4LDJA

Crystal structure of a gdp-bound g12c oncogenic mutant of human gtpase kras
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 62
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ldjA00
5JI2E 2XTMA 2PT5A 1UADA 2WMNB 3KB1A 1HE8B 4G3XA 3U7FB 1K5GA 3E2IA 3ZLJA 2OBLA 4NBSA 2Q21A 2JJ8A 3Q9LA 4GI7A 5GJWC 4II7A 3IGFA 1J90A 1R0ZA 1ZD9A 2C78A 4FMDF 3SBEA 2R6DA 1Y63A 4O0MA 5KDDA 2H92A 1YZQA 3EARA 1KZGB 2P2LA 3MGCA 2P5TB 4JL5A 4TWZA 3WYAA 4DIEA 2JLYA 1X8KA 5HTKA 1XPOA 2ZQ5A 2JJ2D 3QF7A 1G21E 2RGNC 3B9QA 4E22A 4DCVA 1ZC4A 2QUZA 1GAJA 2XNDD 5FOUA 4LC1A 4XH9B 1XEXA 5CM9C 2ZYVX 1JBKA 2F9LA 2Q3HA 2CCKA 2EVWX 1YR9A 5IT5A 4AYWA 3LVRE 4QG7A 2FEMA 1M34E 4OI2A 3NBYC 2ZUCA 4IFEA 2WWXA 3LA6A 3T1VA 1M6NA 3QENA 2YWEA 2FU5C 3RRYA 3X1WA 2ONJA 3KTAB 1MT0A 3GEEA 2FF7A 5KU1A 4OHWA 1NMZA 1GKUB 3KJIA 2ZVQX 2ORWA 3KL4A 4C4PA 2HLDA 1XPUA 4ERNA 5LD2C 3K9NA 2YINC 1DAHA 1NIJA 1SKYE 3RAPR 2GBLC 3NHBA 3QBTA 1IN4A 4AYXA 5B58C 3OAAD 3EC2A 4TLAA 2IA5A 1NVUQ 4LV8B 4CIDA 2O8EA 1IN7A 1Z6AA 4BZXA 5JFGA 3M4YA 4Q1FA 4UNPA 1SVSA 2A78A 2BJWA 3OE7A 1WXQA 1XJ0A 2J59A 5P21A 3MD0A 4OI1A 4JLAA 3S1AA 1II0A 2GAOA 3SQWA 2F43B 3SFVA 3ADCA 3AVWA 4MITA 2PBRA 1OYYA 1DVRA 2NMVA 1FOEB 2GRJA 5B2ZA 2VTKA 3CRMA 3K09A 5EZ5A 3WYGA 2EW1A 4KITB 1X3SA 3EZFA 4CEHB 3W5IA 4NYIR 2CLDX 3EZ6A 2CL0X 1J2JA 4LHZA 1GRRA 1G5TA 2DPXA 4TLCA 4XWOA 3DZDA 1P2TA 2ZSAA 3I1FA 4IDHA 4RD3A 3WRXC 4DCUA 2YHSA 2ATXA 4L8GA 2A5DA 4QXAA 2GKSA 3W6PA 3FGNA 5DN6A 1G8HA 2ZRAA 4BFXA 1ZMXA 821PA 2Z5FA 4RCZA 5FR1A 5CB6A 2O8CA 2D06A 2OV2A 1J8YF 3SI7A 3MSXA 3DMDA 4A82A 3KQHA 2FGJA 1DS6A 3B2EA 2IS6A 1AKYA 2C9OA 2WIAA 1GRNA 3X2SA 5IRCD 1Z22A 1N25A 4WXRA 4LZZA 4PHGA 4M2LA 1SVIA 1PLLA 2XSZA 4H9GA 5JBQA 1QHHA 5CYOA 3PUYA 2V4ZA 5DI3A 4B3XA 5HZHA 2BMJA 4G1UC 1JPNA 1NVWQ 1II8B 1ZUIA 2GCOA 4P4SA 4AURA 2IBMA 3K0FB 2HF8A 2FFHA 3B9PA 4JMPA 2AXPA 2FSIA 1F2TB 5C4GB 4A6PA 5K8UA 3VAAA 4RD6A 1XTIA 2QEQA 3K9LA 1XJCA 2ZEJA 1VYTA 1PLJA 4LJYA 2O8FA 1FL9A 2ASEA 1W44A 2GJ9A 3AUYA 1R8SA 2D3WA 4IXNA 3RRMA 3ZVLA 2QA5A 1JAHA 4JSTA 2EFDB 4W5WA 2QBYB 4UNQA 3ZD6A 1PLKA 3OF5A 2WV9A 4M1TA 3SQXA 2OCAA 4D6PA 2V9PA 5KTYA 2J7PA 3FB4A 2J9RA 3ZH9B 1E9EA 1RPZA 1HYQA 1US8B 4HAXA 1XZPA 2FSHA 4ABYA 5JZVA 1IM2A 1NN0A 1BS1A 5FOWA 4Z1MA 5JRZA 3U6KA 3CRVA 2N46A 3VKWA 1L8QA 1UDWA 3FHTA 1HEIA 2F6RA 3CX8A 5TXGA 2QRNA 5SZKB 1E2NA 1GILA 3VR4A 1UKVY 1P75A 3AKYA 1N6KA 3AF2A 2BJVA 2NG1A 1CR1A 1F5NA 5JMTA 4C0AC 3FOZA 3MMPA 3TBKA 4LX0A 1JR3E 4NH0A 4PAQA 3UK6A 4CEJA 4PSKA 2R6FA 5SZIA 3VU9B 3OZXA 5A0FA 1ZJ6A 3MAAC 3FVQA 4LBVA 4I4LA 4MYUA 4ZCLA 2WSSA 1P4SA 4OHZA 3TNFA 4HB3A 3JVUA 3THYA 4X8OA 2IHYA 1GNPA 3AGPA 2IYLD 2VH5R 3AEZA 4BFVA 1SZPA 3LBNA 4MGYR 4M9QA 1Z08A 4TSFD 2OZEA 2QP9X 2FOLA 3OIUA 2ZAOA 2JA1A 3MUFA 4ASUD 2W00A 4LRWA 4TLEA 2NO6A 4US1R 2ZRJA 2ZXUA 3OEHA 5F9FA 4PO9A 1XBTA 4IW3B 2X1VA 2NTYC 1UKYA 2GJAA 5DI3B 1G4AE 4C2UA 1I2MA 4L15A 4POAA 4JLJA 3WHLA 4ACAA 2FX3A 2QQEA 2J45A 2XB4A 3IEVA 3RC3A 1IJFA 1W0JD 5FUYA 1UEJA 2NQ2C 2X2FA 4LV6A 4NZYA 3U3RA 5HE9A 1QVRA 2P0EA 1ZNXA 2VP5A 1KK1A 1EFHA 1KY3A 5FL7D 3HPRA 1KNQA 1JB1A 3GJ7A 3CRQA 5DNYB 5F9HA 3GLGB 2FPKA 2MSDB 1JNYA 4FWIB 2G0NA 6Q21A 3WBKA 1KJWA 3WY9A 5GADl 4O3MA 1KDTA 5ANRB 2IWRA 2W2VA 4C9BA 4KBFA 5L3SA 2GCPA 1O3YA 3LXRA 4LYFA 4TSFA 3U5ZB 5EE3A 1ZM7A 4EJSA 3QG1A 5KNCA 4DC9A 3FKSA 1AGRA 3SE0A 3RWOA 2CE7A 1UAAA 3IBYA 421PA 4EPVA 3RANA 2H8KA 1OIXA 1VKJA 4C2TA 3BXZA 5G41A 1A7JA 3BRWD 1X1SA 2A5GA 2D2EA 3TH5A 1JR3A 5TARA 2PX0A 1D2MA 3CZQA 3U3OA 4O2LA 1F60A 1G3QA 2IX3A 3K09C 4TQ9A 1RFLA 5JI3E 2ZRBA 1KI6B 1KO7A 1QVAA 1E2LA 2GK6A 1ZCBA 3GLIB 2LWIA 3TJZA 1W0KA 3NBXX 3HU2A 4Q47A 1E32A 4P4TA 3ZDQA 4MKHA 4K46A 4WZBE 1H65A 3U7HB 3WMEA 4OJKA 5JJLA 4BZQA 4PC6A 1M74A 2JJ1A 1L2TA 3GJ0A 3PUXA 1BYIA 3IEUA 4FW9A 1WBDA 2CDNA 3TW4A 2AHOA 4ZI2A 1DAIA 2ZPTX 1QHSA 4TMXA 1S3SA 1T8UA 3WHKA 5EQTA 3IQWA 3AVUA 1PV4A 4FIDA 1T6NA 2KI5A 3BB3A 4NCKA 1VG1A 4YXWA 2CLSA 4I1VA 1HTWA 4BRUA 1GP2A 1Q22A 2QTHA 4W9MC 3AQ4A 3L8YA 1OHHA 5LDDC 1Z0JA 5GVRA 4XVRA 4FCTA 1P9WA 5FTNA 1FQJA 2QTVB 5LBIA 5H70A 4WZAE 4F38A 1ZCAA 4U00A 2KBFA 4BLTA 3RS0A 3AVTA 2GESA 3O8DA 4UNRA 2OM2A 2RMKA 3W6OA 3KTAA 3BWDD 4US0R 2ZRKA 2IYUA 4NYIQ 4QNMA 4LDJA 4B48A 2WPDA 5IF9A 2WWYA 3R9WA 5AUQA 2RHDA 3ADKA 4EPRA 2QGNA 1T3SA 1T8TA 1OF1A 2A9KA 2GVDC 2RB4A 3REFA 4IOKA 1Y3AA 5GJBA 3Q72A 2IYYA 2QAJA 3PFIA 4Q02A 1ZW6A 1TQDA 4YQFA 4V02A 1XMSA 4JL8A 4ZV4A 2WWWA 2MMGA 1NNEA 2E87A 2V55B 3GFOA 1S96A 3KZ1E 2VIIA 3WNDA 2YC4C 4URZR 2ZM5A 5C18A 4B34A 2ZR7A 1Z6XA 2FSGA 1U81A 2ZRMA 2A5FA 1VTKA 4PAOA 2XB2A 2WSSD 5JCPA 2EFHB 1WA5A 1G8PA 3KKPA 1E94E 1G3UA 2WWFA 1EFCA 1GRQA 1TMKA 2BM0A 1P72A 2GK7A 3FWYA 3HU1A 5FFMA 3VHLB 3B82A 2CVFA 4Q9JA 3KQUA 1N6IA 2GWHA 2C8VA 4WZ6A 5IK2D 2N1BA 2P67A 1WCV1 3OFND 3CIOA 5FL3A 1YR8A 4EIWA 3CPHA 3FMIA 1Q1ZA 3VHXA 1PJRA 1EXMA 1KI4A 2OXRA 2WJIA 5K8TA 5EXTA 1G19A 4LBZA 5FI1B 2O8CB 3GLFB 1NVVR 4EFNA 3MJRA 2OFWA 1XMIA 3SJCA 3W6NA 2A5JA 2PCLA 1G3IA 3DOEA 2PJZA 5HPYB 2FFQA 2IEZA 4MRNA 4QC2A 1BH2A 1CP2A 1E99A 4BE7B 1O87A 2WWGA 3QIAA 3GJXC 1RRPA 2HUPA 3I72A 4TLDA 1MABB 3A4LA 4LGMA 3GP8A 1WDTA 3LVQE 4M1MA 2IYRA 3AKCA 2RGAA 4TTRA 1ONBA 3EPJA 3SR0A 4GMXA 2QENA 2Q9CA 2ZUBA 2AKAB 2ANCA 3LLMA 1XMVA 4QM7A 3P1JA 3SZRA 2VL7A 1RRCA 3DZ8A 1OLOA 4PPQA 3SHFA 3CKLA 4D0GA 1F2UA 2BC9A 3N70A 1EX7A 4QOSA 1ZIOA 3KKMA 3PEVA 4P4UA 4RY2A 5DYIA 4B35A 3RS2A 2G1JA 2CNWA 2PZGA 4W7SA 1DE0A 1CJKC 4EJSC 4R71A 2RGEA 1U90A 3AUXA 1JJ7A 2J7PD 3W90A 4NYMQ 4V0ME 3W8RA 4QKQA 3TE6A 1VG0B 4CEJB 4PC7A 1NRJB 4OHVA 4HI0E 3Q7QA 3LAWA 3VU9A 5BYJA 4H1VA 4M1SA 1ZM9A 4N0EA 3IHWA 4RJLA 5CJ2A 2IYSA 3FPAA 2WICA 4IRUB 3MWJA 1QHYA 4WVFA 5AUPB 1E9RA 1Z83A 1Z0DA 3D7MA 5AWFC 4F93B 2CJWA 2O0KA 1YVDA 4M9ZA 4FN5A 4KYUA 3AP3A 5TVKA 3KQNA 4V03A 4IHQA 4DWJA 2WM9B 4AIIA 2REOA 4PTLA 3RVBA 2C9YA 4UKDA 4KODA 2CBZA 3DVLA 3VR3A 4MRVA 1FP7A 1JPJA 2PLRA 1LF5A 3RDPA 1XRJA 5GVSA 1SXJD 5AJYA 1N5IA 2BMFA 2KSQA 2ORIA 2GZHA 2W6IA 3NBZC 4A92A 3D31A 2O0HA 1OB2A 1NJGA 3GJ4A 2FWRA 1IAQA 1G8GA 2EFCB 3U6BA 1C1YA 3UMSA 5AR1A 1G3RA 2WWIA 4RCYA 4C0KA 2R6CA 1F48A 3GLGA 4AWXA 4ZO4A 2QMHA 5JS8A 3ICQB 3CNNA 3NEJA 4RD4A 3TAHA 2J0QA 5TV2A 2VP0A 3R7WB 5SZHB 1P62B 2ONKA 1AJEA 3B5JA 4KFRA 4ZIRB 5IK2A 3GLIE 4A0RA 1I2DA 2D4HA 1ZNZA 1UDXA 1YZUA 3NXSA 2OCYC 2YC2C 1F2UB 1P61B 5FBQB 1WP9A 5DGXA 2ZUDA 4OKSA 4TL8A 5HR5A 1X8JA 4AC9A 4HAWA 2GEUA 4Q5IA 5KSOA 3EX7C 1BYUA 3IDQA 3SYKA 1LB1B 2QM7A 3ADDA 1TEVA 3QPUA 4JSYA 1A82A 4A4DA 1W36B 4PPFA 4PHTA 3WP1B 2Q3MA 4IVPA 2HXYA 3F8TA 3P27A 3CPEA 5LB2A 4HLCA 2PJRA 4B74A 4YMUA 2ECKA 4IDOA 1NLYA 1KKMA 5JHHB 2Q0HA 4A8JC 3U61B 2J0UA 2CJWB 3I5YA 2ZRIA 2R8RA 4GNKA 3BK7A 2ZJ5A 1XB2A 4MUAA 1G7SA 4TN1A 1WQ1R 1Z0FA 5GJCA 2QP4A 4PPNA 2HYDA 4OI0A 1ZUNB 1KNXA 3ECCA 4BRWA 3QF4A 1IBRA 2CCJA 2VA8A 3BB1A 4IEEA 1TQ4A 3AF1A 2VHCA 4FI3C 4AD8A 2DFKB 3ZZ0A 2ZU6A 3UATA 5KDOA 3L0PA 1LW7A 3P26A 3T61A 3EA0A 2ZSDA 4X8MA 3OIVA 2ODEA 2FA9A 1HH4A 4JYBA 2DWPA 1N6NA 2GXQA 3FHOA 1F2TA 2OCPA 2QQ0A 2R6AA 2VP6A 1D2NA 4LJ9A 1QHIA 3X1DA 3W9YA 4MDEA 4D4MA 1Z3IX 4NU0A 1T5IA 2VBCA 2VSFA 1E1RD 5JWRA 1EWRA 4RZ3A 1E1RA 5CLLA 2HCBA 2ZIAA 4TT3A 4B3CA 5BWMA 2AK3A 1T4GA 1TADA 1E2GA 4HLUA 2W6JA 4RZXA 5UKDA 5DHFA 2OAQ1 3NC0C 4R2HA 2XEXA 3V9PA 2ZETA 3EPHA 3LWNA 5KNDA 1M2OB 2J7KA 1FX0A 1AZSC 3P4XA 3U60B 3EWSA 2F1JA 2IUSA 1G17A 4Q9KA 3R8FA 1KO8A 2KJQA 4DLSA 4IVRA 3LLUA 3EW9A 1G6HA 1CBUA 2IYZA 2XJ4A 3L82B 4Q4JA 3GQBA 2BV3A 3AGQA 5TY0A 2B7BA 2IYWA 1W36D 2JLWA 1UBEA 1KO4A 5FPTA 2V1XA 4Q7MB 2GNOA 5EXSA 2O8DB 1KOFA 2WJHA 4KXFB 1YU9A 3BH0A 3QKSA 2DFTA 3OHMA 2W83A 4Q9HA 5EP1A 5AJVB 2MSCB 2REBA 4PC1A 2J0VA 5L3QB 1EFUA 1GG2A 2XJ9A 4JKIA 1HA3A 4NYJR 2BIFA 1MO4A 2OLJA 4HAVA 1KI9A 4RKFA 2UZIR 1R2QA 4BLRA 3CF0A 5FPKA 2C04A 1NN1A 3TVDA 3KQLA 1KDRA 4M0LA 2VSXA 4HSEA 2ZJBA 2H5EA 3HYTA 1TUIA 5C4MA 1EX6A 2EFGA 2ZJOA 2V6IA 2EWVA 4A6XA 1Z28A 2IF0A 3GJ8A 4G5GA 1Q20A 4M1WA 5E3HA 4GZLA 3QXHA 1KYIA 3QKUA 4CT5A 1NVVQ 2J1LA 4N1AA 2NO0A 1EWQA 4DVGA 1ZAKA 3OEED 3O8BA 2WJVA 3SNHA 1OXVA 2PX3A 1JXMA 1RE0A 3DKPA 2QGZA 4HEJA 4LHYA 5J4KA 4K81B 4Q7KA 1R7RA 4TQUS 4PAMA 4YC7A 5C2JB 4LJ8A 2XZOA 4DDWA 1ZU4A 1G4UR 1MV5A 1EGAA 3C5CA 5FUVA 4HYYA 1NL3A 2OO7A 3TLXA 1Q57A 2W2XA 4M1KA 2GBLA 3ZGXA 1VCNA 3LRPA 4LSGA 4B3GA 2YWFA 4LOAA 3C41J 4E07A 4LPSA 1Z0AA 2KWIA 3ZVNA 2RH5A 3KFVA 4JBWA 2QE7D 1U0LA 2AWOA 4B32A 3ZIAD 3U3JA 3B1XA 3CH5A 3LDAA 5DI9A 4EJSB 1FUKA 4TT3D 3K0CA 1RJ9B 4FWTA 1AGPA 2ATVA 2BCGY 3V4RA 3B1VA 2NZ8A 4NDZA 4DSTA 1S2MA 1FFHA 4V0MA 2NOAA 2CLCX 1YJ5A 3WNBA 1M7BA 4E5UA 4BFSA 4P32A 2X8AA 3DMNA 3FHCB 4JIMA 2QAGC 1J99A 4URXR 1P60A 3HDTA 2WWHA 3HR8A 1S4QA 1ZC3A 3EAQA 1CULC 3RS5A 4Q9IA 2P6UA 1J8MF 4HLQB 1Z8FA 4BASA 4D25A 2J5XA 1COWA 5AK0A 3QEOA 1Q1QA 5G3YA 5FPHA 4Q1AA 4RKEA 3A1VA 1L7VC 2F9MA 2WIBA 2KBEA 4IDPA 5FTMA 1R6BX 4CF7A 1FNMA 4QL3A 3KXIA 3B6EA 2B8WA 1OH7A 4QJ4A 4B71A 4YMTA 5IDVA 1R0XA 4LHXA 3K0EA 3BB4A 3C16C 1VECA 4G5RA 5EE1A 1E3MA 3Q85A 4R7ZA 4QBFA 1G3MA 4KFUA 4P0TA 1ZUHA 1P9NA 4PHHA 1MKYA 1Z6YA 3OEHD 4CVNA 2ZJYA 3TKLA 4U7DA 4ZKEA 3BH6A 3CM0A 4FMDB 3WP0A 3TRFA 1G6OA 2FPLA 3ZZTA 3RS3A 3PR1A 4TMVA 4B2PA 3EA5A 4TTPA 2W6ID 1ODFA 1NSFA 1BO6A 4LYJA 3QVVA 4OQLA 4S35A 1OB5A 5F3WB 2FPMA 3K0AB 2FEOA 2JLZA 2ZI4A 4TMWA 2G77B 3M1IA 2O8BA 4KU4A 1TX4B 5L3RA 1T9HA 2IUTA 4NCJA 5KDLA 3QXSA 3J81k 4L16A 5CITA 3ETLA 4ZI3A 3PEYA 1COWD 3QPVA 1KJZA 3FDIA 1CJTC 2WVJA 3UMRA 3ZYCA 1N0UA 1ZM3A 3T15A 2IS4A 2F7SA 1G7CA 1XXHB 2JIZD 2QAGB 4ZDWA 5KPJA 3VKHA 3ZJYA 3PITA 2NO1A 4NCIA 4G5SA 1UKEA 1MH1A 1YE8A 4B73A 2R9VA 3U3KA 1Z29A 1DG1G 1EG7A 2OCBA 4LJ5A 4OHXA 4YMWA 1NY5A 1DARA 5DLQC 4KYIB 1KIMA 1MOZA 4TMZA 2EU8A 3K9GA 3H0KA 4BLSA 1OE0A 3A6PC 4CEIB 2WMOB 1CJVC 4UNSA 4ITRC 4Q4LA 4KAXA 2KE5A 2GJKA 1NKSA 5G40A 3ZVMA 1YZTA 2MSEB 2OAP1 1E2JA 3TR0A 2I1QA 4DLUA 1VIAA 3R9IA 2AFIE 1TAGA 2GDJA 4TQAA 3B7GA 4XSGA 3TUJC 2QI9C 2AK2A 2NPFA 5CDFE 4UXIA 5F2EA 5FOSA 4LJ7A 1IXSB 2F1RA 4KJZA 1YRBA 4BZPA 2W0MA 4LBYA 2BDTA 1KI6A 3LH5A 2Q9AA 4DB2A 3VR2A 3RS7A 2J41A 1U0JA 5HCIA 3BFXA 2ZE6A 3QUSA 1G8YA 2OUKA 3FKSD 5H8WA 1KAGA 1ZIPA 3PEWA 1U2RA 3CZPA 1QRAA 5CYPA 1QHGA 4DLXA 1OFHA 5C1BA 1FZQA 1SHKA 3EIEA 5BN5A 4QHYA 4C0LA 1C4OA 4Z8XA 3IPXA 2ODBA 2RKOA 5J4VA 5A5GA 4HB2A 4TYNA 3G0HA 2IXFA 4JZKA 4NMMA 1FUUA 4MYHA 4DLYA 3PJRA 4GMDA 2AX4A 4PPGA 5SZJA 4A8JA 1EFTA 1VHTA 3LW7A 4TMTA 1ETUA 1R0WA 3KKNA 4DUGA 4HLUC 5KUTA 3MJHA 4YONB 8OHMA 4JLBA 3O47A 4WAUA 4URUR 2FMXA 3PCRB 4NCHA 1ESMA 1S9HA 4EPYA 1P73A 4C0JA 4URYR 4I99A 4KO8A 1V43A 3TAUA 4JT2A 3KXKA 1E9DA 3QI2A 1X8LA 1KTVA 2G9NA 2NPIA 5EP2A 1D2EA 4Z51A 4ZKDA 2Z6VA 1E4VA 4QGGA 4TYYA 3B85A 4QHTA 4WA7A 4Z1MD 4U02A 4HZIA 2IC5A 4XSHA 5JEEA 4EPTA 3F0TA 4CGZA 1BIFA 4XOIA 5AJWA 4EAQA 2W6JD 1OXSC 4QM6A 2Z83A 3BD9A 1UJ2A 1P7CA 3QBVA 4PSVA 4NHOA 1IN5A 3CH4B 3QOFA 3LQQA 4RD0A 3CRRA 1I4TD 4CT4B 1ANKA 3C14C 3QG5A 1KSHA 4O2RA 5EP4A 1W5SA 2FDCA 3FMFA 1RC8A 4CW7A 1RIFA 2D62A 1E2IA 2PMKA 4V0NA 2G88A 2O5VA 2V6JA 4RFVA 5TMPA 4C0BA 1VHLA 2FGKA 4N3NA 4PO8A 1VG8A 3U4QB 4A0GA 2B6HA 2H1LA 3D8BA 3GFTA 3H86A 1CRPA 2QT0A 2ZS7A 1XD9A 4A0HA 1CJUC 2WPDD 3V4FA 2DHRA 4L5BA 3B60A 3FYHA 1E96A 1U94A 4BQSA 2G1KA 4B76A 2WJGA 4B6EA 1G8FA 1GOTA 1OHHD 2QNRA 4DSNA 2Z0MA 2BCJQ 1BMFA 1GNQA 4XTCS 2A30A 3GLIA 1RW4A 3AVOA 3MWYW 4ACBA 4AK9A 1XZQA 1H8HD 1TQ6A 4Q1CA 4EUNA 3QXJA 1IY1A 2FNAA 3KXLA 3MRSA 3JZMA 3OIYA 4JKYA 4KHZA 2BBWA 2BOVA 2J87A 3IO5A 3ICEA 4NE2A 2C03A 5TDHA 4C0QC 2WAXA 1NIPA 1Q21A 2FG5A 4MKFA 1W4RA 2ZE7A 1XNJA 4FCVA 4A8JB 2YVUA 4Q66C 1X86B 3FKQA 1CF4A 5BXQC 2ODWA 5E95A 1AK2A 5KYKA 2BHRA 4LY6A 1W4BA 2FJUA 3C5HA 4HZUB 2EYQA 2QORA 2MMCA 2JIZA 4OQXA 4LUCA 2XTZA 2WBLC 1XCPA 2F3TA 1GZSA 2JLXA 1BOFA 2ODNA 4MKIA 4Z54A 3GMTA 4MRRA 3KJEA 4DT1A 2IYXA 3NIBA 1UM8A 2GF0A 1NBMD 4P3YA 3HU3A 1KAOA 1M8PA 3Q5DA 3QE0A 1XPRA 1HE1C 5K8LA 1WE2A 3GJ3A 3G5UA 5LB4A 1Z2CA 2B8TA 3W3AA 2QN6A 5G53C 1OXUA 5CK4A 3SC3A 4PXAA 4AYTA 2GETA 5TB5A 1Z0IA 2XXAA 2C99A 2ZJAA 3AP1A 3CX6A 4B3BA 4MDFA 4EFMA 5B30A 2GJ8A 1D8TA 4M9XA 1XFAA 4TYQA 4TMKA 4DEXA 2GEVA 4C0HA 5E4FA 4JVMA 5EUMA 4DSOA 2F55A 1OXXK 2X19A 3LFUA 4Q1EA 5LD2B 1KK0A 5E7MA 2ZI9A 3ZZUA 2UVQA 4I1UA 1FPMA 1R4AA 3Q8XB 3RLFA 4LI0A 2XTNA 3I61A 1XU4A 3F3YA 2BKEA 1NLFA 3M6AA 4M9SA 1DO0A 4ZCMA 1F3OA 3ZQ6A 2OLKA 2JJ1D 2R6GA 4LC0A 4NCNA 3PUWA 3GD7A 1N5JA 3NDPA 4DCSA 1OH8A 2QRZA 1N2CE 2ORVA 4A2QA 3SFZA 1IN6A 3EZ2A 4DSUA 1E2KA 1IOZA 2A2ZA 4FD2A 3AB3A 3EWAA 3T34A 3I3SR 3UPUA 4DBLC 2RGXA 3K70D 1PVOA 2HJVA 2ZSBA 3Q7PA 3A1UA 4M8NE 1E2EA 1JJVA 3T1OA 1SULA 4P31A 1Z63A 1OFIA 3F5FA 2B7CA 1A2KC 3GFPA 1X1RA 4A9AA 2B21A 4K8OA 1H8HA 4NTZA 4GT1A 3P4YA 2O8FB 3PXGA 4DLWA 1QHNA 2CCGA 1KSJA 1X6VA 2WOJA 4Q4AA 4HUTA 4KCGA 1I4LD 2C9CA 4D4LA 1XDBA 1PUJA 2QT1A 1W0KD 2XOKA 1E0KA 2CXXA 2XOKD 4Q7JB 5KSYA 1K5DA 3SYLA 4AKEA 3K0AA 1KO5A 1D9XA 3FE2A 4GSYA 4GP6A 3THWA 1GVNB 3AV0B 4JVLA 1T3LA 1TQ2A 2AL7A 2BBOA 2IYTA 4XIGS 5FUXA 3X1ZA 5KPDA 4OK5A 1LF0A 1VYUA 4BFWA 4QBHA 4JVNA 3AVQA 3GEIA 2OEPA 2DR3A 2GXSA 4DDTA 1XXHA 5EP3A 1CS4C 2IUUA 4WW0A 4NONA 3A1WA 3CB4A 3SOPA 4LK2A 2XZPA 4LV5B 1XTSA 3TQFA 1DO2A 3A1TA 2XGJA 2RCNA 3IIJA 2OG2A 3EIQA 3EASA 5CJPA 3UIEA 3KQKA 3AP2A 2HF9A 1J7KA 2LKCA 3E1SA 1K8RA 4KSBA 5HE8A 1KHTA 2ZI3A 4I81A 1SVWA 2XAUA 2ZR9A 2DFNA 2PH1A 3CBQA 1AM4D 5K8IA 2OFXA 4CEIA 2ZJZA 2JLVA 1DG3A 4TZ6A 1U9IC 1VDZA 2IEYA 3BGWA 4F4JA 4ASUA 2YZ2A 1RYFA 2ZREA 1P2SA 2ZITA 1XXHE 5BN4A 621PA 3U7GA 1E2QA 1U8ZA 4KBGA 1S0UA 3C7KA 3W3ZB 2VF8A 1MO5A 2GILA 3H1TA 5L3VA 3BERA 4BFUA 4F7WA 1P2UA 3L0IB 3RSOA 5EE0A 2GVZC 3IQXA 1UBCA 1RKBA 2HV8A 4IDNA 1GUAA 3K53A 3NC1C 1OKKA 4JLDA 2CMKA 1NP6A 4Y0AA 1CJMA 3WRYC 1ZBDA 2DY1A 1U98A 4MGKR 1P2VA 1QHHB 5BN3A 1E0AA 2PMDA 3I32A 1B23P 3FTQA 3DHWC 1GDDA 1OIVA 3GPLA 4QNRA 1R8QA 1NG9A 4WIAA 1M7GA 3SS8A 1G5RA 2Z4SA 1UBGA 2P6RA 4D0NA 3CW2A 5JJIA 4Y0VA 3T35A 4HDCA 3LXXA 2BEKA 3SJBA 5FTJA 2OBNA 1LS6A 1P5ZB 3CR7A 5E7IA 2IS2A 4G5OA 4UXHA 5H1YA 2H16A 1KJYA 2VQSA 1Q1BA 5CIQA 2CE2X 3WXMA 4B44A 4KVGA 4HUQB 5KHOC 1KI8A 4X8LA 5EXXA 2J46A 2RGDA 4BEBA 3MG9A 4PX9A 3SU8A 2OESA 3NDBB 1CIPA 3QNUA 1II9A 2FFBA 4GBMA 4M1YA 1KMHA 4Q4JB 4US2R 3GJ5A 5HCNA 2Q3FA 3KKQA 4F4IA 1ZD1A 4R2IA 2O8DA 2VEDA 1QZXA 4TLBA 1CLUA 3AVVA 2DB3A 1P3JA 4GFDA 4MYTA 3WMFA 4DCTA 4TYPA 4L9WA 4NL4H 4B3FX 1XEWY 2QPTA 1QG4A 2P65A 4FXPA 3VNVA 2WOOA 4KFSA 3MFYA 1E2HA 4UNNA 5J4LA 1IN8A 4FMCF 3RYTC 2Y8EA 3PQCA 1Q3HA 1NVXQ 1EESA 3L43A 5EUQB 4ZDIA 3W8NA 4BFYA 2A5YB 1AS2A 3T1QA 4CZ2A 2ZANA 4M21A 4UJ5A 4V0KA 4C30A 4DDUA 2FSFA 3U4QA 1TTTA 3LQRA 3BJIC 1E9AA 2GJSA 4LJAA 3ASZA 4S2EA 4EDHA 4XTRA 2VHQA 2D2FA 5JCZA 1R5OA 1UPTA 1AIPA 1YQTA 1TF2A 1S1MA 1KZ7B 2C95A 2YWGA 3AVXA 4HATA 2WKQA 3RABA 1ZM2A 3RSLA 5JJKA 4IDQA 4BUJA 2ZRFA 1OKKD 2C96A 4OJQA 4P4SB 4KSCA 2QMUA 2YV5A 1KMQA 2DYKA 3TW8B 1XTQA 1E9FA 2AWNA 2GHIA 1CTQA 1W2HA 2XNDA 3NHAA 4PQRA 1YR6A 4TL6A 1ZYUA 2F1HA 4BLPA 1A5TA 3H84A 2JEOA 2ZI6A 1Q0UA 1J70A 4JT4A 1NJFA 3RWMB 4J0QA 5KSPA 4ARZA 3ZVRA 3U2QA 2YJTD 3TK1A 4H1UA 221PA 3ZQJA 2H57A 2HLDD 1DAEA 2ZE5A 3ND8A 4HAZA 5F98A 4IOMA 2HDNB 1AS0A 2QBYA 3X1YA 5FPSA 3B1WA 5KNBA 1U0HC 3R8CA 1D5CA 5FPYA 4XWKA 4TL7A 2BEJA 3DEFA 3KUCA 3BBPA 3A36A 4DT1B 3VR1A 4XWAA 5HKKD 1XP8A 1TUEA 2ZAMA 1E0SA 4OYHA 2CK3A 1CR2A 2V1UA 1WF3A 4Q03A 1VCOA 3I8XA 5L8VA 2BBSA 5JLJA 1E1QD 1KI3A 3V00A 1XTJA 4RZ2A 1CXZA 2RGGA 3SJZA 5J4HA 2HT1A 4BPBA 1KGDA 2I3BA 4MRPA 2VP2A 1JEEA 1ZINA 2FE4A 3RRNA 3FFAA 3VR5A 1E9CA 3SDZA 1M7HA 1Q12A 1GITA 1GIAA 2FN4A 2VP9A 2VSOA 1GL7A 4DIDA 1AZTA 4Q00A 5HZKA 1WB9A 3IHLA 2GCNA 3H2YA 4TL9A 4Q1BA 3KFXA 3I8SA 1XTRA 1NG1A 2GXAA 2Z43A 4M1OA 2G83A 1Q3TA 2QSYA 2QL6A 1KKLA 4LHVA 1FW6A 1MO6A 2QSZA 1E79D 1U99A 1YHNA 2R65A 2ZYWX 4KLNA 4D4JA 3NH6A 4R9UC 3I5XA 4Q4AB 3P32A 3C4JA 2G3YA 1A2BA 2ZRCA 4AKIA 2ZRPA 2R2AA 1AKEA 3SHWA 1DBSA 3AF3A 5JHGB 1HT1E 4YDHB 3B1ZA 1OXTA 1TEXA 2J3EA 4C7OA 2ZYUX 1S8FA 4AG5A 1VCIA 3AF4A 3MCAA 3L8ZA 3IIKA 3LD9A 3VX4A 1KDPA 2ERXA 2O8EB 5E7JA 1DELA 3AVPA 4WBSA 3T12A 3TUIC 1E69A 4DLZA 2LKDA 1G64A 2YOGA 4LYAA 5C46F 1SKYB 2ZU0C 3GLHB 1T0HB 2IYVA 1SVOA 5CLQA 2G6BA 4DUGD 1H8EA 3TR5A 1OV4A 1RYHA 5LPNA 4AY2A 1AA9A 1XF9A 3RRZA 1ESNA 2PCJA 2BWJA 1CEEA 3TUZC 4HAYA 2UZ3A 2FV8A 2BM1A 2VO1A 1R5NA 5D3MB 4OK3A 4PSAA 1NN3A 1LTQA 1N5KA 2EQBA 3T5DA 1SGWA 4QJ3A 3PUZA 4QGFA 4PQFA 4EPXA 3LNCA 4ZCIA 3R20A 4RFSB 4KVAA 4GZMA 2OT3B 1XD2A 4MGIR 2JDID 1TF5A 2IXGA 4PZLA 3TMKA 2XITA 2BKUA 3THXB 1VCMA 2REXB 5AJXA 2GZDA 2QZ4A 1XCGB 4URVR 3JVVA 1HQCA 1SHZA 3DM5A 1XMJA 3CPJB 1VG9B 5JECA 4JJZA 3KJHA 1LNZA 4GDFA 1TU3A 4Q4HB 4TYWA 2IL1A 2K5UA 3OESA 1FQKA 3PIRA 1H8ED 4NPHA 4JLKA 5JRJA 1G9XA 1W4CA 4NYMR 1E9BA 1TU4A 1QDEA 3OEEA 4IJMA 4PO1A 2VF7A 1DTSA 5J40A 2DBYA 1R5BA 1GKIA 1XTKA 1HURA 4E09A 3AF0A 4RSGA 1Z47A 1CR4A 3HYRA 5DE3A 3K0CC 1XEXB 5DYGA 2X2EA 2G0TA 2CHVA 2PL3A 2F3RA 1NN5A 1QBKC 1KK2A 3OFNA 3BORA 1KI7A 4HB4A 5JEDA 1UKZA 1E4YA 2W58A 1MRNA 1NSTA 2CHGA 3A4NA 3QKTA 1W2GA 1YZNA 1MABA 1NY6A 4B2IA 1ZP6A 1PUIA 2UKDA 1N6RA 2Q9BA 2QU8A 3R9XA 2PZFA 1W0JA 2ZRLA 1U8YA 4HAUA 4UXJA 3U7EB 3WMGA 1N6OA 1FP6A 3UKDA 1RRGA 2AN9A 4B3DA 1A1VA 5FL7A 3GLGE 1VPLA 1CRQA 4BFZA 4DRZA 4GL2A 3PEUA 2XX3A 2HCJB 1N3BA 2RAPA 4PZYA 5DN6D 1WRBA 1KMHB 1RVDA 3KKOA 2HYIC 1OH5A 2RGNA 1P9RA 1TF7A 2TMKA 3B8HA 3U3MA 4GOJA 4UQOA 2H17A 2VP4A 4AKHA 3CONA 4PC2A 2BMEA 1ELOA 1G291 3FMOB 2ZE8A 1HY3A 1UFQA 1Z06A 3VQTA 4EKDA 3CNLA 4DZZA 1Z07A 3QJYA 3QKSB 2ZSEA 4HUQA 2FZLA 2ZI5A 4QBGB 3TQCA 4DHEA 1AQYA 2JCSA 4JLVA 1E9SA 2ZYTX 2PEYA 3CX7A 1DAGA 5B57C 4W5HA 4CEHA 4D0LB 1IJEA 3KDSE 3THYB 2AFHE 4QGAA 1IHUA 3RNLA 4A2WA 2YKGA 2EYUA 4G5QA 3TIFA 2KB0A 3BS4A 5AUNB 4QHSA 5BQ5A 4AI6A 3ZS8A 3THXA 3CR8A 3VNUA 1TPZA 1G1MA 1D9ZA 2CL7X 2BMDA 3NG1A 5DHAA 3N2EA 1E2DA 4AG6A 1JI0A 4C3ZA 4KI0A 2XZLA 1KSGA 4MH0R 3TVTA 3VX3A 1W48A 1GM5A 2CEAA 3QSYA 4WXPA 1E98A 3GEHA 1LV7A 4WOPA 5JS7A 4GP7A 2C77A 2R62A 2IS1A 3NEYA 1ZU5A 1SVMA 4GOXA 4Q19A 1OYWA 3CWQA 1GSIA 2GF9A 4B47A 4GPTA 2WHXA 1MRSA 2JATA 4E03A 2IF2A 4RD1A 5A4JA 2E1RA 2GAAA 3U44B 3B1YA 1JEDA 1VMAA 2OBMA 3IO3A 1YZLA 3NTUA 1ZNWA 121PA 4BECA 4AKGA 4Q48A 4BLQA 2WSMA 4F92B 1YKSA 2ZROA 2DWOA 3DKVA 4C0SA 4ON9A 2OE2A 3MLEA 1W5TA 4DKXA 2ERYA 1W7AA 3FFBA 1NBMA 3EG5A 4YLGA 5BYKA 4OI4A 5FTLA 4D82A 5BW8A 2OXCA 2LCFA 4Q21A 1YRAA 1RZ3A 3ND9A 2I1VB 2ZSFA 2HJGA 1QF9A 1XCMA 1N5LA 4NKRA 5B64A 4JLMA 4XVUA 1UF9A 5FR2A 5M04A 1LY1A 3BH7A 2XXAB 2C2HA 1YR7A 4OQFA 4HLDA 3TGPA 4MQBA 4OHYA 2IW3A 3C15C 3H4MA 3OAAA 5CB8A 3T06B 3A4MA 3AVYA 2GZAA 2JLUA 3PG5A 4LJ4A 1E2PA 3PUVA 2VHTA 3HPQA 4B6FA 2NGRA 4GOKA 3A58B 4Z8YA 1JXOA 3EXAA 3RHFA 1W49A 3D3QA 3FMPB 4JJKA 1I4DD 1ZNYA 1SXJB 4OK6A 4DXAA 2XNSA 4Q9LA 2QM8A 1OPXA 2GXUA 2O52A 3KJGA 1W36C 1W4AA 2ZR0A 4JL6A 1GFIA 3K9HA 4IOJA 3WBJA 2OFOA 1T3HA 1N0VC 5FI0B 3B13B 4HB0A 4F4CA 2QMEA 5FOVA 2VHJA 2WAYA 1NKTA 3ONWA 2PZEA 1BKDR 1DOAA 4TZ0A 4D81A 3K1JA 4QGHA 5JSZB 721PA 5J4YA 2P3SA 5ELXA 1KDOA 1U9IA 4FMCB 1FMJA 2ANBA 1LFDB 1T5LA 2CNWD 1N0WA 5FBVB 1GTVA 1GNRA 3K0FA 4ZPXA 3K70C 2QP3A 1FTNA 3U44A 2ZRNA 4ESVA 3DL0A 2NZJA 5DISB 5KOYA 1XWIA 4OL0A 3GLHA 2QE7A 1VIYA 4A2PA 3NWJA 1G16A 1RRFA 2QG6A 2VRWA 4ESHA 4JBXA 1V5WA 1Z6GA 3DOFA 3NH9A 4Q7LA 2C5LA 3UWOA 4B2LA 3EPKA 3M0EA 5JWOA 2ZJ2A 1K6MA 4O25A 3DO6A 3SN6A 4A0FA 2JASA 4LWZA 3SJAA 4PHFA 1F6BA 5FBRB 4DEYA 2WTUA 1JALA 1E79A 3THWB 3QXXA 2YWHA 4PC3A 4BFTA 3DDCA 3NVAA 5D3MA 4ZDJA 3IUYA 1RJ9A 4D26A 3C8UA 2IK8A 1A4RA 4DDVA 1SVLA 2B92A 2QTFA 2R44A 2QMOA 1CR0A 2A7QA 2CL6X 4BLOA 3A37A 1XEFA 2WZQA 5AUOB 4NYJQ 2ZVPX 4NP6A 5EXPA 2IYQA 3EZ9A 4D4KA 1JAIA 2NO7A 1Z0KA 3IBGA 4HDOB 521PA 1XJQA 3CRW1 1R0YA 4LPKA 2V7QD 5FH9A 3QXCA 3NKVA 3LX8A 2P6NA 3A1SA 1OSNA 3SEAA 4Q4HA 3KUDA 3L2OB 4YXWD 4IKEA 1DAMA 3HWSA 1NMXA 3K8YA 3QPWA 2HT6A 5EE9A 2IWHA 1KI2A 4DCNA 1BMFD 1L4YA 1R10A 4RFSA 2YOHA 4R98A 4PQYA 3GLHE 4FCWA 1NF3A 1PZNA 4EQ6A 1E2FA 1AS3A 1T0JB 5DSZA 4MYCA 2EWWA 2PLFA 2JDIA 4LJ6A 3QF4B 4RD2A 1OW3B 4IVQA 2A3RA 4PZZA 4QBIA 4KLZA 4MGZR 1IQPA 4KFTA 3RC8A 3RS4A 3CF2A 1OT3A 1N6LA 3PVSA 4EFLA 3T5GA 3GLFE 1HQYE 5JSZA 1W1WA 2D7CA 4L4UA 4RVCA 5DO9A 5CIWA 5FTKA 4DLRA 1TL7C 5KSZA 4JLOA 2RGCA 1DEKA 5FBWB 2RHMA 4W5JA 4DLVA 3ZD7A 4LYHA 4QJ5A 1Q1EA 1KI1A 1ZD8A 3X1XA 3P20A 3NBFA 2IHBA 4YMSA 4ARZB 3KX2A 1NBME 1L4UA 4XVQA 2ZS9A 3OE7D 2CK3D 1GL6A 4G0NA 3S1AB 2AD1A 4IOLA 2JGNA 3PENA 3BC1A 2AD5A 5EE5B 4QFMA 3PV0A 3REGA 1FMLA 1SQ5A 3EZ7A 5CM8B 1DAFA 4EPWA 5L3SB 2JLQA 4Q18A 2DCUA 1KY2A 2W0SA 1KSFX 5DIFA 1XD8A 3N2IA 3QVUA 2ZS8A 1FX0B 4MKGA 2ZJ8A 2GTPA 1IXRC 2GEDA 3D6TB 1EFRA 1CKEA 2H7VA 4PFSA 2HXSA 2D74A 3MWKA 4OQNA 3VFDA 2WJYA 2FFAA 3ADBA 1GWNA 3TSOA 3CO5A 4CRWB 2V8OA 4A36A 4OQMA 3I4LA 1P6XA 3UANA 3A8TA 4JYCA 3WYFA 2IXEA 2ZTSA 2XSZD 1G41A 1ZRHA 2WKPA 1B0UA 4P33A 2QPOA 3DPUA 2RGBA 4XJXA 4I1OA 1FTSA 4GRAA 1UEIA 1W47A 1DPFA 2BVNA 4ZDKA 2VLIA 3AKEA 3WNCA 1DAKA 3K70B 2QROA 1KO1A 1DADA 2OHFA 3CNOA 2V7QA 3E5HA 3MWLA 1S3GA 4IFBA 3IPYA 4LHWA 4HDQB 2PT7A 1JR3D 1II8A 1G20E 1OJLA 2GCOB 2VHUA 2VPPA 4EQ6B 3AKDA 1WBBA 5FOXA 5JWHA 1EK0A 1YZGA 3IILA 4LBWA 2FZ4A 4UJ3A 3TSWA 3GLFA 5J5CA 4CYMA 3Q3JB 4IXMA 1IY0A 1YZKA 4PR0A 4Q1DA 1IXZA 1W46A 4JLPA 4V0LA 4B75A 4B33A 4DB4A 1SXJC 1QG2A 1Z2AA 3AM1A 3HP1A 2IT1A 3R7WA 2JLSA 3LV8A 1HV8A 2D7DA 3O8CA 4ZIRA 1WMSA 3GCGA 4D80A 3E70C 1US8A 3LY5A 1VYVA 1E6CA 3UXMA 1KK3A 2CHQA 1N6HA 2CVHA 4D2IA 2O0JA 3IIMA 3UWKA 3VR6A 2QAGA 3UMFA 2VYFA 3EC1A 4MUBA 3EPLA 1OFUX 1SVKA 3QKRA 2DFLA 1JECA 2L0XA 4IEIA 3EIHA 1CU1A 1QHXA 1LVGA 3B78A 4BGDA 3CLVA 4M53A 4A1FA 3DM9B 2OSBA 2HEIA 4FMBB 3VTKA 1M1YE 1ZVQA 2EFEB 2YNMA 1XX6A 5KO2A 2AXNA 1IY2A 4JVSB 3LBHA 5FUWA 3L0OA 2JAQA 1JQJC 1XD2B 1C9KA 2J0UB 4XD7A 4BEJA 1NLZA 2ZI7A 4URWR 4F91B 1EFRD 5FOTA 5EJEA 4QRHA 2V3CC 3SYNA 1U8AA 2DWQA 5IHPA 1G7RA 1AQUA 3LO5A 2I4IA 1ZM4A 1OIWA 2PEZA 3BFVA 3LBIA 2F1IA 1LS1A 2YOFA 2OILA 4L9SA 1N6PA 2N42A 2GA8A 1GL9B 1G7TA 3L0SA 4G01B 1SKQA 4MRSA 4B43A 2ZRDA 5CDFA 5G3ZA 3N5CA 3CWZA 2NO9A 2FH5B 3W34A 3UG6A 4CDGA 2J0SA 3ZS9A 1S9DA 3IKJA 3CUEF 3AH8A 3QQ5A 4OBEA 4M4SA 2YYZA 4X8HA 4JBYA 1TNDA 4I1SA 5HKKA 1SXJA 1GKYA 5H68A 3I92A 3TSZA 1OH6A 3HJNA 4ILEA 4RZUA 3UG7A 3ZIAA 3BOSA 2X77A 4M22A 4DJTA 3G82C 1OFTA 2WJJA 2W2TA 4YMVA 3QY0A 4PANA 2ZRHA 3CF6R 4JLNA 1UBFA 2AKYA 1Q44A 3I62A 1G5PA 4XD7D 3KB2A 4HZUA 1Z6TA 1FNNA 4TTQA 4BWYA 2BBTA 2E9SA 3THOA 2NIPA 2SHKA 4LCBA 2O8BB 2JLRA 1NI3A 4C7OB 4N0DA 3VMFA 4FINA 3T1TA 5J47A 3BE4A 4KV9A 5CK5A 2V54A 5DH9A 1G18A 2H18A 5EZ6B 4YDSA 1SXJE 3BIFA 5FBLB 3SBDA 4V0OA 1E1QA 5GJVC 1HT2E 3JZAA 2QPAA 3I73A 2Q6TA 3LX5A 1NMYA 5AJZA 1D6JA 3VKGA 5D3QA 2WKRA 3O8RA 3LW8A 2C98A 3OIWA 2AR7A 1IONA 3BFKA 3QKRB 2JJ2A 1Z5ZA 2F43A 1MO3A 1JR6A 2QY9A 1S1CA 1T91A 2P5SA 1JQLB 4A15A 1HUQA 3W5JA 3K0SA 3Q5EA 1E0JA 3QEJA 4Q01A 1XEWX 5L3QA 2Z4RA 4U5XA 3ASYA 4JS0A 1MR3F 3BAFA 2ZRGA 4MA4A 1AN0A 1E2MA 3HR7A 4DLTA 3GJ6A
chains in the Genus database with same CATH superfamily
1Q92A 4GRDA 1HE8B 2X0IA 3U7FB 1K5GA 1QG0A 1XTTA 3E2IA 5TGTA 4KW7A 2FZKA 5IFKA 2VKQA 3Q9LA 1AQNA 5GJWC 4CQLA 5A1TA 1ZJ5A 3NYIA 1CUXA 3O4VA 1GO2A 4FT4A 1MZVA 5JVDF 2C78A 4FMDF 3SBEA 2R6DA 3Q41A 5F7XA 4H7HA 3E6AA 3G0CA 1ZD3A 1Y63A 2J6HA 4NENA 5KDDA 4X62B 3UV3A 2BH9A 2ZBQA 4DVJA 1PG5A 4BVHA 1DLIA 1FLAA 3MGCA 4JL5A 2ZQYA 2DQZA 4MDYA 3WYAA 4DIEA 3H5IA 4UQPA 1DQZA 4IIDA 2AXQA 3OLZA 5SYAA 4H4DA 4UFOA 3MB8A 2IJGX 4BV9A 1YI8A 3C3BA 2FHSA 2P2ZA 3OPNA 4DR7B 2PPLA 4I5DA 5FOUA 3JQAB 5CM9C 4CG3A 1RXYA 1TCUA 4N8SA 1LSOA 2VP3A 5CHEA 4AYWA 4UTPA 4X1YB 4FQ8A 3NHFA 3N86A 1RQRA 2BEUB 2FUEA 2IW1A 2UZ0A 2ZUCA 3JVIA 3LA6A 1LZLA 3LHFA 3NBYC 4AP6A 2OCKA 3VSBA 3DFUA 3ILYA 2CUNA 1MT0A 3ZY3A 3FVTA 4OHWA 1E20A 2HBQA 1J24A 1FYVA 3AW8A 5BUZA 3H1AA 3JQQA 1XPUA 4AROA 4Q12A 5DU2A 4RPLA 2C9DA 2IPAB 4ERNA 1NHWA 1YNOA 2YINC 3H3JA 1KBOA 1DAHA 1NIJA 1SKYE 2I5PO 2BKXA 3AHDA 3RAPR 5B58C 5I47A 4AYXA 1B3BA 2MINB 2XLCA 3QVLA 3NAGA 5EGNA 2ENUA 4CLHA 4ATNA 2F8LA 2FSUA 3EC2A 3LSYA 1EVEA 3NUQA 1BG6A 1NVUQ 1ODKA 4LV8B 2VDMB 4WNAA 2VTBB 3AXSA 1IN7A 1E7RA 1Z6AA 1BE0A 4Q1FA 5AVVA 2DQ4A 5B3JA 1CP3A 2JFBA 4FX5A 4IO1A 3ZHRA 1XAHA 2XH8A 1EX1A 3C3KA 1PJTA 2NQTA 3DGEC 3SHOA 2J59A 5P21A 3MD0A 1UJNA 4UHEA 1OZFA 2QRPA 3F74A 4B17A 1VMKA 4UUPA 3WKCA 1U2ZA 4MITA 4UM9B 2PBRA 1K5HA 3FUCA 1DVRA 3K94A 3MSCA 5B2ZA 4AJLA 4EB0A 3WYGA 3BTSA 3K09A 3LVFO 3EXEB 5EZ5A 1KDYA 4ZO6A 3ER9A 5C8XA 3VR5D 3B36A 3D2CA 3VRHA 3W5IA 3SXUA 2VT6A 1AXGA 1J2JA 3PUJA 3RROA 3LQ1A 2Q2QA 4IWXA 4W8OA 2JBHA 4ZT6A 1K3UB 2I8LA 2DPXA 1CUHA 2GPAA 4I9HA 4J0JA 4QSMA 3I1FA 3WRXC 3SXJA 4UULA 4EY6A 3OQMA 3PI6A 1YK1A 1DEXA 5LSAA 3OQHA 4YYZA 3BHNA 3RFTA 3ZJTA 3OZUA 2GKSA 4WN3A 3FGNA 5JYBA 4QYMA 4UBJA 2VYCA 2Z5FA 1OVMA 1QUFA 1LLDA 2VC2B 5FR1A 2K6GA 2OV2A 3E23A 3MSXA 4DCOA 1XZMA 3KQHA 4IBOA 3WZ2A 4IIVA 1XZKA 3GDHA 3A3YA 3PFHA 1M2EA 2E48A 4I6EA 3RIMA 1LBHA 2CUTA 4LZZA 2FEAA 3UGTA 1AV7A 4JNCA 4M8SA 4Z7OB 4R2WA 1QB8A 4FOTA 1PK7A 1TO2E 2V4ZA 3EOZA 1P91A 2Y76A 3AERA 3EC7A 4CM8A 2V98A 3L49A 2GZSA 3L7JA 4QUKA 1II8B 1TM4E 2QWXA 1HSZA 2KMLA 1Z0UA 2YV1A 2J9ZB 4UAUA 1YBHA 5DMHA 1JPUA 1F2TB 2EJCA 4A6PA 1U4SA 4RD6A 3VAAA 1FLVA 4AUNA 1XTIA 1ZMRA 2QEQA 4RUKA 1XJCA 3C6KA 2RARA 1MMFB 1VMIA 2VN8A 2AG5A 3LQYA 4NVRA 1CUAA 1JHUA 3UJPA 1A2OA 3G0GA 3LUBA 4J0DA 1FL9A 1W44A 2I6GA 2GJ9A 1T1GA 1RM5A 1D1TA 2D3WA 2CXRA 3BSSA 3CZ4A 3GXOA 3ZVLA 1PGPA 1ZIXA 2QA5A 2O7VA 4F9EA 3U37A 2HR1A 4JSTA 3UMGA 2VDNB 5EPOA 4UNQA 1MP0A 1PEKE 2QR2A 1J1ZA 3OOEA 3TL2A 2OCAA 4D6PA 5I9NA 3LWZA 1WVGA 1JZQA 4J16C 1RRMA 4O0LA 4QQFA 1WXGA 1WPRA 1BQEA 4PGHA 3L7IA 4HAXA 1IBSA 2V7GA 4S1PA 4I4TB 3T7TA 5AM2A 3DWFA 1IZ7A 1HYEA 5EJFA 4ZOAA 3PNYA 2XXJA 5FOWA 3ROKA 3U6KA 1FU8A 3CRVA 2C8LA 4IJWA 5KTSA 2QNBA 4OGGA 1OT5A 1S4MA 1XPJA 1B2LA 3ESBA 4A2CA 4DIBA 3FHTA 1O4WA 3PE6A 1QO9A 4OF4A 4UHDA 1GILA 4K03A 5AI0A 4B6JA 4ZYUA 6REQA 1FDOA 1HOXA 2G5GX 4M9UA 2BJVA 2IQIA 3D6JA 3MWGA 4FZ3A 4ER0A 3TEMA 2PD3A 4MZDA 5K6AC 4TV8A 1CQWA 4PAQA 4PBRA 1QIDA 4MUFA 4JBNA 2A14A 1CUZA 1T8PA 2WUEA 5SZIA 1RHQA 3FI0A 4TPKA 1BW9A 1V5FA 1WCYA 1ZJ6A 4K9LA 3DAOA 4RHTA 4WCDA 3SVTA 2WSSA 1P4SA 2ZOSA 3OT1A 5LUBA 1W75A 3TNFA 2AF3C 1SCQA 2P9JA 3JYPA 1XZIA 4WPGA 3UT6A 3AGPA 1QGED 4RABA 3ZWYA 1TCBA 4MGYR 3HUTA 4HMOA 4J0FA 4AL4A 3N39C 5AHRA 2JA2A 2OZEA 2PKXA 2QP9X 2SCUA 1WUJS 1XKLA 4CF6A 3HUDA 5CURA 2JA1A 2ZT5A 5I8ZA 1C9EA 5IP5A 4OA5A 4TLEA 1L4HA 3NDRA 1FQWA 3I1JA 3AZQA 4NBKA 3FTEA 4MGEA 4C6HA 3E48A 2OWEA 4BRZA 1MC5A 4NS1A 3ONEA 4FE7A 1PNOA 1M1YB 4HNHA 3TZ6A 5CT9A 3SKVA 2O2CA 1KU0A 2GNAA 2HJRA 3CU5A 1HYBA 3WHLA 2VZ9A 3MYRA 3RVLA 2WK1A 1P1RA 1UAGA 3RC3A 1P1KA 1W0JD 4RVSA 2ZZNA 3BDVA 3NI2A 5BV8A 2X2FA 1QU2A 5LC1A 3V55A 4NZYA 5C8VA 3IL2A 4CMJA 4KXYA 5A02A 3ZCXA 2VP5A 1H6AA 4WK4B 1EP3B 1EFHA 3F3SA 5FL7D 1L7OA 3STUA 4WBNF 1HT0A 3NJ4A 4IUYA 1M2VA 5CDGA 5H59A 4FWIB 4R3NA 1EFPB 1BA2A 5BW4A 5ICSA 6Q21A 2PXHA 4XIFA 5BNZA 2C7RA 3PVCA 4O3MA 3FG9A 5ANRB 3LS2A 2W2VA 4Z9FA 2CNDA 5H80A 3SYTA 5BVHB 1O3YA 4LYFA 5DN9A 3CVUA 2FVYA 3U5ZB 1PQ4A 3LYUA 4LRXA 3LUJA 5KNCA 2WUWE 4NDNE 2RJ3A 1AGRA 5KYTA 3SE0A 2CE7A 2OXEA 4IFTA 4UOQA 1XTPA 1NXOA 1Y7HA 2IPMA 1PG0A 4EF5A 1U9CA 1Z5NA 1PI3A 3RANA 1QO0D 3QBJA 3DXFA 3WGUA 4ND8B 4EPVA 3DT6A 1VKJA 1W6UA 3COWA 4ZEWA 5A4AA 1PAUA 1A7JA 4MWTA 9MHTA 3K6RA 1G2OA 4Z9YA 2D2EA 1PFQA 4R7GA 3BWYA 3Q40A 4DFDA 2AG1A 3WKEA 2Q5LA 5BSVA 1GL3A 1JR3A 5BW5A 1ZR2A 1EUDB 4NMLA 4CMHA 1O0BA 2ZXFA 3A3OA 3DOCA 4R8VA 1U3TA 3TNJA 4GGOA 2PS9A 2OYRA 3K09C 3NEAA 4UDXX 1RCUA 3L01A 3M9XA 1KI6B 2NZVG 3L93A 4FWBA 3ZNNA 1KVTA 3VNRA 5J3JA 5BSKA 2C1EA 3GLIB 3DVAB 2DUUA 4TUYF 4J8PA 3C3XA 2GAJA 1DRWA 2HPVA 6AT1A 4AY6A 5A9SA 1SUEA 1T6BY 3OA2A 1HWYA 3TQSA 1VJ0A 4L08A 4YAKA 1EI9A 1H65A 4FFSA 3U7HB 2I9PA 2VPXA 3QA3E 4Z4FA 3K6JA 5JJLA 1AKRA 1N3IA 1M74A 2N1MA 2YASA 3GJ0A 3MQFA 3W2IA 2QOEA 4NOMA 2DHEA 5K4HA 1IG0A 5TQJA 3TW4A 2F3SA 1JXAA 1Y1KE 1Q3KA 2ZSUA 3WHKA 1T8UA 5JNSA 1EWVA 2EGHA 3IQWA 2FQXA 3AVUA 1P6UA 3BB3A 4NCKA 4P2GA 5AI4A 1H1DA 3OICA 2P4SA 2X8BA 1ZXBA 3LHIA 1SQGA 3ZI7A 4BWFB 1TEZA 1GP2A 1Q22A 4G67A 4W9MC 3L8YA 1LI4A 1D09A 5HFJA 2CLHB 4X20B 1TM3E 2AFHA 1EGVB 1KYQA 2P75A 2FPOA 2QTVB 3OKPA 1Y0BA 1WKCA 2XAAA 3NAMA 5H70A 2PVPA 3OEWA 4F38A 3QEBZ 4BLTA 1C1XB 3FUWA 3G2PA 1NKVA 2V3CC 3AVTA 3DUFB 1Y9AA 2JW5A 3O8DA 3AB7A 1WCWA 4RKWA 2RMKA 4Y9SA 2J0EA 1H1TA 4B84A 2W4MA 4QNMA 5IF9A 4NYIQ 4OXYA 4LDJA 3R9WA 2ZQZA 1P4AA 4EPRA 1JQ5A 1T3SA 1RJFA 1T8TA 2QVZX 4M9CA 4BMVA 2WNIA 2X2OA 2ZTUA 3NNSA 4I8DA 4YK7A 2QAJA 3KAQA 3RSFA 1QAMA 1ZW6A 3CUVA 5A03A 1XMSA 1IBKB 2WWWA 3QRWA 2QLTA 3N53A 1NNEA 3GFOA 5IUKC 1JR2A 1G38A 3EIOA 3GV0A 3LUDA 2BTEA 4RV4A 2CMHA 2VIIA 1T9KA 2HWUA 3UICA 3VZPA 3E15A 3WNDA 1YR1A 3FNEA 4OA8A 3KQSA 3W78A 4B34A 1PCXA 3HA7A 2FSGA 1R6DA 2RD2A 1AB5A 4D98A 4IUDS 3DZBA 3A3KA 3EQ9A 4WK6A 2R97A 1USGA 1HBJA 1RBZA 3ZWNA 1IZ9A 4DJEC 5TRTA 4KMRA 2N47A 1GU0A 4LXQA 1G3UA 3PXCX 5G0SA 5HX7A 2QRQA 2ZJFA 4WKCA 1MHTA 1GRQA 4R69A 4FB4A 5JAQA 3D8HA 5DBEX 3AUAA 3VHLB 2R8XA 3B82A 4ARBA 3SSNA 3DBRA 4TTTS 5AJTA 3BMCB 5AXCA 1FYXA 3R0XA 5L6MB 2XE6A 1QANA 1V6SA 5FIUA 4EW1A 3E9QA 5DTQA 4IGKA 4FS8A 4H0FA 1TJ5A 5FL3A 4EA6A 1DG9A 1TVEA 4QICA 5EKDA 4MRAA 1F4LA 1YOBA 4V0LA 1Q1ZA 1H2RS 1PJRA 3ZC3A 4D9GA 1EXMA 4J49A 2QG9A 2WJIA 1Z4IA 3R3SA 4HGYA 3C6QA 3GLFB 2HJHA 3NCTA 4RULA 4JCOA 2YXBA 3AY3A 4MWEA 2DH6A 2OFWA 1WOMA 1D4FA 3GEPA 2PCLA 3KYIB 1S02A 3DOEA 2PJZA 2QW8A 2L82A 2RI6A 4KQ6A 4CKBB 4V1CA 1YSCA 1E6KA 4JU9A 3BKWA 1O87A 2C59A 1DV2A 2D0DA 1HNZB 2G72A 5I4KA 2NU6B 1MABB 3A4LA 4E13A 3GP8A 1QCYA 3KSZO 1KYTA 1WDTA 4GWKA 5LP1A 3D8NA 3VJKA 1YVUA 4M1MA 2J6CA 4L8WB 4R3WA 5HRCA 1ONBA 2BM9A 2UZ1B 3BRQA 4WZAA 2FE1A 2EHDA 3GCXA 2IELA 2XWQA 3B9BA 4JYPA 1LLQA 1NQUA 1XDWA 1UWVA 2AKAB 4RZHA 2X0NA 3D4NA 3O75A 4LWOA 4ZCSA 2IZ1A 4HH4A 4QM7A 1UXIA 2VL7A 2OPHA 4PPQA 3ESRA 1HT3A 2YVLA 2JLVA 1IZZA 3CKLA 1F2UA 4IDBA 5E8RA 4BGEA 1HEYA 1JSXA 2WJ4A 4G1BA 5LDHA 2XTJA 1BMTA 1K7EB 1XRMA 2FR8A 3C3DA 4P4UA 3ESXA 1KZ9A 2XUOA 3RS2A 3A9CA 2RK3A 2HO5A 2WE8A 2CNWA 3O6VA 4IPTA 1DMSA 5LU8A 1CIJA 3LWBA 1PWHA 2YYAA 3R0IA 1EUQA 1DJOA 4RBNA 3SX2A 4BNKA 4BNMA 1U90A 3AUXA 2XA1A 5I7RA 3F7NA 4V0ME 5IVKA 1LBIA 3AWIA 3VU8A 6NULA 3LHKA 1E5XA 1L6RA 1LSJA 5G3YA 1APBA 2E5LB 2VNSA 4G81A 1L1QA 4H1VA 1ZM9A 3HCBA 3IHWA 1I4OA 5CJ2A 4YAOA 2FX2A 4E1VA 3AESB 3PWZA 4HQFA 3MNFA 5KCZA 2WE7A 1E9RA 1RQ7A 1N2XA 1Z83A 3PPVA 3D7MA 2V59A 5AWFC 2D1YA 1SIOA 3M6XA 1N3LA 1IYZA 1T3TA 2HGSA 3TTXA 2DMRA 5E0KB 3UFXB 3MS4A 3KQNA 4DWJA 2E21A 2WM9B 3ZWVA 2V7EA 1F1BA 2WC1A 3LT2A 1KL7A 4ZT2A 3T52A 1HDGO 4BBPA 4ZFNA 3PT5A 5MFPA 1YZ3A 3FUTA 3QELB 3BE6A 1ZDMA 2PLRA 3IEPA 1W88A 3OCXA 2JC3A 1XRJA 1Z9BA 1OGJA 1N5IA 2KSQA 4A92A 3VYSB 3D31A 3PR2B 3V1TC 1I9GA 3KVYA 3GXBA 3RUIA 1PR2A 1BXKA 1HM5A 2PRKA 2RAVA 4N47A 3VH1A 4ZVLA 1C3JA 4OMDA 4KGDA 1IAQA 5A9TA 1G8GA 1FVFA 1K6EA 3TOZA 5HUJA 4KNVA 1LSSA 1NFRA 2IZ5A 2JFPA 4K6HA 1HDYA 3L5KA 1R4MB 3OHSX 1E3QA 3RYIA 5FUQA 3N2GA 1LLFA 4DR2B 1QZZA 2PY6A 3BK1A 3GAMA 3F67A 2WYHA 4S1TA 5A0VA 4LXUA 3TWOA 1RC1A 1WB5A 3OQIB 2GN8A 5AQEA 5D84A 2XCQA 2AMFA 4P93A 2QMHA 3HG7A 1CY2A 1Y6RA 2NU6A 2XKBA 5GV7A 3VPGA 5JS8A 3ICQB 1KYYA 1NW4A 1HDOA 1WMAA 3FX2A 3NEJA 3HCCA 2HCFA 4GPEA 2VP0A 4RD4A 3EBLA 3R7WB 3ACBA 5SZHB 3T1NA 1A69A 1P62B 3Q1LA 5JNUA 2MCFA 3R3XA 5KOHB 1FFSA 3R0QA 1IK6A 3GK3A 4W1RA 4ZIRB 5IMSA 4A0RA 3BD8A 1HE5A 3QM1A 3I76A 4WNAB 4MQ6A 1K7YA 2H1FA 2P91A 2PGDA 4NABA 4ZVOA 4DQXA 1URPA 2G1UA 2IY8A 3M89A 1RBMA 1UDXA 3NXSA 1DBQA 5KC8A 1I0IA 2CW5A 2EX0A 1F2UB 2N3ZA 4PCAA 4BP8A 4E5DA 5C7YA 5DGXA 5D01A 5AW0A 4OKSA 5EMHA 4YRCA 3TFQA 5HR5A 4HGRA 4WV3A 2X5JO 4JBLA 1TYEB 2LR0A 4EB3A 3VR2D 4Z0HO 3DBLA 2VDPB 3R77A 4WGGA 4E4RA 3MGBA 5KSOA 4ZEOA 3EX7C 3PLRA 3IDQA 3V8RA 1S89A 3C0KA 3ILHA 5EQFA 4BNHA 3ADDA 2QM7A 1I3LA 3UWDA 4A4DA 3HI4A 3CINA 2UVDA 3DDWA 1KXJA 2H1CA 1TVKA 3WJAA 3ZXIA 3F8TA 2G36A 2GPYA 2AYZA 3P27A 3QEMA 3BHIA 1V5IA 2QF7A 4HLCA 3MHTA 1USWA 4GPZA 4YMUA 3HGTA 3AESA 4RDIA 4F45A 1W85A 3GDWA 1KKMA 1C7JA 5JHHB 4A8JC 5JY6A 2J0UA 3FSGD 2WJWA 3I5YA 1YFZA 1P4GA 3JQEA 3BK7A 4GNKA 3OTOB 4PG4A 2FRXA 3OJFA 4MLPA 2RDMA 1RC8A 1Z0FA 3I1YA 1BHO1 1DT5A 2I3ZA 5HGJA 3P4UA 2LPMA 5CYFA 3ECCA 3VDRA 3PTAA 1A9YA 1QTNA 2ZT7A 3QF4A 2HGZA 4LZAA 1ZD5A 2Z3VA 5DM1A 4D2IA 5BUQA 1OWOA 2VA8A 1AK9A 3IAS6 4F4HA 3CIFA 4NFLA 1N4DA 1RP1A 3G1WA 3HFRA 1B2RA 3KOOA 2AOUA 5HVNA 2ZU6A 3UATA 5ALTA 4BNGA 2B61A 5KDOA 3P26A 2JFNA 3EA0A 1M6EX 4E5KA 4F5YA 3SX0A 3KR1A 1XAIA 3T7JA 3LPAA 2FA9A 4JYBA 5DYYA 1P4HA 3DLAA 4H0NA 2V0GA 1V11A 2DWPA 3H4IA 4HNRA 4X90A 4TKVA 1F2TA 3U81A 3H0EA 3AKZA 1U7OA 2VP6A 1RMYA 1PF7E 2W70A 3PQ7A 4BN0A 1R37A 2VWQA 4FLMA 2QRKA 1P0CA 1DX6A 4DJ5X 1T5IA 5KX5F 3WNZA 4RZ3A 2HCBA 5AM4A 3JPWA 3TTWA 1DIAA 2DJIA 2AK3A 2ZUEA 2X7JA 3QLJA 1C7RA 2QTNA 2W6JA 3DG9A 4X85A 4RVGA 1QRSA 3NC0C 3ZNQA 3K2IA 5KNDA 1M2OB 4OXQA 2J7KA 1XJWA 5CG1A 1P9OA 1K0FA 3UV7A 3KYJB 5LA6F 5CPFA 2F1JA 1F9AA 5ICGA 3H17A 2VQDA 3N8KA 2ZIUB 3CZRA 4BFVA 3WWCA 1M6HA 5TY0A 2AZTA 1Y6QA 1H4SA 4BX8A 1SBNE 2IEGA 2GNOA 2V1XA 3DZCA 3O4JA 4Q7MB 4KXFB 4KMSA 3DF7A 1IZYA 1EQUA 1U28A 4Y8VA 1C3OB 1A76A 3BH0A 1O6CA 3C5WP 4MVYA 3RUCA 4D3XA 4F46A 5EP1A 5AJVB 1P18A 1KGSA 4YPVA 2LD4A 2I99A 2ID9A 2J0VA 4DANA 1N2JA 3R3HA 1GG2A 2DPHA 2NT4A 4OYRA 3IAFA 4BLWA 4UFPA 2BIFA 1EFLA 3GCDA 4UMEA 1HQKA 4O4IF 2JFWA 4D0NA 1P19A 2QT9A 4O1MA 4Y1RB 3RVPA 3T7IA 2UZIR 1UOQA 3EN0A 1DCTA 4NF2A 5F1YA 2H5IA 2BGRA 5FPKA 3KQLA 2R60A 4M0LA 3WFIA 2VCYA 1SN7A 3G6WA 1RI3A 2G17A 2ZTHA 2IDMA 2INGX 1EYZA 4X3CA 2PN1A 3GUYA 4RTQA 2K7ZA 2I4TA 5CVJA 2HMWA 4A6XA 2ZJ3A 1BXRA 3MS7A 5AH0A 3GJ8A 4LMBA 1QE5A 2W93A 4JWTA 4TN5A 5E3HA 4M8LA 5KX5B 4N0QA 1MAHA 1PL0A 1QOZA 4LX8A 2X2PA 1B8PA 3QKUA 4L8LA 3V4LA 3SZUA 1QV9A 3VH4A 2J1LA 2W6NA 4E2ZA 4DVGA 2I4OA 4LF9B 3O8BA 1EWQA 3WIOA 1ZGAA 2VDKB 4P92A 1CFZA 2CJPA 4RHXA 1FU7A 2VLBA 4LHYA 1B1AA 3RSQA 1GRCA 3WRWA 3WIBA 1R7RA 3UTDA 5C2JB 2W6PA 1FFWA 3R2JA 2ONCA 1KHHA 1V11B 1EU1A 1ZU4A 3O7MA 1MV5A 4KAAA 2HHAA 5AI8A 1TYCA 5IJ0B 4AQ7A 3H1GA 4I66A 3IBTA 1Y1QA 5FV4A 3RIYA 4U39A 4X1YA 1PYOA 1A4XA 2W2XA 3LL7A 4DG8A 4PLCA 5TS2A 4LYYA 2O8NA 4LSGA 2YWFA 5DYWA 2YIDA 2HA4A 4P98A 1LXCA 1G2PA 1V95A 2KWIA 2H31A 3AONB 4FKZA 2YYYA 2RH5A 4I36A 4QD3A 1OXKB 2BFBB 3KFVA 3FFXA 4A0SA 4O5AA 1Z45A 1K3FA 1ZK1A 4DBLE 5JH7A 4PYNA 4Q34A 1V6CA 3ZUGA 1RMTA 4RMIA 4WFQA 2NNWB 5DI9A 1RJ9B 3SR3A 4EVSA 4GR5A 4N7JA 2ATVA 3V4RA 4ME6A 5LXTB 3P0FA 5EIHA 4V0MA 3GNTA 4IAOA 2ZTVA 1YJ5A 4L4ZA 1M7BA 4BFSA 7REQB 3FHCB 3GLQA 2DFDA 3FXAA 3CLSD 2I1LA 4MI3A 4Z6KA 3FRIA 1P60A 2WWHA 4JH0A 3EAQA 5DHRA 4RLFA 1YCDA 5MN4A 3R75A 2P6UA 4EHKA 1J8MF 4M1QA 1TDJA 4WKBA 1WLYA 4BASA 4CDMA 4GPD1 4D25A 1COWA 5FHRA 1Q1AA 3D3KA 4LWQA 4RW0A 3TKYA 1P5HA 2F9MA 4J6FA 3RJ5A 1P7ZA 2KBEA 4OP3A 4UDOA 3CEPB 4QL3A 2GD1O 1PTJA 2VA9A 3ROEA 5KWEA 1MOQA 3L8HA 4IVNA 4GYYA 1R0XA 5IDVA 2DXIA 3K0EA 5FFFA 4OJYA 3TN7A 1I3MA 1VECA 4IY1A 4K9RA 2I9KA 4J29A 2W42A 3DE3X 2CXQA 4PHHA 2BKAA 4F3NA 4AZ3A 4ZICA 1YS7A 3PLNA 4NBNA 3X2FA 3NTRA 3PHLA 3TKLA 4G8CA 4MPTA 2HJWA 2UYQA 3G2NA 1ZA2A 3BH6A 2KPOA 4FMDB 2F59A 1TGVA 3ZQKA 1KAQA 3ZZTA 4YMHA 4D3YA 2JI6A 2OZVA 2WJZB 3WSVA 5JMWA 4JOCA 1V1MA 2XGSA 1H6BA 2VK2A 3STWA 1MQ8B 3G79A 1CX9B 1UXKA 2B99A 2FPMA 2TS1A 3DV2A 3IFSA 3KUKA 4OB6A 4PTYA 4CE6A 5GP1A 4LRYA 4TMWA 1NXTA 2G77B 2VT7A 1G0OA 4KU4A 3RYFB 1JHVA 9LDTA 3ZOZA 2XECA 3QXSA 5AW6A 3OP4A 4JVOA 4L16A 2JS7A 4JX8A 3G7SA 3MT7A 2JNWA 3H75A 4ZI3A 3GRYA 3HCWA 3JALB 1CJTC 2WVJA 2XD9A 4RF2A 2MOKA 1Z17A 1JA1A 3DWGA 1N0UA 3T15A 3TIXB 2F7SA 3DOIA 2CB9A 2J3HA 1L7NA 2YBDA 3ZR4B 3O8OB 3N2GB 3GLSA 3QFHA 4G0OA 3IUSA 5E9AA 3VKHA 2BRUA 1NNLA 3P71T 5EZYA 2BE9A 2VDOB 2BTOA 3FZNA 1SU7A 4QYSA 3QLVA 3BZWA 1MH1A 1PN3A 2BFBA 1Z29A 1DG1G 1AUPA 1GGMA 4KYIB 1KIMA 1TUGA 1DJPA 4MV3A 5BSUA 1OZHA 2E4ZA 1V3VA 1EFAA 4XYLA 2C1XA 2BFDA 4OHRA 3S70A 1CJVC 4UNSA 5K1ZA 4ITRC 3LBAA 4CL8A 4HXYA 2VRCD 3FUUA 1KIAA 3FNQA 3PRHA 4R51A 4RY0A 6CHYA 4ED9A 5CP8A 5G40A 7REQA 3ZVMA 4BYGA 4C2BA 2XMZA 1E2JA 3HDVA 2CLMB 3P2MA 3TR0A 3EJ6A 1PTKA 3HZOA 4DLUA 5LMUB 1P0MA 2QJRA 1N8NA 4JU8A 4NK4A 4QXRA 3C43A 3GLVA 4OXNA 1SJ9A 3VZRA 3I28A 3S1LA 1PGJA 4UXIA 3TINA 1JFFA 3IAM1 1J8VA 4LJ7A 2F1RA 4B45A 2PR7A 3NVMB 3QX8A 4MS1A 1T26A 1G2QA 3T7CA 5FXMA 1U7DA 4Z3KA 4E7OA 1ZKDA 1NXPA 4E5NA 4CM9A 3E3LA 3M81A 4DB2A 3RS7A 2V65A 3QI7A 2P78A 2HA0A 5HCIA 4UFNA 2Q50A 4AY4A 4UBLA 2DGDA 3QUSA 4G4SP 5EJAA 3VJLA 4CMAA 3DMTC 5B3KA 5CA0B 1HSOA 5LVAA 1VJDA 4D0RA 2P2GA 2AW3A 4LWPA 5CYPA 1OFHA 1N0IA 1GSOA 1QK5A 1WHSB 4RENA 3DE6X 3REQB 2YUIA 4QHYA 4DSZA 1C4OA 5KYNA 1JWAB 4N3BA 5LZ8A 3RK4A 2YMMA 1JFLA 5J4VA 3WYBA 4TYNA 1DAOA 5JYEA 1R9JA 2GB4A 1FUUA 2XF2A 3M5WA 4DLYA 3KCNA 3D2LA 3HNRA 2AX4A 3T9CA 1GQOA 1EFTA 4S04A 3LW7A 3PB3A 2W2QA 4UHCA 5B4UA 4CIWA 5KTKA 2VRCA 4JA2A 5KUTA 1RZRD 3V2GA 2GHRA 5CDYA 3MTJA 4B5KA 1N7IA 3DOJA 3KT0A 1RHJA 2JCXA 1WU7A 3CMCO 3D3JA 1CDZA 3PCRB 2I3DA 3EXFB 2NSHA 4EPYA 5J63A 4OQDA 1V43A 3TAUA 3HJUA 2OZLB 1IVYA 2DR0A 3BQ9A 3H8WA 5THKA 2ZWVA 2I7TA 3CA8A 4PLWA 3BA6A 1X8LA 2DKNA 2PKRA 2G9NA 3OZRA 2NPIA 1UP7A 2CD7A 1D2EA 3BDIA 4RTKA 1E4VA 3PEEA 4AX8A 5DB4A 1R9NA 1M2VB 2IC5A 5JEEA 2BDEA 4CGZA 2IEIA 3DZIA 1BIFA 3ND6A 4XOIA 1OXSC 1X38A 4DPLA 2HHLA 2JBAA 3D4PA 3NIDB 3GJYA 3T1YB 3DEIA 4L28A 4NOKA 1G21A 3RVSA 3PXDA 2P6MA 4JP1A 3QOFA 1O6ZA 4RK7A 4K9PA 4QXQA 4YJ3F 1SFRA 4CT4B 1QCZA 5MN5A 5AHXA 3GLKA 3L46A 5A5DA 1NW5A 4MI1A 4OQ4A 1QHEA 4RA9A 4K2AA 4O2RA 1TGYA 4AB1A 1Y4SA 4AJEA 3BMNB 4CW7A 1QIHA 4YUZA 2D62A 1GT6A 3K0HA 3OY2A 4W4TA 2Y3IA 1L5WA 3ECSA 1YFJA 5TMPA 4G5YA 2C4WA 2C83A 2DSTA 3FZYA 4Q93A 1L1RA 1LBQA 3CLKA 1XRNA 4CBVA 4DMGA 4CM4B 4KO4S 5AKHA 1PT9A 2B6HA 3D8BA 4FR5A 4G0ZA 3WLPA 5DGCA 1P3Y1 2QT0A 1F20A 1T5BA 4A0HA 1CJUC 5E1DA 2XB6A 4GNRA 3EXG1 1K06A 3HVJA 3OZFA 4PICA 1MQSA 3QA9A 3WSWA 1DLJA 3MRVA 4B6EA 4C07A 1ECLA 1JVNA 2Z0MA 4DWVA 2BCJQ 1B6RA 1GNQA 1U7PA 4XTCS 3RJ9A 3AVOA 2HFJA 4BOYA 2ALJA 4K2HA 4FDVA 4TKUA 3BUSA 1XZQA 3NTXA 1TQ6A 1WUTA 2H1IA 3WAKA 1Y5NA 3HNPA 1Q0LA 3MRSA 4H59A 2IE8A 2GM4A 1OX6A 3WDKA 4KX5A 2BOVA 1PU2A 1OMOA 4NE2A 2CYCA 4HV4A 1N9ZA 4EMBA 1NIPA 1OTHA 5K01A 1Q84A 1H2YA 1GVHA 3HGQA 3NEPX 4OHUA 3I34X 2CZGA 3OZTA 3ZJVA 3IEXA 3RV3A 2FEPA 5BXQC 3SHVA 3D54D 1MVLA 3L8FA 1BX3A 4LY6A 3L4EA 3C48A 3NZEA 2EYQA 2YVAA 2JIZA 3D8SA 5JADA 5E4TA 1EZZA 4REQA 4C14A 3PRKE 1ILEA 3KIPA 2EV9A 3LZ6A 3DBVO 3PHCA 3PR3A 4G0MA 2QSJA 3NV9A 3WSTA 2QB5A 2IV3A 1UBRS 4N01A 5KYYA 3ER8A 4Z54A 3GMTA 2BHTA 1Q77A 4F60A 3ND5A 3SY8A 3VPSA 1UBUS 2NSDA 5AW1A 1C7ZA 1UM8A 1H0SA 4P3YA 2CBGA 3BVPA 4FYMA 1KAOA 1XVUA 1DJQA 2BISA 2XIQA 1WE2A 3AFGA 3GJ3A 2EF0A 2OY0A 5IANA 4J4TA 4MVJP 5CK4A 5CTJA 2BSQA 4PXAA 2FWAA 3Q6IA 1FEZA 1O9HA 4WKPA 2ZJAA 3CX6A 4O2BB 2C92A 1MB0A 3WWDA 3T7KA 3T3GA 1UJCA 3C85A 3JRXA 2PSSA 4LZOA 4E2YA 4J1NA 4F6RA 3L8GA 1I0LA 3CH7A 2MSLA 1EVIA 3IUEA 5C31A 1KZ6A 2WV7A 2ACVA 4WXYB 2GEVA 5CEJA 3X1MA 5LCXA 5BQXA 2PH3A 1OXXK 2X19A 4G0XA 2VXBA 4JNKA 3DJFA 4YUAA 2XWPA 5LD2B 1AN9A 1KK0A 3EZXA 3KC2A 4KR0A 3T7EA 1C80A 2CHUA 4J7CA 2C54A 1U2TA 5JZBA 1Y4ZA 2IUEA 2YZ7A 9GPBA 3R6GA 4CCAA 4DPMA 4U9IS 3UZUA 1FIUA 1FP4B 4IYJA 2JAPA 3PC4A 1USVA 1OI4A 3I61A 3Q15C 4RTSA 3LLSA 5JD4A 3PXGA 3FM9A 2Z5VA 1DO0A 4CLRB 4ZCMA 4DCSA 2YWCA 2EGGA 4IZ6A 3KELA 4NAHA 3SFZA 1P17A 5TPWA 5K8VA 3D5TA 1IOZA 1UWCA 4DABA 1AC5A 5TC4A 3S2FA 1M0EA 1M1YA 3EWAA 4FOPA 3WL4A 3T34A 3DMTA 3I3SR 3A2LA 4DBLC 3UMYA 1WB6A 3ZK7A 4YUWA 3ZCQA 3G5MA 3IKLA 2ODTX 5DBOA 1Y7LA 1L5QA 1SULA 1GPUA 3DWEX 1QWOA 3DEJA 3QUQA 4GOLD 5LQSA 1Y5IA 3IDAA 4FGUA 3F5FA 1R4ZA 4JGIA 4XDYA 2M6KA 3SZLA 2EIXA 1PS9A 2VOJA 4GT1A 4D1YA 5DOVA 2FPPA 1QHNA 1R88A 1KSJA 1U80A 2CCGA 4Q4AA 1VJ1A 5DMXA 4AXXA 1VRWA 4HUTA 4K6GA 2COUA 1PUJA 1W0KD 1T29A 4TRNA 2BSXA 2WHYA 16PKA 4GZ6A 2XOKD 3A27A 1B3RA 1NJ8A 2H2FA 4YX9A 2OXIA 3EWNA 4GSYA 4BNIA 4MLCA 3WLQA 3HSYA 5GY7A 1CETA 1C29B 1T3LA 3EZGA 5BSRA 2BBOA 2IYTA 5KPDA 1MX9A 4OREX 3TG2A 2GPTA 1WEHA 1LF0A 1PYDA 3CLHA 3NP7A 4FS3A 4G89A 4LOLA 1RACA 1ZHHA 3AVQA 3GEIA 3SF0A 4AICA 3RKUA 4QYIA 2DR3A 4MSUA 1IEWA 3SOPA 4C1NA 4NONA 3QHAA 2VZLA 4LK2A 3JARB 2O3QA 4KDEA 4LV5B 2W8BB 1RADA 4MWOA 1SQSA 1Q1GA 1P8AA 3TQFA 3DCJA 6PFKA 2EHJA 3EASA 5CJPA 4ZD6A 2WWVD 3UIEA 3UO8B 1EUDA 2FX5A 2LKCA 5GOZA 1K8RA 5HE8A 5B6JA 1KHTA 4JY7A 3I3OA 4D43A 1WETA 1ABEA 1ZIYA 3ONDA 1DOHA 3AJ9A 1U1CA 3EH1A 4PLYA 3W8EA 4FKBA 1AM4D 5K8IA 2EKQA 5AK5A 1X70A 1KBQA 2KLHA 1LRJA 1ULAA 1VDZA 2IEYA 4JA0A 4R31A 1AQIA 2CMGA 3BIOA 1BWRA 3DEKA 2F9FA 1T10A 4F4JA 3U19A 3K5IA 2YZ2A 3LPNA 1P8JA 2ZITA 3DA8A 621PA 5DM60 2PSFA 4P4NA 4PZDA 1H2WA 3B7PA 3T7RA 5LKAA 3R41A 4HSGA 4OHPA 1FNSA 4LHEA 3W3ZB 1WL8A 2VF8A 2GILA 4LG1A 3IOMA 2O1WA 1ODLA 2QTLA 3IQXA 1UBCA 4G97A 3EUWA 2HV8A 3MIZA 3LKBA 1GUAA 3NC1C 4OUDB 4LXXA 4R0VA 3PXUA 4QTYA 1VPTA 5REQB 4KQKA 4Y0AA 2HIMA 4AUKA 1CJMA 2Q3DA 1EDZA 4M98A 1YB5A 4CIXA 2GPNA 3E3AA 1P2VA 3DD1A 4MARA 4U7JA 2PMDA 4IXWA 5DIZA 3FTQA 3PQ5A 1PL6A 3ZWPA 1B23P 4IHJF 1B0ZA 4X3PA 1Z6ZA 2WKWA 1JKXA 3ETHA 3IUBA 3TW8A 4DJJA 4UU1A 5KQMA 3RQIA 3Q88A 4PG7A 3F6PA 3SS8A 1LTHR