4Q7QA

The crystal structure of a possible lipase from chitinophaga pinensis dsm 2588
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
259
structure length
259
Chain Sequence
AKELTWVAIGDSITYLNDHLDETGNRVSKGYLTRLNEILPNLKYINQGHNGWTSGGIAGNIDSLGLIKADVYSVFLGTNDWWQGRPVGKLDDYQHDNGNTTVYGSFRIIISKIRQLNPEAKIVLITPMQRNDFVYIADAKNNAFGSYQKKNGQTLEEFANAVLTIGRYEQIPVVDLYHHPLLTLRNMVKFKHLKNPKNGKYVNYKYPAFVNIPFNPENNEYPYPPAAVNLTYDGLHPSDKGNAIIASALADVFRQLGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a possible lipase from Chitinophaga pinensis DSM 2588
rcsb
source organism Chitinophaga pinensis
molecule tags Structural genomics, unknown function
molecule keywords Lipolytic protein G-D-S-L family
total genus 91
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4q7qA00
4I8IA 4PPYA 4XVHA 2WABA 1ESDA 4OAOA 4LHSA 2Q0SA 3W7VA 5BN1A 5B5SA 4S1PA 3DCIA 4K3UA 1ZMBA 4HF7A 4NRDA 4JGGA 1VJGA 4RSHA 4Q9AA 2VPTA 4K7JA 3DC7A 4JJ4A 3HP4A 4K40A 3SLRA 2O14A 3PT5A 2Q0QA 3P94A 5CD9A 3BZWA 3U37A 1BWQA 1BWPA 4Q7QA 1K7CA 2WAOA 1IVNA 4H08A 1FXWA 4OAPA 1PP4A 1ESCA 3RJTA 3DT9A 1BWRA 4TX1A 4DEVA 2APJA 1WABA 5A4AA 4JJ6A 4K9SA 3MILA 1JRLA 1DEOA 4RW0A 4IYJA 1FXWF 3KVNA 4M8KA 5HOEA 1ES9A 1VYHA 3DT8A 1J00A 4JHLA 1U8UA 1YZFA 3SKVA 4HYQA 3DT6A 1V2GA 1Z8HA 1ESEA 3C1UA 2HSJA 5JD3A 2W9XA 1DEXA 4JKOA 2WAAA
chains in the Genus database with same CATH superfamily
1U9IC 3OIFA 3L8YA 2K87A 3RCBA 4R5MA 3LQQA 5F76A 3HBMA 1DX4A 1NM5A 4FNOA 4AY5A 2P9FA 4FN5A 1PR6A 1NUHA 3Q3EA 2RGDA 4H18A 2WHPB 1TKBA 2D0IA 5JALA 4F11A 5DT2A 1P8JA 5K9ZA 3H0CA 1F3OA 3MVEA 3PUYA 4AD8A 4E88A 2IFTA 1NTOA 3DDOA 1NJ2A 2B34A 4OK5A 4XM1A 1ADJA 3LOPA 3HN2A 3TSAA 1HDZA 5G40A 1DKQA 3C4JA 1NIJA 1TEVA 3LX6A 3F5QA 3TZBA 1QU3A 1XALA 4JT2A 3U3MA 1OR8A 1LPOA 2Q6IA 1T4CA 1I30A 2HQSA 4H7JA 1T0HB 1QONA 2J6BA 4LI0A 1DTSA 4JI7B 2UZ4A 1GRRA 1FMTA 3PL5A 5KX5B 3FWPA 3JR3A 1QGOA 4MVJE 1SQGA 1RXUA 1HKHA 3OTIA 4WY5A 1A5TA 5AM4A 1FRQA 2AUTA 3CV3A 3LU1A 3W78A 2P1DA 2HUNA 1UPBA 3FR7A 3WDKA 4GT1A 4LDQA 4ID9A 2ZSIA 4KXLA 2EBWA 2XA9A 1PG2A 5E95A 2NU7B 4TGLA 3FHTA 4MYSA 4XIFA 3MWJA 3O8DA 3K9CA 1COWD 2ZBRA 3U49A 1M2GA 1EBBA 3Q3VA 1YQQA 5EEGA 4NY1A 4N6NA 3GOHA 5CVCA 3GEIA 4HWOA 5EQTA 5K0NA 3R5SA 4AB1A 3I73A 3OJ0A 4P80A 4HGOA 2N42A 3EC2A 3STXA 3TR0A 2DH6A 3LQKA 3ZQJA 5KZMB 1KIAA 3IA7A 1DCTA 2FQ1A 1Y80A 1TAGA 3C15C 1SVMA 2FW8A 2P2CA 2Y77A 4RCVA 4M9XA 4NHEA 3UJAA 2BGMA 4C0SA 4EY7A 1K3TA 4M0FA 3IAS6 2H1VA 1BDIA 4BB6A 3PNVA 1FYDA 1ODJA 4YXWA 3VZSA 4P7JA 2GD6A 2HIMA 3LQ1A 5CT9A 4B4UA 2R5FA 5C7IO 5FYQA 5CDTA 4YLYA 2CNWA 1T8WA 2JGFA 3GXOA 1QVWA 5DWQA 4EO4A 1N6HA 3CZ5A 5TF4A 5L8VA 9MHTA 2ZJ2A 3AYZB 1AK1A 4OHOA 2HQOA 4UNQA 5CFNA 1H4TA 2E9SA 2G4LA 4TVSA 5EJGA 1PVOA 3ICVA 1HMPA 2JK1A 3KOOA 4N0MA 4XWAA 2NAPA 3W5DA 2BUCA 5AXCA 3DYBA 3DS8A 1Q7RA 3SXPA 1KNXA 1SU7A 4OYLA 3VZBA 2DKNA 3FYUC 4R2HA 2J4FA 4IF4A 1JYSA 3ZEAA 2Q3FA 2VDLB 4E2FA 2P6NA 3E05A 4QDTA 3EZLA 3TRKA 3S1SA 3T5CA 3M6FA 2EW8A 4JWKA 3FKJA 3IAS1 2QXUA 2W4QA 4ZT6A 4ZALA 3RFTA 1FNDA 4I6JA 4G86A 2A9JA 5JSYA 4YGXB 4J3NA 5IBCA 2ARKA 1MO6A 1XT6A 4WGFA 4JASB 3TWOA 3CVXA 4QXPA 4DMHA 2BFMA 2VT3A 1BHJA 4U2GA 4CDGA 4V0RA 2GPSA 4G23A 3LWNA 3RC3A 1DE0A 1RM5A 3W2TA 1GTMA 2EQBA 3QK7A 3R3VA 2JFWA 3VSDA 1C14A 1PYGA 3B7GA 2RI1A 3MLAA 4G5HA 4MV3A 4N65A 1R0RE 3D7LA 3INRA 3ICOA 1RABA 2AMJA 1AD2A 4FFNA 4KAFA 3ONVA 4CQJA 5LSAA 1UKEA 1YNOA 3H1AA 3T3IA 1T25A 2DVMA 4BMVA 2IHJA 4Q3LA 2WNIA 4ARSA 4TMTA 5IJWA 4S1WA 3FHOA 1UXGA 1YS2X 1FQJA 1GDHA 2FWRA 3GLQA 3WLEA 3N3AC 3IP5A 5JCPA 4OKNA 2JIRA 4EY3A 1FX0B 3DLCA 4AMUA 3C3AA 1GUZA 2XTZA 3BSYA 1VLMA 5H1YA 3NIDB 4JYPA 4NMHA 1QF6A 3DTVD 3FCCA 1XAGA 4DCTA 4IWXA 1BD3A 3F97A 3DEYX 3OIWA 1BDJA 4Y9RA 2WK1A 5G4KA 4NBWA 4AZWA 4FOPA 4DT1B 1UZNA 4JQOA 2Q3BA 2XA2A 1KZ7B 2Y1OA 3MRSA 2DX7A 3ZZMA 1BZYA 2QYOA 3MTBA 5GZ1A 2GCPA 1GNQA 4NJMB 1UZAA 1TAHA 3RDPA 2UZ3A 2A5LA 2Z3ZA 3HM2A 2GKOA 2N3ZA 4QZVA 1C9MA 4DGSA 2IU0A 2HDOA 4Q9LA 4AYWA 1PR9A 4QU8A 4DGQA 4ALJA 4YMWA 4BWYA 4JBWA 4XAQA 1CJUC 3G0GA 1WTAA 3SC4A 4NSNA 1J1UA 5I9TA 3VR4D 3DQZA 1YS1X 1YJQA 3ESQA 5A03A 4S05A 1XCGB 4RXMA 4QGGA 1O8BA 1ZW6A 2J59A 4R9UC 3RS5A 3TH5A 3VTKA 3HL0A 1KMNA 5B7NA 4GR5A 1YZTA 3RVRA 3CEJA 4MB6A 3UFXA 2QD3A 3WV5A 2EJVA 4TPKA 5AHWA 2I4OA 2PKWA 3PQFA 4LE2A 1CZKA 2XXAB 3DBLA 1JQAA 1HQKA 1O54A 2E49A 2GJSA 2QNBA 2ZEJA 3ENKA 1JDZA 3PF8A 4DV7B 1KY4A 4HNVA 1AUPA 2GA9A 4KYTA 3WGGA 1G7TA 4CV1A 1Y5NA 4NV3A 3K8QA 4QLOA 1Q92A 1RPJA 4NCXA 1IQPA 1Z34A 1S7GA 1Y9EA 4MKXA 3ISVA 1M1YE 1QH8B 1MX1A 5CDGA 3NNSA 1U81A 2I9KA 3OQBA 1I7QB 1HLPA 2NVUB 4XD2A 4A10A 1W5BA 1XA3A 2II6A 4NYIR 1I33A 3WNVA 3IL2A 1QTNA 3PUZA 4UFNA 4XYBA 2PUDA 4JVMA 5JAHA 5DP1A 3HV0A 3B1JA 3I5MA 4GQAA 5LOVF 1PEDA 3RT9A 1XXHE 1U28A 3MT7A 2V65A 2IZ5A 2OD9A 3BD9A 4K3VA 1U3TA 4PWZA 5FAXA 3ZHYA 3B2QA 4MVJA 4PQYA 2WKQA 1QIGA 1GLGA 2R00C 4X94A 3UJ3X 1X92A 1KEKA 2QX6A 1XNQB 2OC4A 5ALUA 4CQMA 5I7OA 5F1PA 2VAMA 3T1OA 5CA0A 5IDWA 2HA3A 5THKA 5CCXA 1N6PA 5IC4A 1OGJA 1QFMA 2FKNA 2VJBA 1OWNA 2R8OA 4CZ2A 2YS6A 3ZVKA 2ZATA 1R3DA 3DZ8A 4WKOA 3ZWAA 1MO2A 4H1TA 4OFXA 2KLHA 2BFDA 2QX7A 2Q4OA 1X8KA 4N9QA 2NO4A 2CLLB 1E2NA 4MH0R 4ZVRA 4LHWA 4UBLA 3HN7A 3FOWA 2F1HA 2G0TA 1UL1X 1UAGA 4RQTA 4G41A 4BMOB 2BFBB 5ERGB 1SD5A 2H2HA 3PIDA 1YZVA 4I3FA 2ZTUA 2B25A 3DFIA 3H8VA 5ALJA 5H81A 1UBMS 3WE7A 2JLXA 3M3DA 3DE3X 2MSNA 3ZW9A 4UAJA 3ESBA 4IOKA 1C3JA 5L7WA 1Q0TA 4IIEA 3OD5A 4UHBA 4HB4A 4L15A 4OUDA 4HOYA 5HA5A 4ZQFA 2ZRAA 3H65A 3DWGA 3PWZA 4MUBA 4YMLA 4A9AA 3CISA 3DE1X 1RCUA 1OH8A 3EBLA 4U7DA 2DFKB 1GPAA 2PH1A 1X77A 2VHEA 3JXEA 4G9BA 3T35A 3ZNOA 4JX9A 3BGVA 1AMNA 4P0TA 4BB5A 1R6XA 2WD7A 3DE4X 1ZU4A 2IYLD 4IPTA 4UVHA 5I9IA 2C8KA 3AFHA 3KEFA 2H5LA 3VNRA 4OHYA 1XCLA 4WN9B 2WTAA 5KHOC 3EG5A 1FP4A 4RAOA 1G6Q1 4YS6A 2PJRA 4TWBA 1BGWA 4N4AA 3GYBA 1PJQA 1ATIA 3DAFA 4FXPA 1FFCA 2G06A 2FN4A 4FGLA 5D5QA 5K3BA 1NUTA 4F12A 5BOSB 2NYUA 3GLSA 3NP7A 2XWPA 3KHUA 1UK7A 3E70C 2O3SA 2L18A 5IFLA 3W9UA 1VECA 4YCMA 1B26A 3IAEA 4CMEA 1UPXA 4QYMA 1LI5A 1E98A 2BHNA 2GUWA 3QKRB 5SY9A 1F5NA 2PLNA 3LG2A 4Y30A 4ZO9A 5CM2Z 2IOFK 4C22A 3SYNA 3W5SA 2QU8A 2W6JA 2CE7A 2VLBA 4OFZA 2B30A 1G5HA 4HAOA 1XD8A 2J85A 3IHTA 1H94A 3T1TA 1ADYA 3IUSA 3ZWYA 4H7DA 1A9RA 1BH2A 1B8VA 1KHTA 3EPKA 3OLZA 4B45A 3OSZA 4LJ6A 4LXHA 4U7FA 5J4YA 1DDOA 2EAUA 1EESA 5HCUA 2B20A 1A9TA 2C5SA 1PV2A 4II2A 4QJ4A 1JKFA 1N1EA 3R09A 1V16A 4G07A 4AP5A 2JFOA 4RADA 5CEFA 821PA 4BVEA 1E58A 1F4PA 2A5JA 2G72A 4KVZA 1KDYA 4X24A 4ZZIA 3RYCA 4O4LF 1VM6A 4JDUA 1W25A 1YRBA 2CZGA 2JC3A 3AOEC 4UM8B 3ZN2A 4E5DA 2CZQA 2PQ0A 1PG5A 3DV0B 2PKEA 3L0DA 7REQA 2PKCA 2I1VB 2VPWA 3EWIA 3ZXIA 1VKOA 1I0LA 1D9XA 1W88A 3K2IA 3QYPA 4ZQIA 1NN1A 2UVPB 4OOEA 3RT1A 2W7TA 4XEHA 2OG1A 4J0QA 4WSOA 5FFNA 1LDBA 3N2YA 5KWEA 4CF4A 5H59A 1EXDA 5EL0A 5D5PA 3F8TA 2BGJA 3K73O 5H9WA 4V2IA 1F8UA 4U9IS 5CYPA 3V4VB 6NULA 2WPNA 1Z5GA 1LSSA 1H2EA 2FR8C 2IVFA 2PZ8A 1EBUA 3N70A 4Y0NA 2V4ZA 5KVQA 5TB5A 4E09A 4EB6B 5CLJA 2FOLA 4IQ8A 1H0HA 2RHTA 1A9ZA 4JOBA 3FXAA 3PICA 1EVZA 1O58A 1WS6A 4OU5A 1TK2A 1TMGE 4BMYA 3MERA 2UAGA 5K0JA 2NP7A 4LHSA 1I94B 2NSYA 3IUNA 2M1ZA 2W22A 2PQ6A 1W8IA 1YE8A 3HDTA 4XIYA 4LIPD 5TS2A 2VO1A 1NVMB 4MUAA 1K68A 4ARZA 3RGGA 2GZ1A 5FTLA 4ZHSA 2I6TA 1E3TA 1A27A 4NHOA 4BBAA 2R00A 1AQYA 3R77A 1QRRA 4FFDA 1X8XA 4B3IA 5H4GA 3S8YA 2Q9AA 3CRRA 3D4OA 4BQSA 1ZK2A 4YCBA 1KEUA 5H68A 4HLDA 1J39A 5EJIA 2D0DA 3BXHA 3E1KA 2ATIA 4OQNA 4QL3A 4G5FA 4G65A 3KC2A 2D1YA 1GHTA 1JBQA 1Z6XA 3LY5A 3W04A 2FQXA 2I4TA 2B1IA 1U8FO 1GCGA 1RTKA 4FB4A 5ETJA 3A25A 1ZITA 4O02B 1YRHA 3ENZA 3IBCA 4MWZA 5ARDA 2ECPA 5BT9A 2KPOA 5BSUA 4M9CA 4D45A 1I4TD 2RKBA 3E9NA 5IJ0B 1O0BA 3DHYA 4PLWA 1ZRHA 5E6RA 3ZZ0A 7ABPA 1IU9A 1IULA 1ZESA 2CYAA 1R9MA 4HGRA 2XNHA 4K6GA 4KO2S 3MT8A 4C87A 1IWBB 4C21A 5A5GA 2H5IA 4JP1A 5AK6A 1Z3CA 2YJTD 5CW1A 4C2BA 3EAQA 2NTYC 4HX5A 1TO2E 2PRYA 1U8EA 4M89A 4MCJA 2WJZB 1L5YA 1PWYE 4QYXA 4US0R 4WOCA 4X65B 3GLIE 3UO8B 4Q24A 1J0DA 3WGLA 3TLJA 5C35A 1DOZA 1BXGB 2ZYWX 1IVYA 4HAXA 3MWFA 2BKLA 4NAHA 1IUOA 1L1EA 2AMLA 3V4LA 5F23A 2RG7A 5EKTA 4CR7A 4V1CA 3DFZA 1T2NA 1U8YA 3EGIA 3I01M 3R5JA 2Z9CA 3SPXA 4A8HA 4HUQA 5FX2A 3ORRA 1SXJC 3QEMA 2RHHA 5C8DA 3UOWA 2VDPB 2A84A 2CLEB 3WFIA 4BEVA 1SCQA 1XI2A 2ODTX 1IONA 3HEMA 4LGCA 2C9OA 1ZGZA 2EX4A 3LXUX 1DWPA 3BXOA 2E4XA 1LTQA 2HAEA 1OZFA 4O4JA 1WB6A 3I6ZA 4XW2A 3QE3A 2GZ3A 1P3JA 4AZVA 1CK4A 3TGWA 3TZHA 2BI7A 5BOSA 1CW2B 3T0GA 3VYSB 1RM3A 3FWYA 3DBIA 5LUBA 5IK2D 3EA0A 3ZWNA 3HSSA 4E07A 4CMEC 3BL5A 5AOCA 5BYJA 4EPTA 2R4TA 2ZAIA 4IM7A 4XLTA 4WQMA 4INPA 2P11A 5TQVA 4QBTA 5BV2P 2Z04A 3K9GA 1EINA 4JBNA 5FD8A 5LJLA 5F73A 3VVBA 4AUKA 4G8JA 3OTHA 2QQFA 1P72A 2YXEA 1AE1A 4UKDA 3W06A 2ZT6A 4PZDA 5HZGA 4F3TA 1BS9A 2HDWA 4JI5B 1JSLA 1MABA 3VJKA 2CVOA 5JSKA 3QI2A 3RU7A 5H7XA 2REBA 4RH0A 5ERXA 3I01A 2VATA 5LQDA 7MHTA 5F9MA 1VYTA 1TC1A 3THXB 2PUHA 2CHFA 4GX5A 4URVR 1JE1A 2I1QA 4C0BA 5KJFA 1YFLA 1KMQA 3AILA 1FXSA 4NBKA 5EZYB 2YDXA 2JEOA 3HZRA 2XMPA 2CLDX 2J9YB 3AR2A 4MQUA 1L5GB 4JXZA 3F6RA 5EIAA 2I7TA 2OT3B 2C1EA 1R16A 4MP6A 3TLXA 2E85A 1MMFB 3OAAD 2HWYA 2ZYIA 4WBNF 4U2EA 2QTZA 1XRJA 4CCSA 3OCCA 2BI4A 2BFBA 2V59A 1Z29A 3L1UA 4LYGA 2YVAA 4B33A 3NDRA 2G4VA 2EBUA 2XI4A 5HUQA 1BFDA 3ZWCA 2QJOA 2CHEA 1EA7A 5DGHA 1S1CA 3R7LA 1W1UA 4BVGA 4E6EA 3LPDA 1L4FA 3JX9A 2HDNB 1QIFA 2O8FA 3UJPA 3USZA 2PKQO 4PZAA 1IZ7A 3O1JC 4XTCS 3CLTC 3RUFA 1XRNA 1CZLA 1DKPA 3ZHBA 4OYRA 3G2LA 3I6BA 1CUBA 4BQRA 4JB2A 3FLAA 4D8XA 2C0CA 1OFHA 3IUQA 4BHTA 5ALIA 4X7PA 5IJZA 2XRZA 2FF5A 5BWBA 1FFAA 2J9RA 1SVWA 4LJ5A 1M7HA 2X9GA 4U6NA 5F21A 1MGOA 1N3BA 2Q50A 5B7GA 3KPVA 2FR0A 3W05A 3U16A 2BEJA 1NI4A 2RC6A 4JLSA 4YFVA 5HJ7A 2O59A 2FWIA 4QJ5A 2VBIA 3D1LA 1MFPA 1NXQA 1W93A 3T9FA 2ZTMA 3CUVA 4BNNA 3CF4A 5A0FA 4BUZA 4YMHA 5IF3A 5IZ4A 3QFHA 4QUIA 3U3XA 1W96A 3TPZA 1JT2A 2OHIA 3ZCUA 1T2DA 3FMOB 1QX3A 2GVZC 3GZNB 4IVQA 3NGLA 2GPTA 2VJQA 4LPKA 4MB2A 2FDCA 3GRVA 1C0IA 2O8BB 1EDEA 3RVQA 3VZDA 3EA4A 3FYSA 3LUJA 4OJMX 4F4FA 1QYVA 4RS3A 4NULA 4HVCA 4RKQA 2CLMB 1RR6A 4U1RA 3O90A 5FNVF 2D2FA 3U31A 4E2YA 1ZD3A 3KSDO 2RJ3A 2VDMB 3JZDA 1LSJA 1E9CA 3RHFA 2VPQA 1WUYA 4C0XA 3MT0A 1QHHA 4FKMA 2CLOB 2H7XA 3ZTWA 1GJRA 2XNKA 3SHWA 2ZAGA 4DA7A 2AEJA 4BNHA 1HNNA 2IGBA 4RV4A 1GKYA 1U3VA 3ZCPA 1JF8A 4BQPA 1EFAA 4KLCA 2FYTA 1DELA 1HYBA 3C48A 2JJMA 4FBLA 4AO8A 5DM60 4P3PA 1DFHA 4HH3C 1S2MA 1DC6A 1HFKA 4DARA 1NP7A 5MN4A 2M32A 4MRSA 1G64A 3KB8A 5E4TA 5IXYA 4HB0A 4JKYA 4E4TA 1LGYA 4W5OA 1U11A 3HFRA 4ACAA 4UBMA 1F51E 4S1TA 3T7CA 4XQ0A 3FLMA 1SXJA 2RMKA 3EIHA 1FDWA 1M8GA 3NJ4A 1ODTC 1IY8A 2VG8A 2ZSHA 4ABYA 2QGZA 4Q0MA 3CUKA 2GRJA 3FUTA 3HDGA 4PGHA 1FJXA 2GTPA 3NTXA 3ZWDA 3A8TA 3ET4A 3HXLA 5SICE 4BIMA 1H8HD 3NHAA 3IP1A 5IDVA 3MBKA 5KYKA 1OZHA 2A78A 1D2AA 3KE8A 1HTWA 2HUPA 3K0CC 4LYDA 4UOQA 3GJXC 3W5AA 4LRXA 4M1YA 1FJGB 3KAJA 2YVLA 4WRRA 1P2TA 2CLSA 3IPXA 1HSOA 2EFEB 3GCWA 2GPBA 3MN1A 1VGRA 5F4BA 5I7UA 1PZNA 2I3BA 3HWSA 2FQWA 1YB7A 1U9YA 5TMPA 3DAPA 2O19A 1Z2CA 3H5WA 5LA6A 2FEAA 2O7SA 3K4QA 2ZB3A 2C5HA 1SCUB 2BHRA 4K9NA 3ZVNA 2AFHB 3MJRA 2ZBFA 4L7VA 2CHGA 1EQ2A 4PTYA 4Z86A 3WGVA 1OKKD 3ZTYA 1J4AA 1JLLB 2BI8A 3R5HA 2IW1A 3FIUA 1KZHA 1PNQA 5FXMA 1EJ2A 1UZUA 3DMNA 1IN8A 3PLAE 5A0TA 3JWIA 1NQVA 1PW5A 2QN6A 1FFXB 1ZNYA 3N39C 4ILKA 3TW8A 4PC3A 1ZAKA 1JILA 1M6HA 3U1VA 1Q1GA 1DS6A 3HFGA 3D0OA 3B52X 1HE2A 3EZ2A 2JFBA 4RY2A 4U9UA 4R51A 3SXUB 3PXUA 4EX6A 1YA8A 1C30A 1QJ4A 2SKEA 1V11B 3AW8A 5ITZA 1I4EB 2ZRBA 4B8WA 3A9SA 3CLTD 1TYCA 5FYDA 3F9CA 4O2AB 5DCUA 4B17A 2JHGA 1NQ5A 3C41J 1MRZA 3DVAB 3PXXA 3WMRA 1NF3A 5AOBA 4HUTA 2A9OA 2DE0X 1J5EB 1HETA 1DJNA 3AHCA 1CPYA 3B3AA 3NLLA 3RG8A 1V7PC 5LYJA 4RY9A 2PTHA 3AL0C 4Y6OA 1ZA1A 4WVLA 1DRJA 1M8KA 2K4MA 2AFHE 1SC6A 2ZDHA 4E08A 5ICGA 2YZMA 3VSBA 2VNIA 2QZPA 3DBHB 3U9SA 1IMJA 3C8MA 3ERCA 4QOIA 5IM4A 1JDTA 4QM6A 1ZRSA 4XX0A 1UWVA 2HSZA 2QQ0A 1BYIA 1V8ZA 3WXBA 1OREA 5FO0A 4Q01A 4FGJA 2C7VA 4KFTA 2GMWA 4KSYA 4MRAA 2CEAA 3OZDA 2ZQZA 4C4SA 3NM6B 5T4EA 4L0MA 4G5QA 4IH1A 4AJHA 4DC0A 4EF4A 5SZIA 3K9FC 3DWIA 2OV4A 2ZSUA 2ZULA 3B48A 4IO0A 4WKPA 3VUFA 5FWNA 4HDAA 1H3FA 5B3JA 2OWDA 4OB7A 5HQ3B 3BWYA 4OQPA 3GA0A 2AZ4A 1TT7A 3BWBA 4OATA 2VYVA 4B2LA 2C9CA 3IOEA 4FEYA 3JQ6A 3LC2O 2HIHA 2IOFA 1PZMA 1VRVA 4MI6A 4QYIA 2G9VA 3KV1A 1KYYA 3LX5A 3GU3A 4PBRA 4DV1B 2VRCD 4EHLA 5INTA 2F1OA 5CFOA 3LFUA 3HBNA 3UWSA 3PEWA 2ZJ5A 3CE9A 3H6KA 4BVBA 1GNSA 1Z0JA 3ADDA 3NAQA 5F7ZA 3L06A 3D4NA 2CXPA 2FP4A 1XTVA 3KVVA 3OLWA 2PD6A 2DU8A 3B3QA 3SYRA 1E0AA 2FX2A 4Q19A 1PNRA 2B21A 2PMCA 3K1AB 4XARA 2ZYHA 4RD1A 2O1SA 3T1HB 1Z62A 5IJ9A 2A9PA 1DU4A 2E4YA 3CA8A 1JUDA 3UA3A 4AP6A 5ADWA 4LOHA 3STHA 3T34A 4KQ2A 5FULA 1E3WB 3X1KA 4D9MA 1OHHA 5IVHA 3JTEA 3AI1A 4TROA 1ECFA 2CBGA 1W9MA 3WL5A 1QQBA 1B93A 1EB9A 1X3LA 3HO1A 2R7LA 4U00A 5FEMA 1ANKA 3NEAA 3PFBA 4UNIA 2IKSA 3IT3A 4U2KA 1PJ4A 3AUYA 3GIWA 3HU5A 4LXQA 1A4RA 1RAAA 4PYNA 4Q82A 1RRCA 4ZVSA 3GUHA 1CZUA 2AT1A 3LDHA 4TWZA 4BXOB 3E9DA 1XBTA 2PO5A 3OM9A 5DTJA 5BOVA 4IJQA 2HPZA 2ERCA 2FA9A 4KR0A 3GWGA 1T0UA 2J5KA 1P31A 2OHXA 2IYEA 5EP2A 5F2EA 1FFHA 3BSFA 2IYVA 4JN6B 1DADA 1FIUA 4FZ3A 1Z7WA 3ZC3A 1QB7A 1VBMA 3D3EA 1UXIA 3ZWKA 5DNEA 3HHPA 1WO8A 1AB6A 3FETA 1XZJA 2ACWA 3G02A 5L95A 1B43A 1YBMA 3I42A 3ESRA 4FT2A 4G5GA 3IKJA 2IP4A 2NLOA 3AKCA 3SHTA 1I2MA 5WRFA 4FYHA 5C4MA 2O0KA 4RJLA 5HUHA 4ZZ2A 1YGPA 4HNGA 5KQMA 2PSDA 1DLJA 4K05A 1U1CA 1OYVA 2WQZA 2Z5LA 2CN1A 4PWYA 5CYOA 3ZDDA 2FJ0A 1E20A 5BSKA 2F3UA 3VNVA 1IFXA 4OSOA 3LKBA 5B2ZA 4KBFA 4DJ5X 4I1SA 1TUIA 3K3PA 2RAVA 2QU7A 1OX6A 1PYDA 2ZROA 5EE3A 1NQAO 3UYLA 4C4TA 5LKAA 3GGGA 1Z17A 1RC1A 2IYQA 4UW9A 4GC5A 1Y9DA 3ITNA 1NDQA 2PUTA 2ORVA 2YJGA 5FOXA 3VR2D 1K3UB 1TD1A 2HH9A 2PXCA 2Q1WA 3INTA 1XVUA 3KTOA 4NE7A 4P58A 5DFAA 4L3OA 4OQLA 4PS0A 3EHEA 4EWLA 2C59A 1XEWX 4MW2A 1X0XA 2DUUA 2Q99A 4U8HA 4BAGA 4CV2A 4DMKA 4B7UA 5LQSA 5LD2B 2QRZA 5EJ8A 1Q3HA 4QQRA 4GSKA 3EVTA 5LIPA 1IQRA 1IN4A 4DG9A 3AJ9A 2EWVA 3T0FA 1CUVA 1WE2A 2JFVA 5AK4A 5KWJA 4ZT7A 2A1UB 2ZIGA 4RZUA 2Q5LA 2VP4A 1J20A 4YIKA 1GR1A 5CT6A 1HT2E 3KOWA 2WTBA 3IOCA 3ZY3A 2DY1A 1TGVA 2EWWA 3HP7A 4O25A 4BNMA 3D7MA 5CVJA 4M0DA 2PAFA 5G3ZA 1GT6A 1TTQB 3O4VA 2B0CA 2MYUA 3CF2A 3FPJA 3KJXA 4HAIA 3SIWA 2AFIB 3T9AA 4H6XA 4JH0A 2DJIA 3UBTA 4HAUA 1FBNA 1KKUA 3BKXA 4Z0TA 1LJLA 2RBGA 4XOUA 2ZUTA 2WU8A 2X0NA 3A0RB 1T6XA 1BGXT 2IVZA 4LHVA 5AWFC 4TMZA 4BMNA 4NNOA 3L7IA 3N6VA 3CMMA 5J43A 1GV0A 1HE4A 3CCBA 1LU9A 3DKKA 4CDNA 3L92A 4WNYA 4JI6B 4AS1A 4R7GA 2ZBUA 1HTBA 4CTNA 1DXYA 4LOAA 4AG5A 5EHXA 2H2GA 2PX3A 3FVQA 1ZC4A 3TCKA 4BNKA 3KEMA 2ZB7A 5CA1F 4N0PA 2W2KA 4XVHA 5DBEX 3QVUA 5GONB 1YE3A 1EWKA 2Q0XA 4EZBA 5L4NA 1R74A 3Q41A 3UWDA 3A6EA 4B83A 3VKWA 1LX7A 1I3LA 5HHTA 1KH3A 3AF0A 1Q84A 3OJXA 5KMGA 3S5JA 4LMPA 4ITRC 1Y98A 5A6SB 1RHQA 4M1EA 3SEFA 1EHYA 3DHEA 3EY4A 3DXFA 2FP3A 2GKSA 4KE9A 5CMLA 3IILA 3TLBA 4EYEA 1AUVA 5KIAA 2PQ2A 4DQXA 4N76A 5KDOA 3ZLJA 1HKUA 5AIBA 3DHVA 2GR9A 3GBVA 4UQPA 4F97A 3AFMA 2V7QD 4Q9AA 5TRTA 4ZDKA 4M8IA 4ZMRA 1F0YA 4Z3DA 1SIBE 4GX1A 4CLRA 1ZHOA 4U4AA 2ZRNA 2F62A 3ZBTA 3K9BA 2VEOA 4C06A 2WTUA 3KLNA 4KR9A 1NM5C 1D4AA 1Z6GA 3FLEA 4JL5A 4MS1B 4OQXA 3ZXYA 3PJEA 1G8SA 2KMLA 1UKVY 3AF2A 3P7MA 1D0IA 4RZXA 4GI7A 4LRSB 4Y6GB 1C4XA 3WBBA 3GJYA 1JV2B 1G3IA 2DPGA 2AG5A 4D8UA 4DYDA 2H57A 1H4QA 4HMQA 2K6GA 1TL7C 2R8YA 3FPHA 5KWIA 3CLRC 3TDKA 1K5GA 1QF7A 5AKJA 5DH9A 2VK8A 3RVSA 3LWZA 2ZYAA 2J08A 2YN4A 5DISB 2QT1A 1M2OA 2F59A 4DUZB 3VKHA 2PIDA 3SZRA 1MHTA 4HVLA 5LMCA 1DZ3A 3S7TA 4KYIB 4IFTA 2AJCA 4GI3A 4JD5A 4OHZA 5KYNA 1S8FA 4WJZA 5CHEA 2FXIA 1EFHA 1MRNA 2DAPA 1JPNA 3FBWA 1H3EA 2C84A 3FCXA 2GWHA 1T3TA 4KAAA 2IDZA 1HT1E 4N3CA 4MRMA 1GPYA 2FZ4A 3QYAA 4Z0NA 5AW5A 2NAFA 4W5QA 4CEJA 3WWPA 4DR7B 4GUAA 5A6SA 5FO1A 5KYYA 3UB4A 1JAZA 2X19A 4QREA 4D0NA 4POOA 1SQ0A 3UGKA 3HC7A 3QPBA 4PHGA 4R8KA 3D31A 5PGMA 5K99A 5BN3A 2W11A 5GOZA 4GMXA 1EFCA 4GO1A 1P75A 3E48A 4MJLA 5K6AC 4H60A 1JSXA 5HGXA 4M1KA 3WL8A 4Z51A 1SBHA 2H5EA 5HE9A 4L5YA 2ZZMA 2YYAA 1JTVA 5CFLA 4CEIB 2C92A 1G0NA 3DR3A 3GMSA 4XM2A 2JLYA 2NYRA 4YY3B 4DDTA 1ZN8A 3ANNA 1UBJS 4KVFA 4R5HA 2AL7A 4NPHA 4HBZA 4PCVA 1Y6QA 3WK8A 4JIMA 1UC8A 3GARA 3FPBA 4J3JA 4Q9DA 4DCSA 3AB7A 1CLEA 1ZSYA 4YJ2F 3V8PA 3I9V1 4V3BA 2DFVA 1UP7A 2JJQA 3I32A 2OQ2A 4X91A 4CR6A 2UUOA 3NTUA 5B4UA 5BURA 1Q14A 1DC3A 3BTOA 4MW5A 5AK0A 2VDJA 1B73A 2WFLA 3ZU4A 2FP4B 4Z2AA 2KBFA 2Q3DA 3PEFA 2HJHA 2L42A 2UZ1B 4KWHA 1WEHA 4TKUB 4DY4A 1GL6A 2WNSA 3H2SA 3WRVA 1V4BA 3LM8A 3QWHA 2C78A 1Q17A 1U3WA 1AMUA 1HEUA 1BQ4A 2P0YA 1NP6A 3ILSA 2QBYB 4DSZA 2DBRA 3DAGA 3I8XA 4MKRA 1XD9A 4K5QA 2QGNA 1UMBA 3G9UA 3V8BA 1IN1A 1R88A 2EKLA 4JKIA 1Q83A 2XE8A 1ILWA 1Z3IX 4LDNA 3FYUA 5EI5A 1UPCA 721PA 4A6XA 4DV2B 4F06A 3HZOA 5T67A 1XU9A 2QA5A 1ETHA 2QRHA 5THQA 5BVHB 4JYZA 2RHDA 3M6WA 4MKFA 3L1KA 2IH5A 1UKAA 2FX3A 1AK2A 9LDBA 3VR1A 1VE3A 4FGZA 3T5DA 3A4TA 3CT6A 3H1FA 1N7GA 1GPDG 4O8CA 3ED1A 4P2GA 5E0KB 3SX0A 4WOKA 5BORA 1YAJA 4OQ4A 2OO5A 1D09A 3VDQA 1XNJA 3Q0IA 2X14A 4OGFA 2NVWA 4AJEA 1PJRA 2ID8A 2O3RA 3HUDA 3I6QA 1QMGA 2ZI6A 4K40A 1C9YA 4NOMA 5JH7F 1MW9X 1M1NA 2P6MA 1KYVA 1YUNA 4P3KA 1UFOA 2VF8A 2B9VA 1PZGA 1A1SA 2HKIA 1U5AA 5F64A 2JJ1D 4UUBA 5G1OA 3BK2A 2IV3A 2DWUA 4GNRA 4GYWA 5CCEA 5KDDA 4ZZ0A 3N6XA 4ZJUA 6LDHA 1P45A 4UCQA 1E6CA 2XR1A 1JALA 1RBMA 4JLDA 1YS7A 6ADHA 4KL8S 5AOAA 3X1ZA 4EJ0A 5CRIA 2DF8A 1LDEA 5A5VA 3DV2A 4R84A 4EENA 2V7GA 1JMVA 3OIYA 2NMVA 1HY3A 1KO4A 1OVGA 2ST1A 3NDPA 4QTZA 3WRWA 3W6OA 1WPRA 1O9GA 2QMOA 1DKUA 2VTKA 1SPXA 1Z08A 2IXFA 4GX2A 2RGCA 3M70A 3SD7A 4RJTA 1NNSA 1WHSB 2X1MA 4HWRA 4IO1A 4JB0A 3RUAA 1NLUA 3V1NA 1G8PA 1KH2A 1M1ZA 2OFFA 2GPAA 3FDFA 3U7QA 3X2FA 1R6AA 4I46A 3ZQ6A 4PSAA 4I1IA 5C7YA 3DCNA 2MU1A 4FLMA 4JLJA 1YD7A 2X7HA 4LWZA 3SZGA 3I1IA 1YFZA 4MUHA 3SXUA 5ALWA 4HX2A 4IMPA 3RIXA 3B6JA 5F4ZA 2P0EA 5TEWA 4EPXA 2C7QA 2X15A 5A1JA 5EJ9A 1EE1A 4J0GA 3D3WB 3R7AA 3VU9B 4NH4A 3ZD9A 3PUVA 1LPSA 1M6NA 4B8ZA 4HDRA 3MTGA 1DEOA 1J8DA 3RSLA 1UBLS 1YUMA 4QBGB 4AIRA 4H59A 5LU9A 1UP6A 4JVLA 1XCBA 2IODA 1A95A 2JIBA 4WCFB 1PJCA 4L0CA 3IMKA 3DBLB 4K2HA 1HL3A 1GSAA 4A36A 2IV2X 1SBNE 2AD1A 4QUEA 2FUEA 2WM8A 3G8AA 3O4GA 1XDUA 2IHBA 4IGAA 2HHAA 3RKSA 3WL4A 2W6NA 3ZLTA 3TF5A 1N9KA 3D5QA 3L41A 4E5KA 3WZMA 2KJQA 4CMCA 1HDIA 2VHZA 2H0QA 3NIWA 1TA9A 5C32A 5JQWA 4EABA 8MHTA 4L4YA 2PA0A 1ISMA 1SOVA 1NNUA 1XDSA 1Z7BA 2ZTSA 3C3BA 4QDJA 1G21E 3BMNA 3O73A 1GAJA 3CZMA 1FMCA 1WCIB 3ZHZA 2B92A 4C1NA 3Q7IA 3ND8A 4DANA 2H4YA 5FWDA 1RQPA 3WYEA 1JR2A 2F1KA 1SFRA 2BC9A 4GDMA 3SVLA 1Z2PX 2PBLA 1P1RA 1ZVMA 3CTPA 4A8TA 1Q7BA 4ZI7A 4GF5A 3LP6A 4QUGA 5EGSA 4E14A 4JITA 4V0MA 4F6LA 2W6OA 2VP6A 3FB4A 1ISSA 3VR6A 4A3SA 2HLHA 4C7BA 3KBBA 4CMIB 3S44A 4KLZA 3FPAA 3OKPA 5HIKA 3EJ6A 4KKXB 2Y0PA 1CQIB 3QV2A 5JCOA 2UUCB 4J76A 1SVUA 1KA9H 5FAKA 5HE8A 2XHEA 3A6PC 3C7KA 1M0SA 4Q7EA 1EFDN 1QPGA 5FHQA 1OWMA 2VDNB 3HKCA 5DE3A 1UPAA 1L8OA 4PFSA 4JT9A 3HXPA 1H6AA 2QAGA 4OA8A 5EE5B 3C3DA 4KXWA 2AOTB 3RU3A 3COPA 3IJ5A 5AVVA 3FDIA 3E82A 2QY9A 1C9JA 4BAZA 4YRJA 3OPMA 4L95C 4LVNA 4MWBA 4TZTA 5HPYB 2HIAA 1LQ2A 3JQRA 1YB5A 3KALA 4UVGA 4TOIA 5EPOA 1IC6A 1U0LA 4RIEA 4D5GA 4OBXA 2JH9A 3ER6A 4MQEB 2GLTA 3L6OO 1KE2A 1GTVA 3TQSA 421PA 4QM7A 3KCQA 2CLHB 3UJ7A 1C0KA 5GM2A 1SCAA 2ZCUA 3DG9A 1JSZA 1RP7A 2O52A 4MTLA 4XIJA 2WD7B 3UM9A 5BWMA 3BQ9A 3QJGA 3UUEA 5BNWA 5EWMA 3D7SA 3ZDCA 1WSWA 1L4MA 4GMDA 4NCKA 4EG3A 3ZGYA 2HWWA 2V9ZA 2YH2A 3A36A 4WECA 1WQ3A 1WUKS 2AQ8A 3OJLA 4DRXB 3GJ7A 3K30A 2FPIA 4MWEA 5FPSA 4TVKA 2KYRA 1TQ6A 3SC2A 4NZYA 4G89A 4CMJA 2JAPA 2ZIFA 1XEAA 4ZEXA 3WKBA 1DVRA 4LV6A 2AXNA 1E1DA 1ZN2A 1PSWA 4I14A 4C4YA 2B69A 3LT1A 1MG5A 1O6BA 4PYQA 2RI6A 4H16A 3THRA 1IHYA 4E5MA 5DASA 1BVHA 1QG4A 4HWGA 5BWOA 3HCAA 3RYHB 3MSCA 5C1DA 2X8AA 2R62A 2XYVA 3P9QA 4XWTA 2GXQA 1S01A 4YCDA 4PTZA 1Z7GA 2MIIA 4WCFC 1NOIA 1PS9A 4I50F 3AEKA 3G0BA 2OSVA 4G9GA 3LGAA 2OGUA 3CX4A 5FRDA 2QUAA 1E9BA 4QVKA 4BWFB 2PU5A 3WLRA 3D54D 4IWYA 1TCCA 2AI1A 2AI2A 4TTRA 4DYVA 2QK4A 1CVLA 2QZSA 1JEDA 4F91B 2X3FA 3PC4A 1O95A 5A4DA 2XB2A 3DP9A 2JW5A 3RVDA 3E3AA 5T64A 1HRDA 4NF2A 3TW4A 2ONZA 1ZIXA 1US8A 1O96B 2ADFA 2W6QA 4Q15A 3CNEA 3KZMA 4N39A 1MN6A 3QX9A 3IMFA 1KJIA 4YN3A 2R7AA 3ROGA 4A0FA 1JN0A 5IPFA 3UPUA 3KHTA 1E9FA 3L2OB 1SUWA 1CZOA 2FWPA 2LTAA 4QASA 5EJAA 4IIJA 3INYA 3T61A 1Y3IA 2VRNA 3QX7A 3NTQA 1E9RA 2P0AA 1RI4A 3RSSA 2C04A 3ANTA 2YZGA 2ZIWB 4KQJA 1VHQA 5ELXA 3C16C 1XZQA 1VMDA 4YLGA 1RJ9A 1SG0A 3DB1A 1UPUA 3RRNA 4B79A 1UMBB 2VP5A 3AY6A 2HJGA 4UPEA 4Y0AA 2HT6A 3P0RA 4Q39A 3HYLA 1FQOA 2VZ9A 3QU9A 1SH7A 4EUEA 3KLOA 5A9SB 2BBTA 3LPNA 1WX1A 1JVBA 4GXRA 1F4VA 2ZRPA 4OGGA 4B32A 1QAMA 3F4LA 4GRDA 3LI2A 2XGOA 2CUNA 2QLFA 3NTOA 1LV7A 3VNBA 2CVPA 3ZBQA 5B1HA 1HSZA 1I2CA 1OXKB 3PU6A 3DOOA 5AW6A 2PX8A 1VJRA 4XKJA 2V7UA 3C7DB 3EPJA 1JHZA 1SIUA 3M5DA 4YCLA 3WIDA 3RR2A 4XSGA 2C2MA 1JWAB 4HXFB 1ZJYA 5DHPA 5HOQA 1DIAA 1LK5A 1SUEA 1HDYA 2XYRA 3CLHA 4OKIA 4AI6A 2BRUC 2F55A 1VHJA 3QJ5A 1KKLA 3EXHB 4P86A 2HWXA 4UD2A 3P9IA 3BJIC 3REOA 1VOTA 3NVDA 5CJPA 5AKLA 4EGAA 1YZGA 1JXMA 3B1KA 4LA4A 3WSWA 1B23P 3MJHA 5J1TB 3EMVA 2WJJA 1NFRA 3DUFB 3QU5A 4C6TA 3PDCA 4IS3A 2RGYA 3T7JA 3A6ZA 1R0YA 1YRLA 5DRYA 1Y4UA 3IEUA 2XSZD 2HLDD 4HP8A 3C7TA 3H86A 3EZGA 1SC3A 4CT5A 2WLTA 1OE0A 2X4GA 1EWVA 4G1UC 4O4HA 4BYGA 3B1FA 2YASA 3ANMA 4GMGA 4Z3KA 1NR5A 2FDRA 2FFJA 1PJ8A 1BWRA 4UE6A 4ZU3A 1K75A 4YAGA 2QTAA 1Y8QB 4F45A 4ZK2A 4ZAVA 5AH0A 3JS5A 3IRUA 1WCWA 2IZ6A 2ID9A 3W8RA 2BONA 3P1JA 1S96A 1KC3A 4HQLA 2O1WA 1EHIA 3A3YA 3SMQA 1T5SA 3L7LA 4DSTA 4BVFA 1Q50A 4CMAA 1EVLA 1LNSA 1NOKA 1R00A 4KODA 1IUKA 3RK0A 2ODAA 1JU9A 4I3HA 4C4PA 3CRNA 3IP9A 5H80A 4K6FA 1ULUA 5A62A 3OM0A 4DE5A 4DLPA 4GIBA 4HJRA 4Z8XA 1E3DA 3AR6A 3VGJA 4B1FA 2HA2A 4FOSA 3CLSC 5FWYB 4LECA 3R9IA 2C31A 3PVZA 3OD1A 3CUSA 4LJSA 2VC2B 3GX1A 4ZYLA 2HMWA 2OLJA 2VJKA 4C2TA 1KY3A 1VKHA 4WZAB 3EZFA 2EYUA 5DNWA 1RKVA 1JU3A 1K88A 3A2LA 1K89A 2NPFA 1YWGO 2UKDA 3VBCA 1XZFA 1EK0A 5IULC 3FOFC 3C1UA 4AS2A 2BGKA 3Q1LA 1MLDA 4TRRA 4CEJB 1BFUA 3OG9A 2VRWA 3BWCA 1JAHA 3GVHA 3SWWA 3MJVA 4YJ3B 4F6RA 5C8VA 2WOJA 2H1HA 3G0CA 3BIFA 2BHSA 3H7IA 4YCJA 4BC1A 1PTKA 4KI0A 3OEWA 4NR0A 4UC0A 3RVPA 1O7JA 1AH2A 5EYPA 4N6OA 1PFYA 3PC3A 1TW3A 1JYEA 4MLZA 1C9DB 3RB8A 4RKYA 3ZZ1A 1E3EA 1JDVA 3QF4A 5DEOA 1IWOA 3PQ7A 1OA1A 4KWEA 4EW6A 3B5EA 1V43A 3DMTC 2QVCA 4YPOA 2IYNA 4EHFA 3WK9A 1NXSA 2JGRA 2R85A 4KREA 4G1VA 2EQ5A 3N9IA 3CW9A 4K28A 4C08A 2PZFA 2Y9PB 1OWPA 3E9MA 4W5NA 5C9ZA 4IUCS 5SYAA 1ORWA 5JU6A 1JA1A 4JXKA 4P7KA 4UZSA 2OP1A 3GT0A 2BFEB 2VAWA 2Q07A 4A8JC 3EQ9A 2ETVA 1CJMA 5KEIA 3W6ZA 3ORSA 1QIHA 3IUEA 2X3YA 5F2OA 4Z5XA 4ASUD 4ALKA 4DJDC 4UBKA 1L7BA 3AWDA 4ZCIA 5LPNA 4PXSA 1Z5NA 1W36B 3GEEA 3G2JA 4DLTA 4IH4A 3OJFA 2HBQA 2QDXA 3P0HA 3OQMA 2Y9MB 1V9SA 2FN8A 3H0EA 5DSTA 4PIVA 4UU7A 3TDNA 4EQ6A 2P9QA 2PWYA 4AICA 4QTXA 2R9VA 3T4EA 3E6AA 2HMAA 5BSTA 2O2YA 4YJ2B 4BLUA 1ORDA 2IYFA 1YQDA 2X6RA 1APBA 1TRHA 2QPTA 4JLBA 1RACA 4KH1A 1OWOA 3ORFA 5IWAB 3B78A 4XCXA 1FMJA 2PPLA 1E7RA 1U8AA 1N1DA 2ZI3A 3RRZA 3QE0A 4DUGA 1U7WA 5I9NA 5LQUA 1FU7A 2BEVA 1N2BA 4CG0A 3JWGA 5CVTA 5TQJA 1I3CA 1AXGA 3U61B 3FUWA 5IN5A 4KO4S 3FTFA 4IL5A 1L7XA 3A4IA 3LXMA 2H1CA 2NUAB 5BR4A 1AHPA 1CY8A 1QP4A 4MCAA 5BYKA 1GKUB 1NVUQ 1U02A 3DTVA 3WAKA 4PG8A 1A04A 1S9HA 2M6RA 3WLAA 5BN3B 5KTTA 4NFYA 1ZPDA 5AI6A 3OZTA 2YS7A 2GLXA 3COSA 3L8EA 1O6FA 3H5IA 1YFJA 5KYYB 2OLKA 1RKUA 1T43A 4IYJA 3GFFA 5L45A 1PFVA 1WNTA 3EXAA 5FL7D 1FVXA 3QJYA 3PXCX 2IYUA 3USES 2FZWA 1C1XA 3RVMA 5ISMA 2JJ2A 2KB0A 2EGGA 2PRJA 2WAMA 1AF7A 4OHRA 1BAPA 1RWQA 3AI3A 4L75A 4XGQA 5TJHA 3WP1B 2HYIC 3ZDQA 3ASVA 4U7PB 3IAUA 5FPHA 2I4MA 2MJLA 3PGMA 3U44A 1YC5A 1ZINA 3UHAA 3MSXA 3JYQA 1RYZA 2PYZA 3UJ8A 2HO4A 2CY0A 3ZV5A 1NJFA 2FN3A 1QPBA 1T5LA 5GGYA 2OB2A 3QI7A 4FB5A 3B6MA 2ZUCA 2GVDC 4J0KA 2BMWA 3P4YA 3VV3A 4CKCA 5K03A 4ZYYA 5COBA 2CV1A 2OOSA 2Y8EA 4ZKEA 2ZUUA 1M2KA 2HTFA 1VIMA 4WGGA 1XZNA 4DCOA 1D04A 4PZLA 3KKMA 3ZKAA 3PTZA 3AVYA 5EVCA 3T9DA 2K5UA 1IBLB 3LX4A 1KIFA 3B38A 4JJFA 3U26A 4R1PA 3ANXA 3TE7A 2GHTA 1E5QA 3A1FA 1XSEA 4G0PA 1X94A 1N2CE 2IEBA 1PL6A 3FUUA 1HLDA 5JYBA 3AFIA 1AQNA 3Q1KA 2FI1A 3G79A 3T5MA 1W49A 4A2PA 3NALA 4A0GA 1ICEA 3M6MD 5BN4B 1FFDA 3GJ0A 1BMDA 4R2KA 4A7PA 1ZG3A 4KPGA 3HHEA 3L7DA 4INOA 1DBSA 3WGMA 5ARCA 2QTNA 1ZUD1 1VJGA 2EYQA 2BISA 3JQAB 4URHA 5IYZB 2XQVA 1BEZA 1G9SA 1AN0A 2C4MA 3R74A 4EFMA 2I5PO 5C3MA 4C3ZA 2P30A 1ONSA 2LPMA 2R8XA 2VSQA 3E8SA 3JU3A 3UWOA 5KJ1A 4RH3A 2DT5A 3PT9A 4DWOA 1ABBA 2AMFA 1XRLA 3FNRA 2HSEA 4MXDA 1XOIA 4P36A 2A30A 1DB3A 1GEEA 2OBYA 4N3GA 1H6CA 1P61B 5CB4A 2CK3D 4OXNA 4X9XA 3HU2A 1F9AA 2D06A 2O4CA 3I72A 3JWJA 4MROA 4GG1A 5LN1A 1OT3A 3N7UA 1UBOS 4Q4AA 4D3ZA 2JI9A 1NRJB 3JVVA 3LQ2A 4EECA 2XMCA 3QBJA 3AC0A 4RO0A 2JLSA 1E1QA 3K05A 4Q7QA 1J5PA 1PX2A 1LF0A 4MIYA 4RE5A 3FG9A 3EUAA 1I3MA 4LQ4A 1A5AB 1ISHA 2ZU0C 4V39A 5ITZB 5KOYA 3P2YA 1X9GA 4DSOA 3K1TA 2AEEA 3ADPA 4MAMA 1ITZA 1AC5A 4HB3A 4Y6QA 2ZR9A 4P4UA 2YV4A 5G2OA 3OM1A 4HL6A 2Q21A 3VPCA 3FSGA 1JIVA 1YVDA 3H9CA 3I12A 3I6YA 4LRWA 4M76B 2NO7A 4R8SA 2LKCA 4EL5A 4RTMA 3WX0A 3EW7A 4RZQA 2YWXA 3NHWA 4LXTA 4R2IA 2ZREA 2OPHA 1PCXA 3T7EA 3K1AA 3PGJA 2YFHA 3B53X 5HKAA 5F9FA 1FRVA 4OHXA 2D1QA 3I9OA 1KGSA 3H4VA 4GPTA 5HF6A 2J0QA 4D4KA 1B7GO 4DIEA 3AG5A 3R6LA 1S2IA 1XTUA 5HQTA 1KAQA 3S2UA 5CA1B 4MVJG 3QXJA 4K9OA 1C5KA 1XWFA 3DO6A 2DBZA 4HCJA 5EY5B 2VEDA 2K2QB 3HL4A 2ZQ5A 4PZEA 3TB4A 1UXJA 2JGLA 4G56A 1N2IA 1NATA 3N28A 1UDBA 5AI0A 4YI5A 3Q12A 1ONNA 2HDHA 1DKOA 4AF7A 5HQ3A 1FNNA 3ROZA 4HGPA 5EPEA 4B4KA 1W36C 1XROA 1C0PA 1YULA 3KWFA 3PI7A 4EMUA 4M9UA 3IDZA 5AW4A 1TIPA 3MJEA 1W1IA 2Z1NA 4N6GA 1H0KA 1L3IA 3L4BC 5F5XA 2B2CA 1LTHR 3PEYA 1KU6A 1ENYA 4TS9A 5K2OA 3NKLA 3L43A 3KXIA 3KL2A 5AUQA 4Z4QA 1RM0A 3NDJA 3D6TB 3H9EO 1JJAA 1Z8NA 4IV5A 1C9KA 1ACLA 4Y0VA 1ZGJA 2NU6A 1A88A 3ETCA 4RTPA 2GCNA 3AJEA 2XQIA 3BSWA 1NVEA 2P40A 1MP0A 4FE3A 5P21A 3ZY2A 3CJQA 2HSGA 4FC6A 4O2AF 3AU9A 1G8YA 4OSPA 1LC0A 3OUTA 4P5EA 3N2NA 4ARBA 4RLHA 5J23A 1MAHA 3FF1A 3L0CA 3L0PA 5CUQA 4Q4CA 4OLFA 2XXAA 1CVIA 5F1KA 1I80A 5FA6A 1QCCA 1M7GA 1R4MB 2AK3A 4FWBA 4RZIA 3HCBA 4R8MA 1NOJA 2WZBA 2H1RA 3KJNA 5G3YA 1J42A 1AS3A 5IBQA 2GRAA 4DDWA 4FYIA 4WE3A 4RD4A 2H1SA 2ON6A 2PPVA 3LUDA 4IOLA 4RK4A 1SU4A 4QT0A 2WJGA 1TEHA 4Z8YA 4CRWB 2XAUA 2FMIA 3R3YA 2VQSA 1EIZA 4CI0B 1H8EA 5JQGA 3ELBA 4ZGGA 4DUGD 2ZVDA 5C53B 1TEZA 1Q44A 2PIAA 2Y0BA 1ZIOA 3QSGA 1YIOA 2GARA 4JI2B 1HTTA 4OHPA 3NC0C 1HR0B 5IT5A 1DPFA 5EUMA 3AP3A 2EVWX 1LKZA 2DZDA 3O83A 4HZUB 1ZISA 2CL0X 5I4BA 2LDBA 2VAPA 1NQTA 2IBSA 1XCJA 4UJ3A 1G55A 1M1YB 1MEJA 3I8OA 2NU7A 1NVTA 2P90A 2O05A 2AG6A 3NUGA 1D0VA 2UV8A 4FBGA 3R0JA 4MOWA 4U7HA 5TVGA 3W90A 3E1GA 1NW4A 1HZZA 2G9UA 4KZPA 1F20A 4Z9YA 2DG2A 3K8OE 3FPSA 1G18A 5EINA 4ARIA 3L7AA 1IE3A 2FFBA 1RD4A 3G1WA 4EM6A 4X1YA 4Z3OA 2ZB2A 3RAGA 4EZEA 5MFZA 1O1YA 3RTGA 2ADOA 3IVCA 1U31A 2WD9A 1HT0A 4NABA 5ANRB 1FTGA 3FYCA 4FDMA 4B3DA 3KOZA 5HSGA 3V8MA 5TGDA 5K0FA 1ECCA 4REQA 5EJEA 3OQOA 2P3SA 2H1IA 3F6SA 5KTMA 4IZHA 4QD3A 3WL6A 3ZGZA 3AKYA 3B9BA 2EP5A 3GQBB 1YZHA 3P0IA 4US2R 4CQNA 3CYFA 5CG2A 4MLCA 1CIJA 1FJ2A 4KO1S 2ILVA 3JY6A 1Q16A 4KRXA 3DZJA 2D74A 3QV1A 4L5IA 5AVJA 4TSFD 2YCBA 3IBFA 2R4UA 4YXFA 3ZWMA 1QIKA 4D6YA 3FFTA 4LGYA 1E4OA 5ESXA 3L7KA 4RJKA 3BEOA 2AF3C 2H0RA 3C6YA 3MMSA 1QKIA 2B7BA 1F48A 5KSOA 2WZQA 4YRBA 4EGJA 1SY7A 2PKXA 1DTEA 2XDQA 1U0HC 4XJXA 1N78A 1V8FA 4NCHA 1S4MA 2F3RA 3UIEA 1YIAA 4QXOA 2B99A 3CO5A 2HO5A 2Z2XA 4X1OA 3SDSA 4YBZA 2LUOA 4OK6A 4PX3A 4H3HB 3DXZA 2W2NA 3TQRA 4DPKA 4E4YA 4HKTA 3MIZA 1QRSA 2W00A 1A2KC 2HU5A 2ZJ6A 1G8FA 3GDWA 1ZMRA 2H07A 2A9QA 4YQFA 4RK5A 1D5CA 4X6UA 3RS8A 3HVKA 4W7HA 4J16A 4WBNB 2RGWA 2BUAA 3BDAA 4KDFA 5J2TA 1HOTA 3QA3E 2A5DA 5K3SA 5JFGA 3BXGA 2CXUA 2F00A 2F8LA 5EPUA 4ASUA 1H66A 3PZRA 1RXSA 4E5SA 4MDEA 2IC5A 5I7EA 2Z98A 3UT5A 4OFWA 4YRTA 1KP2A 3C87A 3LOQA 1QKKA 2PMDA 4KXXA 3UK1A 5EJ7A 4XX0B 1KWKA 3HXMA 3E84A 3D02A 4G5OA 4F4HA 2B3DA 4BQFA 3CG4A 1JG3A 3HYRA 3ISTA 3FCOA 5LDHA 4QXAA 2P5SA 3QKWA 1ATZA 4G5RA 3GVIA 4WKCA 4FCTA 1EJ6A 1DQSA 1P1IA 2P9GA 4P93A 4C7KA 3BD6A 1YZKA 1L4KA 1JDBB 2HXYA 3IJEB 5LKRA 3RW9A 4YQEA 1VLZA 3IBGA 4BJHB 1EWQA 4H1WA 2AS0A 3N8IA 2AQIA 1NNEA 2RB5A 1QZZA 2WYWA 3HV2A 1CSEE 4MRMB 2YHSA 2CJYA 5DCYA 4ZRDA 3UB3A 6YASA 9ABPA 5BUCA 2GCIA 4BNGA 4KACA 3S81A 3OMWA 1R8QA 4GFDA 4RGVA 1HEIA 2JFUA 1XTRA 1MOPA 5EIOA 4FSXA 4AQDA 4BLOA 4FFRA 1Z2NX 4WLFA 2RKOA 1BWQA 1WHSA 4YK7A 4JT4A 3T4PA 1XFDA 4CM5A 4K2AA 3V32A 2V6GA 3KG2A 3UOAB 3D1JA 4IILA 4KQWA 5K8CA 4ON9A 5KTRA 2D5CA 1N2CB 4BRSA 4R9SA 2R1VB 1VKZA 3IKTA 3UCEA 5IARA 3SXJA 4HJXA 4AKTA 3IEPA 2F8MA 4O5OA 1BW9A 1A82A 1TVCA 2BVNA 1X7WB 4B5LA 5F98A 1ND6A 2FN9A 2XOKD 3TW6A 1H8ED 2WAYA 2HFJA 3VC1A 3FCYA 3U7FB 3OEHA 1KGDA 1I7SB 4V2UA 2QM8A 3I9KA 1P7VA 2PSJA 1ORHA 3CUWA 1X74A 3CGGA 1G21B 3RJTA 2NZJA 3ACBA 2IUEA 4PLPA 4E15A 2HC9A 3SF8B 3R7WA 1J09A 3CIFA 5JARA 5I4IA 1I4LD 2E37A 4OTZA 1C1YA 1M9NA 1TIBA 3DE2X 5KPJA 3LPCA 3BB4A 3VHRA 3OA2A 2AV6A 2ZZKA 3EC1A 4BO1A 4TTJA 2PWZA 2WOOA 4Y2TA 2ONCA 4BFZA 4D9JA 3EXFA 3QXGA 2OAEA 1YRAA 4FDUA 1Q12A 5AVYA 2BAGA 1FTNA 2H29A 1FNMA 3A3KA 3D0RA 1SVNA 3WJ2A 5BW8A 2VJAA 3OU7A 3D2BA 4Z2YA 2I2WA 3BTVA 4OHKA 4HYQA 4S24A 5LB2A 3R23A 3R8XA 3AUJB 4JSTA 5ES3A 4C7MA 4Q3KA 1KO1A 2X41A 1QP8A 2QN2A 4KFRA 3VH2A 3PUKA 2J9FB 3HVRA 2ETXA 4KQMA 4LOLA 1WDWB 4FI3F 1HT3A 4IMJB 3U60B 2V03A 5B3LA 3O21A 1NG9A 1PEAA 5D00A 1J1ZA 1DEXA 2XCLA 2E4AA 3CSUA 1KTVA 1GYRA 3L0SA 3TTYA 5TR9A 5SV2A 4CKBB 3SQLA 1DFIA 5FLKA 2C94A 4RC9A 4RXUA 1E8DA 2NZ8A 1P9WA 1J1IA 1C7JA 4HDCA 4CM8A 3GLKA 4JCOA 4LF5B 2H52A 4TRJA 3BB1A 4CKYA 5BMVB 1KDRA 2AJTA 2W2PA 2D5BA 2Z8XA 1ZM9A 3WGHA 5ALRA 1SEVA 3WLFA 2G76A 3AUTA 3B8HA 1XCPA 2BHTA 3AOGA 2XECA 4UPVA 4J7XA 3TUJC 2Q6VA 4DMCA 4OA5A 5AUPB 3EOBI 2QM3A 4GP7A 2BFCB 3OIUA 1DDIA 1FSPA 2RHLA 4W7SA 4KR7A 3BHIA 3PDWA 4HGYA 4L5JA 4ZAXA 4ED9A 1C8BA 1SCBA 5ALZA 1Z4LA 1KSHA 3VR5D 3UNXA 4DIUA 3I34X 1VL6A 2NX2A 3D43A 1BRTA 4EUNA 2DBQA 1DUIA 1KERA 5SYNA 4L57A 2IXEA 2P3OA 4YH1A 4RHUA 1Q19A 3WK6A 1C7ZA 1RP1A 3OCVA 2PGAA 4GP9A 2DJ5A 4IRUB 4J49A 3H9UA 1XQ1A 3PGA1 3BFKA 4MPPA 5T4HA 3M4NA 1N5DA 4KIFA 4ZVVA 1GCUA 3INGA 3NETA 1I2AA 1NJ1A 1U2GC 4G67A 2Q0QA 1MX3A 1YDMA 2FETA 4QKQA 1DHTA 4M83A 3L4KA 3C6XA 3K1JA 1V41E 4ERXA 4XB1A 4A0QA 4YP1A 1KPGA 3VM6A 2WU0A 1GKLA 3WGIA 2P69A 2HNBA 4DDVA 3BIWA 1GOTA 1TM3E 2W93A 3B3GA 2NUAA 4JZYA 1VPTA 2Z2YA 3DEJA 3ER8A 4MX8A 1PVDA 2NO0A 4WL0A 4TKMA 4EG7A 4P38A 3S2IA 5JNLA 1WCYA 5K0LA 4QDUA 1TU3A 5A0VA 1JJFA 4FGWA 3U81A 2P3QA 2LXNA 1XVTA 3MCZA 3VA7A 2IUSA 1T9ZA 4FS8A 1UBRS 1MDBA 3WAJA 1KI8A 4JQYA 4X7RA 1M33A 1J56A 3DBHA 3HYNA 1V7CA 2QYHA 1A76A 3FVRA 4RZ2A 1XMPA 1SBTA 4Z9AA 4CFZA 1QCDA 3BWDD 3GB9A 2DETA 4G8BA 2KSQA 3UYKA 5E38A 2C1XA 4KK3A 1N25A 3A9CA 2KWIA 1MENA 3DXYA 2OORA 4PYIA 3HKDA 2QG9A 2XTMA 3IPLA 3MW8A 4MEAA 4XASA 1L5LA 3DWEX 4R9NA 2QNIA 2VOEA 1KO5A 3A9WA 3CRVA 4LOIA 4GR9A 3JQQA 4F5EA 1SKAA 1DWUA 1I8TA 3D3WA 3IO3A 3P2MA 5CK4A 2GFHA 4K87A 3TEJA 4BP9A 4EA7A 4DNXA 5C5CA 4MMZB 4JGIA 4DJEC 5HRUA 1Q20A 1ZL2A 4Z6KA 2XXBA 1A4UA 3WHIA 2WRZA 3ECAA 2CXXA 4MQ5A 4N8SA 5HMMA 1RRMA 1U8TA 4BQNA 1T2VA 4IDOA 5DPMA 1IZYA 4JBIA 1ZVQA 4CIWA 1YJCA 1T36B 4MYRA 2FK8A 2HX1A 3OOSA 1JNXX 2J4CA 3ESAA 3LRTA 3N87A 1FC0A 2ZSBA 3QPDA 4F92B 5AVSA 4TM8A 1CR4A 3HU1A 1P0IA 2WJAA 5C81A 1RWBA 2BFOA 4PBSA 4R2WA 2HM7A 1WDMA 3GEGA 1K6MA 2PT7A 2ANBA 1FSZA 1MAAA 4TWRA 5T6BA 1G42A 3WIEA 1Q1ZA 4LYFA 4OAOA 1FY2A 1MEOA 5TNXA 1L1QA 2W0MA 1GZ7A 2C4HA 4D0GA 1CIVA 3MYRA 4QU0A 5CIYA 1DGQA 2WMOB 4EUHA 4E5UA 1WMFA 4JODA 4RVHA 2RBKA 4K0RA 3V1UA 1Z13A 2C4NA 1Z45A 1AURA 3IE1A 1MVNA 2VDVE 3GLRA 3QFCA 3CM0A 1A9SA 3KDPA 2Q2OA 2WJYA 5EP1A 5TY0A 3X1JA 5JECA 1EG7A 4AMZA 1CQWA 1OXTA 1S9DA 4QEZA 3F3MA 1B3RA 1Z8DA 4N7RA 2FMKA 5IH3A 1FMFA 4UFPA 4F5WA 4ZOBA 3FROA 4F71A 5JHGB 3DNFA 3HSKA 1KK1A 2IU6A 5KJ6A 1JKMA 4GLBA 2VT7A 5DLYA 1BE1A 5JADA 1ZS9A 2MMCA 3NWOA 2WTMA 3O8OA 1KAGA 2XW6A 4QATA 1OV4A 2GN2A 1NG1A 2I7XA 3K32A 5LP6C 4BMSA 3QU4A 2EJCA 5LZ9A 3ZDBA 5K4GA 3CN9A 2PA3A 1WSBA 3ABZA 3PJGA 5F77A 2R97A 4FIZA 4LJAA 5AKHA 1JLSA 1MO3A 2X1LA 2JKVA 3AEQB 2WBLC 5JXGA 4I8DA 4BP3A 4Q47A 1XZ8A 3HVJA 3L8GA 3OIDA 1P1FA 4IJMA 3T1VA 4RTOA 3OJEA 4QPCA 4DSAA 4PAQA 4D4GA 5JAOA 4FZRA 3NZEA 1L7VC 2EWMA 1SVLA 3WADA 2JKYA 2ZCJA 4HPJB 2JEZA 2M6SA 1W59A 3KTDA 4BVHA 3KQYA 3MTEA 2ZWMA 2HSDA 4KQ6A 3TEMA 2QPOA 3V7UA 3O4RA 4K9RA 3KP1A 3SHVA 4MQBA 1ZH6A 3FDXA 3I2JA 3KSAC 2TSYB 1NSYA 2IZ0A 4QFBA 1TIKA 2BMJA 5ER9A 1GYPA 1U2GA 4G4SO 5TPWA 1MPTA 5BWLA 3P2JA 3PQDA 1RNLA 2VXYA 3KFLA 3MCWA 1NFQA 5AIAA 2JGEA 1Y1TA 2QRLA 5EWMB 3U0BA 1W4BA 2YICA 3P27A 3CVWA 1SKBA 2G8NA 3AEZA 4MK4A 2H7YA 2GM9A 4MR9A 4YI3A 1EEHA 1B4DA 1KZYC 1U2QA 5LOVA 3ZY5A 1P4SA 1N2XA 4HATA 4RDHA 4JDPA 2V7XA 4ZVUA 4NS1A 3KKNA 3DULA 2SNIE 2VVTA 1QPZA 3IKLA 2X0IA 1GN9A 2K7FA 1YZNA 3X1WA 1DRKA 1IUNA 3LPMA 3VPBA 2ZYSA 1JXAA 4DR4B 5AHKA 5LQRA 2R6FA 2XMSA 1CNEA 2ZIXA 4JBHA 3LT0A 2PVPA 4ZO6A 4DCJA 3FKSD 3DDHA 2OO5C 4C30A 4R1QA 2ZS9A 3WIUA 4P98A 4Q7MB 2OO7A 4WASA 4X6XA 3SR3A 3TQIA 3SJCA 3FR8A 1P3Y1 4PAMA 1P1BA 4RD2A 1WVGA 4JFAA 4NPAA 2C7RA 4EGFA 2FEKA 4ZHQB 4D9GA 5J58A 1Z73A 4CTMA 2G7MC 2QTCA 1L7DA 5DBGA 3VYVA 2FPLA 2BN4A 2XQKA 4TT8A 2AVNA 3AKEA 5TDHA 3KDAA 5IM5A 4CM8B 1RYFA 4H3VA 1G3RA 1OFTA 1VHTA 1ECLA 4EAAA 5GONA 3HTXA 1DJLA 1JQ3A 1QBGA 4E2XA 1E1RD 2G07A 3T38A 5K8IA 1NDUA 2XLBA 3H18A 2WIAA 3KWLA 1IOZA 4BN4A 1NR7A 5K0CA 1W2HA 1V3UA 4PZ9A 4Y2XA 1BX0A 2PKQP 3QE9Y 2I66A 3J7TA 3AMVA 3M4XA 4F96A 1LB1B 1RMTA 4J4TA 3BZBA 3I8SA 3DSRA 4E30A 1I14A 1M67A 2VOJA 1CF4A 4CL2A 4C0HA 3VU9A 2QL7A 3O2JA 5IT4A 13PKA 1ZI6A 4QGHA 4WW0A 1KH1A 1RJ9B 2C4TA 3F6PA 4GYYA 4MUEA 4GMHA 5IBPA 4MKHA 3WSTA 2HLDA 3NYQA 3GJTA 4ER3A 4BRWA 4KIJA 4LZNA 1H2AS 5CXSA 3A6JA 3H83A 5LZ7A 3TR5A 4LV8B 1YO6A 3KAPA 4FFPA 3B6EA 3V6MA 4CDMA 2HPHA 2WIJA 3T3OA 3GZJA 4M0EA 2AOWA 5F3DA 1LPMA 2JD1A 3QTLA 1R12A 3OQHA 1E18A 3GLHA 2GESA 1K8QA 3U4MA 4Y2QA 5AKEA 2PJZA 4DN6A 3FDJA 3QEOA 3S99A 4O08A 2WMDA 4LKRA 4G63A 2Q5JA 3E22B 3S68A 3HA3A 4G0NA 3KKKA 5JEDA 1HE3A 2QLBA 3PFCA 1F3LA 5B6PA 2Y67A 3R7DA 3WB1A 3EARA 1NVKA 4R0MA 5K0TA 1XCOA 3T1QA 1UEXC 4YJDA 2G4CA 1KEEA 1JP7A 4IOJA 5T5QA 2DR3A 2PZMA 1C29B 3C8UA 2E48A 3JATA 2W6ZA 2WV7A 4CM9A 4DLXA 4AJPA 3NHRA 3R9WA 4F1WA 3DT9A 4N8EA 1TO1E 4X45A 1L4EA 1PR4A 2NVBA 2FKAA 2LE0A 4FFSA 2ZT7A 3ZWVA 1F6DA 1B6SA 1UDCA 2XF2A 3L7CA 1FTQA 1E79A 3URKA 3FHCB 1PV1A 4AY3A 2REQB 4URZR 4RF4A 5DGXA 2O3QA 2UUBB 2V45A 1AKEA 1WCXA 1UJ2A 4KFSA 4ZU1X 4B43A 2WV9A 5EYPB 2FRXA 2AX3A 4M8KA 4MV1A 1Q7EA 3K9LA 5LBUA 5JS6A 4DR5B 4R01A 1OZAA 1CP2A 3Q3HA 4X6LA 1CERA 2RKWA 2Z58A 3A0UA 2GN0A 5K3FB 5JZ9A 1U8UA 1T5BA 2NSHA 1A50B 2VPIA 3GZNA 3MG9A 3PZBA 4QTUB 1HDEA 4FOOA 4I4LA 5H5JA 2FOIA 1IZZA 1EBFA 2VSFA 1IZ9A 4NBLA 1LFDB 1RADA 1CZHA 2W2XA 3TGPA 3WP0A 3IXLA 1ZO8A 4TVOA 4FHFA 1QH9A 3ZV7A 2HBRA 4DDUA 3NRBA 4QBHA 3CUUA 4KQKA 3WQQA 3EN0A 2IOYA 1QRTA 3UAOA 5FI0B 1E6MA 3WKAA 1DWOA 3WRXA 1SUAA 1GTG1 1DAIA 4MWCA 3G8YA 1ZD4A 4BV3A 4N48A 1DO0A 1TYZA 2I7DA 3PR1A 4PV7A 5A5FA 4JUCA 3DV0A 2PFSA 1JQ5A 5FTMA 1CUJA 2B98A 5CNJA 4MUFA 3SQNA 4CQMD 2ZGVA 1R10A 2BZ0A 3QKUA 4AX4A 2ZJBA 3Q4GA 4J1QA 5CD1A 1LLUA 2LIVA 4M1MA 1NKTA 2F3QA 5DXJA 4R3NA 2WICA 3JQAA 3QFFA 3EIEA 4B6OA 1JG4A 3AHEA 1TQDA 2LW7A 1P6XA 4WD3A 4H3SA 1J49A 1P0FA 3UJ9A 4F6RB 3OC6A 1MB3A 2ZIXB 1LXCA 1KQNA 2DFTA 2V7QA 4MUGA 4O0LA 4Y9TA 4EB6A 1JDBC 4LRUA 2O7NA 5A02A 2YHIA 1NN5A 1RBQA 4AUNA 2AQKA 3KTAB 3WYGA 1Z6PA 16PKA 1KC1A 1K3FA 3KQPA 1E3QA 4DY6A 4H1HA 3BJMA 4N0DA 3T7SA 2X3UA 3DA8A 4B7ZA 4C6HA 4RZHA 1CQPA 2BP7B 3HR7A 2XITA 1GGNA 2V6IA 5IDXA 2GM5A 4Z1MA 4RTNA 3WQHA 1RJFA 1PJZA 1RTTA 3VKUA 4C4ZA 3VKFA 2BR5A 2A94A 4L8GA 3ADCA 3MAAC 4S0XA 1VL5A 4RFLA 3BGSA 2HV8A 1CBUA 1TECE 2XVXA 1ETUA 2RAUA 3DOJA 4OGLA 1MA0A 4UU0A 1K8XB 5HTKA 2QM0A 3PYXA 4YDHB 5EOVA 1GZHB 3HUUA 1ABEA 2RSLA 3HO8A 4XGKA 4Y1RB 1FXWA 2X6QA 1MJ5A 2C7GA 2QL6A 5LMZA 2H2AA 3GJ6A 2OV2A 2FFAA 5G0WA 4IIYA 2OHJA 4GSLA 2GD1O 3CUTA 2GBIA 4LAFA 2IEZA 4DBLE 1PR1A 2NXCA 1D2HA 5AI5A 3PXGA 2ACEA 5M34A 1KEZA 4X61A 2DFDA 2F8TA 1T9KA 3TZKA 1ORTA 3I30X 3I04M 4KXNA 1L1FA 1ZN7A 4BBZA 2FW6A 1XZCA 3MLBA 4HFRA 4CIDA 1SUPA 3U7GA 5LWHA 4WOJA 2ZRCA 4Z0PA 3OX4A 2ODBA 1BVUA 1K6JA 2D4AA 3RK4A 3VHXA 5KC8A 4PNZA 3OFKA 1MV5A 1J0BA 2XB9A 3EYAA 4BRUA 3ICQB 3EAGA 4QX6A 4P3OA 2JHPA 1XXLA 3DL4A 1BU8A 3VV2A 4B44A 2OBMA 3ASZA 3AHDA 3EA5A 2HHCA 3IVRA 4N8DA 3ZV4A 3WRYC 1C3EA 3HCOA 1KR5A 4NCAA 4M7OA 3T5AA 5AW8A 1GPMA 4QARA 621PA 5FUVA 2O2JA 2FR1A 2Z6UA 4O29A 5CDSA 1E2PA 1KBOA 1FYFA 1JR3D 5BUZA 3BXZA 2XTNA 3ABQB 4NS4A 3ZWOA 3H2JA 4ES6A 5BRJA 3DT6A 5L7TA 2YJNA 3LE8A 4MVCA 1NW9B 4Y6SA 3U1TA 1A8QA 1FRZA 2IEDA 1YBFA 2LVBA 4YASA 4J4BA 1IZ8A 1W6RA 3D4PA 1FF9A 3QLUA 3S0JA 4BASA 2BGWA 5FPTA 5CPFA 1DQZA 1L7MA 4ODIA 2IYOA 5KDLA 1JU4A 2P7HA 4N47A 4YDQA 5K0BA 3CXUA 5SYMA 2NQTA 2DSTA 3QP9A 3HB9A 4KXUA 3Q10A 4LWOA 5ALKA 3P0EA 5ILQA 1NF9A 2Q0SA 3WHKA 1IL0A 1L5FA 2DPXA 4IJ6A 1AKNA 1CDDA 3BE4A 4LJ8A 1SHTX 2OMKA 2E6UX 5E6SA 2HHLA 4ZT2A 4B48A 1P7YA 2KW5A 4H35A 3U7HB 4KBYA 2RH9B 3RJ5A 4NJOA 3OBIA 2Q8PA 1ZCAA 4R3WA 2PS0A 1EUCB 3AEYA 2AZTA 2P9YA 2Y92A 1GYQA 3NOOA 3NBFA 4TRNA 4IV8A 4WBSA 4X92A 1J5XA 3LCMA 3SYTA 2MTBA 1VBNA 1GSIA 1VE6A 1NQXA 3AFGA 2HF2A 3AXSA 1VSVA 3NONA 4LY0A 3O0TA 4ZXFA 1U2TA 4BV9A 5AUNB 8ABPA 1G9TA 3OPXA 5I47A 1PJAA 2FRVA 1JB1A 1SXJE 2P75A 1NXXA 2RDMA 3FMGA 3NAZA 2AH5A 3GVPA 2ASVA 1ZAYA 3AYXB 1SXHA 3B85A 4JNCA 2C2YA 2IYXA 3E9CA 3MCUA 4OXRA 5JAPA 1C3LA 1ULAA 2J5BA 5D3MB 3TTWA 1UC9A 3KVRA 3CFYA 2DHRA 2GUGA 4GPZA 2QMZA 4L5AA 4RUKA 4TV9A 2XTJA 2ROQA 3PC7A 1ECPA 2OGSA 4FYYA 4L8YA 3PJRA 4W63A 3I3SR 4UZEA 5LR6A 1XAHA 2NT3A 5DNYB 4Q66C 3VTZA 2GHQA 3QA9A 3QH4A 2IE8A 5TC4A 3ZVMA 1KHHA 3WVNA 3L79A 3HB5X 3BYZA 4MQEA 4ND6A 1Q2XA 5JDCC 1LUAA 4U6QA 4FM9A 1XMXA 2YXBA 2Z6QA 4M7PA 4YRRA 5FWYA 3WNZA 2YKGA 2YX1A 4IEFB 2UYCA 5JDIC 2ZWAA 3G82C 4X8OA 1T5IA 2I3AA 2YHIB 1N6KA 1XLVA 3PC6A 4KU4A 4LNUB 3A31A 4YJ3A 2YYZA 4I3GA 3FRJA 5ALOA 1L9KA 2FZKA 1TLLA 4UVIA 3ZE2B 3B8EA 1JJIA 1JZQA 3PRHA 3TX2A 1SKMA 4ARZB 5KKCA 1J6UA 2IF2A 4NXNB 1L7QA 2I71A 4I4NA 1GG5A 5AHXA 4DUPA 4WZBB 1LJUA 1TLTA 3NB0A 3ZIAD 3K6RA 1QQ6A 1EFPA 1S8OA 1V16B 3F3SA 5DJ5A 4DMFA 4K6KA 1JTEA 1YIDA 1Y4ZA 1AB5A 1H85A 3LA6A 4QFCA 1C1DA 1Z07A 4IKPA 2PBRA 5HFNA 4HLCA 2A58A 3VRHA 3QPWA 2EIXA 1GRQA 2ESRA 3ONDA 1ZD9A 3SQWA 1PJBA 2WP0A 2VP3A 3QXXA 1T0PA 2FSFA 3L6DA 3FPGA 3TXAA 1L5MA 1MC8A 1BEUB 2OGZA 1A4IA 3JW8A 4CM9D 4KZKA 4KRGA 3V1YA 3BVPA 3R7FA 3RVNA 2DR2A 1H6BA 5JAIA 4KDRA 1U1FA 4JBGA 4UMVA 4WZBE 3W8EA 3H1PA 2QTGA 4TT3D 4XVCA 2REXB 3AP1A 1DIHA 2PUAA 3E9EA 4CNBA 3LBHA 1P1JA 4B71A 2GN9A 1Z8HA 1P73A 2J3MA 3R9KA 2HZBA 1I10A 2EFHB 3AK4A 3I6IA 1GGKA 4X20B 1XPJA 3GCGA 5D2CA 3MWLA 3TNJA 2LWIA 4HNUA 1CV2A 1EM6A 3F49S 4H9GA 2L2QA 3H9JA 4C78A 4UBIA 1IMOA 3PC8A 1NVVR 3BMQA 4CQLA 2FW1A 1P5JA 5E6UA 4BXOA 2ZB4A 5JXJA 4B09A 2H4ZA 1I3NA 3NIBA 3ODGA 3Q15C 1KTIA 4NL4H 1HWYA 4NCIA 3RQIA 3KKEA 4TMVA 3DQPA 3PR3A 5EIFA 3ANLA 4XUCA 3SOZA 2AOUA 3TMAA 5LA6F 1L5KA 1TYBE 1UWCA 4JLOA 3U7IA 4A1OA 4I9HA 3AF6A 1YKFA 2ZB8A 5B2FA 3DEKA 2XBMA 2HCTA 4BIIA 2H2FA 3GLVA 3WWOA 4Y9UA 1PQWA 3C4QA 4MI3A 2GBCA 4QOSA 3MRXA 4X00A 3RODA 4BBJA 2XQGA 2DP4E 3DLIA 5BYAA 4GPEA 1PGOA 1OFIA 2ZJ4A 3FHLA 3LKDA 4M6WA 1Y42X 2Y1FA 1W0KA 4HNHA 3K5IA 2I34A 4DLLA 1NXTA 2YJZA 4Y2RA 3UGQA 4K46A 4IQ4A 4RJIA 3SBEA 4D8YA 5IMSA 5IS2A 2CCKA 5FBWB 2OSBA 3FUVA 2PANA 2HQ1A 3K70C 3I0ZA 1GY8A 3DH0A 1YS9A 1Z5PA 2IPLA 3I5AA 5EZ5A 3PDHA 1O6ZA 4B2YA 4BNFA 2VCHA 4PC6A 5EHIA 2NYAA 1LK0A 4N5MA 3K16A 2XD4A 4CM4A 1QHGA 1CUGA 3IKVA 4H7PA 3UQZA 4M21A 2HF9A 2VAVA 3KIPA 3TIIA 5HDBB 2Z4RA 5E3HA 1CJKC 2D13A 4OLBA 2A9RA 4LCJA 4WLVA 2WE8A 3DZBA 3JWEA 1YACA 3M83A 3W8NA 5EJFA 1G5PA 4AY6A 1CB7A 1JWBB 1QC5B 1U28C 5KNDA 4G1EB 3EIXA 1U04A 4JR2A 3W4KA 1W4AA 2TS1A 4PAGA 1QKJA 5KQSA 4QYSA 1T3SA 1WPXA 2VHVA 2YOFA 1ELOA 4RKEA 3N86A 3OZEA 4CKCB 1TMOA 2NXJA 2OCDA 4MW1A 3KVYA 4NYMR 4DAOA 4HFNA 5JSZB 5IH7A 3FNFA 4IHJB 3EVFA 3KB2A 1DNPA 3OOWA 3OT1B 3TLMA 5IM4F 1UAAA 1XTJA 3T99A 1C0LA 1GNVA 2H9YA 2EEPA 2JFNA 3IB3A 1N5MA 1LBQA 3OTQA 3R3XA 5JLJA 2G04A 1E32A 2VNKA 5LP6F 4LHXA 4DZZA 4JL6A 3TQTA 2B37A 2FY8A 2J31A 4IF6A 2VUHB 2XCOA 4II3A 4O1MA 2CCJA 4YAJA 2FFHA 4FMBB 5L4SA 3O1IC 1O77A 3BWMA 3VHXB 4B4OA 1JXOA 3FJ1A 3MGKA 3FVWA 1OXMA 2D8MA 1F12A 4J1TA 3ZHCA 3SHFA 2H2IA 3CKLA 4ZYVA 3RRYA 2ZPUA 4FFVA 4IIDA 3WDMA 1UBSB 5J2UA 5EHGA 2INGX 2ZRFA 3GFBA 1D5WA 5IX8A 2RGXA 2FWAA 4EBBA 2X7XA 1VTKA 5H82A 2XCSB 4BNWA 4DEXA 1WSDA 4DJJA 2ZAYA 4OAQA 1WULS 1DUVG 2I62A 4PLGA 3WWYA 5JC8A 1DBVO 3KYDB 2PQMA 4M0MA 2RGAA 1H9BA 4Z4CA 3GRFA 1X87A 3NYWA 4G4JA 2B82A 4AJ9A 5B7PA 1FA9A 2BDTA 2XMRA 3I2YX 3OWOA 3RKUA 2RIRA 3R3HA 3SQDA 5ES4B 4P4LA 3W4JA 3HWWA 6Q21A 1WZUA 3L93A 5DMXA 1VJ5A 3ER9A 2YRWA 4G0UA 1F0PA 1JQDA 3EQZA 3LOUA 3GELA 2JBWA 3QKSB 4GWLA 5BSHA 1E9VA 1PR3A 4DUYB 3KR1A 3IIJA 3H9GA 5F51A 3UK0A 2VXBA 3P8ZA 1QM5A 3BIJA 2VWHA 4RHYA 4UHHA 3LXXA 4HMOA 4CG2A 3BMCA 2DQSA 3ZJUA 2J0UA 3W7VA 4HB2A 5F1OA 3BHMA 4XH9B 4RENA 3RHSA 2J6HA 3P2OA 5C4GB 4QE3A 3RTAA 3TTVA 3ZBPA 2WD8A 3NAMA 3S4YA 3HYTA 2AFVA 2FG6C 3SP1A 5L6MB 2C9BA 5HVNA 1UM8A 1V4NA 3EVZA 1JDSA 4DA8A 2Z95A 5I51A 5IABA 3TBFA 3VC3A 4ZODA 3RVBA 1V8PA 4MCIA 4X54A 3TIXB 2YN2A 2BM0A 1T8TA 2G9QA 2QE6A 1GZVA 4CCAA 1NVBA 2BFNA 3DZCA 6REQB 1N0UA 3PWKA 2JDID 3KXLA 2EATA 2XDQB 5ESDA 1U2RA 1VL8A 4TTAA 5F12A 5GY7A 1Y81A 4HS4A 1GTL1 5K3AA 4YWJA 3KWMA 2Z3WA 4D26A 3T7TA 3ABSB 1YNSA 3GLIA