW6A 3AKDA 3GEBA 3ODGA 2QRQA 3P9YA 1QP4A 1Q2XA 4YO7A 4B3JA 2GRAA 3EUEA 1RZ3A 1GQOA 4LF4B 1ISMA 2YOGA 3Q3VA 1QIDA 5CFNA 4AQYB 5H9VA 3UWPA 3OEEA 5D6NA 3LK7A 3HE3A 2FRDA 3HU5A 4NQRA 3K73O 1J25A 3KKOA 4EEZA 3BULA 1CUGA 1I1QB 1K92A 1VYVA 2R47A 2ZI5A 3VC3A 4AM8A 4BZZA 4AY2A 5GGYA 1SBTA 1IB6A 1JSLA 4JIGA 1KZHA 1BA3A 1E6UA 4JP3A 2ZCJA 1BVYF 2F1HA 4ZAVA 1KQGA 3NNDA 1U81A 1DG9A 4Z9FA 5A9SB 5B6JA 1XRJA 5IJ9A 2DWPA 2V03A 3IAXA 3P2MA 1XEXA 1VZ3A 1JPNA 3HV2A 1WMFA 3OMWA 1PUJA 3BGSA 1GVNB 5JXHA 2P75A 3JYHA 3CA8A 4NFSA 2HXSA 3CFYA 1DIOB 2C2XA 4KK3A 1ZXBA 1QV6A 3RKSA 4MS1A 4JOBA 4CLDA 5FB3A 1NW4A 4B3TB 4RC9A 3LG2A 2XAAA 3M49A 4GOOD 1H1DA 1WCV1 3MZ0A 3U2QA 1FP1D 2W6ZA 3O0TA 1JWBB 3GU3A 3R3XA 4M54A 3BWMA 4S1NA 3T1OA 2ZSJA 4WOKA 1T2UA 3I01M 4J0EA 5IUJC 3QF7A 5CMLA 2QLNA 3F90A 3L1IA 5CH5A 5JYEA 4CQNA 2HCJB 1T1RA 2O06A 5FH9A 2ZRGA 3TQFA 3ZV4A 3TWOA 4F04A 3E58A 4PC6A 1P31A 3ERCA 1K4KA 3BRQA 4MQ5A 1WWKA 3KOUA 1Z5WA 2A0FA 1DC6A 3DMFA 3E2IA 3L92A 4KVGA 2WSLA 3HEMA 1X1SA 2Q0QA 2ZRHA 2EZ4A 2D2IA 2V98A 4XXHA 3UB2A 4BVEA 1EX9A 1LRJA 4W5JA 5EMMA 4TTRA 4BQQA 5JMWA 1Z8HA 3KOYA 3VYSB 3PIRA 5IULC 1HE8B 4GMDA 1HK7A 5IBQA 1M76A 2PH3A 3RV3A 3AWIA 4BTEA 1C4XA 1TM3E 4PF1A 4D9GA 2QVXX 4U0KA 4URZR 1GCOA 4RDIA 1GQFA 2ZIXA 1NXPA 4BNXA 2AMYA 4D9FA 3QKIA 3UMJA 1K7XB 3LIPA 2UYCA 3H87A 1UBRS