4Q7QA

The crystal structure of a possible lipase from chitinophaga pinensis dsm 2588
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
259
structure length
259
Chain Sequence
AKELTWVAIGDSITYLNDHLDETGNRVSKGYLTRLNEILPNLKYINQGHNGWTSGGIAGNIDSLGLIKADVYSVFLGTNDWWQGRPVGKLDDYQHDNGNTTVYGSFRIIISKIRQLNPEAKIVLITPMQRNDFVYIADAKNNAFGSYQKKNGQTLEEFANAVLTIGRYEQIPVVDLYHHPLLTLRNMVKFKHLKNPKNGKYVNYKYPAFVNIPFNPENNEYPYPPAAVNLTYDGLHPSDKGNAIIASALADVFRQLGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipolytic protein G-D-S-L family
publication title The crystal structure of a possible lipase from Chitinophaga pinensis DSM 2588
rcsb
source organism Chitinophaga pinensis
molecule tags Structural genomics, unknown function
total genus 91
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4q7qA00
4K40A 4H08A 4RW0A 4JKOA 1K7CA 1FXWA 2W9XA 1ZMBA 4JGGA 4Q9AA 3PT5A 3KVNA 4JHLA 5BN1A 3DT6A 2WABA 4XVHA 1J00A 1DEOA 1YZFA 4K3UA 2O14A 1JRLA 2Q0SA 3DT8A 3BZWA 1DEXA 4M8KA 5A4AA 4K9SA 1ES9A 1IVNA 3P94A 1V2GA 4I8IA 3C1UA 1VYHA 4LHSA 3SKVA 4OAOA 1ESDA 1ESCA 3U37A 5B5SA 3DCIA 1ESEA 1BWQA 5JD3A 2VPTA 4NRDA 3DT9A 1WABA 4IYJA 4PPYA 4K7JA 1PP4A 2APJA 2WAOA 1U8UA 3DC7A 4S1PA 2Q0QA 3W7VA 1BWPA 2HSJA 4RSHA 4TX1A 4JJ6A 1Z8HA 5CD9A 5HOEA 4HF7A 3SLRA 3RJTA 4OAPA 4DEVA 4JJ4A 1FXWF 4HYQA 1BWRA 3MILA 3HP4A 4Q7QA 1VJGA 2WAAA
chains in the Genus database with same CATH superfamily
1OGYA 4NZPA 3VNUA 3BK2A 1V95A 3OE7D 4EMUA 3CVWA 4P35A 1NBME 4TOIA 2YY7A 3II6X 1J2UA 1C14A 2WYWA 4ZO8A 1NASA 1QIKA 4AKHA 1EX9A 3V7WA 3ETNA 4JB2A 1ESZA 5TX7A 1O9HA 4G89A 3EMVA 4D45A 4A6EA 1T9BA 1U0JA 3H6KA 4O6VA 2OCGA 4B6JA 5HIMA 5CM2Z 2IVFA 1ZMTA 1AGXA 1BA2A 2QROA 5EN4A 3P9QA 1XOIA 3K2IA 6PFKA 3CXRA 1XPJA 1FMLA 4JY7A 4FSXA 4FI3F 4JX9A 1K4MA 3B2EA 2MJLA 2ZRQA 4YASA 4UNQA 3F98A 4KUHA 4RENA 4K6FA 4REOA 3RGWS 2VATA 2GLUA 1PYDA 2YV4A 4YV0A 1UXKA 2V7UA 2V74B 2R7NA 4KUGA 1N2CB 3WKBA 4QGGA 4HQ0A 2QM3A 3EIXA 4JQOA 4XH9B 4PLHA 1S2IA 4DQDA 4RTQA 3RIXA 3LFTA 3JASA 4I8IA 4O08A 3SBEA 5L7WA 2IZ7A 4KV9A 1M0EA 1G8PA 3KVOA 4QGSA 5ELMA 2X76A 2H16A 3MOIA 4B3FX 4E30A 1NNLA 2HWYA 1DLIA 1EWVA 5ALPA 5HFAA 4WCFC 3NXSA 2R6JA 3IQXA 1KJWA 3QU2A 4M22A 5CA1B 3ITKA 1RRCA 2RE8A 3HZZA 2YVUA 1RAFA 1OXBB 2JGEA 3PFCA 3EPPA 2EFJA 1GGVA 2F3PA 2NTJA 4RF5A 1U7ZA 2YHIB 3CZCA 4I3HA 3MF4A 3KETA 3DT9A 2MSKA 1XQ6A 2P4QA 2PYDA 3G1TA 4RSMA 1KEZA 3CRVA 5FBWB 3U3MA 4BX2A 4EGCB 4UJ5A 1UBHS 4HZUA 2AGVA 3K8OE 4P5EA 3PNLA 4XD7D 4YRLA 4A8JB 1MGPA 1XU7A 4PFKA 3USES 4A8PA 2NSYA 1S8FA 4BEWA 1QHYA 4HADA 4LJ7A 3VAAA 1X1EA 2D2XA 5JU6A 3FJOA 1XZGA 1B76A 5A1TA 1R8JA 1MH9A 3KOZA 3OTHA 3ZOKA 4F86A 3ACDA 5K0JA 2WTUA 3OJOA 1TK9A 4RKEA 1BC5A 4MWSA 3LM8A 1GADO 4O3MA 3MQ4A 4Q7EA 3VC3A 3HDTA 1E5QA 3ZVLA 1QCCA 2GJSA 4XWTA 1Y8AA 3PC2A 1C4XA 4M6WB 1EWYA 3WNQA 2ZJ5A 4DVJA 3DPUA 1QYWA 2W6CX 4N40A 2BEJA 5GJVC 5D3MB 2DXIA 1KJYA 2R8RA 3K9BA 1UKYA 4DIKA 2WHYA 1CJMA 3BERA 3EISA 5EZQA 3LOQA 3PPXA 2EEPA 1H2RS 4GRDA 4NY1A 2C59A 2PU7A 3L7JA 4N0DA 1BCRA 3G6WA 1N0UA 1F20A 1KY5A 3NALA 4QPCA 1P19A 3V8RA 3ZIAD 4HY3A 1K6EA 1R5JA 2IYXA 3RAPR 2GCPA 3SIRA 5B1HA 1BQEA 2CVHA 4JL8A 4R8MA 3TLBA 3C3CA 4IMPA 3QHPA 3ZH2A 4CKWA 2XUGA 4XW2A 4I3GA 2WB4A 1Z8NA 2XVXA 4OUDA 5DLPA 1SUAA 3DKRA 4G4IA 1JFFA 2D2EA 1JPNA 2WFAA 3KQSA 5DBEX 2R8EA 2YWRA 3N7AA 5IKEA 4EB6B 5CIWA 4NJMB 1PR9A 4QPZA 2XJ9A 4G1FA 3ZE1B 2ZRHA 2R44A 1FDUA 3EODA 4RZ2A 4AJEA 2UZ0A 1VRVA 4Z0TA 4JYAB 3LLMA 2VJNA 4C4SA 3LQRA 3O6VA 1I6WA 1OW3B 3N2KB 4R2MA 3JY6A 3KHUA 4LYHA 3PGMA 4G4GA 3L40A 3HU1A 2CMHA 3DZHA 2YZ7A 1CHDA 2M6RA 4W63A 1TZBA 3I3SR 3T06B 1N25A 1P91A 2HADA 4LVOA 3DTVA 4Q4DA 4AUKA 1PVDA 3HCBA 1HEYA 4BTEA 4C29A 1JBKA 4GUAA 4PC6A 5BMVF 2YMMA 4IIGA 5KYVA 1J0BA 3AW9A 4YIHA 4KXXA 1EE9A 1Z9BA 1MG0A 4G67A 3DMFA 4N39A 2IIBA 1KMCA 4MRPA 4V0KA 5A4AA 5KOYA 1E1QA 4X1IB 2CFCA 4K9SA 3IT0A 3U1TA 4NAHA 4XVCA 2HR1A 4OBEA 2JC3A 3ROZA 4E2YA 3KSAC 3VV3A 2JLYA 5EUBA 5EG5A 1VI6A 5ICCA 4E4TA 1HUQA 1D0SA 2HNKA 4NQZA 4I9UA 4BVBA 1MJGM 1T5SA 2BMFA 3LXXA 4H7DA 1D6NA 1D2MA 1DEHA 3AIOA 3LCRA 2HLPA 3OLWA 1XTVA 1UCFA 4HL6A 4ZV9A 2CE7A 1U0TA 4IDNA 1FP2A 3TUZC 3HWRA 3T3OA 3C6MA 2AMLA 4NHOA 1J90A 4D56A 3DBRB 3NNDA 5DOZA 4DSTA 4PXSA 3G5TA 1SEVA 1D2RA 2LCFA 3ZWVA 1Q22A 5GINE 1VL0A 4OJTA 1VSUA 2FSUA 5DHSA 3M4JA 4D4IA 4ARZB 5KKNB 1ZMRA 1GUDA 4L5YA 1BRMA 2JIRA 1H1DA 3LW7A 1GQRA 1U8FO 4BNDA 3OKAA 1FMFA 5CD1A 4ZI3A 1LC3A 1IRIA 3QX8A 3DMGA 5HF9A 3ZTWA 2PFKA 3D0KA 2NZ8A 2D0DA 5F12A 4CMCA 3BG5A 3K71B 1F2VA 4C3VA 2V7EA 1JWBB 2FSHA 1HDYA 4M7RA 1U3FA 4G5HA 1RM5A 1OXSC 1KIMA 5BN3A 2HQOA 4GZ6A 2XWPA 3IPAA 1T4MA 4FR5A 2VYVD 4RD6A 1M67A 3PU6A 4NABA 4UVIA 3Q5GA 3WXBA 3GLIE 5J2UB 2QBYA 2FPGA 5DK4A 3UGQA 2VOEA 4P8RA 3ECAA 1R10A 1E6CA 1ONPA 4HGZA 1K4KA 1BMQA 1BHJA 1T2UA 1T5LA 1XGKA 2EYQA 2I2FA 2IW1A 2P79A 3BTSA 3IQZA 4RX1A 4XKJA 1PF7E 2Q3CA 1YR1A 4DRXB 5HM8A 8ADHA 2Y1LA 3OCVA 4LKRA 4FX2A 3NETA 4M9ZA 3I5YA 4OQXA 5F2KA 1R5BA 5KTTA 1ZJ4A 2AF4C 5C7OO 1JHDA 3OM8A 3P45A 4RKYA 4F93B 1F2UB 5IM4A 1BQ4A 2IE8A 4YQZA 4JJIA 3BICA 2PT9A 3DP9A 1BHQ1 5DH9A 2QTZA 2CZQA 2P90A 3EZ2A 4OB6A 4CTKA 2NUAA 3BDVA 5DVZA 1WV1A 1QGDA 3WO1A 4G4SP 3L1VA 5DX0A 1E89A 5ALDA 1TKBA 2GAFA 5I7HA 2EW1A 1K5GA 3KD2A 1OBCA 2XSZD 3OIUA 1JEQA 1ISPA 1U1DA 5HK9A 3G1WA 4Y2XA 3ZU3A 4PYIA 3NYWA 4YJKA 1K63A 3HCOA 3GLGE 2QRKA 4Z4QA 3ERCA 3JWIA 3A1SA 4AJJA 3AR7A 4R3WA 1KJ9A 3GJRA 4ZXPA 1OFVA 4S35A 4QUDA 2M98A 2CGEA 3CRMA 1BGXT 3JQFC 4MGZR 2J30A 1CB7A 4OTZA 4OXKA 4WLUA 1UDXA 2GJ4A 2WVGA 5DZSA 3HNPA 1QFXA 4RADA 1EM8B 3QBTA 2IIQA 1ZAYA 3IVGA 5LZ4A 5TDHA 3TZCA 3H4TA 3GRUA 4Y2UA 4B6EA 4R2KA 1FFDA 3BIJA 3KKLA 4D8YA 1QTIA 1SU8A 3VDNB 1YKSA 3MT8A 5H3CA 3UAXA 2ZXUA 2WQ7A 3THRA 4REQB 2WB2A 1XFAA 4CEJA 1LZKA 3IPRA 4OOFA 3GJ6A 4QO7A 3X43A 1FL9A 1JXOA 1ZVQA 2IEYA 2QPTA 2WKWA 3ASYA 3FCCA 4XZ3A 5E7QA 3ZEIA 3BWBA 4ZJUA 3EOAI 3IERA 1C8BA 2KHZA 1F2DA 1FSZA 1J07A 3DQQA 1ZK3A 1S01A 4D9IA 5ITZB 1EXNA 1M66A 1FDIA 1UXGA 3H87A 4DCOA 1ML4A 1I5RA 4MR9B 3RU7A 3C8ZA 4MGYR 1BJTA 5FLKA 1GIAA 3AY6A 6REQB 4MMXB 2EP7A 4FFMA 4MI1A 1P17A 5JS8A 3G5LA 2PX3A 2A1UA 2XTNA 2X9VA 3PNVA 4AJLA 2I3BA 3C3KA 4XEUA 1JEOA 3R9KA 3GLIB 4JVNA 3RAFC 3K9NA 4GOND 4XIJA 4PO1A 4QOHA 2AOTA 4NI5A 1MV8A 1L3IA 2B25A 5BSEA 2I1WA 3PHLA 2PAFA 2PUDA 4LOJA 1JMVA 3E3AA 4JBYA 2IC5A 3D2LA 1ECGA 1P44A 3IGFA 4QDXA 1K9VF 1U2EA 2DETA 1WWKA 1WM1A 1CR2A 3SR4A 2FN7A 2X4GA 1FDOA 4YBRA 4ROSA 4CQLB 5TVKA 1MTOA 2JAOA 3HJRA 1S7GA 3PICA 4FDMA 4N47A 2WQ6A 3E61A 2ZTVA 1LFAA 5F2NA 2FLVA 2ZI6A 1EYZA 2WHEA 1Y7LA 2JAHA 3Q5EA 3JAKA 1E9SA 2A8YA 1EK0A 3PT9A 4MIEA 3WLEA 4BS9A 3REOA 3ZR4B 1TM5E 4HX5A 2XTZA 4IVNA 4LDAA 4M9RA 1AHHA 1XXLA 1TA0A 3QBEA 3EW7A 5DHUA 2GZSA 2G82A 3L0SA 4A0SA 1ZQ1A 2P9FA 1DKRA 5AOAA 4MK4A 5E9WA 4OHZA 1GY8A 1KY3A 4ACAA 4I50F 1QH0A 2GT1A 2PX6A 5BYBA 1OVGA 1YI8A 1ZCFA 3JYQA 3ZUPA 3ZHYA 1NI4B 3LLVA 3GLGB 3D4NA 3IP5A 3RVBA 4CODB 1V5IA 1WUHS 2AWNA 4LXTA 3HK2A 3DM9B 2RSLA 721PA 1DRJA 4NMMA 4MQUA 1VLQA 2X8JB 1SZDA 4LX8A 1DIBA 1N6IA 3EAQA 4BQPA 1YFKA 5DBFA 1U4NA 4E5VA 2FZEA 3BFVA 2HEGA 2D5CA 3L6UA 4KQWA 4ZVNA 2ATEA 1TW3A 5LN1A 2R7AA 5AOBA 1LPBB 1Q2XA 1C8KA 2V7BA 3O1HB 2VSOA 3CZQA 2IZ6A 5AH0A 4ZAFA 5GONB 1V4NA 3RUHA 5FWNA 3IEUA 2PZLA 3F5FA 3LYAA 2CLHB 3IKTA 3GJ5A 2O6LA 3E9MA 2W2XA 3BORA 3MHPA 1JNXX 3W5UA 4UHKA 1IK4A 2IHJA 2RB5A 3PQ6A 4N1AA 4BP9A 4LN1A 2VBIA 5DRTA 1BG6A 5CJPA 1DIAA 5IJWA 3PGVA 4E13A 2W6QA 4EY6A 1MOPA 3R7WB 3SC6A 3SN6A 1ZJWA 1FFSA 3E9NA 5IK2A 1KVUA 4HVTA 2BFCA 1KNQA 1QONA 3K4HA 4JMLA 4RLFA 4R3NA 1WPRA 1L5FA 3MVEA 4B7UA 5ESXA 1MJGA 4EKEA 1F8UA 2ZI5A 5CT5A 2OILA 1LBTA 3HYTA 1XWFA 2ZTMA 2G8LA 4JBGA 2QUIA 4UCFA 5IBQA 1YCDA 4EQZA 1DNPA 3L6CA 5TGZA 1R8YA 3E2PA 3GLTA 4RA6A 5CURA 2DP4E 1NX9A 5DGCA 3ZX5A 4GMGA 2IIPA 5FQOA 1I9CA 2EKPA 5EKTA 1BVHA 4RHEA 1T2DA 3UGJA 2P9BA 5BMVA 2W2QA 1DVRA 1G5FA 1XK6A 1WZCA 3A6LA 3JQRA 3VZPA 1P4JA 3OLXA 3PUZA 5EMNA 4JI0B 3E9ZA 5HBGA 3OTGA 4YAFA 1DQPA 1GV0A 2M1XA 2PJZA 3BA6A 4K81B 4LHSA 4N6GA 1GKKA 5BSUA 4KPFC 1RLIA 4CU5A 1NRXA 4DJJA 4D9MA 2Y77A 2DZDA 2PUTA 1C8VB 4DSZA 1JDBC 4BO1A 2VDKB 1BNCA 4H0NA 2M6KA 1IWPB 4HK4A 1H8ED 3KQVA 2Q3MA 4RKFA 2EWMA 5ALTA 3HCDA 3C3DA 3OX4A 4KX5A 2BBWA 3KU1A 5A4IS 1P4HA 2CKDA 1N2GA 3FGPA 3GH1A 1PV2A 4F4JA 4YRAA 4YAOA 1Y3BE 4R98A 5L3QB 1PNVA 2AN4A 3LNTA 4MKXA 3TH5A 4K6MA 2VJYA 2C9BA 3KJQA 1EDZA 2D7DA 2XMQA 2NU8A 2HKIA 4QU8A 1HA3A 1T2AA 1PAUA 2HUPA 3QKSA 4QXOA 4I46A 4PVDA 5GGXA 3UHJA 1Q77A 2BCEA 4QNRA 2H07A 5GWXA 3NHLA 3FYDA 3LQYA 5KI6A 4EATA 1A5ZA 2Z9BA 3H18A 2O4CA 3IT1A 2QTTA 1Y6ZA 2KW5A 3MJRA 3OEHA 4WFQA 3H5NA 5DWDA 4D4MA 1RBQA 4G2TA 2UUBB 2IP1A 2OD2A 3RSZA 4A8JC 4UNIA 1WY5A 5C9ZA 4I8XA 5CA1F 5C53B 1CPYA 1GCAA 4AECA 1HSZA 1BU5A 5K3SA 1HT2E 2HF7A 1PV4A 4DUGA 3KOOA 3B5EA 4LFAB 2GEBA 1PJ3A 2ZM5A 5BW6B 1TMOA 3N53A 4URUR 1GTJ1 3L79A 4MVJD 1C3EA 2BYTA 1G2PA 3H84A 5H3HA 2FFRA 1EVQA 4H18A 4IDBA 1C1XB 3LX5A 1U0SY 1NL3A 3T1QA 4TS3A 3F9CA 5EY5B 4CM8B 3JW8A 5GPBA 2P6OA 3KJHA 4C0AC 5A5EA 2C3PA 2Z5VA 1G0NA 1I4TD 1M33A 2QPOA 1EVJA 1T91A 2OT3B 3UJ6A 3UK2A 5A04A 4JNCA 4D3XA 4ER6A 1EFRD 1ZGZA 3HZHA 3KL2A 3DO6A 1QE5A 1YNOA 2GEFA 1V5FA 3EEBA 3LVBA 4F2DA 1BQ3A 3OVMA 4DA7A 3FYUB 1IOVA 2QE7A 4PN7A 5J4YA 1TIPA 1QH1A 1BXRB 4JKIA 4LCEA 2HGSA 5AVJA 3TRFA 2ZIGA 1CYEA 3VOTA 3L0YA 1WE2A 4OVKA 1AGNA 1KDVA 3VPHA 4CPDA 1Y6RA 4EG0A 2V7WA 2XUOA 4MRNA 4ZO9A 4A0RA 1RJDA 3CNNA 1EFVB 4QBKA 1E0AA 4R6XA 4X94A 3HBLA 3FYSA 1BE1A 3GLQA 1FS4A 3NHZA 5AW9A 5K3AA 2ZJBA 4FJ0A 3I1JA 1P1KA 4IOLA 4MS1B 5JCPA 3IVMA 1ZH6A 3OX2A 1CC1S 1M34A 2ZBGA 1SUFA 3GGGA 1Q0SA 4G6ZA 1OJ7A 2PKXA 3ET5A 2V0CA 3K9GA 4B3TB 1N1GA 1KVRA 2J6BA 3IXQA 4XTCS 3R6DA 4ZAXA 1GUYA 1ORRA 4ROTA 4CDRA 4UNPA 4FFBA 4GU5A 3D4PA 1TKAA 3BQMB 4KK4A 1X42A 3B78A 2NTNA 4HAZA 2PR7A 1UF9A 5DFAA 1RU3A 3U09A 3ZWPA 4PSVA 3RFTA 5AVVA 2Z9DA 2Z2XA 1DV1A 3DF7A 1LPAB 5L6MB 4DUYB 4PPGA 3FSGA 1OBFO 1SRRA 3ZLBA 1OHHA 1VXOA 5FTWA 3ODPA 2XBMA 4ZVTA 1NXOA 3VU1A 5AFSA 3MYRA 1I51A 2QZSA 2QMOA 4G25A 2WVHA 4J0KA 4MGIR 4F8EA 2ZVJA 2O07A 3KPVA 4UEOA 4CMIB 1JAZA 1XZBA 4W6ZA 4Z7NB 4AYWA 2O8CA 2YZKA 1WU7A 5WRFA 1P77A 3WGHA 5BPFA 1WHTA 5JHGB 1PEDA 1EFHA 1SA0A 3G9UA 3GROA 4J9VA 4JN6B 3S0JA 1OU0A 4HNUA 5LLTA 3G0HA 4JB0A 4B3MB 4OM7A 4ZI5A 4G24A 5B7PA 4CXMA 4C4XA 1VSTA 1Y1PA 3GZTB 4XX0B 2ZAMA 1Z73A 4Y7CA 1L5LA 5EJ2A 3ANYB 3JZDA 1EVZA 3NLLA 2FDXA 2B99A 2DBZA 3ISJA 4HAUA 4D1YA 5JH7B 4WKNA 1SKMA 1H4QA 1G8SA 1S7CA 4OB8A 4C7OB 4O2LA 1KEEA 2B4TO 3IDFA 1Z2CA 1OX6A 1I7DA 4WLEA 4E6PA 1TF5A 1Q1BA 2HTEA 2BEWA 4G86A 4IJVA 4DIOA 2O8DA 1XRPA 3A1FA 3U1BA 1YCFA 5JTUA 4DKJA 3EXEA 13PKA 2E1RA 4HQFA 4Z53A 2PUVA 3FF4A 3AM1A 1T6ZA 5LYJB 2QKYA 1RHQA 3AF3A 2Y92A 4R8RA 4B84A 1F3LA 2OGWA 2HDHA 3PXXA 4IJWA 1UXIA 2V7GA 1DAOA 1NUTA 1WKVA 2WZBA 2GM3A 2X6RA 5CJ2A 5DDIP 4TSKA 5BOSB 2IHBA 4I50A 3A06A 1OVMA 4ID9A 4Y18A 1WUJS 3MUFA 5LQJA 1C9DB 2RK6A 2WAAA 2C96A 3DWGA 3EZ7A 1RXWA 5GIOE 1Z36A 4AY6A 4E5DA 1O8BA 5M04A 3R7SA 4CM1A 1K7XB 3CKMA 4NNOA 1NQ5A 1P0FA 4P4SB 3D9QX 5FL3A 1Y80A 3T3IA 4HHEA 3RK1A 1L4BA 1CUVA 1O94D 1II9A 2FPLA 2XYQA 4RIHA 1IONA 3EDOA 5J2UF 3NG1A 4E03A 5K0NA 1I0ZA 2JFGA 3OM9A 1X7YB 2PJDA 4ZGGA 4QTUB 2DYKA 5E0OA 3IUNA 3VR5D 3R24A 1D6JA 4GUDA 4YAIA 3RVMA 3WIOA 5IBCA 2JCSA 4QODA 3KYDB 4N01A 4DB2A 1JR6A 2ET6A 5ALIA 3ZCPA 1WR8A 2YL2A 1VP9A 5A3RA 1RQ2A 2VUSA 1V7ZA 4HO1X 4HX9A 3MFYA 4V2IA 5E4YA 4HB2A 4YXFA 5FAKA 3NGMA 1OXTA 4NJEB 2HV9A 2QRVA 5JNVA 1PGNA 3DDUA 3U6KA 4UBOA 1JIIA 3CZ4A 1DWOA 3ND7A 4JOQA 1TPZA 4D2IA 3KT8A 4KAFA 4PQRA 4PXAA 3IXLA 3LAWA 1YQTA 1T13A 1C9KA 3O7WA 3OTOB 2FW0A 3OTQA 1EFTA 3AR5A 3AFIA 3BBPA 1SQ0A 4CCAA 4GPIB 2KE5A 4OBBA 1US8A 3AUKA 2H2HA 2ZE8A 3PTAA 1N7GA 4MGKR 1HH4A 3TO5A 2VYFA 1N6PA 1Q6ZA 2ZYDA 1QAMA 3JSAA 4DSOA 3E03A 3F5MA 1NW3A 1CV2A 5AWFC 1EVLA 2C94A 1ONNA 2BM1A 1IQRA 1UPUA 2HRQA 3BXHA 4C0JA 3R8CA 2BI4A 2QSJA 3CR8A 3WYNA 3C7AA 4QRDA 3MTIA 3U56A 1SMKA 1YE3A 1ZGAA 2X7HA 1UZLA 3C0KA 3HDQA 2WK1A 2YINC 4RPLA 4CBVA 1R1DA 1A1VA 4TYYA 4TYNA 2HA6A 1U9YA 1YB4A 1Y5LA 2HK8A 2I4RA 3CRQA 4UHEA 3UG6A 2P9ZA 1LBHA 4PQFA 3PSHA 3KLOA 4DIEA 2HD4A 4MS3A 3CUKA 1LX7A 2ZQYA 5A6VA 3OSZA 2AYZA 3QM1A 1J25A 4AM8A 4WNAB 3R2JA 2HX1A 2BJVA 3ABZA 3RRJA 5DSXA 4HUJA 4IIHA 1XTZA 4FILA 4QUEA 1NATA 3RYIB 4EVSA 3FHTA 4K6KA 4JFRA 3A27A 2JL1A 3LZDA 4C4RA 1NIPA 3RC9A 5DF1A 3ANXA 3L2OB 1E64A 4MGEA 1T6NA 2I2AA 3AVUA 1N2CA 3NOOA 3IE2A 4ZYVA 3I1FA 2Q4EA 1EK2A 5A0FA 2WSBA 3VSAA 2X8AA 3DM5A 3LP6A 3UXEA 1SPBS 1WDLA 1H5NA 2YS7A 3NIDB 2MYUA 2Q3JA 4QXQA 1YHZA 4HDAA 4EYSA 2H1WA 2EIHA 5ECYA 3EZFA 1NW4A 4L6IA 5F5XA 2ID9A 5CA1A 1GTVA 3RVSA 4GLLA 2YVLA 3S27A 3SQOA 3ZK7A 2G3YA 3QI2A 1N6OA 3SLKA 3VH1A 3W5AA 4DILA 3KDPA 3CTPA 3E5NA 3A6ZA 1HKHA 1Q95A 1L5MA 2JDIA 2W2LD 2WBLC 2WSIA 3L8YA 2X0FA 1MVNA 4LWOA 4EHDA 1EESA 3JV7A 1MT0A 1NULA 2XT6A 2BI8A 2ZUWA 1G5RA 5DN9A 2W22A 4GKBA 1QOPB 1SB8A 1NYRA 4A8JA 3KXLA 1K08A 2C61A 3KKKA 4D4LA 2X14A 1W29A 4QGBA 1Q1NA 2P65A 6NULA 1YV9A 2YUTA 1DIGA 5F1OA 2HQRA 4NFHA 2PUBA 4EKGA 4C0HA 1KKUA 2LW7A 1XMSA 2XUDA 5AM3A 1BD4A 2Q21A 4XJTA 1YZFA 1PG5A 3H1TA 3SYNA 2JKVA 5AM4A 3AU9A 2C9DA 2EV9A 1WDMA 3Q4GA 4A6PA 5IUNC 1WETA 4M6WA 3ZDRA 5B3AA 3R5TA 2BFEB 2RGEA 4QEZA 1XLWA 3K6JA 1N6LA 1UBUS 1F06A 3HUEA 3KKEA 1Z2AA 2EWVA 3DVSX 4IIXA 4KYVA 5D3MA 3K0HA 4TM7A 5DBGA 5CDYA 1T9KA 2ARKA 3UPDA 3OMXA 1GZUA 5JS7A 3FZYA 2RG1A 4Y1EA 3PR3A 1O6ZA 3FB1A 5DULA 1FJHA 2BGUA 4MI3A 1DELA 2BZ0A 3A37A 3A3NA 2ZS9A 4IAOA 3UCXA 2P1ZA 1EAYA 3KOUA 1UKEA 1WSBA 2DWQA 3FG9A 4RORA 2I1QA 3BBLA 3V8BA 4HDKB 5DJ5A 2X7XA 4IIBA 1ZIYA 1JJVA 1HKUA 1ESEA 2EZ8A 5LVAA 3C3YA 5D84A 2IFTA 2QYTA 5G53C 3RF7A 2X6QA 3IULA 4MP3A 3NBUA 3PEFA 2XDYA 4ZV7A 3CCBA 4B31A 3GFTA 3ZEAA 2NYAA 4JSTA 2PBRA 4NJMA 1E2DA 2N0SA 2OPHA 4I1UA 1GZSA 3GJSA 3DUFA 1IBSA 1KK1A 2A86A 3QH4A 4PGHA 5EOVA 3HADA 3G2NA 1YJQA 3W2HA 5FUQA 1YHNA 3N2KA 3ADBA 2QTNA 1N9ZA 3C5CA 1XRRA 2RC6A 3HN6A 4HGRA 4J4TA 1HDXA 1J23A 1KP2A 2ZZKA 4PRLA 5EFOA 4YH1A 1ZCJA 2V7QD 3WMGA 5KKCA 5JCOC 3EJWA 3F6EX 1JECA 3JWEA 4EYEA 1D2CA 2ZETA 2BTOA 5CEJA 1IU9A 3KKOA 3UH0A 4B85A 2BSQA 4LDJA 4E3WA 5CHEA 5DMXA 1OB5A 3MGBA 4ZOCA 4EWLA 1GOTA 1OJLA 3F90A 2NLOA 3WQSB 5HXAA 4O2BB 2WD7A 5EZ6B 4X8HA 2CYCA 4A5OA 3PTLA 3G82C 3F5DA 3CX7A 4KN5A 1R6UA 1P0IA 3GRAA 4RABA 2EZUA 3OY7A 4GG1A 2G1AA 3DFMA 4AJ4A 1NRWA 4GPTA 4DF3A 2CXSA 2LIPA 3I64A 4KDRA 2YHUA 5DN6A 2J0QA 1O08A 2UYYA 3MBIA 3OC6A 3BFXA 3E27A 2XDAA 4BVFA 3DBRA 2JGMA 4M86A 1T0BA 3VR6D 3CJQA 5ALEA 1PD0A 1T0HB 5KQRA 2GA9A 2A1TR 1PL0A 3TJMA 4KXLA 4C43A 4CG0A 4FDLA 4PCVA 5IU6A 2B61A 4Q1CA 2AK2A 2H0RA 2ADMA 2OC9A 1RI1A 2E4WA 2W2KB 1FXUA 3VPCA 4TWBA 3OZBA 3HJHA 3RS9A 2HRDA 4NSNA 5CDGA 4NIMA 1SN7A 2E5FA 1SQSA 2H31A 3GFBA 1C50A 4J2OA 4WK2B 3WYBA 1ZVVA 3GLHA 1A2KC 4J1NA 5EE1A 3ZHQA 5KTMA 4FEAA 2POQX 2QZJA 1YHYA 4JEHA 3NTRA 3N2YA 2ZSHA 2ATCA 1MJFA 3F8WA 4EJ2A 5JXWA 1NN5A 3OICA 5I5EA 1YAJA 2JJ2D 3FYUC 3T1OA 2IL1A 3TKLA 1DRKA 1K3FA 3EYAA 5J2UA 1PCXA 1Q19A 1RC1A 2C0QA 3ZZMA 4CKBB 2ZLBA 1RLUA 5JW6A 4M8KA 3C5EA 3WQHA 3R3JA 1C7FA 2WJWA 3OTIA 3AOEC 1KDTA 3LS2A 1W19A 4FYWA 4L07A 4UZEA 4WACA 4DRXA 2C0PA 3P94A 4HCJA 5LZ8A 4ZHQB 1G3RA 4HSGA 4UUMA 1ST2A 1HETA 1E2GA 4PTLA 3N8NA 5HVNA 1PK8A 1UM9B 3C4QA 2BFAA 5LZ5A 1QF9A 4KXQA 5P8WA 4LQCA 1QKIA 4O4HB 3W5IA 4NONA 1NMXA 2OV4A 1C2TA 3G8CA 3NIGB 3T7SA 2CLIB 3JQGA 3DB1A 3E3LA 2HDNB 1EA5A 1UWKA 4KNYA 2QSUA 4MVJM 1IUOA 3K09A 2ABWA 3B51X 3H2BA 4EHIA 1X9HA 1OT3A 3R5FA 3JVVA 3MJ4A 4FMDF 1QH8B 5J1TB 1ZY2A 1Q74A 2Q5LA 4RZXA 1W5FA 1WXDA 3ZWDA 3NJ4A 1L7AA 2PD4A 5HE8A 3ZJVA 3RRXA 2R6ZA 4MUYA 3IDOA 2CXXA 3NWEA 5BYAA 3SF8B 3M70A 4RLQA 3AW8A 3IQEA 3ULKA 2AE1A 4PG4A 5H80A 5J59A 2MMGA 1WCYA 1L7BA 2JIDA 3A1EA 4D9NA 4EJFA 2FOLA 2YBEA 4UQLA 2PMFA 3AEXA 1QK3A 5ALHA 5LDGA 4LSWA 1E5VA 4PR3A 3S2FA 4LIPD 1A3CA 1E63A 5CLJA 1GQ2A 3A25A 4FSHA 5DNCA 4GEKA 5FBRB 2YVKA 5EKUA 3BWMA 4KLRA 5GIPE 4REQA 4K88A 1E7MA 1G4AE 1SCIA 1XHFA 1SIWA 5CW1A 4PCLA 1ZWKA 4MAFA 4NV3A 1MOQA 4P6VF 1OAAA 4BFSA 5FOXA 3QA9A 4OI4A 4QYIB 4WCVA 5C8YB 4JQYA 2UKDA 1H6AA 2BZGA 1XHEA 2QYHA 3P1JA 3T1NA 1H6DA 5IH7A 2OV6A 3ZOZA 5ITZA 3DLIA 4OGGA 5HJEA 1Y3AA 3K15A 3WKAA 1N34B 4S0XA 3THYB 1LF5A 4MR9A 3PRKE 5E6SB 521PA 1SHTX 3U2QA 3HRHA 5ED0A 2ZBUA 3DL7A 4L4SA 4S1VA 6REQA 3G6KA 2CXRA 3BXFA 3DZKA 4LJAA 5H16A 2GYVA 5GVSA 2K4MA 1RR6A 3NHRA 3ZXIA 5C52B 2HU8A 1H2ZA 2BPOA 2PIDA 1QRDA 3UJAA 3GLIA 3CLVA 3PA6A 2YWEA 3DDWA 1HT3A 3NFRA 3OF3A 4I8DA 2FX3A 4Q34A 2WIFA 3SZ3A 3UAGA 5L51A 1KU6A 2CYBA 2G25A 1XQWA 3BFKA 1T36A 3MRTA 1L4KA 3IUSA 2C7VA 3C3BA 3KSDO 1PT5A 2Q4TA 1L3CA 1OMOA 4PG8A 1MQ9A 1JHVA 1C7EA 1JZSA 2O1SA 1D2HA 1OU4A 2FZGA 2X5XA 1OILA 2HFKA 3AYXB 3DWEX 4IRMA 1FUKA 1E3WA 3S5JA 3W77A 3PZRA 2VP0A 4Q9IA 2EFCB 2P3SA 4PYLA 1ZH2A 4B4DA 5B58C 1VDZA 1JG7A 1K9SA 2QU8A 2V59A 1QHXA 3JD2A 4GFDA 4KNVA 1NTRA 5LYJF 1NVMB 3EULA 3M1LA 5KHAA 1M5UA 1KPGA 1YRQA 2C5BA 4RO0A 3JRNA 1N9KA 3I42A 1VMAA 1WKBA 3W34A 1VIDA 4JROA 4CR7A 5IK2D 3LPMA 5MN6A 1J2JA 4OSOA 1G42A 1EK6A 2D7CA 3DEFA 4HN2A 3WMFA 3B3FA 2HF9A 4XWOA 2WSSD 1G2QA 3WJAA 4ASUD 4Q4CA 1MXHA 5IFLA 4YRMA 2E37A 5BR8B 3GLGA 2GZ3A 3I2HA 3RODA 1JDSA 2QP4A 3ZNOA 1UUFA 4JIMA 1J0AA 3RG8A 5DLEA 4PAWA 2CJWB 2X8JA 3DZ8A 3AINA 1UBCA 2W0SA 3U9LA 3LL7A 1IMJA 3E9DA 2XCUA 2YZ2A 3AB7A 4NBVA 1SIBE 4M9UA 4QPPA 5FTJA 4PYJA 4U3JA 5KZMB 2EQ5A 2C9CA 4BCCA 4ZVUA 3MWEA 4ENVA 2CMKA 4MR8B 3CH4B 4JT4A 2IUTA 3OWHA 4MKGA 4QNMA 5AI5A 5IC5A 2XCSB 3F1LA 3NMUF 4U2DA 1K4YA 3RIEA 4ARCA 4NNJA 2D6FA 1A8SA 3ETEA 3VMMA 2W93A 2WV7A 1PW7A 1TT7A 4PIVA 3IUEA 3FNEA 3VZDA 3BIOA 4PYNA 4CQNA 4H27A 2LKCA 2O7NA 2V9ZA 4OREX 5A1JA 2NZVG 4KGVA 3R7WA 5F3WB 4Q18A 3HUDA 2ZAGA 2J9GA 1GPDG 1M72A 3G59A 3H11B 1MEOA 2WLSA 3QOFA 4RMHA 4DV0B 2RI6A 1AF4A 4YJHA 3T7JA 1T1SA 4CLRB 3RTGA 3UMRA 1JBQA 5L3RA 4F0JA 2ID8A 1RPTA 3GMIA 2KB0A 2A0FA 3SZLA 4WZBE 1PI3A 3CZAA 4CF7A 1VZ3A 2VPPA 4ZZIA 4MIOA 3W8EA 4ATNA 4IFIA 3NGXA 1HYEA 4N18A 4MW4A 1RTKA 4JVMA 2COKA 4FQ8A 4AFNA 1Z68A 4DIBA 5JUWA 3OEHD 2OB1A 4Q05A 2YCBA 3MJEA 4WL0A 4V0QA 2ACKA 4LSZA 1E4VA 2C2WA 2A7QA 1X74A 2C4NA 2B7LA 4HMOA 4ZHSA 3T0FA 5J4HA 2XNKA 4K9MA 1O9BA 2YV5A 1YR9A 1KYTA 1ZNYA 3ND8A 2A0XA 3SSNA 2VYQA 1BX1A 4KQ9A 1XZPA 1UP6A 2WJZB 1R00A 1RQNA 4NE9A 4DUGD 4YV2A 2EW2A 8AT1A 4I5EA 1CW2B 3FBWA 4EYQA 2OCAA 4EZEA 1J0EA 5KIAA 2AG1A 4KO3S 4NULA 4YRNA 5LDHA 1Z0KA 4UTZA 4W9MC 3PQ4A 3QU7A 4FNGA 1UOEA 2Z1MA 3B6EA 3CY6A 4E70A 4L5JA 1Y7PA 1T26A 4P3NA 2RHDA 4YHBA 3T94A 2PNFA 3HFGA 4NCKA 1LVUA 3FUTA 1T1JA 3IH5A 2XKAA 1YS4A 4JJFA 4LMPA 1GTRA 5L3QA 3DHWC 3D6JA 3OECA 3K9FC 2W9XA 5JZBA 3M6AA 1VSBA 2JGIA 3HY6A 2WZDA 4G1VA 4H4DA 2MCFA 4Y6PA 1XNRB 2JCGA 1Z4NA 2R1VB 3P52A 4FFPA 3O4VA 4IWNA 1YKFA 3OIWA 2ZQ5A 5L3SB 1P7WA 2JAUA 3DD1A 2EWWA 1SXHA 4GYKA 5JFOA 2C1EA 4TKVB 1AN9A 3AEUB 1UC4B 1Q57A 3G85A 3ZD7A 1NVTA 4L2IB 3AJEA 3TLZA 3UMCA 2Y93A 3GFRA 1U99A 3UZUA 5FORA 3DHEA 3SZUA 5IDWA 1GXSB 3MN1A 4K03A 1M76A 2XA1A 1MORA 2XRYA 1BD3A 1U0NA 2QSZA 1SJ9A 1T3ZA 4UBMA 2VQ3A 5SYNA 2HCBA 3PUVA 3RSGA 3IODA 1K7YA 3OOHA 4JJZA 4HDQB 3I1IA 5EAIA 2WYUA 3BGIA 2H52A 4IS2A 3WBJA 1JJIA 2FR8C 3WL7A 3ETLA 4KYUA 2JJMA 3HGMA 1KARA 4YI3A 4DWWA 4FT2A 4BKRA 1C1XA 3PXDA 1GDDA 5FJJA 3WL5A 1P7PA 4CM8A 1ISGA 3TE7A 1OYYA 4X90A 3P0JA 2B1GA 5L6LB 3WMWA 1XVAA 4OM8A 3HB1A 2ZGVA 2W00A 5I9NA 4JBIA 2JFUA 4WZBB 1JILA 3PCRB 4GMHA 3E9YA 2B94A 3ESAA 2B1RA 2ZJZA 4JOCA 4QT0A 4V3BA 3VSCA 1G17A 5ALMA 4O02B 4C2AA 1E61A 2BFMA 4H4CA 4DQKA 5JDCC 5EMKA 2I3ZA 4B7AA 2DE0X 2Z56A 4E5KA 2TMYA 4C2TA 3QPVA 2ZIWB 5B1DA 1TLFA 3JZFA 4IUDS 1EFVA 4M1QA 2GEKA 1D0VA 2P9GA 4GMFA 3OWXA 2DWPA 2O2IA 3EX7C 3T9CA 3CM0A 3HP7A 5AKXA 3DW3X 2G08A 2YWXA 1CUCA 1S6YA 2NVUB 3HB7A 3Q9SA 2QVCA 2ZSAA 4HBZA 2IPNA 3DNMA 1QORA 1V9SA 3BGDA 3I53A 5AHWA 3UA4A 1W1IA 3LV8A 3T7DA 3ANMA 4YLYA 2NPOA 3HU2A 1YQWA 2FSGA 1FBNA 4JAVC 4ZOLB 3KVRA 1WW2A 3AXTA 1I24A 1EA7A 3GL9A 2C8JA 3ANSA 2Z0MA 4YAWA 5H9VA 5LJLA 2C9OA 5FFMA 3L46A 3HN2A 3EEOA 1XRLA 3KQKA 1RTTA 4C0BA 5I48A 4NDAA 3EFEA 3PHBE 3SQMA 4MCIA 4CI9A 1BOOA 4RM3A 4PAQA 5MGBA 3CGWA 3CKKA 1GPWB 1I7NA 3GRVA 3LBHA 3O1LA 2AZ4A 4HLUA 4Q9LA 1A69A 2ADFA 1RJEA 1E79A 2HMVA 1NVWQ 3V2UA 4G0OA 4MPTA 3UHAA 3CRRA 2GAJA 1NXSA 1E6WA 4E5UA 1G98A 1GUAA 1H0SA 1M7BA 4MW9A 4CMIA 1HFEL 1UKBA 4Q02A 5F73A 3RHFA 5G4KB 2JCXA 3MBKA 4HI0E 1CRWG 1OWOA 4L16A 1XLVA 1WNTA 2DR0A 3AI1A 1V5EA 3ENVA 4I19A 3S68A 4YB8A 1ZDMA 1FSPA 4LRSB 5K45A 1YZTA 4KLZA 4LWPA 1ZOOA 2VJBA 3O94A 1Q0TA 1OV6A 1KO7A 2PLWA 3EHEA 4FBGA 2YOHA 2H1HA 3NBYC 2QT0A 4XX0A 1TEXA 4D4KA 2R0QC 2WM8A 5E9JA 2Z2IA 1DUIA 3RVPA 2ZSDA 3JQ9A 1A8HA 4O2BF 5M2QA 3BWXA 4ZRNA 4C7OA 1DEOA 5K0FA 2XNHA 3NJ8A 4FCTA 3PHIA 2J45A 2PL1A 1PFYA 2BFDB 2J4CA 4OMCA 5EJ8A 1RQGA 5LLDA 2Q0SA 2HU5A 1PWEA 1SK9A 3QPDA 2BSXA 2FFHA 5COAA 1H4SA 2LWIA 3QFHA 1V48A 1U9ZA 1RLOA 4PAMA 2VHWA 2BN4A 5DSTA 1G8YA 3MB5A 2ZB7A 5A4FS 4LWQA 1CFZA 3GWGA 4NCJA 2NO4A 3ZCSA 4UDOA 4ZT7A 1RXCA 1H66A 3ZZUA 2IUYA 3COJA 3QFRA 4QM6A 5LYJA 4KBFA 1QJCA 4BLSA 3HCRA 2GNOA 2I9KA 1Y82A 3MA0A 1G1MA 2D06A 1JDNA 5EJEA 3O31A 4YRBA 1KZ7B 4V3CA 2ZWIA 2IEGA 4EDFA 2HMWA 4PHCA 3TZLA 1R9NA 3IQWA 1D0IA 2JJ8A 4J4HA 3A1UA 5B53A 2DUUA 1MW9X 2VZ0A 2Q7DA 2EHJA 1G5PA 3M6MD 2JGLA 4HLNA 2V6BA 4KUEA 4C87A 2NZWA 2R79A 1Z13A 1D4AA 2MYNA 4JB3A 5ENDA 4RPIA 1O6CA 4DREA 2OHJA 1I2DA 4TVSA 3OSUA 1AQYA 1U6JA 5K7SA 3PITA 4AMZA 2VNSA 2PX8A 1ISSA 1A76A 2R6AA 4P4SA 5IKOA 1I2AA 1P2DA 3ANTA 5BNIA 2ANCA 3PRYA 3P2JA 4FU0A 3UVEA 4QE3A 3V8QA 4AIIA 2GUWA 3KJIA 1JA1A 3R23A 3T9FA 1YS9A 2V1XA 3WLJA 1CG6A 2ZRLA 3C8MA 4BO8A 5C7YA 2XQJA 4GPAA 4IQFA 5JTTA 3LECA 1CFJA 3SQXA 10MHA 1EFKA 4MUHA 3S1LA 4KR0A 3CPHA 3R9WA 4ZHQF 3IA2A 2IV7A 3PJRA 1U3CA 2V97A 2F4NA 2J3QA 4G1MB 1SHZA 2CHEA 2HIMA 3BGVA 2FPIB 2GHIA 3G0CA 4O4HF 1RPNA 3WLMA 2OHVA 4NJEA 3UK0A 2ZJ3A 4DMRA 3U6BA 5CAEB 5SY4A 3D43A 3M5WA 3LCMA 3F1KA 2D59A 3WBFA 2V03A 3PX2A 3ZU5A 1RJ9B 3M82A 4B3RB 3ZCVA 2WWIA 4POAA 3OI7A 1C7IA 4HWPA 1ZCBA 3CZMA 3WMRA 1Q1ZA 3KE8A 1Z75A 3ML1A 2YV1A 4PS1A 3RFCA 3GH3A 4J0GA 4P31A 1IJFA 4PVCA 2XCTB 3FR8A 3NTQA 3O03A 1SXIA 1GWNA 5FIUA 1KMHB 3VJLA 1MQ8B 2D0OB 4MZXA 1Y4ZA 4EG6A 2FPPA 3HXKA 1LDGA 2AL7A 2BH2A 3GDFA 3ROGA 3O90A 2R8ZA 1BS9A 2R7LA 1ZHFA 2QT1A 1SNYA 1AT1A 3EWNA 4V39A 3U5ZB 4BEBA 4DLWA 1E8MA 4NOJA 4W5RA 3CQ9A 4K9LA 3WQBA 1P2UA 4H1HA 3LGSA 5DPMA 5H02A 5K2OA 1M0TA 1T24A 2QN6A 3U3OA 3IIMA 4BO2A 3L4KA 1T3GA 3P19A 5AXDA 5KYYB 4DV6B 1M7HA 3PJDA 1F4LA 1SXGA 4NJOA 2PD6A 1NWHA 1DWUA 1TYZA 4NG4A 1YWGO 2MHCA 3RLFA 2BKXA 4WNAA 1N2XA 5C8YF 1IQ0A 1Z74A 2B4QA 2O2EA 5F9FA 1ZZEA 2JF0A 4BGUA 4GLJA 2AFVA 5HFJA 2H1RA 2K87A 1PG2A 4W5JA 1BFKA 2F62A 2R62A 5F4ZA 3TLXA 5B3LA 2FUNB 3ID6C 1E99A 2YY5A 2AI2A 3O9MA 3OG9A 4LHZA 5A7HA 3B1KA 4LRTB 1XG5A 3BH0A 1DU4A 1NAIA 4U7GA 1XZLA 5IASA 1VECA 1DKLA 4UPDA 4XQCA 2GBIA 1MQSA 3DVLA 2O8VA 5CGZA 3MB8A 1M1ZA 1KQPA 2EF0A 2IYSA 3B2NA 1Q0LA 3QU5A 3M89A 1YVPA 1RMTA 4GX5A 1U7TA 4A16A 1L5QA 2ETVA 1CKEA 3Q2IA 4L4UA 4Y2PA 1BDBA 1NBMD 3G8DA 3AJDA 3DLAA 1E6KA 4B74A 5F7OA 5KVVA 1VA5A 4LEIA 2FF5A 2XAUA 1ZRSA 3VBEA 1M1UA 4Q15A 5TXGA 2HSGA 4O5OA 4E1BA 4WTOA 4NYJQ 4FGUA 2A9OA 2NXJA 3F4BA 4B71A 1FYDA 1NURA 1WLSA 2UYQA 3CZRA 2DB3A 1F1BA 1QGOA 2J3LA 1LW7A 5E6RB 4J16C 2XRZA 2Z6AA 4BLOA 5AJYA 3RC8A 3IJPA 4BEVA 3G0DA 5A4JA 2FEOA 4S12A 3LQ2A 1AS0A 5GJWC 2XDWA 2JLZA 1V8OA 4DM4A 1QR6A 2I3DA 3LD9A 1W9HA 2FU5C 2QS9A 3MQFA 1LBSA 4PGFA 4PO8A 4G36A 1JHMA 4G85A 2J6HA 4JJEA 4BZQA 2V5VA 1XNQB 1QHNA 1W48A 1A9SA 3E1SA 5JAOA 2FR8A 3BXOA 3NEJA 2X4LA 4M1EA 2X1LA 1H2HA 3BMNB 1XAIA 4QUIA 2OORA 3PC4A 4Q47A 4TWZA 1VE7A 5EXTA 1FPMA 2VK4A 3OCWA 4EUFA 4JKYA 1G8HA 3NC4A 1Z8HA 1S2DA 5ANRB 1V1RA 4NG5A 1VHLA 1V71A 4E31A 1Z4OA 1QGZA 4EEZA 4TTRA 3PUKA 4HPWA 2GR9A 5FPPA 4AU1A 1N4DA 4DL9A 2ZJ1A 4B3SB 4DWOA 1HLFA 1VSVA 2DSTA 3KOWA 4KN6A 4OFBA 3G0GA 5HSGA 3WXMA 3A1VA 2G28A 3E9QA 4RFLA 3GEBA 1H1LB 3UO8B 3KQPA 1Y4SA 1SZPA 5A7FA 4WBXC 4FDTA 3ENKA 4NE2A 4XR4A 3YASA 5DU2A 1U8XX 3V8PA 2A3NA 1ZIDA 4B2PA 2R68A 2GS9A 2YYZA 1JHRA 4L9AA 4XVRA 4YMIA 4ZRDA 4EITA 3I1YA 2B8WA 2VZ8A 3QXXA 4P2GA 3V4RA 3CBQA 2YNMA 3TAHA 2IEAA 3JZAA 4J2HA 1ENOA 1Z6GA 3KBBA 5JWOA 4J1QA 5T41A 1ADJA 4CMJA 5TMPA 1IWBB 4FLEA 3IDAA 5DSZA 5DN6D 1D09A 3E7DA 3IHTA 4C7JA 2AUMA 2SICE 3OAAA 1F7UA 3AKEA 3N76A 2H00A 3NDPA 4ZANA 1U5BB 1ZU5A 1P74A 2VRCA 3GUYA 4LRQA 2HEIA 2BAGA 1B0PA 1TCVA 3VR4A 1T8WA 4RV4A 5JXGA 2PUFA 4BWVA 4LJKA 1EDBA 1IN7A 3SSOA 4OFXA 1XN4A 4H4EA 1ZJYA 4ZVVA 5LR6A 4JT9A 1GO2A 4AO7A 4B6SA 5BPHA 2P62A 2QDXA 3ABIA 1UAAA 4X45A 1P2TA 1TO6A 4EFLA 5CXXA 4GXQA 3J7TA 5CT9A 5DX1A 1Y8RB 2XMPA 3P9RA 3CWCA 4CN9A 1KI2A 2HLHA 2OTCA 1AXEA 4H77A 2XTMA 4H59A 1MX1A 2WHXA 4XPZA 5JYCA 1K7SN 1U2GC 3HN7A 2FV8A 4R2WA 5A3QA 3GX1A 1C3JA 1NXTA 2Q6IA 4O2BA 4O25A 3A6GA 4X6UA 2AZXA 1RCUA 2WJIA 3WFZA 1MEEA 1O6BA 1W581 1JMKC 1I3OA 2NNWB 2F8TA 3QTBA 4KPUB 5CM9C 3TQIA 1ISMA 2CL6X 2FWPA 2IXFA 2YIVX 3WDMA 3GQBB 1V45E 4QTYA 4FGLA 5F52A 3DEKA 4UEKA 1Z06A 2Z08A 3E58A 2AUTA 4WRRA 1YJXA 2WEKA 3K0FB 1K7FB 1ZD4A 1WJGA 2G06A 4NZOA 2OA0A 4EI2A 3GJ8A 4M8IA 2G67A 2P9QA 2XWSA 4X0EA 2WWWA 4GL2A 4RMJA 2CL0X 4GC5A 1BZYA 2Q2QA 1UC5B 4DJAA 4EA7A 1YL7A 1R6DA 3KTOA 1EFPB 1I13A 3CZ5A 3MLEA 3OWOA 1NNSA 5AK5A 3GG9A 1RM3A 2J3MA 3RRMA 2W2KA 5BWCA 1EWKA 5T7BA 5DO9A 3CZ9A 1KEPA 4LQDA 2APJA 3IV9A 1TTPB 2VT6A 2JH3A 1P6UA 1WMFA 2PCLA 3QJYA 4YAEA 3DE4X 3CJTA 3R3UA 2C92A 3HLKA 1XCPA 4U9UA 3I9NA 3ELYA 5ALGA 1DQSA 2D3WA 1FLAA 3K5HA 3LX8A 3CUTA 4LXIA 4NYMQ 5G0UA 3V8NA 2NGRA 2V1UA 4IWXA 3NT5A 1GRCA 2I0FA 2SKDA 4G1EB 3WBBA 1U3DA 2RKBA 4E6EA 1YZHA 1BS2A 3CX8A 2HC9A 3T7RA 2GRAA 2GVZC 3WGMA 4CKBA 5I6DA 1WXIA 1X6VA 3Q5DA 4OIFA 4W5OA 2QRHA 3VHXB 4D7AA 3WSWA 2W48A 5BQFA 2R2GA 1PS0A 4WLFA 3ENWA 3ZHBA 4ZHQA 1E2FA 1VBFA 5TQ2B 1KI3A 4MYHA 2MSNA 3H17A 5DP1A 5HFNA 5LZ9A 3EWSA 3L8EA 3C85A 2BFPA 1U31A 3QTLA 4JA0A 4RUKA 3TSAA 4BAUA 4O4HA 1E98A 1H05A 2BZSA 4XB1A 4MQ5A 1X87A 5BQOA 1UWCA 4B75A 2JLUA 3FSEA 1MKYA 5IVKA 3PGLA 1ZITA 4L9RA 1ZONA 3CE9A 3MILA 4QYWA 3HCEA 2V55B 1PLJA 5TT0A 4CM6A 1W94A 5AVKA 3AY7A 3H42B 4HRVA 4RD4A 3V1YA 1QH8A 2OQIA 2HPHA 1J1ZA 1SC4A 2ZJ6A 1OYOA 5H0IA 5LIPA 4K28A 3GEHA 1YB2A 1PVOA 1G8JA 2PZAA 2QMUA 2XH8A 4CIYA 1NW7A 4K2HA 3EG9B 4MPDA 1SVKA 3SF8A 3U3XA 3BMXA 4M0UA 2CVOA 3T5PA 2X6TA 2NTVA 3K0CC 4C6TA 3Q3JB 1G4UR 5DEIA 4M8SA 5KYWA 1JEJA 2RGNA 4CF3A 4BGVA 3IX7A 3L5OA 5DWQA 2NYRA 2RAPA 2WABA 1Z5ZA 1YDMA 4QKQA 3E22A 1XDWA 1I4DD 3BHNA 4ZOLF 1U7DA 2XF8A 1DOAA 5BVHB 2I7XA 3MXTA 5EL0A 1NYTA 3LC0A 3T38A 5ALXA 4PYMA 1I4LD 2PUAA 1KOJA 2WF5A 5JSKA 1X8XA 5TMBA 3SPXA 3D1JA 1Z22A 4X65B 4G23A 1A7AA 4CKEB 4RVOA 3I6QA 3WVNA 3AETB 3DL0A 4NCBA 5A9SB 5T67A 2YXNA 1JQAA 4QYIA 4RYDA 1UZAA 3L6RA 5C8YA 3WJ1A 4DG9A 1GUZA 1B3BA 3SMVA 1ABFA 4HPJB 1IJBA 3FDZB 3SHFA 4DRYA 1UKAA 2VDMB 1Z4KA 3L02A 5U4QA 2DQYA 3A7DA 2I7TA 3PS9A 1AXRA 1FS5A 2KX7A 2JI8A 2KQUA 4KWIA 5E6SA 3THYA 3LYHA 4M21A 4BIMA 2Y1DA 4Z9XA 3PQDA 5DP2A 3KYCB 1OFHA 4Y6GB 5CFNA 3WKEA 4I1PA 2PCJA 3Q6MA 2FLKA 2ZJYA 4ZEWA 2X77A 2P2SA 4HGPA 1XNJA 4IUCS 4ENPA 3SVZA 1JFTA 3QLVC 5FP0A 2EKDA 1QS0A 3O3MB 4QULA 1EQ2A 1KBOA 2AXNA 3FKSD 3GRPA 3SC2B 5I7SA 1N2OA 3BAZA 2V0NA 4B4VA 1IIBA 3W5HA 2IK8A 1UKCA 2QM8A 5HGXA 4M2LA 4N3BA 4OPMA 2DG2A 3H9UA 4YFYA 3U4GA 2HHHB 1GVHA 3LT0A 1EWTA 2J5BA 3HKBB 1PL6A 4ID3A 5CH3A 3PC8C 5DHTA 3HHEA 1XZ8A 1KORA 3HI4A 3OF2A 4XRRA 3RYCB 1RWNA 1NDHA 3BMCB 4Q3EA 3B12A 2OFFA 3STXA 1E2HA 1XQVA 2I67A 3RTDA 1G9XA 3HE3A 5TARA 1GNRA 3AG6A 3ZDAA 3PHGA 1BJKA 5JSZB 2Q1YA 1HDRA 4LZOA 1QO0A 2IWRA 3K0EA 2YMQA 1NLZA 5B2EA 1BYIA 5J9FA 3SKXA 1IHYA 3U3ZA 2JFFA 5D1HA 3V5NA 4DLSA 3T4EA 1CTQA 4B6PA 3NH9A 4RK6A 1PT6A 1M83A 2FAXA 2VP5A 3M83A 4TTVA 2WC1A 4DLUA 3RWOA 1I2CA 3SDBA 2R6CA 3L1KA 4CMBA 1XIVA 2XV1A 1UBOS 2C4HA 2Q1UA 4IIVA 3KEOA 4IRXA 4JJAA 4F6LA 2CJWA 1VTKA 4R71A 3IOCA 2XMBA 3V97A 4HQOA 1A71A 5HMLA 1R4NB 3RS3A 2ZBEA 4B2LA 5I7OA 4KKXB 3C3XA 3WLIA 5HIKA 1MX5A 4EZIA 1JLSA 3UA3A 1CUWA 3AKDA 2Y1KA 5G0VA 5L95A 3UUGA 3THWB 3LWDA 4WADA 1XMIA 4MR8A 4LFBB 1TK3A 2I2DA 1IOWA 4QM7A 3VNQA 3PGXA 5IUKC 4CMKA 1PWXA 4IY1A 1ZNQO 2FZVA 1PZNA 2HA0A 4L74A 2YDYA 4IIUA 3AL2A 2FXIA 3ESRA 3JCZA 3O84A 2GEDA 2WHRA 2D1FA 3KZOA 4O4LB 4F9FA 5AJWA 1ETHA 3FY4A 3OTWA 4UQOA 2FMHA 2V4UA 3H7IA 2YIDA 1UK7A 4AZWA 4YCDA 3UUFA 4DAOA 2F3QA 1P5RA 1M6HA 3H11A 1IZ9A 3CNLA 1R37A 2EGGA 1XPUA 4XVQA 3FDJA 3OY2A 4CLRA 2PH7A 2H57A 3RNLA 1PGPA 2Z8YA 2JGJA 1HR0B 5AKEA 2QQ0A 1KQGA 5FTMA 3GCDA 1VCNA 2F2TA 5REQB 1SQGA 1OXUA 1QK5A 1CDEA 1XTUA 1WHSB 1YULA 2NOAA 5EUMA 4YXWA 2R8PA 2RGDA 3WP1B 3WC4A 1UBTS 5CA0B 4M4SA 2DQ4A 5AW0A 3AJ9A 3V6MA 5IJ0B 1ILEA 4YIKA 1QC5B 4EJ0A 3D0RA 2YUIA 1K98A 4AULA 3JQ6A 5J23A 2IDZA 4OFWA 2GPWA 1T9DA 5K9ZA 3BZUA 1X7DA 3R4VA 5H9WA 1SQFA 3B89A 1ZSYA 2O7SA 2PTHA 1LQTA 2O23A 3FI9A 3L9WA 4LMRA 4P58A 4RF4A 3I5UA 2J1LA 3ROFA 1DC8A 3BIWA 4A6DA 4MRMB 3B48A 3UJCA 1DWPA 4TMTA 4C5BA 4ER7A 3FTQA 1W75A 3EXHB 4G65A 2OXCA 4QLAA 4RLHA 3SCZA 4G0UA 3A05A 1PGJA 4MB0A 3KVYA 1A1SA 2QN8A 4IFBA 1GV1A 5FBQB 2ZRJA 2NZXA 2PKYX 4L0MA 3TSOA 4CNBA 3QNUA 1DRWA 4JXJA 4Z6KA 1AKNA 1ST3A 4ND2A 3RRBA 5L4NA 2BC9A 3B3AA 4YP7A 3W04A 2RHWA 2VAWA 1G55A 1NSYA 3HJAA 5KNDD 1L4UA 5KPDA 3JTMA 2R1VA 1F38A 4WY8A 5L3SA 2VQEB 2CFIA 1Y6FA 2C5EA 4B4WA 4V1CB 1JNYA 4INOA 3QNWA 1QLJA 2QY9A 2WU1A 3P2MA 4JZYA 4KJZA 4TKVA 1KTIA 3IE1A 1EUQA 4DZTA 2Q0QA 2PX5A 4L2IA 3ZW7A 2H54A 2IEBA 1U28A 3DMTC 3KYBA 3NHAA 4V02A 3EMBA 3UHOA 3AR2A 1USGA 1UBGA 1P72A 1ZN2A 2A7XA 1O9GA 4HD8A 4OK6A 2WWFA 1GTSA 1W1UA 5CXUA 2C8LA 2JI4A 2LUOA 3Q15C 5DHFA 4HDMB 4QUKA 4FX5A 4JL5A 1OKKA 3IYLW 3TCKA 1HTTA 2JLAA 4KXMA 3BYZA 1Y48E 3BB1A 3K2QA 4JI6B 3OIYA 4PIMA 5CK5A 5I4KA 1L4LA 2WUGA 5T6BA 3EB9A 5C1PA 5EHQA 3LX6A 4XPIB 3RU2A 3NPMA 2HN9A 4GPZA 1ARZA 1XD9A 2DBVO 3TDNA 1DPFA 5IF9A 4DLKA 1ORTA 2QRJA 1Z63A 3H3FA 1FFXB 3DNFA 1L5YA 3IQGX 3Q3CA 2HZ7A 4NZ9A 1KR2A 3PG5A 1IUPA 4MJ7A 2WVJA 3VYWA 3CPJB 5F5NA 3K1AB 3AHDA 4PPQA 1Y1RA 1E2LA 2G77B 4LGVA 4OKIA 4BMZA 4F5YA 1TAHA 4YMHA 4PPNA 1D2GA 1DS6A 1Q0PA 4YACA 1T1GA 3A9SA 3QQ5A 3W3ZB 5G41A 2H4XA 4OXQA 3KTDA 1D4FA 2ZPUA 2H17A 3QXGA 1P7CA 3S8MA 1AHPA 1L5OA 4Y6LA 2HPZA 1XTBA 5LMCA 1PW5A 421PA 5I9TA 5K1ZA 3JVDA 1UOPA 2H29A 2OBXA 3P2OA 4LXYA 2Q4RA 4UBKA 2N1BA 1CEQA 5CCXA 4YMSA 4RY9A 4MPRA 3SE0A 1CJKC 1CX9B 1PWHA 1W4CA 2VOJA 3RJ5A 1KDRA 2A0YA 2P2LA 3O4FA 3U13A 2B83A 1GPH1 3U26A 1QRSA 1SY7A 1VKHA 2O7VA 3QVVA 4KH0A 1E3IA 3I5MA 2NVUA 3TIXB 2YTZA 3DE0X 2BY4A 4UCQA 3DLHA 3UJNA 1F8FA 4OQ4A 3VISA 1EZZA 5KDOA 1M2HA 2Z6UA 1CJUC 1XMVA 5C1DA 1W5AA 4J43A 4LWZA 2FUG1 2MSWA 2QQFA 3HA3A 1TECE 1KFEB 2FP3A 3DR5A 1BKYA 3OEYA 4ZOLA 3TD6A 5KVCA 3HB4X 4B45A 3K31A 4TVOA 4POOA 2NU9A 1ANKA 4QECA 2DM6A 3H6HA 4Q03A 3DPIA 1OPRA 4RS3A 2ZI3A 3DFKA 4HXYA 5ESDA 1BN6A 4CKXA 3I9FA 2B4AA 3RAJA 1BHO1 3NIFB 3RGGA 3M9XA 3VR2D 1ESCA 3H1AA 3F9RA 4HEHA 4F85A 5ITWA 3TMYA 1N7IA 1X8JA 4I1RA 4LC0A 3RFVA 2C5SA 4AICA 4BMPB 1QIJA 4DCTA 4MEJA 4EI7A 2FDCA 3K6RA 4KGXA 4ZTUB 1BVRA 3AYZB 4FOOA 1ND6A 5ITVA 3CR3C 3FOBA 2ZWVA 5G4KA 1SBYA 1H3FA 3KWJA 3T9AA 1CETA 1U0GA 3EVBA 3GG2A 3KFVA 1E9BA 4QGFA 4UU7A 3CIOA 1XDZA 4MV0A 5GM1A 1IY8A 2JGDB 1NVEA 3F7TA 2QYSA 1C9JA 3BPSA 4YUYA 4MMZB 4ALKA 1LS6A 3CINA 5LMNB 3D5TA 5CT6A 5F98A 2WWXA 1FNMA 3R5XA 3TW4A 4XUCA 2YFKA 1N5KA 3S7ZA 2NO5A 1E5TA 5KU7A 2BEUB 2XLBA 3UJ9A 3PWKA 2A1TS 2VP6A 4QQRA 2CFRA 1IUNA 3EZ6A 2R5WA 1LRLA 1ZK2A 1ZOPA 3CRZA 2QJFA 3L7OA 3MUOA 3PKIA 2DY0A 3OT4A 4LC9A 1PV1A 1FSSA 5TQ0B 2Q1SA 2X0EA 1T3LA 2W70A 3VR1A 4RGYA 4JJ6A 2BFWA 5E9QA 1AN0A 2FQ1A 1SOWA 1IK6A 3L7YA 1OUMA 1HWYA 1UBJS 1H6CA 2CWWA 2V3WA 3GVIA 2OESA 5IDQA 4FOPA 3UM9A 4YC7A 2XWQA 1CR1A 2VLBA 3GP3A 1YQGA 3AZOA 3LF2A 3OD5A 3RVNA 2O50A 1D6MA 3T5TA 3MCWA 3VKWA 4GQIA 4L5AA 3V4FA 1M2VB 2GN1A 3IAFA 4M46A 4JLOA 4OQYA 4WERA 4X60A 3HRKA 3RKUA 3SHVA 5IW8A 5T8KC 3MPUA 4Z4EA 2OD9A 2LV8A 4M38A 4X1OA 5K05A 1M2EA 2GSWA 4E5NA 4GQBA 3VX3A 4Y0AA 4B09A 2W0MA 2BONA 3HMKA 4OBXA 1ORVA 1AM4D 3DDCA 1J8FA 3FJYA 3PFBA 1IG3A 4QELA 3PC8A 4ZA2A 3M6WA 5HP4A 2AHRA 2GTPA 4P82A 2B30A 4BWGA 5KSOA 3ZV5A 2SNIE 1BGVA 4CHTA 4JA2A 2ZT5A 2F43B 1TQ6A 3TLKA 1WIWA 3K9WA 1JE1A 2Y1FA 2FMIA 4XGRA 1W4BA 4HEQA 3VU3A 1M5TA 1BXZA 4BZPA 1W2WB 1NF8A 2Q2OA 3AESB 5FYDA 3ZXUB 1MC5A 2M2IA 3DAPA 1EK5A 2BJHA 2G9QA 5IDYA 3LPAA 1YRAA 5IX8A 2ZWPA 1TQHA 5H83A 3KHKA 4LG1A 2WY2D 5ICEA 5JJCA 3ZQKA 1TFRA 3BXXA 3SC4A 2PO7A 4FYIA 5AW5A 2RG7A 4PGMA 5JO0A 1MB9A 4IJQA 2FHSA 5DWVA 1C8LA 1VB3A 5ICGA 1DKOA 1MTZA 1Q92A 2JFPA 4OHPA 4XFJA 5AKKA 3U9TA 4JLWA 4L51A 2FPIA 3GK3A 4UCXA 4UTNA 1FF9A 2QX6A 3Q7RA 3RR2A 4B7CA 4BNWA 5CAEA 4JYPA 3TBFA 1W52X 1A95A 4YN3A 3F6BX 1MO2A 4MYSA 5IAOA 1FBTA 1N1DA 1Q0QA 1YZ3A 4Z0HO 4QRHA 4ZMSA 1RJ9A 1O95C 4C9BA 4DMMA 4XVUA 1P2VA 2C4WA 1T4CB 4TTTS 1N5IA 4ARBA 3KOXA 3K0AB 4G09A 3ZQ6A 3LUKA 1K5DA 5ALJA 1L4HA 4JI4B 2ZT6A 3E9CA 3KQNA 1CD5A 2OO5C 5FR1A 2BGJA 3VAZA 2NO6A 2ZE7A 3DKKA 3GFOA 3JSXA 1RWBA 1KMHA 2MR5A 1ESDA 3NVAA 1G4HA 1T1RA 1W36B 3SM9A 5I7WA 1U1GA 1EDEA 1XR3A 5AQ1A 5MF6A 1TQDA 4DMCA 1NBAA 2CHQA 2ZOSA 1E0JA 5HRCA 3ZTYA 1M1NB 1KYZA 3EXIB 2GNPA 3D6MA 2VHXA 1VE3A 2GEUA 3F7MA 1GSAA 2NYVA 3RRNA 5GGYA 4DR3B 3NOQA 1JFSA 2IOYA 2P0EA 2QL7A 2Y67A 3BRWD 3GFVA 5CTAA 3SKYA 4DE5A 5MFZA 2Q50A 2Q5FA 2JLCA 2OV1A 4ND8A 1GLGA 3NGLA 4OQLA 2EG5A 4ZT2A 1XD2B 5CLIA 4EA8A 5KWVA 1KK2A 4H7KA 3W5CA 3LUAA 5AO9A 2GKOA 2REQB 1AIPA 2IEIA 4ZQEA 2N75A 1N75A 3C74A 1VCOA 5IAEA 4BX8A 4EG3A 5AUOB 2YJZA 4INPA 4JC4A 1NQXA 1TQ8A 1L8XA 2RFLA 5GTDA 3W2FA 1C9MA 1Z2OX 4AJOA 3SEZA 4KN9S 3HSKA 1A9ZA 3WB9A 2BUBA 3NIBA 2PZFA 1C30B 1J56A 4M1KA 3MWKA 1MB3A 3LGXA 2W2TA 4QJBA 2HXYA 3FMPB 3GPDG 1UK8A 4M9SA 1XALA 1JQJC 1HX7A 3BXEA 5THXA 1KO8A 4BKPA 1LA2A 4KSBA 1XVUA 4TQ9A 3GLFE 5FUYA 4AK9A 3KLBA 5K03A 3F47A 5AJHA 4L4RA 3QPWA 3QA3E 2AW3A 2VHCA 3I39X 4YRSA 4EA6A 3WGUA 3RW9A 4OFZA 1KZ1A 4LFCB 4QDJA 2Q4OA 4GI7A 4TWJA 3TFQA 1SBHA 3GR6A 4R0MA 3IEXA 4KVFA 3PC6A 4LYJA 2QX8A 1ZN9A 2VSNA 5L9AA 3HKDB 1H3EA 1KF0A 1XYYA 3G3EA 3C7KA 2ERXA 3LDFA 1ONBA 2B1QA 3KU4A 2FETA 3MSXA 1BGWA 1ZESA 3ORFA 2C7BA 4IJMA 2YQ5A 3H2HA 4J0EA 4AT1A 4DLVA 3MYYA 2VH1A 4RPCA 2HB6A 2RAFA 1GNQA 3FZNA 2FUEA 1RXUA 3KR1A 1YC2A 4OYYA 4ADSG 2XLCA 5D7NA 3DEAA 3S3TA 2W6IA 2ZDQA 3F6PA 4FWTA 5D5QA 3GMDA 1D03A 1X1TA 1Z18A 4KBYA 1J70A 5DM4A 3T95A 4F12A 3ADCA 4FS3A 2JH8A 5DM60 1U7WA 5TGDA 4EVIA 3FMOB 1I3CA 1XF1A 2PPLA 1P9OA 3TOSA 1A27A 4YJDA 2WKPA 3BMNA 1DG3A 1VJ5A 2Q1TA 3BOSA 4IDFA 5BV0A 3NDBB 1PX0A 5KWEA 4BVHA 1KAOA 2P6UA 1YQEA 3WICA 3VR4D 5BR4A 1U04A 1EXMA 1D3AA 1LDMA 1PJSA 2HBYA 4BQOA 1U6IA 2ENUA 3F6YA 1LJLA 3DXZA 4H15A 1F9AA 4IOJA 4KE8A 9GPBA 5JY1A 3OEED 3EEYA 3TTYA 4R54A 5E1OA 4D9JA 2RB4A 2WMDA 4JC5A 5H82A 5HTKA 4Z4CA 1A4RA 2A9PA 3T1YB 1IVNA 1IDOA 4WZAE 2AMFA 1DUVG 4I6GA 3HDVA 4M76B 3VPDA 3FDIA 1KDYA 2IS4A 3R9IA 3NR2A 4LS3A 1C0KA 3SHOA 1TKCA 4BVJA 4FYMA 1LBQA 5JDIC 3Q41A 1EP9A 5HK8A 4BE4A 5E1MA 2G4CA 1JZTA 4QXAA 3L1JA 3AERB 1USUA 4R69A 3TW0A 2PSHA 1MAAA 1XTJA 3BFJA 3NBXX 4OG2A 3N8KA 1IL0A 2HK6A 4TKZA 4JBNA 4NV0A 2Z1NA 4ZOBA 3HV0A 2AMVA 4CM3A 1BWQA 3DV2A 4C06A 3I9JA 2XR1A 3AZQA 3D02A 4HAYA 3G88A 4NRDA 1II0A 4UEQA 2I7CA 1E2MA 2WKQA 4YS6A 5LQCA 3C1AA 3CPSA 2H4FA 4Z4HA 2J3EA 1KSHA 1RRKA 1AB5A 1RJWA 2E0IA 2J7KA 2MIIA 3A0UA 3BCUA 3DZCA 3NUQA 3OLYA 5CR9A 3OMWA 3THOA 5EWLB 2CBGA 1W36C 1U5BA 5COQA 2SECE 3WDKA 3OCCA 4DNPA 4XGKA 1J33A 3GLFB 3VU8A 3L0PA 4GMDA 2PQ0A 3I52A 3QFFA 4IJKA 5FOUA 2B8JA 3V7YA 5A9RA 1KH2A 2C29D 4I5FA 3PJGA 1PTKA 3BL8A 2ECQA 3RASA 1TLLA 3GNSA 2H4WA 3RS7A 3O9ZA 3SY8A 2XZTA 1DBRA 1QQTA 2FF7A 5HNKA 2XUZA 1WXWA 4OJYA 4KZKA 3LK6A 5FPSA 1WVGA 2H4YA 1PJAA 2P3OA 4WBSA 1Y8RA 1T2VA 2P3LA 2L82A 3WOHA 1IJEA 1SOAA 4MOWA 4B7ZA 3LVFO 5BQ3A 4BRUA 4ZWNA 5THKA 4ENUA 2EGUA 4YMLA 3OUTA 1DQRA 4JUFA 4N5HX 2Z3WA 1YOVA 5IVPA 5IYZB 3LF1A 3LLUA 3U7JA 5IG2A 3A1CA 1B3RA 2FN9A 3D8RA 5KOJA 3Q3HA 4YHHB 4BLWA 1JLMA 5EZSA 4KIWA 1M54A 3AHCA 1XU4A 1B4DA 1KMNA 3HBMA 4KPUA 4O63O 4P4LA 5LSAA 3GQBA 4ZALA 3NRCA 1E4EB 2SKEA 4MHTA 3WGGA 2FQQA 5KWSA 3NBMA 1B8NA 4KQJA 1FDTA 5AI8A 1OCEA 1FLDA 4JVOA 5FUVA 3UXYA 3FOEC 1VGRA 1P4GA 1F5NA 4RW0A 3C2QA 3EIUA 4EPYA 1APBA 3DEIA 1EFPA 1TUGA 3EVAA 4KQ2A 5IANA 1ODFA 5FHRA 2YV2A 2QD4A 2XNDD 4ZXFA 4KG7A 1Z4JA 2C5LA 4WZAB 2W8BB 2CDAA 5K3CA 2REBA 2XUJA 3K53A 4WA7A 2P4EA 4E4YA 2IYPA 3WV5A 2CDCA 3GUUA 1IBCA 1RADA 3KSRA 2QDKA 2PUGA 2V7PA 1LQUA 2O3TA 1I5EA 4LXGA 2NSLA 5HKKD 1TLTA 4DV4B 5B2ZA 2B6HA 4PG5A 1JYSA 4A8HA 4L3WA 4PTYA 2HUNA 1CNEA 4ZGBA 1OI4A 2VNKA 3E82A 3MWDB 1JRLA 3CVOA 4S3MA 4UU8A 5GMOA 3WZ2A 1HNNA 2H18A 2JIZA 3FROA 2UYHA 2FGKA 1AKTA 1JGTA 1RE0A 1W46A 1YVRA 2ZSKA 3T3GA 4U9IS 1UFOA 2EF1A 2RGGA 4EECA 3T3MB 3VHXA 4TLLB 3KWFA 5TQ2A 2GN4A 4R40A 5KQLA 1WCV1 4J1TC 1PEAA 1O57A 1RI5A 2QW1A 4UD6A 5IZ4A 4XSHA 3IS3A 5BRAA 4A26A 1YMUA 3H65A 2Y9MB 3GV0A 4MRRA 2ZUCA 3OA0A 2YXEA 1WB5A 3RH0A 1AG9A 1VPEA 2ETXA 1QGYA 2IVZA 1BE8A 3CB2A 3AFHA 1HL3A 5H7XA 3IUBA 3WLSA 1W7AA 1YS6A 2BKVA 3KJZA 4BJHB 4FBMA 1G2OA 3HRIA 2E85A 2QZPA 3JR7A 2CVFA 2VPTA 1R18A 3C39A 1JB9A 2IZ1A 3PPIA 3QY9A 3FRHA 2O20A 4E5PA 3MJCA 4W5TA 1O4WA 2QUKA 3ZCTA 2E4UA 3DQZA 1AKYA 1G1AA 3AEZA 3KQLA 3EGOA 1JJFA 3EG9A 4RKQA 4FYKA 4MWOA 2WG0A 3S2EA 3S1AB 1NU6A 2OYCA 4ZDWA 5A06A 1Y0BA 4F3YA 4QTZA 3WHPA 2P5SA 2YBDA 3IILA 5DYNA 4RJIA 5GZ3A 2B5OA 4YTEA 4UFNA 3GYGA 2VLIA 4TSFA 1NXPA 1GPNA 1MU0A 4RVGA 3EH1A 4MVXA 1Z35A 2GXAA 1TO1E 2D1SA 1Z26A 2IYAA 1KGSA 2NXCA 2OQVA 1Q7EA 4AKEA 3IFSA 2ZPTX 3N8HA 4YECA 3FTFA 1I6MA 3FHCB 3TEMA 4DDVA 5CDUA 2PZ8A 4ESOA 1KZHA 4QJ3A 3T1TA 4UDNA 3QLUC 4HGYA 1KC1A 3A9CA 3PNOA 4CKEA 4A1OA 1XBTA 3VH2A 2EERA 1N0WA 1H22A 3MTDA 4HB0A 3OQOA 1L7OA 3AETA 4RM2A 3TD9A 4R1OA 4MW1A 5A9SA 5E7MA 2IGTA 2RGAA 4BTVA 3BREA 3AR8A 4GXNA 1YZYA 5BSKA 5BSHA 2V6MA 2FMXA 2PAAA 2XHZA 4FYVA 4A92A 3KELA 2C4TA 2E18A 1U3UA 2CK3A 3QV2A 1VCHA 4MS4B 3WLHA 4I1VA 3FPGA 4CUKA 4ZZ1A 1IVYA 4O2RA 1V9CA 4CCSA 5LD2C 3U44A 4WX2B 4KE9A 3D1VA 3A6HA 1I3NA 4Q82A 5AM2A 4PX9A 5BNFA 3FGZA 1EFLA 2BV3A 2RHOA 3OFJA 1F7VA 2BGWA 3JQPA 1P9RA 3QLJA 1NNEA 2PIAA 4K40A 4MRVA 4EX7A 2Q5OA 2F17A 2ZK7A 3EEFA 4GWKA 1RWQA 3SC2A 1A96A 3A6KA 3C87A 1UPCA 1K5PA 1E1RA 2DKNA 1ODSA 1X19A 3IAS6 6GPBA 3J81A 3URKA 4B6RA 1QSGA 2WJPA 2TYSB 2XX3A 2GETA 3N7TA 5IVDA 3CG4A 2CLDX 3OLVA 4Z3OA 1XJ5A 4QT4A 2R6HA 4OQPA 4C7BA 3GP5A 3GAAA 2C77A 2OEPA 2PUWA 1M6EX 4U7HA 1G20E 4UM9B 1FC0A 1B73A 1FE8A 1OX5A 5B3JC 3RYCA 3M5PA 3BMCA 4XD2A 3V8EA 3E3NA 2IZ0A 4KWHA 1D1QA 4MVJG 3AF2A 3B5IA 3V7NA 1KC3A 3E7PA 5FLXA 4LNUB 5JSZA 1IOLA 3KXKA 4DNQA 3L1HA 3HNRA 3ZK8A 1OAOC 2R1TB 1IZ7A 2RHCA 1IN4A 1NMQA 1OZFA 2XXJA 3O47A 4U0KA 3TW8B 2JLVA 2L17A 2Z3VA 2VZLA 4ICIA 3LYLA 3NV7A 1FFEA 1MNAA 4MYDA 2XZPA 4J91A 2OFWA 2BHLA 3GMSA 4PNPA 4Q7JB 1CUEA 5JWRA 4NEGA 5JOQA 3PNSA 4LMAA 4MRSA 4US1R 4EH1A 1GU7A 2IY9A 1A9RA 1ZU4A 1E9VA 1KERA 2F1JA 2XNSA 2ACVA 3JWGA 3NTUA 3AHGA 2YJ6A 2E55A 3R0ZA 1TUIA 3BHMA 4LZWA 2DQKA 1TVKA 1I8TA 4MP8A 1R2QA 4MYUA 3H5LA 3USCS 1IQPA 4EY5A 3CO5A 2ODWA 5AIBA 2FOIA 3L7LA 1UEXC 3QKRB 3L49A 1DTSA 4M88A 4W1QA 4YUZA 3QVSA 2FQXA 2PWZA 1TB4A 3QXJA 4R1QA 3RUAA 5ED4A 1COWD 4TM8A 1W30A 1JR3E 2C3UA 2DCUA 2V4MA 2BDEA 1IXZA 2Z30A 5FO0A 4S05A 4ZREA 1S9HA 5FLYA 1N8KA 3S1SA 1JVBA 1TJNA 4XJSA 3HVJA 2XE7A 4H7JA 4RK7A 1MFZA 2EJVA 2WF7A 3A8TA 4EW6A 3ZPXA 4Y8VA 4BNHA 3HYNA 1PX2A 1UBRS 2VDVE 4N4AA 2JI6A 3VPXA 5KNCH 4MA4A 2A59A 5DNVA 3T15A 2HPVA 2J3HA 3DR3A 1KVQA 5EEGA 3CNEA 3MELA 1P1JA 2HO4A 4CMEA 3HM2A 5C7LO 2DQSA 1H2EA 2Y2VA 4KCGA 2BE7A 4K5QA 4Q7LA 1IRXA 5EJ5A 1QG0A 4CGYA 3AL3A 3U4QA 2DMRA 2ZATA 5REQA 4FC7A 1RWOA 5JG7A 4RDIA 4W9NC 5EE3A 2BEKA 1WHSA 4J7CA 3ZVKA 2HJHA 1W44A 4OGLA 3W3AD 2ZCJA 3X1ZA 2WDZA 4WN3A 5IJ0A 4I7EA 4X8MA 1QC5A 2W6MA 3RT9A 5B4UA 5EA2A 1L8LA 3O4JA 4FYJA 1FP6A 2XKJE 3HXMA 4D41A 1HORA 2QN3A 2N3ZA 5CUQA 1DTWB 4OH1A 5G02A 3RJTA 3PYLA 6Q21A 1D04A 1IHUA 4X85A 1LDYA 3TQSA 5ADWA 1U2DC 1G20B 2F8MA 3FIJA 1GAJA 1G63A 4QATA 2J4FA 5AKGA 3FWZA 4DDKA 1KJ8A 4PFJA 4MRMA 2GEVA 3P9KA 4OKSA 3WWDA 1CR0A 3DOEA 1DQZA 5AUPB 1AUPA 3R7DA 4BATA 5CEEA 2OK7A 3EXHA 3EPLA 1PZHA 3DKIA 3GNTA 2CLMB 2RBEA 2ZAIA 3C43A 2DVMA 3E5RA 1C1YA 4L5BA 1Y7IA 2XOXA 4IO1A 1JYFA 1AH2A 2BRUC 1FRNA 2VF7A 2Y8EA 3PCTA 4DDMA 1KYYA 3JRXA 4K9OA 5K8LA 4E21A 1UR5A 1Y1LA 1EX7A 2GXQA 3NVMB 1NJ8A 1DQNA 2DPLA 2E48A 3O82A 4M87A 1LPPA 1FUYB 1MAUA 4O0LA 3EK2A 3F3SA 3IV7A 4HDNA 4QJ4A 1OGJA 3NDRA 1UJMA 4AZ0B 3K35A 4QYMA 1A98A 2QRZA 4FR2A 3NW9A 4U2FA 4CL2A 4V1CA 2Y76A 2XGMA 2BH9A 2SCUB 3A4IA 4Z3KA 3HY4A 4QUBA 4KPYA 2LDBA 4Q3LA 4JASB 1U4OA 2UUOA 1TEZA 1RLTA 3VPSA 1J00A 4BE9A 3F46A 2JEYA 5E1DA 1WB9A 4OATA 4XIFA 3IDQA 2D1YA 2XMSA 3H5RA 1N0HA 5AJTA 5JANA 1Q21A 2HYDA 2XB8A 2QQ5A 2X0DA 1PFVA 1Q0UA 4BB5A 4Q37A 4KRYA 3IP9A 2PQ2A 4YT4A 3T3DA 4OP1A 4EGQA 4LVNA 2E5WA 4I5GA 1MGOA 1ZLYA 4KQCA 2WF8A 4XPIA 3ROQA 5JJ5A 4Q24A 3DQPA 3FWHA 4PNHA 1SXJC 4M1OA 3KSUA 1SUEA 4LDPA 1Y1QA 1C81A 4TRRA 1FFXA 4EUKA 1BMTA 1DAHA 2R8XA 4CFYA 4BUZA 3ZHVA 4GYWA 1E8DA 2XODA 1KYWA 4IV0A 5DYTA 2ERCA 4JUCA 3K1AA 4NK4A 4JGBA 1S4QA 3KQQA 2PUCA 1V47A 3N8DA 3Q40A 4N5LA 5B55A 4NYIR 4A0QA 4FGSA 1K66A 1RKUA 4LPSA 1TTQB 5CB4B 4H6VA 1KFJB 4R1TA 5IEJA 1Y6JA 4D5GA 5KYGA 1JDPA 3U7HB 3GLVA 1L4EA 1WUIS 3I23A 1J8MF 1ZI9A 3R3HA 3CONA 1A4IA 2P7IA 4YRJA 1MZVA 1NF2A 2WAXA 3WGYA 1LRJA 3FZGA 4GWLA 1E0SA 4BN4A 4FGJA 3QKIA 2XMZA 5AUNB 5DNDA 2RGXA 4OX9Y 2GARA 2WNHA 1J8VA 2BIFA 3A4TA 5BOVA 3V32A 2ZULA 4GX1A 4LK3A 1CUAA 4MH0R 4KQMA 1ZCZA 1E2NA 1OI3A 4DTIA 4BCDA 2IDMA 2ZRNA 4E88A 3I34X 5BV8A 4YDRA 2C03A 5GP1A 4I9FA 4KWEA 2VJPA 3C5WP 4AY2A 1C1HA 1PUIA 2UUPA 3DE7X 4M8LA 2F4VB 3FUXA 2GCGA 2O3JA 3I8XA 4PSUA 1PBTA 4KPGA 2HHLA 2IXDA 4JH0A 3U31A 3TQFA 1A72A 3KXPA