4LDJA

Crystal structure of a gdp-bound g12c oncogenic mutant of human gtpase kras
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GTPase KRas
publication title In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ldjA00
1WA5A 2P6NA 4RFSA 1E2IA 3GQBA 4V0MA 2VHUA 2QEQA 1TF7A 4K81B 2VP2A 4KHZA 2D74A 3NTUA 2ORWA 1E6CA 1KAGA 1OPXA 1UBFA 2G0NA 4S2EA 4IDOA 2DYKA 2AWOA 4DWJA 1R0ZA 1JNYA 4DDTA 3FYHA 4G5QA 2BCGY 1B0UA 2WKPA 1DE0A 1YZGA 5J4HA 3W9YA 2XJ4A 3BAFA 4BFSA 3NC0C 3PUYA 3REFA 5KSPA 2VP9A 3QKRB 2VL7A 4WAUA 4EQ6B 3GLIE 2Y8EA 2F9MA 4R71A 4LPKA 2G1KA 1ZNYA 4CF7A 3T12A 1IXSB 4A2WA 5D3MB 3VKHA 4TTPA 1KMHA 4E22A 3AF2A 4UXHA 1IN6A 3AVPA 4C0HA 4RZXA 521PA 4LK2A 5A5GA 5L3SA 3EPJA 2PZGA 4KCGA 4JS0A 2FFBA 4G5OA 2ZU0C 2YYZA 3AGQA 4LWZA 5DYGA 1GL7A 2NTYC 4ASUD 2LKCA 2V1XA 4JLOA 1SHKA 1HA3A 4D4JA 3RC3A 4YONB 1ZUIA 2HF8A 3LX8A 1W4BA 2ZR9A 1JPJA 3NH9A 4MRNA 4DB4A 4KFRA 4CEJA 4OQMA 4WVFA 2QQ0A 4RJLA 4C2TA 4M9XA 3TQFA 3L0IB 4ABYA 4F4JA 4DDVA 4Q47A 4JBWA 1T8UA 1OB2A 5AUPB 3BH7A 1FTNA 1LS1A 1OKKA 1YZUA 1OYWA 2ERYA 2PT7A 3P4XA 1N6PA 1RVDA 1SVMA 2IXEA 1U8YA 2QSYA 3MWKA 1E9FA 3NG1A 5JCPA 2NIPA 2WWHA 1Q1BA 2QGNA 2ZI4A 4B73A 5FPTA 5JLJA 2XGJA 1MOZA 4QM6A 3JZAA 4FI3C 1HH4A 4L4UA 1MKYA 4QFMA 3AKCA 1KK1A 4FMDF 3TKLA 2VBCA 3ADKA 1VYUA 2OLJA 3A4NA 1VIYA 4IEEA 3I5XA 3D6TB 3FDIA 2QBYA 1Z06A 1NF3A 3IO3A 3NDPA 2GK6A 1VCOA 1EESA 1Z5ZA 3DOEA 3FHTA 4NH0A 2CHQA 2ZJ8A 5FBQB 2ZAMA 4RD1A 1D8TA 3VKWA 3WYFA 3DZDA 3QVUA 1I2MA 4PPNA 4BFYA 3O8CA 2BKUA 4JBXA 4D0NA 3I32A 2Q3MA 2DB3A 1J70A 4R2IA 1EXMA 1Q22A 3GD7A 3W5IA 1A4RA 1OH7A 3IILA 2QQEA 4QNMA 2W6IA 3AVVA 1ETUA 4TQUS 1HTWA 1T3HA 4JLMA 2P5TB 1UKVY 4LY6A 3G5UA 4U7DA 3VR1A 2QAGC 2QP9X 3SE0A 2F55A 2OXCA 4IOKA 4MYTA 4W9MC 1PUJA 1QG2A 1R7RA 1AS0A 3PQCA 2CHVA 1KJZA 2JIZD 1VCNA 1OSNA 4HLUC 4JT4A 2PJRA 4NCIA 4D81A 2UZIR 4DCTA 4DVGA 4UNNA 1TQ4A 1FNNA 121PA 1I2DA 2OHFA 3E2IA 1XTIA 3Q8XB 2WOJA 4QHYA 4AD8A 2VP5A 3SU8A 2WJIA 1E2DA 5IDVA 3VFDA 2ZJ2A 3ECCA 2JLWA 1UF9A 1IXZA 2FX3A 2V6JA 1PLKA 3HPQA 2QA5A 1ZUHA 2FGKA 4KSCA 2CLSA 4DKXA 2Q0HA 3CNOA 2IUTA 5JWRA 2N1BA 2IWRA 4TT3D 2H17A 4A8JB 2UVQA 3KJGA 2GA8A 2AR7A 2OAP1 4TLAA 1R0WA 4GP6A 3V9PA 4XTRA 4B43A 3H1TA 5HPYB 4Q5IA 2FPKA 4LJ5A 4IXNA 2KI5A 2XZLA 1ZMXA 2WZQA 1DAEA 4M9SA 1XPUA 1E2GA 2WSSA 3FPAA 1W44A 4EPTA 1V5WA 3QXHA 2FEMA 1RRPA 1VTKA 2AWNA 3NBFA 2XNDD 4C7OA 3PEYA 2DY1A 2REOA 3TVTA 2G3YA 2DR3A 4HAZA 5HE9A 1SKYB 3TVDA 3WRXC 1RYHA 3VHLB 1ZVQA 1B23P 1G4AE 1NVUQ 1E9EA 2GEVA 2IHYA 1JEEA 1XTQA 1N0WA 1J7KA 1TUEA 2QE7A 2ZIAA 1F5NA 2XTNA 4DDWA 3LRPA 2XAUA 1OLOA 2DHRA 3RAPR 2OZEA 1ZD8A 3GLHE 2AK3A 1DAKA 3BS4A 2R6FA 2WPDA 4DLUA 3SQXA 3V4FA 4M53A 2REBA 4LGMA 5GADl 2R8RA 4D6PA 2ZI6A 5B2ZA 2H18A 3CB4A 4A6XA 1NL3A 1G5PA 1NVVQ 4POAA 1ELOA 5HCIA 3BJIC 1F60A 721PA 2IUUA 3SHWA 4NYJQ 5HKKA 1YVDA 2FSGA 5SZJA 3B82A 5DI3A 3GJ6A 4FINA 2ZU6A 1IN4A 2RMKA 2C9YA 5EE0A 3QF7A 1G4UR 3PUWA 4NCJA 4JLVA 2H92A 4HSEA 3EA5A 2NQ2C 2RGXA 1JAHA 1BMFA 3A6PC 4B71A 3GLFA 1EGAA 2EWWA 2P5SA 1U0HC 2SHKA 3NEYA 4UKDA 2BJWA 2FN4A 2YJTD 2IS6A 2PH1A 1MO5A 3OIUA 3C8UA 4JVSB 1KI1A 1VDZA 5FR1A 4NMMA 3CF0A 5EXPA 3G0HA 4P4SB 1LVGA 4Z51A 1LV7A 3SYLA 3WP0A 3DVLA 1O87A 2QMEA 4JBYA 1E94E 2ZS8A 2ZSEA 3CPJB 3DMNA 4PAOA 2A5YB 1VG9B 4BFWA 3B9PA 2PEYA 1AZTA 1Z0FA 5B30A 3P26A 2EFCB 3WMGA 2D2FA 1R5OA 1UKYA 4Q7JB 3FTQA 4LRWA 3GJ0A 2Z6VA 2ZITA 4KYIB 3IHLA 4V0ME 4A0FA 1AA9A 1NBME 4BASA 2CLCX 1NIJA 3N2EA 3BD9A 3BFVA 4OI1A 4M9ZA 1XMVA 2O0JA 4DIDA 5KO2A 3N5CA 2ZJ5A 5DISB 1L7VC 2MMGA 1U90A 3BC1A 2FWRA 5B57C 1SVIA 1KK0A 2F9LA 2W0SA 3P20A 4TYYA 2ERXA 2FFQA 2J1LA 3CLVA 3TE6A 2R6AA 3QEJA 3EPKA 4DZZA 1ZM9A 4EPRA 1WP9A 1FX0B 5LB4A 5SZKB 3B1VA 1XNJA 2ZSBA 4KITB 2QENA 2WIAA 4B34A 4F4CA 2GK7A 2BMEA 2GNOA 2P3SA 4QM7A 2V8OA 2DFLA 3O8BA 2XSZD 4M1OA 4Q03A 5HZHA 1E9RA 5B58C 4QBIA 4OI0A 3B13B 4PFSA 1F2TA 2ODWA 3BXZA 3DDCA 4V0LA 1RRCA 3SNHA 1GOTA 1KK3A 1SGWA 3OIYA 1TAGA 2GVDC 1XF9A 3ZIAD 2IYZA 2WWIA 4BRWA 2J5XA 1G7RA 1CF4A 1XB2A 5EZ5A 2C8VA 3MRSA 4Y0AA 2WIBA 4YXWA 4N1AA 1QHHB 4EDHA 4BGDA 2RHMA 1ZC3A 2E87A 2ZETA 3LVRE 2AD5A 5BYJA 4Q7KA 4BPBA 3NIBA 4GZLA 2E1RA 4AG6A 2NO6A 3V00A 4EAQA 3EX7C 3IEUA 2YOGA 3LY5A 4NYMR 4PZYA 4OQLA 1XD8A 4FMCF 1FFHA 3QG1A 1II8B 4Z1MD 3BH6A 2VQSA 1NY5A 4XWKA 5C4MA 5KUTA 1X1SA 1ZJ6A 5SZHB 3MGCA 4CT4B 4DJTA 3K70C 1E2HA 1GWNA 2G0TA 1H8ED 2HV8A 3OE7A 1OIWA 3GLGA 5IHPA 4P31A 5DN6A 3TW4A 1SXJA 1EK0A 1XEXB 4PANA 2OXRA 1YQTA 2W58A 2XITA 3VR3A 1TU4A 1OE0A 1IONA 4V0KA 4NTZA 4NYIR 3J81k 3EWSA 3E5HA 5BN4A 3GEIA 3QUSA 2V6IA 4NDZA 2JLUA 1CJKC 1AS2A 1R5NA 3CM0A 3RHFA 1CJTC 4I1OA 1GL9B 2IHBA 4IFEA 1T8TA 1IN5A 5L3QA 1JR3A 5JCZA 2CNWA 1J8YF 1A2KC 1W4CA 4NONA 4L16A 5FTNA 1N5LA 4N0EA 1SHZA 3GLIA 2O5VA 5J5CA 4RZUA 4ARZA 4BZQA 3ASZA 4X8LA 3IDQA 2V7QD 1RZ3A 3U7GA 2J0SA 3DEFA 4URWR 1P61B 4LOAA 1IAQA 5FOVA 3IPXA 4MGYR 1A7JA 2OFOA 4D4MA 2OILA 1KSJA 3WNDA 1PVOA 2ZTSA 4FMDB 2QMOA 5CJPA 5DLQC 3THXA 1CS4C 4ACAA 4TYPA 4XD7A 4PHTA 1GP2A 2R2AA 3HWSA 5GVSA 2NZ8A 3AP2A 4R9UC 2JJ8A 3UXMA 3T34A 2QNRA 4DSUA 4ZCIA 1YR8A 4WA7A 2IYRA 3EZ6A 2CL0X 1RW4A 3FE2A 1S96A 1EFRD 1NRJB 1WQ1R 3G82C 2WWYA 2OG2A 4Q1BA 3EW9A 3M4YA 1EG7A 4JSYA 1P9WA 3R9IA 2XXAA 1II0A 4M1MA 4CEIA 4LYHA 421PA 3EPHA 2G9NA 4XVQA 4HZUB 3NC1C 2RCNA 2J7PA 2DWOA 1OH6A 2QT1A 2H5EA 2P2LA 1EFTA 2HEIA 4LSGA 2C03A 3TAHA 2C77A 2NG1A 3U44A 1G6HA 2JCSA 4Q4HB 1DAIA 5EP3A 2PT5A 3F0TA 3AH8A 4QBGB 4Q02A 5LDDC 1DARA 3VR4A 4BE7B 1CR4A 2FOLA 2V9PA 3UG6A 3QENA 2XNSA 4OKSA 4FW9A 4OBEA 4FCWA 2JLSA 4G0NA 2O8BA 4ZO4A 4YMVA 1RC8A 5JSZB 3QKUA 4X8MA 4MDFA 3ZJYA 2IA5A 3BERA 2PZEA 1G19A 1J2JA 1LTQA 2Q3HA 1W0KD 1AGRA 4UJ5A 621PA 2O8EB 3LBNA 1P7CA 2ZM5A 2X19A 1TQ6A 2OBNA 1S0UA 3KZ1E 3U6KA 1XZPA 1F6BA 1I4DD 1M7GA 2ZRDA 1OFUX 3X1XA 3OFND 3I73A 2LCFA 2FF7A 2ZRMA 3U5ZB 3IO5A 4TYQA 4ZPXA 3NBYC 4L9WA 2FPLA 3LH5A 1G3RA 2ZYWX 1AS3A 2C99A 2GXQA 1N6KA 3RS3A 5AJVB 2HDNB 2VTKA 4ZDIA 5BXQC 1I4LD 2ATXA 1KI2A 1NN5A 1OKKD 1II9A 3BBPA 3CRQA 3K9LA 4BLRA 1Z6AA 4GOXA 4EIWA 2OSBA 1MRSA 4FN5A 4YMSA 5JRJA 3ZQJA 5DYIA 5KSZA 3FKQA 5FPSA 5KPDA 1OFHA 4Q21A 2O8FA 1EFHA 2OUKA 4B3FX 4GRAA 2O8CB 1FUKA 2D06A 3WNCA 5FI1B 4A82A 3LQQA 2NO0A 2QAJA 3QXCA 3MAAC 2XOKA 3LBHA 4XSGA 5EP2A 3Q9LA 3ZS8A 1A1VA 1RRGA 4RFSB 2JLYA 2ORIA 2VPPA 4NBSA 4TMVA 1W4AA 3IBGA 1RFLA 4PPGA 1KK2A 3OIVA 3GLFE 4KJZA 1N0UA 1X1RA 3WMFA 3HPRA 4OK3A 3EAQA 2R6GA 5KNCA 2DFNA 2RHDA 2WJYA 3SC3A 2QMUA 2X2FA 4BEJA 2WJVA 4F91B 1XD2A 4JLJA 5AJWA 3S1AA 4YLGA 3QEOA 2EVWX 2BC9A 2VEDA 4B6FA 5CB8A 5GVRA 5F9HA 2ZYUX 1F3OA 3WHLA 2YC2C 4CEHA 1XCMA 2W6ID 4W5JA 3BWDD 3ZS9A 2G77B 2C04A 4TL7A 4WXRA 2UKDA 1ZNZA 5TARA 2MMCA 3U4QB 2OT3B 1FP6A 4NHOA 4ZIRB 2QAGA 3KFVA 4A15A 2QTFA 3KXLA 3IIMA 1R6BX 3B8HA 5EQTA 4AI6A 3VHXA 3RS4A 1D6JA 1PJRA 4Q66C 1TEVA 2OEPA 4GT1A 3VR2A 3THYA 3VKGA 1JALA 2MSEB 1GFIA 4TLDA 4DLWA 3K70D 1KI6A 3AP1A 3GEEA 1AJEA 5B64A 3U60B 1G3QA 1U2RA 1IBRA 1SXJC 2GCNA 2HUPA 4B3XA 4EJSC 4HUTA 3KQKA 2W00A 3CWZA 1Q0UA 5JMTA 4DHEA 1U0JA 2A78A 2ZRIA 1M34E 4US2R 2X77A 3L43A 5J4KA 4KAXA 1WE2A 1YE8A 2WJHA 3ZZTA 3KQLA 2OBMA 3SBDA 3NDBB 3X2SA 1G1MA 4MKIA 3AKEA 4MRSA 1GKYA 4TSFA 1AM4D 4KLNA 2JLVA 1WDTA 4P32A 3OEEA 2VIIA 2FZLA 2ATVA 3FHOA 2NO7A 2JJ1A 1R4AA 5EE3A 3KJEA 3EZ9A 2YWEA 4NE2A 4IVQA 4V0OA 3VTKA 5J40A 1Z6TA 3RS7A 3UWOA 4D25A 1TQDA 2NMVA 3ND8A 1E9BA 1G8YA 1HE8B 1NLYA 3K0FB 3VAAA 4W5WA 1AKYA 1EX6A 1RE0A 1TNDA 4TMXA 4WXPA 5H68A 2CMKA 4EFLA 3AF1A 1OW3B 4X8HA 2MSDB 5JWOA 2VP6A 4HAXA 2H16A 3K0EA 1FP7A 1OIVA 2F7SA 1ZD1A 2IYWA 2XTZA 4ILEA 2QBYB 3UMRA 1OHHD 2CJWA 2OBLA 1VIAA 2B6HA 3A58B 4DDUA 4D0GA 2PMDA 1XPOA 4Q9KA 1JB1A 1WRBA 2QGZA 4PHFA 2AFIE 5HCNA 2F43A 3AVQA 1D5CA 1QZXA 1KI4A 3MCAA 1DG1G 4OI2A 4YMTA 2F6RA 1Q1EA 1XTKA 2FNAA 3OHMA 2JJ2A 2VRWA 2D7CA 1CTQA 3SJZA 1OT3A 2WJJA 5KU1A 1ZD9A 2EYQA 1NN3A 3DOFA 3GLGE 4F92B 1E2LA 2IK8A 4YQFA 1U99A 4KU4A 1M7BA 5E7JA 5HE8A 4DT1B 2WVJA 3SHFA 3TAUA 2F1HA 3QVVA 1FQJA 5GJCA 2WPDD 3SS8A 1PUIA 821PA 1D9ZA 2QI9C 4D2IA 3NEJA 1DTSA 1RJ9A 5FUXA 2WKRA 4PPQA 1N5IA 1HV8A 1NBMA 3N70A 4CDGA 1VYVA 5P21A 3SEAA 2ZSAA 2H57A 4Q4AA 4OL0A 4QHSA 1OJLA 1IJFA 1UAAA 2R44A 1G21E 5HKKD 4Q1EA 2QPTA 2R6DA 4NCKA 4P4TA 1XP8A 1YR9A 5C4GB 2A30A 3RRNA 1JR3E 2ZRBA 4KO8A 1M6NA 4TZ0A 4G5SA 3AF4A 1E69A 1Z0AA 4URZR 1GKIA 1KSFX 4YC7A 6Q21A 4Q1DA 2HF9A 4FMBB 1JAIA 3IIKA 5HZKA 1TF2A 3ETLA 1HEIA 4FMCB 1BMFD 4US0R 4V02A 5GJVC 3VX4A 4JIMA 2W2VA 4I81A 3TUIC 1HUQA 4DIEA 3QSYA 5K8UA 3U3RA 5F3WB 3RC8A 2YV5A 2W2XA 3EC2A 3QBVA 5FPKA 2GJKA 1QHSA 1XTSA 2Q3FA 1KZ7B 4HAUA 5G3YA 1UBEA 4I1VA 1WBBA 1WMSA 2ZQ5A 2BBOA 2NPIA 4ON9A 3KUDA 5JEDA 2CK3D 4O3MA 2GJAA 3VU9A 1N25A 4KODA 1P6XA 3Q7QA 1FQKA 1G20E 2WWGA 3MWJA 4IOLA 4TTRA 1E4VA 3ZLJA 4MQBA 2OFXA 2Q6TA 1ZBDA 1YZQA 4C30A 1CIPA 1XPRA 1JJ7A 3AVUA 3LXXA 1CRPA 3M1IA 3RVBA 1WXQA 3ZVMA 2VLIA 3BIFA 4FWIB 3RWOA 3QPUA 3MD0A 3UG7A 1S1CA 1GNRA 1X8LA 3KXIA 2IS4A 1KZGB 4B2IA 3T1VA 3SBEA 4V03A 1JXMA 4UNQA 4JLNA 1HT2E 2C9CA 5FTJA 2WMOB 4IOJA 4HB3A 3VR5A 3WNBA 2CVFA 5KNBA 3KKMA 1NMYA 2PJZA 4QKQA 4OI4A 3B1ZA 4H9GA 4NL4H 1L4YA 4PQYA 4GFDA 1XXHA 3TGPA 2GDJA 4D4LA 4LYFA 3UKDA 4RVCA 4BLSA 1Q1QA 2AX4A 2QUZA 1NN1A 3R8CA 1XX6A 4B2LA 1KI7A 4C0LA 3EZFA 5HTKA 2PX0A 4KFUA 4QJ3A 1CR2A 1WF3A 2OCAA 5AWFC 4ZCMA 4M1YA 2GXAA 3B7GA 1X8KA 4JMPA 2BCJQ 4OHWA 2D4HA 2G83A 4ZV4A 2IUSA 4I1SA 4A0RA 2YKGA 3TUZC 4EUNA 1VMAA 2ZSDA 1E0KA 1XU4A 3THOA 4B2PA 4DUGA 1W36C 2GCOA 1G8HA 1N6OA 2P6UA 1ESMA 4JVLA 2RKOA 5FFMA 1AQUA 5LBIA 4YXWD 1ANKA 4MGKR 1G8GA 5LPNA 4NCHA 1ZCAA 4IDQA 1NVVR 2CE2X 2YVUA 3CRVA 5IF9A 5FPHA 2YNMA 3WBJA 1P60A 5TXGA 4G5RA 4NYJR 2J0UA 2I1VB 2ZJOA 2PX3A 1KSGA 5K8IA 1G291 2A5GA 5CYPA 4M22A 1N6RA 3DL0A 3RRMA 3OE7D 1G16A 2W2TA 2ZR0A 4IVPA 5DN6D 1MABA 2ONJA 1SXJD 4AWXA 1WCV1 2IYLD 2RH5A 3KX2A 3AM1A 4DSOA 1GM5A 3U61B 5CB6A 1P5ZB 4QGAA 2G88A 2ZREA 4XTCS 1W0JA 1Z2CA 2VSOA 3U3MA 4LV8B 4HUQA 1Z6GA 2J0QA 1DO0A 3AVXA 4LYJA 2A5FA 1X8JA 3LAWA 3O47A 4DBLC 1Z63A 3IBYA 3EZ7A 4ZDJA 3UIEA 5KYKA 4IW3B 1H8HA 1KI3A 1E32A 4DLVA 2CNWD 3CR8A 4AIIA 2O0KA 3QKRA 2ANCA 4A9AA 3R9WA 2AKAB 3OAAD 1G3IA 2CVHA 5JI2E 1OXTA 1P2VA 1IM2A 4A0GA 1GUAA 2QZ4A 4IJMA 5D3MA 3PIRA 4MGIR 1KTVA 5FOUA 3WY9A 5EZ6B 4QBFA 5EE5B 4XVUA 2C2HA 5DE3A 3WYGA 4O0MA 2XX3A 4MYUA 1P72A 3KB2A 2FSFA 4DB2A 5CIQA 1QVRA 1Z08A 1XJQA 4GL2A 3KB1A 1E2EA 1XFAA 3TNFA 2G1JA 3FMPB 3ZYCA 1A82A 2R62A 2QTVB 1QG4A 3L0SA 2WWXA 2FFAA 2KWIA 4GMXA 4PAQA 3WMEA 4PC6A 4XD7D 3FGNA 4RD4A 2D2EA 4NCNA 2GTPA 1COWA 2CL6X 1L4UA 3DKPA 3UK6A 3RSLA 2BWJA 3BE4A 3LD9A 4A0HA 1GNPA 5EJEA 4D0LB 2V4ZA 3CWQA 4PR0A 4RD0A 4KBFA 1RKBA 4BFZA 3OEHA 2CCKA 3NWJA 4PHGA 1G5TA 5IRCD 1NN0A 1T4GA 1GDDA 1BKDR 3BFKA 3IUYA 2FFHA 1AZSC 2J7PD 2ZI3A 2GZDA 1UEJA 1W46A 4YMWA 4I1UA 5GJWC 1KY2A 1NSFA 3KTAA 1D9XA 1IQPA 4C2UA 3U3JA 4DSTA 1IJEA 3QPWA 3PR1A 2PCLA 4LC0A 4URXR 1NG9A 4CW7A 2WHXA 4GBMA 1W5TA 5FOSA 4AKEA 1CR1A 2EW1A 3D7MA 1GIAA 4S35A 2REXB 2QY9A 4MDEA 1IY2A 3HJNA 4JKYA 3U6BA 1ZU4A 4M1KA 1FL9A 4LC1A 5C1BA 5IK2D 2P0EA 1XTRA 1Z0KA 3QBTA 3A1SA 2XZPA 2NZJA 1DEKA 2QG6A 3MJHA 2HJVA 4IHQA 3TR0A 1OB5A 3CF6R 3Q85A 3NKVA 2VSXA 4MH0R 5E3HA 1K6MA 2HXSA 3C41J 1S1MA 1ODFA 3GLIB 2W6JA 1GITA 3FFBA 1E1QD 5AUQA 2QT0A 3P4YA 3B1YA 1MO3A 3FOZA 2BM1A 1E2QA 1M2OB 1XEWX 1OXVA 1W2HA 1VG8A 1R10A 2PLFA 3A1UA 4WZAE 3BH0A 1UM8A 2B7CA 2F1JA 3AEZA 3PEUA 2P65A 4ZCLA 1KI9A 4C0SA 4LHVA 2OO7A 3GMTA 4BFVA 3AF0A 4FIDA 5FR2A 1LY1A 1YZKA 1ONBA 1SVKA 1VCIA 4EPXA 2V54A 1E2MA 1J99A 4JL5A 2IF0A 1Y3AA 1LS6A 1FMLA 2WBLC 4I99A 4KBGA 4HB2A 4XH9B 2LKDA 2XOKD 2JDID 3TLXA 4NPHA 4JLBA 1F2UB 4EPYA 1TU3A 3T06B 4ACBA 5KHOC 1US8B 4A8JA 4A92A 2XB4A 5LD2C 3K9GA 4BECA 3GFTA 3F3YA 2QORA 1NG1A 2QM7A 3QKSB 1C9KA 2DCUA 4Z8XA 1E2NA 3U3KA 4AKHA 1VHTA 1QRAA 1T0HB 3D8BA 4ZDKA 2XJ9A 5FPYA 1KI8A 2VSFA 3AUXA 4LYAA 4MYCA 5ANRB 1GTVA 2A7QA 2FSIA 1N5KA 3SFVA 1K5DA 1W36D 2IS1A 1H65A 3HU3A 1P2UA 2ZS7A 2IYQA 3NXSA 4RD2A 3IQWA 5E7IA 2ZAOA 4TL9A 1P3JA 4PQRA 3DO6A 1BOFA 3RS2A 4P4UA 3FKSD 3CPHA 1EX7A 3QG5A 2GESA 4Z8YA 4Q4JB 5EP1A 2HLDD 4PX9A 2Z0MA 2Q21A 2J87A 3TQCA 3FMIA 4B35A 3AVYA 5BYKA 3A4LA 4IDNA 1NY6A 3RANA 1U98A 5FL7D 4LJ7A 1NVWQ 1ZM7A 4FXPA 1LF0A 4NKRA 4NZYA 5K8TA 1ESNA 1JI0A 4Z54A 1KGDA 4JJZA 2DPXA 1KY3A 3ADCA 4EJSA 3OESA 3LDAA 2ZE7A 3PFIA 1G41A 2ZYTX 2R6CA 4E03A 1R8SA 2WM9B 4LJ6A 1X86B 2ZS9A 4CGZA 1DO2A 1NJGA 4GI7A 2FG5A 1G7TA 1XXHE 2WSMA 2IBMA 1YRAA 2TMKA 3WBKA 3X1WA 4OK5A 2ZUBA 3I4LA 3LLMA 4B6EA 5HR5A 4LBWA 1WB9A 2JJ1D 2GJ8A 3CRRA 3TJZA 1BO6A 3GP8A 2EFHB 4C0BA 1Z83A 5FOXA 1NMXA 2ODEA 4QL3A 2QROA 4IOMA 4QGFA 4BFXA 4XWOA 3NHBA 4N0DA 2BIFA 3BRWD 2GHIA 2QMHA 2GVZC 3PUVA 5C2JB 4W7SA 4BFUA 2IXFA 3VMFA 4TT3A 3MLEA 3DMDA 1CBUA 2O8DA 4U02A 3WP1B 3GPLA 4UNPA 2DWPA 4PC7A 1X3SA 1KIMA 2BBWA 5EE9A 3V4RA 1DG3A 3A8TA 5JZVA 2R9VA 4TQAA 2P6RA 3EWAA 3GCGA 2RGNA 4OJKA 3REGA 3NBXX 4EPWA 2JJ2D 4HYYA 5DIFA 1ZIOA 3H86A 4JVMA 4H1VA 2PLRA 3QE0A 4DLSA 3K8YA 2NO1A 3ZVNA 4BEBA 2GWHA 4MRPA 1CRQA 4TTQA 5JWHA 3PVSA 5J4YA 4KVAA 3FHCB 5DO9A 5K8LA 5TMPA 3NVAA 3W34A 1BYUA 2GRJA 2QAGB 1AN0A 3PJRA 2VH5R 4C0JA 1NBMD 1KDPA 2FMXA 2ZRFA 4LJAA 3HR7A 4JLDA 1E1RA 3L8YA 5DH9A 1EWQA 1JPNA 2J7KA 4KYUA 2FEOA 4B32A 2ZJBA 3OZXA 1UFQA 1LFDB 3GLHB 2IF2A 5FBWB 1FX0A 3M0EA 2X1VA 1UJ2A 4URYR 4Q18A 4PO8A 4DRZA 5JS7A 2J46A 3MFYA 4PZLA 1KDOA 2HT6A 1HURA 1U94A 4DLTA 3THWB 1XD9A 3L2OB 1GRQA 4HDOB 5BW8A 1ZINA 2GEDA 3R7WB 3W6OA 2CHGA 2YINC 4MA4A 5JI3E 4A1FA 5E7MA 5CJ2A 4JLAA 4QNRA 3AGPA 3H2YA 4MRRA 1QHIA 8OHMA 1N0VC 2IYUA 3I8SA 4TZ6A 3I72A 3K53A 1FZQA 2ZJAA 5CK4A 4PSAA 1T3SA 1J90A 2Z4RA 3SOPA 1BYIA 4GP7A 1W4RA 4PQFA 4XJXA 2Z4SA 5JJIA 1QHHA 2JA1A 2GF9A 3K0AB 3NHAA 3KJHA 3K9HA 4IKEA 2RGGA 1U0LA 2RB4A 1TTTA 4B3GA 1F48A 2BMJA 1IXRC 4DLXA 1Z47A 3LA6A 1II8A 1G3UA 3AQ4A 2QRNA 1HT1E 4XIGS 4Q1CA 3UMSA 1XJCA 1G18A 4JJKA 3TH5A 4QRHA 4GNKA 4FD2A 1YZTA 3H0KA 4HAWA 3GFOA 1KHTA 1DPFA 3KFXA 3L82B 3MWYW 3ZH9B 2H1LA 1XEXA 3K0CC 2YWFA 2JLZA 1E0SA 1G9XA 1DOAA 2FJUA 3RRYA 2HYIC 4K46A 2QTHA 5FI0B 2EFGA 1T5IA 3FWYA 4IRUB 1UPTA 2AXNA 2WJGA 2LWIA 4LZZA 2AFHE 1I4TD 2OFWA 3CR7A 4GZMA 2ODNA 3CH4B 3N2IA 4MRVA 1E79A 2B8WA 4RZ2A 3RWMB 1UKZA 4A8JC 2CEAA 2VF8A 4Y0VA 2F3RA 5FTLA 1YKSA 4M8NE 4BLPA 3T61A 3LX5A 2A3RA 1HYQA 2O0HA 1UEIA 2J3EA 3TBKA 2FPMA 1R0YA 3UANA 3JVUA 4KLZA 3SFZA 4IVRA 3AVWA 1Z0IA 2ZI5A 2A5JA 3PUZA 3CZQA 1SKQA 4DXAA 4CT5A 1E2PA 3IGFA 2XSZA 1NKTA 4N3NA 4BQSA 3L0OA 1KMHB 2VYFA 2UZ3A 2W0MA 4TMWA 3CRW1 3EZ2A 3FFAA 3FVQA 3ZIAA 2NOAA 5L3SB 2C9OA 2IL1A 2BDTA 3HYRA 1W49A 2I1QA 3DPUA 1E3MA 1ZU5A 1G6OA 1O3YA 4Q7MB 2IEYA 4URUR 3H84A 1YR7A 4U5XA 4OQNA 4TL8A 1L8QA 3UATA 1XCPA 4CEJB 4WBSA 3ND9A 2F1RA 4XSHA 2AHOA 3B6EA 4A2QA 4LBVA 4C0QC 3ZQ6A 2JASA 5M04A 3ADDA 1E96A 3QQ5A 2F1IA 1ZM2A 1OV4A 4HZUA 4LPSA 2GAOA 2JATA 1DBSA 1DAMA 2IT1A 3PEWA 1W0JD 1NLZA 3PENA 4ERNA 2B92A 3EIEA 1DAHA 3GJ3A 3SYNA 2ZRPA 1G7SA 1OIXA 4CIDA 1GILA 2B7BA 4RZ3A 4BZXA 4RFVA 3SQWA 1HQYE 4KI0A 4Q4HA 1P73A 1AQYA 1S9HA 1UADA 1H8HD 4DEXA 4Q9HA 3LWNA 4Q00A 2IEZA 3CKLA 4US1R 5J4LA 1W2GA 3Q5EA 3ZZUA 1N2CE 4DEYA 5F2EA 2H8KA 2IYVA 2ZRKA 1QHNA 2WSSD 4FWTA 5TVKA 2RAPA 3I5YA 4I4LA 2QP3A 2YC4C 2ZRHA 5JSZA 1KO7A 1OXUA 4LHWA 4WIAA 1P4SA 3CRMA 1GRRA 1W47A 2FH5B 5AJYA 2O8EA 1SKYE 3CX7A 3HYTA 2BKEA 1XMSA 5H70A 1VCMA 2ZROA 3AUYA 3CONA 2JGNA 1Z22A 1GVNB 3BORA 5AR1A 2RGNC 2BOVA 5KDOA 1SULA 3WHKA 2WKQA 1QHYA 2RGEA 2VF7A 3DHWC 2QE7D 2WTUA 1MO6A 3B5JA 4WOPA 3C16C 1COWD 4L5BA 1U8AA 5EXTA 2VP0A 3ZD7A 2N42A 4UQOA 3KL4A 2CL7X 1EFUA 1CJVC 3MG9A 3FMOB 4CRWB 4RD6A 2ZJZA 3I3SR 3OEHD 3K70B 3C5HA 3D31A 3QXXA 4QXAA 4C0AC 2CXXA 2GILA 4JT2A 2O8CA 4BLQA 3VNVA 3EPLA 3O8DA 2W83A 4PSVA 5KSYA 4NU0A 4PC2A 3BFXA 1VKJA 4DCSA 1NLFA 2PBRA 1S3SA 3DZ8A 3QPVA 1BH2A 4HUQB 1XRJA 4QJ4A 2I3BA 4IDHA 2MSCB 5EXSA 3ZVRA 5JEEA 2EYUA 2YWHA 5FBRB 1Q57A 3I8XA 2KE5A 1Q1ZA 1BIFA 4G5GA 1P2TA 1GL6A 3VR6A 4Q9IA 3P32A 2PEZA 3CNLA 5TV2A 4G01B 4HLDA 2GAAA 3W8RA 4DSNA 5GJBA 3L8ZA 4EFNA 1NMZA 4IFBA 2ZE5A 1Q3HA 3U4QA 4X8OA 4ZIRA 2ODBA 2W6JD 2IC5A 1KAOA 4TLEA 2VHQA 2ZUDA 4C7OB 1UDXA 1W0KA 1YZLA 5J47A 1GRNA 1P9RA 3QF4A 2WWWA 4RD3A 1T6NA 3QY0A 5AJXA 4F4IA 1G3MA 1YRBA 4QGHA 3QXJA 4MKFA 2Z5FA 4IDPA 2X8AA 3PV0A 1E4YA 3OFNA 1NVXQ 3VQTA 5FBLB 4LX0A 1JJVA 4HB4A 2IXGA 2PL3A 3W5JA 1K5GA 4EPVA 1N5JA 4G1UC 1OXXK 1PV4A 4PTLA 4JYCA 3BB1A 4HI0E 2XB2A 4R2HA 3RABA 4ZI3A 2C96A 2Z83A 1ZNXA 4AKIA 1DS6A 4HAVA 2HXYA 4KSBA 4ZKDA 1DAGA 3HDTA 1XZQA 1KOFA 1VYTA 1C1YA 3HU1A 3PCRB 5F9FA 4L9SA 2EFEB 1N6NA 3U3OA 3A1TA 5DI3B 3X1ZA 1CULC 1E9DA 2QN6A 1W1WA 1Y63A 3A1VA 3K0FA 1ZYUA 1Q21A 3KTAB 3T15A 2DFTA 1ZUNB 4E07A 4ESHA 1G8FA 2GZAA 4JLPA 1JR6A 3BOSA 2QRZA 5EUQB 1KNXA 2OAQ1 1E0AA 1XMJA 3UPUA 2EWVA 4HLQB 1G8PA 3I61A 3GLFB 4MKGA 1U81A 4DCNA 5C46F 3LXRA 3SJAA 3TSOA 5CLLA 4OHXA 3TK1A 4B75A 3U7FB 1GKUB 5TDHA 4DLRA 3SN6A 4OHVA 1ZIPA 2QSZA 5DGXA 1UBGA 1LF5A 4HB0A 3AB3A 3GFPA 1Z0JA 3KJIA 3BB3A 1P9NA 3E1SA 4DT1A 4MGZR 3LFUA 1DVRA 2XZOA 5CDFE 4TQ9A 2A5DA 3TW8B 1SVSA 5JHGB 1ZCBA 2IYTA 3EG5A 2IW3A 2FSHA 3K1JA 1YU9A 3CW2A 3GJ7A 4YMUA 1AK2A 1XBTA 1XEWY 3WXMA 4AG5A 1OYYA 2YOFA 5AK0A 3H4MA 3W3AA 4B3BA 4HLCA 1C4OA 3E70C 1KJWA 1CKEA 3LBIA 5JJKA 2IX3A 3R9XA 4DLZA 4CYMA 5CYOA 3B78A 1JEDA 5A0FA 1ZAKA 5FTKA 1QVAA 2ZUCA 3F8TA 4B3CA 1MH1A 1N6HA 3B60A 4MITA 4UXJA 1JR3D 2BEJA 5DSZA 4Q1FA 3EA0A 3ZVLA 1D2NA 2WOOA 2YHSA 1XWIA 2BMDA 4EQ6A 1M7HA 1KDTA 2GETA 1ZW6A 3W3ZB 4JKIA 4TWZA 2OV2A 3T5GA 2GXSA 2AN9A 3KKPA 1F2TB 3K09A 2WMNB 1MO4A 1CP2A 4OHZA 4PHHA 5CK5A 3SDZA 3U2QA 2HT1A 1EWRA 4R7ZA 2QM8A 5H8WA 4V0NA 4ESVA 1W7AA 2NPFA 1OHHA 1LNZA 3CX6A 3RLFA 4AYXA 1IHUA 1T0JB 2CE7A 4A4DA 3RRZA 3LV8A 1TL7C 1ZM4A 4KFTA 3F5FA 2ZXUA 3CF2A 1JQJC 2ZE6A 2OCPA 3TSZA 4B47A 2ZEJA 2WAXA 2FE4A 1FMJA 1X6VA 3IPYA 1W5SA 1DELA 4L8GA 2ANBA 2Q9BA 3KXKA 3GLGB 3TRFA 2VHTA 1SXJB 3WRYC 3SZRA 2JAQA 5JECA 1E1RD 4EJSB 3KKNA 1E9CA 1HE1C 4GMDA 1KO5A 1AKEA 1T9HA 2VHJA 1M74A 1XDBA 2D62A 2CCJA 1GZSA 4QC2A 4XOIA 5EE1A 2D3WA 2GXUA 2PZFA 1VPLA 4LHYA 5LB2A 2IWHA 1G5RA 3C15C 3LLUA 3LVQE 4AC9A 4GPTA 5KOYA 2IS2A 2WV9A 2BM0A 1S9DA 3IHWA 4UNRA 1CXZA 4LCBA 1LW7A 2JLQA 5FBVB 3I92A 5L3QB 1IY0A 2OCBA 1KO4A 4LHZA 1QBKC 4A6PA 5KDDA 1Z07A 1S4QA 3GJXC 4QGGA 5FL3A 3GJ5A 4QG7A 3EASA 2AKYA 4OK6A 1LB1B 1QF9A 2L0XA 3AKYA 4KV9A 4OHYA 1IN8A 2ZJYA 1GAJA 3RDPA 4ARZB 5E4FA 221PA 3ASYA 3DM9B 4Q48A 4ZI2A 2VP4A 2GBLA 4B74A 5JFGA 2O8DB 1ZP6A 2J45A 3O8RA 4D82A 4XWAA 3RSOA 4ASUA 2BBTA 4TL6A 3D3QA 4B3DA 3IQXA 4LV5B 2R65A 3UWKA 2IYXA 2HCJB 1TQ2A 2J9RA 2FU5C 3W90A 5BWMA 2CK3A 5UKDA 3THXB 1GSIA 5DI9A 1OXSC 3K0CA 3LQRA 1WBDA 5EXXA 3PXGA 4K8OA 1TMKA 3EC1A 2ZI9A 1T5LA 4IEIA 4PAMA 1A5TA 3KQUA 2NGRA 2PMKA 2KBFA 3SYKA 1J8MF 5EUMA 4RKEA 2CBZA 3HR8A 4C4PA 2A9KA 1NJFA 2FGJA 5AUOB 2ZE8A 1E2KA 2J0VA 3NBZC 2XXAB 4AYWA 4CVNA 4CEIB 1VG1A 2ZI7A 5DHFA 1E79D 4F38A 3PUXA 5TB5A 3Q5DA 5TY0A 2GKSA 3PG5A 5JRZA 4TLBA 3TR5A 3UMFA 4LBYA 4BLOA 3JVVA 1VECA 3R20A 4JYBA 1U9IA 3GEHA 3U44B 2JEOA 4QHTA 1XMIA 4H1UA 3LO5A 4BFTA 3OF5A 4PSKA 1YR6A 1NIPA 1Z6XA 2QP4A 4DLYA 1T3LA 2IYSA 3BB4A 4ZKEA 2ZANA 4GOJA 4BRUA 4TMKA 4PO9A 2QU8A 4M2LA 2O8BB 5FUYA 4B76A 3T5DA 4WZBE 4D80A 4UNSA 2ECKA 4PO1A 2DBYA 2QL6A 2RGCA 3T35A 1R5BA 1FUUA 3VNUA 2AXPA 1AIPA 3W6PA 3TMKA 2V55B 3KQHA 4WW0A 2BEKA 2GCPA 1D2MA 1FTSA 3DKVA 4KVGA 3AP3A 1OFIA 2WAYA 2FZ4A 1CJMA 4Q4LA 4BWYA 1XJ0A 2B21A 1Q3TA 5CM9C 2KB0A 3QXSA 4M1TA 2H7VA 1S2MA 1PLJA 2ZR7A 1CLUA 3CPEA 5D3QA 3IEVA 3L0PA 3B2EA 4L15A 2WICA 1R8QA 3MJRA 2N46A 4JL8A 4Q7LA 4TMZA 5G53C 1UDWA 2JIZA 2X2EA 4RSGA 2ZVQX 4TSFD 4YDSA 1TUIA 5FOTA 3OEED 3RNLA 4LBZA 4C0KA 4XVRA 1PLLA 1OF1A 2EFDB 2O8FB 5KTYA 5L8VA 3PEVA 3AKDA 1NSTA 3U7EB 5SZIA 5FH9A 4P33A 1FNMA 4GSYA 4M0LA 4LI0A 2Q9AA 5JBQA 3RS5A 1RRFA 1SVOA 4LUCA 5JS8A 1Q12A 2XTMA 1E2FA 4ZDWA 3RS0A 1P2SA 1PZNA 1R0XA 1T91A 3AVTA 3P1JA 4AKGA 4HZIA 4MUBA 4G3XA 2KSQA 1KMQA 4FCVA 1E0JA 2CCGA 2XEXA 2V3CC 1OFTA 4M1WA 3K09C 4P4SA 3A4MA 4E09A 3FB4A 3CBQA 1ZNWA 1XD2B 2GEUA 3A36A 3S1AB 2ZRCA 2NO9A 1MV5A 3OAAA 4QOSA 5L3RA 4M9QA 4RKFA 1W36B 3B9QA 1L2TA 5FOWA 1XEFA 4FCTA 4LJYA 2HJGA 3Q3JB 2BV3A 3M6AA 4JLKA 4CEHB 3QI2A 4Q9JA 2XNDA 1VG0B 4AYTA 5L3VA 2YOHA 5AUNB 3T1TA 4BUJA 4P3YA 1QDEA 3K9NA 4HEJA 1Z0DA 3B1WA 4HDQB 4LHXA 4IXMA 1KO1A 3C5CA 2RGBA 5BN5A 2OLKA 3BK7A 2KBEA 1FOEB 3NH6A 3TIFA 2FDCA 3QJYA 1TADA 4OYHA 3THYB 2CLDX 1TEXA 4DCVA 2O52A 2EQBA 3CIOA 5KPJA 1KI6B 3Q7PA 3ZZ0A 1Z8FA 3ZDQA 2IYYA 4HAYA 2GJSA 1M8PA 1NI3A 5AJZA 1UBCA 4YDHB 3C14C 3QKTA 4F93B 4D4KA 4O2LA 4KFSA 4OJQA 1F2UA 4QJ5A 4CZ2A 4TLCA 2Q9CA 1US8A 3CUEF 4AURA 4NYMQ 2WWFA 4O2RA 3SI7A 2J41A 2D7DA 4PXAA 3QKSA 1Z29A 4OQFA 1CU1A 1MT0A 2ASEA 2OCYC 2KJQA 2OESA 3B1XA 2BHRA 1Q44A 3Q72A 4Q01A 2QPAA 4B33A 1KJYA 3R8FA 4HDCA 3CNNA 1IY1A 1M1YE 3A37A 4NYIQ 1G17A 1NP6A 3SJBA 1KSHA 4NP6A 1SQ5A 3LNCA 4M1SA 1ZM3A 2HYDA 2CJWB 5IK2A 3PITA 2BMFA 2VO1A 2I4IA 4AK9A 4A36A 5FUVA 2P67A 4ITRC 4Q4JA 1CEEA 4EFMA 2GBLC 4JL6A 4JZKA 1P62B 3MWLA 2AL7A 2F43B 1RIFA 2CDNA 4QBHA 2ORVA 2V1UA 3ADBA 4II7A 1KDRA 1TPZA 1A2BA 1EFCA 4D26A 1SZPA 1N6IA 5KSOA 4Q9LA 3U7HB 4B44A 1QHGA 1GNQA 1W48A 4LDJA 1HQCA 3KUCA 1E1QA 5CDFA 5JHHB 2VHCA 1NKSA 4Q19A 4RY2A 4B48A 1SVWA 1OH8A 2FA9A 1BS1A 1FPMA 1G64A 1E98A 1MR3F 1YJ5A 2OE2A 2ONKA 2ZRJA 4KXFB 3EIQA 3A1WA 4LJ8A 4PPFA 2JLRA 5CLQA 1RJ9B 1KYIA 4LJ4A 2GF0A 5IT5A 1V43A 5G41A 4UJ3A 3TSWA 3CZPA 3MMPA 1IN7A 4Q4AB 4UXIA 1Z6YA 4DC9A 4MYHA 5J4VA 1D2EA 1XCGB 4BZPA 1XTJA 2K5UA 3DM5A 4JVNA 1S3GA 3WYAA 1Z3IX 3EXAA 4R98A 1E9AA 4E5UA 2G6BA 1U9IC 4F7WA 5ELXA 2JDIA 3T1OA 2JLXA 4AY2A 4HATA 3HU2A 4RCZA 3C7KA 3X1YA 4DUGD 2ZRLA 4TMTA 4A2PA 2C5LA 2E9SA 1Z2AA 4M21A 4PZZA 4W5HA 3JZMA 1ZC4A 2ZPTX 4C3ZA 3VX3A 3MSXA 3BGWA 1E2JA 1KKLA 3ICEA 4GDFA 5KDLA 4P0TA 4TYNA 1KKMA 3IKJA 3I1FA 2FV8A 5CITA 1DADA 3EIHA 3SJCA 3KDSE 3ICQB 1U8ZA 1E99A 1CJUC 4JSTA 1YHNA 2BBSA 5G40A 3VU9B 4MUAA 3FKSA 1ZRHA 2VA8A 3AVOA 4URVR 2ZRAA 1JBKA 1JXOA 2DWQA 4LV6A 2HLDA 1TX4B 2QPOA 3QNUA 1HY3A 2YWGA 4Z1MA 3QF4B 3HP1A 1RYFA 5FL7A 1H8EA 2ZYVX 2RGAA 1G7CA 5KNDA 4HLUA 1K8RA 1P75A 3I62A 1QHXA 3CH5A 4MKHA 3W8NA 4RCYA 5BQ5A 3GLHA 1IOZA 5EP4A 1FW6A 1S8FA 1YZNA 3EARA 3C4JA 3LW7A 4C9BA 1RPZA 3ONWA 2B8TA 2OM2A 3THWA 2ZVPX 5E95A 4O25A 2AD1A 1XXHB 4TYWA 1DAFA 2AK2A 3SR0A 2HCBA 3RYTC 1AGPA 2ZRNA 4DCUA 3R7WA 2C95A 5FTMA 2GZHA 1GG2A 3MUFA 5LD2B 2Z43A 3T1QA 1KNQA 2C78A 3X1DA 5G3ZA 4EKDA 3TUJC 5BN3A 5JJLA 3ZD6A 4PC3A 3P27A 1OH5A 2DFKB 1Q20A 2RGDA 2ZSFA 1VHLA 2YZ2A 3AV0B 3OIWA 4TN1A 1JECA 1TF5A 2PCJA 3KKQA 4U00A 3K0AA 2ZRGA 5F98A 2EU8A 3IIJA 1N6LA 4PC1A 2GCOB 3FMFA 3ZGXA 4LJ9A 5DNYB 1UKEA 5DHAA 2V7QA 2A2ZA 3QIAA 4J0QA 5FUWA 3KKOA 2GJ9A 2BVNA 5A4JA 3CO5A 1CR0A 1MRNA 3QOFA 4Q1AA 2C98A 1E9SA 4WZ6A 2J0UB 4M4SA 3W6NA 4BLTA 1KO8A 3GJ8A 3LW8A 5C18A 2J59A 1Z28A 4OQXA 5CIWA 4GOKA 1NNEA 3AF3A 2F3TA 1EFRA 3KQNA 1SXJE 3GJ4A 2BJVA 3B85A 1MABB 5CM8B 3K0SA 1N3BA 1JQLB 3CX8A 1SVLA 5H1YA 1R2QA
chains in the Genus database with same CATH superfamily
3UMBA 1JPVA 2AOUB 2J07A 4JC5A 2MT9A 5DBGA 4O2AB 7MDHA 5A71A 2VHUA 5DGIA 3ASVA 5JJ5A 1LNQA 4KHZA 1ZA2A 4MB0A 3T9EA 3BSWA 4J3JA 4UBOA 1E6CA 2XUHA 1ZGGA 1PSZA 4HS9A 4MQEA 4IDOA 4S2EA 2AWOA 2HLNA 4EY8A 4CTJA 3PR2B 1IJKA 3PNVA 5ALZA 2A1IA 3LHDA 4L9AA 1ZIYA 5KI6A 1NC1A 3KSDO 2ZJ6A 5J4HA 4RZHA 1Z4PX 4PTYA 4YV0A 3NC0C 2PKXA 3C3JA 3E2MA 5H83A 2XRYA 3IH5A 1NW3A 3JZFA 4BAGA 3BMCA 2Q8QA 3QKRB 5ESXA 3WNZA 2VL7A 4WAUA 4IMJB 4EQ6B 4LPKA 2IITA 2YASA 2G1KA 2P9QA 2XCOA 5F4ZA 3RE1A 4A2WA 4MMZB 1ZW1A 3VKHA 1GZ7A 3OJLA 5TS3A 3ZU3A 4E22A 1TE2A 2D5CA 3AF2A 5FADA 3MUEA 1XQ1A 2G5CA 1V71A 2CN1A 521PA 1RLIA 2VBFA 3QPDA 5AQEA 2VCYA 2VNAA 3FIJA 1QIJA 2J5QA 3KSZO 2PZGA 1TEHA 4JS0A 4KCGA 2CJFA 1PZHA 4G5OA 4WNIA 4HAIA 2NTYC 4WGGA 4JLOA 3PT9A 2QXTA 1NURA 2YY6A 5TIIA 1ZUIA 2HF8A 1W4BA 3HKEB 2VA9A 3GNTA 4MRNA 3BWVA 1QONA 4KQEA 3VPHA 3W06A 1B8NA 2NACA 2WA1A 4MS3B 4ABYA 4C76A 4F4JA 1I7QB 4H3KB 3TB4A 1BQ3A 1T8UA 3MGGA 4YJ3A 4ZALA 4QLBA 1PT7A 1WWKA 1RMTA 1LS1A 1OKKA 1X7WB 4TV8A 2ERYA 2ZTHA 4MJ3A 1QQBA 2IIQA 2IH2A 1SVMA 2X0FA 1U8YA 1O5OA 5I3ZA 4D92A 5ALYA 1Q1BA 5FPTA 3N7AA 3FJOA 1PT6A 1GAEO 3IUMA 3EJ6A 3FPKA 1MKYA 1VPDA 1ZS9A 3AKCA 4C08A 4E31A 1CCWA 3AM3A 3RHTA 1I3OA 3LS2A 3NYIA 3TCXB 4B6RA 4I66A 1USKA 1Y34E 2IHVA 4IEEA 1J56A 3OPVA 3TXXA 2XGOA 2AFHB 4TXJA 3C6BA 2QBYA 2RGUA 4HNHA 1JIUA 1IHOA 2GK6A 3E18A 4CQMB 4DM3A 4E13A 3K6SA 1Z5ZA 3DOEA 4UMFA 3ONEA 2C3PA 1B8VA 3GPBA 4LZLA 2I7XA 3C7CB 3OICA 2ENWA 5J23A 2ZAMA 4C4SA 3WYFA 4Y2QA 4V1CI 3FR7A 3QVUA 4KRYA 1I2MA 1UPFA 2Z6UA 3UJDA 3DMTC 5LLSA 3F49S 4D0NA 2A9QA 3H1AA 4MW4A 4IDEA 5CLJA 1Q22A 3W5IA 1A4RA 1YR2A 1OH7A 3AUJB 2W6IA 4HVLA 3LCRA 4HEA6 3MRTA 4TQUS 5KTTA 4ARCA 4BIIA 1YA6A 4BQOA 4LY6A 3LQ1A 2TMYA 1BFDA 3HN7A 3ABQB 3S5JA 4ZGBA 4Z5XA 1Y8RA 4PSDA 2VWGA 2QP9X 3CSSA 3TAXA 1VB5A 5TQ0A 1Y7IA 3NR2A 3R3VA 2GPSA 2PQ6A 3DZFA 3ILHA 4MYTA 4KE9A 4PHCA 1OD6A 1QG2A 5C52B 3ABIA 1Q0RA 2X0RA 2QNBA 2JPDA 5JFTA 5KTNA 3NS7A 2RD2A 1YQGA 2CHVA 4TVKA 1WCXA 2JIZD 3PUJA 1VCNA 4XFJA 2BP7B 2ZB4A 3NYWA 5ALTA 1T9GR 5E1MA 2VEOA 4DVGA 2JI6A 3GY0A 4P83A 121PA 3HP7A 1T0IA 2OHFA 5EKTA 4ARBA 2BEUB 2Q7XA 1YBAA 3F3MA 1JVSA 5JADA 4DV5B 2VP5A 1ONOA 3WS7A 4K0KB 2WJIA 1E2DA 5IDVA 4NBNA 3VFDA 1X39A 2V6JA 4LTNA 1K4MA 4TRRA 4IGEA 4KSCA 1W76A 2QA5A 1ZUHA 3HPQA 3NV9A 4GPIB 3UMMA 4FB5A 1A71A 2BCEA 4GZ3A 5F5XA 4A8JB 1UAGA 3CZRA 1QORA 2UVQA 4LZPA 3DOHA 1YMQA 1XRQA 3HJTA 1U2PA 1U2GC 3TDNA 5C81A 4I1RA 2GEBA 2XNJA 1MPTA 4KMSA 4RHXA 5AMXA 3V9PA 4A2CA 2PXXA 3FSEA 1ZOOA 3H1TA 3R3YA 3VZQA 3ZQKA 5C37A 4EYQA 5JNRA 4LJ5A 4IXNA 5DZSA 3HJGA 4DNFA 3S2UA 1E2GA 1P81A 2WSSA 1W44A 2NTVA 3FPAA 4N5LA 4ZAXA 1AK1A 3STUA 5IDXA 4RVFA 3JYNA 1VTKA 2CNKA 3N3BC 3NEPX 2XNDD 3R6GA 5EFOA 1GADO 3B9RA 4HXGA 3PEYA 2AFIB 5GONF 4UBLA 3O3OB 4FM9A 4PLPA 5CTJA 1SKYB 3TVDA 1Z12A 2DT5A 3KYDB 1FMTA 3AFOA 3H9BA 3D6HA 1B23P 4GKBA 5JQGA 3S5UA 2O6LA 1T34A 3G2KA 4NC9A 3ES9A 3IA2A 2GEVA 2IHYA 3UAOA 1N0WA 2YL2A 3NGXA 4S12A 1G42A 2QE7A 5K3SA 5BMVA 4UUMA 3BDVA 1W9HA 4DDWA 5BW4A 3LRPA 2XAUA 1EFDN 1Y3DE 4R1MA 2DHRA 3HXQA 2OZEA 4RYLA 2AK3A 4Y6RA 4AY3A 3SQXA 3UBTA 2IFTA 4F96A 1BCSA 1DRJA 3G6KA 2J30A 2CZCA 5B2ZA 2NPOA 2OBYA 3UAXA 1P5JA 1Z5WA 2CXHA 1ENOA 2QX4A 2SKEA 3M1AA 4FLMA 1J2UA 3FB1A 1FXUA 2Z1MA 1HFEL 1UM9A 5HCIA 5K3EA 3GT7A 4EW3A 3E9NA 5E6SA 2X76A 1WZIA 3ACDA 2Y92A 3GFFA 3I28A 5SZJA 9GPBA 5HFAA 1G21B 4HNTA 2PE5A 3U13A 3MAGA 2ZU6A 4V0RA 4OH1A 1IOWA 1MGOA 2CDBA 3T7AA 3N2ZB 1ZUNA 5ALMA 2HCTA 1G4UR 1E3SA 2IGBA 2O1SA 2Q62A 1MO2A 3G0GA 4HPWA 4LQCA 4NCJA 5AXAA 1WXGA 2NU9B 4CMEA 2RGXA 3Q9SA 1YMUA 2FK8A 4CDRA 4FHZA 4M9UA 5DRYA 2IZ5A 5ALVA 2ID8A 3LU1A 3M70A 1KJJA 1U0HC 2XDWA 4QNNA 2BJWA 3EK2A 4UKDA 2FN4A 2YJTD 4GNRA 1MO5A 1YAJA 4Y6PA 3ESDA 3C8UA 1KI1A 3U9LA 4CU5A 3CF0A 1TGYA 4TX1A 3E53A 5HOEA 4P4SB 3BTVA 4Z51A 1NX6A 4HQFA 2FZVA 3SYLA 3OHPA 3DVLA 3HJCA 4D5GA 4B6QA 3LLCA 4LVNA 1OAOA 1MAAA 3OTHA 1QCDA 2Q1XA 3HTXA 2A5YB 2HA7A 4CMCA 3IE1A 3HCOA 4UCXA 3TW8A 3EZYA 3KJXA 4NENB 2V65A 1CJSA 2OBBA 2PEYA 1H4VB 1DG9A 1KZ9A 2G4LA 2JBAA 4PTZA 2YHIA 2EFCB 5T6BA 1R5OA 1UKYA 1Z5GA 2OGUA 4ND2A 5DEIA 1XAGA 1TLTA 1RVV1 1JU3A 1XLVA 3TQIA 5K0JA 3GJ0A 4C6TA 2Z6VA 2XVXA 1SBTA 2XODA 4X7BA 4C4AA 5ILGA 2I6XA 1TKBA 3OQJA 1XMVA 2O0JA 4H59A 4M9ZA 4DIDA 5KO2A 3VH4A 2HHJA 2Y93A 2ZJ5A 2MMGA 3GXOA 1B41A 4ZYZA 1JIQA 1SB9A 1L6IA 2PR2A 1C1HA 1KK0A 3P9SA 5DGDA 3OD5A 3P20A 4PNPA 2FFQA 1E7YA 2ZIXB 1LPPA 3ZOKA 1VMDA 3QEJA 1HDCA 2Q5EA 1QQ7A 3U4HA 4P54A 5SZKB 2CJPA 1IQRA 4OHUA 3PTLA 2VCHA 1U2SA 4HGQA 1CUFA 1I36A 2OB2A 2WIAA 4HDNB 4JNCA 4F4CA 1IBLB 4O6VA 5JYEA 1DINA 2QYSA 1MX3A 2ARKA 3DF7A 3KD3A 3KTFA 4JA0A 4RH1A 5B58C 1R6UA 3IKMB 4F3TA 2OKGA 1GOTA 4Z4FA 1PJBA 5TMBA 4O4HA 1MJ5A 4TKUB 2GVDC 1JEQA 4L8YA 1QLHA 3G8YA 3GZTB 4Z9FA 2RONA 1HOTA 4DMHA 4XYLA 2J5XA 4F9TA 1SQ6A 4ZO9A 1ZVMA 4X0EA 5KYVA 4INJA 5BV1A 4I0WB 3VISA 2ZB8A 3I1YA 4C21A 3K30A 4R16A 3ER6A 2BKVA 3MK31 4BPBA 3ESBA 4E15A 3NHYA 3M49A 4DADA 1HSOA 2O54A 3V00A 6ADHA 5DCUA 3EX7C 2COEA 4PZYA 1JWAB 4I2NA 2R5NA 2HK7A 4NBLA 4XM0A 4BNVA 2YNMC 2D3TA 1HQDA 5KUTA 4DTIA 3MBOA 3BH6A 2VQSA 1NY5A 3EGEA 3EGDB 4P53A 5SZHB 1D1TA 2OV4A 2QR3A 2X0KA 4BNLA 4CT4B 4H77A 1JR2A 2G0TA 1GWNA 1ONSA 1H8ED 1YXMA 2H00A 1OIWA 4FZJA 1NDQA 1RYBA 1UKAA 3JQDA 2P90A 5IHPA 2YWXA 5DN6A 4J0FA 3TW4A 1SXJA 5JNUA 1XEXB 4TTJA 5EWJB 4N39A 1YVRA 1ZJ5A 2QLFA 3DD5A 4I5DA 1OE0A 4MZXA 3B6JA 1IONA 3O9ZA 4PW0A 3O5AA 3DXZA 4V0KA 5ALEA 3VYRB 1A2QA 1OYOA 5K6AC 2C3YA 3E5HA 5BN4A 2C4KA 3HFSA 4DL9A 4BBPA 3FZQA 1I7PA 2V6IA 3NTOA 1CJKC 4M6WA 1A9OA 1E64A 3DHEA 3KZKA 5K0TA 3CM0A 4J6EA 1ST2A 1ISMA 1RWMA 5CMLA 4BWGA 1C3OA 1T8TA 2XQGA 4LZOA 1T4CA 1O03A 1JR3A 1QANA 3NZEA 5CYGA 3HFGA 5JCZA 5FLEX 5HXAA 4QU5A 2AG1A 2YTZA 3JPYA 3UWPA 4BAUA 1W6RA 4I5FA 4FDVA 2BR5A 2QW0X 3ZV4A 5AM4A 3NALA 4N0EA 1N9GB 3TN7A 4NK5A 4EBFA 1IB6A 2UAGA 4I3FA 4IHJA 3GLIA 3KLMX 3PSAA 1H2BA 2FW9A 1L5YA 2H8GA 4ARZA 1FSPA 1RZRA 4HBZA 5AESA 1L4BA 3C85A 4IF6A 5FJJA 2J0SA 3U7GA 2VCEA 4QG3A 4Q6BA 1P61B 4EVIA 5FOVA 5EHQA 3B38A 4MGYR 3AY3A 3TEMA 3GP3A 4PZPA 3C3YA 3E0XA 4ITUA 4FMDB 2QMOA 1XVTA 4KUGA 5DHRA 1IVNA 4F21A 2XBUA 5EJFA 1M66A 4ACAA 1KAMA 2JAWA 4TYPA 5AKKA 1XK7A 1QPBA 4PHTA 1KBOA 1T36A 1UMCB 2QIOA 2NZ8A 3AP2A 3EVGA 3HWSA 3UXMA 4D7AA 1BW9A 3KETA 1W2WB 1W1IA 1YR8A 2G9ZA 3FWPA 1W5EA 4ND6A 4OM7A 1S96A 4JC0A 4WA7A 2NU8B 4EI9A 3GAAA 3G82C 4FT2A 1JT2A 2WWYA 1SUAA 4DDKA 4CKEA 3EW9A 3PGJA 1PR5A 2NVUB 1EG7A 2I6FA 3HU5A 4P7FA 3TZHA 2C3OA 5K05A 4B9AA 3R9IA 3WK4A 1RR6A 2XKAA 3OFJA 3CLTC 2CLLB 1YB6A 4ZAZA 2JI4A 421PA 3EPHA 1N2HA 5K51A 1GZHB 3H2KA 3DSRA 4CI0B 2JHFA 4G0MA 3P5BA 1PNQA 1XRLA 3LC0A 3P9KA 1JSLA 1VPVA 3AR6A 4LSGA 2WFLB 4WPGA 2C03A 3FZYA 4TUYF 4D9CA 2AA3A 1DMSA 1MOQA 4Q4HB 2BUCA 3WWEA 1L8LA 2HTFA 1DAIA 3LKVA 2CDCA 2QLLA 3IR6A 3HEBA 2H0AA 4ZA2A 4DMFA 5KSWB 4O29A 1XHLA 3IFSA 3O8OA 4FR0A 4KTTE 4Q02A 4BE7B 2X5JO 2V9PA 3UG6A 4DMUB 1MXHA 5KQMA 3QE2A 4TVOA 2HR1A 3QENA 4P0QB 3VPGA 1WB6A 2PRKA 4NFLA 1AHHA 1MEJA 4ALMA 2O0MA 3HVKA 1SKMA 4UQLA 4AM8A 1OOEA 4JLKA 3DNMA 5K3CA 1C9EA 2PZEA 3CTPA 1J2JA 4KN9S 4QICA 4I4NA 4YNBA 4AB1A 1D07A 2IOHA 3CZAA 4CM8A 1V26A 3M2TA 3Q2KA 3TRJA 1VP9A 2X19A 4QDKA 1M5UA 1K7CA 4NOMA 4YCAA 2WIJA 3WGUA 3U6KA 1I4DD 1Z18A 2PTGA 3IV6A 2QJFA 4MVJA 3AINA 4LSZA 3WQSB 3DWIA 3X1XA 1DCMA 4XB6B 5CH3A 4KXNA 2ZB3A 2B1JA 4KXMA 2FEKA 3LGSA 1XVAA 2O8NA 4QT0A 2IPAB 4Z0NA 2FKAA 4UBMA 4L9WA 4EF4A 3STWA 1DEXA 3DPSA 2ALJA 3O3NB 2C99A 4O2BA 4ZT7A 2Z8XA 1N6KA 2ZYDA 3OZWA 2VTKA 3F6CA 1ID1A 5AJVB 3TIVA 4ZDIA 5HZMA 5BXQC 1FDVA 2PSHA 3KHSA 3AK4A 5BVHB 3CF4A 4YCLA 1IJBA 1Z6AA 2J33A 4LXQA 3HGQA 4G97A 2X13A 3AB7A 4UCFA 4RZSA 2QD4A 4AKSA 4FN5A 4YMSA 2MYPA 4B4KA 4BP9A 1XRMA 3KWJA 1TYBE 3FKQA 4OH7A 3HKBA 1I4WA 3RIXA 2O8FA 4M76B 3ORQA 3ZI4A 5LWQA 3NTQA 1SPBS 2O8CB 1M2VB 2D06A 4G0QA 4LJKA 3DONA 4WSOA 2NO0A 2A0XA 2QAJA 1FP4A 4Z7NB 5EP2A 5I4CA 5KQRA 2IYNA 2GCEA 3JQBA 3BXEA 1H94A 4N18A 3ENQA 4YT8A 2WIDA 1IN1A 3QA3E 2VPPA 3WDKA 2B2NA 3HE3A 3WWOA 4ERXA 5CT5A 3Q2OA 2NNWB 4KQIA 5HF8A 1OLSB 1R00A 1GDHA 3HPRA 1UDCA 1M6HA 2YY5A 4OK3A 3BA1A 1FDIA 3IT2A 3KVOA 4RJIA 3E9CA 3K8OE 3ZWWA 2RHDA 3OU6A 3W5HA 4DC1A 3COJA 1A8PA 3IUQA 2X2FA 3FCXA 4G0UA 4K9DA 3MEQA 3E9RA 3SHTA 5AJWA 3ILXA 3L7YA 3QEOA 4YLGA 2DUJA 1C3XA 1DUSA 2FSVC 3H1GA 1AOXA 4HRXA 1JKIA 5JD4A 3CXRA 2NYAA 3MMZA 4AMGA 3V2GA 1XCMA 3KOOA 3UT6A 3RSGA 2JFUA 5KNLA 2FDXA 2HBYA 1Y5LA 1ZNZA 2UKDA 3RSHA 5ARBA 4WBNA 2XNHA 2P3LA 1FP6A 4ZIRB 5A5FA 1KP2A 4NX2A 5LYYA 1NGSA 1JUDA 3KXLA 1R6BX 5C7YA 1WKCA 3AFIA 3O7WA 3A7EA 3F7TA 3RS4A 3WGGA 1D6JA 1PJRA 3C4QA 2GPBA 3LT5A 1QKJA 1I2AA 1R0KA 5T6MA 2LVBA 1B76A 3DLIA 3O38A 3WMXA 1B6SA 4L7VA 4TLDA 5IVDA 4EA6A 1OVMA 1GUBA 3EIUA 4NMHA 5EG5A 5BQPA 3GEEA 5EA2A 3VVMA 1Q95A 4M89A 1ZA1A 4I55B 4RPGA 4YRNA 2XA2A 2I6GA 4BX2A 1I4OA 1U0JA 2ZRIA 5E1DA 5J4KA 1DX9A 1YE8A 4JENA 5JUWA 1ZHHA 2OBMA 1JU9A 2BTOA 3SBDA 3TL2A 2XD4A 4E11A 1KJ8A 4DV4B 3AKEA 4BQQA 4S1NA 2EG9A 3RR2A 2JLVA 2VIIA 3FCOA 1HE4A 4P2BA 1IY8A 3T94A 4BXOB 2V4MA 3C8MA 1YACA 3LUDA 1FYVA 2QD3A 4GVPA 3T8YA 2GAJA 2HRZA 4NE2A 4IVQA 4Z4HA 1N1DA 1CEXA 4EF5A 1CHDA 1NVGA 4ZU3A 3PFWO 1QX3A 4WXHA 3WSVA 1GFSA 1EX6A 1YASA 3UB2A 2A1UA 2CMKA 2PJDA 1ZGBA 3AF1A 1Z36A 1OW3B 1YQXA 2XWJI 4X8HA 4ZZIA 2JLBA 4AJLA 2XTZA 1DC7A 2AR0A 4JYPA 3UMRA 1OHHD 1SHLA 1VIAA 2B6HA 2OBLA 3A58B 4GOMD 4MR7A 5F12A 4Q9KA 3DC2A 2EX1A 4PHFA 1NT2A 1MFPA 4NEGA 2EJCA 2F43A 3PE3A 3RWBA 2J4CA 1KI4A 1X1EA 3ZTTA 2NAFA 1G8AA 3H04A 1TLLA 2PKQP 4O1MA 1G5HA 5DASA 2CEKA 2FNAA 4TOIA 1N7HA 1X38A 5LJLA 5BNFA 4UM9D 3PI6A 2D7CA 1E20A 1SU4A 2EYQA 3NDRA 4WK4B 1PQPA 1JA0A 5H0IA 1E2LA 1Q91A 3QX3A 4DGQA 3M33A 3YASA 5HE8A 2XR1A 1BX1A 1X1BA 3SHFA 2A8YA 3MINB 2H31A 4MV8A 4TM8A 3TZLA 3OTOB 4EYOA 1Z7EA 3OCXA 3LF2A 3KSRA 4K26A 2QI9C 1WF6A 1LNSA 3ZBUA 2AKEA 2O23A 4CL2A 1X77A 2WKRA 3IURA 4PPQA 1GR1A 3OU2A 4YO8A 3K9FC 2UZ1B 5P21A 4K2HA 3SEAA 3CCCA 5EIOA 5E2IA 2KX7A 4ECEA 4OL0A 4Y6SA 3FA2A 5HKKD 2B25A 1YV9A 4A73A 1BU8A 2UXBB 3O2JA 2G1UA 4Y9TA 1DIOB 1JR3E 4RC9A 1IPHA 4KO8A 2O5CA 3IDFA 1P6UA 3RFFA 4B80A 2O2GA 5LXTB 4LTMA 2X5KO 1DJMA 1KDZA 2BYTA 1DPGA 1GKIA 4YC7A 3WFIA 1BCRA 2WE7A 3SC6A 4A6DA 3ME5A 1ZXLA 1FYEA 5TEVA 1QCYA 4CU2A 2FW7A 5DBIA 4DQ0A 3GGCA 5HZKA 3UHFA 4ZAYA 4FMCB 2XYRA 4NJMA 2GK4A 1AO0A 1BMFD 3VX4A 4V02A 2Q5FA 5GJVC 4JIMA 2FN9A 2RDMA 3AHDA 3Q9UA 2I8CA 2YV5A 3EC2A 4GQBA 1KFKB 16PKA 4NV3A 1XYGA 4KIWA 4PCUA 4S04A 5FPKA 2QG9A 4UATA 2GJKA 2BMVA 1HFKA 3UMYA 1TC2A 2C2KA 4WNAA 5CA0A 1HQKA 3R6DA 5KINB 1WL8A 4UEJA 3AKZA 4I1VA 3D8UA 1F8FA 2NPIA 1JTVA 1I2ZA 2V03A 4O3MA 4FI3F 2HY7A 3CIFA 4TXMA 3Q7QA 3MWJA 1RYYA 1E4VA 2ZPAA 1ML4A 1NBWB 1YE3A 2OFXA 4IMRA 1AGYA 4OSOA 3IEXA 5AKXA 1YZQA 1XPRA 4Z0HO 3DG9A 3VNRA 1Z4IA 8ADHA 1JJ7A 1TUBB 5EYPA 3AVUA 1CRPA 2WJ3A 3QW2A 2OV3A 4BV2A 3WLSA 2FHSA 3WTCA 4FMPA 3EE6A 4CIAA 1JVNA 1QWSA 3UG7A 3AHFA 5CRIA 1CUDA 1AQ6A 2IS4A 3WJAA 1KZGB 1L7OA 5LA6B 3RIGA 1WCIA 2WQZA 3SBEA 4V03A 1JXMA 3H1EA 3R5FA 3K1TA 4JLNA 4YHBA 2FQWA 3KP1A 4PQGA 1HT2E 2Z95A 1QZTA 2R97A 5AW3A 1NMSA 3FCCA 3VR5A 4NV1A 4GBJA 4N8SA 2ERCA 3WG9A 1L1EA 2CVFA 2VC2B 5KNBA 4LDRA 2XBMA 4LJSA 2BMAA 5EWLA 4N3GA 4I7EA 4PQYA 4DCCA 4D4LA 2D1RA 1UMBB 3TGPA 2YZMA 4DIMA 4NBKA 4BLSA 2P2GA 1Q1QA 1RAGA 2HU2A 2NYUA 2X6RA 4X7MA 1QVVA 1R6TA 3R74A 2OZPA 3WB2A 3VYSB 1QQAA 4UVGA 4C0LA 3EZFA 1ZOPA 3HUUA 1QR6A 4MS1B 1Q0HA 2XKKA 3UKOA 5F23A 1R18A 1YI8A 2JIDA 4ZEWA 2CB0A 4MP3A 5J2UA 1VRVA 1X8KA 2ZWVA 1NM5C 1XQWA 4MWGA 4NNJA 4QUHA 4J76A 4WXEA 3T9BA 3ENVA 3ZWNA 5LQJA 1LTKA 2YKGA 2XIJA 1W5AA 3HP4A 1BU5A 1VMAA 3D4PA 5CP8A 3THOA 3ZD8A 4B2PA 4XKJA 4EUNA 2EQAA 2QRJA 3IE0A 3H8SA 2UU9B 1G8HA 4JUCA 2P6UA 1P0MA 1F6DA 2HHLA 1Y3BE 3DAHA 1W96A 4JVLA 4C6RA 1KARA 3G9ZA 3TTUA 4YXWD 5I01A 5B2FA 3LG2A 4NCHA 2IV3A 3VBCA 4IDQA 4Y2TA 1YJQA 5DVZA 3JPWA 1TAUA 1ZUD1 5K0BA 3T41A 4I50A 1R3DA 4XQ9A 5HILA 4HRVA 2ZJOA 5B6IA 3M4ZA 3H2BA 1F0NA 4P36A 1LLCA 1TA0A 3OE7D 3CW9A 3FAZA 4Z9XA 3EULA 1Z82A 2OC9A 4H17A 2HRQA 2IYLD 3U3XA 4D9FA 2AOUA 1I0LA 1QUFA 3AYXB 3G2LA 1FYXA 4DSOA 1P5ZB 2PM8A 4YCJA 4J8PA 1F8GA 2FW8A 2WFMA 4AQYB 3FNBA 3IDZA 4MQFB 1W0JA 3NAMA 1Z2CA 5EMMA 3UV6A 4FFPA 1YRLA 2QN7A 3WTBA 2J3KA 1Z6GA 5BOSA 2J0QA 1DO0A 2FPGB 3AVXA 3A1EA 1FY2A 1USVA 1ZWKA 1X8JA 3LAWA 3O47A 2FRXA 4NVRA 4DBLC 1Z63A 3X1MA 4ZEMA 1K6JA 2I4LA 1T3GA 1GRVA 4J1NA 4OL9A 4WJZA 5EJ2A 4ZDJA 9MHTA 3P9RA 3PHBE 1RZUA 4DLVA 5JC1A 5KKCA 1PYDA 3QKRA 2ANCA 1O95A 2AKAB 3UKJA 1FYWA 3TW0A 4CV3A 4QJIA 1OXTA 1U65A 3BE8A 2JF0A 4JB8A 1GUAA 2QZ4A 4IJMA 5K0NA 1BDJA 2JI9A 3WL7A 3PIRA 1FDRA 2HHHB 1OXKB 3I6ZA 5DE3A 4G0VA 2XX3A 3GUVA 2LNDA 4MULA 1ODLA 4HL6A 4D6YA 3U7JA 2VUIB 3F4LA 1N0IA 1QVRA 2XUOA 1CRZA 3KOYA 5IFLA 3KB1A 5JTTA 2XEDA 5JLAA 1E2EA 2CNOA 2OKCA 1S7GA 1T1RA 1A82A 1Y1PA 2R62A 2WF5A 1EA7A 1X1AA 2PZJA 2GRAA 3AR5A 4YPOA 4JI7B 4BVJA 3HKEA 5EIWA 1QG4A 1Y5MA 2C5EA 2O7QA 1DOZA 2FFAA 2KWIA 2P9JA 3B1JA 3C3XA 4JT8A 4F11A 4J4HA 3FGNA 2QJOA 5ABPA 1JQ3A 1FX1A 4FSXA 3EMKA 1PZMA 1COWA 1F8XA 3OKFA 4ZQGA 2JAOA 1I30A 2Q5LA 4X91A 4LSWA 4CLEA 5MGNA 4KMOA 3WL3A 1V1MA 3M83A 3DP9A 1X7WA 4D0LB 1RC1A 2H1WA 1V0JA 2V4ZA 3A3YA 4RIHA 2R84A 3SHQA 3LQ4A 3HCEA 3ZHZA 3LUGA 4KBFA 2CCKA 4BVBA 1O6BA 1PTJC 1Z37A 5FPPA 3KO8A 3M7IA 4ANFA 3B53X 4O4IB 1DV1A 1GDDA 1B14A 1A1SA 3DVSX 1AZSC 3HSKA 2J7PD 2ZI3A 2HFJA 4JUBA 3W4JA 2ILVA 4MS4B 4NECA 3RODA 3KYCB 3KTAA 5EJAA 2FXVA 4XDZA 2IH4A 3OPMA 2XMSA 3E9EA 1UZUA 4UOEA 1KEPA 4J0CA 4Z9AA 3GA0A 3FGZA 2LCQA 4RIFA 2AFHA 4URXR 4HH4A 2QVBA 3LE8A 4D4IA 7ABPA 4H7EA 2Z5LA 5A7FA 4PN7A 2ONCA 1GIAA 4S3MA 1XZKA 2REXB 4N0MA 5FT9A 2CWDA 1HF3A 1IY2A 3RJZA 3U6BA 2AS0A 1U8TA 1ZU4A 4F71A 4MDEA 1GFWA 2P7IA 4LDPA 4YJ3F 1XTRA 5E38A 5IXJA 1T5OA 5CA1F 3QOYA 2RHOA 4XE5A 3QBTA 3H3FA 5DN6D 4QBTA 5K0FA 2NZJA 4ZFNA 4MW9A 2WNIA 2QG6A 2HJVA 3I9LA 3HJHA 3S7TA 3LIPA 2Q1UA 4R7GA 1YCFA 4ZK6A 2DLCX 1OBVA 2VSXA 4FHDA 4MVYA 5JMPA 3ZBTA 3C41J 2EC5A 2HXSA 3ORRA 5U1PA 5E3HA 5AQ1A 3JWPA 3VBEA 1NATA 1E1CB 3B1YA 3FOZA 4CE6A 4A92A 2DX7A 1XEWX 3A1UA 1OXVA 4HVAA 4WZAE 3UJNA 5CCXA 2P2YA 1ADGA 1PEYA 2QVYX 3L0CA 4HDMB 1YB5A 3IAEA 3IRVA 3KAJA 3RAFC 4JJAA 1GU1A 1H85A 1CDZA 3M4JA 4MKZA 4DCGA 1QO0A 3FFXA 3GMTA 4JELA 1VBMA 4YK7A 1A5ZA 2PU5A 1WNTA 4OM8A 1RJEA 4ZYWA 2BP7A 1F5SA 2A14A 2VH1A 4RQUA 4EM6A 1VL6A 4RJTA 3L3BA 1OFUA 1ONBA 1SVKA 2Q1TA 3A04A 3CLUD 3HDVA 3ONDA 3QWBA 4CQLA 4LCEA 4EPXA 3VU8A 1YQEA 2BEUA 2WF8A 2IF0A 1TJ3A 3OTWA 1C1XA 2WBLC 2GD1O 4BNUA 2PD4A 2I4OA 2YMMA 4I99A 4KBGA 4DJFC 3O0TA 4D3ZA 2LKDA 3M89A 2JDID 1ATIA 3CF4G 4DR2B 1YS2X 4N54A 1F2UB 2B5WA 1FUEA 1DWUA 3IBFA 3IERA 3OJEA 3T06B 4A8JA 3ZHYA 3DUFB 3GYBA 2HWXA 3CY6A 3LXMA 3A0RB 3GJQA 5LD2C 4BECA 4KO2S 1O97C 3ACCA 2QORA 5AKIA 3V8NA 1C9KA 2HNKA 1LX6A 3ELBA 2HRCA 3MB5A 2YRFA 1RI1A 2YJ3A 4O4LB 2HK8A 3E7XA 4NQRA 5AK3A 3QOWA 2JW5A 3ABRB 4K6GA 4UPDA 4ZDKA 1HT0A 1UBMS 3N1UA 5FPYA 5LQAA 3E9DA 2OD9A 3AUXA 4LYAA 1GTVA 1IZ7A 1E66A 2A7QA 5KYWB 2JA2A 2IS1A 5KVQA 1W88B 3HU3A 1TKCA 5BV0A 1ZJ4A 3IQWA 3MERA 5HW0A 4PLVA 5LQMA 4PQRA 1XZNA 3NNSA 5E4TA 2AFIA 2ZBUA 2NP7A 1ZK4A 2P9GA 4Z8YA 5JSFA 5K6RA 4JUAA 5EP1A 4FYKA 2Z0MA 3GT0A 3OOHA 2E89A 3KYDA 5H3LA 5L4SA 3JSXA 3DTVB 2FHPA 1UXJA 5IZCA 2QLJA 2W48A 4RLQA 3V8QA 4KPUB 3GDGA 1PTKA 1NY6A 3KTOA 1GUYA 4LJ7A 1JHAA 2R8YA 2XCIA 3R5TA 1K8XB 1LF0A 1A88A 5K8TA 1TK3A 4WLEA 3OF3A 5J9FA 3WIBA 5AH0A 2JGFA 4EK9A 3H9GA 2DPXA 1KY3A 4PU0A 5H9VA 4EJSA 3ADCA 1U0BB 3LDAA 1EBBA 2BR4A 2W9XA 3EEBA 3TECE 3ZCUA 3VDQA 4MQ5A 3JTEA 1MP0A 4WEOA 5DJ5A 1E59A 1FE8A 4FE4A 2WSMA 2W37A 2A3NA 3FYSA 3F5QA 3HKCB 4KO3S 1T2EA 3RU2A 3W2FA 1L5KA 3FPJA 1Q0TA 5IEBA 1SZJG 2ZUVA 3DR3A 1SQFA 3HDGA 1BGVA 3N87A 3X1WA 4BMYA 2QVZX 1GGHA 1G21A 3LWZA 4LBWA 3QKIA 2GO7A 2XLBA 2GD6A 3DWFA 3HSSA 1WB9A 2X4IA 4TKLA 3RARA 3TJZA 2PPVA 5CM2Z 2VAXA 1VHQA 2JRLA 5IKPA 1RTKA 1EEHA 5EJ9A 1IL0A 4J2OA 4QL3A 5DM60 5JQGF 3QZUA 4FEGA 4IOMA 1GPBA 3RHZA 3KZNA 2NU9A 3QU9A 4N0DA 3TD9A 3K8QA 1R0LA 4L08A 5AXCA 1YIOA 3E0QA 1Z6QA 4P08A 5EFZA 5BMVF 5C2JB 2IXFA 2OYCA 3VMFA 4LOHA 1OLXB 1H6AA 2XXBA 3FKJA 3FYUB 1YB7A 3WP1B 5DCWA 5FV7A 3VDMA 2DWPA 2FUG6 4PC7A 5D1HA 1KQGA 1KIMA 3F90A 1XDDA 3V6MA 1DBRA 2OORC 2ZQZA 3CCFA 5JZVA 3R6WA 2VHVA 2FKNA 4I5GA 5HUJA 1YD7A 3CZ9A 2UVDA 2H7YA 4CF3A 4EPWA 3BJMA 1KRWA 1UXOA 3QLUA 4JKOA 3IMFA 4JGBA 4J16C 4OSPA 4DLSA 4NENA 2PZKA 2QVLA 2P0YA 4BEBA 4M0UA 2A92A 2R6HA 1CRQA 2GD2A 3CEPB 3DUWA 4MRPA 1XWFA 4MZDA 3VNQA 3GVPA 4QGBA 5BP7A 4ZZ0A 4D8UA 6YASA 5K8LA 3IAS1 2R7AA 1ULBA 1KMNA 2X0NA 3BYZA 4MGHA 3V2UA 2OXFA 3W34A 5BN1A 3FMGA 5KNCH 5JW6A 1RKXA 1XTVA 3CG0A 4QUGA 1I9CA 2HCFA 1YQUA 1Z5OA 1A72A 4KACA 1FSGA 1C8BA 1CY2A 1KMMA 3ET5A 2QRKA 4YRMA 2ZRFA 4P34A 5DNVA 2Y1GA 1ES9A 3HR7A 3OPXA 5KOHB 1NXSA 2DPYA 4V2IA 1UBNA 1JLMA 4BO6A 4MKRA 4XFKA 2NZXA 1U2ZA 3EF0A 1EWQA 1K2WA 2J7KA 4KYUA 1GDTA 2CXOA 2FEOA 3L4EA 1EVZA 4Q3CA 3AB8A 1LFDB 1M10A 4NFSA 3TQQA 4EJ0A 5JAPA 2X1VA 4URYR 3B8EA 5JS7A 1YC2A 3CHYA 4OIFA 4PYRA 3JWHA 3A26A 3Q41A 4UOQA 4R3UC 2VAMA 5ECWA 3MFYA 3ORYA 2EFJA 4HDNA 4PZLA 4UU0A 1JHPA 1XD9A 3TZBA 3DJFA 4AF8A 3WQHA 5BW8A 4HDOB 3BCSA 2GEDA 4HGYA 2YINC 4D8WA 1KRHA 5CX4A 5CJ2A 3AGPA 3UCXA 3H2YA 4XXHA 4R05A 4BN0A 3QBDA 4LKOA 1E5XA 4KUHA 2C61A 3NOOA 4TKUA 1LJUA 4TZ6A 5U4XA 2NTNA 2HBZA 3KPJA 4I14A 1CG6A 1BRMA 4PSAA 3HCBA 4W1SA 1J90A 4RMGA 3SE7A 1U0FA 1DGQA 1RQPA 4YMHA 1BYIA 1W4RA 3FNQA 3K0AB 4QPJC 5CDGA 13PKA 2AG6A 2Q3CA 3KR1A 5AI5A 4PS0A 3VC2A 5HUHA 1A8IA 2RB4A 3I04A 3PS9A 4F46A 1F48A 4PIPA 2XHZA 3EVEA 1GPDG 2I1LA 4C89A 1RKVA 1KYXA 1Z47A 3BKXA 3NFYA 1GZ6A 3S2EA 5IS2A 3A1NA 4HWPA 2N1MA 1JHYA 4PBRA 1G3UA 2VUSA 3EGDA 4FYXA 4QOJA 3E81A 4Z2YA 2H1IA 4RK0A 4QRHA 3TH5A 3VZSA 4RVGA 3CVOA 3HZZA 1KHTA 5H3CA 1Y8CA 2HLHA 2XZTA 4PGAA 1BJTA 2CUTA 4OLAA 1XEXA 1G9XA 5EWJA 1ZRNA 4ZZ3A 1F7VA 2HYIC 1ZJZA 4G5YA 4K46A 3KQQA 5I5GA 3UTCA 3WGHA 4XD2A 5FI0B 1T5IA 2Z58A 2C2GA 3FWYA 5CBPB 1XCJA 2EP8A 4XUCA 2QTTA 2AFHE 2D1FA 2TSYB 3L8GA 1BDHA 3AIOA 2OFWA 4GZMA 2P11A 4JBNA 4R40A 3N2IA 4MRVA 5K1ZA 3ZGNA 4HFNA 1CY8A 3C3WA 5A9SB 2CEAA 2VF8A 1P5FA 1G9TA 1XKXA 6REQB 3NO4A 4DG8A 2P2ZA