1XQYA

Crystal structure of f1-mutant s105a complex with pro-leu-gly-gly
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
290
structure length
290
Chain Sequence
ECIENYAKVNGIYIYYKLCKAPEEKAKLMTMHGGPGMSHDYLLSLRDMTKEGITVLFYDQFGCGRSEEPDQSKFTIDYGVEEAEALRSKLFGNEKVFLMGSAYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELPAKYRDAIKKYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDITDKISAIKIPTLITVGEYDEVTPNVARVIHEKIAGSELHVFRDCSHLTMWEDREGYNKLLSDFILKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray snapshots of peptide processing in mutants of tricorn-interacting factor F1 from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase
molecule keywords Proline iminopeptidase
total genus 88
structure length 290
sequence length 290
ec nomenclature ec 3.4.11.5: Prolyl aminopeptidase.
pdb deposition date 2004-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12146 Hydrolase_4 Serine aminopeptidase, S33
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1xqyA00
2W6CX 1IUNA 2OCGA 5HK9A 4X95A 5ALNA 3D2AA 3H2KA 5ALSA 2VT7A 5HFNA 5AIBA 2WIGA 1WB6A 5FPQA 5CXUA 5AM1A 2WG1A 5BWBA 4LYEA 4Q82A 4Y2QA 4G8DA 1XZJA 1DQZA 1ORVA 5FRDA 4N5HX 1C7JA 1JT2A 4WDQA 2C5FA 4LXIA 1QLWA 4ARBA 1F0NA 1BN7A 2WJ3A 1Q0RA 3W06A 4Y2RA 3STVA 3VXKA 4FMPA 4I4CA 4EY4A 4H7JA 2WQZA 4DMCA 3D2CA 5KWJA 3I6ZA 5CBKA 4DSZA 3ESCA 4ETWA 3QPDA 4BE4A 1QIEA 3O4JA 2WFZA 4X91A 3S2ZA 4JNCA 4UBOA 3R3UA 3H0CA 4CG3A 2RHTA 3QMMA 1VA4A 4JH0A 1CFJA 2RIPA 2ZJ7A 4AZ0A 3BDVA 4Y2JA 4AB1A 2OCLA 2HRQA 2WUDA 3DYVA 2WU3A 1CUJA 2V9ZA 1CUUA 3TGLA 7YASA 3QZUA 1O6GA 3IVMA 4NVRA 5LKRA 4BZZA 4EUSA 1VXOA 3V1NA 1N5RA 1H2XA 2PSHA 2WFMA 4UBKA 3ZPXA 1XZGA 4FBMA 4I19A 1VE7A 1WPRA 1GPKA 2DHEA 1GGVA 3P2MA 2XUOA 3AJAA 2HU7A 3CN7A 1ZGBA 1MPXA 2VAXA 3AIMA 5IH7A 3LIPA 5CT8A 5ALRA 1XRNA 3QPAA 2C0PA 5FP0A 5K3AA 2XMRA 2E3JA 5C81A 4BRSA 1QE3A 1Y7HA 5ALYA 2QS9A 2GBCA 2GZRA 4IH1A 4X3CA 2WJ6A 4RE5A 1T2NA 4BATA 3BJRA 1UKBA 4KRYA 4UFOA 1H22A 3IUJA 5AK4A 1ODSA 4NS4A 4L3WA 1JJBA 1XQYA 3W05A 1G5FA 1CUHA 4BP8A 3ZLTA 1CQZA 3O95A 1LPOA 3RLIA 1XKLA 2Z5GA 3O9VA 1YS1X 3VDXA 5HF5A 2HA6A 1CR6A 4KE9A 2XT0A 3KXPA 2HFJA 3RK4A 4JEIA 5CH5A 3WKDA 4FHZA 2HA3A 4KYVA 4BAZA 5HF6A 5AICA 4BDSA 1AZWA 5ALDA 1SCQA 1E8DA 1UKCA 2AJDA 1DT3A 4JYPA 3ICVA 3FLAA 4H35A 3WIBA 1BN6A 4HVTA 4KAFA 2OQIA 5ALHA 2VQ6A 4X7BA 4UFNA 4WJLA 5DTIA 3H2JA 1ZI6A 2Z8XA 4B9AA 3HC7A 3I2FA 3QMVA 3FYTA 2H7XA 3WK4A 4ZREA 3WKCA 3RARA 5K3DA 1CPYA 2YH2A 4GWLA 2PL5A 4N8DA 2XUGA 1TKRA 3X3HA 3H17A 1DQYA 3G9UA 5LKAA 3ESBA 5CT4A 5CT6A 1XRLA 1AUOA 1MTZA 5LZ5A 4BVLA 4MQLA 1LGYA 1K6EA 5ALVA 2XQFA 1LBSA 2GBIA 1DU4A 3M83A 2WIDA 2RHWA 2I3ZA 3QITA 1UT6A 4INZA 4Q3LA 1IUOA 2ZYSA 1XZBA 2YXPX 1CUZA 5AOBA 3WWOA 2V96A 3M82A 4G9EA 5CH8A 2WG2A 3SC2A 2XUDA 3G0CA 1ACJA 4OD0A 5CH3A 3WK8A 1WB5A 5LZ9A 1EI9A 1RP1A 3FVRA 3F9CA 3DS8A 1XZIA 3ED1A 4QDOA 2ZSIA 1SOMA 1TCBA 3F97A 4HRYA 3R40A 2OCKA 2DQYA 2HFKA 3C8HA 4BC1A 1EDDA 1DWPA 2HHAA 2AJ8A 3O9MA 5E4TA 2CEKA 1GXSA 4ZRDA 5AI4A 2XUKA 5HQ3B 1XQWA 5HF9A 5LYYA 1SCIA 1HL7A 4FDMA 1DX4A 2Y2VA 5AH0A 3AIKA 3H2IA 2WFLB 3R3VA 1EB9A 1Q0ZA 5JZ9A 2WTNA 1XZDA 3WLAA 3EF3A 5ALOA 3UUFA 1H23A 3DJYA 2VSQA 3PFBA 2QJWA 3FYUB 2HU8A 4OB8A 1QGED 3G0DA 3D0KA 5FV4A 2CKMA 1C4XA 4MXDA 4B81A 2WSLA 3FBWA 1CUCA 4QLOA 4ITVA 1TK3A 1DT5A 5DNUA 5AKHA 1E66A 4UHFA 3C6ZA 5JD6A 1XZCA 2O2HA 3O4GA 2PU7A 3I6MA 3C70A 3PF9A 1ZD2P 1N5MA 1JMYA 6YASA 1S8OA 2BUCA 4XJVA 3BF7A 3K6KA 4Y2VA 1RWQA 4UBJA 1MT3A 3Q0TA 5AKLA 2H7CA 4PV7A 3YASA 2B9VA 3ILSA 2ZVDA 3WWDA 5T4EA 2PUHA 1ISPA 3STXA 4EY8A 5FKJA 1R50A 1OCEA 4J7AA 1NU6A 3B3QA 3BDIA 2ES4A 4GHWA 1QZ3A 1CUGA 3PI6A 2H1IA 5T4HA 1ZOIA 3BL8A 1XZHA 1QTIA 5AKEA 4C4YA 5YASA 2WKWA 4EHBA 4L0CA 1X2EA 2K2QB 5EHZA 1UOOA 2VJBA 2Z8ZA 2X5XA 3C5WP 3EQ7A 4BAGA 1RYYA 5AM2A 4B85A 4U2FA 1WHTA 2OXEA 1WCYA 3U1TA 3RKSA 4MEBA 3LP5A 1QOZA 4A23A 1WB4A 4EY5A 2OGTA 2NW6A 1IZ7A 4U2DA 5ALLA 3SWWA 2O2IA 4W1RA 1EDBA 3G0BA 2BGNA 2HA7A 1CUBA 3AZOA 4KEAA 2I3DA 3HYSA 2ZJ6A 1A8QA 2XQKA 5ALWA 1GQSA 4P08A 2GBFA 4Q1VA 1E8NA 4Q05A 2XUHA 1HDEA 4QWWA 4KE8A 5AM0A 1MU0A 2OCIA 3H19A 4QDTA 3H2HA 5AK3A 5JYCA 3H2GA 3O4IA 2JGMA 2XLCA 2C7BA 5CMLA 4BCBA 4IQ4A 3JWEA 4UBIA 5JIBA 4M0FA 3I2KA 4P92A 1EINA 1TCAA 2XUJA 4TPKA 4UFPA 3EQ9A 2J4CA 3NUZA 3G7NA 1FFCA 2C4HA 3WYNA 3JW8A 2QXUA 4J0HA 4V2IA 4BC0A 5LIPA 5JASA 3IULA 1XRMA 3KD2A 1QIFA 1J07A 3I2HA 4W9RA 1W75A 4WY8A 4H7KA 1FFBA 4OYYA 4OSEA 3PUHA 5AKJA 3LCRA 5IVIA 3OC0A 1E8MA 1X70A 4HTAA 4E46A 1MN6A 5AI5A 1MX5A 5CRIA 3H1AA 3AUKA 1CVLA 4AZ3A 5AKZA 2XMBA 4UBMA 4MEAA 5ALMA 5C8ZA 3DEAA 3DNMA 5ALQA 5KREA 3IIIA 4H7DA 5AM4A 5A7GA 4IH4A 1P0PA 2V97A 3HSSA 4Y2TA 1TRHA 5EIHA 4BZWA 2EDCA 1J1IA 3PICA 1Q84A 4BYMA 4QDUA 1TCCA 1J2EA 4GLBA 3LIIA 3PE6A 1HQDA 3K9BA 4MQMA 2PSDA 4X6UA 4PSUA 1XLWA 1F8UA 2PKYX 1FFAA 4X6XA 3OOSA 4G9GA 5DWDA 2QXTA 3PUIA 1ACLA 4K2AA 2QTBA 3WJ2A 2VF2A 4J0KA 4J0IA 1CEXA 1UK7A 2BFNA 3UMJA 3FAKA 5ALUA 1QO7A 3STWA 4U2CA 3WA6A 1YAHA 3ESAA 4H77A 4PQEA 5EFZA 4FLFA 1ZD5A 2R11A 1AX9A 2IITA 4Y2SA 3LLCA 1P0QA 4NMWA 3DD5A 5K3CA 1XZMA 2QRUA 4XVCA 2GYVA 5K5EA 1N1MA 3E1GA 4C6HA 4W1SA 1PFQA 3W9UA 4HXFB 4C4ZA 4WFIA 5HFAA 5E4JA 2JGKA 2QOEA 4H7EA 3FNBA 3FLEA 1AQLA 4G5XA 2GZSA 4LXHA 3NGMA 4E14A 4F60A 2JBWA 3I2IA 1BROA 2VTVA 1W6RA 5ALTA 2B61A 1BU8A 4KE7A 1W76A 4RE6A 4J0GA 2G5PA 3WKEA 2XMQA 3H04A 3I1IA 2J4FA 3VJLA 1JJIA 1VLQA 4YPVA 4YK7A 5JD5A 3I28A 3G9ZA 5JANA 2DQZA 2UZ0A 3HEAA 3GBSA 3RM3A 1NX9A 5AKKA 4WFJA 3H1BA 1Y7IA 4QDZA 4FLMA 5DYTA 4N8EA 3WWCA 2WIFA 4X94A 5FDFA 1SC9A 2X8BA 5I9IA 3ZLVA 4UPDA 3DL4A 4BCDA 4GBGA 3ESDA 4YX9A 3DYIA 1E5TA 2RI6A 4B83A 4GDMA 5JZSA 4F21A 5IVHA 1QIGA 2Q0XA 4WY5A 3WYDA 1Y37A 4AO8A 1U2EA 2HM7A 3NWOA 3DOIA 2Y1KA 2BUAA 1ORWA 3V9AA 4PF1A 2JF0A 1CV2A 5ALXA 1I6WA 1R9MA 4H7HA 2OAEA 5I7UA 5EI5A 1YCDA 2ZJFA 4RPCA 2XB6A 3G9XA 4AX4A 3VISA 3C45A 5EHNA 3A2MA 4DYHA 3PFCA 1DX6A 1LPMA 3A2NA 1TIBA 4ZI5A 1XZEA 1NU8A 1QJ4A 5JAUA 5AOCA 2WLSA 5D6OA 4FTWA 2PSFA 5KWIA 3QVMA 5K3FA 3L1JA 4QZVA 4ZV7A 2W22A 2O7VA 3R41A 1KU6A 5HF8A 3M3DA 1F0PA 4W63A 4AQDA 1YS2X 4ZXFA 4AO6A 3FLBA 3QMWA 2ZYIA 2VJCA 3VVMA 2VT6A 1EA5A 4C89A 4OCZA 1F6WA 3AIOA 1VXRA 2QJRA 3DCNA 5AK5A 2HIHA 1LBTA 5BOVA 1LPBB 4UHCA 4I3FA 1R88A 5HKAA 1MAHA 4JYMA 1QTRA 3GUUA 5DTJA 3QM1A 5ALJA 4FFWA 1CUFA 1P0IA 3G0IA 3I2GA 4BVJA 5JAPA 1SCKA 4P9NA 1ETHA 1EXWA 4DGQA 3D7RA 1CUAA 2AJBA 3EBLA 4AO7A 1CIJA 4LXGA 4Y2UA 3C5VA 4UHBA 4QDXA 1PJAA 1U8EA 1J06A 4C87A 2WHQA 4DMHA 1SFRA 1AURA 1A7UA 2HL6A 2PVSA 5EIEA 4XX1A 1JFRA 2WUFA 4UBLA 3WJ1A 2BUBA 1MX9A 4UBNA 3T52A 1MNAA 1K63A 1M33A 4CCYB 5HQ3A 1R1DA 2OG1A 3A70A 3B5EA 1K4YA 4L9AA 4ROTA 3IA2A 4Y2PA 4TVKA 1LPNA 2P8SA 3QYJA 5AJHA 1A8SA 2HA2A 1VA5A 1XRRA 1CUYA 2JGLA 4GW3A 5JZBA 3IB3A 5E4YA 4Y2YA 2JEYA 4H18A 4PO3X 1N8SA 4IHAA 5K3FB 3ICWA 4KRXA 4FFVA 1FSSA 3QBJA 2CZQA 2WU4A 3JYHA 2XI4A 5AK6A 3DQZA 4M0MA 2B4KA 1MJ5A 2BGRA 5AKYA 1WPXA 1MNQA 1U4NA 3I6YA 4FNGA 2HADA 2C58A 4OPMA 3CCBA 4B9EA 3N2ZB 1QIIA 3LS2A 3OM8A 2YASA 3AFIA 2DCMA 2O2GA 2ONCA 5ESRA 2CMFA 3L1IA 4E15A 3E3AA 5AI8A 3V48A 1X2BA 4J0DA 2XLBA 1UK9A 2RONA 2XMDA 1XZFA 1CUWA 2WIKA 4ZV9A 4MWSA 1OXMA 3HI4A 2X76A 1XZKA 4J3JA 4EBBA 4U2GA 1HBJA 2BAGA 4W1QA 2CB9A 5T4FA 1ZD3A 1H2ZA 3FWHA 5ALZA 4AN1A 4DSAA 2H9YA 2PSEA 1UWCA 2G4LA 2WTMA 5AOAA 3KSRA 4X93A 4AMZA 3BWXA 3ZLUA 4G8CA 3C6BA 3FSGA 4K6KA 2VAVA 4QE3A 4KJXA 4NZZA 3FYUA 1T4MA 2GYUA 1QIDA 2RAUA 1W52X 1KU0A 1CLEA 3C43A 2DHCA 2WIJA 3WQHA 2OAGA 1H2WA 1CQWA 3W04A 1XQXA 3Q8WA 2Z3WA 4KE6A 2HA0A 5DYYA 5T4BA 2QR5A 3K2IA 1ZJ4A 4DNFA 1AMNA 3STTA 2WJ4A 2XQIA 1HKHA 2WHPB 1XKTA 5CT9A 1UKAA 3H18A 4X90A 1Z68A 2JGEA 2ORYA 4BBZA 1THGA 1JMKC 4WFKA 2ACEA 4PSDA 2OQVA 3MGAA 2DR0A 3WA7A 3WWPA 2CUTA 4QEKA 3F98A 2XMCA 5EIAA 1W4LA 4AN0A 3A2LA 2QMQA 5AKGA 3D4LA 3DLTA 3DKKA 1EX9A 1Q83A 1YR2A 2VA9A 2XE4A 1JU4A 4G4JA 2RGUA 4CI9A 2PUJA 3GZJA 5SYMA 4UHDA 1WHSA 3F67A 2XDWA 5K3EA 4GECA 4DNQA 4BP9A 1QIMA 2C0QA 3OTQA 2PM8A 1USWA 4LIPD 3WL8A 4JUIA 3WK9A 1YASA 2JGJA 5ALPA 3GELA 3QPCA 4OU5A 1R9NA 3IUQA 4MYSA 4IO0A 2D0DA 4OUKX 2FJPA 1VZ3A 4C01A 1G42A 3WK6A 2VEOA 2GBGA 1B6GA 5ALEA 4X97A 2VATA 2ZYRA 3DOHA 3PF8A 1ZIXA 4Y2XA 5J3JA 3C8DA 3GA7A 2HDWA 4ARAA 4EB0A 4PSCA 4K6HA 2AJLI 1P0MA 5BWCA 4A5SA 2XUAA 1UK8A 2AJCA 3R0VA 5E2IA 4BB0A 3MUOA 2IX9A 4DIUA 4FBLA 4DTCA 4IH9A 3HZOA 4KAAA 2VJDA 3OG9A 4XWGA 1D07A 4MWTA 1YA8A 3FCYA 1XRQA 4CIBA 3BIXA 4HAIA 1EK2A 4M0EA 5CT5A 1B41A 1IUPA 5FPPA 3HRHA 4N5IX 3V1KA 3WL6A 2PSJA 3FYUC 3C6YA 3G0GA 1GKKA 4ZGBA 3OURA 3TRDA 1TQHA 4BDTA 1YA4A 2PU5A 1QIKA 2G63A 4G1FA 4FLEA 2QKYA 1UZAA 1LZLA 2BKLA 5A71A 3T4UA 1MAAA 1FFEA 3DL7A 1FFDA 5AP9A 5FUMA 3KWFA 2D5LA 4QLAA 1H2YA 2QM0A 3HLKA 5AKXA 1BEEA 3UUEA 2CBGA 5LLSA 1ZICA 3AZPA 4P93A 4AMYA 1BRTA 3L1HA 1HPLA 1QONA 1EVEA 3AINA 3WI7A 1FJ2A 2HA4A 2I78A 1XROA 2BCEA 4DMFA 3R3XA 2CJPA 1VJ5A 2WUEA 1LPAB 3A6ZA 2ZYHA 2QUBA 4KR0A 1ZI9A 1KEZA 5F4ZA 2OGSA 5C7YA 2HRRA 5HKBA 3HXKA 5AI6A 4DNOA 2G5TA 4RGYA 4Y9SA 3WL5A 1LPPA 2WILA 5FXMA 3V1LA 4CFSA 1A88A 3N0TA 1UK6A 3W2TA 4B84A 2JEZA 2V98A 4K6GA 4K5QA 5LZ8A 4WDRA 3IUNA 5ALFA 4EY6A 2BJHA 5JAOA 4BVKA 4G8BA 1L7QA 3AILA 4X00A 1LLFA 5JADA 4QWMA 4O08A 4DLNA 4Y7DA 2Z3ZA 5IVDA 4B7ZA 4N8SA 4EZIA 2XMGA 5ALKA 2LIPA 4HRXA 2Y6VA 1ZGCA 1QIJA 3F8SA 3G02A 2XQJA 1O6FA 5D3KA 1GQRA 2J3DA 2XQGA 1XRPA 4LKOA 4WCVA 4Q3OA 2PBLA 4BCCA 3O0DA 3R3YA 4DNPA 1IVYA 5IVKA 3D2BA 4X71A 5DYWA 2XMSA 1K8QA 4BE9A 4OB6A 4B6GA 1K5PA 4B0PA 3BIWA 4CCWA 3W9BA 5AI9A 3WKAA 5CW2A 1ZD4A 5HZGA 3S8YA 2FX5A 3SX4A 4OU4A 5AM3A 3IBTA 3C6XA 4BAUA 1YAJA 1YSCA 1BS9A 4ZWNA 5A2GA 3ZI7A 4UHEA 2OLEA 4F0JA 1C7IA 1EVQA 3STUA 5CTAA 3IUMA 1WOMA 3I2JA 4S0XA 1ZJ5A 5LZ2A 4MYDA 2XUFA 4U2BA 2I03A 5JATA 2PPLA 3TJMA 2C5GA 4DMKA 3FSGD 1PV1A 4U2EA 3MUNA 3V1MA 5A62A 4BRZA 1IZ8A 5HCUA 4PW0A 4G4IA 2EDAA 4LYDA 1BE0A 4B80A 3EIOA 3SK0A 3CCCA 3U0VA 2J3QA 4H7FA 2HU5A 1THTA 2OGZA 1VZ2A 1YB6A 1UXOA 1BCSA 4CIAA 2R8BA 1UOPA 1R3DA 1YB7A 3HJUA 1AGYA 4FNMA 4UUQA 2JGIA 4QA9A 1XZLA 3BXPA 3F96A 1MO2A 1UOQA 4J0JA 2ZSHA 2HA5A 2IIVA 3DDUA 2WUGA 3NOXA 3KDAA 4AXBA 3STYA 5IKXA 2FJ0A 2B20A 2Y6UA 4LHEA 4PNZA 4QNNA 3BF8A 5CURA 4X6YA 5DLPA 5AM5A 2JIDA 4BTLA 3G9TA 3MVEA 5EHQA 3WWEA 4H7IA 2QZPA 3DKRA 1XLVA 3ANTA 5C8VA 1TAHA 1CUSA 4Q34A 1GKLA 4J0CA 1EB8A 1VE6A 5JAHA 4CG1A 1BCRA 2H7YA 3TEJA 1G66A 3CN9A 5AO9A 1GPLA 1EHYA 1ODCA 4F5ZA 1GT6A 4C4XA 3BJMA 2JGFA 3FCXA 4J03A 3FVTA 1DWQA 4FOLA 4UHHA 4OB7A 5AI0A 1CUXA 1VOTA 4EY7A 5KBYA 2XUIA 3ANSA 5LP1A 1WM1A 4B82A 2DFPA 2ECFA 3AZQA 4HXGA 5A7FA 2QUAA 1LZKA 2AXEA 2ROQA 3VJMA 3PDCA 2ACKA 5EGNA 4B0OA 1CUIA 4XIIA 2FUKA 5A7HA 5H3HA 5AIAA 1DWOA 4GEGA 2YYSA 5K3BA 1CUDA 3FOBA 5AHXA 4H0CA 3KWJA 3G8YA 1W1IA 2QVBA 1ZIYA 3R3WA 3D5EA 4HS9A 2VJAA 5CXXA 1JJFA 1JI3A 3GFFA 5ALIA 1XLUA 1U65A 1DTEA 3IDAA 3R3ZA 4C88A 1CUVA 4MJ3A 2GYWA 2WFLA 5AKIA 4E11A 2DSNA 4RNCA 1EK1A 1XZAA 2WM2A 4YASA 4KACA 5DNVA 4TGLA 3WK5A 3HABA 1CUEA 3ZV7A 2WHRA 2XMZA 1E89A 1JKMA 5BV7A 4EA6A 5I8PA 2OPHA 5D7BA 5DNWA 3E4DA 3CXUA 1EDEA 2Y2UA 5LZ4A 3ZWQA 1OILA 3WZMA 1XQVA 1MX1A 4X85A 3WL7A 3I1YA 3WZLA 5JALA 3B12A 2EEPA 1ZI8A 2WHPA 4FWBA 1JU3A 5LZ7A 5ALGA 1G4HA 1QFSA 4KAJA 3O4HA 4Z49A 1DINA 4GI1A 1AKNA 5HK8A 3QH4A 1E3QA 1LNSA 3OPMA 1GPNA 2QT9A 4GXNA 5JARA 1BEZA 3WKBA 1GZ7A 3D59A 2XUQA 5FOQA 3BE8A 4FKBA 5D3ZA 3EQ8A 4W1PA 4DM7A 5EHXA 4CCYA 3WIOA 1R4ZA 1AC5A 3D3NA 3VJKA 5FLKA 1ODTC 4D9JA 1L7AA 5SYNA 1VKHA 3M81A 3WMRA 1L7RA 1QO9A 1QFMA 3IURA 3WK7A 1HLGA 5A6VA 4CG2A 1IMJA 3VKFA 5ISMA 2O7RA 4G4GA 1EH5A 5JD4A 2XUPA 4Q3KA 1XFDA 1LPSA 2PX6A 3E0XA 5C8XA 4BTVA 3C87A 2DHDA 1QIHA 3KOOA 3VVLA 4OYLA 1A8UA 2WG0A 4HXEB 1UFOA 4L72A 3GROA 4A16A 4X92A 4HZGA 5DJ5A 1CRLA 3HACA
chains in the Genus database with same CATH superfamily
2VUSA 3AIIA 2HK9A 2BR4A 1U7XA 3GJQA 5A04A 4W5JA 2XKAA 3HA2A 4KIFA 1W5BA 4ZKEA 2HK7A 5FNVB 2H92A 4II2A 4WBXC 3P9IA 3C1UA 3UAVA 3ZWBA 4YMTA 4TKMA 1KK1A 4YAUA 4X20A 3ABQB 4ZT6A 5DSTA 3H2KA 4GNKA 4HWPA 4HH3C 5JHGB 4Z8YA 5K6AC 2CDCA 2EZUA 5IT0A 2VNHA 1W4ZA 1W36C 3KYIB 1YQDA 1Y7LA 5HSGA 1O95A 2WIGA 2GDZA 3MCTA 1WB6A 2D74A 3C85A 2XB9A 3L0IB 3LXMA 1JW9B 4FMDF 4G97A 1CCWA 5AM1A 2WG1A 4BMDA 1F14A 3RC2A 5AFSA 5B2EA 1R2QA 1AV7A 2RB5A 3ZD8A 3WFZA 1QVWA 2Q5CA 4U3JB 3K1AA 1XZJA 1DQZA 3EVNA 1Y6ZA 4V1CI 1NBEA 1DJNA 3OA2A 4FHGA 5IM5A 5FBKA 3E18A 3IQXA 1C7JA 3ILYA 4N5HX 3DWGA 3O84A 4MRPA 1TD9A 1AO0A 4D1YA 1W2HA 4FOPA 1I0IA 4UASA 3UCFA 2XCTB 4WV3A 3F6BX 3H9EO 2CUNA 3EIUA 3S7ZA 4RNDB 3UC9A 3A3KA 2YV1A 2WVHA 2FK7A 2Y77A 3OLQA 1I6LA 1NQOA 3FRIA 3PE4A 1M1NA 3STVA 3K70C 4QL3A 3OQOA 1IHXA 2Q6OA 2QLJA 3C24A 4LMPA 3KKKA 1UFRA 4FMPA 1FP4B 1RPTA 1JRLA 1Z37A 3ZQJA 1XXHA 2JI6A 3VDMA 4EY4A 2WHYA 1OE0A 2C4KA 4DMCA 4KWTA 4DJJA 1SQ6A 1SA0B 2OV3A 3LHFA 3L7AA 3L43A 4JX9A 4RVGA 4YRCA 5IWAB 1IHPA 4MULA 3PXUA 4DSZA 3EFBA 3ESCA 3O92A 4YRDA 1P7CA 2QTAA 1QGAA 1SK9A 1B1CA 1L5VA 4Q5IA 1U63A 1XV5A 2HQBA 1XTIA 1GGMA 3R7FA 3KKPA 3TGWA 1NVAA 1XLTA 5E6RB 4U63A 3O4JA 3Q7RA 1YS6A 3PD1A 2WKRA 3L8HA 1ZR4A 2H4JA 2Y1EA 1RHMA 2ETVA 4M0UA 3LHIA 4C4TA 3I30X 4OHYA 3U16A 5LXTA 2W48A 4MO2A 1DTSA 4JNCA 2XECA 3R3UA 4I36A 3H0CA 3GVIA 1YA6A 3BK7A 3GJ3A 4CG3A 3BHMA 1SRRA 1L5YA 4TYPA 1DQRA 4EYSA 2VTDA 1WZUA 1J5EB 4IJKA 4ZCLA 2OMKA 4RV4A 3VNQA 3FXAA 2P5TB 3NEJA 4LRSB 3ANYB 2JFVA 3OFSA 3NETA 1DTWA 2ZJ7A 5KSPA 1TFUA 3FYSA 2NU8A 3R6TA 5B7PA 2XB2A 4KO1S 3T9EA 3UGTA 2GN4A 5I7AA 4RVFA 1B6SA 2JJ2D 4LWQA 4OGGA 2O20A 3RWOA 2IELA 5A5GA 2H48A 2XCOA 3NAZA 1Q0UA 4XARA 3ZH9B 1E2NA 2P4SA 2YNMA 5EINA 4N03A 4QIHA 3AUUA 4KLCA 3B6ZA 1X7WA 3A6DA 3DP9A 4IS3A 3ZE6A 1Z6XA 2PS0A 4DWVA 3UN1A 3KOZA 4H59A 5LKRA 4NVRA 4MR7B 4XSHA 5FJJA 4BZZA 2ABWA 4HWOA 2HX1A 4KKXB 2CLLB 3PENA 3V1NA 3HWRA 1V7PC 4P93A 1SEPA 2YMPA 3E7PA 3I3SR 3H8JA 4B3RB 5FLEX 1P72A 4K05A 3UJBA 2WFMA 4UBKA 2JLYA 4LF7B 5HDBB 3ZWCA 1G0OA 2Q1XA 3CLSD 2OV1A 4PM4A 5FUYA 3DFFA 2ZYGA 1MGOA 1VJDA 3N2IA 3PT5A 3VPGA 4I19A 3P9CA 5HEKA 1U6KA 4P53A 3GLSA 1E0AA 1VM6A 2EHJA 4B6JA 2VCYA 3QVTA 1JHOA 3HO1A 2IL1A 4RYDA 5ANRB 3ZBUA 2BBWA 3PDJA 1DNPA 4LSZA 4QVGA 3MTQA 4N3GA 2Z6QA 2QRKA 3S7TA 3ZY4A 5J47A 2GB4A 2VL7A 3AFGA 3CN7A 3E5MA 4YHHB 1CZRA 4H3KB 5F2OA 1VJ0A 3B38A 1NE2A 3OM9A 5IH7A 3H65A 1JZSA 1YU6A 2BL4A 3LIPA 4ABYA 5T6MA 4BNUA 4AJ2A 4P3PA 3MWKA 1N8TA 2D59A 3A1EA 3OP1A 4MUHA 4MW9A 5HKKD 4GGMX 2GCPA 1AQJA 5ALRA 4N7JA 4XJTA 4ZYWA 3UAYA 1G98A 3QPAA 2P65A 3HB1A 4N65A 4QTZA 5K3AA 5TLSA 4WUVA 4Y0VA 1QLJA 3I8OA 2F4NA 1Y7HA 5KWSA 5KSWB 3OA0A 1FP4A 5JEEA 1BMQA 3UKDA 4ZVQA 1OSNA 2D13A 2OR3A 2GZRA 1KR2A 3TOCA 2JAXA 2XVYA 3JU3A 1E0JA 2DBVO 1PKXA 1YBHA 1T2NA 3MC1A 1EJ0A 2PQ2A 4PAWA 4B6SA 5CX1A 1GSHA 4Q4JB 4MJLA 1QLHA 4CM3A 3P2KA 4PZYA 2JCGA 2AOWA 4JI8B 4TVOA 1FJHA 2ZJAA 3TN7A 3IUJA 3H1PA 4NS4A 4DTCA 1OJ7A 2QUKA 1G2PA 1ISMA 3FTQA 3Q15C 1DARA 1U8UA 1JJBA 7MDHA 1IK6A 2ZRJA 3H97A 4FSDA 4W6QA 2EZ8A 2BMJA 1G5FA 3CEMA 4R8LA 3HKEA 5FB3A 3SSMA 3KCQA 2Q6KA 4JC5A 4TRNA 4AT1A 4M1ZA 4YV0A 4BP8A 3GPBA 3H5AA 2JCBA 2ZIEA 4YJHA 5I8WA 3WE7A 3ZLTA 1NMSA 1QH8A 1C7FA 1CQZA 1BAPA 3O95A 4YDRA 4BMOB 4ND5A 3VGJA 1E5LA 4AF8A 3HQ4O 4DLUA 3RLIA 3U4GA 1Y3CE 1ZM9A 3H5WA 3LK6A 4YQYA 2QRJA 4TZ0A 4DG8A 1Y7PA 3RF6A 1HEYA 4G0QA 4NLLA 3C3PA 2REQB 3HXOA 1PR0A 3O9VA 2VRWA 3KPWA 4NOKA 5J2TA 2FR8A 3AVWA 4EFNA 1KOJA 3ZUPA 3ZHSA 2WZBA 2Q3EA 4IQFA 2W11A 1N9KA 2J48A 5CVJA 2UUBB 1VBNA 5C4GB 1RQGA 2O06A 4JEIA 4JD5A 3WKDA 4LJ4A 1JEYA 4QULA 2ZI5A 2X9QA 2PGNA 3O9ZA 4KUGA 3ZNQA 1ZK4A 4F92B 1Y1KE 4BAZA 1AUQA 4YAWA 2VDVE 1WSDA 1N2BA 1WVGA 3E5HA 1C80A 1NVBA 1H2FA 2LKCA 1DOAA 3CFYA 3DTVB 3JZAA 5SY9A 5BWLA 2GK4A 3IEVA 2PBFA 2OKGA 3K9QO 1XFAA 1WPGA 4KFTA 2VTBA 1E8DA 3VBCA 3CCFA 5AHKA 2F4VB 3QVGB 4LGCA 1C9DB 3VNSA 3TNYA 1NVMB 4YRBA 2AI2A 3L7JA 4RHUA 4ZYUA 4I9HA 2XA2A 3V4LA 4RPKA 1NV8A 2I4NA 2CT8A 3RF7A 5CVUA 5JDCA 4EECA 2VNSA 3CE6A 3SN6A 1BN6A 1G64A 2ZUCA 1GTRA 2VPTA 1KSGA 3EVZA 3X1JA 3N76A 2BN4A 2Q2OA 2R6CA 4WJLA 2FZ4A 5BRJA 3HDJA 2ZIUB 2FFRA 1P19A 1DKUA 1ZI6A 2Z8XA 3X2EA 4B9AA 3T5DA 4JVLA 4YV2A 1A7JA 3I53A 3QMVA 4XYMA 3IFSA 3FYTA 2NVUA 1DUVG 4M1OA 4OHXA 5KIAA 5F73A 3SHQA 1GA6A 2CN1A 4I9NA 3RARA 3SXUB 2LV8A 3HY6A 121PA 1UIRA 3FOZA 4N8DA 2PMWB 4R98A 2F62A 2FDRA 2OB2A 1MB3A 2NAPA 2V1XA 3BE6A 3E8MA 3LUKA 4UM5A 1TKRA 3LQKA 3R7NA 4YP5A 4MLCA 1X1QA 1G7CA 2WJYA 2GN9A 3EGWA 1K68A 1B14A 1EUDB 1OPXA 2IXTA 2R44A 4G0MA 4LZZA 3UBMA 4YMGA 2IOYA 4FJ1A 4NAUA 5I7VA 2OXIA 3WNCA 4EUKA 1M1YA 5CT6A 4G0ZA 5BSWA 4RIGA 1W2GA 1AUOA 4E4RA 3GCXA 4EHHA 1ULBA 3GEPA 4BVLA 4B6FA 5LFAA 3VKWA 5ALVA 1I4TD 4UJ3A 3TRHA 4F3KA 1SELA 4FEEA 3ORHA 3NH6A 3VR2D 2DC1A 3OI7A 3PYLA 2IYYA 5H80A 3D31A 1DU4A 1IXRC 3VNRA 1O6CA 4L02A 1PO7A 1V4NA 2FJUA 1A5ZA 1FNDA 1XPJA 3HEBA 4H7PA 3KLNA 4V0MA 5EOVA 2I3ZA 4KXUA 8ABPA 1UT6A 1ENPA 4INZA 3S1SA 2CFSA 2V59A 5AXAA 5TT1A 4MX8A 1DHTA 2YXPX 4DLKA 1JKJB 2QA5A 3WWOA 1MIOA 2AE2A 3EPPA 1VLVA 3M82A 4G9EA 4EM6A 5A1TA 3TQRA 2WJAA 4XD7A 4ZT4A 4MHTA 3ACBA 1P2VA 3GV0A 3G0CA 3H2BA 1LQTA 3EVCA 4RSRA 1BZYA 3FSJX 1KKLA 5CH3A 2ZREA 821PA 5LZ9A 3DAYA 3PRYA 5BNTA 2CL0X 1YZGA 4F3NA 5D7NA 2R79A 3ZX5A 2QX4A 2H1HA 1N34B 2FQQA 3GARA 4QDOA 4LJ7A 3DWEX 1TCBA 3Q3GE 2FSUA 2OSBA 2WKSA 3F97A 3R40A 1IG0A 2GWHA 1T8YA 2C9MA 2OCKA 4HGRA 3T15A 4C22A 2YWJA 1KDYA 1CX9B 4BB5A 2HFKA 4BC1A 2QD3A 3K7EA 1EDDA 2YIJA 4QGBA 5EJFA 4PFQA 1U2TA 1R4NB 4PVDA 3ENQA 4F84A 4URVR 1DWPA 1Q5PA 1TUEA 4Q4AA 2HHAA 1NVKA 1QH0A 3RVQA 2CLDX 1NE7A 2V4UA 4MZDA 5J43A 2O52A 3D3WB 1HE3A 2ZANA 4DYDA 2QROA 2XYPA 3N5KA 4RK1A 4ZAXA 2FN7A 3DLAA 1OXUA 1O6BA 4EG0A 1FBTA 4ZCRA 2QL6A 3PR1A 3BBPA 2BZSA 2D4HA 4N54A 4P36A 2HZ7A 5HRUA 1XQWA 5LSAA 2F8LA 2YWDA 4CFZA 4XWAA 1OBFO 1HL7A 1XTQA 3ZXYA 4JP1A 3OX4A 5GGYA 4A2WA 5AH0A 5ITWA 1MC5A 1T0UA 1ZMRA 2IC5A 1KK0A 2VC2B 2WFLB 5BQPA 1Q7EA 3SBEA 1EB9A 3EYAA 5JSQA 3IXMA 5FNZA 2E4XA 4IFTA 3FMVA 1VMAA 4NYMR 3B20A 4A4DA 3BAFA 3FMPB 3BQNB 4EITA 4ZRMA 4Z4EA 4CKZA 2C29D 4NULA 4MS1B 5LL6P 2IPMA 3A04A 2W6ZA 1IYZA 1ECCA 3I5AA 4DT1B 4YRPA 4L78A 2OFWA 2QI9C 2VG8A 1YK1A 1ZD9A 3HLTA 4XCQA 4EX6A 1H23A 4QYWA 5BT9A 2ZUFA 1OTXA 3OTGA 4LV6A 3V8RA 2YXBA 3WBFA 1O7JA 3DAHA 1UUFA 2GSDA 2VSQA 4FGZA 4WKGA 4C5AA 4LV5B 4I6JA 1Q2XA 3QVKA 3EZNA 4DA9A 3PFBA 2CHFA 4I55A 1ZD8A 4UU7A 3T9FA 4DJDC 1XXLA 4ZJYA 4JKIA 4WK0B 2ZTUA 3ENKA 2QT0A 3DP7A 3MBIA 3TI7A 1FJXA 1E2UA 1VL6A 1J0CA 2C98A 2NG1A 3NWJA 3ZJ4A 3K09A 3GLIB 3G0DA 3ZDZB 5KTYA 2ESRA 2H63A 2WTXA 4RVHA 3IBCA 2Z58A 4ZQFA 3FF4A 4Q7EA 5JSYA 2C4TA 3AHCA 3JARA 2CKMA 2GM5A 3VR6D 4G36A 2DJ5A 4OFWA 3G5MA 2BZ0A 4MXDA 4EW1A 1VMDA 2FUG6 2V6GA 3Q88A 4Q3NA 3TWOA 5ICGA 5KTKA 1CQXA 1FFHA 5HXAA 3WHPA 4ZTUB 2BONA 3D8SA 2RJOA 4JJ8A 3EF1A 4F6LA 4ALNA 1FLDA 2H07A 2ZYDA 4JUFA 1C7ZA 2AKEA 3BEOA 3FPBA 3AEQA 1NQAO 3D3KA 2WIAA 3L7CA 4GYJA 1TYZA 1FUEA 5ED4A 1VLJA 4Y18A 3SQOA 2GO7A 1CP3A 3MMSA 1NHGA 1QZUA 2COUA 4Z5XA 3QVLA 1ECLA 3GPDG 1DOHA 4B33A 5J23A 2WV7A 5TVGA 2FWNA 3QVGA 4DBZA 4DR4B 3ZYCA 4BV3A 3AKDA 1E66A 4Z7JA 3W1EA 4U7WA 3W8RA 3K35A 2AX4A 4QYXA 3DMRA 3I6BA 4LHWA 4FR5A 1XZCA 2W4QA 4IIDA 2PU7A 1KGSA 4V0KA 5D1HA 3BWVA 4HVCA 2B83A 4QPZA 1N5IA 2GN6A 4P80A 4YO7A 1R0YA 5TMDA 3PQ2A 5D87A 3C70A 4NXMB 1ZD2P 4YPOA 1JMYA 4B7CA 4F5DA 1M6WA 1T9BA 3MERA 1ZIPA 4PCUA 3JAWB 4HGQA 2BUCA 3BF7A 1HURA 3HVIA 4JP3A 1XD2A 3CZ4A 5B1EA 1E3WA 1H3FA 3DSRA 4UPEA 5DE3A 3IIMA 4RENA 5FAKA 1COWD 4PHCA 4BS9A 3D7LA 1SH7A 4M9XA 1M2VA 3SZRA 5L3SB 1JHQA 3WJAA 4HPWA 1LXCA 4LG1A 2ARKA 3AMVA 3B2QA 3Q0TA 1J99A 2B8TA 3HYNA 1JLKA 1JWBB 4RVDA 3K0SA 2R8XA 3TH5A 4PV7A 4JXJA 1NRJB 2B9VA 1VE3A 2QUIA 5KTNA 2I29A 3BSWA 3ILSA 1Z74A 3BMQA 1KI7A 1A2OA 1TLLA 3NBUA 1BVRA 1T91A 4YP6A 3AKCA 1T9DA 1RTTA 4LRQA 5FT9A 2WUWE 5T4EA 4AVYA 4BGUA 4JI2B 2PUHA 3IMKA 4DKJA 1WTCA 3HYLA 1KS9A 2HDOA 3LJKA 1T25A 1OCEA 4Q3BA 3RVOA 1HYGA 1TVEA 4IMIB 1P1FA 3Q6IA 3DEJA 3MWJA 2LUOA 4MS4B 3OCVA 4P7BA 3TB4A 4C4RA 1E61A 2ES4A 3PUVA 4GHWA 3ZHCA 1QZ3A 4BB6A 3B78A 3IDZA 3A3NA 5A9SA 2OHFA 4BO5A 4NE7A 2I4TA 3Q7PA 5G4LA 1XZHA 1QTIA 4KH1A 4WZAA 4MDFA 2VYND 2KM1A 5K99A 3IJRA 1F20A 1T9ZA 3B2EA 4KV9A 3FX2A 1TZKA 4KBGA 2J59A 4JMLA 1RJFA 4EHKA 3C3CA 3EQ6A 4B35A 3IHLA 4CDGA 5CK5A 2AD1A 4BZXA 5IPFA 5AJWA 1I1NA 2P9TA 3JQDA 3KJGA 5TJHA 4GPBA 4TTTS 1C8LA 1E9FA 2X5XA 1GQ2A 1GTMA 1LBQA 2QQGA 5HMLA 1YZHA 4BAGA 2V7UA 1AO3A 4LVOA 4JB2A 3LX8A 3OZRA 1O87A 1MA3A 4U2FA 1ILEA 3BIJA 1U1GA 3U1TA 4RTRA 3FG9A 3RAFC 3GJRA 2HJSA 2X0JA 3LP5A 5IEBA 2N3ZA 3ZHOA 4EY5A 4TTVA 1IY2A 5HVNA 2NW6A 3N8IA 5C1PA 2BDEA 1FS6A 2WSBA 2SICE 3FSRA 1XCOA 4U2DA 5ALLA 2WF9A 3QWFA 1TGVA 1JJAA 3I52A 2EZ9A 3M5WA 3IE2A 1Z8HA 3ICPA 2YL2A 3A6KA 3G0BA 3OEHD 4WLNA 4C4AA 4UHKA 1TTTA 5F21A 3NALA 1CUBA 4F86A 2ODTX 3E9ZA 2XUZA 3DAGA 3G59A 3IPYA 1Y9ZA 3HYSA 5HCIA 3WYAA 2PJRA 3UQZA 3SM9A 3UZUA 1UODA 5B6PA 4XM1A 3GEGA 5LIRA 2PZJA 2H51A 1L7MA 2FRDC 4B3XA 3PRKE 1AKTA 4FVTA 2GJ9A 2H2GA 2Z3VA 4Q1VA 1D5CA 4Y7CA 5F1YA 4CMJA 4E13A 2XUHA 1HFEL 4AJ1A 1I5RA 1V0JA 4KBFA 1ZVMA 4TV8B 1P81A 4TS4A 4JJIA 1JAHA 3ISTA 3Q6MA 1G63A 3CV3A 1NYRA 3ABRB 5H9VA 4RLSA 1UWLA 5K3OA 1RAIA 4PLWA 4YRTA 1MU0A 2JG3A 2F64A 3ZGOA 3H19A 3T3NA 1PSZA 4U7PB 5JYCA 1AS0A 1PLJA 3O4IA 3PNOA 4F3YA 2XLCA 4HQNA 3WGHA 1XNRB 3MFYA 3AVXA 1ICIA 3KUUA 4FYPA 4TV8A 3NG1A 3MUFA 2EXXA 1L5ZA 4NDZA 4NOJA 5CMLA 3GU3A 1DTWB 4MQFA 3TE6A 3UAOA 4LOAA 4AQ7A 4EMSA 3CMMA 2V6FA 4IQ4A 3VR3D 3WO0A 1TA9A 5DNCA 2B37A 5DHQA 1EZ4A 5D3MB 3TW4A 3I2KA 4P92A 1TCAA 2GZDA 4GZ3A 3V2GA 4PCAA 4R8RA 1RMYA 4YJ3F 4UFPA 2Q5EA 1TTQB 2WF5A 3EQ9A 4UUBA 4H31A 4JSRA 1VB3A 4NNOA 3TOZA 3UC5A 3W5SA 5HUJA 3V2UA 4QUKA 1DAPA 2X13A 3VR2A 3S2FA 1ZUNA 1R7RA 3G7NA 1KJIA 3D7MA 1Z08A 2Z5FA 4XGKA 1XVLA 3QLEA 2ST1A 3PA6A 1HNNA 3IEMA 3IDQA 1KO8A 3JW8A 3U7FB 3I5MA 3MT7A 1RWKA 3HB9A 5T41A 1EFTA 2NUPB 3BPSA 2Q21A 1PJZA 1N8KA 3ORRA 4X7MA 4F72A 1S7GA 2G71A 3CW8X 5K6TA 1VMKA 3HSKA 1LV8A 4JJ7A 3EW7A 4V2IA 3QF4A 3U9LA 3M6XA 1GCGA 2BFBB 1NMXA 1YFJA 1H42A 1GRQA 2HGZA 2F9FA 4XIFA 1IOZA 1MB2A 2AG5A 2H65A 4BV9A 4NWIA 1AMUA 1BGVA 5FYDA 3TZ6A 1J07A 4PYJA 1QE0A 3GP5A 3TKLA 3BMOA 5J4KA 2Z04A 4OYHA 3HKDB 1F06A 1TCVA 2BEVA 3KZNA 4U5QA 1ACMA 4H7KA 2HQRA 1NP3A 4HX9A 3TLYA 2WRZA 4LBWA 5DCLA 1Y6RA 4OYYA 1CY1A 2WMNB 3BOSA 3PUHA 2VJNA 4HAYA 1C9JA 1Z7EA 3Q2IA 2NTJA 3FPAA 4D7AA 5HS4A 3D4NA 4AWXA 2WF6A 3QA9A 4MYHA 4YC7A 3RR2A 1KAMA 5AUOB 2JLXA 4OGWA 4HDSB 3MNFA 2DULA 4KIWA 2V7VA 3OC0A 3TD6A 3KPVA 4NECA 5KOYA 2WD7A 5LA6B 3CR8A 3KTOA 1C14A 2H29A 4E46A 4PG4A 1FVHA 2FWIA 4DIBA 3HP1A 3RUHA 3ZQKA 4HB4A 5I4CA 2IDJA 2XIQA 4US1R 5KOHB 2HSJA 2JFPA 3Q8KA 4NU6A 2HC9A 1J00A 5EP2A 2AZTA 4NK4A 4EATA 2GD6A 3H1AA 2I99A 1IY0A 3ZZ1A 1TM3E 4M83A 4DL9A 1ZLXA 1GARA 2NXEA 5B3LA 2XMBA 1XAJA 5GAJA 3GX1A 4LPKA 3PXBA 3RABA 2INGX 5K0SA 4G5OA 1CNMA 1VJTA 5ALMA 3QG1A 2RCNA 3FH0A 3H9JA 5C8ZA 2IRWA 5DXFA 4JXXA 3AUJB 3ER8A 1XQ9A 1FMTA 5EMKA 3EIEA 4D02A 2R87A 2PIAA 2EIHA 3WV4A 1J42A 2J8ZA 3KP1A 4BB9A 1DBSA 3LFHA 4W7IA 2YV5A 3T7TA 2RGBA 5DPMA 1GNLA 4XEHA 2NSYA 1POWA 1GHTA 3G8DA 1HDOA 4L4XA 5JYEA 2LPMA 4TTAA 4CEJB 1KORA 2QJTA 3JAWA 3GWZA 2EG9A 1TECE 2ZR8A 4GRDA 2P6MA 1Z2DA 1F9AA 3E22B 3C41J 4TMYA 1UEIA 3B60A 2EDCA 2H52A 2IP2A 3F46A 1ZGHA 5JO0A 1J1IA 4HH4A 2QVCA 4LVCA 3PICA 1VDMA 4LNHA 1CNEA 1Q84A 4XLTA 5E6UA 1IN5A 1Q50A 2OD9A 3H5IA 4RQTA 4Y9DA 1GGHA 3QLUA 4BYMA 3M89A 3C3YA 4Z2AA 3AXSA 4V0QA 1IHOA 3PXGA 1ZJWA 2NZVG 3KQPA 3MA0A 3B6MA 3SX2A 1DCKA 4U0JA 3RIEA 4YCMA 1H2HA 1N6HA 1N4AA 1NMQA 3KLMX 1GUAA 1RXYA 3RJZA 2VP3A 4LRXA 2ZPUA 1NFRA 3DXFA 3HWSA 1F8UA 1SR8A 1AZSC 2PLWA 4II3A 4WKOA 3NHBA 4GX2A 3TMAA 3CVOA 1AQNA 5LDHA 4Q16A 4YJKA 3DZHA 3EXG1 4AD8A 4IYRA 2A58A 2O2JA 4I55F 3SSNA 3ROZA 1BXGA 1ACLA 1COZA 4K2AA 4OP3A 5BMVF 2QTBA 3E5RA 2EZ4A 3KHKA 4QRIA 1CTQA 1VSBA 4WNYA 3WJ2A 5M5BA 5GJWC 4J0KA 2K87A 1VIDA 2KWIA 4EPXA 1UK7A 4HB3A 3UMJA 3FAKA 4IDPA 4YRNA 2O23A 3MTDA 3C7AA 5HKKA 1FDIA 1OZFA 2D5BA 4HVAA 2QZJA 2ZIXB 4GT1A 1K97A 2G77B 3BAZA 1QK4A 3FN4A 4FLFA 1BXRA 4IIEA 3GOHA 2V55B 3M1IA 4FXOA 3OZDA 4C0LA 1AX9A 1BXZA 1I1QB 1NBIA 1W4CA 1XZNA 1VG0B 2PZEA 2WYUA 1YKFA 4FFSA 1SCJA 3MS4A 5I9TA 2R25B 1QHXA 4HNAA 1FNMA 1BW9A 3A4MA 3LLCA 4IOJA 4CQMA 1P0QA 1GQQA 2EFJA 1GPMA 2VWHA 3DVSX 3DD5A 3DOEA 4L28A 4PAOA 3WMFA 5CA0B 1L5QA 2PRIA 3HNOA 4LYHA 4XVCA 3QUCA 1VJRA 3OWHA 2WSIA 3QV2A 4RAQA 2Q7DA 2I7DA 2ZXUA 4W5WA 3C3KA 2YICA 1YJ8A 1OJLA 1Z28A 2TMDA 4LK2A 3TVTA 4MVJD 4CZ2A 1P4AA 4E12A 4HXFB 4C4ZA 5T7BA 1RM4A 4WZAE 4INJA 2X4DA 4WFIA 4MTLA 4WOCA 5LLTA 5HFAA 4O5OA 5CLHA 2JGKA 3NIFB 2QOEA 4I2VA 4RM3A 5MGBA 1JEAA 2DRIA 2HWYA 1R0LA 2QK4A 3L6EA 3QBEA 3AOEC 1PFWA 4G5XA 4NG5A 3RJ9A 2M32A 5JAIA 3KJEA 4ZZIA 3HVUA 2VDRB 4LXHA 2AF4C 1WDMA 1YBMA 3N86A 3UWKA 2PWPA 2WAOA 1RWMA 4X5OA 3N6RA 3TPZA 1E3JA 1D6JA 4HDRA 2EW2A 1G5RA 2B6HA 3UGKA 4AG3A 1FQJA 4OQXA 3R5JA 1G21B 2PX0A 2JJ2A 2I0FA 2WHXA 3AQ4A 2QLBA 3E8XA 5GTDA 1XAGA 3BRCA 3QLTA 5DHFA 1PQYA 3F6CA 3L7OA 3OLCX 4TYMA 2FUNB 2AR7A 1WCWA 2B61A 3Q12A 2AFRA 3RSOA 5IF3A 3J81k 4KE7A 4TKUA 4K8RB 1OYWA 4J0GA 3K4PA 5B12A 3WKEA 1NPTO 1C9EA 3DH0A 2FOLA 3QPWA 3I1IA 4GX0A 4JEUA 1VBFA 1OGIA 4AYXA 4Q9NA 3LU1A 2CVFA 3OX3A 4HAOA 2H85A 3EZ6A 1N2EA 3DCIA 5AW5A 3SF8A 2J3LA 4YK7A 3ZBQA 5KJ1A 2GXUA 4GPD1 4AWBA 3I28A 2RSLA 4IIVA 3TB6A 3HCAA 3CGGA 4NZOA 3KZOA 1GPDG 4JODA 1U8XX 3D6HA 1FNBA 1SC1A 4D4HA 2P1RA 4LYFA 1GL7A 2AMYA 3H7AA 1IPEA 2MHCA 4GC9A 1DBRA 2GD2A 1NNSA 4QXRA 1Y7IA 4Y1FA 5B1DA 1P7ZA 3BTUA 3MWYW 4YDSA 1YZTA 3MS7A 2YWHA 3QKRB 1CW2B 1LU9A 4N8EA 1SKYB 5LDDC 2Q3DA 4N6GA 2FLWA 4PHTA 2H1WA 1H1TA 2Y0PA 2IUSA 1OWMA 4HAZA 1X8JA 3BTSA 4M2LA 3T3MB 3EF0A 3W90A 2B3TA 2QVYX 2WVJA 4ZVOA 5JECA 5TF0A 2FKAA 5SZJA 4D3YA 2O48X 2L0XA 4CJXA 1RZVA 1SC9A 2DH6A 2X8BA 1U0RA 3NT4A 3I5YA 1Z83A 2V5AA 3QNMA 4UPDA 3JD4A 3ZLVA 1QP0A 4KR3A 2BJVA 2GLUA 4FEAA 4GBGA 3ESDA 1ECFA 4IJ5A 5KHOC 3M33A 3LOUA 5NLLA 1Q44A 2WPDA 4U7JA 2C7PA 1E5TA 1ZSVA 3FDIA 2RI6A 3CZQA 4JS0A 5JDIA 4F21A 4EO7A 1Q1AA 2P90A 4J1TC 3LHKA 3OQ6A 2HBQA 2Y0EA 3PQ4A 2FWJA 4IGEA 3OF2A 1U2EA 2IZ5A 2I6UA 3GT0A 1XDZA 1VKRA 3BXGA 4KKVA 4TVSA 3I01M 3DOIA 5LQNA 5DRYA 1EFDN 5IASA 3G23A 1NN5A 2M1XA 4A0FA 2HHHB 1WQ1R 3VU9B 4G09A 4R2WA 2AUMA 2HNKA 4GPTA 4OAOA 6GPBA 3WFIA 1CDEA 4XPZA 1YNSA 3D6NB 4M0LA 5EP1A 1A76A 4CUKA 2JF0A 2PV7A 2G9NA 5HUHA 1K5HA 1BDMA 2EWWA 2YZGA 5GV8A 1YS4A 4HSGA 2NADA 4UQPA 5I7UA 5EI5A 1P7YA 3NC0C 4FW9A 4FGSA 5TQ2B 4K9PA 1NBME 1NN3A 3P4YA 2R9VA 1D1SA 3G9XA 4GS5A 3Q8MA 2E49A 3D2LA 3FD8A 3LPDA 2CFIA 2QU7A 3AY7A 4JUAA 3TNDA 3U7QB 4IIFA 1U3VA 3R5HA 2K5UA 1OFTA 4W5HA 4C7JA 4PLZA 1IIBA 3SJUA 4EK9A 4BFCA 1V37A 2OHVA 1JAYA 4IDBA 1OREA 3U62A 1JQBA 1V26A 6NULA 1QMGA 1T24A 3I09A 2YXNA 3PFCA 2IEGA 5ARDA 5ILGA 4LFAB 1QFXA 2AN9A 4U7HA 5LXTF 3E2PA 2DYKA 3TVDA 4Q19A 2XQVA 1XZEA 4UC0A 3JWPA 4H0NA 1Q6ZA 3LKZA 1CIPA 2WLSA 4FEYA 3IMFA 5D6OA 2EG5A 2H31A 3NATA 3PXDA 3TSYA 3KKEA 3U4DA 1P0FA 3LPLA 1AA6A 2P2DA 1Y82A 4MRRA 5K3FA 2ID4A 3L1JA 3OAAA 2W22A 4QZVA 1ZCAA 4OGKA 2GPAA 3WXBA 3WQBA 4BFTA 4XR4A 3A2KA 1NXOA 2NQTA 2DBRA 3GXBA 4PLHA 4ARSA 1K3TA 3EHEA 1CJCA 1GG2A 2FW0A 4ZXFA 3W5UA 1ZHOA 2A7XA 3FLBA 2V9CA 4PR0A 4UAGA 3RVNA 1KVUA 3HBAA 1IB6A 2FFHA 2UYYA 3GDHA 4OQ4A 3RUEA 4RF5A 2JGNA 2PKWA 3WYGA 1YCGA 1SWVA 3EC2A 4CLRB 2Q5FA 3TL6A 4E7OA 2VF7A 4LRTB 1P6QA 2Y0DA 2FZCA 4HTFA 1KWGA 3PQCA 3VVMA 3G89A 4V3BA 3MOIA 3DEHA 1DS6A 3O2NA 4Y6GB 1EA5A 4BNHA 4KZKA 5IHXA 3QUTA 1M6HA 1MOQA 2PH5A 1GPAA 1F6WA 4I5EA 2JB9A 3AIOA 5B1YA 2B9EA 2CVPA 2A3NA 2QPLA 4NBLA 2BDTA 3S68A 4M53A 2PE5A 4RF2A 2OHXA 2P4UA 5LDGA 2NM0A 2EFHB 3EWNA 4DIOA 5CB4B 1XHLA 1O77A 4NIMA 4ARUA 2ZTMA 5AW0A 3B5JA 1LPBB 2JAOA 3E5NA 3C3MA 2GZMA 4BKPA 4I3FA 1R88A 4UUPA 2YJ5A 3IDFA 2CF6A 1OWNA 1UPXA 2YWXA 3B48A 4XGRA 1OV6A 1REQB 3JQ7A 3LQ4A 3T5GA 2W2VA 5JXWA 4O4HB 3AEZA 1J9EA 2XTJA 3QM1A 5DTJA 1QDEA 2O8CB 2PPVA 3CF2A 3EWIA 4F7DA 5ALJA 5EL0A 3QFCA 1CUFA 2GK3A 2OV2A 4FK8A 5HJ7A 4JB3A 2VHCA 4IOLA 4GX5A 1J8MF 3EUWA 5DT2A 1U02A 1FZQA 1L8OA 1Z7GA 3DPIA 2WFAA 3OOYA 4DGQA 2AZDA 2O2CA 3AKZA 4KLZA 4O2AB 4EPYA 5JWRA 1CUAA 3W6ZA 4DVJA 4UXJA 1K8YB 2PTGA 4WA8A 3WR5A 3WBBA 4AO7A 1X7DA 1KPHA 3AB7A 3JQAB 5THQA 1CIJA 1OLSB 3KZCA 1A7AA 4LXGA 4AS2A 4RJTA 3D3JA 5F7JA 3QTBA 2XXAB 3QKWA 3UHOA 1PJAA 3RU2A 4ZC1A 1UAAA 4Q18A 3CONA 4BGEA 4JU8A 2WHQA 3G9QA 4PQYA 3VX3A 2Y1OA 5KPJA 1KDPA 2FCRA 4H16A 1SFRA 4WXHA 1NTRA 1U7WA 5GONF 2MSCB 3UK0A 4LJKA 1J2YA 1N5DA 4RADA 2I1VB 4RVNA 2IH5A 1MX9A 3CLUC 3RT9A 4DVGA 2EKBA 4L0QA 4FKMA 2NPIA 4N39A 3MRVA 4OFZA 3T52A 4LDJA 5E1MA 1NJ1A 2P9YA 2QAJA 2BELA 2ZS8A 1M33A 3TMYA 3L0CA 4NV3A 2A9JA 1ZA1A 2I2WA 2NTNA 3LUAA 4TL7A 1TUBB 1ZG3A 3G79A 3SMQA 3MINA 4J6EA 4KXVA 5L6LB 2CL5A 1TO2E 2XGOA 1QQ6A 2ID8A 3UKOA 1JHDA 2BMDA 3A70A 4ZU3A 3EIXA 1L4UA 2X0RA 3K8ZA 4GP7A 4L9AA 4UMVA 5M34A 3RYCA 4QYSA 1YB1A 4JK3A 3EXEB 5KYNA 3AU8A 1Z2OX 2QSJA 3DFUA 1ZN2A 3I04M 4D97A 2P79A 1AMOA 1G20A 1WD7A 1U9IA 1P44A 4UNIA 3TAUA 1G8HA 5IKEA 3KETA 3IIEA 3K31A 1W73A 5G2OA 1NIPA 1YF3A 2BVNA 3NHLA 4EFLA 3TD2A 5BN3A 2QQFA 5H8WA 2HA2A 4DC1A 1HXHA 3S81A 1MABB 1XRRA 4M7RA 3SEAA 2N42A 1TYEB 3BULA 3BMOB 4XZ3A 3GEEA 4ZJUA 1E0DA 4YAJA 1RLIA 4LZOA 4H18A 1GV0A 1H65A 4KVFA 1USVA 2I2DA 3U7IA 4IHAA 3ZDEA 5AUPB 2JHAA 1A9OA 2XRMA 1X1TA 3FR7A 1NC3A 1Y1QA 3C4QA 1POXA 3QBJA 1MV8A 1Z5NA 2AL7A 2CZQA 4L1KA 2LR0A 4MGZR 5EWMB 5ITSA 4KFRA 2JFHA 1QQBA 3IH5A 5AK6A 3IQIX 5FFFA 3WSTA 1TT7A 2B4KA 4EEXA 2XXBA 1OTHA 3BMNA 4YPFA 5AKYA 1WPXA 4YP1A 1G3RA 2ZAIA 1PHPA 4QG3A 1PZFA 2E4YA 5KNBA 5KNBH 1G2QA 1PWEA 4H1VA 1RXIA 4HFRA 4FNGA 2HADA 3B7GA 2C58A 4L74A 4OPMA 4AX8A 2XWJI 4H08A 4KQ9A 4Q48A 4ZAYA 2FZVA 5KJEA 3WBKA 4B9EA 1QIIA 2BTQB 2OOSA 3LS2A 3EZFA 1Q0PA 3NKVA 2IHBA 3OM8A 4FCTA 4KLRA 4MYCA 1OW3B 3KX2A 1U2QA 2YASA 3VH4A 1SHKA 3KPUA 2YOHA 4B7UA 2Q3HA 5B1IA 4IF6A 1GZSA 2LNDA 3RADC 2XITA 1Z0FA 1CRZA 2BHNA 2NV2B 4Z9XA 3QFTA 4YGYA 4H3VA 4UZEA 4EKEA 1OYVA 3OO1A 2I2XB 5EA2A 5E6SA 1CZLA 4R5MA 5B64A 2QHXA 1Q17A 4FDLA 1AKQA 2PUBA 3UICA 2IIQA 4ALJA 1V8FA 4J0DA 2FF5A 5A4AA 3AM4A 1Q20A 3COVA 3DONA 5E3JA 1UK9A 3OD5A 5KYXA 2P6UA 3EDQA 1NW4A 1IK4A 1CUWA 1XZFA 3X44A 1GU1A 2R7NA 2B7CA 3TLGA 2C7RA 3FUXA 2X5JO 3M7IA 4P4GA 4ZQGA 2PZ8A 3GP8A 3U9TA 4BLPA 5BSEA 5C1OA 3OQPA 4G8JA 1QDLB 1VJGA 2O3UA 2X76A 3AEKB 3LUGA 3KVVA 1NNI1 4RVSA 4MINA 5FI3A 4J3JA 4C06A 3NUGA 1AQIA 1GOTA 4U2GA 2F43A 2J08A 1HBJA 1AUXA 3KEGA 1FDWA 4L08A 4L9RA 4DY6A 2FMTA 1SULA 2B25A 1O95C 3DHWC 3DJFA 2CB9A 2NU7B 3EXAA 5T4FA 1QHSA 4L5BA 1TLTA 4ZT2A 3K0FB 1U7HA 3UG6A 4E31A 3UT0A 2V45A 3D1VA 3AHJA 1IQ0A 3FWHA 3I05A 1FP1D 1WMDA 2R1UA 4DSAA 4ZEVA 1UWCA 4YGXB 3QU9A 521PA 1QJCA 2WD8A 1G5TA 1NI5A 1X1AA 4NFHA 1I30A 4YP7A 5AVSA 4PX9A 1GZHB 1QOPB 3M5DA 3LKDA 1NT2A 2H8KA 2EJTA 4CFYA 4IJVA 4O3FA 5TMPA 1ECBA 4X1IA 4JI5B 2HDHA 3SY8A 4WIAA 3FSGA 4R2HA 3WDLA 5BSHA 1U2SA 2PBRA 2QN2A 2ZWIA 1MFZA 2I2CA 3MJTA 1B3RA 2PX4A 1QRDA 4KJXA 3FYUA 3LUDA 3PQ5A 4M89A 4QECA 3MTBA 1T4MA 3O31A 1W85A 1A4UA 4XWTA 3NHSA 5K0ZA 1EFVB 4RS3A 1FX1A 1G3UA 4IFIA 4DDHA 2HRCA 2W71A 3FDXA 3MHTA 1FF9A 2Y71A 4C30A 3EEFA 4MDEA 3DDWA 4O2AA 1UAYA 4A9AA 1QANA 1CLEA 2ZIGA 3TGPA 3KEFA 2Q2VA 3QW4B 1UDXA 3P9KA 1QUFA 2HJVA 3JWHA 4NI5A 2OD7A 3HJGA 1H2WA 4Q00A 3IOCA 1K88A 2IIBA 1NUSA 1Y81A 1HH4A 1Y5IA 2ZBVA 3Q8WA 1GILA 1JYSA 4Q21A 4KE6A 4DUGD 4YDQA 1ZK0A 1FFYA 3KTAA 2ODBA 1OVGA 1NMZA 4YFYA 2VJLA 3U3DA 4YT8A 1KY2A 1R6UA 3RG2A 2GQ0A 5T4BA 2NVOA 3A7DA 3I61A 4ZU1X 4QT4A 4E51A 2W6QA 5IRCD 3HJNA 1ZJ4A 3SHTA 3UJ6A 2WD7B 2WJ4A 3AUTA 3L8CA 3A06A 2R6GA 1HKHA 1T1GA 1XPRA 3AY0A 1UKAA 2PUGA 1M74A 5CVDA 3UWOA 3G7UA 4M8KA 3JQ6A 5FI1B 4KPYA 5EXPA 2N75A 3TDNA 1L5LA 3K9HA 4BE7B 2C88A 3EDMA 4PC1A 5IBQA 2C54A 1UPBA 5AVOA 5L7YA 4PFSA 4LISA 4BX9A 3OQ1A 1JMKC 4WFKA 4AUEA 1LRKA 3HJCA 2OLKA 4MVYA 2XCRB 2PH7A 2ACEA 1I3OA 3I9V6 3IKLA 2DR0A 3LT1A 5IJWA 5KQLA 3OC6A 3WWPA 2HTEA 5HE8A 4A2QA 2GJ4A 1B73A 1DE0A 1TDJA 1I5OA 1HE8B 3A9VA 5EIAA 5KWEA 1XWFA 4EB8A 1W4LA 4H1WA 3DLCA 1RYDA 4CYMA 5IULC 3VSAA 5GM2A 3N0WA 4JLUA 5HIMA 4UXHA 3DHEA 5H4GA 3KT0A 5DN9A 2GEFA 2B69A 4BEVA 5IH3A 3GW8A 1DJLA 5EIOA 3URMA 4Q9JA 5GV7A 4A0HA 1EX9A 4IG4A 1V71A 4TL9A 3SQWA 2XOXA 1HYHA 3E3LA 1Q7TA 5IXJA 2DQ4A 3BQMB 3CPEA 3HN6A 3HRIA 1WW8A 3WIUA 5IK2A 3UH1A 2R7AA 1ZJYA 1AQUA 1E4OA 1ZGJA 2CLSA 2VP6A 3CW2A 6PFKA 4ARIA 1SQSA 3ZWYA 2XCUA 3MHPA 3GZJA 1PVDA 5SYMA 4ZGGA 1SHUX 2YZKA 3ZGXA 1TNDA 1EEHA 3L6RA 3SI7A 1MENA 4JITA 4B8WA 1S6YA 2I87A 3V1UA 4HEHA 1STOA 1T15A 2AT1A 3QIVA 3T35A 2NU7A 1E98A 3FHCB 1CJBA 3FY4A 4BP9A 4DNQA 2GKSA 2GETA 1IMOA 1NWCA 5GQSA 3DDCA 3H4MA 3WP1B 3SXPA 4REQA 4BPBA 2BY4A 3IUYA 4M7WA 4LJAA 1U5AA 3DMDA 3OTQA 3RT1A 3COYA 4KQHA 3ROGA 2P3QA 3WADA 3CO5A 3E4CA 5KVSA 5DLYA 1USWA 2ERCA 2FSPA 3EDCA 1U9JA 5TJ9A 1GT91 5KTSA 5KU1A 4AG6A 1SIWA 1U7OA 3DC2A 1B3BA 2VZ8A 3OE7A 4UE3S 1ES9A 1O9HA 2XWQA 3D0OA 4DCGA 3IPLA 4OL0A 4I5DA 3JPWA 4BLVA 4J16C 5ALPA 4RQUA 4HQ6A 1P2TA 1DRUA 3G13A 4LV8B 3Q6NA 4QAQA 2RC5A 1EHCA 2D0DA 5GONB 4KHPB 1LSUA 4OUKX 1FP7A 5K8IA 1VZ3A 1E1CA 5GOTA 4C01A 4G0VA 4PYQA 2Q6VA 3M4JA 4I55B 3IP3A 1G17A 2ZRKA 3EHDA 4QUGA 1B6GA 3SYRA 3WK6A 1QTQA 4UQLA 1DEOA 1CJVC 2ECQA 2PX5A 1NW6A 1SC4A 2PBZA 5DHRA 1G8SA 4WXRA 4CM6A 4B75A 1R5BA 2SHKA 3OF3A 5I3CA 4DIEA 1DBPA 1EM8B 1SG0A 5AHOA 3MTIA 1XF1A 2PUTA 4E2WA 4FQ8A 1PZMA 3C8DA 4M21A 5BNIA 5IYZB 1D8TA 4B8YA 1ESZA 3OQHA 3T1QA 5FIUA 2F1RA 1IM8A 1UBOS 2QI9F 4DR3B 4XVQA 1XJCA 2HDWA 1PD0A 4MQEA 1VLLA 1HT3A 2C2BA 2AD5A 4KMRA 3MQ4A 2B4TO 3ZEIA 1QRUA 3G2LA 3TR0A 3ID6C 5J5VA 5CIWA 2I4RA 3IT3A 4B6OA 1WW3A 3N8HA 3R3HA 1XEFA 1TK9A 4MUAA 1MIHA 1Z56C 1Z39A 2AJLI 3AC0A 4O4HF 3F1KA 3RDPA 4A5SA 5LWHA 4IMJB 1YZLA 4F85A 5KNLA 5DVZA 3RB8A 2OTCA 3B2NA 5H5JA 4B3SB 4XJXA 4CI0B 3MUOA 5C18A 1RYBA 1YZUA 4E3WA 4FBLA 4YJ2A 3H9QA 2DTXA 3AB3A 3GVXA 4M9UA 4NOLA 4UVIA 4EAAA 1BVUA 3WDKA 1P6XA 5CCXA 1Y8ZA 3C3JA 3VPCA 5BP7A 2QVGA 1ODFA 1QSGA 3LX5A 4KAAA 1AQ6A 4MVXA 4C78A 2Z6UA 1M6NA 5K8CA 1YO6A 2HBZA 1KGDA 3S29A 1SOAA 3MJSA 4MWTA 3QNUA 5FFMA 5EJGA 3GGCA 3ZIAD 3BZUA 3P32A 4E2FA 4JLBA 1G6OA 1E9BA 2HYIC 1ICEA 5E9QA 1YA8A 3ESQA 3C5HA 2TMGA 1YDHA 2XTMA 4GR4A 4LTMA 1XZ8A 2HV8A 3L2OB 4ED9A 3IVXA 3MCVA 3DLHA 4HAIA 1R15A 3WLMA 3X1ZA 4MWGA 4BU1A 2MMCA 2OFXA 1FOEB 2W8BB 3BE5A 4E22A 5K05A 4XQEA 3K1YA 3HRHA 5A9SB 1P3DA 2RH9B 4N5IX 3PLAE 1X87A 1D4ZA 2W0MA 1QK5A 2PZBA 3DDOA 3LZCA 1SCDA 4FNOA 1G21A 4L5JA 1II8A 4WJZA 3VR6A 1ZOOA 3SDSA 4HAUA 4B6QA 3NJ8A 4R6WA 2HRDA 4B8ZA 5EZ6B 2FVYA 3GRYA 3OPYB 2W2MA 3L5KA 5IXYA 4A8JB 4ZGBA 5I47A 1A2BA 2M9MA 3DOUA 4KB5A 4FB5A 3F5QA 4QDKA 6ADHA 1Y1SA 1MIOB 3LT2A 3TIGA 1YOVB 4LZWA 3LBAA 2VPIA 3VHQA 1Z75A 2R5WA 3JRWA 3FVWA 4FOOA 4MV8A 3W78A 2CJXA 1YA4A 4KQGA 4R84A 1EFPA 3KSUA 4JR0A 4JT2A 1DLIA 1PTKA 1V5EA 2NSJA 3CY6A 4G1FA 2A9KA 2E5FA 4FLEA 2P2GA 1NJ5A 3IO3A 2BF4A 4FINA 4KIUA 2ORIA 3ZHXA 3CZRA 2H06A 5E2AA 1LZLA 1YIOA 1X42A 1EAYA 4C6SA 3CRQA 4Z4GA 2D6FA 3CX3A 1WDTA 1R8XA 1PN3A 2XXAA 3AM3A 4DLSA 1NMEA 5AVTA 3T1VA 1FTNA 3ZC3A 3QMPA 1O0CA 4KREA 4L6AA 5FUMA 4CM9A 3TO5A 5HGXA 2OFFA 1IG3A 2E4WA 2CBZA 1HE4A 2PL1A 3ZGZA 4WGGA 5SY4A 4EJ0A 4QOIA 4CEIA 4LECA 2IXAA 4M1QA 3FDJA 5IAEA 4H3HB 2ZVJA 1XQ1A 4CMKA 3UAZA 2BGJA 3NBAA 1I2AA 3GNQA 2GHTA 3SEFA 1WWKA 2W70A 1NLZA 2YWEA 3JY6A 3WI7A 1O5OA 1UZMA 1MORA 4XLLA 2HA4A 3IP5A 4URHA 2EKZA 5DLDA 5GPBA 2K7FA 1D2RA 4N3NA 3GDOA 5HCNA 2DBQA 4PVCA 3R9KA 4ZAFA 4EG1A 3NBMA 1K4MA 1VJ5A 2B8NA 1GM5A 5DB4A 3A6ZA 3IP6A 3R7WA 1M2OA 4HRVA 3O8QA 2PNJA 4F3RA 3SFZA 5AW6A 5K45A 2D0PB 4CF6A 3QQ5A 4P4SA 4DREA 1Q1NA 1U9CA 3H0EA 3H84A 4KR0A 4ZOCA 4DJ5X 1ZI9A 4S05A 3MGCA 3H42B 3OEYA 5E7IA 2W6JD 1SBTA 5FI5A 4IQ0A 1G8GA 4X54A 4WLVA 2IU4A 2HJHA 2J5XA 4REQB 3TM4A 4DNOA 2H5LA 1PDWA 3BRWD 4DAEA 1EESA 3T1OA 3S0JA 2QRMA 2WILA 1Q0SA 4XAQA 3A6FA 3QVSA 1WIWA 2PKRA 5IDWA 4UTXA 4FX5A 1A88A 4JBLA 1GL3A 2EFYA 4MTCA 1PFKA 1E4VA 4CEHB 4QGHA 4LY9A 1UK6A 4GD3Q 4A5OA 3SIXA 4OFXA 1I4EB 3O26A 5FEMA 3TS1A 1J8VA 1PWZA 1T4DA 5FBZA 2JEZA 3A6GA 4P7JA 2NT3A 3VC2A 3EXFB 2BRUA 3EOBI 2GPJA 5FTKA 1Q95A 4K6GA 3SYTA 1PFGA 3DE4X 4K5QA 4OUDB 1LDEA 2VYFA 2J7KA 1DUSA 2FF7A 4OI4A 3ZEAA 3EXG2 4GVPA 2B8JA 5B37A 1QHIA 1Z2CA 3W4JA 5TR9A 4BL5A 5LLDA 4G8BA 3P0HA 4G5YA 2EFDB 3CT4A 3ZY2A 3UJPA 1LLFA 4RZSA 5TB5A 3RROA 2IFTA 2O50A 4DCPA 1CU1A 2DQSA 2O1SA 2WWVD 3TJZA 5FTWA 1T0BA 1NX6A 4O08A 3ANLA 4F4IA 2J5RA 2RBGA 2NP6A 1N9ZA 4L15A 1IE3A 1I32A 2Q5QA 4FP9A 2Z9CA 1U90A 2XZOA 4RU1A 1XP5A 4BVAA 2GN2A 3D4OA 3KKNA 5BYKA 1GPJA 2JKYA 1XTTA 4MIOA 4NZMA 4YCSA 2C1ZA 3AVUA 4LOJA 3O8RA 4N0EA 1EWYA 4B4VA 3THWA 2V0GA 4MV6A 5IT5A 4K03A 3NM6B 3CUTA 2V7PA 4Y1GA 1X92A 2JGRA 3F8SA 3G02A 3HCOA 3PXAA 1KHTA 2RKWA 2WLTA 4MMZB 4RPHA 1OLUA 5K2MA 1Q92A 1ZCBA 4I50B 4XTCS 3UMGA 5CFOA 2J3DA 5CCDA 4LKOA 1K08A 1QVRA 1JZTA 4WCVA 2FP4A 3UJCA 1Y8RA 1Q7RA 1H4TA 1KOLA 3RU9A 4E2XA 3R3YA 3LX6A 4IIHA 1X1SA 1IVYA 4TTQA 1JEQA 1YBAA 1GNQA 2I34A 3WYEA 3CX8A 2VWPA 2BIFA 1P80A 3D2BA 1D3AA 5J40A 3WMEA 2ZTLA 2PUFA 5HQJA 2XMSA 3ENNA 2Y1XA 3KAKA 1PJTA 1WZEA 3E84A 3PGVA 1K5PA 3HE3A 5JFGA 1MDBA 3NXSA 5K0TA 2Q4EA 1QR2A 2X2OA 3QJ5A 1N78A 3O75A 2MR5A 2BEVB 1JECA 4HADA 2XDAA 1AS3A 4GI5A 3V7WA 4GPZA 1NTOA 2OWEA 4OU4A 3IBTA 3OCWA 3FGNA 2DFVA 4GKJB 1YSCA 1BS9A 5BW8A 4IVRA 4EUHA 5KINB 1XB2A 1J21A 1KQ3A 2IEAA 1C7IA 1PBNA 4LC1A 2GASA 5FOSA 2A59A 4UD6A 4GZ5A 2ETXA 1YR7A 3GZNA 4FSXA 4BVHA 5KB3A 4JBIA 4E08A 1UC8A 3VR4A 4ZMRA 4I8IA 4DSTA 1IAVA 4PAQA 1X77A 4QHYA 3I2JA 1QK3A 2G9QA 3LA8A 4F56A 1NOIA 2A0UA 2FFAA 3CLUD 4B48A 5LZ2A 2JPDA 4MOWA 4MYDA 3UHPA 1SN7A 1EP1B 2BLNA 3S2UA 1SG9A 1DIOB 2B8WA 1GGNA 2XAAA 4U2BA 4JBGA 5LMUB 4Z3DA 4XWYA 2PPLA 3AFOA 3FNHA 3TJMA 3EZLA 4D81A 1T2EA 2O7SA 2YHBA 4A8PA 1KTIA 3TG2A 2WMOB 5JAZA 3P19A 1SKYE 1LLCA 1ZM2A 1RDFA 1C8KA 2NN3C 2UVDA 2ZJ4A 3DZBA 3HDVA 3Q3CA 4KQFA 3TW0A 1HT0A 5KEIA 5G0VA 4G56A 4L85A 5CDSA 5K0BA 5A62A 4BRZA 1TM2A 5JBQA 2XNDA 2C5EA 3HJBA 4P38A 1QVAA 3A4LA 3ZDQA 4DGSA 2VKQA 1EZ1A 2CXOA 3D3WA 4F9GA 1B74A 4OOEA 1BE0A 1L4HA 2I91A 3EIOA 3OECA 4ZOEA 2FLVA 3QX9A 2CMKA 4M7PA 1ADCA 4Q9DA 2J3QA 3T3EA 3TVYA 1THTA 2HWUA 4YQZA 2NO1A 1GR0A 4KPEC 3TTXA 4QBGB 1UXOA 1BCSA 1HC7A 1Z33A 2WKQA 3DUWA 5E2BA 2I2AA 4CDNA 3VR0A 1GNSA 2J9GA 3ZUGA 4B46A 1R6DA 2R751 3KV1A 3PWSA 3LSYA 4D0NA 1UOPA 1R3DA 3HJUA 2GVZC 4B6RA 5EPOA 4JYAB 4OY3A 5B7NA 5KX5A 4UUQA 3FPGA 3WQSB 3DR5A 1IM2A 3KC2A 3MLAA 4DSOA 2FZLA 1JDBB 1YL6A 4K0RA 5JBIA 4XVRA 4G1EB 1KQFA 5I5GA 1NVDA 4LHVA 1XDSA 1W88B 1W0KD 1QFJA 2H7VA 2V7QA 4S1WA 4JI4B 2ACWA 5C7OO 2GA8A 2QTVB 2JGDA 4LXXA 2NU9B 3SS7X 5KNDH 4K87A 3GUZA 2ILVA 2ZSHA 4GKKB 3SJCA 2HA5A 1GG8A 5FL7D 2H4XA 2ZBUA 1UPUA 1SUWA 1Q0TA 3UWSA 4YAGA 2DUUA 1PTJA 2DBZA 3KFLA 2IYZA 2B20A 4CU5A 3ZN2A 3TSAA 4PNZA 5AW4A 4QNNA 3RJ5A 5IM4F 3I0NA 2AHOA 5CURA 5GIPE 4X6YA 2HSDA 3GT3A 3EPHA 1US8B 3HTXA 3B7WA 1VYHA 2ZBEA 4ZAVA 1EGQA 1EQAA 4J1TA 3M6IA 4J6FA 5C53B 1H8HD 2BF7A 4CCSA 1ZLYA 2ZUSA 4P3OA 5CA0A 3WWEA 4ZV4A 4H7IA 5SY6A 3LVRE 1G21E 4K46A 4OI1A 1EGMB 1ZSNA 2WC1A 2NPFA 2X8WA 2HNBA 1P73A 3J7TA 1AT1A 2HWKA 3VH2A 2J7PA 4PC7A 1JKIA 4CG1A 4RY8A 3VFDA 5JJIA 1NJSA 4D44A 3TEJA 1G66A 4S1VA 4XPIA 1T4CA 3A1WA 4ZVMA 1EHYA 1SGWA 1P5FA 3AKYA 3MTGA 4G84A 4NCXA 4AUKA 4DG9A 5A02A 5BN3B 1FJGB 1X14A 1Q1ZA 2CLKB 3ZOZA 3AR6A 1NVFA 2JGFA 3IODA 4O1IA 4OHFA 1NJ8A 1JFSA 1O08A 2JAHA 4OH1A 2F1HA 1NWHA 1SXJE 3FVTA 5F1KA 4FOLA 3ZJVA 3GRKA 4OB7A 2RGXA 3L4JA 1OB2A 2C20A 4I2NA 5AI0A 3CG0A 3OPVA 4J4HA 5T5QA 2NNWB 2XUIA 2XSZD 5HW0A 3FZGA 3NTQA 4O4JF 2Q46A 2GSWA 1L4MA 2H00A 2QRQA 3C3EA 2DFPA 2ECFA 3AZQA 1OXBB 3EEYA 3IEUA 4RD0A 4E7PA 4CN8A 2G88A 1P5ZB 1ND6A 4PGMA 4O29A 4DQKA 2WWHA 4QYMA 1B2RA 1GGKA 1LQ2A 1SBZA 1MV5A 1GU0A 2O6LA 2AXEA 2ROQA 1D03A 2NACA 2YCBA 2ZBRA 3ELDA 3L7BA 4XW2A 1MH1A 4Z3OA 1A2KC 3LDFA 3TCNA 3GHHA 3FPJA 3BD7A 4I6EA 3BMQB 3X2SA 2DWCA 2R8PA 4B0OA 1CF9A 1CUIA 4R9NA 2OA0A 5FLYA 5A7HA 1OPRA 3RRNA 3FLMA 3DHNA 3V32A 5AIAA 1FIUA 2ZZMA 5HS6A 1UAGA 1VIVA 2CNBA 2JIPA 2Q4DA 3RQIA 4BVGA 3D7SA 1OASA 1GUDA 2ORWA 5TDHA 3L7IA 3ZXXA 5K3BA 2H1OA 4BLOA 4UCXA 5DM4A 1M67A 4CKEA 1NIJA 4UKDA 2DSTA 3SSAA 1IDOA 3G8YA 1IU9A 1EK6A 2G36A 1EZZA 1U7DA 3CLKA 3CURA 3LBIA 4GGOA 4PPQA 5THKA 5J2TB 4ALKA 2QVBA 3QI2A 1J24A 4CU2A 2PMBA 2DHRA 3HVKA 1F8XA 1GR1A 1M6VA 3IC5A 3L7MA 3M6LA 3IPCA 4M0CA 4NNPA 5FOWA 4I8XA 1KJ9A 3O2QB 3DBRB 1AM4D 1A72A 2WWWA 4Q39A 4EBFA 1VE5A 3GFFA 3IBSA 3JVUA 2AFIA 3D8TA 2JHCA 5G40A 2CYAA 4CT4B 1YWGO 4YXWD 4NYMQ 4DR7B 4DOMA 1IRXA 4C0WA 4LHSA 2R4UA 2C95A 1RHQA 2MTBA 4NY1A 3W2IA 2JFGA 3JQEA 4G0WA 1CUVA 4INOA 3JQ7B 4NFLA 2WY2D 2GYWA 1DFGA 4DQLA 4DMLA 2YNMD 3GFBA 2CZCA 1S8AA 3KOYA 2YIDA 4WERA 2AVNA 2P30A 2HPHA 1ZH8A 3I5XA 3T4XA 4AJIA 3KQVA 1MXHA 2SKEA 3C98A 4YASA 3SHFA 4S3MA 1ZMOA 2VYVD 4HAVA 1R0SA 4L8VA 2GBLC 4CG0A 2H3EA 5EAIA 2ZUBA 2BKVA 1WHTB 3R5FA 1YZQA 1Y1TA 1XSEA 3NYQA 1KEVA 1H1DA 3DHVA 1XK7A 3I9MA 4NABA 5D00A 3TLGB 4C5CA 3SR4A 1ITZA 1QNLA 2X9NA 1JG7A 3F1LA 4TMVA 4B47A 3FYHA 1GPWB 4CRWB 2WHRA 4URXR 2G70A 2YYAA 5LD2C 3DQPA 4LTDA 1C3OA 3CT6A 2JRLA 1OHHA 3PGA1 4EA6A 2CUZA 4NBTA 4KX5A 4PN3A 5D7BA 1RLUA 4IFEA 4UUOA 2RGYA 3RU3A 3CLSC 1FPQA 1E0SA 1PGNA 2WWXA 2ZB2A 3RGWS 4V03A 4D6XA 2ZJ5A 3CXUA 4A92A 3GPLA 4DY4A 2ICAA 1SCAA 2H2FA 5GY7A 5BR1A 3R2JA 1E1RD 4K9MA 3OU2A 2MCFA 2JGAA 3ZKAA 1Y80A 2C7VA 1UC4B 4NCHA 1MX1A 4X85A 2YDXA 4LNAA 4YO8A 4ZOQI 4XRRA 3CUVA 1FDUA 1HYBA 2E87A 3TDKA 3B3GA 3CKMA 4D8XA 1E2HA 2DPXA 2HXYA 1Z4JA 2LP4Y 3KOUA 1KI9A 2WHPA 2G80A 1VP9A 4UDOA 3WGQA 3DD1A 1SOUA 3HJRA 2GESA 1JU3A 5LZ7A 3DBOB 1VBKA 3MRTA 4GMGA 1H0HA 4TRMA 1DAHA 5ALGA 3IKVA 5ER9A 1RI2A 4AF7A 3NYRA 3O4HA 4Q15A 1YB5A 3FM9A 3CJRA 3R8FA 1IHYA 2WT9A 4GI1A 4JJ6A 2ZE6A 3R8CA 1VCOA 2PZAA 4IDNA 4ZYZA 1U9IC 3OQMA 1E3QA 1LNSA 2RHOA 4C6TA 4MQFB 3WHLA 3U39A 1J23A 1KEWA 2QT9A 2Z0MA 5JARA 2OY0A 3OUTA 2BFEA 5BOSA 3WGLA 4ZI7B 2AZ4A 4FKBA 5CHYA 5D3ZA 2PX3A 4GYYA 1UQUA 1LEHA 4AURA 2MJLA 4CODB 5DTEA 1KL7A 1W96A 4U6QA 3K5PA 5JCOC 3R5TA 4BTEA 4DM7A 1TVCA 2PRJA 2Z6VA 2IOHA 2X77A