4LDJA

Crystal structure of a gdp-bound g12c oncogenic mutant of human gtpase kras
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 62
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ldjA00
4GMXA 5TDHA 4D82A 3FWYA 3VMFA 4A15A 4HEJA 2V6IA 1OKKD 3SR0A 5JWRA 2WWYA 3SEAA 2A7QA 1ZM4A 2X2FA 2B8WA 3CX6A 2VP6A 3H2YA 2Z4SA 5CITA 2BJWA 1FP7A 2JIZA 2WWGA 4LYAA 2OT3B 2ZRFA 4C0BA 2FFBA 3CM0A 4BZPA 3GLFA 1US8B 4DLWA 3K9HA 2WJIA 4PHFA 3CF6R 2V6JA 3B78A 1P60A 4DSNA 2YINC 3G5UA 1W4CA 3IILA 1DOAA 1UBGA 2QP4A 2WJGA 2WWHA 1LTQA 1OYYA 2GDJA 2LWIA 2JJ1A 1R6BX 3SE0A 5L3RA 3SDZA 4A82A 2HJGA 4NYIQ 5KHOC 4IVQA 1NJGA 4LHXA 3IEVA 1GRRA 3DMDA 2WOJA 1MKYA 3IIMA 1V43A 2QMHA 5KNCA 1R0YA 1J8YF 3P4XA 4E03A 4TMXA 5DHAA 1M74A 2QQ0A 2AXNA 2YKGA 3ASYA 1TTTA 2XNDA 2KBEA 3AF1A 4IFBA 1AM4D 1AQYA 1TAGA 5G3ZA 4OI0A 1B23P 4NDZA 4GBMA 3WNBA 1E9AA 4LYHA 1WBDA 3EG5A 1SVOA 3GD7A 1EWRA 2VP2A 1DARA 4YDHB 1QHSA 2PZEA 4LC0A 5B57C 1RW4A 2FPLA 5AWFC 1E4YA 1JPJA 4FI3C 1KMHB 2EWWA 3QJYA 3KTAA 4B32A 1XX6A 2WM9B 2ZRLA 1XTKA 4JSTA 3LQQA 3H0KA 3TMKA 3CF2A 1COWD 3I73A 4KHZA 4OHZA 5AJXA 3UG6A 1DEKA 1G5PA 4LPSA 2GZAA 2WHXA 4DLTA 4WZAE 4R2HA 1XD8A 4DUGA 1YQTA 2AKYA 2CK3D 5HE9A 3RVBA 1KNXA 3GLHB 2D7DA 4GPTA 1E9DA 1NMXA 2KE5A 1W4BA 4I1SA 1M7GA 4DT1B 1EGAA 1N5IA 5FI0B 4HAXA 4OQXA 1VTKA 1EXMA 4G5QA 1G3RA 5J4KA 3K0FB 1XMVA 4L8GA 4Q4HB 4UNQA 2WMNB 4XH9B 2A5JA 1R5BA 1F2TA 1Z06A 2C03A 1RYHA 3HPRA 4X8MA 2C98A 3I1FA 3D3QA 5KUTA 3TSWA 3ASZA 2D2FA 3QQ5A 4C0QC 3B85A 3PJRA 4DSTA 1WQ1R 3PR1A 3UPUA 4M9ZA 2ZR0A 1ZUHA 4Q5IA 4C7OB 1KJWA 2QQEA 3BRWD 4JLVA 1SULA 1RIFA 3CNNA 3IHWA 4K8OA 4YLGA 1T8TA 3L0PA 5JWOA 1G8PA 1Z5ZA 2R9VA 2GCOA 4NH0A 2FX3A 3GEIA 4V03A 4DCSA 3S1AB 1KYIA 1TX4B 4L16A 2VP4A 2G88A 1UAAA 4N1AA 1G8HA 2Z43A 1GM5A 2GJ8A 1VCOA 4MYUA 2WTUA 1XJ0A 1FNNA 4S35A 2DWQA 3KZ1E 5HTKA 2WJJA 2HXYA 1ESMA 2D62A 1XCPA 5KTYA 2W0SA 1HT2E 1NMZA 3DVLA 3Q9LA 2Y8EA 4OHYA 5F2EA 2FGKA 2VPPA 2AD1A 1ZM9A 2FMXA 3QBVA 4QGHA 4RD2A 4KBFA 2W6IA 5KU1A 4LHZA 5FBVB 4MH0R 4BLQA 2A30A 1CULC 1OIVA 5JRJA 1XD9A 1W47A 5DN6A 1SXJB 5CLQA 2GCNA 1KO1A 1E2MA 2Q3MA 4OHXA 4ASUA 2GHIA 1OV4A 1XBTA 3AEZA 1S9DA 5H68A 4DWJA 3RC8A 1GTVA 1RFLA 5DNYB 1U0LA 1XXHE 4KLNA 5CDFE 3K70D 3HU2A 1P73A 1UKYA 3PENA 4FW9A 3U3KA 1ZP6A 1FL9A 2ZREA 4EKDA 1EG7A 4QBFA 2BBOA 1YZNA 2ZRDA 4QC2A 2J0QA 4B2IA 1EFHA 2I3BA 5TXGA 4QBHA 1PLLA 3A4NA 4Q7JB 3RYTC 4BFYA 1G41A 1NBME 1YU9A 1MRSA 4F38A 2YWGA 1Z2CA 2ZSBA 3SYNA 4Q47A 3KQNA 2P6NA 1FQKA 1T0HB 4RD0A 1N6NA 5C1BA 1EFCA 1M7BA 1NMYA 2G83A 1EX7A 1LF0A 4CEHB 2GF9A 3OZXA 1QRAA 2ZROA 1UM8A 1W2GA 2GAOA 3NDPA 4DLXA 1KI6B 4E09A 3DDCA 4B33A 1TEXA 1X1RA 1XEWY 1TF5A 2PL3A 4DLZA 5JZVA 2PJRA 1XZQA 5JBQA 1OPXA 5K8UA 2QROA 1UBCA 3P4YA 4H9GA 2DHRA 4QM7A 2GETA 3B1VA 2B6HA 1M2OB 2ZSEA 4I81A 4YC7A 2QMUA 4JL6A 3K70C 5IK2A 1UBEA 2JJ2D 4CEJB 3W6PA 3SHWA 2O8CA 1SXJE 2WPDA 2XB2A 1R8SA 1FW6A 3SFZA 2BWJA 1HA3A 5D3MB 2C8VA 3CONA 3W3AA 3TR0A 2QAGC 1HYQA 1KO7A 3X1YA 4YMUA 4URZR 4C0AC 3EPKA 4OK5A 3GJ5A 4ESHA 4IOMA 1GSIA 1Q12A 2R65A 4HB2A 1D2MA 1Q22A 3VKHA 2PMKA 3EC1A 1P72A 4DRZA 4URXR 3GPLA 4PC3A 3VU9A 2DCUA 1T5LA 3CKLA 5JS8A 3H4MA 3CBQA 1CR4A 4EJSB 2QT0A 3PFIA 1HV8A 4MKGA 3KJGA 2GAAA 4G5GA 1IOZA 3KJEA 4CT4B 2O8EA 1GNQA 1XD2B 2ERYA 1Z07A 4A6XA 3SN6A 3ONWA 2QU8A 2B21A 2QI9C 1VIYA 3SC3A 1KZGB 1WB9A 2KJQA 2O8DA 3EAQA 5FPKA 1XRJA 1US8A 2W2XA 3QF4B 3T1QA 3TLXA 1JB1A 2GEUA 5FTNA 3PXGA 3KQKA 2V7QA 3LXRA 3U5ZB 4HAUA 3ZD6A 2YC2C 1VPLA 2VSOA 4M4SA 3U7GA 2IL1A 3RRZA 1LS6A 3S1AA 3QY0A 2OILA 3SJZA 2W6ID 2AR7A 4PC2A 1G6HA 3ADKA 4ACAA 4DDVA 2QEQA 5J4YA 1QG2A 3LRPA 2OLJA 3RS3A 4BUJA 2D7CA 1KK3A 3EARA 4GOJA 5FFMA 4RCYA 3AB3A 2XJ4A 2KWIA 5SZHB 4EJSC 3C15C 4QHTA 1RZ3A 3VR6A 1AGPA 3PV0A 4PSVA 5DSZA 1AZSC 4GZMA 1FQJA 1U8ZA 3L8ZA 3GLHE 3OE7A 1XCMA 1KKMA 2AWNA 3KUDA 2VHTA 3HR8A 3A4MA 4W7SA 3PQCA 4B47A 1T4GA 4Q1DA 4LX0A 2GK7A 3LQRA 1P5ZB 2OV2A 4IDQA 4LYFA 4ZKEA 3WBJA 1XJQA 4GT1A 2J45A 4LV8B 3A37A 3M1IA 5LDDC 3Q72A 3VR1A 4JKYA 4BFXA 1C9KA 5DLQC 4B6FA 3U4QA 4IEIA 1VYVA 2B7CA 1RJ9B 2ZSDA 4HI0E 4W5HA 2XEXA 2RHMA 3BXZA 3R9IA 1GRQA 2H16A 3EZ9A 4BWYA 2XOKA 3HDTA 3K0AB 1X6VA 3Q3JB 4G1UC 4KCGA 1FTSA 4BFSA 4DDTA 4WOPA 3MFYA 3A36A 2QUZA 2WICA 4D4KA 1L2TA 4BRUA 2WBLC 3AQ4A 4DB4A 4QM6A 1R8QA 4AKEA 1HQYE 4GMDA 5AK0A 4LRWA 1J8MF 4IW3B 2AHOA 2H7VA 5HKKA 3FYHA 4M1SA 3K1JA 1S1MA 1SVIA 2PH1A 2QTVB 1G3UA 3T15A 3PUXA 5E3HA 1DPFA 2F1HA 2D2EA 4HUTA 5B64A 3DKVA 4QGFA 4Q21A 4MGIR 1DG3A 4TWZA 2ZANA 3IPXA 4DDUA 1X8JA 3Q8XB 3AF0A 5KOYA 2JCSA 1RC8A 3IBYA 2C9YA 3JVVA 1HT1E 4M53A 1IN8A 3AGPA 1W48A 4RFSA 2GRJA 3MWYW 4MRRA 2IHBA 3RSOA 2JATA 2HCJB 2NZ8A 3KJIA 4V0ME 4Z51A 4JT2A 3FHTA 2OSBA 3AVTA 4B48A 1UEJA 3K9GA 3GLIA 2ATXA 4TMZA 2WWWA 4KLZA 4HLUA 2A5DA 4N3NA 4PX9A 1ZM3A 1OXUA 1FTNA 1XCGB 4PPGA 2BM1A 3C5CA 2ZM5A 4YXWD 2ZU0C 2FA9A 2JJ1D 2ZJYA 4UJ5A 5FR1A 4F4JA 1CJUC 3FHOA 4WXPA 4OK3A 1KMHA 3MWLA 2MMCA 1TPZA 1OSNA 3FFAA 2ZRBA 5HE8A 2RGGA 1U0HC 1SXJA 2FFAA 1PLJA 4ABYA 1QHYA 1IXSB 3G82C 4L15A 1FX0A 5IHPA 1G18A 2JDID 3CX7A 3NVAA 1SKYE 5KSZA 4B3GA 4E07A 3AP2A 1G64A 3KXIA 2IYZA 4B3BA 4XD7A 2MMGA 3WXMA 3F3YA 5L8VA 1GUAA 3NBFA 1E2PA 5JCZA 2J0UA 3CWZA 1QZXA 2JAQA 1G6OA 1KSHA 3C16C 3LLMA 4O0MA 1S1CA 1AN0A 1QG4A 2LKDA 3K09C 3NTUA 3EX7C 4MYTA 5G40A 5G41A 3U3OA 1KTVA 2F3TA 1AGRA 3GEEA 1QHNA 4B75A 4ZDIA 5BN5A 1YE8A 3QXHA 2HDNB 4Z1MD 1NLFA 2ZRMA 3QKUA 2X8AA 2XOKD 3B1WA 3QKRA 4NP6A 2J46A 4TMTA 1KI6A 2EWVA 1JQJC 1XTSA 1R0XA 4TYQA 2Z4RA 4JLBA 4FXPA 3UMFA 4RFVA 1TQ6A 3ZYCA 1NVXQ 1Z22A 5EE9A 5FPYA 2QE7A 1ZD8A 4OI2A 4TL8A 4U7DA 2OESA 4II7A 2EU8A 4U02A 1Z6YA 1KIMA 2O8FB 2OBLA 2JJ8A 1DO0A 4C0KA 2CL0X 5KSOA 4DVGA 1II8A 3PITA 4NCIA 1ELOA 3HYTA 2GBLA 2IYRA 4E22A 3MWKA 1N6HA 2UZ3A 3UG7A 2XNDD 2ODNA 2CVHA 4A1FA 1KHTA 2ZE6A 1WXQA 1NN0A 1Z0JA 3PUZA 4X8OA 3EIHA 2ODWA 4OQNA 1ZIPA 1WA5A 1I4DD 3JVUA 4TLBA 1GWNA 1T3LA 1W0KD 1VCNA 2J0VA 1JXOA 3C8UA 3MJRA 2GKSA 4JZKA 3DZDA 1Z6AA 4XSHA 4M2LA 1U9IA 3QPVA 5KDDA 3X1XA 3T12A 1NN1A 1HURA 3UATA 2IYWA 3R20A 5CLLA 421PA 2FSGA 1T5IA 3FFBA 3I32A 4PPQA 1LNZA 2GBLC 1DAKA 4NONA 1FMLA 2IEYA 2UVQA 3K0FA 3IQXA 3NH9A 4ARZB 4Q9JA 3MLEA 3CZQA 1VG1A 1GFIA 3B1XA 3B13B 3SFVA 3T35A 1XPRA 4DT1A 1RE0A 2WPDD 2ZJZA 2R6AA 4MYHA 2IYYA 4A92A 4Q4AB 3THYA 3OEEA 1CR0A 3LAWA 1OXSC 4Q4HA 5FOSA 4C7OA 2QORA 1ANKA 1XEXB 4YXWA 3ZVMA 2O52A 2DFLA 1VHTA 1H8HA 4KVGA 3AVPA 5CB8A 4RZ2A 2XB4A 1N6IA 2RAPA 2AFIE 3R9XA 3TBKA 3DMNA 1NL3A 3IO3A 3T1OA 1CS4C 4O25A 3OEHD 1AA9A 1IXZA 5LB4A 1HTWA 4LBVA 3W5IA 4XWOA 2IYSA 4MQBA 3CRRA 2RHDA 4C0HA 2JLVA 1W7AA 1X8KA 4HUQA 1OH5A 2VA8A 3B60A 5KPJA 1D8TA 1CU1A 4CYMA 1SVWA 1Z8FA 3I5YA 2VEDA 4XTRA 4DLVA 1BMFA 1AS0A 2E1RA 2H18A 5FBRB 4AI6A 1YR7A 1E9FA 1S0UA 3QEJA 1YZLA 4PSAA 5HR5A 4FN5A 4G3XA 4UNNA 3TW8B 3BFVA 3THOA 3THWA 4GRAA 3M0EA 3WRYC 4DHEA 5IK2D 3ICQB 2DWPA 1ZAKA 1E1RD 4IOKA 2VLIA 2RMKA 1HE8B 1QHHB 2VSFA 3KB1A 3RABA 2NO1A 1SVKA 3VX3A 1NG9A 4DEXA 2C9OA 4Y0AA 4HAZA 2J87A 1VKJA 4O2RA 1E9CA 2OFWA 1KDTA 5CJPA 3LD9A 4TL9A 3CPEA 2WAYA 1IBRA 2VQSA 4B6EA 3N5CA 1FNMA 3THXA 1N5LA 1UKVY 2F55A 2XTMA 3QKSA 3RWOA 2PEYA 1XTQA 2PEZA 4LYJA 2C78A 4O2LA 3U44A 1JJ7A 2V9PA 1NBMA 4TQUS 1N6KA 2O8BA 5FPTA 5HZKA 2JIZD 2J7PA 2V3CC 2JGNA 3KL4A 1U94A 4QXAA 3GLIE 5KNBA 3CRMA 5FOUA 4CZ2A 3OE7D 3B1YA 5C4GB 5J4HA 1OE0A 2BMEA 3ADBA 4YMTA 1TF2A 4UJ3A 3T5GA 3D6TB 1DAEA 2QAJA 4DJTA 2ZRNA 1CF4A 2CL7X 3TSOA 2ZRIA 4LHYA 1M1YE 2W83A 4LJ9A 1T0JB 1Q44A 5CIQA 4IDNA 2KSQA 1P7CA 4IVPA 2OFOA 1IN4A 2X2EA 1ZD1A 1JI0A 3AH8A 3I72A 5A5GA 2CCKA 3BERA 1NNEA 2BIFA 1P4SA 2FE4A 4BECA 3RS2A 3K0EA 1Q1BA 5J4VA 1DE0A 1NG1A 1IY1A 3GJ0A 1E2QA 5HPYB 2O8CB 2WSMA 4JL8A 5C18A 4P32A 1N0WA 1W49A 2OE2A 4Q1EA 3TR5A 3ZS9A 4FMCF 1N6PA 2XGJA 3VU9B 5EXXA 1IY2A 1DVRA 3O8BA 5E7JA 3BS4A 4HB0A 2ZQ5A 4MDFA 1KI9A 1KI8A 2RH5A 4HLCA 2MSCB 3B1ZA 4NMMA 1A1VA 2FSIA 1YR9A 2XTNA 4LCBA 3GP8A 4D6PA 4LJ4A 2YOHA 1KMQA 2RCNA 1ZNWA 3KTAB 1IXRC 3SYKA 2XSZA 2EW1A 3LY5A 4UQOA 2QM7A 4PZLA 2CNWD 4KO8A 4MKFA 3TQFA 3FGNA 5SZKB 1SGWA 2J7PD 3QF4A 1A2KC 1XD2A 1GKYA 2NQ2C 1IN6A 4EPWA 3JZAA 3U60B 1I2MA 2BVNA 2EFCB 2WV9A 1Z3IX 4EUNA 1WF3A 2FNAA 4KU4A 5LD2C 3PUYA 3NC1C 4A2PA 3ECCA 4WVFA 2CXXA 4BFVA 1JR3A 4Q4JB 4TTQA 2RGAA 1J2JA 5F98A 1BYIA 3SHFA 4CEIA 4F93B 4HDOB 2RGEA 5DGXA 2V1XA 2K5UA 1U2RA 1ZW6A 1BH2A 5F9FA 2IYQA 2FH5B 3LBNA 4FCTA 1Z6GA 1W5SA 3LWNA 2IUSA 4RY2A 4TQ9A 1AK2A 5FI1B 3GJ8A 1K8RA 3NHAA 1EFRD 5KNDA 1E2HA 2F1IA 4LOAA 1ZBDA 3BFXA 3A1SA 4X8LA 1E2KA 3KX2A 3WNDA 4A2WA 3CR8A 3F8TA 2C77A 2CLSA 1QHHA 2CDNA 1JPNA 3MAAC 4A0RA 4C9BA 1SXJD 2ZS9A 2NIPA 3G0HA 4Z8YA 5F9HA 3QXCA 4A8JB 3OHMA 4FWIB 3GMTA 1QF9A 5EZ6B 3VFDA 2VL7A 2XZOA 2HYIC 4PQYA 2NGRA 3QF7A 2YOGA 2J5XA 3QBTA 3UK6A 1R2QA 2J7KA 3B5JA 4OQMA 4Q7LA 5M04A 2GXSA 3P20A 1RJ9A 4IOJA 2Q9CA 5EP1A 4HZUA 2HJVA 3IPYA 3DEFA 4M9SA 4PANA 2PT7A 2QL6A 2WKRA 1ZC4A 1FMJA 3EZ6A 2YVUA 1JALA 4LJAA 4AG6A 3VQTA 1ZRHA 2V8OA 1UDXA 2AKAB 4PXAA 4RCZA 4DZZA 4D4MA 2KBFA 1IQPA 5AR1A 1AZTA 3QXXA 4BFTA 3C14C 4HDQB 4QGAA 2FWRA 3QKRB 1E2IA 1XF9A 4PO1A 2FFHA 5J4LA 2EFDB 2QBYB 3RNLA 3GJ4A 1HH4A 2QENA 4LV5B 4Y0VA 1DAFA 2I1QA 1XFAA 3HJNA 2OEPA 1E0KA 4B3XA 5AJWA 1RPZA 3H84A 4JYCA 2ZJAA 4CVNA 4IJMA 3D8BA 2BEKA 2IHYA 4HLUC 2QMEA 1TADA 1G3QA 1W2HA 2AK3A 2YWFA 3QVVA 4TL6A 2O5VA 3PEWA 1TQ4A 1GAJA 1ZIOA 2J3EA 3GJ3A 1R0WA 2XTZA 1OH7A 2AD5A 2FF7A 2J9RA 1CJTC 2X19A 4NYMR 4JBYA 4CEHA 2GTPA 2OBNA 2G9NA 3RRYA 4RKEA 2X77A 2ZJOA 1U81A 1E96A 3HP1A 4M0LA 1YRAA 3LV8A 4LUCA 4UXJA 2CMKA 4TYNA 1D5CA 1QVAA 3QSYA 3DM9B 2GK6A 4I4LA 1HQCA 2RGNC 1X3SA 3BH6A 5DI9A 3FMOB 1U8YA 4H1UA 5JCPA 4L4UA 1LY1A 2J41A 3T61A 1OYWA 4S2EA 1S3SA 1YR8A 3LLUA 2CE7A 2ZS7A 3TVDA 3UKDA 1S8FA 2N46A 4NYMQ 4JS0A 4LSGA 3AF2A 3LVRE 3NEJA 2RGCA 1W36C 4PZZA 1P2SA 3BC1A 3JZMA 5DYIA 2IC5A 2YHSA 2MSDB 2XNSA 4FD2A 1LVGA 3KKMA 2DYKA 4HATA 1IY0A 2KI5A 3QKSB 3ZVRA 4P31A 4ARZA 1KI1A 2YZ2A 2DBYA 2ZR7A 2PZFA 1Q1QA 4UKDA 4URUR 1H65A 4QBGB 3LO5A 3MRSA 3IDQA 1IN5A 4NZYA 1ZM7A 2PX3A 4Q4AA 1LV7A 4Q9LA 2CNWA 4JLDA 5IRCD 1KY3A 1GP2A 2G1KA 1G8FA 2IXFA 4ZKDA 4MYCA 5FUXA 5GJCA 4EQ6B 3KKPA 2DFTA 2ZXUA 2IT1A 3OAAA 1UFQA 4DSOA 5CK4A 2AX4A 2ECKA 3DHWC 4KODA 1XEFA 3CO5A 4Q19A 4RD1A 2PBRA 4YMVA 4RD4A 2XZPA 4DIEA 3PIRA 4K81B 3BJIC 1H8EA 4JLMA 1RRPA 2WWXA 4XJXA 4UXHA 4Z54A 4A8JA 3FKQA 3LXXA 4BQSA 1S3GA 4HAVA 3IQWA 2F3RA 4ITRC 5K8LA 1M8PA 4PTLA 4D26A 5L3QA 4BLOA 1XU4A 1YR6A 2P0EA 2Z6VA 3EASA 1NLYA 221PA 4JLOA 4TMVA 1GILA 2ZS8A 5A4JA 2D06A 3V9PA 1L8QA 2BBWA 2ZI5A 3OIYA 3W6NA 2OM2A 5FTJA 4GP7A 2L0XA 1XP8A 5CDFA 1GL7A 2XAUA 3B6EA 2WSSD 4NPHA 1MRNA 1ONBA 4DLUA 1WE2A 2IYXA 3W5JA 4QJ3A 2QMOA 3KKNA 4I1UA 1DTSA 1UDWA 2ERXA 2IYVA 3GFPA 2BHRA 4LY6A 4B3DA 2A5YB 3DZ8A 1DAMA 2ZRCA 4V02A 1ETUA 1WDTA 1XEWX 3LVQE 1G5TA 4BFUA 4Q7KA 2W58A 1CXZA 1HY3A 3E5HA 5GJVC 1EFUA 2O0HA 3WNCA 3I8XA 1TL7C 4IFEA 3R8CA 5L3SA 3Q85A 3REFA 2A2ZA 2GESA 4GNKA 4B3CA 4M21A 5FBQB 4R71A 5DYGA 4LJ7A 1G291 4NL4H 3T1TA 1OFUX 1G3IA 4HB3A 2AFHE 4KI0A 4NCHA 1NN5A 5EQTA 4EDHA 1ZC3A 5JWHA 3CW2A 3L82B 3OFND 3WP1B 2JLYA 2DPXA 4HAYA 1L4UA 1TQ2A 2ZTSA 2HT6A 3NBZC 5AUOB 2LKCA 3EA0A 3AV0B 5CK5A 4A9AA 3KQLA 3BB3A 3TSZA 4B34A 1DBSA 4E5UA 5E7MA 1J99A 5EP3A 2P67A 1BMFD 3A1TA 3AKCA 5BWMA 3BORA 1NF3A 1EESA 3ZQJA 3EWSA 1KNQA 5TVKA 5JJIA 4DLYA 5KYKA 5TMPA 1W36B 1W46A 3K53A 2OBMA 4MDEA 5AUPB 3FMPB 2IS2A 1KSFX 3AF4A 1CKEA 1WP9A 3L43A 1YZQA 2Q3FA 1W0JD 2A9KA 2IUTA 3KB2A 4JJKA 2VP9A 3AVVA 3AUXA 5GVSA 3FOZA 2GJKA 2XX3A 2ZVPX 1G7CA 3HU1A 4HAWA 3W8NA 2VTKA 2CE2X 3VHXA 4OK6A 3VR4A 3CNOA 2ORIA 1RRGA 4NE2A 1Z83A 3OAAD 3OEED 2VP5A 2HCBA 1PZNA 1LB1B 2JLUA 1E9EA 4EFMA 1KDRA 2FEOA 1R5NA 4CT5A 4G0NA 3RS4A 5UKDA 3U3MA 2FEMA 2MSEB 3NIBA 4Q1CA 4Q7MB 2CHVA 1ZJ6A 1LFDB 4LK2A 4GP6A 1R10A 4QFMA 2H57A 4TLDA 3THWB 2TMKA 4A0FA 3CWQA 4D0NA 3GLFB 3ZJYA 4IHQA 821PA 4ZIRB 5H1YA 5LB2A 2PZGA 3WYGA 3NKVA 1QVRA 1N3BA 3ND8A 2EFHB 1KDPA 3QG1A 5DH9A 2VSXA 3KDSE 2G1JA 3MSXA 3LBIA 4JKIA 2F7SA 5JEEA 1OB5A 3C41J 5IDVA 4TYYA 3SQWA 1L4YA 3P32A 1F2UB 4Q18A 1Z0AA 1V5WA 3DO6A 3EWAA 4DCUA 4CGZA 4HSEA 1ZMXA 4PQFA 3RHFA 1Q0UA 2H8KA 2ZUBA 2FSFA 1FPMA 4P4SA 5BN3A 3BBPA 4KBGA 3GJXC 4CEJA 2ONKA 2AWOA 1ZUNB 2YV5A 1Z29A 1F60A 4F7WA 2ZAOA 1COWA 2ZE8A 1TMKA 4XIGS 4G5OA 4N0DA 3AVUA 1U98A 4OJKA 3C7KA 4DLSA 1I2DA 3RS7A 2CK3A 5H70A 4R2IA 1W5TA 1E4VA 4PC1A 1KOFA 4PZYA 1AKYA 2ZSAA 4URVR 1JEEA 5JLJA 1TUEA 2F43A 2GF0A 1D2NA 1Q3TA 3ICEA 3GJ7A 5AUNB 5E4FA 3VR2A 4A6PA 5EP4A 5JRZA 1II8B 4HB4A 3U7FB 2IS1A 3B2EA 2OHFA 1A82A 1X1SA 3W8RA 5DHFA 2QAGB 4LJ6A 4YQFA 5JMTA 2ZYTX 4WW0A 2EYQA 1VG8A 3MG9A 3NBXX 3WMEA 1WBBA 1F6BA 1GL6A 2V7QD 5HZHA 2BCGY 3PUWA 1EFTA 1MO4A 5FUYA 1ZNYA 3QE0A 4AK9A 4NKRA 5TB5A 2ZJ5A 3QENA 4MITA 1HUQA 2RGNA 4NBSA 3LX8A 4X8HA 4IVRA 1CJMA 2R62A 1BS1A 3WP0A 1AJEA 2YC4C 2HV8A 1E79A 1NIPA 2D74A 3AKDA 2JDIA 4ILEA 3CIOA 3TQCA 4LHWA 4Q4JA 1WMSA 3L0SA 1YVDA 3IIKA 2QP9X 5JJLA 3ZZ0A 1BIFA 4KYIB 1E2DA 2CHGA 1JR6A 1NY6A 4JLPA 1CTQA 1GNRA 5FH9A 4B71A 2ASEA 1G7SA 3PEYA 4LV6A 2GJ9A 2ODEA 4AWXA 4XVUA 2Q9BA 1NVVR 4ACBA 4C4PA 3UWOA 3BH7A 4BEJA 4UNRA 2QT1A 4JLNA 2D3WA 1X86B 2REXB 3GQBA 4M1TA 4MKIA 4OJQA 3P1JA 3UANA 3VKGA 2OG2A 5EUMA 1N6OA 521PA 3U4QB 1M6NA 2IXGA 1EFRA 3K0CC 3WYAA 2QGZA 4RZXA 4BFWA 3IGFA 3ZH9B 1Z63A 3ZLJA 5HCIA 5AUQA 2NO0A 4O3MA 1ZNXA 1NI3A 2PLFA 1T3SA 3QOFA 1J7KA 1VCIA 4P33A 3ZQ6A 3MD0A 1G7RA 1E6CA 3FTQA 1YZUA 4V0LA 5FOWA 2WMOB 4TLAA 1E2LA 4IDPA 2GXUA 2ZI3A 3I62A 4GSYA 3BB1A 3CRQA 4LHVA 4AYWA 1Z0IA 4B43A 4AKHA 4R98A 1JECA 4P3YA 4WXRA 4XVQA 1YZTA 3CUEF 4EAQA 5EE5B 1NP6A 3E70C 1BKDR 1N0VC 4Z8XA 3E1SA 1P61B 4Q01A 5G3YA 1AKEA 2FGJA 3KUCA 4JYBA 3GLGE 4LC1A 1LF5A 5EXSA 1IHUA 4FMCB 2OAQ1 3GLFE 3OFNA 2JLRA 1JJVA 2QSZA 3U6BA 3AF3A 4OI1A 1II0A 3EW9A 2P6RA 5FOVA 2E9SA 3L0IB 1ZM2A 4XWAA 2JJ2A 3CRW1 4W5WA 1FUUA 5J47A 3I8SA 4GZLA 4KFSA 4Q48A 3GLIB 4GFDA 2O0JA 4KAXA 2FSHA 4MKHA 2R6GA 3TAUA 3E2IA 4OQFA 2QPTA 3H1TA 2ZI6A 4FINA 2R6FA 2BM0A 1KK2A 1XTRA 5AJZA 2JLXA 4IXMA 4DBLC 1XMJA 2VF8A 1P9NA 1KO4A 2A5FA 3RAPR 2QRZA 1OH6A 3K9LA 2F43B 2GVZC 4QL3A 5FL3A 3VTKA 3VNVA 5JECA 1XMIA 1QBKC 2PLRA 2VRWA 3MJHA 1ZCAA 4XVRA 3VHLB 4F91B 2BBSA 3UMSA 5CM8B 3IO5A 1T91A 3KFXA 3M6AA 2VF7A 5L3VA 2R2AA 4NTZA 3VNUA 3CNLA 5DE3A 2IA5A 3OF5A 1GZSA 4HZIA 4KITB 3OIVA 3TUZC 3BB4A 3FDIA 5FBWB 3FB4A 1D9ZA 4FMDF 3SJBA 4XD7D 3TVTA 2BMFA 2J0UB 3IKJA 3VAAA 5B58C 1HEIA 2P5SA 2WSSA 3WHLA 4ERNA 1W0KA 3I4LA 3CLVA 5DIFA 3W3ZB 4MGKR 2P6UA 3VKWA 2H17A 1Z0FA 3AKEA 4NYIR 1E9BA 3N70A 4M9QA 4EJSA 3EPLA 2BDTA 1CP2A 1ZINA 2EFEB 2WWFA 1IJFA 2C5LA 2ZR9A 4PQRA 4QRHA 1AS3A 4MUBA 2HEIA 2QZ4A 2OAP1 4ZPXA 2ZRGA 4ZDWA 1M34E 2CLCX 3PEVA 5CM9C 4B35A 4C0SA 3QKTA 4EPVA 3LBHA 1KSGA 3KXLA 1GNPA 1H8ED 5LD2B 2V1UA 1Q1EA 2BCJQ 3SJAA 3V4FA 1U0JA 4BFZA 2YWEA 3U61B 2ZPTX 2ZRAA 4OI4A 1IM2A 2J1LA 3Q7QA 4PAOA 4EPXA 4PHTA 4UXIA 1BO6A 5ELXA 4ZO4A 4LDJA 1CJVC 3NWJA 4QBIA 2WVJA 3LA6A 5JHGB 3K70B 1UF9A 2J59A 3B8HA 3C5HA 4Q03A 2OCAA 4EQ6A 2GEVA 2YNMA 4A8JC 5FTMA 2OZEA 4BRWA 1W4AA 2WZQA 3PEUA 3B82A 4CEIB 1E2NA 4AYTA 5BN4A 5KSPA 1KAGA 2GCPA 4EFLA 3WMGA 1ZU4A 1GVNB 1N2CE 5BW8A 2OO7A 2ZI4A 3T1VA 5L3QB 1A5TA 1NSTA 1S9HA 3A1VA 1ZVQA 3ETLA 1B0UA 1NJFA 1QHGA 2ZVQX 5DO9A 5LPNA 1QHIA 4TL7A 3SJCA 1NN3A 2I1VB 1MR3F 2C2HA 5JS7A 1XPOA 1Z28A 1MH1A 2GVDC 2CEAA 2QGNA 4NCNA 2V54A 3SYLA 2FV8A 4D4JA 1F48A 4IRUB 5JJKA 4DDWA 5FOXA 3N2IA 2ONJA 1N6RA 2CBZA 5JFGA 2QY9A 4KVAA 4QNRA 5BXQC 1OFTA 1DAHA 1VMAA 4M1MA 3RDPA 4C2UA 4TYWA 4WA7A 6Q21A 3F0TA 3TIFA 5L3SB 3F5FA 4AKGA 4QHYA 4FWTA 2CJWB 3C4JA 4JL5A 2IW3A 4MRVA 3TUIC 4C0JA 2GEDA 2WIAA 4MRPA 1XEXA 2BKUA 2C95A 4GOKA 3R8FA 1N6LA 3CX8A 2F1RA 2IBMA 3M4YA 3O47A 1P6XA 4RFSB 2FG5A 2QPAA 2ZRKA 1R4AA 1XMSA 1XB2A 2CLDX 2PX0A 4DKXA 1T8UA 2P5TB 2AL7A 5EE1A 3DOEA 2IX3A 3BFKA 2VO1A 2E87A 3FHCB 3GJ6A 1KI3A 3V00A 1OXTA 3Q5EA 3PUVA 2Z5FA 3L2OB 1YJ5A 1CJKC 4R9UC 4LBWA 2FFQA 3WBKA 4HLDA 4U00A 1SKQA 3PCRB 4KFTA 3HR7A 1E9SA 4JJZA 3U7HB 2OCPA 3EC2A 3K09A 4DCVA 3MGCA 3MWJA 5CYPA 4PPNA 3R7WB 1OB2A 1DADA 1JBKA 1MO5A 4MA4A 1P2VA 1NVWQ 4CRWB 3V4RA 1W36D 1CBUA 4DEYA 3OIWA 2R6DA 4J0QA 1FOEB 5IT5A 3KXKA 4IXNA 2B92A 3DPUA 3W6OA 1NIJA 1VDZA 1C1YA 3HWSA 1KJZA 3W90A 4BGDA 3LDAA 1XXHA 4KV9A 4V0MA 2ZYVX 4D81A 1CRPA 1G5RA 1SKYB 1Z08A 4AD8A 2IUUA 2EFGA 3AP1A 2QAGA 4OBEA 5KDLA 2GXAA 3B9PA 3LW8A 1E32A 2G77B 5E7IA 2F9LA 4POAA 4DC9A 1VCMA 2ZJBA 1TU3A 3AM1A 3X2SA 5FUWA 2HLDA 1MABA 2C9CA 5B2ZA 4KFRA 8OHMA 3ZD7A 3RLFA 1WRBA 2O8EB 4TLCA 4ZIRA 4QHSA 1A2BA 3U44B 5BYJA 1JNYA 2HXSA 1XJCA 5E95A 3EIEA 2IYUA 4Q9HA 2YOFA 2DFKB 2CCGA 4TSFA 3R9WA 5CIWA 5BQ5A 4TMWA 1JEDA 5GJBA 3WMFA 1GKIA 4IKEA 2QA5A 5CJ2A 4MRSA 2WJYA 4ZCLA 2CVFA 4OYHA 1O87A 5ANRB 2ZJ2A 5FL7A 2EQBA 3L0OA 4EPTA 1KAOA 4NYJQ 1QDEA 3IHLA 1TEVA 2BV3A 1G9XA 3KFVA 1P2TA 3T5DA 1QHXA 1VYTA 1G3MA 2PJZA 4C0LA 1E69A 2OXRA 5BYKA 4OL0A 1N25A 3NDBB 1OXVA 1SQ5A 4L9SA 1Q57A 4I99A 3ZIAA 3IUYA 4V0NA 1E9RA 1VHLA 4IEEA 1Z0KA 3DKPA 2NPFA 3GLGB 4G5SA 2IF0A 2IK8A 2Z83A 5TARA 4RD3A 1KY2A 2ZRPA 2BMDA 4EFNA 2R8RA 5K8TA 3BD9A 3J81k 3EZ7A 3LNCA 5DI3B 1BOFA 4NYJR 4PHHA 4TT3D 1BYUA 1N5JA 4TMKA 3ADCA 3A6PC 1ZU5A 2QRNA 2YWHA 1HE1C 4A0GA 4PR0A 4CIDA 4QKQA 3VX4A 4L5BA 1I4LD 4HDCA 4W5JA 5C46F 2XXAA 2N42A 4LPKA 4PC6A 1F2TB 2J0SA 3BWDD 1MO3A 4LBZA 1K6MA 1SVMA 4MGZR 3RRNA 4B73A 1Y3AA 3BOSA 3ZGXA 4G01B 2ANCA 2BMJA 4F4IA 4OQLA 4TQAA 3CRVA 2NPIA 4WIAA 1VYUA 4U5XA 5JI2E 4F4CA 4PAQA 4MRNA 3WHKA 1L7VC 2Q21A 1FUKA 4GOXA 3TK1A 1NVUQ 4HLQB 5HKKD 1Z6TA 2JLZA 3K0SA 4CF7A 3THYB 621PA 3ZVLA 721PA 4QJ4A 3FVQA 1OXXK 2ZEJA 3LW7A 1G17A 2VBCA 2BOVA 3CF0A 3BH0A 3LX5A 3QPUA 3HU3A 3I92A 2GNOA 4UNPA 3A8TA 3EZFA 1DAIA 4TTRA 3CPHA 3PG5A 1E94E 1E2GA 3VR5A 2JLSA 2IWRA 4G5RA 1JR3E 1JR3D 2QG6A 3FPAA 1CLUA 4LWZA 3R7WA 2ZUDA 3DM5A 3CH4B 2NO6A 3IIJA 3WRXC 4AG5A 3ADDA 2EYUA 2BBTA 1U90A 3MUFA 4KXFB 4UNSA 1NY5A 1GITA 3I61A 4BEBA 2ATVA 2RKOA 2ZSFA 3AVYA 4B74A 4MGYR 2LCFA 4DCNA 1OT3A 4ZI3A 3AVXA 2H92A 1UEIA 4JLJA 1R0ZA 2DB3A 2X1VA 3X1DA 4C2TA 2JLWA 2AN9A 4RJLA 4D25A 4V0OA 3T34A 1XWIA 1GIAA 3FKSD 4DUGD 2GZHA 1G8YA 1J70A 4PAMA 4CW7A 2QNRA 5AJYA 2XZLA 1P75A 3FKSA 3HYRA 4D0LB 4IOLA 1KJYA 1PUIA 2FPKA 5JEDA 3TGPA 1WCV1 1Z47A 2FZ4A 1YZKA 2F6RA 3EA5A 3KKQA 3OEHA 4RZ3A 4BLPA 2HLDD 2CL6X 2CCJA 1DAGA 1RVDA 2GA8A 1E99A 4ZDKA 2ZYUX 1Z2AA 3ND9A 1XNJA 5EE3A 4XWKA 5IF9A 1FX0B 3AVOA 1KSJA 4TTPA 1K5DA 2QSYA 1XTJA 4EIWA 2QBYA 2ZJ8A 3UWKA 3NBYC 2F9MA 3X1WA 2UKDA 4B44A 4AKIA 3FMFA 1GG2A 3U3RA 1P62B 3U6KA 4GL2A 3O8RA 2OFXA 2REBA 3SZRA 1J90A 3THXB 1YZGA 1NKTA 1NKSA 2VP0A 3RWMB 2XITA 5F3WB 4JBXA 1OLOA 4BLTA 4BASA 1G21E 2FU5C 2C04A 4MUAA 1VG9B 4AYXA 1KI4A 2O8BB 4Q02A 4D0GA 2AXPA 3QPWA 4B2PA 1C4OA 4FMBB 1Y63A 3BK7A 5DI3A 4URWR 1JAHA 1F2UA 2P3SA 2A78A 2FPMA 1CRQA 5JHHB 2DY1A 4NU0A 2Q0HA 5EP2A 4BLRA 1RKBA 5A0FA 4M1WA 5EUQB 2HUPA 1E79D 4QOSA 2XXAB 5G53C 1OIWA 4JVLA 3VR3A 4GI7A 4DB2A 4Q9KA 2GILA 2GJSA 1XXHB 3TW4A 2FZLA 3KJHA 1PVOA 2PCLA 1Z6XA 1ODFA 3P27A 4JVMA 2IF2A 1U99A 4YONB 1TQDA 4H1VA 2O8DB 5FBLB 5CYOA 1S4QA 1E0SA 3QEOA 2H1LA 3ZDQA 3REGA 3RSLA 2W0MA 5HCNA 5C2JB 5EZ5A 1E2JA 2Q9AA 3OIUA 2QTFA 2OCBA 3MMPA 4JMPA 3EPJA 1PUJA 3NH6A 2IS4A 1XTIA 2JASA 2V4ZA 2FOLA 1Q20A 4TYPA 4Q4LA 3SQXA 1Q3HA 2ZI7A 4Q1FA 5JSZB 1CR1A 2WKPA 4XOIA 1GL9B 3AKYA 4M1YA 1E1RA 2HF9A 1LW7A 5GADl 4EPRA 4A36A 2VHCA 5FPSA 2CJWA 2OLKA 3A4LA 1OJLA 4TSFD 4URYR 5TV2A 3BIFA 3SBDA 3SI7A 1YHNA 3AGQA 4LZZA 4FCVA 4KSCA 4TZ6A 1OW3B 4A4DA 3TJZA 1SXJC 1RRCA 4JSYA 4QJ5A 1KO8A 2ZE5A 1FZQA 5FL7D 4B2LA 1CIPA 2C96A 3U2QA 1DS6A 3EXAA 2W2TA 1E0JA 1N5KA 3OESA 2NMVA 1H8HD 2QE7D 3P26A 2C99A 2OUKA 1DO2A 2ANBA 1P2UA 1EX6A 1IAQA 3ZZTA 3H86A 2A5GA 3K0CA 1W44A 1UADA 5H8WA 5EXPA 4IDOA 1G4AE 2WJHA 4OHVA 4US1R 4JT4A 3PVSA 3RS0A 3I5XA 2WAXA 1ZYUA 5EE0A 2ZUCA 2HF8A 1GDDA 1G8GA 2QM8A 4JVSB 1MT0A 1YKSA 4KFUA 3AVWA 2NO7A 3CZPA 2QP3A 5D3QA 4BZXA 2FJUA 1GKUB 4C30A 4WZBE 3FE2A 2VHQA 2R44A 2NOAA 5CB6A 1SVSA 5KSYA 3LH5A 1YRBA 1NLZA 4ASUD 2I4IA 3QG5A 3SBEA 4RZUA 2B7BA 1X8LA 2B8TA 5DN6D 1VIAA 2RGDA 2V55B 3NC0C 1OHHA 2OXCA 1EK0A 1JAIA 1RYFA 1SHKA 1UJ2A 2DFNA 1A4RA 5JI3E 1ZD9A 3RRMA 5DISB 4HUQB 4HZUB 4DSUA 3GEHA 2IEZA 1ESNA 1MO6A 1T9HA 2G0TA 3WY9A 4M1OA 4N0EA 3GFOA 3AVQA 4D4LA 4JLKA 2KB0A 3GLHA 4P4TA 4LJYA 4M22A 5EJEA 5LBIA 2IS6A 1AS2A 2QN6A 2W2VA 4TT3A 2ORVA 3CH5A 2NTYC 1P3JA 4LBYA 2ZE7A 4PSKA 4B3FX 4DIDA 4TZ0A 3EZ2A 3TNFA 2P65A 1S96A 4KYUA 2VYFA 2G6BA 3UXMA 4L9WA 3AUYA 4BE7B 2WJVA 1PJRA 4V0KA 2VIIA 1E3MA 1A7JA 1OFHA 2GXQA 2RGBA 4NCJA 4RSGA 3SOPA 4D2IA 1CR2A 2WWIA 1IJEA 1NRJB 1EWQA 4ZCIA 2PT5A 3IEUA 5AJVB 1PLKA 1U9IC 1AQUA 2FDCA 3BE4A 1KKLA 2ZIAA 1U8AA 3RC3A 3UMRA 1OF1A 5EXTA 2GCOB 4PPFA 5FUVA 3L8YA 121PA 5SZJA 3ZVNA 1Z0DA 5SZIA 1K5GA 2JEOA 2R6CA 4RKFA 5D3MA 1S2MA 3TH5A 3O8DA 1P9WA 1KDOA 3A1WA 1OIXA 4YMSA 5FTLA 4DXAA 1E2EA 3CPJB 1TNDA 3SS8A 4LI0A 1PV4A 3Q7PA 4M9XA 1D9XA 4BLSA 4YDSA 1E1QA 4Q9IA 1XPUA 1E1QD 2VHJA 2EVWX 4PO9A 2CHQA 3D31A 3K8YA 3O8CA 4LGMA 2XJ9A 2SHKA 3TRFA 1T3HA 3TUJC 1MOZA 1KK1A 3ZZUA 4OKSA 1W0JA 2RGXA 3NEYA 2BEJA 3BAFA 2P2LA 3W34A 4PO8A 1G20E 4TLEA 4P0TA 3QVUA 4YMWA 1VECA 4Z1MA 2PCJA 2XSZD 2ZRHA 3HPQA 1Q1ZA 3LFUA 1R5OA 4M1KA 1Q21A 1O3YA 1UKZA 5P21A 3KQHA 3QIAA 1SZPA 4FIDA 3TKLA 4ZDJA 4CDGA 5B30A 4PHGA 4LJ8A 2IYTA 2QTHA 2ODBA 3B7GA 5FOTA 5FTKA 3W9YA 3GFTA 4P4SB 3NHBA 4AY2A 3DOFA 2GWHA 1MV5A 3SU8A 2ORWA 3U7EB 1MABB 1OKKA 1XDBA 2O8FA 3QI2A 1E0AA 5GVRA 2D4HA 1FFHA 2NO9A 1G1MA 4F92B 1M7HA 2GJAA 1AIPA 3TAHA 1DELA 1R7RA 2Z0MA 3I3SR 3RS5A 4ESVA 3T06B 4JBWA 4RVCA 3EIQA 1E98A 3IBGA 2ZITA 3ZS8A 3TE6A 1TF7A 1OFIA 2G0NA 4A0HA 2WKQA 5C4MA 2DWOA 2H5EA 1VG0B 1W1WA 1T6NA 3RANA 4DCTA 3QXJA 1IONA 4I1OA 1KZ7B 3K9NA 2NZJA 4FCWA 1NBMD 1XZPA 1DG1G 4OHWA 4ZCMA 4IDHA 4US2R 2ZI9A 3KQUA 3EPHA 4K46A 3AP3A 4KSBA 2Q3HA 1TU4A 2IYLD 1KI2A 2O0KA 2WIBA 3GLGA 1ZUIA 2DR3A 2UZIR 4M8NE 1F5NA 2GZDA 3U3JA 2IXEA 1G4UR 3X1ZA 1NVVQ 1SVLA 2JA1A 5TY0A 5KPDA 4AC9A 2W00A 4R7ZA 3NG1A 1OH8A 1OHHD 3NXSA 2N1BA 4A2QA 1ZCBA 4PC7A 2VHUA 1IN7A 2F1JA 4AIIA 4AURA 5JSZA 1E2FA 1JXMA 4RD6A 1G7TA 3Q5DA 4I1VA 5K8IA 2RB4A 1II9A 5KO2A 1CEEA 2BKEA 2G3YA 4W9MC 2JLQA 2ZYWX 1G19A 1F3OA 3A1UA 1UKEA 2NG1A 2ZU6A 4BZQA 2YYZA 2YJTD 4ON9A 3FMIA 4KJZA 4XSGA 5KDOA 4GDFA 2REOA 4FMDB 5J5CA 3QXSA 1G16A 1KO5A 2PMDA 4QG7A 4Q66C 3KKOA 4Q1AA 4Q00A 2HT1A 1KI7A 2FN4A 1NSFA 3N2EA 1JQLB 1D6JA 2IWHA 2OCYC 4TN1A 4ZV4A 3ZIAD 5J40A 4C3ZA 1UBFA 1D2EA 4QNMA 3SNHA 1W4RA 2ZRJA 3MCAA 3DL0A 2W6JD 4PFSA 4B76A 4NHOA 3WYFA 2BJVA 2W6JA 4JVNA 1P9RA 3CB4A 3GCGA 4XTCS 2AK2A 4LJ5A 1GOTA 4HYYA 4NCKA 5GJWC 5FPHA 1TUIA 3B9QA 4US0R 1ZNZA 1UPTA 2WOOA 1SHZA 1LS1A 2HYDA 3CR7A 2QPOA 2Q6TA 3QNUA 3A58B 4JLAA 3D7MA 3QUSA 1KK0A 1FP6A 4ZI2A 4BPBA 4WBSA 4D80A 4EPYA 1N0UA 2BC9A 2VH5R 1KGDA 4Q1BA 5FR2A 4WAUA 2ZAMA 1RRFA 3BGWA 4JIMA 1GRNA 2ZETA 4WZ6A 4DLRA 2A3RA 3K0AA 3UIEA 1I4TD 4P4UA 4QGGA
chains in the Genus database with same CATH superfamily
2WYWA 2VSYA 4QWMA 4MJ3A 2G6TA 1KEEB 1UMKA 2B82A 3MJCA 3PQDA 1N3LA 2Y77A 2OQVA 1FDWA 1CUDA 1U1IA 1GNVA 3DFMA 3BWEA 4PV7A 1X80B 2J5QA 2P9EA 4FE4A 5TMDA 3DJYA 5FYQA 4G85A 2WUDA 4FJ2A 3H2YA 5LZ9A 4CBVA 3ELYA 2BJWA 3PX3A 2CV0A 4HXYA 1GRVA 2JIZA 4LYAA 2A33A 1WUIS 3R8XA 3NIDB 2CVZA 2BTQA 4C0BA 1RLTA 1M8FA 1WCIB 5J58A 2MSWA 2XA2A 3HUEA 5E1DA 3FYSA 3HB9A 2H2DA 4PU0A 5JTUA 1WM1A 2R8ZA 2WJIA 2AR9A 2V6JA 3B78A 3F6PA 5PNTA 2YINC 3IILA 1UBGA 1B0ZA 2AW5A 4GXNA 1LTQA 1OYYA 5HGXA 2LWIA 4QOGA 2EFJA 1UBRS 1A9YA 1R6BX 1U7UA 5KHOC 1NUAA 1NWCA 4RGYA 4RLSA 1HFWA 1EFAA 2FZKA 3X2FA 1Q0LA 4ZT2A 5I7RA 2VSQA 1VBKA 2C57A 3DMDA 4S12A 1N2GA 4ZQEA 5FFFA 2ODAA 1V43A 4PO3X 2PUEA 1YSCA 4I1PA 4NE7A 1NRXA 2NAFA 1M74A 3DAYA 4ZCRA 2FOXA 3DFKA 3CEHA 3HL4A 1FK8A 3KZOA 3ESAA 3MCZA 5E2AA 4IFIA 4C1BA 2HB6A 4CI0B 2ZT6A 3OCCA 5DM0A 4MVJD 3WICA 1M2JA 4JSRA 4MIEA 5GIOE 5KWVA 5HIIA 3FCAA 3RSQA 1DARA 4YDHB 1J0BA 4ZANA 1QHSA 4LC0A 4HWGA 2EP5A 3JCZA 3SDBA 4N7MA 3SX0A 5JYBA 3RYFB 1DWOA 1Z4OA 3FPHA 1AK9A 3PS9A 5I51A 3GV0A 1Z0SA 4BJ6A 1NVAA 4P2GA 2I1LA 3BDAA 4G09A 1CQJB 4JSTA 3H0KA 1ICIA 1PQ4A 4F1JA 1BS9A 3I73A 2GKOA 5FLYA 5IJXA 3GGPA 3OQJA 5B37A 2PYIA 4MV0A 4UBJA 2V3WA 1G5PA 3Q0TA 4LPSA 4RADA 2RG7A 3KKKA 1ENOA 1RBYA 3MBKA 4NICA 3WGGA 4DLTA 4G1CA 4KVZA 3D1VA 3KOXA 1DI0A 1LGYA 2CEKA 2OGSA 1UXGA 3ABQB 1X74A 3RHZA 1YQTA 2CK3D 3LUBA 3RVBA 3GLHB 1SM4A 2D7DA 2KE5A 3OZUA 5KYYA 1AUPA 1A9OA 3PXBA 4I1SA 4DT1B 4QXPA 3IYLW 1EVLA 4D3FA 5HXAA 2V7UA 4LOIA 4Q7QA 1C3OB 3DPIA 3C3EA 2IV2X 1G3RA 3DLPX 4ZWNA 5T8KA 4L8GA 5IJ0B 5J4KA 4Q4HB 4XH9B 2A5JA 4LCJA 2DU8A 3MBOA 3S1LA 4DA9A 2IOYA 1Z06A 1A50B 1JDUA 2O2ZA 4X8MA 1ZJ5A 5CT8A 1QYCA 3BULA 2CBGA 1DXHA 1U11A 1QV7A 2JIMA 2ZSKA 5H3CA 3WAGA 1PWHA 1UKBA 2DETA 3AEXA 3AHHA 2OV3A 3JALB 1WDLA 2E6UX 4JN6B 1ZUHA 4C7OB 1AB5A 3BRWD 4K8OA 4JLVA 3TCKA 3CNNA 1T1EA 4YLGA 1R9JA 1X77A 4NESA 1N2JA 2AS0A 1SCDA 2QRVA 2FX3A 4PZ0A 4V03A 1WVMA 3W04A 2FHPA 3KQOA 3PHJA 5K1ZA 2P2ZA 1TX4B 3LC7O 5AKXA 3S1AB 4DCSA 4MR8A 2G88A 4MQEA 3CY6A 1YL7A 1DSSG 1RYZA 2Z43A 2IZ5A 4D9HA 4UC0A 1ZL2A 2GJ8A 4U63A 4X63A 4EI8A 2WTUA 2Q4BA 2F2TA 5ALIA 2REQA 3TX2A 3HCEA 2P1DA 1E1CB 1D6MA 1EPUA 1Z35A 1XRMA 3DZKA 5K0JA 1FJHA 2AEMA 2ZYGA 2B1RA 1P2BA 2W0SA 1CPYA 1KAQA 2XIQA 4N7BA 3TM4A 3ZHOA 3ZHQA 1J2TA 4OBXA 2E1PA 1KEEA 4DIOA 4OHYA 4RD2A 4MVXA 4QGHA 4NCXA 4UATA 1MT3A 1DXOA 2AMYA 2ACKA 4KBFA 5EG5A 5JJCA 3PWZA 1EX1A 2NSHA 1XZFA 3RR2A 3SJ7A 3FFWA 5EHIA 4LHZA 3QJGA 4C0XA 4LCEA 5FOQA 2A30A 4BVJA 1NQUA 1SU7A 3HA3A 4NABA 5D1NA 5DN6A 1PR6A 4O2AF 4ALJA 1X0VA 5CLQA 2Q3MA 1OV4A 3AEZA 1S9DA 1OASA 4M7WA 3ENZA 3F97A 5KI6A 4EHDA 3NPAA 3D8TA 4KLNA 1T5HX 1MXFA 3HU2A 1QZZA 1XLVA 2W90A 3KYDA 5HFAA 5IVKA 2HIHA 4EKDA 3DE5X 4QBFA 2BBOA 1RJDA 1YZNA 4BKOA 5DBGA 4HFNA 5EJGA 4B2IA 4C08A 5TXGA 3B1JA 1IB6A 1U0RA 1PLLA 3A4NA 4QBHA 5A4IS 3PLAE 3RPEA 1NBME 3T8YA 3QBDA 5C81A 1L4MA 2FDXA 2YWGA 5F3RA 4UCWA 2C7QA 1U3FA 5BN5B 5AM0A 1T0HB 2DTDA 5LXTF 1DC4A 4J07A 3K70B 1EFCA 1BKSB 1O9GA 2WYIA 4CEHB 3E8SA 2C29D 3COWA 3GPBA 3I04A 1UM8A 2HLPA 2HU8A 4KGVA 5ALJA 1U04A 5EIOA 4KRYA 3VC1A 4E09A 1CUIA 2QHXA 2NTNA 1X1RA 1U3GA 4NBVA 1TF5A 1MOPA 1DKRA 2QIPA 4U7FA 4X6LA 1QH8A 2IHUA 1XZQA 4PWYA 1GU7A 3ZKAA 3H05A 4D6YA 3OT1B 5K8UA 2QROA 5GINE 5K3FB 2OCDA 2EKQA 5GV7A 1MP0A 3P4YA 1G8SA 4I81A 3URKA 5B3JC 2QMUA 3HEMA 3HB5X 1A5BB 3NM6B 4FMPA 5K8JB 5KEIA 2DQ4A 2JJ2D 2B69A 4G56A 1ULTA 4LGVA 4WESA 3E03A 3MHTA 3C74A 3NVMB 1GA1A 2JC3A 2JJMA 2WPDA 1PK9A 1RQRA 1MBZA 2BWJA 2BR3A 4GUDA 1SCBA 1UQUA 2R3SA 3DDZX 4X1IA 5D3MB 4IVNA 3VJLA 2WFZA 3TLBA 3ZE2B 4YRCA 3AXTA 1UPBA 1W5AA 3HXQA 1CRZA 5HWSA 2A4KA 3DYIA 3M6XA 3NHSA 3OD1A 3RIXA 2IH5A 3X43A 3Q8MA 5FI5A 1ZGBA 2YJNA 1RI5A 1PWXA 2PMKA 1P72A 3AMVA 4DRZA 4XX0B 2E85A 1TDJA 3RWBA 1R3UA 4PC3A 4P4GA 3V4PB 2B78A 1CD5A 4JEHA 1K06A 3LI2A 4EYGA 5JS8A 1B8VA 4OG2A 3TRDA 1XTBA 4EJSB 4KIUA 3HM9A 2RHLA 2BP7A 2MOKA 2GAAA 4HPJB 1IOZA 1AE1A 1AXEA 1BRMA 1M5RA 2WVGA 2FPIA 3L04A 2ERYA 4LYGA 1IK6A 3AI3A 4OQDA 1BN7A 3AM4A 4KE9A 1YZFA 3RVPA 3FPKA 1SHLA 4Y2PA 3WC4A 2XYPA 3BK1A 4GLFA 1YJQA 2BHLA 2O2IA 1EDDA 2KJQA 3KQYA 2O3RA 4KWTA 5FPKA 3F6YA 1YFLA 1US8A 3QF4B 4HRYA 1IE3A 1KPIA 1JB1A 2CMDA 3LCCA 3TLXA 1E7SA 4HNVA 3N2LA 3RUEA 4HAUA 1MJGM 1VPLA 4Q12A 3QX8A 4M4SA 1VJRA 3PHIA 4Y6OA 2WSIA 3U7GA 3S1AA 3BGSA 2JK0A 3SMQA 1QGAA 2QD1A 2W6ID 1JU4A 1NE2A 1JV2B 1QIFA 2G4CA 4PC2A 1G6HA 1VP9A 3S40A 3Q98A 3IQZA 2E82A 2BW0A 2OA0A 3ZTTA 5L4LA 3W5DA 4CGYA 3R7AA 1DUVG 4AJHA 2D7CA 1KK3A 3EARA 3MT9A 1OGJA 3IIIA 3C39A 3PGMA 4E6PA 5FFMA 5ERYA 4RCYA 2HTFA 4BO4A 3A6JA 5SZHB 4Z0TA 4EJSC 4AFNA 4L5IA 1RZ3A 3RVLA 1WHSB 1WUKS 1ZN8A 4LHSA 2EHJA 4HN9A 4JEUA 3WWPA 3WGNA 1MOSA 2VKQA 3L8ZA 3GLHE 4DUPA 4EBBA 4R2XA 5A4KA 4RDIA 2AWNA 3UAWA 2YV3A 3UGKA 1JG3A 4JWKA 1Y9AA 3PNBA 4WH0A 3OQOA 4Y98A 4IS3A 5CVEA 1QQTA 2PBLA 2OBFA 4CTNA 5JISA 4GT1A 2J45A 4J1QA 3B1FA 3BZWA 4NH4A 4Y2GA 1PW5A 1C2YA 2GCGA 3D02A 4HYEA 4CETA 1T3TA 2Q8PA 3ZIUA 4BFXA 3R6LA 5DLQC 5TQ2B 2N47A 4R2LA 2YWJA 1CFZA 1VA4A 3DL4A 5D6NA 3GEMA 1T15A 2F17A 4ZYVA 1RJ9B 2DC1A 2Z2ZA 3WMWA 1J7JA 1C81A 1DMRA 5LOVA 2R0QC 1QCYA 1QYWA 1A9QA 1PE0A 3AJAA 4BWYA 2XOKA 2QW0X 3COZA 2XUPA 3E8XA 3HDTA 4GNRA 4G1UC 3WLJA 4CCYA 2QQFA 3E9EA 4LRSB 4B5KA 2AQHA 1GZDA 2D1YA 3KJNA 3L02A 4K40A 2B30A 4D4KA 4BRUA 3FOFC 1Q7BA 3L7DA 4L50A 3UUWA 2DY0A 3ZEAA 1P5FA 1I4OA 3EVGA 4LRWA 2JI9A 3BAZA 3F7NA 4OJNA 5CCDA 2H7VA 4TQGA 3A6ZA 5HKKA 1GQYA 1QDUA 2WAOA 4DV1B 1U8XX 1T36B 2Q4OA 1SB9A 3WLHA 3WQBA 2INGX 1SVIA 3UYKA 2QTVB 1G3UA 3PR2B 3EFOB 2EGUA 1DPFA 3PJDA 2D2EA 3T15A 5E3HA 4HUTA 2WHPB 2AB0A 4KPUB 4MGEA 3EVBA 2EF0A 3DKVA 5JJ5A 3I30X 4QGFA 3ZZNA 4BX2A 1P1IA 2PGDA 1UMDA 4HUJA 3ZHXA 4B45A 1EDZA 4MGIR 4B17A 4FFDA 4PGFA 4TWZA 3IPXA 1E92A 3C7TA 3P2YA 4FOLA 4DR4B 3QHQA 1Q5PA 1C1DA 1UJBA 1CC1S 2XLBA 3TMYA 1AMUA 2OZKA 3IBYA 4CDMA 1WX1A 1JILA 2DH6A 3EQ2A 3AGPA 2DUUA 4M7PA 4RFSA 1GG8A 4Y6SA 4Z6KA 2E4YA 4BV8A 2IHBA 1ZIDA 2AA3A 2IZZA 3RSOA 1Y9EA 2HCJB 2ZDHA 3LQFA 4G2TA 4TRJA 4JT2A 4UM8B 3LKBA 5AK4A 3ZJVA 2FFRA 2PUHA 3FHTA 4P7FA 3O0DA 4FYVA 3OZRA 1X1QA 1X7XB 5THKA 5JUWA 3GLIA 2BMAA 2ATCA 1NW6A 1SQGA 3DDWA 3JQBA 3BMXA 3OCVA 4MI1A 1YUMA 2FEWB 2W11A 2VCYA 4R3WA 5E2BA 5EA2A 4OO3A 2A1UA 1U6JA 2WU4A 1NQXA 4PX9A 1OXUA 3C4QA 4IG4A 2CMHA 1FTNA 4CV0A 5EHXA 1GGNA 2BM1A 3HYNA 4RQTA 3AYZB 3UT6A 1R27A 4L78A 4G4GA 1MQAA 1Y1SA 1YCDA 2JJ1D 2Y1WA 2WDPA 3RRJA 4D8WA 4PN3A 1P1FA 3ZGOA 3GZTB 4DC1A 3PI7A 2FQWA 1OI7A 4Y6RA 3F47A 3VHRA 1T9KA 1TPZA 3FFAA 2O0LA 5K6AC 5HE8A 4A6EA 1ODLA 1Y4ZA 5E9QA 2WJ3A 3SXUB 1QHYA 1IXSB 3CPSA 4DTCA 5K01A 4L15A 3AG5A 3T7TA 3RARA 3Q9UA 3WA6A 4B3GA 2YJ3A 4E07A 4GKJB 3AP2A 4B3BA 4XD7A 4QASA 1H0RA 3WXMA 5L8VA 3WTCA 1X87A 2JAQA 1G6OA 1KSHA 1PJLA 3FYDA 3LLMA 1S1CA 2YQZA 1L5WA 3QVTA 1SQSA 3HA2A 1U7XA 1W0CA 3QLUA 1QG4A 2YZMA 3FF1A 3VOTA 3SYMA 3VZRA 4D99A 3S5UA 1JAYA 1EUCB 5K51A 2IU0A 4AY5A 1G6KA 1RM3A 5G40A 2UU9B 3E3LA 2ZAYA 1KTVA 4KQXA 4AW9A 2VF4X 1AT1A 1AGRA 1P18A 3TW8A 3WQHA 4PLWA 1DUSA 2C9DA 2ZRMA 3WDSA 5AM2A 2XOKD 3QKRA 4NP6A 2LIPA 3DFFA 2RI6A 4KYVA 4RH1A 2ZIXA 3WB9A 2VJNA 2UVDA 3AG6A 1JQJC 1XTSA 3L77A 2Z4RA 3HA5A 3OUTA 4DA4A 4FXPA 1DQYA 3VVCA 4DV7B 1TQ6A 2PE5A 2Q2WA 2V6BA 4MVJF 3SCZA 4ZYTA 1NXWA 3KM0A 5DNEA 5EE9A 5FPYA 3VNAA 10MHA 3DNPA 4OI2A 1E6UA 4TL8A 2OESA 1SC4A 4U7DA 1Z6YA 3L6DA 1KIMA 2ONCA 5F76A 4WCFB 3E1KA 1V1JA 4HRXA 4RW0A 3U7IA 1YI1A 3B3AA 2AEJA 4QQFA 4BNVA 4ZI7F 5LKRA 2H54A 4DJEC 3V1NA 4B3SB 3AJ8A 3C3XA 4RHTA 2GBLA 1J9ZA 2HPZA 3KJFA 3OZSA 3SEQA 2XNDD 4MV9A 2BDUA 4NK5A 2LPMA 2C5GA 4BWFB 2D3TA 2ZE6A 1DC6A 4IV8A 1MLDA 2JVIA 1V16A 3K7EA 3FIJA 4JI1B 2P9ZA 2W2MA 4LE1A 3VHQA 5H4GA 3KSAC 4X8OA 1A69A 1ZIPA 2WYOA 3DGFC 3O83A 4EUHA 1GWNA 4WXHA 1M2EA 1U0SY 1I7NA 1M66A 1P4HA 1LPOA 1T9DA 3P9PA 4JASB 5DHRA 1XGKA 3EH2A 3RYHA 1ECBA 4YRDA 2BGKA 3QWBA 3RODA 1RSZA 2ZUVA 3AIIA 3H8VA 3QPVA 4UPDA 3KVYA 4NRDA 3ZV6A 1CEYA 3T12A 1KQGA 1V6CA 2BZSA 4XYLA 4RVFA 4RETA 4L4YA 3TNLA 3UATA 4F46A 2BZ1A 2IJGX 2IYWA 1Y37A 3CLHA 4MTCA 3F78A 5CLLA 4F5ZA 1M10A 4MPPA 3IJ5A 5HJ2A 4JZYA 2HQRA 3TOXA 1KYQA 3LDHA 1DAKA 4NONA 1SUIA 3DTYA 3FUWA 2IEYA 5AVKA 3GG2A 5A5VA 1I32A 2CDAA 2G04A 3K0FA 5HKLA 4WN3A 1GA6A 4ARZB 3HWRA 4Q4CA 1G0OA 2YS6A 4JYAB 4BMOB 4KRXA 2HHHB 1UZLA 5GIPE 3NIWA 3TLGB 4NNOA 4A92A 2I1WA 1TT5B 1LTHR 2DF8A 3OM8A 5EGSA 1KOLA 1NOKA 1Y34E 3FWPA 3G0DA 4TSKA 2OP1A 1OXSC 2GZSA 5FOSA 1WZUA 3UENA 3PC8A 2OAEA 3RF6A 2OO5C 1L8LA 3D6FA 3MUEA 2QORA 1XEXB 5FIUA 4RTSA 2YBDA 5HEKA 1QANA 2DFLA 3AONB 1H8HA 1ZIXA 3IESA 3HFRA 2YZKA 3ZLUA 1AUQA 4RZ2A 3EG9A 1JSXA 2XB4A 3N2NA 4QUKA 2LE0A 5CB4B 1TO6A 1O08A 2IPNA 4JY7A 4UEJA 3Q3GE 4W8HA 4AIRA 5JDCA 1ZWLA 1QF7A 4MV5A 2DJ5A 3T1OA 5JQGB 2O3SA 4WZBB 5LZ5A 2VN8A 2HEGA 1MC4A 1AA9A 2B9EA 2C00A 3L18A 3TAXA 4UPVA 4RF5A 3N8GA 2W6OA 4D8VA 4J7AA 1K92A 2ENUA 4L5JA 3BSFA 2YJ5A 1U4NA 4ZCTA 4KREA 1X8KA 1Y4DE 3RSCA 4BP3A 2VA8A 1OH5A 1Z4IA 4RPCA 5KPJA 5GV8A 3OJFA 1QMGA 2ZBVA 4GXQA 4CYMA 2R1TB 4O02B 1L4KA 1ZHOA 1M5UA 1SZDA 1VL8A 2YY7A 2Z6AA 1PQYA 5I3CA 3ME5A 4LDZA 4URFA 2PKQO 4B0PA 3DAOA 4IIVA 5D87A 1CRWG 2H18A 1YR7A 1DX9A 1S0UA 2CXHA 1YZLA 4PLFA 3OCUA 4PSAA 5KNLA 1H5NA 1O5TA 2Q5LA 3K35A 4OQEA 4Y2UA 2Q41A 1J2UA 1ZJ4A 2C42A 5CCEA 3THWA 5NULA 3M0EA 4NJMB 5IK2D 2UYYA 3AOEC 2PMBA 1Y7LA 2OQRA 2Y9PB 2R1UA 3K2QA 3E61A 1GZ5A 2VLIA 1JLMA 2VSFA 1TEHA 1C3XA 4KDFA 4PSUA 4ZVKA 3RABA 2YMPA 2OORA 1JG7A 3OCJA 4EUEA 1BXKA 1O1YA 1KVQA 2C9OA 5ED0A 1RABA 4DV3B 3U7QA 4XUGB 3NM4A 4NFHA 3ABSB 1WD7A 4L0QA 1E9CA 4JC5A 2OFWA 2O3TA 3IQEA 1KDTA 3EFEA 1K4KA 2EJBA 4CF4A 1IBRA 1PZHA 2G63A 3QLVA 4D8UA 1UZAA 2PAFA 1FNMA 4D3ZA 1SC3A 1DFIA 3E53A 1RQPA 2XTMA 3RWOA 4UOEA 1N77A 2FZ5A 3I2KA 5G4KA 3G7SA 3DKRA 5DHQA 3LDGA 4UOZA 1P7WA 3V4LA 3EGVA 1D09A 5JXWA 3HBNA 5DRYA 4HZGA 5AHWA 4AY6A 4EG0A 2XEDA 4K2HA 4DA8A 5BOVA 3EY9A 3GJSA 1SUEA 2EJUA 4BTVA 3ISJA 4PYJA 2JIZD 1K1EA 2PSDA 1O8BA 2JGNA 3KL4A 2H1FA 3D6NB 4R9VA 4QXAA 1U4SA 4TS3A 1R6AA 2QI9F 2A1TS 3HZOA 3CR3C 2QN8A 4ZCSA 4PM4A 3QV1A 3E9CA 5C4GB 3SM9A 1V16B 1NX9A 1OE0A 4COKA 4MWEA 2EP8A 3ADBA 2YFQA 4GPAA 1VL6A 3FGZA 4ZVOA 3T5GA 2QAJA 4OMUA 2JG3A 4PYMA 3GGGA 4D97A 4OHBA 1ISGA 2ZRIA 3OIDA 4GQIA 1M1YE 3N7AA 3E9YA 1UUFA 3O8LA 2W83A 4WKCA 4PZCA 1CRLA 3T3GA 1T0JB 2RIPA 3F98A 3KEOA 3PQ3A 3GLVA 5BNZA 4IVPA 4R8SA 2OFOA 1DIOB 4KDRA 1GAEO 2AEFA 3HB7A 1ZD1A 3JWEA 4DCCA 3I72A 1BJKA 3BERA 4PONA 1VE1A 4NMHA 3U0VA 3WWZA 3WL5A 1O0SA 4BUCA 4KR2A 3EY4A 3PUJA 3GJ0A 5HPYB 3PGLA 2WSMA 4NCBA 4P32A 5BMVB 3GMDA 4N8EA 4PZPA 2HWUA 3ZS9A 3RCBA 4FYJA 3VU9B 1XDSA 1FPQA 5EOVA 3O8BA 1CUGA 2AOTA 4II2A 5CLFA 3A1EA 2IVZA 4NC9A 3TB6A 1SXIA 2P3OA 1CETA 1U2SA 2MSCB 4IQ0A 3B1ZA 4J94A 1LU9A 1G6Q1 5I9NA 3JSXA 2NXCA 1Q0HA 4LCBA 2YOHA 1C4KA 4KUGA 5EKUA 5FPPA 2RCNA 2VAMA 1U1FA 4DEVA 3KTAB 4QO8A 3RVRA 2PUWA 5CNMA 1PDWA 2EW1A 4MI9A 3C85A 5E4YA 3DO5A 3PRJA 1NR1A 3FTNA 5KJEA 2FW0A 5SZKB 3EVFA 4LISA 3V7FA 1LSOA 1TA0A 1JEYB 2NQ2C 1LBSA 5FLKA 1IN6A 1FNCA 3PX2A 4EPWA 5K0BA 3TKAA 2WV9A 4EJ0A 3BTOA 4QELA 1P6QA 3IQHX 4NZPA 4LF6B 1M2VB 1QE0A 1ZZEA 1YRWA 2AJCA 4JFAA 4K5QA 4U2BA 4EABA 2JFGA 1IUPA 3MNFA 3VISA 2Q4TA 1UP4A 4YIKA 4ZRNA 4MVWA 3JQDA 2D0PB 3CURA 4YJ3F 2V98A 2XMRA 4HDOB 4OFXA 4F84A 4ZMRA 4CL2A 1PF7E 5BQFA 5DGXA 5BV1A 3HV2A 3UWSA 3HKCA 1GNTA 4CV3A 2C9BA 3PNPA 3WGKA 1B0PA 2V7PA 1X7ZA 2IYQA 5AKEA 5AOCA 4AJLA 5HOEA 2YN0A 5KJ1A 1W5SA 3U4DA 5KQRA 2OLEA 4TQ9A 1FF9A 4N40A 4P84A 3GJ8A 5TS2A 4Q3OA 1JTVA 2Q2NA 3IUMA 3NHAA 1XNRB 1EFRD 1T0UA 3W06A 1E2HA 5KNDA 3N0RA 2F1IA 2HQBA 2CXRA 3DE6X 3CVYA 2ZKLA 3MWFA 4JUIA 3WNDA 2B34A 3TIIA 4M8LA 1O9BA 1VPEA 2C77A 4DL9A 3KYIB 1ZK4A 4A0RA 3ESDA 3EXEA 2Q29A 1U9CA 2DGDA 4BJ1A 3G0HA 4JIGA 1Q77A 3WL8A 4YHHB 4A8JB 3KHTA 1JT9A 4N5IX 4RCVA 1QF9A 5KBYA 2YN4A 5K05A 4PQYA 2HYIC 4X44A 2NGRA 3QF7A 3ZEIA 1K86A 2J5XA 3O1HB 4MVJA 5LLSA 1R2QA 2J7KA 3F49S 3GQVA 4Q7LA 1WQ3A 1Q0ZA 2WF5A 3RJ5A 3P20A 1OI3A 3ZV7A 3DZIA 1RM0A 2WM3A 1GPYA 3ITKA 4NZOA 2FCAA 4M9SA 2HJVA 4PANA 3R4CA 1NC3A 3K9FC 2QL6A 2PL1A 3ML1A 5AJUA 3IUQA 1L6RA 2JAUA 1P4RA 3AUAA 3TRIA 3I9JA 5BV7A 1DEHA 4TS4A 1JALA 3M9WA 1XZIA 1NJ1A 1ZRHA 3JZIA 4ZHQB 4PXAA 5F5XA 4JQCA 4D4MA 1C41A 3DMYA 2B9VA 1IQPA 3A4VA 3FRHA 1UKCA 4S1WA 3HGMA 4L95C 1AZTA 4FLEA 4CMAA 1S3IA 4HDQB 1S2NA 4GO1A 3AFHA 5EINA 5HZGA 4ZTBA 5CT9A 2C82A 4MQFA 1GADO 3KT8A 3R7SA 3JYHA 1IXYA 2QBYB 4F04A 3RNLA 4IV0A 3GJ4A 3QMPA 3FRIA 4MQLA 2QZSA 3M33A 4U3JB 5CFNA 2HDOA 4LV5B 3OIGA 1KJQA 2R86A 3GA5A 3MERA 2NV2B 3QOYA 4O8ZA 2VYCA 3GNSA 1CY1A 1E0KA 1C3EA 3H84A 4S0XA 1S8OA 4F12A 3LLCA 1ONSA 3I5MA 3D8BA 2XA9A 1ZMTA 2BEKA 1BHJA 2BISA 3IKLA 5JMPA 3UCEA 3QVVA 4TL6A 5IAOA 1PR2A 2WI8A 4Q3LA 3BPSA 4ARBA 1TQ4A 2K7FA 2J3EA 1OH7A 5CFLA 1DWUA 3DOHA 1JQEA 4UDXX 4YMIA 4HGNA 4K9RA 1BFUA 2CFSA 2GTPA 2Z3WA 4JDUA 4CEHA 4ZO8A 3RRYA 1G21A 2I54A 1O6CA 1H2EA 3D7SA 2XMSA 1ECJA 1O94A 3A6FA 3I9V6 3MLAA 4RA9A 4QTTB 5ES4B 4UXJA 1YQUA 3UMBA 1SIBE 2X8BA 4RKWA 4TYNA 2DBQA 3S5JA 4CL8A 2Y68A 1C30B 3QSYA 2IDKA 3I6ZA 1ZW1A 4I4LA 4D4HA 3ADOA 5C35A 3H9JA 3CBGA 3A3KA 5DI9A 4H1UA 4DJAA 1W19A 2UXCB 4CR7A 1GU0A 4AF8A 2GHRA 3T61A 2H2IA 4N5HX 4R3UC 1OYWA 1EIZA 1JHOA 1YKGA 3GDWA 3Q12A 5EC8A 2R87A 3LLUA 5LIRA 3EGWA 1FXWA 4YAOA 5BYAA 1TRHA 1WMFA 2HUNA 3AC0A 3UKDA 4MQ4A 2IOHA 3ZQ4A 3NEJA 2V0GA 4O4LF 3OSUA 3VKFA 2V4UA 2CMFA 4OAQA 2BZGA 3WKBA 4ND8A 1OWNA 3STTA 5ALUA 2W5UA 2YHSA 1IUOA 2MSDB 4MLCA 1Z8DA 4UVDA 4N41A 5JXJA 4HATA 1UBUS 2SCUB 1X1TA 4P31A 3KFLA 4C6TB 5JSFA 2BFWA 3GBSA 5C1DA 2YZ2A 1NNUA 2XDQB 2NU6A 3C5WP 4FQ7A 4J3JA 1W4ZA 1PNRA 1OX4B 1XN1A 3ZV4A 4AZ3B 1X1BA 5LSAA 2I62A 2TMDA 3EFBA 4NHEA 4QBGB 4WD3A 3CVJA 3NPMA 3CSSA 3C6MA 3ZBUA 3SVLA 4RESA 1K8XB 2K2WA 4Q9LA 4Z7QB 2WYVA 1KC1A 4DM3A 4F97A 4YRKA 1W75A 3L1KA 4C29A 4FONA 4ISCA 1LPAB 1FB5A 2G4LA 5EXEA 3NNDA 1TMOA 1RP1A 3KTFA 3UJ7A 3E1GA 5I5EA 4LMBA 1RDFA 2AX4A 4D02A 2AVNA 2I8LA 4YAEA 3U7JA 3PHCA 5CU7A 5DEIA 2ZCVA 2QX4A 2ZIXB 4RD4A 2XZPA 2BE7A 3GPIA 3R0IA 2ZB3A 3PIRA 3BJIC 1UPXA 2DWCA 4PRLA 3RLIA 2H7XA 2ZWAA 5LQMA 3JASB 3RBXA 1RRPA 2WWXA 4ESEA 3FSGD 2AJ8A 2VDMB 1N2OA 3AJDA 3ANXA 3L06A 4S3MA 3TM5A 3FKQA 5DNVA 4A8JA 4IJVA 2EW8A 4N6OA 1RLUA 4HAVA 4MWBA 4OP2A 3VTZA 1T4MA 4DQUA 5JYDA 4I50A 2F3RA 2OFPA 2W71A 4ITRC 1NMSA 2B1JA 4FGWA 2F3QA 4LXXA 3ND7A 4MRMA 5DIZA 1XU4A 2Z6VA 2Q46A 4EATA 3D1JA 2BEUB 4JYPA 2B6NA 5A4JA 4R8MA 4KQWA 2GFIA 2PXXA 4R84A 5P8WA 1I6WA 2ZI5A 2QVGA 3OIYA 1CZHA 2PX2A 4W7IA 2ZBFA 4EEKA 4PYLA 4EZBA 4R1SA 2BN4A 3HUDA 1FLVA 1RBQA 2L0XA 2HA3A 1XP8A 3IDFA 1MB2A 3QVGB 5CDFA 1IYZA 4YPVA 1MV8A 1JFVA 2PXAA 1F4PA 3B6EA 4O4IA 1GZUA 2JANA 2IYXA 4M0MA 1PW7A 3K6JA 1ZMBA 3T94A 3W5JA 2C1XA 1R6VA 2EEPA 2HSZA 1DTSA 2QQGA 2VBFA 4N8SA 4CLRA 1QIJA 1GZ4A 1ZR4A 3ETEA 4P3KA 2B25A 2NZ2A 3D4IA 2X6RA 2ZRCA 1QUFA 3LVQE 4KZKA 1HR0B 1CJBA 4HEA6 4YCAA 4LF4B 1DOZA 2P2SA 2JAWA 2P9BA 4KO3S 1SUDA 4IDFA 2VPYA 2RCYA 2ZZKA 3REFA 2GESA 1KFCB 2BD0A 1EGHA 4JT8A 5FBQB 2HFKA 3ZCXA 4EHAA 4R71A 3GPCA 4CG3A 4NL4H 1G291 3UV3A 4BVBA 4E14A 2XQKA 4BV3A 1GTG1 3H11B 3OM1A 1H05A 6ADHA 4UHJA 1E3WB 3VDMA 2YHIB 2CC2A 4NCHA 3QLVC 4UBIA 5EQTA 4EDHA 1ZC3A 3TTVA 2WPNA 3L82B 3NGXA 1XLWA 1X1AA 3OFND 3PT5A 4XIJA 5D2CA 5ECWA 2BYTA 4U4AA 1PFWA 4RSHA 3OJEA 1TQ2A 4XOUA 1VRVA 1TM2A 1N5RA 3OQIA 2LKCA 2QLTA 3VSEA 1CNFA 3E23A 5EJAA 1RI2A 2IFTA 5DGTA 5IH7A 4ZTZB 2JIRA 4AX4A 4B34A 1CG6A 1DBSA 1UBLS 3A1TA 3AI1A 1A71A 5BWMA 5ED4A 5E7QA 2M6RA 3EWSA 2UYQA 2YV2A 4HDNA 5KYKA 4MV7A 1PD0A 3T3DA 1FMCA 3ONFA 4X65B 4EI2A 4YWHA 4FYIA 1ZSNA 3AF4A 1Y1LA 4IX1A 4O6VA 3FVRA 4KN5A 2Q28A 4L5YA 3AM3A 2VP9A 1K0FA 1BQ3A 2A58A 4E4TA 2LUOA 5IKXA 1V8DA 3HU1A 1T5OA 4GYKA 3Q15C 5DGIA 3FWKA 4DQ0A 1V45E 4HFJA 2CE2X 1WDMA 2BZ0A 4OK6A 4YJGB 3VR4A 4BMXA 4F6CA 3CNOA 1WNTA 3OAAD 3P2OA 4FGUA 4KMRA 1XRRA 1O6FA 3FDZA 4C5AA 4D9CA 2BGIA 2Z1DA 3Q3VA 2XZTA 5DGDA 3Q7EA 5F78A 3NHRA 4G37A 2V4MA 1HRDA 4FS8A 1R5NA 2B0CA 2FR8A 4CT5A 1UM9A 2F9FA 4QGSA 2FW1A 5T7BA 4RAQA 4ZALA 1P0FA 1LK7A 3OKCA 3LUKA 1QK5A 3W2FA 5JD4A 2PV7A 4DR2B 3LPCA 1LFDB 4WK6A 4JJAA 1R10A 3AJEA 4QFMA 4TLDA 4Y1EA 3THWB 3SHTA 3SMVA 1FQOA 1UT6A 3V2UA 2B2CA 3QFFA 4QAQA 4AECA 4MULA 1TJNA 4ECAA 2TMYA 5B2EA 1W73A 5IM5A 3GN2A 3NKVA 2JLAA 4V2UA 3QG1A 4HBZA 1J1ZA 1KDPA 3PFGA 5EHNA 4C14A 3MSXA 2G1JA 4EYKA 4BNIA 4WKNA 1IBSA 4FDMA 5BVGA 1IUKA 4TKVB 3SQWA 3NWBA 4JP2A 5PGMA 4DY4A 5LQKA 2GN2A 1B6GA 3UMYA 3M6UA 1ZJYA 3MA0A 3OZWA 3T7KA 5D6OA 4JI6B 1QUEA 4GKAA 4WBNF 1ZMXA 4MCIA 3RHFA 3OF3A 2C5AA 2FSFA 1KHHA 1QO0D 4K3UA 4WFJA 1CUWA 1Z7EA 2ZCUA 1QORA 1W76A 4XSVA 2G67A 1FFBA 1XR3A 4IJQA 2X23A 5G4KB 4BAUA 4W5RA 1RKQA 2P2GA 4LZJA 3O8NA 1G1AA 4E12A 2VWGA 3BJMA 4GR4A 3CN7A 1COWA 2ZE8A 4GPBA 1KAMA 1U98A 2RGUA 1P1JA 4MAMA 2FUCA 3C7KA 4AJPA 1G0NA 3OLZA 5H70A 3V2IA 1E4VA 4PC1A 3EFHA 1QGED 5K0TA 1NHWA 4L74A 1I4WA 1MVNA 2J6HA 3GCXA 3V1YA 2ZSAA 3PCXA 1PTJC 5E1BA 3ZTYA 1D0VA 2XQVA 2F43A 3N39C 4MWZA 1D2NA 3SIRA 1XDWA 4BU1A 2AYZA 2XE8A 3N0VA 5AXDA 5A5FA 4M8IA 1TJ3A 3L8EA 4A73A 2FI1A 2PKWA 1H0HA 4K03A 2Q07A 3R76A 3U4CA 3VR2A 4B40A 5JRZA 1TEZA 3QFTA 3U7FB 2IS1A 3A25A 2OHFA 2PUTA 2WWTA 2X8JA 1ZWKA 3ZU4A 3LA8A 4CQMB 3WQQA 3Q7IA 1UWKA 2JZNA 4LJ6A 2IHVA 1O4VA 2ZYTX 1AKMA 4B4WA 5IDXA 2JEZA 3DDSA 1R0KA 1D4OA 3WMEA 1OU0A 5AMXA 4KR7A 4WXMA 3P5SA 4RWZA 2GPAA 4H08A 2BCGY 3PUWA 2NTJA 4UUMA 1YR3A 1MO4A 3G0BA 4URHA 1CY8A 1QX3A 1JLHA 2QNIA 2W4QA 2AW3A 1GKKA 2OGWA 2P78A 2ZJ5A 3GGJA 3MINB 4ODIA 4ZEOA 4F9GA 2RGNA 2PGLA 5B7QA 3AR4A 1I10A 2IP4A 2R62A 3C6YA 1BS1A 4AP5A 1WXEA 1Y7IA 2OD9A 3W6ZA 2V59A 1Z5NA 2LXNA 2PX8A 3NHYA 5AW6A 2RHTA 4U7WA 2JDIA 1EVQA 1TZBA 3ROFA 1E2BA 3T4UA 2BT4A 5FO1A 1BWPA 1YVDA 3O4JA 4N5MA 4HXEB 4K8RB 5JJLA 4YI5A 1VXRA 4KYIB 3ZZ0A 1X70A 4C6HA 4XA8A 4BCCA 1T25A 3M82A 4UDNA 5C8YB 4L5AA 4CE6A 2QRHA 3WL3A 4ERXA 3A1NA 1RP7A 2PRYA 1GFSA 1PNVA 5ALSA 4JD5A 1X7WA 1XI2A 4MWGA 5EJ4A 2GJ9A 1YT5A 4CIAA 3U31A 2HLHA 2P0AA 2QLMA 4TVKA 1FUYB 4ACBA 4BRSA 1Y89A 1HMPA 3UWOA 1G38A 5FDFA 3BMQA 3FTFA 4IBOA 4OX9B 1SH7A 3L0YA 2QZJA 3LZCA 1X86B 4JLNA 4RGVA 3TPZA 4BU0A 1M0WA 1PJ8A 4IJKA 2M98A 2NYUA 1E1DA 4HVTA 1IJBA 1M6NA 2ET6A