4Q7QA

The crystal structure of a possible lipase from chitinophaga pinensis dsm 2588
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
259
structure length
259
Chain Sequence
AKELTWVAIGDSITYLNDHLDETGNRVSKGYLTRLNEILPNLKYINQGHNGWTSGGIAGNIDSLGLIKADVYSVFLGTNDWWQGRPVGKLDDYQHDNGNTTVYGSFRIIISKIRQLNPEAKIVLITPMQRNDFVYIADAKNNAFGSYQKKNGQTLEEFANAVLTIGRYEQIPVVDLYHHPLLTLRNMVKFKHLKNPKNGKYVNYKYPAFVNIPFNPENNEYPYPPAAVNLTYDGLHPSDKGNAIIASALADVFRQLGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipolytic protein G-D-S-L family
publication title The crystal structure of a possible lipase from Chitinophaga pinensis DSM 2588
rcsb
source organism Chitinophaga pinensis
molecule tags Structural genomics, unknown function
total genus 91
structure length 259
sequence length 259
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 4q7qA00
5B5SA 4PPYA 3DCIA 2W9XA 1BWQA 4K9SA 4H08A 2VPTA 4I8IA 1IVNA 3DT9A 3MILA 4Q7QA 4RW0A 1ESEA 1FXWA 1DEXA 3DT6A 4TX1A 4IYJA 4HF7A 2APJA 2WAOA 1ZMBA 4HYQA 1DEOA 2HSJA 3DT8A 4M8KA 4OAOA 1ESDA 3W7VA 3SLRA 4Q9AA 4DEVA 4S1PA 1VYHA 1J00A 2Q0SA 1JRLA 2WAAA 2O14A 3KVNA 3U37A 1VJGA 1ES9A 4K3UA 1BWPA 1U8UA 1BWRA 1K7CA 3DC7A 5BN1A 1FXWF 4JJ4A 5JD3A 3P94A 5HOEA 4JGGA 4XVHA 3SKVA 3BZWA 4JKOA 1V2GA 3HP4A 5CD9A 3PT5A 4K7JA 2WABA 4K40A 1WABA 1ESCA 4JJ6A 3RJTA 4LHSA 3C1UA 4OAPA 4JHLA 2Q0QA 5A4AA 1YZFA 1Z8HA 4NRDA 1PP4A 4RSHA
chains in the Genus database with same CATH superfamily
3VR2D 4HS9A 5FD8A 3LFUA 4K3VA 1YUBA 3ZH2A 2XMBA 1Z36A 4GOXA 4YQZA 4F91B 5EIXA 3IBSA 3KU1A 1CJKC 2F17A 5JU6A 2XSZA 3F6CA 4FIZA 1Q0SA 2D54A 1YRWA 3D2CA 3LCUA 1O97C 2XQVA 4PZ9A 5D3ZA 2Y2UA 3SZRA 3WLMA 3PQ8A 3T54A 1OROA 4HYTA 3B7PA 3KKNA 4RHTA 1E5XA 4OQQA 3BC1A 1NRXA 1JHDA 3PFIA 1M0WA 4CM8B 3OQIB 3NVDA 4CM1A 4DV7B 5EZSA 1MQSA 2DUNA 4UPVA 3ZIAA 4PPGA 1SG9A 4YP0A 2J32A 1RAFA 1QK5A 3X3HA 2BEVA 1E1NA 3L6CA 1LPBB 3BL8A 5ALQA 3VZCA 1C8VB 4BBAA 1GU1A 1Q3HA 1LBSA 4BNDB 3R6WA 3LA6A 3EW7A 1E3MA 3AEKA 3E53A 5ECDA 4JDPA 2JFFA 3GFTA 4ZFNA 3I58A 5FUYA 1Z73A 5HRAA 3MWLA 4MPRA 5AM1A 5FPPA 5AVTA 1G3QA 4LF8B 3QOFA 4GOOD 4MVJF 4MS3B 1SU4A 5JUWA 4XGRA 3FRIA 3W2EA 2F43A 1NVBA 2AFRA 4TL7A 3VO9A 2NXCA 5H4HA 4CF7A 3KEMA 4W9MC 1JXQA 3TLGA 1QHSA 1TCUA 1SQ6A 3GRFA 3PXUA 4PSKA 1FNCA 3A04A 2ZGVA 3BILA 3AVPA 4R1OA 4ZRNA 2B82A 1YRBA 4B7XA 5IVHA 1OBOA 4XUEA 4S1PA 4G9BA 3S5UA 3T4XA 1J00A 1VGVA 1DTWB 3OTHA 3EY9A 2FQXA 2IY8A 3C48A 3L84A 3NTUA 3P9XA 3K5PA 5D3KA 3REFA 4BECA 4F8EA 3IFSA 3KR0A 3NBFA 3FWZA 2XT9A 1RHQA 1U3DA 2VHQA 2IOFK 4JEMA 1JFTA 4MROA 1JHOA 4AW9A 3ROQA 2EFCB 2QVCA 3G5LA 4HH4A 3DCYA 4P4UA 3JTEA 3MQFA 1F17A 4NJMB 1DELA 1CY1A 4LXYA 5BVGA 2ZWMA 1ZESA 4EX6A 2VF7A 7MDHA 5LMCA 2JCGA 1Y34E 1TA4A 3ZCTA 2IXGA 5JISA 3VR6A 4C3UA 1U8CB 4GZ5A 3OP4A 2WZDA 2YC2C 5SZKB 4F3CA 1A27A 1D2NA 4X8HA 2ZUEA 1FMJA 1RLJA 1ZN8A 2AXEA 2QSYA 5E95A 2AFHA 1ODKA 3SYTA 3WLJA 4ND8B 3F6PA 3PEVA 2VNSA 3PKJA 4E13A 1P6UA 1Z25A 2B7LA 4PSAA 1TL7C 1UADA 3PD7A 4H1UA 1O6BA 1YA6A 2HB6A 4IHKA 4BNIA 3RC8A 1KPHA 1W8IA 3UTCA 2W6IA 3GDWA 3I8XA 2FPMA 3LPCA 4QO8A 5CB4B 1NXQA 1NJ2A 1WUHS 2BC9A 1CF9A 1HFWA 2H7XA 3BFXA 2V98A 3DEYX 1G2PA 3UKJA 4FNAA 3AJDA 2HA2A 2HSGA 4R9NA 4YWJA 4DV5B 5DLQC 1A1VA 2XH8A 1FYVA 4JJKA 4TQAA 4ZQBA 4I4IA 2NPIA 2NV2B 5ICGA 3F46A 1JFFB 1QV6A 2Z2IA 5IJ9A 2JGFA 2PX4A 4I1OA 1M54A 2ZEJA 3E3MA 4E2XA 3OQVA 4YJHA 4G25A 2CFCA 3W5DA 1UPFA 2WKRA 5EQJB 1P1RA 3IV6A 4DWVA 1BWQA 1Z07A 4TMTA 4IMPA 4NYIR 3WNZA 2FPIB 2G36A 3MRTA 4AJIA 1KJQA 1TYAE 2JIOA 3G5AA 2JH9A 1Z4PX 2HQOA 4F96A 4NHOA 1O94A 4EB6B 1G8FA 1Y9DA 2HXSA 2AFHE 2JAXA 2KM1A 2VDOB 3E9QA 4IILA 1OYOA 4KR0A 4YX9A 4UTRA 3HSKA 2J5RA 4NBRA 3MD0A 1JYFA 4R9UC 5JPDA 3D2AA 1L4FA 4PYNA 1D2RA 2KJQA 3QEJA 4JU9A 1PBNA 1X2EA 1A2QA 1XKXA 1KOFA 3ZBQA 5DO9A 5BSMA 1OH6A 1EUZA 1NI4A 4JX9A 4PTZA 2W8BA 3NBZC 1TVMA 4IEEA 2QI9F 1WDLA 1FJXA 2WMDA 1P39A 4GSYA 4D56A 1RYBA 1SHUX 1UL1X 2OZLA 1NOJA 3CEMA 2C7GA 4IJKA 4JMLA 2RKWA 2WINI 4CTMA 5CCBA 2OC4A 3JQ7A 3M81A 4K9PA 4RAOA 4BQIA 1WPXA 3ZWDA 2QBYB 2KLBA 2Y3IA 4D3XA 1O9HA 1SJ9A 1SUAA 1Z62A 2PU7A 3FMFA 5DMXA 3FZEA 5EHIA 5GM2A 2VXBA 1HT2E 2MDTA 4G1MB 4WV3A 3TWOA 2QLMA 4FR0A 1B0PA 4WN3A 3RUIA 4N12A 3C3PA 4LZOA 1XEXB 4D6PA 4LHZA 3I2YX 4DSTA 4FDUA 5FLEX 5E6RA 5JV5A 2YVUA 3EVEA 3ELYA 3O3OB 5H16A 5BUZA 3I62A 4JI2B 4XM0A 3HU3A 1UAAA 3CRZA 3GJ4A 4XDYA 4QA9A 3FCEA 1RQRA 4TT3A 4Z99A 3SXPA 2G8LA 5DLDA 3T3DA 1GNTA 1ZHFA 2TSYB 4XRGA 5KDOA 3V8EA 2W2XA 4HT3B 1X1SA 1CYEA 5LOVB 2GNAA 4IH9A 1W75A 4MDHA 5JY1A 4WZBA 4IEFB 1SOVA 3KOMA 5E9AA 4DDHA 3NIGB 4JQSA 5CGZA 3SM3A 1TGYA 4L85A 3A6GA 3FCYA 1MVNA 3IBTA 4GYYA 1F8UA 1IFXA 3H4TA 4H17A 1OH7A 3L4JA 4C0JA 4MQMA 2EFGA 3LGAA 3IO3A 1I4EB 1NZDA 2GBLA 3U40A 3RRNA 2PUWA 3LSTA 4UTOA 2ZS8A 5ESWA 4B34A 2R48A 3EISA 5IU6A 3BTSA 4TT8A 1QS0B 1MX1A 1JHAA 2QV7A 3DL7A 3DTVD 4OQMA 2PYDA 3PKZA 3MWFA 3E9ZA 4A8JC 1J0XO 2WU3A 3BMOA 2WNHA 4L8LA 3R8XA 2PUFA 4HAXA 4KVGA 1CK4A 3BTOA 3CUSA 3QFTA 2R751 3LFTA 1ACJA 2D8AA 1P72A 1I7LA 2ZSEA 1KSFX 4LTDA 4W9RA 1TB4A 4LYHA 5AJXA 5JOQA 3LJKA 4LOHA 4ZZIA 2PX0A 3FLBA 3PS9A 5K0NA 3EXIA 4WZBE 3HGQA 3KS9A 3RRYA 4AJ2A 4CU2A 3Q9NA 2VSOA 4QO7A 1L5LA 2QIPA 1XK6A 4R5MA 4BVEA 3LKBA 3T9EA 1OLXA 2R1VB 2H1IA 3OZTA 2PXXA 1ZD1A 4AUKA 3W0LB 3ZVLA 4XQGA 2A7XA 5IRCD 4EABA 2I6SA 3URKA 2Q1WA 4NBSA 4FYMA 1E1CA 2XTAA 5L6LB 5JJKA 1SBZA 1ZONA 3N2EA 3ET4A 3IT2A 1UXHA 1STOA 5DBHX 4JJFA 5E4FA 3TZLA 2F64A 2QQ5A 3OQMA 3OM9A 4BFLA 1S01A 1M1NB 2OGTA 4U6NA 1MTOA 3CH7A 3W04A 1UC9A 5LQNA 2DAPA 4M7WA 5KVCA 2ZJ6A 3BJRA 5GAJA 4S1NA 4MRPA 5AKYA 4GOKA 1NMXA 4TXNA 3ZVRA 5J2TF 1SGWA 1M73E 3HFGA 4L4RA 3DZGA 1AXEA 2HBQA 4E15A 3WGIA 1T4MA 4DIOA 4UBKA 4KXVA 1UOOA 2FRVA 3HDJA 4EZIA 2P5UA 3I04A 4G5GA 2IA5A 1N5IA 2GPWA 2PX8A 3ILVA 4FE4A 3FR7A 3ZV5A 4QEKA 1YZUA 4WCFA 2VBFA 4UD6A 5A3JA 2O4CA 3TDMA 4LGVA 2Y1DA 3MINA 1INLA 3EAFA 1GSHA 3FNHA 3N0TA 4UU8A 4EEZA 3O82A 3S29A 1EE2A 2JRLA 5CAEA 1KMCA 2NT4A 2YHIB 1XNHA 1ZC4A 1VC2A 4Q1AA 3TOZA 3ZUPA 3UJ9A 2FEKA 3EWAA 2Q0XA 3WOHA 2GYVA 3JYNA 4BRWA 4AX8A 1AU9A 1UXKA 4FDMA 4Y1RB 1L7RA 1XYVA 4ZCQA 4JMPA 2NUPB 3EXEA 2JC3A 2XDQB 4P4NA 4RNCA 4RMHA 1QIMA 1UFVA 1HEYA 3F7NA 5JZSA 1X6VA 2Q0SA 3IQFA 5K8UA 3HXMA 4LQDA 3PTLA 3Q9LA 3A8TA 1CQJA 5EEHA 4C20A 1NRIA 2FH5B 2GZMA 3MJTA 3A9RA 4GQAA 4ZODA 4GIBA 3F9CA 1XQYA 2WHQA 3OAAA 1EVEA 2QJFA 1YMVA 1X7HA 2QU8A 3WYDA 1L4GA 4MTCA 3U2QA 5L3QB 1ZX1A 4QDTA 1RMQA 2AG1A 1Z13A 5KOJA 1L5KA 1GGKA 3ICWA 3RUDA 4CTOA 2Y9PB 5EIFA 1RWOA 3EQ8A 1LU9A 3H2KA 1P73A 4HD8A 1P9RA 4DPKA 1CR2A 4P84A 4TV9F 5GINE 5IFKA 4QUAA 1P2TA 1XMJA 4K8RB 4KE8A 3VTZA 1JU3A 3TEJA 3PB3A 4I1UA 3KXLA 3LT0A 2W2TA 1I7PA 4P3PA 4Y2SA 3FWHA 3KJXA 1NHGA 2I6QA 5CNJA 4HVCA 3IELA 3ZWWA 1MJFA 4IRXA 2P41A 4ERNA 1K7EB 1JNYA 2QWXA 4OFXA 4YLEA 4ZYZA 1AMOA 1O2DA 2BHRA 2GTIA 5CLQA 3G7SA 2V8OA 4PYRA 5FI0B 3DMGA 3FYUA 3PQ6A 4NY1A 2R1TA 1L4EA 5KTYA 3ZQUA 4YJ2A 1PV2A 3A11A 4RANA 4ONEA 1N2GA 3GMDA 2H4ZA 5FJIA 4IY1A 1P74A 1JPNA 4U3JB 3VI3B 4EF4A 1P3Y1 5DEIA 1K5DA 2VHXA 3H1AA 2CD9A 3LUAA 1XVIA 3FYTA 4Q16A 3VVMA 5K7SA 4AKHA 1T0UA 2G9NA 5KTTA 3C6QA 1KE2A 2ZE8A 4FBMA 3LVFO 3M9WA 3X1JA 3LC7O 4MHTA 1ZI6A 4JNCA 4M0LA 1QZ3A 3A2LA 1ESMA 4I2NA 4IIJA 5JYDA 4I36A 3WADA 4F97A 4N7BA 4QGGA 1VE3A 2JGDB 1H42A 1HDOA 5F4BA 1J8DA 1TFRA 1X8JA 2YIMA 3FUWA 4KK3A 3LW7A 3RVQA 1C14A 2DHQA 5K3SA 4ZP1A 1P18A 4QM7A 5LJIA 1C30A 1GTZA 1K66A 2AV6A 3IP5A 5JO9A 1KMHB 1PQUA 1GSOA 3IHWA 4HH0A 2WSLA 2E5WA 5I3CA 3HXOA 2IYOA 5HQJA 4FN4A 1SXJA 3E5RA 3F3SA 1PK8A 2FR8A 4I4CA 4ALKA 1EX9A 4ZJYA 1I33A 2AEFA 1QV9A 4QOEA 5FA5A 4D8XA 5BNWA 5DN6A 3R2JA 1EFKA 1NVXQ 5JVDA 3OC6A 1L7DA 2VDKB 2XUHA 1PRYA 5F73A 2B98A 4J07A 5EWJB 3FG9A 3OKPA 2VNKA 1OXMA 3BCUA 1PSWA 4FKZA 4KCGA 4RWZA 2M6LA 3RVOA 1OX4A 1ZUWA 3Q3CA 3VVBA 3L49A 1KI2A 2XUKA 4X54A 1SUCA 1C7ZA 2Y0BA 2XQIA 2GBGA 1A4XA 4D8VA 4E3ZA 4OJTA 3U4DA 2QY6A 1X92A 3IT0A 1F12A 4EG6A 4ER6A 8MHTA 4QOSA 1Z17A 1GSIA 1M6YA 3OI7A 4H3SA 3SR0A 4DC0A 4L6CA 1YRAA 2ZUDA 3EPLA 3LL7A 4GX5A 3IAAA 5KOIA 3NASA 3JAWB 1VSUA 3T35A 3LUDA 3WX0A 4N47A 3PPYA 1JIIA 3OJFA 1HV8A 1U9JA 1FNMA 3HNPA 1LS6A 4Q1FA 5EHXA 2PZ8A 3DTVB 3H11A 3K0BA 2RBGA 2VZLA 4N5LA 1SXJE 2EHJA 3NDPA 4E5UA 3ISVA 3FNEA 5LJLA 2PQ6A 3U5ZB 3QWIA 3L0PA 1XU4A 4BCDA 3MOGA 1O08A 4MR9A 2ID4A 1U65A 1H0HA 1XTTA 6REQA 3RKUA 5FUMA 4FFSA 4FDTA 1UDBA 1U0JA 4YMTA 4YCNA 5ETJA 2JFYA 1QIFA 3O9MA 2BFAA 2K7ZA 1M2VB 3PFCA 3O9VA 3ONNA 2AQHA 3VSCA 4UFNA 3TLAA 3ANYB 2ZR7A 1JXAA 3HHPA 2JKVA 2VK2A 1XC7A 3DCJA 1VMIA 4DLPA 5B12A 4QXMA 4JBLA 4K5QA 2V03A 3CE6A 4HNQA 5B57C 3J80A 1OFHA 1T1EA 2PVPA 4E03A 3L4SO 1JGTA 4ES6A 1NDQA 1N4AA 2C5EA 2A9RA 3A2KA 3HMKA 4GBJA 3DHWC 3VMMA 2Z5LA 2AB0A 3UGJA 2IH2A 2QZPA 5KHOC 3X2SA 1OLOA 2QMYA 2R5WA 1I3MA 1LDGA 1U0FA 2WHEA 1B16A 1KP3A 3WMRA 1CXZA 3LE8A 4L75A 3FD8A 4DLWA 5CH8A 4XJTA 1RI2A 1WCIB 1XMQB 4UUQA 1RPZA 1QPBA 4OLBA 2AVNA 3BH7A 4KUGA 3Q87B 4UEJA 1LW6E 3AOEA 2J46A 3O1IC 3EEYA 5I6DA 3NUQA 1PN3A 4RK7A 3DQQA 3UT6A 1NVGA 1E64A 3JX9A 3TVDA 4QU5A 3MS4A 4BHTA 1WBDA 3L40A 1H05A 1XTJA 4V24A 5HDBB 3RFVA 1QHXA 4KUEA 1IY1A 5HRCA 2Y4NA 4P3OA 3EG9A 4BDSA 1MQ8B 3LK7A 3QI7A 4TYQA 2JLRA 2XWQA 3W3AA 4I9NA 5JAQA 3SBOA 3SKXA 4CKCB 2EG5A 1K5GA 4XUCA 1DG3A 5JANA 3QVUA 4HVTA 2H92A 3M7IA 3JQQA 1UMBB 2EG9A 3HWSA 3N8DA 4UVEA 5H81A 3T7TA 3UY4A 4BFZA 4EVIA 3TECE 1A9ZA 3PI7A 3QWHA 3RIGA 2IH4A 4XX0B 3HA5A 4M0PA 3WZMA 2H8KA 1J1ZA 3B1XA 1PUIA 3D5EA 3H8SA 4BLOA 1TMYA 1YNSA 1IQRA 2H2HA 1ZKMA 2D62A 1IC6A 2J87A 2ZBEA 1DVRA 1UDWA 3T3PB 3U48A 2GZSA 1JWBB 4RH0A 4BCCA 4BV9A 4JLDA 4P92A 1HDXA 2PWZA 3ACCA 3I1FA 5ECGC 3EQ6A 4E1AA 4YAFA 3MRXA 2I9PA 5JLJA 1QIGA 1V4VA 2FW0A 4S35A 4BATA 1I6MA 1SXPA 1YB1A 2L0XA 3HKBB 3G0HA 4IZ6A 4MHSA 2AF4C 1JHYA 2H9AA 3DBVO 4LN1A 3V8NA 2PH1A 3PD0A 4G01B 1RKXA 4JBWA 5EJEA 4CEHA 5HIIA 3TR6A 1DAGA 2WC1A 2AHOA 3Q6IA 1WXXA 5AVWA 2DSTA 1QQ5A 3TLBA 2J6CA 4DANA 1IEXA 4M1QA 5DTJA 1MPTA 1K4YA 2D0DA 3LV8A 4MULA 4QYXA 4XD2A 2YOGA 1G291 1ELOA 1LI7A 5LNK1 4LGCA 4BE9A 1CVLA 2BWJA 5JDIC 4LY0A 1P60A 3F6YA 2CE2X 3KTOA 1V16A 3QEMA 1KMMA 1KA9H 2I1LA 5CTJA 2YVLA 1P9NA 4V1CB 1FLAA 4RS3A 3UAGA 1IN4A 1L5HA 2BFEA 3WKDA 1LBTA 1NVAA 1Y98A 5FWYA 3B36A 4BO4A 3TXYA 1Y9AA 3FFXA 3TTTA 1FTWA 1Z4KA 3NIDB 1FDRA 1D1TA 2A30A 4KV7A 2GD6A 4IM7A 4NBVA 4NBTA 3WMWA 1YDWA 4BVKA 5CXUA 2PZLA 1C2TA 1YZYA 4L76A 1QDUA 5EUMA 4AJOA 1H5QA 3WRXC 1BU5A 1L5NA 3T94A 4J0FA 4I0WB 4KKVA 1CP2A 4HUJA 2AYZA 1IM2A 3TBHA 1C0LA 4PQRA 1VMEA 2CHVA 5JD3A 2VUHB 3FVVA 2C99A 4X7BA 1U5BB 1B6RA 4U00A 4CM3A 4H15A 1N2CB 2R1ZA 4OQXA 2BGJA 4V0LA 4FR5A 1K75A 1UQRA 4B83A 2VPZA 1QX4A 1SOWA 1AF4A 4EHKA 3PT5A 4G8JA 2KPOA 3NYQA 1EB9A 1SCUA 2ZE7A 3LY9A 2OOSA 2X22A 4JB8A 4Q39A 4DZRA 3CW2A 3SOPA 3AM5A 4M9SA 1JVSA 1ZUHA 3FPSA 5KUTA 3G2PA 1ZY2A 3NIBA 3OZEA 4PY2A 4YRRA 3EOBI 4RKQA 2HD4A 1CLEA 4PO3X 3AQIA 1A9OA 4PYOA 4IINA 4K28A 1DBVO 5DW0A 3TVYA 1FPMA 4ND4A 4FOOA 1D8TA 2NADA 2ZBUA 1UBOS 1FTSA 2WKWA 2O8DB 4N0MA 5AKGA 3O47A 1I4WA 2IHKA 1PR1A 3U6KA 5E2AA 1AKMA 4HR7A 2WDZA 3H6HA 4JWTA 1SG0A 1X7XB 3G5UA 3W9UA 3SEAA 3H83A 1UBEA 3WFZA 3VU9A 1RCUA 3R8FA 3PUWA 4FWIB 2A86A 3TZHA 3UUEA 1XSEA 4OX9Y 3PF8A 3G82C 1RM5A 2G17A 4LZZA 3STHA 2R6DA 2OL4A 2NX2A 2XCLA 4HY3A 3X1WA 4Z4CA 5JAHA 1KDRA 2GZ2A 1M75A 1YQUA 1IY9A 2ROQA 1QVRA 4Y1FA 4EECA 1DKNA 4MUMA 3W8FA 2BCJQ 4AD8A 2Z1MA 2BUCA 3F8WA 4KW7A 4AKEA 1HKUA 5HKBA 3T1YB 5JTUA 3KE9A 5EYPA 3SXUB 2CV0A 5IAOA 1JVNA 5M7EA 3TKAA 1FW8A 1IUNA 4KXMA 5UKDA 5CB4A 1Y7IA 1ZUNA 4JH0A 5H59A 3CLHA 4HQKA 3QIVA 3TQTA 4TUYB 2C82A 1SCJA 5ECYA 3EFOB 1FMTA 3GR6A 1BA3A 3DDWA 4WPGA 7YASA 1E1QD 1F1JA 4EDFA 1UP7A 4LX8A 2FV8A 1B00A 2IEIA 1KP2A 4FDAA 5CA0A 3OX2A 1HSZA 4YMWA 1ULBA 2XXJA 4TKUA 4JLBA 1H8HA 4MA4A 1DO2A 3UXEA 1P2UA 3H5LA 1LPMA 1N6RA 1VMKA 1PNVA 1W46A 4UHBA 2Y27A 3FXAA 3RK4A 1U7HA 1AKRA 4L73A 1S9HA 3ZY4A 2C5LA 4YPOA 4KNWA 3GRYA 3Q6MA 3RF7A 4YYEA 2C4WA 2H9IA 2WW8A 3IVAA 3LDFA 3FFWA 2BN4A 1YB6A 4Q24A 3WGGA 3ZG6A 1C7JA 1G6OA 3OX4A 5CFRA 1JEQB 2I7CA 1XE3A 4HUQB 4I50B 4JLJA 5FJJA 2GXAA 1KVSA 2GS9A 3W9BA 4MV6A 2IP1A 2IYFA 5ICMA 2VO1A 2RK3A 2YIJA 4MUIA 3F3MA 1JFVA 4MW1A 3UJCA 4BO2A 1ZJWA 4ABTA 4R7GA 3T3EA 1H69A 3V46A 3NEYA 4FMBB 4ZDKA 1NVVR 5ALOA 4UFOA 4ZYLA 2FY8A 4K0KB 4YUXA 1K97A 1Y8RB 4RM3A 4FDVA 5LP6B 2CY0A 1ILEA 1G1MA 1UBRS 1ONNA 2O2GA 3OY2A 5CFZA 1IUOA 1C29B 3PGXA 4MKIA 1N2BA 3O0TA 3OH8A 4H7FA 1DDOA 1CF2O 3WLHA 1B1CA 3MERA 3ODPA 4G56A 5EFOA 1Q3KA 2X0NA 4I08A 3ZWAA 3GAZA 1GRCA 3EVCA 4BOYA 3PNLA 5EPUA 4F9FA 3ICEA 1KC1A 2H63A 5CLFA 3VKHA 2RIRA 3ZIAD 3IALA 3E8XA 2LVBA 1HETA 2CVFA 5ENVA 3DV0A 1FX1A 2QX9A 1U2RA 1FTGA 5EOVA 1QG6A 1K8RA 3PJFA 2X0KA 1N0IA 2C5HA 3G1UA 4JQZA 2YINC 1Z6ZA 1UXJA 3BE8A 2KYRA 2J3QA 4RXUA 5U1PA 4DV2B 3LQRA 2EJBA 3HFJA 3L82B 1J25A 2V7QA 4OXYA 4AQ7A 5ARCA 2ON6A 5U4XA 4N41A 1EVJA 3EMDA 5DKFA 3DJYA 1ENYA 5ANRB 5EHZA 4E4TA 2A0XA 3WK5A 3LD9A 5BNZA 5JQGA 3QEOA 1ZHHA 2CJXA 1PG2A 1V45E 4LE0A 1G4HA 1PTJC 1WF6A 4XDZA 2YFKA 4XRRA 3AESB 1USKA 4L5CA 2NXEA 4R41A 2B1IA 3LXUX 3MJVA 4TMYA 2HRRA 4DNOA 4O59O 5DISB 1CRPA 1AXGA 2WB2A 2V5UA 1XAHA 4Q4LA 2YFHA 2EJWA 3BORA 2JA2A 1E9RA 5G4KB 3QX7A 5TDHA 4CXMA 3I61A 1VLQA 121PA 3EZ6A 5EIBD 2XKAA 3C5VA 4Q7QA 4FJ0A 3GEMA 3KZOA 1KGDA 3I3SR 5WRFA 5IKPA 2UYYA 2YJZA 1O6ZA 1N92A 2FDRA 2ZB3A 5FYQA 1MGOA 5B3LA 1ISIA 3L8HA 4XZ3A 4XYLA 5G0VA 4JLNA 3WLSA 3V2IA 4ALIA 2VS1A 4HLQB 5PGMA 4FX5A 1R6DA 2BJWA 5LD2C 3OFKA 3NBAA 3P9ZA 4OKSA 5DP1A 1JAHA 4RJIA 2QT9A 3EEBA 1UDXA 4OAQA 1UDCA 2DR2A 2BRUC 3DEHA 1TMKA 3VR6D 4J1SA 1U8ZA 4RENA 1KYXA 3P0JA 1XA4A 2HWUA 4DC9A 4XSVA 1KPGA 2C78A 4N3AA 1QXSA 4AMVA 4Y6GB 1RM4A 3AVQA 3HS3A 3MLEA 3FHTA 2VR1A 2JL1A 1PS8A 2XX3A 4CLEA 5T5QA 2R68A 2ISCA 1U8XX 4DADA 3HSSA 4G2TA 3TEMA 4RIIA 4PF1A 4I7EA 4AAYA 2JI6A 4EW1A 4OI2A 1DX6A 1T6ZA 1NVFA 2W6ID 3KWFA 1OW3B 1QYVA 2JLQA 2CNDA 4QQFA 1K88A 1XLTC 1D04A 1EDZA 1Y3IA 2QRHA 3DKRA 3ESZA 4TTPA 5CT8A 3VPDA 4ZJZA 4F5WA 2QLFA 4HZUA 4OP3A 1AKTA 4YECA 3PFNA 4HLNA 2HA6A 1RWKA 4N8EA 3R7NA 3SZUA 3TK1A 2FEPA 1LNZA 2XTJA 5J3JA 3QU7A 1CZRA 1MH1A 3LOUA 1QLHA 4DL9A 1KAHA 3AP2A 3HC7A 4GF5A 4N76A 1IQ0A 1KXJA 1QH0A 1Z88A 2FZKA 2X4IA 3D5QA 4NAHA 4OXRA 3AY0A 2WLTA 3HGTA 4GSKA 4Q7EA 4W8GA 821PA 4MP3A 2GK6A 5IT4A 2FPXA 4B6FA 4YB8A 1DKLA 4C3OB 1V5EA 1IHOA 3GP5A 2D7CA 4G9GA 3R8CA 3BRQA 1T4CB 4OQFA 5JS1A 1QOZA 4IR7A 2R79A 3COVA 3JYPA 4LDQA 3TQIA 4GMDA 1FDSA 1O94D 2RI0A 2HGSA 3D6AA 1D09A 1G5PA 1OLSB 2WJJA 1Z6GA 2OG1A 3T9DA 1A4UA 5IT5A 5K3EA 4DBVO 4O8ZA 5ER6A 4YUWA 4NV3A 1Z5ZA 3MELA 3V2GA 1E77A 4M3NA 4FOLA 2GZHA 4MV7A 4XGQA 5D00A 3BB3A 5HPYB 5A9SB 3DFUA 4MIEA 3K0FA 4OLJA 1XWWA 1VB5A 1GGJA 3NNDA 1VLLA 4FDLA 4IIEA 4ZAGA 1GL6A 1C7IA 1T0JB 5AVZA 1SQSA 2W2MA 3WWEA 2O5VA 3AG6A 5IBRA 1VIMA 3GW8A 5KWIA 3FSJX 1M5RA 3U9TA 4LXUA 1A2KC 1T91A 1YNOA 4QQKA 1GGHA 4RORA 5DXJA 1RJFA 4NDAA 1YB2A 1AOXA 4OGGA 2RH5A 4HTFB 3RANA 1F0PA 1OQAA 2RCYA 4WGFA 1N1DA 2VHWA 1L7XA 3RU7A 4EFDA 4V38A 1EUCB 2BR5A 2VAXA 5IKOA 1YB4A 3W7BA 4YV1A 1IOZA 3W1VA 4QOIA 3ILXA 5E1DA 2EQ5A 2ZRFA 2DUMA 4OK3A 3V7UA 3VAAA 1TTTA 4EG5A 3DULA 4IO1A 4P3XA 1X87A 4MDYA 2B37A 2PQ2A 2R6FA 2Z1NA 4J2TA 4QRHA 4R1PA 5LR6A 1P44A 1P7CA 2DY1A 4OXKA 1LQUA 3K9QO 2VXCA 3OT1B 2VRNA 4G09A 1EG2A 1KR2A 4UD2A 4UUAA 5EQFA 3PFFA 5HS4A 4KPUB 4FPXA 3O8CA 5CVDA 4B44A 3PWSA 4TT3D 1E5LA 4IBOA 4IPTA 4L4ZA 4XAQA 3STWA 4URYR 3VH4A 2PMBA 2VAMA 3TXXA 1OFIA 5GGXA 3SLGA 5DBGA 3EPPA 5L7WA 1VIVA 3OCVA 5KVVA 5BSRA 3K9CA 2J3DA 1M6WA 3WLFA 3QBTA 5B58C 5E4TA 1MABA 2XZTA 2QTZA 1EWQA 5EE3A 3JQGB 4OO3A 4ZQHA 1C1DA 3H8VA 4BRSA 2R6GA 3IMCA 2G9QA 3HGMA 4WCDA 1PKXA 2JI9A 5F2OA 1R6AA 1D03A 2R8YA 4JCOA 4LYGA 4Z86A 4AMZA 3CURA 4TSFD 3OA0A 4B31A 1VA4A 2OLJA 3R7WA 5DCYA 4MKGA 4MUAA 4AICA 4E4YA 2RGNC 2HU8A 3IBFA 4JD5A 2A0UA 4PR0A 5DASA 3HXQA 2FETA 2BFFA 3F7TA 3ANMA 1B23P 1DP4A 4MV9A 3VU1A 3LKZA 1PGNA 1T4GA 1W5AA 1GYRA 4M1KA 4MLDA 2OQIA 3GAFA 4X63A 2DVMA 4KLRA 3VOAA 4GSLA 1R4NA 5I48A 3ISJA 1P4RA 1DKUA 4RKYA 3ND9A 3THSA 1YCHA 4C9BA 5FP0A 2MU1A 4HEHA 2I54A 2I87A 2BEVB 2AEJA 4UXHA 1YK0A 1DQNA 4BTVA 2IPAB 3AEKB 1IZ8A 2QAIA 2YJNA 3G88A 3JQFC 3MXTA 1GKYA 4E2WA 3CLSC 2V5AA 1N3YA 4ZIRA 4WLVA 3V42A 3C15C 4YMGA 2F43B 3K1AA 3M6LA 4OJMX 2IYTA 2WILA 3O5AA 4GHWA 4YPFA 4JJ4A 3TLGB 6YASA 3JRXA 5FFMA 4Z3DA 3D3KA 3I45A 4JS0A 5CD1A 2C7BA 1BFDA 2EBHX 4DGSA 1M2EA 1QYIA 3F74A 2N1BA 1ZL0A 2QTNA 5J1SB 4XDHA 1NUSA 3UTDA 2C58A 2ZIUB 3TBKA 1CQWA 1IMOA 1SCDA 2AG5A 3D3JA 3GMTA 2BMVA 4E5PA 7GPBA 2IU0A 1NUTA 1XZLA 3OQNA 3FOBA 3LIIA 3N5KA 1MKYA 2GBCA 3C6ZA 3QLVC 3WLEA 5KSZA 4D8YA 1J5PA 4H1VA 3RJTA 5JBQA 3H8WA 1E7YA 3A9SA 3I8SA 4HATA 2ES4A 3MHTA 4TL9A 2IE8A 4ENWA 4UVGA 3R9XA 3TPFA 4BLRA 1SA0A 4R51A 5BVGB 2JEZA 2Q28A 5BW4A 2CMDA 3U4GA 3ZXUB 3R7BA 4BIIA 3Q3HA 3E9EA 2CVOA 3ITNA 5F21A 5C7IO 1G9XA 2ZYIA 1XZDA 1JB1A 2HF2A 1Z9BA 2LKCA 1C3VA 3CMMA 4BE4A 1YR7A 1PL8A 2G1UA 4E7PA 5GZ3A 3Q3JB 4HADA 2AFHB 1EK0A 4WLUA 3BWYA 4BAZA 2DT8A 3JQBC 3MMXA 3EAGA 3GJSA 3RAJA 3OAAD 4XUDA 1W76A 2Q3LA 4ARZA 4CUJA 1DXHA 4A23A 3QE3A 1J2JA 3DO6A 4AXXA 1PJZA 5DM0A 2IODA 2I7VA 1NVKA 2C8JA 2JFHA 3RTDA 1C8BA 4KNYA 3GFPA 3OEEA 1ZMTA 4JC0A 1JHZA 4Q1DA 4O4IA 5IJ9B 1QRAA 1KZ6A 1WXFA 1VM6A 4YJHB 3U56A 2APJA 4AJ9A 1XKQA 1USIA 1L7MA 4BNGA 1BN6A 2P3SA 1HMYA 1RPAA 2HHAA 3O1HB 3O8LA 4GLOA 4E4RA 1T5IA 5J23A 1Z5GA 4HX2A 4RULA 3G13A 3FNGA 1K92A 4U9HS 7REQA 1RXEA 3ZJVA 3G85A 3GRCA 1YL6A 1SVOA 2HM7A 1X9IA 2QYHA 2Z58A 1OIVA 1X1CA 4JELA 4LEIA 3OWOA 1KAMA 4FGSA 1RBZA 1H23A 1M2GA 4PFJA 2EX0A 2R6AA 3FVTA 3L02A 3OLZA 4H9GA 1SQ0A 5J4YA 3K70D 3L3BA 2ZPAA 3UKOA 4OM8A 3FZNA 1W19A 3KAPA 4EOGA 2OXIA 3TJRA 1CUYA 3LUHA 4EDHA 3IQEA 5TSDA 4WLEA 4D3SA 1N4DA 2B7BA 1Q95A 2PCJA 1GNPA 1RC1A 2P8SA 3QRWA 3K2EA 3L1JA 3MAGA 1N36B 5L6MB 1L1FA 2OORC 1NI4B 1Z5UA 1HEUA 2B6HA 2W8BB 1I4LD 1J5XA 1UOPA 1N5MA 2PFKA 1X8LA 4QNRA 4ZO4A 5EN4A 2HCJB 2ADFA 1ONPA 3LRXA 3T7SA 1MG0A 4GYJA 1VHWA 2OZLB 1VA5A 1Y48E 3ENZA 1XZGA 3K5IA 1Z38A 5EE0A 3MHPA 3QVWA 4I14A 5C51B 3JQ7B 4MV5A 2X4DA 4JL5A 4WKBA 3WL7A 1BXRA 3CRMA 1C1HA 4W63A 4L57A 2Y1WA 1ZP6A 1NE2A 3L1IA 2Z04A 1IN8A 3QVGA 1X7WA 1P3JA 1M2NA 3M2TA 4RJLA 4EPTA 1E7RA 1PW5A 2BRUA 3IDZA 2C0PA 3HO6A 5H9VA 3LC1O 4BZQA 2HMUA 4BGDA 5I9TA 3SCZA 2RHRA 4CVNA 4J90A 4MX8A 5G41A 2WKSA 4ALNA 3KVVA 1EE9A 1OU0A 3AKEA 4A6DA 2CXSA 1KTVA 4B9EA 4D8UA 5E6RB 5CIQA 1RE1A 2YHBA 4RFLA 1E2EA 4ZT7A 3H86A 4EF5A 3HP4A 2QM7A 1E7WA 4QFBA 4FFBA 3GCZA 5DN6D 2XXBA 2QSJA 3DBRA 1E4YA 4YRAA 3UWPA 4C01A 2EHDA 3QJYA 1I2BA 4N6NA 4RYLA 3L0YA 5JPIA 4RTKA 4RPJA 4IZHA 3HLTA 3QPDA 1KI4A 4WZBB 1F4PA 1RAEA 1R8SA 2PGOA 4GRDA 1MRSA 2J3EA 2ZWAA 3HCDA 4QYIA 1Z39A 5AW5A 3H1GA 4B5LA 2EJCA 1U7OA 3ETEA 2CLLB 2MWMA 3BWCA 5G53C 2J85A 3BWEA 3T5GA 5JJCA 4ARIA 3IVCA 3VMFA 1XMOB 4KLAA 4W82A 1DUSA 4EG1A 4Z9BA 4HB0A 2V55B 1CY4A 1NQVA 3G2LA 3HJCA 4IZIA 1IPFA 1RU3A 2FG6C 4HDSA 2ZYRA 2AN5A 4XW2A 2FG7C 3AZQA 3E8MA 3RFCA 5L7TA 2REQA 3WAJA 2F8TA 1EVZA 3PGVA 2CXUA 2BGIA 2AKAB 1OI3A 3H9GA 3NCTA 5BOVA 2HDOA 3BMOB 3KKOA 1O87A 3L0SA 2CDCA 1T9ZA 4DIEA 1OAOC 3MSCA 2YMMA 4A73A 1FSGA 3SK0A 3QX8A 3RNOA 3FWPA 3T52A 3E1SA 3WNQA 1ZIOA 3B13B 3CQ9A 3RVKA 5BURA 4FYYA 2GNOA 2X1HA 2C31A 4E2ZA 1FMLA 3O8OA 4YR9A 2EZ8A 5BR8B 2NAFA 1HL7A 3EXIB 3KKZA 4RKFA 1KI8A 4KPYA 3UBMA 2DFTA 4YV7A 3ENQA 3NLLA 3G8BA 1OLXB 2FLWA 3TW8A 4E46A 3JYOA 4IVRA 4NARA 3ZGVA 4RIGA 2CSUA 1E6EA 2EKLA 2CMKA 1UIRA 1E3WA 1PLLA 3CSDA 3VR5A 4ARUA 4KXUA 4EFMA 4RY2A 4ZAVA 3H6GA 3T38A 1O95D 1AX9A 3IOYA 1E1CB 1LVGA 3LTEA 1MAWA 2ACWA 2OV3A 3MWDA 1UOEA 3UC9A 3VU3A 4FW8A 1PFUA 1W1UA 4DE5A 4F93B 2B4TO 2I2BA 5A02A 4CGYA 3GCWA 4GVXA 2W98A 2VI5A 2AOWA 3FWKA 4N5HX 5HF9A 1X1QA 4Q9AA 4JT9A 5ABPA 1RM3A 3J81k 2O3RA 1CVIA 5KYUA 2UUCB 3KXIA 4TZKA 3GEHA 1LZLA 3P1JA 1FDWA 2D2XA 2ONJA 4C7BA 3I1YA 4NJEA 3MB5A 1UEXC 4US1R 4Q01A 3D1LA 1HY3A 5KSPA 1P0QA 2HK7A 3DPUA 1U0SY 3K16A 2PKYX 4ZV9A 4LF9B 4AP9A 3K0CA 1MB0A 1G41A 1RWXA 2DWQA 1GU0A 2FW7A 2R4UA 3PJEA 4JQOA 4PX2A 4LE1A 2EYQA 2GCPA 4FSXA 1N2HA 4WCFB 5E2BA 4Z9YA 4LZJA 1GADO 3AU8A 3MINB 3GEPA 3FJ1A 1BWRA 1Z0AA 3JYQA 2J59A 3IR7A 2A9JA 2C5BA 4MV1A 2PO5A 3UB3A 2Q1YA 5CAEB 1LRKA 2P4HX 5JCOA 4R3WA 5IXJA 4P1ZA 3G3EA 3Q5GA 3ONVA 3W3AD 1FTYA 2BFPA 2DX7A 4TYYA 3NYIA 4EKNB 3HE3A 2GJ8A 4FC7A 1WDMA 2HYDA 3VVCA 2HADA 4HAOA 4XQCA 1JQ3A 2OBYA 3KHKA 3EXEB 1ILWA 3DXZA 2QB5A 3O4JA 3W6ZA 5IDXA 2PTGA 1PAUA 2ZUCA 1C7EA 3JD0A 2RGNA 3ZHTA 1JJFA 2C5AA 2WTXA 1ZGBA 3PQEA 4HDCA 1CQJB 4J1NA 5C46F 3AR4A 3RC3A 3GGPA 4F72A 4WECA 2HN9A 2IS4A 5J9FA 5AKEA 3MTEA 2DETA 2EFHB 1P6XA 1POWA 3OECA 4DLXA 1HYGA 5EXDA 1R50A 1J21A 1CRLA 5KOJB 2B0CA 3LF1A 4MEAA 4O29A 2C2ZA 3BXEA 2HIMA 3OETA 3N2ZB 4GPTA 1TD9A 1NQAO 4NDZA 1TFUA 3UO8B 4ZVNA 1R0WA 5JMWA 1Z0IA 4G5RA 3MTDA 2ZCVA 5K05A 2E3JA 3IXQA 4IV0A 3OF2A 2ID8A 2EWVA 4YQEA 4FBLA 4C0BA 5KTSA 3I6QA 2QDXA 3DMTC 2PJRA 3ZHOA 4M86A 1S7GA 4QU0A 5J43A 4IOLA 1NR7A 1F38A 2B94A 4LIPD 3AFNA 3RUCA 2JBAA 1L4YA 1YDGA 1JV2B 3HBJA 3GC6A 3PL5A 5E9WA 2Z2XA 4O08A 1SU8A 2B8JA 2YRXA 1L7QA 1C3EA 3DDOA 2OO3A 3O4RA 4K6FA 4TS4A 2KB0A 2PKEA 1M8PA 1F6WA 2AIRA 2WFLA 2R1TB 3FYUB 3LHSA 4RHCA 1MNAA 4YJ2B 3S4YA 2V7BA 3GP3A 2C03A 2C95A 4WEOA 5CT9A 5B53A 3K70B 1VSVA 5IAJA 1R5BA 3RUEA 2P1DA 2ZJFA 2ZK7A 3HY6A 1LLDA 3PNKA 4G1UC 1VP9A 5DIZA 3U4QA 2DUUA 5FHRA 3FW1A 3DZBA 1J22A 2VZ0A 3O26A 3BMQA 1HA3A 2Y0CA 4H7JA 4R31A 3WRVA 1YAJA 2OYCA 1ISHA 2PNJA 5AUNB 1V96A 4WFIA 5C8YA 4G8CA 4P83A 1H3EA 2OO5A 4MYRA 2AMVA 4QUDA 4IIJB 4RGYA 2O5RA 1R4ZA 1SCKA 3MJSA 3VSDA 3N87A 1UPAA 3WTCA 7ABPA 4RSRA 1NZFA 3IEPA 3THOA 3GVHA 1L8LA 3KD3A 3VPAA 5LUAA 3GT0A 1JP7A 2LCIA 4D5GA 3RS9A 5FNVF 1C30B 3NVMB 2OHFA 2NO7A 3AZPA 3CRVA 4NNPA 2HW8A 4DB2A 1XU7A 5AI8A 2GK3A 1ENZA 3AHCA 4RESA 3UJPA 3KEGA 3RTAA 1SXJB 4KVAA 4C22A 3WBBA 1KXZA 2QVZX 1O6FA 3NHBA 4C7MA 4F2DA 1MOSA 1PKEA 3MMPA 1HE8B 2PZFA 4QYWA 4MWSA 4E32A 4YR7A 2XR1A 4NZOA 3U3JA 2AXPA 1L7NA 3D54D 2GVNA 5GWXA 1FBTA 1JR4A 3EDOA 3BGSA 5JVDB 4Y2JA 4DXAA 1RXUA 3ZNPA 5K03A 3GIDA 3LDGA 2IZ1A 2JFUA 2YXBA 3IQDB 2B4YA 1OX4B 3VU8A 4M54A 2H5EA 4CG2A 4RBNA 3DUFA 3EBOA 3BQMB 3OSZA 2D3TA 3SR4A 3AVXA 3I2GA 2MYUA 2OBXA 4OA5A 3W4JA 2EKQA 1IATA 3GPCA 4QQRA 3TSWA 4Z1OA 1T0PA 2YNMD 4KQKA 4MUBA 4Y2RA 4CN9A 4CU5A 5KNDA 1AUOA 1HTBA 1BJTA 3FI9A 1SD5A 4BMPB 3WMFA 1PT9A 1P9OA 4CCYA 1OV4A 1WLSA 3DE5X 4P34A 3VJKA 4F2HA 3H11B 4M8SA 3J7AC 1GCGA 1LSSA 2BFCA 3BCSA 3K2BA 2OG2A 3IP3A 2FP4A 3Q0EA 3B12A 1TRKA 3IAS1 4PQYA 4AIRA 1SQGA 1VE7A 4OREX 4OQDA 2NTYC 4MR9B 4OGFA 1YASA 6REQB 3C1TA 2NG1A 5HK9A 3ZJUA 1OWLA 2HWYA 5G02A 5HVNA 3H2HA 1ZGAA 2O57A 2OXEA 1VECA 1CUWA 3PNSA 4CR7A 4IZOA 3IQHX 3DA8A 2XUFA 2OB2A 4B2IA 4KMRA 3ICVA 4AXBA 3L0CA 1XDGA 1H8HD 2Q0QA 4ARAA 2FXIA 1JG3A 5DTEA 4BVHA 1IH8A 2HF8A 1DXYA 4M0UA 1RR6A 4NF2A 3S44A 4B3FX 1ATZA 3KKKA 1K68A 3PGKA 1GTJ1 3AYXB 3SZGA 3WV4A 1V39A 2YJGA 3NVKI 3ZTTA 3E0XA 2JG3A 4DDUA 4BKMA 1XJCA 1ZVJA 2PT5A 4TQ9A 1QRUA 1BQ3A 3GELA 4PC6A 2PZEA 5SICE 3A1VA 3E18A 2AMLA 3OOJA 4IGFA 3WNCA 4H1WA 3AJ9A 3OOEA 4RCYA 2VJCA 2ZJ0A 3PQ4A 2NUTA 4RVHA 5K8JB 4RTNA 2BI4A 4BO0A 3SIPA 5F1OA 2IEYA 4ADSG 4EL0A 4PX9A 1PVDA 3KEFA 2JANA 4KPFC 1FDIA 4LYEA 1ULSA 5BSVA 1WXDA 1A9YA 1N7IA 4AS1A 2CLSA 1DKPA 3ZWPA 5IMSA 4LVNA 3C16C 4EUSA 3AR5A 3K15A 1MDFA 1K7FB 3EW9A 1U0TA 3A1UA 2GF0A 3LXMA 4X44A 3FHCB 2YZ2A 3I3OA 3WZ2A 1NXVA 2AEEA 1L5MA 4HXYA 3JWIA 1SIOA 2O5CA 2HXYA 1ZIXA 1TW3A 1XCGB 1AN9A 3BXXA 3EG9B 4NLLA 3SG0A 1XRJA 1VOTA 3UWMA 1M1XB 1E1LA 2UXBB 3AR9A 1JIUA 1E89A 1O03A 2VKQA 3B82A 4Y7DA 1E2JA 1R3DA 3QYJA 4RY9A 4A2WA 3FPBA 3SJBA 2PE5A 5CPBA 2J3JA 2HR1A 1M1YA 2VDPB 4M22A 3VJRA 1N2ZA 2CLOB 3EUAA 2ZM6B 2V7QD 3NVAA 1DQSA 2GAFA 5BQPA 3TTWA 4RKWA 2NZVG 4TTTS 1BSVA 3NV7A 3ONDA 1Y8CA 4KLCA 1GUBA 2H3EA 1KU0A 2IDMA 2YXNA 2AWOA 2CLMB 1EK6A 3E05A 2AUNA 4WKNA 5LA6F 4CCAA 3R5TA 3BJIC 2ZVQX 5EJFA 4AECA 1UZMA 1HDEA 3BM5A 3ZD8A 4JROA 1MEEA 1XJQA 1ZOSA 2PJZA 3QKIA 2PKWA 4FD2A 2FFQA 5IT0A 1OREA 3NOXA 2ZRNA 3DP7A 5ALZA 3IPXA 1C8KA 2NPFA 1OH8A 2VDJA 4AUNA 3E03A 4DKJA 3NTLA 4ETWA 1TEHA 4DDVA 1B73A 2XMQA 3CEJA 4G0ZA 3TI7A 1CJTC 4CEHB 3LQKA 2HQRA 1KJ8A 3TNJA 2HSZA 5D8DA 2QR2A 1HFEL 2BEWA 2JK0A 2PMKA 5H83A 3VKUA 4BAUA 4D4KA 5BY2A 3K8OE 1Z29A 1GDHA 1ZSNA 4IHJF 1S2IA 1X2BA 1YQQA 4XVHA 5NULA 1HRDA 2Q5EA 1U3WA 2ZU6A 4FU0A 5KYKA 1FMFA 1M1YE 2BFBA 3BK2A 2D5BA 1V16B 2E4YA 3QEMB 5HMMA 1M83A 4KIFA 1Z34A 1L5HB 2BFEB 421PA 4P2BA 5KKAA 1SVUA 1AA6A 1X15A 3Q88A 5FWYB 1R6XA 3KSMA 5SV2A 3WQHA 1R8XA 5EKUA 1KAOA 2LZ0A 5IJXA 3ELUA 3EG5A 2WP0A 1MW8X 2F1JA 4PN3A 4BCBA 4GE0A 4NZZA 4D0NA 5LM3A 3AVUA 3PUVA 2O07A 2YW9A 2GD0A 3E5MA 4KGXA 3VPBA 3I5YA 2HV9A 2VT2A 1HDZA 2P4SA 2WKQA 4RDXA 3ADBA 1SKQA 2G9VA 3K4QA 2RB5A 2ZJ3A 3IB3A 3VPSA 4KIWA 4LBVA 2HLHA 2GH1A 3W79A 5KINB 3FDFA 3B7WA 2GZAA 3JQEA 3FBWA 2WMNB 1N77A 2M6SA 4FKBA 3TPCA 3BDVA 1S2OA 3GNSA 1IM5A 2GM9A 3U0VA 5K8IA 1BKYA 1QF6A 1Z4IA 4A3SA 1C1XA 3C3WA 4IDGA 1G8GA 2PWAA 4HNTA 4JUFA 5HM8A 1SIBE 3OE7A 2OCXA 1JJBA 5EMJA 3BT7A 4UXIA 2IGBA 2HCTA 3DHYA 5DWVA 1MPXA 4DIKA 1SCUB 1JU9A 4X60A 4JYBA 4AJJA 2B7CA 1PFVA 5CT6A 4D4HA 3NEAA 4UPEA 4ZICA 4DPMA 3GFFA 2WVGA 1DEXA 4X90A 4H0NA 3PRHA 3FR8A 4X41A 3EDCA 3GLKA 2CXXA 3IRUA 4M9RA 3HWWA 5BO5A 1YR2A 2VAPA 4I4NA 4KAJA 3IIKA 4DA0A 2IUSA 2G28A 2BR4A 2RGEA 2QN2A 1I2CA 3GEBA 1KO7A 1X7GA 4NG4A 3TLXA 5HUJA 4CT4B 2BCGY 2I2FA 2UVQA 3WNBA 4DBZA 3OA2A 2ZDQA 1WO8A 4BVFA 4YRMA 4N1AA 4QXAA 1VKNA 2GJ9A 4G4SO 4H4CA 4W5NA 4QJBA 4E5DA 1TLLA 5FKJA 4N0EA 2VWHA 3VU9B 4FMPA 1CUUA 4UNQA 1Z3CA 3K0SA 1CDDA 3ADPA 2OV1A 3T8YA 4CFYA 1OGYA 4DQ0A 5F98A 4EBFA 3QLUA 2FGJA 3K92A 1YHNA 2W2VA 2DQZA 1S3FA 4FS3A 4YJ3F 1UKVY 2ZYAA 1LK0A 1Y3CE 4KXFB 1XJWA 5EYPB 5DZSA 5IBPA 5KMGA 1I4TD 4DJFC 2YL2A 5E7QA 5B4VA 1WJGA 3HWX1 4IO0A 1NTOA 1U0HC 1WVGA 1R5NA 2G1KA 3KR2A 3KYDA 4HDRA 1ZUNB 3QFRA 3ZKWA 3D0RA 3KO8A 4Q5IA 1XLWA 3S2EA 5HP4A 2UZ0A 1WKCA 2J6HA 2X6QA 5C1DA 3G2NA 8OHMA 3E81A 1FZTA 1U7XA 1NE7A 2P9YA 4NOKA 3BIJA 5I45A 2FOLA 3LCVB 4BRZA 5CA0B 4CN8A 1EZ1A 1NT4A 2GXSA 3H5RA 1ZIYA 4TKUB 4UNIA 1O4VA 1ZD9A 3PA8A 2VYCA 4ACAA 5B3KA 4I1YA 4JBIA 3QVVA 3SS7X 2OZKA 1D07A 4M89A 4QTZA 3GD5A 2IU4A 5AW2A 2XVAA 1NW4A 1UJ4A 1VLMA 2BIFA 1ECCA 3OIUA 4HGOA 4HGPA 5ALHA 5F4ZA 1I0LA 4J03A 1JA1A 3DEFA 3F2VA 2ZSUA 2EP8A 2KHZA 2XBLA 3SSAA 4WVLA 1AS0A 3QYPA 3U9LA 4LJAA 2XECA 2CSXA 1AGYA 3K0EA 3QA3E 3ER6A 5AVSA 4BQFA 3W2GA 1Q19A 4MVJA 2PR2A 5DW3A 2FN4A 2FCRA 1R0KA 2QNBA 3M8KA 1VI6A 3MWEA 1VSQA 4OQEA 2J5BA 1AK2A 2ZPTX 4NBNA 2BGLA 2IZ0A 2WJGA 3VHXA 1EP2B 1NG1A 1ZK1A 3BXPA 4R7TA 4RMJA 1VRWA 2B34A 2AS0A 3LSYA 4TXJA 1TQ4A 4BTEA 4FC6A 2NXNA 3OZFA 3PTZA 4JLMA 2VF5X 3I37X 3BSYA 5FWNA 1ORTA 2JARA 1ADCA 1PWZA 4CM6A 1R88A 5EIOA 4A26A 1G2QA 1FYDA 2VDVE 1Y1SA 5BRJA 1ODTC 3HVIA 1DIGA 2HDNB 3H2YA 4LC0A 1A5BB 3BH0A 3KJIA 2Q21A 3BE6A 1XYYA 2W2KA 2PKQP 5BQ3A 1ISSA 2FLKA 5IC6A 4E07A 1NJ6A 4RGQA 2F4NA 3OCUA 2JFVA 3DV0B 1Q3TA 3K0KA 3KOUA 3S2IA 5FR1A 5B36A 4XIFA 4N48A 3B3FA 5JLAA 4HFJA 2BKAA 4IWYA 2PWYA 3TTSA 3IEMA 1T1GA 4M1YA 3SQNA 1IRIA 3WDLA 4PICA 1U0NA 4MVJE 3PFWO 4BVGA 4EB0A 2NO0A 3BIFA 3E61A 4FT4A 2KW5A 4B82A 1EKXA 3G2IA 4D9FA 5CFMA 1Z0JA 1B8OA 1KAQA 1OV6A 1ABFA 1T3ZA 1XEWY 3NBYC 3T4UA 3DPIA 4IIHA 3TW6A 5JQGB 2UXCB 3PV0A 1VKHA 3B70A 4EW3A 3H2SA 5KC8A 5HILA 3CVUA 2HPAA 2HMWA 3HCAA 3EULA 1MHTA 1CW2B 2YXLA 3ROTA 2O54A 2HEIA 1JHUA 2J41A 5AVQA 1O3YA 3F73A 1XPUA 1DEOA 3AUUA 3D3QA 1PR4A 3P0EA 4QBIA 4JB0A 5GJWC 3BMXA 1JKFA 3GJTA 1TJNA 2HRQA 1YIDA 2RC5A 3KJNA 4IG4A 4PAMA 3WKCA 4IUBS 4PSCA 1XALA 3CUUA 4BN4A 4YDRA 1X1TA 4MJLA 1ESDA 4L08A 4PO1A 1EUDA 1VPTA 4BN0A 1Q0RA 1KSGA 4YI5A 3TNFA 3E9RA 5GVSA 1DGQA 2Y1OA 1L0BA 3O1JC 1LGYA 4PGGA 2H1RA 4XGKA 1XDWA 1MORA 5CLIA 3OKAA 1ZOIA 1YBAA 5E3IA 4BZPA 4YRSA 4CIVA 4R2HA 2Q50A 2WIDA 4ZQEA 4IYRA 5KTRA 1ISRA 3H4MA 4GMHA 2PGAA 3KQNA 4OHRA 3TSAA 2FOIA 3BMCA 2YUIA 4GP7A 1U7DA 2B21A 1GNLA 5DOVA 3CEHA 1DV2A 1KH2A 1TO2E 3A9WA 1MX3A 3B1WA 3GHYA 3ZGOA 2WJWA 3DW1X 4QDXA 1I5OA 3AW8A 5JRZA 2PS1A 4NFSA 4LHXA 1ISPA 5DXAA 4GI1A 4PC7A 3WYGA 1GITA 1WP4A 1ZN7A 3GRKA 5DH9A 3GWZA 4D9GA 4QOGA 3TINA 1DFIA 2HBYA 3FBGA 3A4IA 3AG5A 5EKTA 4N8SA 3COZA 3K09C 5FBQB 1NXXA 4X62B 1XHEA 4IDFA 1PV4A 2H85A 2Q9AA 4HZUB 2JRCA 2F9LA 1JG4A 4QPDA 4KO1S 4HX9A 4NEQA 1PQWA 3FTPA 4TXLA 4AJLA 4C4PA 1DIRA 5AM5A 4NBLA 2QOEA 4DMGA 4EFLA 5GMOA 5DHSA 3NHSA 3IE2A 2Y0EA 3ZGNA 4E7OA 4ED9A 1O9BA 1Z28A 2J9FA 4ER0A 1M6EX 4EZEA 1I3LA 1I9GA 4JC5A 2WAXA 1KZGB 2Z4RA 3OBIA 2YYYA 3NWJA 2DKFA 2ECFA 1RHMA 1XF1A 1SOUA 1RRGA 2F3PA 2RARA 2XYPA 3EEFA 4KRFA 5AK6A 3S3TA 4D4GA 4C88A 4KU4A 3CWQA 1GR0A 3A6PC 1FLDA 5EJ2A 4AO6A 2XNSA 3KBOA 4YO8A 4Q9LA 2X13A 4NZYA 4LJ9A 3VUEA 3KAJA 1ECBA 3SX2A 1X1AA 3B1YA 4NESA 4F5DA 3DNMA 3INNA 2PX3A 2YWBA 4RGVA 4Y6QA 5TT0A 5GIPE 3WJ7A 3K2IA 2HFJA 1YL5A 4YACA 2AZMA 1L5VA 1OD6A 4NCBA 3L43A 4JXJA 1VSBA 3MILA 3STTA 3AEYA 3RV4A 1U4OA 1ZIDA 4UBLA 3TIXB 1DTEA 4F3KA 3K0FB 3LOPA 3O94A 4J9UE 1RRPA 4O5AA 3TAHA 5A2GA 1PHRA 5H70A 2YIDA 2Q4EA 4I9HA 1GVHA 2C83A 4R3UC 1XDDA 3PX7A 3U4IA 2R6HA 3N3BC 5SZHB 1I2AA 1RRKA 1SHLA 4XYMA 4U7DA 2YV1A 2EARA 3RR2A 2ACEA 1EFDN 1Q1BA 4Q9JA 3DLBA 1G59A 2ZETA 4C7XA 1K08A 1HZZA 1WTAA 2C0CA 2EERA 5BNIA 3D3EA 3ORHA 4AN1A 2Q4OA 3KT3A 2V7XA 3C4VA 3QBVA 1FDTA 2GRUA 2OYSA 1V3VA 3L4BC 4DAOA 4B09A 4D0LB 3KNZA 4FI3C 3O91A 4D0GA 3KELA 3D6NB 2PKCA 1V47A 1M72A 3FCAA 4OYHA 2QN9A 4RMIA 4P7KA 3E84A 3EFHA 1KI9A 3OTWA 4F9EA 3OZXA 4TTSA 1FFCA 3A1SA 2G3YA 1YIOA 1M1UA 4II3A 1GZHB 5FTNA 4AUMA 4QPZA 3KLMX 2F7SA 3WGMA 3KQSA 3V4SA 1LF0A 2IEDA 2XYHA 2P2YA 2BM9A 4BX3A 1G5FA 2IF2A 2AZXA 1Q17A 1KEPA 3I6MA 3L05A 4H1HA 1J7JA 4H16A 4LOLA 3HYRA 1MABB 4BQNA 2JVKA 1ENPA 3K05A 2EX1A 2JD0A 3L7DA 2XCIA 5FPYA 2C9OA 1KQFA 1C1DB 2BY4A 1RJ9A 1MW9X 2C57A 3NMUF 2ERYA 4JK3A 2WNSA 4ICIA 1BX0A 3ZLUA 3AR3A 3PE4A 3R7WB 1X13A 4US0R 3OG9A 3SJUA 4RFSA 3VPCA 5ICEA 2ZSKA 4LJYA 1VZ3A 3WYFA 3OESA 1O58A 2OKGA 3LS2A 1K7CA 3QLTA 1EFLA 4XGIA 5E7IA 5K51A 1POXA 3OIWA 1TC1A 2R7MA 2BFFB 3SC6A 4E11A 4EKEA 4Z6KA 4JUDX 5J2TA 1ZHOA 3LHKA 2UUAB 2ARKA 2BOVA 2GPJA 2XLCA 3HYLA 1P1IA 2EKDA 4CKEB 3Q3VA 4ZCSA 4BFSA 4P81A 1R4NB 1DXOA 1NJSA 4E5NA 3NAGA 5CXSA 3KV1A 1MUUA 1JW9B 5HS6A 1WZEA 5TARA 1T9AA 1O0CA 3FNIA 2BMWA 1DTSA 3FRHA 3GLQA 4YONB 3G9UA 4UXJA 4E0BA 3WL3A 3B6JA 4CG3A 4F85A 1THTA 3TCNA 3OHMA 1EB8A 2C9CA 5E3HA 4DMUB 2J6IA 4JI3B 2IU6A 5DYNA 3OMXA 3FPJA 4ZIRB 1PEYA 3G9ZA 5EUBA 1W6RA 1ZD3A 3BHIA 4LWZA 2IHJA 4P36A 3VR5D 2I71A 3K1AB 1CRWG 1CUVA 1R0ZA 3PQ7A 5EKDA 3S70A 3DBLA 2NACA 3CZPA 5TB5A 5L9AA 2VCYA 4H7IA 3LHDA 4LOJA 3SBEA 3IXLA 3IQGX 3B3GA 5KDLA 2VLBA 3N75A 1KBQA 5LFAA 2BAGA 2NSLA 3HFRA 3NNNA 2NU6A 1TTQB 2BKXA 1H6DA 2AG8A 5CUQA 5KYVA 2YCLA 3JQ9A 3OU6A 1OX6A 3DDHA 2B1RA 1NC3A 4O1HA 1L1QA 3CF4A 2CKMA 2EP5A 3CU5A 4M46A 3PNBA 2VSQA 3DAHA 5K20A 1GJRA 1FUKA 1Q0PA 2GDZA 4K9RA 1P2BA 4C7OA 1QVWA 3PEUA 4O4LF 2O23A 1RYNA 3GJ0A 3FCXA 4TV9A 3TTYA 3UMVA 3URMA 3FETA 2QRKA 2CJFA 3SC3A 3AHGA 2B30A 4DWOA 3IAUA 2CHFA 1MT0A 1RWWA 1CDZA 3W05A 3CNOA 3JS5A 3R9XB 4K9MA 3EN0A 3ZNOA 5K1ZA 1PT8A 1SA0B 3LY7A 2IX3A 4PSDA 1FX0A 4B4WA 1O96A 1UP6A 1NPDA 3OWXA 1TZJA 4IHQA 3H9CA 1CY0A 4PPFA 1G21A 4MEBA 2H51A 3KUDA 3R40A 4MEJA 5JNSA 3IEIA 1DBRA 3T7CA 3L93A 4GC9A 3DLAA 4M8KA 5CHYA 3WIEA 3OLQA 4WWHA 5F51A 4BO7A 1KPIA 2ZT7A 2WU0A 4PPQA 3RG8A 1SZCA 1L4UA 5G40A 5FTKA 4MQUA 1I2MA 3S99A 2JIDA 4QEZA 4JOSA 1FRNA 4JENA 4YP6A 2X2EA 2I3GA 4ARZB 1NY5A 3ZOKA 4PCLA 1YB7A 1IB6A 3CKYA 3C14C 2VG8A 4NP6A 2RB4A 1FS4A 1QPGA 2YXDA 3HV2A 4WZZA 5HE8A 3SHOA 4HPXB 5JZOA 2ZTVA 1JRLA 4BEBA 4O4IB 4WJLA 3LWZA 3UBTA 4ZVUA 1IBLB 1I4DD 1QTIA 2O19A 3W2TA 1HNWB 1QGED 2GPYA 1VJGA 4LNHA 3SOZA 1QUFA 5CJPA 1T4DA 1Y3FE 2LWIA 3CR7A 3L6OO 2B2XA 4Q3NA 3QE9Y 3R3XA 2EEPA 2ETVA 4P2GA 3AW9A 4KQXA 1J07A 3AWDA 2N3ZA 4MQ6A 7REQB 2FWBA 1YDMA 3EOAI 1PGQA 1NN1A 2FUKA 1G21E 1DAIA 3MOIA 4WMLA 2M6KA 1OXUA 4RVNA 3TMYA 2W6CX 3ESQA 3I64A 3CB4A 4NG5A 4UMFA 5E8RA 1NMSA 3DBOB 5AOCA 1RTTA 3C8UA 3LPAA 4DNPA 1VYVA 3HB9A 2PVCA 1E0JA 1HSOA 3AR8A 3PDJA 5J4VA 4X5OA 4RZIA 1KJNA 3T1NA 2UV8A 5K8VA 4DIDA 4RH1A 5JCZA 2QLNA 4CTNA 2Q6TA 4HYEA 4Q93A 4C76A 3NTOA 4JNKA 3B6ZA 2A84A 4LECA 1PK9A 2GHRA 5K6AC 3E9DA 1YRHA 4Y9RA 5KYNA 2V65A 4PYQA 3IPCA 4YC7A 3DFZA 4C30A 4XOIA 1HG1A 4X7MA 3T7JA 5AK4A 5K0LA 1R0LA 2H2FA 3QE0A 3WB1A 3KKPA 4YMVA 4CBVA 4MWEA 1IK6A 3IAHA 1WVMA 1CUXA 4DA6A 5DT2A 1BXRB 4C5BA 1ODJA 4F04A 3QVGB 2X5JO 1X7WB 1PBTA 2AN1A 2IHVA 1XN1A 4DR1B 1DOHA 4D6XA 1AC5A 1KYTA 3U3MA 3OD1A 3VAYA 3C0KA 3JQCA 2HPVA 3UJDA 1FTQA 3DF7A 3GROA 4QJ3A 2XGMA 3NI2A 3QKRA 3OTOB 4RD4A 1J20A 1FEZA 4RL6A 2AOTA 2D1FA 3CSUA 3O38A 3TTXA 1JE1A 1MRNA 3ZI4A 2G88A 1JNXX 1TAQA 1QLJA 4BC0A 2C4VA 2Z0MA 1G3MA 5IDWA 4FFBB 4F2GA 5DFAA 3DBRB 5MFZA 3IHLA 3ZU4A 2OO7A 3K09A 1IG0A 2AKYA 2VL7A 2CJPA 4FCVA 1SQFA 3MGBA 2VJBA 4GM4A 4KLZA 3B48A 3OEHD 3AEXA 2WTBA 4F5EA 3CX7A 2JJYA 1BHO1 4QYIB 1QP4A 2DY0A 3G0OA 4JGIA 2HSWA 1AK1A 3RTCA 2PNFA 5CM9C 2COKA 1C9DB 3R4CA 3OLCX 2Z09A 5AVKA 1SULA 2MOKA 1KRHA 2MYPA 2NU7A 1K7YA 5DI3A 1FS6A 1MU0A 5KNDD 4HFRA 3T99A 5ADHA 4GMXA 1Z6YA 1HLFA 1H4VB 3RBAA 4G9EA 2ZIVB 4GX0A 4HDSB 1EVLA 5A5VA 4CMKA 3D7LA 1R1DA 2QEQA 2IU3A 1D1SA 2REQB 2R8OA 5KJFA 5KYWA 1F7UA 4KR2A 1GAQA 4B74A 1UK9A 2PGLA 4MRSA 1XNJA 3E3LA 4OHKA 3O7WA 4RA6A 4LDNA 4G89A 1FDUA 1Z33A 2Q6VA 4GLBA 4XWKA 1GSAA 1TCVA 1BTOA 1JKXA 1GYQA 3AF3A 4O1IA 2FSIA 4NXNB 1P2DA 4DEVA 4UOQA 3U26A 2R9VA 3DYBA 4JBXA 4D80A 2PUAA 1CQXA 1QLWA 3O8OB 2VK8A 4ZTZB 3RRJA 2OCDA 3FMPB 2K5UA 1PR2A 2CYAA 2W7TA 1HZJA 3L6UA 1E69A 1EAMA 4S2UA 3IB6A 1GAWA 4PVCA 3TW8B 2WFMA 3ULKA 1NWHA 2WZQA 1Z6QA 3EBPA 1AUQA 3P5BA 1ODLA 1E3WB 3F47A 5F3RA 4KIUA 4EWLA 4LF4B 1P5HA 4IF4A 4B45A 4QUIA 1L9XA 1W581 3IR5A 4DLBA 4EHFA 1TM7E 5TS2A 3AONB 4TV8F 3MWDB 3TG2A 1U9IC 2GYUA 1QMGA 3KXDA 3U7EB 1F7VA 4XI9A 4UHFA 1FXWF 3L5OA 1Z0KA 2DH6A 4UBJA 3UH0A 1XNQB 2CFTA 2VJYA 5FV4A 1U8FO 1T8WA 1Z37A 3UC5A 2XB2A 1Y1KE 3WA6A 1QFJA 5BUCA 3F3YA 1GILA 3MB8A 3OLYA 3ZVNA 4NYIQ 5DX8A 3PFBA 4ALMA 3RRZA 1XTPA 3I9KA 4KZPA 4MWDA 3M1YA 3FJOA 1VBMA 2H4HA 3UJ3X 2I91A 5ARDA 4CKWA 1U04A 2A2ZA 4MUHA 4NJEB 4X95A 3RHSA 1IHDA 3T5PA 5CXXA 2PXAA 4PHGA 5JASA 4C1BA 5K6RA 2XLBA 1P7VA 3E1GA 4MV3A 1E9DA 1EAYA 3MJCA 4R40A 1J23A 1R37A 1H4TA 1OHHA 2R8PA 3WL6A 1CUBA 3G2MA 2YOHA 1DI0A 1XTBA 1FRZA 4JVNA 4KAFA 4HDAA 4PIMA 5JFGA 3VU0A 3HBMA 1Y5NA 1X19A 4KXLA 4ZZ1A 1G8MA 4Q05A 3SF8A 4BP1A 1UH5A 3DOCA 3OCJA 2Q3BA 4GPIB 4JX8A 2ABWA 1U9YA 1NKTA 2GEJA 5THQA 5D6NA 3FIJA 1URPA 3LFHA 3CEAA 1G18A 4LVOA 1RLOA 4O1MA 5ERXA 4ZCRA 5B64A 1A76A 2GNPA 3DEAA 2VCHA 4U9IS 5ELMA 4BKRA 2GJSA 2NZ8A 1H93A 2G07A 2TYSB 4TTAA 4U5QA 1G20A 1RYYA 4WESA 4Q9KA 1L4LA 3G8YA 4IIFA 4RADA 3WSVA 1E5TA 1T4BA 3TQHA 5EE9A 4DXDA 2P9BA 1M74A 1QYRA 5ESDA 1PZMA 2PSDA 4TMZA 1Z3IX 3FAKA 2EBWA 3MJHA 4KSBA 3H9BA 4NBWA 2O50A 4N7RA 3MAAC 4ZJUA 3U3XA 3C8DA 1VMDA 2AK2A 1EGVB 2PBFA 3PXAA 4LMAA 2GYYA 4MJ3A 1XMSA 5EC8A 4ZAWA 5TGDA 4C7JA 4D6YA 3C4JA 5DNUA 1I9CA 2FCAA 5AKKA 4AF6A 3AVWA 3GLRA 4MJXA 4XWOA 4G37A 3JZMA 1KZ1A 1JDTA 5FYDA 1YACA 3DVLA 3A27A 3KHTA 5G4LA 4DQLA 3DKIA 4TS1A 1YI1A 4TYPA 5EXPA 3TYXA 1X1BA 4OFZA 1CZKA 2JBAB 4F45A 1XZFA 5A5DA 4NC9A 4PSUA 2HV8A 4HH3C 4XLLA 4KX3A 1IY2A 2XRFA 3IDAA 1DRJA 3LPLA 5K3FA 4B6OA 3GA0A 4OQYA 1OY1A 2O7VA 2WFLB 1YVDA 2WSBA 3MCAA 3AJEA 4K05A 3DE6X 1G20E 4NE7A 5JH7F 2BMFA 3NO4A 4X00A 2OYRA 4ZV7A 3RGGA 2GKGA 3RSLA 2BZSA 1Z8FA 2QX8A 3A6LA 2P5TB 5HZGA 2CUNA 3H5WA 1GCIA 3UQYS 4BQOA 1MD9A 4WK6A 1RHUA 4ZK2A 3WP0A 1RADA 4CLOA 3U4QB 1T9BA 2PX6A 4O33A 1FU7A 3FLMA 3BMQB 3KE8A 3LUCA 1ORHA 3R0ZA 4W7IA 5IUJC 2WIAA 5EZ5A 5C8YB 4M87A 3ZY5A 1DBWA 4X85A 3JU3A 2BBTA 3MYRA 4YH1A 3T1VA 2P6MA 4WLOA 4MI9A 2PKXA 1QVZA 5FULA 2UUBB 3FGNA 4RS4A 3C4QA 3LNTA 4I81A 4LWQA 3TLEA 1SKMA 5TEWA 3VC2A 4EF6A 3IVXA 3OE7D 1ZK3A 1KY4A 4I3GA 5DSZA 3UUFA 4HAWA 4D9JA 1ZMOA 3PU6A 3TJZA 1VHQA 4X20A 1NR5A 3VPXA 2WM8A 2H0AA 2YJ3A 4PG6A 3ZQ4A 3BE5A 2JHCA 3EUWA 3G0BA 3OO0A 5JNRA 2H4FA 4HGRA 1MEJA 4WAUA 2J33A 3H5OA 3ND7A 1WEKA 1EK5A 2ZE5A 5HF8A 4DTIA 4E6EA 1Y7TA 5IYZF 2PK3A 2ECPA 3NR2A 1JDBB 4RTMA 4XR9A 1XO1A 1L5OA 4FHZA 1VPEA 1GQ2A 3VR4A 1L6IA 4BV3A 3SMQA 4GLFA 2D1SA 3IP8A 7MHTA 4XB1A 3VSEA 4P4LA 1JECA 3V7YA 2VATA 2QR3A 3DUFB 4YCLA 4LV8B 1BXKA 1LNQA 3ELBA 2XE8A 3R1IA 2B3TA 2PQ0A 4L1KA 3X2EA 2GASA 1E5VA 3M1AA 2YN0A 4U39A 3L01A 1HH4A 1XRSB 2NXWA 3OQHA 4TPKA 3WC4A 1Z2NX 3BVPA 2PHZA 2K2QB 5CT5A 3HCNA 4GPEA 4RV4A 2ZQYA 1JYSA 3PNVA 2DE0X 2ZWPA 3H5TA 2QW8A 1Z2CA 3IOCA 3NBMA 3OJ0A 2IELA 4MWCA 4CCYB 1I2ZA 1V8DA 4N3CA 4G1EB 1ICEA 4LDPA 4CV1A 3LU1A 2BFCB 4G0NA 1T8YA 2FP4B 3OPYA 3HY3A 3TNDA 1XZKA 3ZC3A 4F7WA 4UTZA 3NWOA 5B30A 5I8WA 3QX9A 4PFQA 1WPRA 1RLTA 4XWYA 4CKZA 3ZW7A 4ZOQI 1XZJA 3QVSA 2GX6A 1HXHA 1SVLA 5CTAA 4YRJA 2KWIA 4LMPA 4AB1A 1WXIA 3CJRA 3V9AA 3ZYZA 2CXTA 1Y4SA 1HK7A 5K09A 5L45A 2OZVA 1KEZA 4TX1A 3DL4A 4LE2A 3WBJA 2V6MA 3LX5A 2DULA 3L1HA 1N0WA 4C1NA 1F5SA 1T15A 2HPHA 3KR1A 4A1OA 4C0SA 1ONOA 4BMOB 5KC9A 2Z95A 3P4YA 3DXFA 1L3IA 4PYLA 1P5ZB 1XVUA 2B1JA 1MC8A 2JFXA 3KLPX 4JT4A 4MCAA 3UHOA 4LC9A 5IF9A 3L77A 3IUQA 4DBLE 3EZFA 3C8MA 3GJXC 3ZZ0A 3R3SA 4FZ5A 1Z4MA 5JARA 3FVWA 3PHBE 2YTZA 3R7AA 4EEXA 1Y9JA 3GNLA 1ZVMA 2NUTB 2HIGA 4R2JA 1C9EA 2C2GA 4MVJD 4M36A 4LXIA 1XV5A 2XT6A 3Q8KA 5IJAA 1L5QA 4WJKB 1EK1A 4R81A 3NGXA 3AI2A 1Z12A 1U8YA 1FYWA 4FJ1A 2NYUA 4OL9A 3LWDA 2LTAA 1YS9A 1U2SA 2WAAA 1I6LA 3EIUA 3K96A 1QOPB 3G0GA 3NUZA 3LDAA 1VZ2A 2JGMA 2WSMA 5HWSA 2O1WA 4K88A 1XKTA 2F9MA 4RSMA 5D01A 2R66A 2EWMA 3AUXA 1IN1A 1Q92A 1WXGA 3DTNA 3B5JA 1RM0A 3HBAA 3N6XA 1TW2A 1YV9A 3KZNA 4OHBA 4MB6A 5KQLA 2VDQB 4D99A 3QXXA 3WQQA 4CR6A 4LVCA 1V2HE 1A4RA 2B4AA 4N82A 3R5FA 4MRAA 4OF4A 1M1YB 3RIHA 3MCWA 1DC3A 1P91A 1UF9A 1JAYA 1ZH8A 3OOHA 1B0ZA 4U2FA 4WIAA 3LYUA 3O3MB 4DY4A 3CF0A 3BSWA 3PR2B 5TMPA 1TVKA 5TF0A 4X1YA 5C35A 4AWXA 3G2OA 1OT3A 4EVQA 1KIAA 2VP2A 2YC4C 4A82A 2Q1UA 4M7PA 3SFTA 3F8SA 3LGXA 4B6SA 2W42A 1H5NA 4UAUA 2ZJOA 1UANA 4K40A 3W3ZB 4NAVA 5CBPA 5L4NA 2IHNA 4XH9B 5L8VA 1U0RA 2WIBA 1V8PA 2PS0A 5LZ8A 4UOEA 1DT5A 4V2UA 3G9QA 4WXYB 3V4OA 4BFXA 3FNFA 5B3JC 4RDCA 1W5EA 3T3GA 2WUVA 3GBSA 1IM8A 4MA5A 3EQZA 2BEWB 2X8JA 2FSPA 4FW9A 4KDCA 1CRZA 2P9GA 4LHYA 1BC5A 2QL7A 1DIAA 1TYBE 3W9YA 3EPHA 1XZ8A 2YCBA 2WV9A 3BFPA 3ITKA 3WZLA 1ZGGA 3N5CA 5ALPA 2LNDA 3ZDAA 1GN8A 4IDCA 2BFBB 1CZOA 3PLNA 4MRVA 1YHZA 1RLMA 1UWKA 3CX6A 1U9IA 1LSUA 3KYCA 1IJBA 4I66A 3MMZA 2L82A 1LB1B 2PO7A 3RC1A 3TRKA 4CE6A 2I22A 4X3OA 4GL4A 1RKQA 1ND5A 2XMDA 4LHVA 1HFJA 1SKAA 3HPQA 4ZU1X 3SLKA 3SYKA 4F0JA 4WXMA 5AM3A 4LX0A 3PK0A 4QBTA 2XUIA 1ZA2A 3MIIA 2GLXA 3BEOA 3QNMA 5EESA 4EKIA 1H2HA 1L4HA 4TOIA 3P32A 1OXXK 5REQA 2YYZA 3CYFA 4P31A 2C4HA 4LFCB 3D4LA 3KKLA 1X3LA 1CQIA 4FGKA 4JFRA 1F60A 3PGA1 4QPPA 1X7DA 2DTXA 3N2KA 3RAEC 3F0TA 1U8AA 4ALJA 4YRFA 2WTMA 1CS4C 4INPA 1YQXA 1ZCFA 1JFRA 1OVGA 1L5ZA 1SKYE 2HF7A 1NOKA 2ZAYA 1C1XB 3CPJB 3Q3EA 1L9KA 2YS7A 5TRTA 4UDXX 4C08A 2J1LA 4MCHA 1CHNA 4N65A 1MJGA 4TLDA 3TOCA 3V32A 4BMYA 3OOYA 3JPWA 3P8ZA 4HEA6 4IKEA 2G04A 1Y37A 2OLEA 2QPAA 2WJYA 3W6UA 5F7OA 2ORIA 3H87A 4DDKA 4RD6A 5B7NA 2EU8A 2XGSA 4MYSA 3U17A 1N5LA 1SOAA 1VG0B 2JI8A 1EFPA 3SAJA 5COQA 4LK3A 2DWCA 5K0SA 2Z8YM 1WCYA 2BI8A 5C5CA 2W11A 1WS6A 1JH8A 1JPJA 4IKOA 1AZTA 2QM8A 1DOZA 4GMKA 3VV2A 1ES9A 2AQ8A 1EWYA 3PR3A 4K3UA 2AOUA 4QUHA 2IXFA 5BOSA 1RP1A 5DCUA 1MQ9A 4JOBA 1T25A 3C7CB 2YZNA 4G8DA 4NYJR 4PNEA 2POQX 4II2A 1GG2A 3A14A 2A59A 3HDYA 5LYYA 3Q8XB 5AW0A 3CGGA 3DP9A 1PL6A 3ZLVA 1PE0A 2J3IA 2Y1GA 3RVBA 3GDFA 1H5UA 4OI0A 4C07A 2X1VA 1BDJA 3RYFA 3UATA 2PPLA 3WXMA 2E85A 3ESXA 2E2WA 3I1IA 3KOYA 5KMGB 2CZGA 2PZMA 4AF8A 3HACA 4KRGA 4PZYA 2RH9B 1GFZA 1LQ2A 3KYDB 4HDRB 3ZKWB 1P0PA 2F48A 4NPAA 4RVCA 3WLOA 1VB3A 1H85A 3EIQA 3KQUA 2AEMA 3CFYA 5TQVA 5C37A 1FFSA 1TE2A 3DFFA 2A3NA 1T2AA 5I4CA 2CNOA 2P75A 5T67A 4P0PB 4KWCA 4R8SA 4DCCA 1E2LA 2FRDA 3AM3A 5J63A 2EQBA 1TJPB 2HMVA 4BMDA 2QXTA 3GRRA 1SPBS 1EHIA 2HFKA 4M4SA 1YBMA 4ER5A 1J33A 1Z16A 3C45A 5IAEA 5GY7A 4PS1A 5JHHB 2VTEA 4MRRA 5FA8A 3GEDA 3G59A 2IFTA 3HVRA 2FFJA 4H35A 4X6YA 2ENUA 2W6ZA 4BNFA 4CDRA 1MX9A 2C2YA 5F5LA 1OTHA 1AQJA 3ZVKA 1PQPA 2FWAA 2VPIA 2VT7A 5CK4A 4J0IA 1A8HA 1M7BA 1D2EA 4RVFA 4BO5A 4F4CA 4R54A 1Q44A 2Y6VA 3FDXA 3BFJA 3HA3A 4TS3A 3U60B 2VHYA 3TD6A 3KZXA 1YQTA 3DE0X 2B25A 1SC3A 1SFRA 3MWEB 2ZB4A 1FP6A 4IMIB 4PNZA 3R7LA 5HQTA 2A1IA 4IQFA 2CVHA 3VHXB 1E9EA 3FSRA 2PL5A 3ZS9A 1QB8A 3QITA 4B87A 1G17A 3JR3A 1Z6TA 3F6RA 3DMRA 4TXMA 5J5VA 3ZDEA 4XIIA 3I0ZA 5DHQA 1D2MA 2RI6A 5H3HA 2VYNA 1J0BA 4G1VA 2NU9A 5TX7A 1VHDA 1MC4A 4J0EA 4IDEA 3FGPA 4AFNA 2WVHA 2COUA 3PQ2A 4M7RA 4COOA 8GPBA 1AQNA 5D84A 2BSQA 4XKJA 1ATIA 3NFYA 4U4AA 1OYWA 2W2KB 3AV0B 3RQSA 2Q4DA 2YHUA 4WDQA 3VDNB 5JSUA 2ZS9A 5C1OA 5HMLA 1ADYA 1P4AA 1JLMA 1X80A 5FPSA 1BEUB 1MMFB 1ZOOA 4OBXA 4OJQA 1NBIA 3PKIA 5CJJA 4ZGGA 3LBFA 3FTCA 4GP9A 5HYVA 5T8KC 4LZAA 1PS0A 2P9CA 3A1EA 4ZEVA 4Y6SA 1SXQA 4G8BA 1T2EA 1J39A 4L15A 4L7QA 4LRYA 1HC7A 3H2BA 4Q03A 3SYLA 2C42A 4NDNE 5E1BA 2WR8A 3A0RB 2ZYGA 3ZHUA 1XCOA 5I9NA 1V11A 5CDYA 3L8MA 3RWMB 1JSCA 1X8KA 2WICA 5ENZA 1EVYA 2AMFA 3HYTA 1NPTO 4HAIA 3LDUA 5KOYA 3LYHA 3G49A 4WADA 5EKXA 4ZALA 5FBHA 3R7SA 3W90A 5LLSA 1VIYA 4KIJA 5EGSA 5EJ5A 4KE9A 1XTZA 4TTRA 3OJXA 3WYBA 1W9MA 3A6JA 4N0PA 4PCVA 1P2GA 5ADWA 4ARCA 1RZUA 3C8HA 1FP7A 3CM0A 4HLUA 4Q1VA 2QTHA 4LSZA 5TVKA 3UCEA 3ZWVA 4BWFB 2FR1A 3HCPA 1OI4A 3CTMA 4URFA 1RI4A 2O0MA 4BMZA 1W47A 1EUDB 3H1PA 3H9UA 2B9VA 4HNAA 4UDYX 5BP7A 4GUAA 4O2RA 2QLJA 2PWBA 3C7DB 3FFAA 4GVPA 1RWNA 1FFDA 2G25A 3DF9A 2OBNA 5ALNA 4Y9DA 3N28A 1Y7HA 5D86A 1LK5A 1Z4JA 5CA1F 1NV8A 3P2EA 1GQFA 2PUEA 1TECE 2OCAA 4M7OA 3RYIA 4WGGA 1A8IA 1ADGA 1AHNA 2YVKA 3BMCB 1CFJA 1XCJA 1C0EA 2C2XA 2P1RA 4M9XA 1J9ZA