4LDJA

Crystal structure of a gdp-bound g12c oncogenic mutant of human gtpase kras
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase KRas
publication title In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 62
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ldjA00
5TVKA 4MUAA 4RFSB 4CW7A 2B7BA 1NP6A 2TMKA 4B73A 1GILA 2PZEA 2FA9A 3EZ9A 4R9UC 4ACBA 2WIBA 5D3MB 2FMXA 2ONKA 4MGYR 2QE7A 2I1QA 1WXQA 2QGZA 3AKDA 4R7ZA 2J0UB 3RS3A 4OI0A 4BFSA 3M6AA 3PUYA 4YMSA 4HAWA 3RS7A 3DPUA 4RD6A 2A9KA 2BEKA 4PZYA 1UM8A 4KVGA 4RZUA 1KO1A 1Z22A 3IPXA 2G77B 3KQLA 1XCMA 1XP8A 2FPMA 4V0NA 2Q21A 2IXGA 1Y63A 4AI6A 3C41J 2H8KA 3QBTA 121PA 4QRHA 4OK3A 1DAEA 1KJYA 1R10A 4O2RA 3A1TA 2P65A 2ZJYA 4NHOA 4G5RA 2Z5FA 4EPTA 2GZHA 1Z8FA 3BFXA 2W6ID 4WIAA 5K8IA 3U44B 1EXMA 2FX3A 3QOFA 4A82A 4ACAA 1HT2E 5FL7A 3EC1A 1E79D 3DMDA 1JBKA 4DUGA 1R5NA 3RABA 1FTNA 2B8TA 2ZJBA 3AKCA 3NH9A 3Q72A 2AXPA 4D4KA 1HY3A 2CLCX 4D4LA 1PUIA 3V4FA 4EFMA 1ZM9A 3TE6A 1GM5A 4BZPA 2PLFA 4DCNA 2ZQ5A 3LDAA 2BBWA 2H92A 2RAPA 3CONA 2DPXA 4Q01A 1CIPA 2JATA 1A4RA 2ZE7A 3TSWA 1GG2A 4JLKA 1OE0A 4V0KA 1YR9A 5FUVA 1QHHB 2ODBA 4EJSC 4CF7A 1Z63A 2PT7A 3WYAA 5IK2A 1G9XA 3UG6A 1YKSA 1E9BA 2HDNB 4ZO4A 4NU0A 3U7GA 1G19A 1TADA 3E70C 1N25A 4OI2A 4WZAE 2YV5A 3GLIA 4AG6A 1RYFA 3OIYA 4JVMA 4QGHA 1GVNB 1NIJA 1SVMA 2XB4A 1P73A 3NG1A 2BOVA 2KI5A 2C8VA 3CWZA 4YDSA 2VP0A 3AF2A 3BH0A 5KU1A 4B47A 1RRPA 1UKYA 4DSNA 4K81B 1JR3D 4IVRA 4B3BA 5JECA 2IYXA 2G6BA 4KBGA 5J4VA 2WV9A 2XJ9A 2WPDA 4FMDF 1HUQA 2WMNB 4Q1DA 4QJ3A 1IY1A 4NBSA 2OXRA 4DLRA 2JLYA 2IYRA 1QF9A 4BFXA 1A2BA 5FI1B 5FOXA 4UJ5A 4B6EA 4B75A 3AVPA 1C4OA 1K5DA 2I1VB 4OK5A 4B3CA 2IYQA 2ZJOA 4PSAA 3VR5A 2LCFA 3MJHA 1GFIA 4F92B 4P3YA 1GSIA 4POAA 3CNLA 4MITA 3C5CA 1F5NA 3JVUA 4Q66C 1G7CA 4D81A 1WCV1 2ZU0C 5HKKD 3THWB 2W6JD 3CR8A 2RCNA 3OHMA 1Z2AA 2P67A 4MYCA 1F2TA 1T9HA 4P4UA 2QENA 5DN6A 4URXR 2G1KA 4YMUA 1IONA 4EJSA 4M1KA 4G3XA 3C8UA 2ORIA 4IFBA 1CJTC 2O5VA 4A8JC 4D26A 4BFYA 1ZM7A 1OIXA 4YC7A 1RRCA 2E87A 1JJVA 2ZPTX 1XB2A 2IS4A 2DWPA 2WJGA 3ICQB 3TJZA 1QVRA 1V43A 1SXJA 3EASA 1YE8A 2HJVA 1OFTA 3W34A 1N0VC 1VTKA 4PC6A 2LWIA 3A1VA 3QPWA 2OHFA 2X19A 1QRAA 4AYXA 2CCGA 4XWKA 2WSMA 1D2EA 2FF7A 3RYTC 4OHVA 1P9WA 3SYKA 2R6DA 4BFTA 1E96A 2EFGA 1L4UA 2R6AA 4FMDB 1FMJA 4CEHA 1J8MF 3OAAD 4Q00A 1JAHA 2CL6X 1EGAA 5FTKA 2OCPA 4LC1A 1G3RA 3TR5A 1YR6A 3TSOA 4LJ4A 2OUKA 4DLXA 4Q4AB 3P20A 2OBLA 2F6RA 4R71A 1AZTA 2GKSA 4M0LA 2PX3A 2JIZA 4QHYA 1E0JA 2V8OA 2P5TB 2W0SA 5JI2E 2ZANA 2QSYA 2ZRFA 5AJWA 1G20E 1Z6XA 4YLGA 3GLGB 2AN9A 1G16A 1E9RA 1Z29A 2E9SA 4ZI3A 4P0TA 5AUQA 1W48A 2WSSD 2ZE5A 1OT3A 5DIFA 2ZRKA 4ZV4A 1TUIA 4PAQA 3W8RA 1XTKA 5HCNA 4TTPA 1AM4D 3TH5A 5FPKA 4QM7A 4G1UC 4A8JA 1G7RA 2K5UA 2MMCA 3EIEA 4LC0A 2FWRA 3VAAA 2V7QD 4PFSA 4JT2A 1JB1A 5FOSA 2RH5A 3QSYA 1FMLA 1OFUX 421PA 3A6PC 3GJ6A 3EPJA 3WNDA 3Q8XB 3HP1A 2GBLC 4NYIR 2QI9C 1X86B 1KZ7B 4AKGA 2GVDC 3B1WA 4OQMA 1G8HA 1DBSA 2IA5A 3K0FA 1XXHA 3P27A 4PO9A 2BC9A 3HPRA 3B1YA 2N1BA 4XIGS 1KI9A 5TARA 221PA 2J7PA 4XTCS 2ANCA 3FKSA 4TMVA 3NH6A 4EFLA 2XOKD 1PZNA 4O0MA 1GOTA 2Q3HA 2VH5R 2JDID 4PO1A 5AR1A 3P4YA 1KMQA 3GLHB 4E03A 2HYDA 2R2AA 5DISB 1QHXA 1E2PA 2DY1A 1OXVA 2BBTA 2ORWA 4QBIA 3UXMA 2ONJA 5C4MA 2A7QA 1NL3A 4NCHA 4UXHA 2VP5A 4O2LA 1R0YA 3EC2A 1Q22A 4UNNA 3CX8A 3CF6R 4BFVA 721PA 1E2NA 3K9HA 5L3RA 5GJWC 2WWXA 2FE4A 3TAHA 1ZVQA 3W5JA 4KU4A 1MOZA 3QNUA 2FSIA 3QE0A 2KB0A 4LHWA 1CR2A 1SHKA 2BV3A 3QVUA 2DBYA 5DO9A 3U3JA 1W49A 2O0HA 2OEPA 4KFRA 4PX9A 4V0OA 1W46A 4QKQA 3OFND 4TQ9A 3PEWA 1XEFA 2WKQA 3WNBA 3FMIA 4Q9JA 1BIFA 2F1IA 2BKEA 1T3LA 1H65A 1HQYE 4FCVA 2O8FA 3IBYA 2CLSA 5EXXA 1XMIA 2HT6A 4ON9A 2L0XA 4MRSA 3LW8A 2AD1A 4D0LB 1VYUA 2GBLA 4LGMA 5EE1A 3R9XA 1K5GA 2VSFA 3I1FA 1MO6A 1IAQA 4E5UA 1GRRA 2YNMA 1H8ED 3PXGA 3RRMA 4JKYA 2QAGB 2RGDA 1ZCAA 2GA8A 4MH0R 1E2HA 5DI3A 2OFXA 4UNQA 4LYAA 4LCBA 4B48A 3NVAA 2NZJA 1KJZA 1DG3A 4NONA 3T12A 4C9BA 1R7RA 4U00A 3LH5A 4W9MC 1FNNA 1GWNA 4P4TA 2W6IA 1MRNA 1LVGA 3EIHA 1E79A 2XB2A 4EQ6A 3C14C 3GLGE 2FN4A 3UG7A 5BYKA 4RZXA 4RVCA 1XCPA 2HV8A 2Q9CA 3QY0A 4BE7B 1JAIA 1KSFX 5JRZA 1OH8A 2OSBA 3C5HA 5B57C 1G8YA 4K46A 3DVLA 3K0SA 2A5GA 2AK3A 3TVDA 1FP6A 4PHHA 4CRWB 3ASYA 1KO8A 2C5LA 2OV2A 2KE5A 4GL2A 1WF3A 1P7CA 2VYFA 4HAXA 5BWMA 4CGZA 1M34E 1NKSA 3O8DA 5KUTA 1G5RA 2PH1A 3H0KA 2BCGY 2BHRA 2WWHA 3WMFA 4YMVA 1GNPA 4LOAA 2DB3A 1E0AA 4JYBA 1JNYA 4MKFA 2BBSA 2YWEA 1G3MA 3WXMA 1P60A 5JSZB 1C1YA 2IYZA 2NO9A 1LF5A 4RD3A 5AJXA 3THXA 1XPOA 4A2WA 4LV6A 1NNEA 4WXRA 1JR3A 4CEJB 2WWFA 2NO6A 4RZ2A 2VHUA 1OXSC 1E98A 1J7KA 3NIBA 3RVBA 4D0GA 2NPIA 4BRWA 2W2VA 4HLUA 3T06B 1E9SA 5BN5A 2D2FA 1G1MA 4AURA 3WMEA 1SKYE 2J1LA 3FGNA 1BKDR 1XTRA 2WJIA 2YJTD 4ITRC 4PANA 4XOIA 2FZLA 3UANA 4A6XA 4DCSA 2O8CA 3BIFA 5B2ZA 4QGGA 2DFKB 1NG1A 1KKLA 2ZSBA 3TK1A 1UF9A 2IWHA 4A2PA 3ZZ0A 3SFZA 1II8B 2GETA 4BASA 3AVWA 2QPTA 4NL4H 1GL7A 5HKKA 3I5XA 2MSCB 4R2IA 4RFVA 2W6JA 1AJEA 2FH5B 1Z3IX 3T1TA 4XSGA 1HURA 4ZDWA 3SN6A 4TLBA 2R6FA 2J45A 2ZJ8A 3A1WA 2GJKA 4XTRA 2R62A 5FTJA 3MG9A 2AXNA 4Y0AA 4Q7JB 2EFHB 3EPHA 2PZFA 3KUDA 1E2FA 1KI1A 1R5BA 2Z4RA 4AKIA 4B34A 2PMDA 4GMDA 2AHOA 3IBGA 3A58B 3TMKA 5IT5A 1IXRC 1N6IA 5JWHA 3GLFE 4TQAA 2GEDA 4JLVA 1U9IC 3UIEA 3NEJA 4B71A 1EG7A 1MR3F 1NRJB 5CLQA 3NBZC 2WWIA 1TAGA 1PJRA 2QAJA 4EQ6B 3ZZUA 3CX6A 2GXAA 1AKEA 3B1XA 1OB5A 5HPYB 3K0AA 1FFHA 2XNDD 3KZ1E 3ZH9B 4I99A 4DSUA 2F1HA 4EPVA 1ZD9A 2QSZA 1QHNA 2RGNA 3OAAA 1NN3A 2VF7A 4QJ5A 3HJNA 4DEYA 5FL3A 5JBQA 1TMKA 1Z0JA 1ZJ6A 1XBTA 2RGCA 4K8OA 5EJEA 1J2JA 5UKDA 2D3WA 4GPTA 2DYKA 3UPUA 3WBJA 4ASUD 1R5OA 1M6NA 1UADA 2QBYB 3B1ZA 3ZJYA 4C0LA 1UBEA 1SVSA 2NO0A 2A5DA 2ZRNA 5FOUA 2HXYA 1NLYA 3SI7A 2ANBA 4WA7A 1HV8A 4C0KA 4D80A 2CCKA 2QNRA 3N5CA 4M4SA 4EAQA 1WQ1R 2QN6A 2WSSA 1ETUA 4B44A 3CB4A 2W2TA 2RGBA 3KJHA 2KBEA 3CX7A 1CU1A 2Q0HA 4BLSA 1U8ZA 4BFZA 2XXAA 1U2RA 2O8BB 1D2NA 1Q44A 2NTYC 4H1UA 1XD9A 5FBQB 2PEYA 2JLZA 4IXMA 3ECCA 4KITB 4Q47A 1E2JA 1CS4C 2V7QA 2FNAA 2XSZD 4TL8A 4XVQA 2QMHA 4TMZA 3RS0A 5KNDA 3SQWA 1RKBA 3L8ZA 1N6KA 2CL0X 2XAUA 3MAAC 1RJ9B 1P62B 1U9IA 3D3QA 3NBXX 3W8NA 5AWFC 3FOZA 3K0CC 4US1R 5B58C 1BMFD 1LV7A 1UBCA 1US8B 4OQFA 1Z0DA 2V9PA 3U7EB 1J99A 2HJGA 4MUBA 5CB8A 4TLAA 1E32A 5GADl 4Z8YA 3SS8A 1XZPA 1ZNYA 3CRMA 3LO5A 2PCJA 4MYUA 4LJ6A 2XOKA 1CR1A 2JDIA 1DO2A 2ZAMA 3P4XA 3VFDA 2ERYA 2QROA 3ONWA 1WB9A 2DFTA 4IVPA 2YWHA 4HLDA 4PAMA 4TWZA 4HSEA 1P4SA 4PQRA 4L4UA 2BEJA 1W1WA 2VPPA 1HE1C 4RFSA 1S1MA 2FPKA 3L8YA 1NLZA 3N70A 2ZSFA 3TGPA 3RAPR 1IN4A 4D82A 5JHGB 2ATVA 4JVNA 2J0UA 4NCNA 3AVVA 1AQUA 1II9A 2QA5A 1P75A 3RWOA 3DZDA 1IY2A 2PX0A 3H86A 4Q1CA 5EP2A 1Q57A 3SEAA 4N0EA 4P4SB 3VR6A 3ZGXA 4CZ2A 2AD5A 1W36B 2AWNA 1GAJA 3RC8A 2IS1A 1E4YA 4JVLA 3X1DA 2WTUA 2ZYVX 1ZIPA 5ELXA 1P2VA 2YWGA 3OFNA 4ZCIA 5B64A 3LLUA 6Q21A 1IOZA 2WAXA 4W5WA 3KFXA 5HR5A 5H70A 3GCGA 3KJEA 1P6XA 4JLBA 3B8HA 4TSFA 2YOFA 4C0QC 4IDQA 3AQ4A 4OK6A 3U44A 2J7KA 1OPXA 4C0BA 2GXUA 3EARA 4JLPA 2WMOB 2D74A 1F6BA 1FTSA 1H8EA 2PEZA 3PVSA 4L8GA 1W5TA 4GNKA 5FUXA 5JMTA 2XGJA 2C9CA 1N5JA 2Z0MA 1AS2A 4U5XA 4OQXA 4M1YA 2EQBA 3G82C 5DHAA 4BWYA 4GOXA 3U5ZB 1VCNA 1KI3A 3I32A 4M1WA 3TW8B 4QFMA 3NDPA 3LLMA 4HAZA 2AKAB 3X1WA 3PR1A 5AUNB 2HYIC 1WBDA 2FDCA 3M0EA 4FN5A 1EWQA 1AZSC 4QXAA 5JFGA 5DGXA 1K6MA 2ZRDA 1QHHA 4D0NA 2XXAB 4WW0A 3ADCA 2W00A 5EXSA 3WHKA 2J41A 1TEXA 3N2IA 1X3SA 4V0LA 2WOOA 1G7SA 2OCAA 3LWNA 3QQ5A 2CDNA 1FP7A 2Z4SA 1D2MA 4NMMA 1E6CA 4B3FX 4TMTA 2NZ8A 3GEIA 2ZETA 1EX6A 2KSQA 2OAP1 4LX0A 1BOFA 2J87A 4TT3D 2D62A 2FZ4A 4DKXA 1VG0B 3RC3A 4ABYA 2AR7A 1JXMA 2HF9A 4JL8A 4DDWA 3I5YA 2PT5A 2CE2X 3RS2A 4AY2A 4ARZB 1RVDA 5KOYA 1YRAA 4F91B 1E94E 1ZYUA 4ZKEA 1IN6A 2P5SA 3NHAA 4QC2A 2VA8A 2A78A 4DSOA 3T5DA 1BYIA 1JPJA 3Q9LA 2W0MA 4V03A 1E2IA 2C78A 4LJ9A 2IYTA 1G3IA 1HQCA 4NYMQ 2GK6A 4LBWA 1M1YE 1GITA 3I92A 2AFIE 1E2KA 2BMJA 3TKLA 2RGEA 1IN8A 2JA1A 3KKMA 1V5WA 4Q03A 1KGDA 3UKDA 5GJBA 1T0JB 2W2XA 2G3YA 5BN3A 1NY6A 4NYMR 4ZCMA 3IQXA 3MLEA 1ZNXA 3THWA 1KK2A 3EG5A 2IYSA 2IW3A 5FPYA 5HCIA 1ZUHA 4H1VA 5SZKB 1Y3AA 4HB4A 4ZDKA 1D5CA 3WRXC 1EFUA 2ZI4A 5KHOC 1NIPA 2P6RA 3K9LA 2QPOA 4DLYA 3U61B 1FW6A 3UMSA 2GEUA 1XTJA 4FWTA 3IHLA 4HB2A 3O8BA 3DL0A 4A0HA 2ZJ5A 3VR2A 4NCJA 2JJ1D 3WYFA 2IT1A 1FL9A 5FUWA 4HI0E 1E2EA 1G3UA 1G5PA 3CW2A 3CRVA 3TVTA 3GEHA 4CIDA 3AP2A 1OV4A 4G0NA 5CJ2A 5DH9A 4M9ZA 3U3MA 4B74A 2A30A 2QMOA 3KTAB 2FEOA 2ZI7A 2OE2A 2Q9AA 1FX0B 4KCGA 4XD7D 1TEVA 1KSGA 1KNQA 2BMEA 3FDIA 2J0SA 3G0HA 4ZPXA 4BRUA 1AS0A 3CUEF 2FFAA 4V0ME 4OI1A 4EDHA 1U90A 3CRQA 4V02A 1S2MA 5BN4A 1Z6TA 2O0KA 2ZI3A 3GFOA 4Q4AA 1YZQA 2QORA 3SFVA 5FR2A 4DCVA 3AVXA 3MWKA 1KOFA 1MV5A 3TLXA 1CBUA 1T91A 3DOEA 4DCTA 2XNDA 4PO8A 3GLGA 4QNRA 1XTIA 3G5UA 1OH5A 3N2EA 3KQUA 4O3MA 3R9WA 1KSJA 1LB1B 4KSBA 4HB3A 1Q0UA 4QNMA 4EPYA 3KQNA 5KSPA 2YC2C 4GZLA 1ZC4A 3TUJC 3GJ3A 1RFLA 3FFBA 5CYPA 3BWDD 3KKPA 4LYFA 4JT4A 2HLDD 4ASUA 3PJRA 1BH2A 1Z07A 3S1AB 5K8LA 1HTWA 4PPFA 1DOAA 1XJ0A 1ZINA 4HAYA 5G41A 1U94A 3LAWA 3ETLA 1W2HA 1MH1A 3R8FA 2BM1A 2GAAA 3FYHA 4KFUA 1EK0A 3VHLB 4TTQA 3AGPA 3ZYCA 4QBFA 4GI7A 4DWJA 4DDVA 1CJVC 2GXSA 4GT1A 1FUUA 4B3DA 1NJGA 2QQ0A 3K0EA 1YZUA 1FPMA 2QAGC 4N1AA 1SHZA 3GFTA 4I1UA 3V4RA 1OYWA 3DHWC 1T4GA 4PTLA 4QHTA 2XSZA 2REBA 4ILEA 1LW7A 2GJSA 3UWOA 4A2QA 2PZGA 3GLHA 3A1SA 4OQNA 2QZ4A 2WZQA 2PMKA 1DAHA 1Q21A 5F9HA 3DMNA 2NIPA 1YZNA 2QM8A 2OLJA 5TV2A 4PR0A 1N5LA 2GHIA 1BMFA 4KYIB 2YVUA 4PSKA 1ZM4A 3OIVA 3MUFA 3PEVA 2FPLA 3WBKA 4UJ3A 1N0UA 2MSEB 4PQYA 4CYMA 2QU8A 5GVSA 5P21A 2VHQA 3T15A 2JASA 4RCYA 4HDQB 1SVOA 3ICEA 2V6IA 3U6KA 1M8PA 4L9SA 5HTKA 2F3RA 2ZTSA 1KHTA 4KSCA 3FMFA 1ELOA 5G3ZA 1R2QA 1W36D 1NI3A 4IOKA 2QMUA 1HT1E 4XH9B 4JKIA 1FQJA 5CM8B 2JLVA 2XZOA 4C4PA 4Z1MD 4R2HA 5JJLA 5J4LA 3PITA 1T5IA 5FFMA 5A4JA 3CBQA 1KY3A 1SGWA 1KI6B 4I1VA 4B3XA 4II7A 3FE2A 1N5KA 1VCOA 3P26A 3DKPA 4KVAA 3TAUA 3T1VA 2BMFA 4Q4HB 2G0NA 1P9NA 2C77A 4LUCA 2HEIA 1NVUQ 2DWQA 2GZDA 1XEXB 3SNHA 2ERXA 5A5GA 2GVZC 2QAGA 3ZIAD 1E4VA 1NVVQ 2AFHE 3TUIC 1SVWA 3P32A 1QHGA 3QXSA 4AIIA 4EPRA 2RGXA 2VIIA 5DI9A 1DARA 1F2UB 2IHYA 3IEUA 4B2LA 2ZI5A 3WNCA 5L3SB 3LRPA 4ZDJA 5EZ6B 3JZAA 1W47A 4TYWA 2H16A 5CYOA 1Q3HA 4UQOA 3RANA 1L8QA 4B2PA 1G18A 5C2JB 5DYIA 4EIWA 5KNCA 2YOHA 3KUCA 3ADDA 5AJZA 2ZXUA 1E99A 1R0WA 4KJZA 4ZCLA 3MWJA 3SC3A 2GCOB 4W7SA 4MRPA 2J3EA 2OCBA 4LYJA 1VIAA 3PUXA 2H5EA 5FBVB 3K9GA 2GK7A 1Q12A 3RRYA 3H2YA 1M2OB 1MABB 4BLPA 1N6OA 3BD9A 4FI3C 4RD0A 1X8KA 5E4FA 1W2GA 1A2KC 4TL7A 4Q9HA 2JLWA 1YJ5A 3DZ8A 4BLTA 4DSTA 3RWMB 1L4YA 1JQJC 3B9QA 3T35A 2CEAA 3R8CA 4BZXA 4CEIB 3QKSB 4TYNA 1O3YA 4LZZA 3CF2A 1T3HA 2EFEB 2ZREA 1VHLA 3LD9A 2XZPA 4A4DA 5HZKA 4IJMA 2A5JA 1DEKA 5EZ5A 5JSZA 2GF0A 4Q7MB 4Q9LA 1R4AA 4MKGA 1SZPA 3CO5A 4TT3A 1SKYB 3KX2A 2R9VA 4RCZA 2EWVA 4TYPA 3KQHA 3QKUA 5CIQA 2OM2A 4CEJA 4KFTA 2BM0A 4JBYA 2IYWA 2GF9A 1IQPA 1UKEA 4QJ4A 5BYJA 4EFNA 3K09C 4Q7KA 2GWHA 2RMKA 5IRCD 1ZD1A 2GZAA 1OFHA 2F55A 4QBHA 1MRSA 1S3SA 2WHXA 4JBWA 1CR4A 1ZM3A 4BECA 3GD7A 3A4NA 3SQXA 2IXFA 4Q1EA 1DAFA 5C46F 3ZVRA 1T6NA 1COWD 1GNQA 5EXTA 3UMFA 4KO8A 3UATA 3D6TB 1II8A 2WOJA 3VKHA 2V4ZA 1LF0A 4AD8A 4NYJQ 3D7MA 3GLFB 1DAIA 2ZE6A 2ORVA 5KTYA 1DELA 3IDQA 1DE0A 3TRFA 2QTVB 1FNMA 3RS4A 5EQTA 1KY2A 3NHBA 1BYUA 4PHTA 3AVUA 4JL6A 4M1TA 5KDDA 4GRAA 2J0QA 1U8AA 3E5HA 3HYTA 2IYVA 1NMXA 2IUUA 2JJ1A 2QGNA 4OBEA 2A5YB 2JLXA 1G64A 1SVIA 1W4AA 5E7IA 3I8XA 1TF5A 1XWIA 2H17A 4LSGA 2J5XA 3T1QA 1DPFA 1LTQA 1W0KD 4JYCA 2ASEA 4C30A 1R0ZA 5FH9A 1P72A 1Z08A 4BFWA 1E0SA 1G3QA 3O8RA 3PG5A 4PC2A 3AVTA 1GL9B 4LV5B 1KAOA 4PHGA 4Q21A 4XD7A 1YVDA 5DLQC 1KK3A 5AUPB 2CE7A 3SBDA 5K8TA 3K09A 1OIVA 3NC0C 3SHFA 1KDPA 1XRJA 4M9XA 3AGQA 2OT3B 4HLCA 2CCJA 5J47A 2QBYA 4C7OB 2O8DB 5FTMA 3GLIE 1VMAA 1TL7C 3B9PA 3VX4A 4AWXA 1NMYA 5IHPA 4XWAA 3HWSA 3OE7D 1WBBA 5DHFA 4IDOA 3B78A 4A6PA 4XVRA 1KO4A 2YYZA 5ANRB 2YHSA 1P5ZB 2XEXA 1EWRA 3A8TA 1Z0KA 3NTUA 2O8BA 3VQTA 1W36C 3VKGA 3EA5A 3FKQA 1P61B 4PXAA 4B35A 2G9NA 1GP2A 1RPZA 2ZM5A 3IGFA 4ESHA 3NKVA 4J0QA 2IYYA 1QG2A 3LY5A 5JJKA 3SYNA 1Q1BA 1O87A 3U60B 1RJ9A 1KMHB 2CJWB 3QUSA 3CH4B 1N6RA 2F1RA 1SVKA 5E3HA 4CT5A 1US8A 4Q1AA 4BUJA 4TZ0A 3X1ZA 2OXCA 1YR8A 3Q7PA 2GXQA 2HUPA 4RZ3A 1Z06A 4QG7A 3AM1A 2C96A 2VHCA 2JLSA 5CM9C 1JEDA 1VYTA 5LD2B 3AVQA 4M21A 1HEIA 1G7TA 2OFWA 4FWIB 3ZD7A 3C7KA 3QF7A 2WKRA 5J4KA 1UPTA 5M04A 1WA5A 4QL3A 2B8WA 3CKLA 2BWJA 4HAUA 1KI2A 5AJVB 1RZ3A 3K9NA 3CWQA 2BIFA 2FSHA 2Q3MA 3HU2A 4ZIRB 1SXJE 1OLOA 1RRFA 1N6LA 4BZQA 5EE3A 2NQ2C 1ZW6A 3L0PA 3WY9A 5FBRB 3SOPA 3AUXA 1E2DA 4WOPA 3MWYW 3AVOA 4C0SA 2DR3A 3GJ0A 4GOJA 2ZRIA 2DCUA 2WWGA 2NGRA 4WVFA 5AJYA 4F4IA 2QUZA 4P4SA 4TYQA 4Z54A 1GTVA 1T0HB 5KPDA 4R98A 3EAQA 3FMPB 1SKQA 3EWSA 4JJZA 1YHNA 2V6JA 1E1RD 1XD2B 2GCPA 2ZYUX 1PV4A 3B82A 3AVYA 1MO3A 5G3YA 4Q9IA 3X1XA 4Z1MA 2XTNA 3VU9B 2ZEJA 1GRQA 3KKNA 2OBNA 3IO5A 1MT0A 2B92A 1MKYA 1OYYA 2DHRA 2J9RA 2ZYWX 3B60A 4JBXA 3REFA 3W3ZB 821PA 2XZLA 3SDZA 3IIKA 1T3SA 1K8RA 2UZIR 3BK7A 4DJTA 2XJ4A 1F3OA 4DDTA 1FQKA 4PPQA 1A7JA 1T8TA 3ZIAA 1DAMA 5J4YA 2VRWA 3A37A 4URYR 3ND9A 5LB2A 2E1RA 1J90A 5JLJA 1NSTA 4YMWA 3KB1A 3U4QB 2CHQA 4U02A 4YXWD 5C18A 4NZYA 5SZIA 1XDBA 2RHMA 4URVR 1GUAA 1M74A 2B21A 3BB4A 2C04A 4DT1B 3ASZA 5KDLA 1W4BA 1KSHA 4RJLA 3H84A 4A0GA 4RKEA 1Z6YA 5TXGA 1XEWX 2BKUA 4RD4A 1KK1A 4QHSA 2FSFA 4TN1A 2ZRHA 2VHTA 4C0HA 1E2MA 4KLNA 2IWRA 1PVOA 3IKJA 1N2CE 2EU8A 3BE4A 1ZNWA 2F7SA 5CJPA 4QGFA 5G53C 2VSOA 2ZRBA 5FR1A 1JXOA 2Q6TA 3QJYA 2P6UA 4AK9A 4X8HA 2IS6A 3D31A 2C95A 4Q02A 1DO0A 3BB1A 1D6JA 1P2UA 1XZQA 3BORA 2P3SA 3SU8A 3ZS8A 4ARZA 1NBME 3MD0A 1ZM2A 4LPSA 4BLRA 2RHDA 2AX4A 3GJXC 3IIMA 1TQ2A 5BXQC 5HE9A 4MYHA 2NO1A 2DWOA 1XJQA 4G5SA 4IDPA 2GJ9A 2YWFA 4CVNA 4D4MA 3JZMA 1IBRA 1S0UA 1UDWA 1VECA 2FJUA 3KJGA 1UEJA 4ESVA 2GESA 3PV0A 3QBVA 4IFEA 4OKSA 1M7GA 3QG5A 2QRNA 3Q5EA 2JJ2D 5JI3E 1HH4A 4BEBA 3QKRB 2OFOA 4IOMA 3LBIA 1S4QA 3W90A 5JZVA 2G0TA 3VHXA 2REOA 4LJAA 4YMTA 1SXJD 4RD2A 1OH6A 4TL6A 2ODNA 3DKVA 1IN5A 3WRYC 1YU9A 1OSNA 3M4YA 1DS6A 2O52A 2MMGA 4PC3A 2QEQA 2BMDA 4XJXA 3QPUA 1MO4A 1I2MA 1Z28A 3K53A 4MGKR 3ZDQA 4M1MA 3F8TA 4L16A 3HU3A 2F9LA 4YONB 3MGCA 3GJ4A 2R6CA 3WP0A 3IPYA 2HT1A 1TU4A 1KZGB 1OKKD 1COWA 1XMSA 2EFDB 2J59A 2RGAA 1G8PA 5EUMA 1EFTA 2RGGA 4P31A 2OZEA 3EWAA 4L9WA 1GRNA 1R0XA 3BXZA 3K0CA 1XU4A 3LBHA 4IW3B 2GNOA 2KJQA 3R20A 2VTKA 4OYHA 4BFUA 4HUQB 4DIDA 3RS5A 1E9FA 1GZSA 2JGNA 3EW9A 4DC9A 5LPNA 2IUSA 1G4UR 5LDDC 1N6NA 2ATXA 1YZTA 3Q85A 3WMGA 4AYTA 1GNRA 3KTAA 4I1SA 2QT0A 3B6EA 2ZI6A 1FX0A 2IHBA 2D06A 1JECA 1OIWA 1U81A 4JL5A 5HZHA 1W5SA 4M22A 3NBFA 1OXTA 2ODEA 2O8EA 3THYB 2VF8A 1JR6A 1XPUA 3HPQA 3RDPA 1F48A 1NKTA 1W0KA 2XX3A 3VX3A 2ZVPX 2CVHA 4HZUA 3PUWA 2J46A 1RE0A 4Q1BA 2QG6A 4HLQB 3QVVA 1YZGA 1PLLA 3EPKA 1ZUNB 2VHJA 2ZRLA 3PIRA 3QEJA 1CR0A 3LBNA 3I61A 4NPHA 2VP6A 3C16C 2ZRGA 5JCPA 4WZBE 2GEVA 1Q1QA 4AG5A 3BJIC 1GKYA 1UEIA 5CIWA 1UKVY 3DDCA 2FFQA 5HE8A 3S1AA 2HXSA 4JZKA 1DVRA 1VPLA 1R8SA 4TZ6A 1U0JA 5FOVA 1NBMD 2X8AA 3TW4A 3B2EA 3OE7A 5DNYB 3V9PA 4FXPA 1E9AA 1QHIA 1HYQA 2VQSA 3OF5A 3F0TA 1GKIA 4PAOA 2KBFA 2OAQ1 2GDJA 3BS4A 1JR3E 4JVSB 2B7CA 2ZS9A 5FUYA 5DYGA 3SE0A 4B76A 2CBZA 1E1QD 3R7WB 5CITA 1WE2A 3SR0A 2R6GA 4PHFA 2V3CC 4IEIA 2ODWA 5JWRA 2DFLA 2W58A 4NKRA 4GBMA 1X1SA 2HCBA 3VNUA 4LY6A 1Q3TA 2CNWD 3LA6A 1LNZA 1RC8A 2PLRA 2EVWX 2EFCB 3REGA 1T8UA 5CDFE 1D8TA 2BCJQ 2VP9A 2C2HA 4Q5IA 5JCZA 2HCJB 3QXCA 1CEEA 5JRJA 1I4DD 2PJRA 3ZVNA 2RB4A 4W5JA 1OF1A 1E2LA 3IUYA 4IHQA 4HDCA 5AK0A 2WJHA 4HYYA 4Q4JB 2CHVA 3PUVA 1AQYA 5J40A 3VR1A 5E7MA 3L0OA 4TTRA 1ZAKA 2F43B 5CB6A 2YOGA 1W4CA 1VCMA 3HR8A 1LY1A 1ZCBA 2REXB 3H1TA 1W44A 3AF1A 4RKFA 3TSZA 3CPJB 1G6HA 4WZ6A 5H8WA 2P6NA 1XMVA 2WJVA 1EFRD 2UVQA 4CDGA 2LKDA 4JJKA 4M1OA 3KDSE 5CK4A 1U98A 4JSTA 4ZI2A 5J4HA 3QXJA 4B32A 3W3AA 5L3QB 3FVQA 2ZR0A 1VCIA 2ZROA 2VEDA 4YDHB 2QPAA 1XX6A 5FPSA 3ZQ6A 4X8OA 1KI6A 1Z0IA 2O8EB 3QF4B 1J70A 3KXIA 4LJ7A 2GTPA 4B3GA 2RKOA 3LNCA 1AK2A 4Q4HA 2WJJA 3FPAA 2IYUA 2KWIA 2YZ2A 1AGRA 1I4LD 2PBRA 1XEXA 2Q9BA 4HZUB 3WHLA 2GILA 4B33A 4JLJA 4HZIA 1NLFA 3W6OA 1E1RA 3AKEA 4LJYA 1Q1ZA 3VR4A 3ZZTA 4IXNA 5KPJA 3GEEA 1L7VC 2WKPA 1TF2A 1KK0A 3AKYA 1ZU5A 3FFAA 4L15A 3MJRA 3X2SA 1KO7A 4DZZA 1F2UA 1CLUA 2QTHA 4I4LA 4QOSA 1A5TA 3LX5A 3NBYC 5L3SA 3U7HB 5FBLB 1HA3A 5EE9A 5G40A 3VNVA 1L2TA 1FUKA 3T5GA 2Z83A 3HDTA 2QL6A 3HU1A 1W0JD 1NY5A 5A0FA 3PQCA 2IK8A 1KI4A 4BEJA 2YC4C 3KXKA 3Q3JB 4P32A 3BAFA 4URZR 4DLWA 1S3GA 2OLKA 1SXJC 4DLVA 2GCOA 5FOWA 1CF4A 3MWLA 1NMZA 3GJ5A 3U3KA 4PC7A 4KHZA 3NXSA 1IHUA 3BERA 4YXWA 4A0FA 1MABA 4DLZA 3QKTA 3AEZA 1KTVA 3BBPA 2VSXA 1YZLA 3BB3A 4A15A 3K70B 4OHYA 2Z6VA 1UBGA 1DTSA 4CEIA 3QKSA 1SVLA 1IXSB 1H8HD 2ZSDA 4D4JA 4OHZA 2ZI9A 1NJFA 1XMJA 2QY9A 2WM9B 3ZVMA 5EP3A 2N42A 3GJ8A 2I4IA 1OHHD 4I81A 3LXXA 1IJFA 1RIFA 2ZSEA 5FTNA 1KYIA 1XPRA 5EE5B 4C2TA 4DLUA 4AKEA 5EP4A 1OH7A 1NF3A 4IOJA 4NH0A 5F9FA 4ZKDA 4IKEA 3EZ2A 2F9MA 3SJBA 1W4RA 1YZKA 1N0WA 1VDZA 4UNRA 3GJ7A 2X2EA 1I4TD 3DM5A 5F3WB 3CZPA 3U6BA 1IY0A 3FMOB 1U0LA 5FPTA 2IBMA 3OEED 1N6PA 5DE3A 2CLDX 2C99A 4AKHA 5GJCA 2GJ8A 2HF8A 4MGZR 3I3SR 3QPVA 4OQLA 2C98A 2QP9X 5LBIA 3C4JA 2IXEA 4JMPA 5L3VA 4XVUA 4WXPA 2CXXA 2JJ2A 4M8NE 2VL7A 1PLKA 3MCAA 3A4MA 3GMTA 1AS3A 3E1SA 1ODFA 3EA0A 4EKDA 4M53A 4Y0VA 1BO6A 1VHTA 4FCWA 4QM6A 1KKMA 2QTFA 1KIMA 3GLFA 3U3RA 3ZD6A 3I8SA 4Q1FA 2IEYA 1HE8B 2ZE8A 4WAUA 1A82A 3QIAA 2ZUCA 3TNFA 2G88A 3LV8A 5H1YA 3MMPA 4HAVA 4L5BA 4US0R 3GQBA 1OKKA 2AL7A 4KBFA 3OEHD 2YKGA 2EWWA 3FWYA 1XNJA 3THOA 4JLNA 3KXLA 4F38A 3VKWA 5BW8A 3B5JA 2IF0A 1NVVR 1E9CA 2Y8EA 3MSXA 3W6PA 2OCYC 2ZRJA 1OB2A 1OXXK 3L43A 4LBZA 1R8QA 4G5GA 2ZIAA 3QXHA 3RSOA 2JLQA 3VTKA 4PPGA 3KKOA 3ZS9A 5LD2C 5LB4A 3WYGA 4AC9A 5CK5A 3ZLJA 3GLIB 1TU3A 3CZQA 4IDNA 1GKUB 2GCNA 5H68A 4PPNA 3VR3A 3Q5DA 2UZ3A 3MFYA 2VBCA 3AF4A 1NG9A 3FB4A 4E22A 1NSFA 4D25A 2H57A 3MRSA 4X8LA 3TUZC 1AKYA 4LYHA 2LKCA 8OHMA 3BC1A 1P3JA 3A1UA 2ZRPA 3M1IA 4FMBB 4A9AA 4LHZA 4JSYA 4FD2A 1Z0FA 4NYIQ 4C7OA 1FOEB 3A4LA 1WP9A 2O8DA 2W83A 1CP2A 2H1LA 2B6HA 2ZAOA 4PQFA 4JIMA 2ZS8A 1Q1EA 3CR7A 1DG1G 4GMXA 2CVFA 1SULA 1XEWY 2ZR7A 3I73A 2ZJAA 3V00A 1M7HA 1II0A 1G291 3ZQJA 5KDOA 1Z5ZA 4NDZA 2D4HA 2BDTA 2IX3A 1LFDB 3B7GA 4KV9A 1ANKA 2Z43A 3LVRE 4JS0A 2FFBA 2WWWA 4EUNA 3ZVLA 4DXAA 2WBLC 4Z8XA 4RD1A 3TBKA 4PSVA 1LS1A 3AV0B 5D3QA 1CJMA 2ZS7A 3IEVA 1F60A 4UNPA 3R9IA 1G6OA 1NBMA 4LBYA 1F2TB 3WP1B 1KMHA 2CJWA 2FFHA 3E2IA 3ADKA 1TQ4A 4EJSB 4HDOB 2AWOA 1BS1A 4DCUA 1Z47A 4MDEA 4UKDA 3KJIA 1E1QA 1X6VA 3PEUA 4C2UA 2WAYA 1G41A 4JLOA 2FU5C 2D7CA 3O8CA 2NG1A 1SXJB 3KQKA 2FGJA 1N3BA 3BH7A 2CNWA 4E09A 4DRZA 3U3OA 3B1VA 4URWR 4S2EA 4JLMA 4N0DA 3BRWD 4MQBA 1UFQA 3CIOA 4F7WA 1P2SA 4PZLA 5DSZA 4ZIRA 4NYJR 3U7FB 2JJ8A 2V1XA 3TR0A 1NN5A 4KXFB 4CEHB 3AF3A 3SYLA 2MSDB 2F1JA 5FOTA 1E9DA 2AK2A 3K1JA 2V55B 1UAAA 4TSFD 1OW3B 3P1JA 3L2OB 4TLDA 3LQRA 4FW9A 2VP4A 1EFRA 1DAKA 4A92A 2XITA 3BFKA 4LRWA 1XD2A 1N5IA 2JCSA 2H18A 2FGKA 1WDTA 4RY2A 5SZHB 5IF9A 4LPKA 3HYRA 3VU9A 1KI8A 2BBOA 4HLUC 5E95A 3PFIA 4TQUS 3EPLA 3LXRA 4JLDA 4NTZA 4FIDA 1DAGA 4DHEA 4A8JB 5KNBA 4F93B 4KLZA 3OIUA 2FV8A 3QEOA 1NN0A 1FZQA 1G4AE 2IYLD 2QM7A 3D8BA 4B43A 2WWYA 3LW7A 2OESA 3C15C 5IDVA 4OI4A 2OO7A 1QG4A 1IN7A 4DDUA 1ZUIA 5TMPA 2IS2A 1UBFA 4MKIA 4GFDA 1IXZA 3U4QA 1KDRA 1ZD8A 3K0FB 3NWJA 1XXHB 3CRW1 4KYUA 4MDFA 1GL6A 5FPHA 4FMCF 5FTLA 3PUZA 3DO6A 3RNLA 5C1BA 1TNDA 3UWKA 4DT1A 2HLDA 3KFVA 4LJ5A 3K70D 3FHOA 1W0JA 1KI7A 1NN1A 1U8YA 1JI0A 3PCRB 4GSYA 1OXUA 2A5FA 1QDEA 4TLCA 4DLTA 1A1VA 1G21E 3LX8A 3IHWA 4KAXA 4RSGA 4W5HA 2PCLA 2CL7X 2ZRCA 5KYKA 4NE2A 4X8MA 2CMKA 5L8VA 3EX7C 1CXZA 4EPXA 1ZMXA 3B85A 2CK3D 4LK2A 3RHFA 3IIJA 1E69A 4B2IA 1YR7A 2VP2A 1X8LA 2VO1A 5C4GB 1W7AA 3RRZA 1LS6A 3EZ7A 2IC5A 3GLHE 4M9SA 2V54A 2QE7D 4LJ8A 1H8HA 1G5TA 2RGNC 3ADBA 3OESA 4TMKA 3SBEA 2QQEA 1ONBA 4S35A 5AUOB 1VIYA 2O0JA 3B13B 3FHCB 4GOKA 4I1OA 2QRZA 2Q3FA 4D2IA 1TQDA 1YRBA 2SHKA 4G01B 4DB4A 1TTTA 4OJQA 5J5CA 3KB2A 4LWZA 4PC1A 1OHHA 2R8RA 3SJAA 5CDFA 3LQQA 2JLUA 5JS8A 5EP1A 4XSHA 2XTZA 1M7BA 3QKRA 4MKHA 3IO3A 4KODA 4DVGA 1TQ6A 2O8FB 3AP1A 5EE0A 2ECKA 1IM2A 2AKYA 4G5OA 1GIAA 3L82B 1S9HA 2FOLA 3T34A 5FL7D 3OEEA 4FMCB 2G83A 3O47A 2QT1A 4DEXA 4DUGD 1YQTA 2BVNA 5E7JA 5CLLA 3TQFA 1UJ2A 3CLVA 3KL4A 3DM9B 3CF0A 2WVJA 1EESA 4JLAA 3K8YA 1I2DA 5DI3B 3T1OA 3W6NA 2EYUA 2FG5A 5GJVC 4QBGB 2FSGA 1E3MA 3CPHA 4BLOA 3GPLA 2IF2A 4MRNA 4TMWA 4UXIA 4BQSA 1Q20A 4TLEA 1ESMA 2IUTA 4HUQA 4V0MA 4E07A 1RYHA 3X1YA 2H7VA 5TDHA 4TL9A 4Q18A 4F4JA 5IK2D 1QZXA 4NP6A 3AUYA 1KAGA 4OL0A 4IRUB 3KKQA 1EX7A 4O25A 5B30A 4OHWA 3LFUA 3NEYA 2XTMA 3BOSA 1AA9A 4GZMA 3OEHA 1JPNA 2VLIA 2JLRA 5FBWB 3H4MA 3T61A 2GAOA 1PLJA 4IOLA 1VG1A 4QGAA 2ZU6A 3EXAA 5JEEA 3A36A 3BFVA 2JAQA 3CRRA 3THYA 1S96A 1U0HC 4IVQA 1S9DA 1TUEA 4G5QA 4LI0A 4GP6A 2ZJZA 1P2TA 2XNSA 4OJKA 4OHXA 4UNSA 4LHXA 1Z0AA 2WPDD 1GDDA 5FI0B 4HUTA 2OG2A 3SJZA 4A1FA 1JALA 1KJWA 1EFCA 4LBVA 1T5LA 2ZSAA 1XXHE 4NCKA 2NPFA 1TF7A 3RRNA 1ESNA 1B0UA 3THXB 4UXJA 2J0VA 1ZC3A 5TB5A 4HATA 5EXPA 2V1UA 4F4CA 1JQLB 1XTSA 1CJKC 1E2QA 5JJIA 2ZUBA 4US2R 4C3ZA 1RW4A 2PJZA 3OIWA 2NO7A 621PA 4MRVA 2ZRMA 4EPWA 1IJEA 1XTQA 1CRQA 4AYWA 5DN6D 2O8CB 3GFPA 4LDJA 4Q7LA 3VMFA 4URUR 4DB2A 1S1CA 1J8YF 1ZBDA 2BJWA 3Q7QA 1S8FA 1D9XA 2P0EA 2WIAA 3R7WA 4BPBA 4LV8B 3CPEA 4XWOA 2F3TA 2FEMA 5GVRA 4Z51A 3AF0A 4FINA 4DLSA 4A36A 3CNOA 3I72A 2X77A 2ZR9A 521PA 1Z6AA 2X1VA 2OBMA 1EFHA 1Z83A 2YINC 4N3NA 1CJUC 1UDXA 1Z6GA 1JEEA 5JWOA 3FTQA 1NVXQ 1TPZA 3EZFA 4ZDIA 1E9EA 4LHYA 1DADA 1B23P 5EUQB 1QVAA 3EIQA 2D7DA 4IEEA 3AH8A 1Z2CA 2OILA 2QMEA 1MO5A 1OJLA 4M2LA 4Q4JA 3FHTA 1VYVA 3PENA 3CM0A 4YQFA 1VKJA 1XJCA 5D3MA 1XCGB 2F43A 4H9GA 4BGDA 5BQ5A 1ZIOA 4MRRA 2A3RA 1CKEA 2QP3A 3IQWA 3QG1A 3AP3A 3DOFA 4B6FA 2C03A 3SJCA 1QHYA 4Q4LA 3TQCA 2JIZD 1WMSA 2DFNA 3JVVA 4DBLC 2WJYA 3CNNA 4Q19A 3K0AB 4IDHA 5JHHB 1KDTA 1XD8A 2BJVA 3K70C 2NOAA 1E2GA 5L3QA 3QENA 1G8GA 1JJ7A 1XFAA 1ZRHA 1X1RA 3EZ6A 3BH6A 1XF9A 1KNXA 4TYYA 2C9OA 2ZITA 2QP4A 2P2LA 2GJAA 1C9KA 3TIFA 1QBKC 3QF4A 4MYTA 5JEDA 4M1SA 2CHGA 1RRGA 3BGWA 3F5FA 4C0JA 4DIEA 1X8JA 3SZRA 1CRPA 2EW1A 1SQ5A 2A2ZA 2GRJA 4TMXA 3CH5A 3OZXA 2G1JA 2ZUDA 3I62A 4KI0A 1R6BX 2D2EA 2NMVA 1KDOA 3UMRA 2N46A 2C9YA 1AN0A 1PUJA 2ZJ2A 3J81k 3W9YA 1ZP6A 2JEOA 3L0SA 3F3YA 4NCIA 4KFSA 3L0IB 1G8FA 5KSOA 3AB3A 2R44A 4HB0A 3PEYA 2J7PD 3DEFA 1NVWQ 3FKSD 4LHVA 4MA4A 1ZU4A 1OFIA 1D9ZA 1WRBA 1CULC 4WBSA 4A0RA 2EYQA 2WICA 2I3BA 4D6PA 2IL1A 4GDFA 2ZRAA 4Q9KA 1UKZA 3W5IA 3NC1C 1U99A 5TY0A 1N6HA 4GP7A 4M9QA 3RSLA 3RLFA 2ZVQX 1TX4B 4BLQA 5KSYA 5KSZA 2X2FA 2ZYTX 1G17A 4CT4B 4ERNA 4MGIR 4HEJA 2UKDA 1AGPA 3QI2A 4P33A 5F2EA 4FCTA 1CTQA 2PL3A 1VG9B 3ND8A 4PZZA 4C0AC 1P9RA 4U7DA 3NDBB 1KO5A 3UK6A 5F98A 1E0KA 2IEZA 3LVQE 2R65A 5KO2A 3IILA 3U2QA 3GP8A 3I4LA 1VG8A 5JS7A 1ZNZA 5SZJA 3QXXA 1AIPA 2CK3A 5K8UA 3HR7A 1QHSA 3SHWA 4Q48A
chains in the Genus database with same CATH superfamily
2Y27A 2XUJA 3N1UA 4AZ3A 1N7GA 5JRDS 2JIPA 2F67A 1YQ9A 3D9QX 4JEIA 1X7GA 4OAOA 5CNJA 1QYDA 4HQNA 1K97A 3I9NA 4O4IA 4OQ4A 2DGDA 1N5DA 3BJRA 3GBSA 4R9UC 2QE7A 3I28A 1WXQA 3BN3A 4NK5A 4WOCA 4NESA 2B30A 2PA3A 3SIRA 3ZCXA 2FPXA 3KXPA 4BFSA 3PUYA 5JZBA 1V47A 3H7AA 4DANA 3RS7A 3SHTA 3PDUA 4OYLA 3TFQA 5DXAA 4PZYA 2PXAA 3ZI7A 1KO1A 5FULA 3IPXA 2UVPA 2G77B 5ENVA 1XCMA 3KQQA 3KQLA 1SOVA 1TKCA 2FPMA 4NX2A 4V0NA 3MWFA 3GZJA 4WJZA 5E4JA 3FWNA 4AI6A 4M49A 3C41J 4YT4A 2YIJA 4KQ1A 121PA 2WINI 5JYDA 4BV9A 1U7OA 5H9WA 2I4LA 4NHOA 1KGSA 5IJ9A 1I7SB 4G5RA 4UVDA 3VYRB 5K09A 2ORED 1G98A 2GZHA 3RYCA 4Y0NA 4LDQA 3U44B 3MTBA 1CUJA 2FMTA 4A82A 4CI9A 1HT2E 1EYZA 1LSJA 3PPIA 1E79D 3D0OA 1XKXA 3KLNA 3L40A 2AXQA 2B8TA 3KJXA 3L01A 4FC7A 2AXPA 3UOAB 5A1JA 2RHCA 4M54A 5JPIA 3DH0A 4EFMA 2LR0A 1ZM9A 3TE6A 3EZGA 4RNDB 1KDVA 1ZQ1A 4DV7B 1H3EA 4I08A 2V9CA 4DCNA 2ZQ5A 1OJ7A 2QG4A 1UH5A 2RAPA 2OVBA 3DXYA 4YFVA 3VO2A 1F1JA 4O4LB 1FUEA 1CIPA 5KYXB 2JIOA 2XMRA 1N1DA 4GM1A 2YY6A 3TSAA 1N36B 3D6UA 4E14A 3MD9A 2NU9B 1RWNA 1CCWA 4D79A 4OOEA 4FDUA 4HWTA 1V16A 1UK9A 2QRPA 4MUHA 1D2GA 3AEXA 2Y93A 4GW3A 3UK0A 4ZVTA 1QF7A 3UG6A 1CVIA 3ESAA 4CIWA 2HV9A 4II2A 3U1VA 4C07A 4DCCA 4ZHQF 3U7GA 4X1YB 2R00C 2MSWA 3M89A 3M1YA 1N25A 5DT9A 3TDNA 3QYJA 1RYFA 1ZJZA 3CXUA 4AP9A 4D96A 5LQCA 4UBOA 4QUEA 3WGIA 2XB4A 3R5SA 4PIMA 1S7CA 2BOVA 4WTOA 4HNRA 1Z37A 3KT6A 2WTMA 3RTCA 4JI6B 1EFPB 1U4SA 3AF2A 4B47A 2R97A 3S0JA 3BZWA 4BO1A 2PKQO 5DU2A 1WB5A 2CD7A 5J4VA 1YGYA 2A9VA 2WV9A 5I8PA 2WPDA 3E4DA 2WY2D 1RHKA 1D04A 2JZOA 4DLRA 4QZVA 3S5UA 4BFLA 1QF9A 1TQHA 2P4EA 3EZNA 5EPEA 1J1UA 2WUFA 3PVZA 5CHEA 4B75A 1FTYA 1Q2UA 1VE5A 3AVPA 2WYOA 2I1VB 3FNHA 3KQSA 3VSCA 4AO7A 2IYQA 3O92A 4MGEA 3CVOA 3OJEA 4GR4A 3I2HA 4DN6A 1AURA 3H0EA 3H5VA 1GFIA 1P2DA 4F92B 5ICEA 1MJFA 5LQUA 4RULA 2WWTA 4POAA 1RWMA 1U2TA 3DMGA 4YS6A 3CNLA 5FLEX 1B93A 4RPJA 4GYYA 3C5CA 2YJ6A 4Q66C 1N3YA 4Q3NA 3NR2A 1TVKB 5HKKD 4I46A 4FFBB 4QO8A 3KCQA 4L3VA 2AI1A 3CR8A 4HEQA 4TKVA 1ISHA 2RCNA 4Z4CA 3OHMA 2P67A 3DBLB 1X13A 4P4UA 2QLNA 1E3JA 2QENA 1GR1A 3AETA 1LU9A 5IC4A 1IONA 2PG3A 3CLSC 1B74A 2ORIA 1FX1A 3ZHBA 4BEVA 4BNTA 4D26A 4GU5A 1OWMA 4BFYA 1SCAA 4HEHA 1PW5A 1R66A 2PZAA 2C0CA 4EEKA 3BHMA 1RRCA 1MVLA 2IS4A 3UQZA 4KK3A 1EDBA 2Y76A 3DZIA 2IYPA 2V65A 2VT6A 2L17A 3JQDA 1DTEA 3C6KA 1SXJA 2QD4A 5LUBA 3CT4A 3ROPA 1KA9H 3V1KA 4TRNA 4WLFA 1T13A 2HJVA 2RHRA 3S40A 1EFKA 2H7CA 1ZSYA 5KQPA 4PC6A 4K6OA 2YBEA 2X19A 4BP3A 3RNOA 3SC2B 4CKEB 3KZXA 2HRRA 4LXTA 4XQCA 1P9WA 1KORA 2R6DA 4W9NC 2LBPA 2EQ5A 3VNSA 4EY6A 2EFGA 6GPBA 3VZQA 5EJ9A 1FMJA 1FJGB 4CEHA 3C87A 2XECA 3QU2A 2CL6X 1EGAA 5F33A 1CG6A 1AZLA 1JKFA 3IUEA 1QGUB 1WKBA 5AICA 3TCXB 5IKMA 1VBMA 2UYCA 2G9RA 5K4AA 3DL2A 2WE7A 4KN9S 4XCQA 4HDNA 1UC5B 3QUTA 1AQ6A 2R8ZA 4Q4AB 2OBLA 3H5OA 2FMIA 2F6RA 1AZTA 2GKSA 4HWSA 4PYIA 2JIZA 4QHYA 3ILYA 3TIGA 2P5TB 2W0SA 1P1KA 1D0SA 1EA5A 5JI2E 2A58A 1ADFA 5AJWA 1CW2B 2PKQP 4FONA 2PVSA 5LXTB 2XXBA 4QEZA 3GLGB 4BCDA 1IEVA 4JD5A 1G16A 2CMGA 3AR7A 1P44A 1Z29A 2E9SA 5EYPA 2Q3CA 1QOPB 3R77A 4IRMA 2ZE5A 4B82A 1OT3A 3VTAA 4ZV4A 5EZYA 2OM6A 1FDIA 1TUIA 3W8RA 1U6KA 4PO3X 4DA6A 1M72A 3OT1B 4CM8B 4CTNA 1L5YA 4EG5A 1RQXA 3KQYA 3WA7A 1QGYA 4G1UC 4JNKA 4A8JA 1G7RA 2K5UA 4Q4DA 5I45A 4A0QA 4GLFA 3ZV7A 3H5LA 2V7QD 2Q7XA 3PRJA 4F8EA 1OI2A 2EG9A 2FW9A 1EGMB 5EMHA 5FOSA 3UJHA 3RTEA 3EH1A 3QSYA 3NHMA 4XYLA 4DADA 4D6YA 4A91A 4EF6A 1H2RS 1TJYA 4FNMA 5B1IA 5A5VA 3WQHA 3ONEA 4CR8A 2G5TA 3Q8XB 2GBLC 3HYLA 4RA6A 3WKAA 3WQRA 4QVIA 3DJYA 5ERGB 3A7EA 3VM6A 1R6AA 1J9GA 3AT1A 1QR2A 5K3FB 5AW7A 4XIGS 1T6ZA 3RVLA 2YW2A 5AW3A 1IQ0A 3VMMA 1K7SN 2J3MA 2XB9A 3GT0A 4EFLA 3LX6A 1IDOA 2C31A 5DLDA 4AX8A 2JDID 4E03A 4FFRA 3DFUA 1Y48E 3L93A 1W88B 3OOSA 2HYDA 2R2AA 4XDZA 2O6LA 1Y1LA 1EDDA 4L8YA 2FWBA 2ZVDA 4UUOA 4QBIA 5C4MA 4BP8A 1NFFA 2EHDA 2O59A 4NCHA 1VL0A 2VP5A 3GYGA 3SQOA 4B9AA 3OY2A 4MVYA 3AEUB 3MCWA 2Q5CA 3WIOA 2GYVA 3PXCX 3CX8A 2HMWA 2YWXA 5C80A 721PA 2P6PA 3K9HA 4L4SA 5GJWC 2AJ8A 5TPZA 1ZVQA 1I8TA 2PT9A 2YY7A 4KU4A 1MOZA 1M6HA 1XTPA 3QNUA 2DRIA 2FSIA 1HKUA 4KDFA 4MWBA 5HFAA 4AB1A 2JCYA 1PYOA 1CR2A 1G66A 2C3PA 2C0QA 2BM9A 3HRKA 1BJTA 3TX2A 1YHZA 3KV1A 4J9VA 1DEHA 2HN9A 3TQOA 4J1SA 1QTRA 4XR9A 3V4SA 4CG0A 4JK3A 1RHQA 3ET4A 1EB9A 2AV6A 3HRHA 4MA0A 4PX9A 4V0OA 3RU9A 1AF7A 2R60A 3BCUA 4AN1A 3PEWA 3A2KA 1PFVA 1A5BB 2BKEA 2PPVA 1HQYE 1U2SA 4R2JA 5BSFA 2CLSA 2ONCA 2VOEA 4D9JA 1P7VA 3VI4B 2DTXA 1NXOA 3QFSA 4MWCA 4YRAA 1C3VA 1Q7RA 3DZCA 4X61A 1H8ED 2FP4A 1H42A 1M66A 1DJPA 3RYIA 1DLIA 1YR1A 2QAGB 3A28A 1ZA1A 3AO0B 2B94A 4QELA 3W1EA 3ZX5A 1JIVA 2GA8A 3EQ7A 3GUVA 4M8IA 4MH0R 1L1QA 4LYAA 4UNQA 5DI3A 4UOEA 1WABA 5CYFA 3SP1A 2XWSA 1GQ2A 1SWWA 3OPQA 3G9XA 1C7JA 4NONA 4RVGA 1NPDA 2GN1A 3UT5B 4BBZA 4ABTA 3O31A 2XWJI 3M5WA 1L4EA 3UPTA 1FNNA 3EMVA 1PR2A 4Q82A 5DV9A 2W6IA 3F74A 1E7QA 2JAPA 1SCIA 2B4RO 6YASA 3SEZA 2HIGA 4EYQA 2VC2B 3QU5A 3T7IA 4P53A 2FN4A 5IAOA 4KX3A 4RZXA 1XNGA 3A14A 3ZQ4A 3OPMA 4I50F 1VBNA 1JAIA 2BFPA 3RUDA 5IASA 4Q3AA 4X54A 1FC0A 3S7TA 1IEWA 4W7IA 2XWQA 2A5GA 2AK3A 4LXQA 2C9DA 4DLAA 2SKEA 5DDIP 5AKZA 4FFOA 5TMDA 4BQEA 4IUBS 4QJBA 4Y6OA 2VYFA 3JQPA 4HAXA 2FR1A 1M34E 3I6QA 2J85A 5LA6F 1R6UA 1XSEA 4FSXA 5A02A 1JIJA 3MXOA 5KUTA 1IPHA 5C8YB 4HGNA 3U7JA 2BCGY 3RBXA 4RMIA 4CMEC 2XHZA 4JBLA 4MPTA 1XK6A 3ZZMA 2WWHA 4UC0A 2R8PA 3EDCA 1O58A 1GNPA 3FYUA 4RESA 5GZ6A 3UM9A 3H97A 1GV1A 3EEIA 3ETNA 1YS9A 4LOAA 4BMZA 1MTZA 4Y9SA 1DMRA 2WE8A 2NUAA 4W4TA 4WCFB 2BBSA 1MEEA 1QGED 3HKEA 3MINA 3WXMA 2G76A 5JSZB 2GZRA 3FDJA 5JDCA 2AMYA 1YTUA 1LF5A 2D0OB 2W2PA 1VB5A 5IEBA 3N0TA 1RCFA 2WJZB 4RZ2A 3NIBA 1J7KA 1MTOA 4D0GA 3DYBA 3AW8A 1BEUB 4BRWA 2I7VA 1B1CA 4KXLA 4HLUA 4LTMA 3VDXA 1SEPA 2D2FA 1G1MA 4D02A 2TMGA 1SKYE 2YY5A 3STXA 5L51A 1AK1A 4BNUA 3ODGA 2FZLA 4DCSA 4AX4A 5AOBA 5B2ZA 3ZE1B 1FU8A 2DFKB 3MELA 2H54A 2HSZA 5IULC 1XQXA 1UF9A 3ZD9A 4DLNA 3KOXA 4BZWA 2YV1A 1XTBA 3FD8A 5K3OA 3BF7A 2P27A 3LUBA 3UMCA 3AVWA 2QPTA 3RPEA 4NL4H 2N75A 3H2HA 4KQIA 3I5XA 1P8AA 3SJ7A 4M1EA 2FH5B 4FE4A 4LMRA 4DR1B 1POWA 2X23A 1BC5A 4GL4A 4GI2A 3SN6A 5DOVA 3MPUA 2A6PA 2FR0A 2J45A 3EBOA 2LTAA 3A1WA 3MJDA 4IQ0A 4BNWA 4XTRA 2C88A 3COWA 2G1PA 1IN1A 2G07A 5ESXA 2IKSA 2JFWA 4I3GA 3TNLA 1OASA 2NVWA 3CUVA 2WF6A 4Y0AA 3A2MA 2HSDA 2NT4A 3C3DA 3C8DA 1E2FA 1KI1A 1TCBA 5JTTA 1VFNA 2II6A 4B34A 1I5EA 4EGQA 3L49A 5G4LA 2AHOA 3IBGA 4IXWA 1ISMA 1N6IA 2OK8A 1DOZA 3GLFE 3TVYA 2GEDA 3ZV3A 3PDIA 1U9IC 4ZU6X 5K0NA 4A26A 3ZQUA 4B81A 1EG7A 3S2FA 5CA0B 1NRJB 1BHO1 5CLQA 5KQRA 4NFYA 2WWIA 3Q7SA 4EQ6B 2HK9A 3FSJX 3HMKA 1NV8A 2GPWA 4OFBA 3QU9A 4MO9A 4R1UA 2Q5HA 4JJFA 1T26A 5K3DA 3KZ1E 4WSOA 5I9LA 5EEGA 1JV2B 2GSWA 2QSZA 3G85A 1V45E 2GM9A 4QJ5A 1HQDA 3HJNA 2LE0A 3DZGA 2RHGB 1TMKA 4DEYA 1ZJ6A 5KYUA 4KMOA 3ZV4A 2GZ3A 1HDCA 4HVAA 4DYHA 1UDCA 9MHTA 4F4DA 5EJEA 1EVZA 3GG2A 3IMKA 5DLEA 1AZWA 2C8JA 2F4NA 3DE4X 4GPTA 4R7GA 3F5QA 1N2HA 2ENUA 4LG1A 5AXAA 4C29A 3UTDA 1NT2A 3UPUA 1X2BA 3RQIA 2QRKA 4I3HA 2Z8ZA 4WFJA 1TKBA 3X1MA 3HVRA 3P2JA 2P9FA 1UBEA 3TFWA 3U4CA 4C0LA 3HUEA 3ANXA 5LBTA 1NHGA 1IOWA 1XL1A 2E4WA 2JJQA 3CGGA 5ISMA 1KEVA 2ECQA 2V5AA 3HL0A 3D4PA 4WA7A 5ED0A 2QXTA 4PPYA 3TW8A 4EAQA 1VSQA 2WSSA 4MS1A 4RW0A 3CH7A 3TI7A 3CX7A 1CYDA 1CU1A 4BLSA 2O54A 2PGAA 1U6IA 3GBPA 4NAHA 3WICA 1NRWA 1UP7A 1WD5A 2ERCA 2H0RA 1Q44A 4QTTB 3G5TA 3IT2A 1XD9A 1PTKA 4FFWA 1Z5PA 3P0HA 3B7WA 3FFTA 4IZOA 1A0OA 5G0WA 2EX4A 2IHUA 3N8KA 4GNRA 5DFAA 3QVWA 2FNAA 4PYOA 4F12A 2GNPA 2GN0A 3B5EA 4YUVA 3UMYA 1ZMTA 3A06A 3VYSB 3ZX4A 1JDBC 3FDXA 4HR7A 3KE9A 4US1R 4IS2A 5ARBA 3JZDA 3ZOZA 1PE0A 3DB1A 2K87A 4Z2AA 4EL0A 4E33A 4IH9A 3CSDA 1QIIA 3CVXA 3ZIUA 2PX8A 1BVRA 2MR5A 2OR3A 3GGCA 1TLLA 5A6VA 4OPMA 3E05A 4Z0PA 4N6NA 4ERXA 1XZPA 1I3NA 2CDAA 2IZ7A 2XOKA 4NG5A 2YMMA 1CR1A 2ZAMA 4HRAA 1WIWA 5J2UF 1WSWA 2BPOA 1WPXA 4JLWA 1JYSA 4EOGA 1MQAA 5DBGA 1I32A 5CBPB 4CF5A 1ZK4A 1CP3A 3D1LA 5BXYA 1P4SA 1OLUB 1HE1C 5YASA 3MMXA 3L8YA 3N70A 1JHVA 3I42A 4WKOA 3PL5A 3RAPR 3LCUA 3WKDA 1VLLA 1MOQA 3F7NA 1SCQA 1YS7A 4NV3A 4TGLA 3OKPA 3VOTA 5JHGB 4QQNA 5AJHA 4JVNA 1FVFA 2YMLA 2DLNA 2PTHA 1II9A 3OCUA 3PEEA 4KLRA 1GAXA 3FHLA 1P75A 4GLJA 1IY2A 1SCNE 1NXXA 2PX0A 3H86A 1Q57A 4Q1CA 3V6MA 3INYA 3VR6A 4JXXA 1UR5A 4UTXA 5DTEA 1P9LA 1GAJA 2VCYA 2IS1A 3KSZO 4KUGA 5CFNA 4DQUA 2PXXA 2NZXA 2OSVA 1K7YA 3OFNA 4PNZA 2IY8A 3LLUA 4Y2JA 4GKAA 3ZLBA 4F3NA 1IOZA 1UMBA 4HDAA 1CE8A 1GPMA 1XDGA 1T9CA 2FPGA 2ZPAA 4ZJUA 2A0UA 1TEHA 3F6PA 3L5OA 1S2NA 1XZAA 4L8LA 4IDQA 1KPHA 8MHTA 2W4QA 1OPXA 1V7ZA 3HDVA 2DF8A 4C0BA 1H3FA 3IQZA 1PJTA 2JGDA 1VIMA 3BMQB 4JLPA 2RONA 5I5EA 5KWIA 3M2PA 2Q1YA 1FTSA 4EY4A 4KVFA 2B4QA 2C9CA 3RSCA 3U9SA 3S1SA 1Z4LA 1KEEA 3EOZA 3ENZA 1KR5A 1FNSA 4H6WA 5HKLA 3V48A 1J8DA 3U5ZB 1R4MB 4PZ0A 3T1YB 2V6MA 4QFMA 1G20A 2HYIC 2V9ZA 5AUNB 1OYOA 5AI6A 3SY8A 1TLTA 4QXAA 4Y6PA 2Y4NA 3DONA 2BONA 5JFGA 5JBIA 5DGXA 3AKZA 1CUWA 1Y5RA 2VYVA 1QHHA 1Q15A 1TFUA 2M32A 4RF4A 4IIBA 4DIMA 2H1CA 1KYWA 4WW0A 4EX6A 5KVCA 3ZU3A 4H1WA 2RK6A 2CWWA 3D8UA 2J41A 3KAJA 2CV1A 2R6JA 4ZYVA 2WOOA 4DV1B 5F5NA 1UQTA 4R3NA 1N57A 1HETA 1TK9A 2F59A 1WPRA 1JEJA 3RKSA 2ZETA 3VZRA 3K5WA 1PVDA 5IBCA 4JA2A 3QWHA 3C4VA 3F3KA 1QIKA 3BICA 3MBKA 4R2XA 1KDYA 4Y6SA 4QIHA 5ALJA 2DQSA 1H5QA 5JAPA 3PC6A 4PLCA 3PA8A 1YNOA 4F5WA 2YTZA 3LCMA 4EH1A 4ABYA 2AR7A 3AWIA 4G56A 4RVOA 4YBZA 4TWRA 4DDWA 1SC9A 1PZEA 2PT5A 3RFUA 3FOEC 3T99A 1CUAA 3JXEA 2OAEA 1X15A 1H2FA 1RVDA 2A14A 4HNGA 4QSMA 5FEMA 4WPGA 4F91B 1E94E 4CM7A 3HVUA 4CKWB 3ESQA 1H2XA 2VA8A 4UASA 1WY7A 5DMXA 3KSBC 2PMBA 3Q9LA 3V1LA 1E2IA 3LQ1A 2XNKA 4F4FA 2A9JA 2GK6A 1M1YE 1BVUA 2WTBA 3I92A 5JH7F 2JFBA 1J09A 1IHDA 4LOLA 4EZIA 4U2FA 4WWHA 2J3JA 1QVZA 4G4IA 1IZ8A 5KX5F 3HC7A 4HDMB 1F3LA 4LNAA 1T9BA 4Q03A 5GJBA 2CZCA 3VHXB 1F6WA 2Y1GA 4GAEA 4MPDA 1WB4A 3THWA 1CIJA 1TFRA 1GLGA 3KOWA 2HF7A 2VDUE 4IX9A 2Z5GA 3HXTA 4JJAA 4LSMA 1U3FA 4Z49A 2CLFB 1Y3AA 2DKFA 4HB4A 1J0XO 2A33A 2ZI4A 3QOXA 2Q29A 3T7AA 4R81A 1LEHA 4E2WA 4HNVA 3RUFA 3IA7A 2SICE 4NV1A 4MVJM 3T94A 1XTJA 3LPMA 4EHFA 2CNLA 5HIKA 1X1DA 4IIVA 3IHLA 4ZHQA 4A0HA 3GA5A 4P5EA 1QIHA 1M2FA 5EJMA 2E6KA 1KIAA 2YH2A 1JDBB 2FW0A 1IUOA 3LP6A 4GVPA 1TM2A 4JJIA 1G3UA 2IOQA 1ESEA 2H08A 1G5PA 1L5MA 3AYZB 3C6XA 3CW2A 1SCUB 1ZGHA 4NBTA 4PYLA 4U9UA 4QYSA 2I76A 4CV3A 4L4ZA 5ARDA 2WFZA 1I0ZA 3GWGA 4JJ4A 1B8VA 2A30A 2BR5A 2FEOA 2BGKA 1L9KA 2OO3A 2ZI7A 2Q9AA 3BQMB 3OPYI 4FN4A 4HF7A 4PCLA 1TEVA 3FWKA 4UBIA 1DDOA 2QJFA 2OBYA 6NULA 3OHSX 3GOHA 4OL9A 4GEGA 1VBFA 4FFVA 4G9EA 4ARZB 5CYGA 2FFAA 3QU4A 1AT1A 3I64A 5EWMA 3LGAA 9GPBA 1NG9A 1U90A 1G2PA 1S2MA 2IODA 5T6BA 4AWBA 2XODA 2ZI3A 3GFOA 4D9KA 4E6PA 1SIBE 4JR0A 4ZVNA 3PVCA 4DNOA 4F3RA 4AY6A 3AVXA 5D5HA 3VH3A 3ONVA 1KEKA 2Q2NA 1XDUA 4DIOA 4V1CB 1ZVJA 4WGGA 4W5NA 1ZOIA 4B4VA 5HJ7A 3DOEA 4DCTA 4PGFA 5G0SA 3HVHA 2C7BA 1EFVB 3UJ7A 3OQNA 2PANA 3MCTA 1QLJA 4GPD1 4CCYB 3I2YX 3AFNA 1KSJA 5TSDA 3NM5A 4TUYF 3IB3A 3IP6A 1P0QA 3RF6A 4PCUA 3ZWYA 2AG5A 2QGFA 2QZSA 2XE6A 3IP1A 4OBXA 4IWNA 4O4HF 1EEHA 4QVKA 5J5AA 3WRXA 4GZLA 4CM9A 2WM2A 4V24A 3TUJC 4EELA 4EDFA 4BX9A 4DUYB 1RFLA 1JEQB 2VYND 3KKPA 4LYFA 4XUGB 3CHYA 5D5QA 3F73A 4DV0B 1YJ8A 1RBMA 2RJ3A 1PHPA 1MVNA 4FZVA 3VUEA 4JJEA 2Q2QA 5HOQA 1QYRA 3NAZA 2WKWA 2I2AA 5C51B 4RABA 5BQPA 3ZXIA 1JFTA 2B9EA 2BM1A 3NIGB 3B8EA 3HYNA 3QUQA 1G21A 1Z4MA 4KIWA 4QBFA 2IOYA 4DDVA 2GXSA 4E0BA 4CHTA 2G7ZA 3DFFA 3R3WA 4LGVA 5JOQA 2W6QA 4TWIA 5G1NA 3IH5A 4CF4A 3N58A 1U8EA 3THSA 4Y6RA 3LBFA 4BATA 2FMFA 2H06A 3GFTA 1U02A 4DG9A 3DHWC 4GD3Q 1T4GA 1OI4A 3A6FA 4QHTA 1OFGA 5B6JA 1VRVA 1KYZA 1LPBB 2XSZA 1OX6A 3L4KA 1JHRA 3TEJA 2P90A 3A1SA 5JSHA 4OQNA 2QZ4A 2QR5A 2WZQA 2IUFA 1Q21A 5JNRA 1D7OA 2O3UA 1F12A 2NIPA 1YZNA 2QM8A 3OLVA 3SSNA 1U1FA 2QDXA 1YB2A 3OBIA 3QXGA 4PR0A 1GPWB 2GHIA 1BMFA 2P30A 2REQA 4KYTA 5K6AA 5AESA 4BGIA 2J4FA 4PSKA 4C6HA 2V97A 1C80A 3JVDA 3MUFA 3V34A 1HKHA 1E4EA 3P0FA 3A10A 5AKEA 3WBKA 5HUHA 3WK8A 4W5RA 1JF8A 1N0UA 2MSEB 1W0CA 2ZWVA 4N48A 4MYDA 3WLNA 4C5CA 1LLQA 4HH3C 5P21A 3T15A 2JASA 1TYDE 4EF4A 5BT8A 4HDQB 5E6RA 2OB2A 3HACA 3K31A 3EHEA 3GLTA 2XCOA 3I9LA 4L9SA 3W79A 2BSAA 4TT8A 3IOYA 5DOZA 1QAMA 1AXGA 1KHTA 1JMVA 3RUCA 3FMFA 4QDOA 1KJ9A 1R2QA 2DH6A 4D99A 1DRUA 4W82A 3JAWA 1ID1A 2CYBA 4NU6A 4RK4A 2ZCVA 4ZD6A 1S2DA 3ZDBA 1N32B 1PS0A 4JKIA 2JLVA 2ZRQA 2VUTA 4C89A 4L2IA 1AV6A 5IAEA 3HB7A 4OLFA 2A7XA 4C4PA 5JJLA 1JVSA 3VDMA 1T5IA 3B3FA 5G4KA 1KY3A 3KSMA 4R2KA 4B3XA 1B26A 3QNWA 4PLHA 3E23A 4O2AF 1VGRA 3RT9A 3ML1A 3TAUA 1WZEA 4O4JF 4Q4HB 5FCDA 3BWMA 1VSBA 3P94A 2MYPA 2CNBA 4KIUA 2IY7A 1NI5A 2ZT8A 2ERXA 2GVZC 1NF2A 4ZAZA 3ZIAD 4BO5A 5CU7A 2I1WA 4MOWA 1GA1A 5A62A 1QHGA 1YT5A 1ZGGA 3SEFA 1UXOA 1RFGE 1E8NA 1MQSA 1J2UA 1AC5A 1FDVA 1F4LA 2PWBA 2Y4OA 3AWDA 3QRWA 4QUAA 2B0CA 1DCTA 3OUZA 1W47A 4BNLA 2GWRA 1PEDA 3DQZA 4MR9B 4YB8A 5AKIA 1L8QA 2VDMB 1RE1A 2I7TA 1RPJA 2WDZA 2VK8A 1TGYA 1WPQA 4LTNA 2WTAA 3RVPA 4LX8A 3OPVA 4EIWA 3MB5A 2X0DA 3OMWA 3KUCA 5C7IO 1NP3A 3QYPA 5AJZA 1VBKA 2OFPA 2HMSA 4KJZA 4WN9A 5P8WA 3RS8A 3LF1A 4MRPA 2J3EA 3CLRC 4Y7DA 5K4GA 5FBVB 1NQVA 1YDHA 2QUKA 2C5GA 4XIFA 1Q12A 1XQWA 1MABB 3H2YA 3ZTTA 2H8GA 1P9OA 2FPRA 2XWPA 3BMOB 3RTBA 2F4VB 3FIJA 3F2IA 2JVJA 4TL7A 2DQKA 5A9RA 3R8XA 3UFBA 4BLTA 5JNLA 2J0QA 1SKMA 1JQJC 1IAVA 2HNBA 3B9QA 2CEAA 4FGLA 4PS0A 3R8CA 3MA0A 7MHTA 4TKMA 1I3CA 1PGNA 3JZIA 1QS0A 2ET6A 1MC8A 2ZUEA 2EFEB 2ZREA 3FTDA 3FCSB 3FW1A 2FZKA 1VE1A 4IHJB 5EGSA 5BR4A 2C0PA 3E7WA 5C9ZA 1QPGA 2V7BA 3CO5A 4QYTA 3EWIA 4TT3A 1VHJA 1SKYB 2M6KA 4C1BA 5A5DA 1SBTA 4TXHA 3OQIA 2JCGA 3QKUA 4GGOA 2YIMA 3B6MA 4JC4A 3GAFA 5CIQA 5AW5A 3NHPA 5MF6A 5BORA 4PZDA 4L0DA 3U16A 4XM1A 1ZESA 5BYJA 1SB8A 4QLAA 5EFOA 2O23A 2ZBDA 2GWHA 2O50A 2RMKA 1FFAA 4IXTA 2Q28A 3I53A 4QBHA 1MRSA 2OBFA 2VK1A 4EB0A 4EB3A 4ZYXA 5T4EA 5JD4A 3TCKA 4EMBA 3N2KB 3VDQA 1IB6A 2YHAA 1BCRB 4YJHB 5BPHA 1DQNA 1NW4A 1SOAA 4I50A 4FK8A 4L5IA 1T6NA 2WJ4A 1COWD 2PO5A 5B37A 3UMFA 4DREA 2BGNA 2IHJA 3QYAA 1OFUA 2I2WA 4JGGA 4MNTA 4R0NA 1UKAA 5IEJA 4JOSA 4MVJP 4YNBA 1ZIYA 2PMFA 3E8XA 1YQDA 4EFKA 1NBOA 3FTNA 1V41E 4G4GA 1Z34A 5ESRA 3WMXA 3A0UA 4G24A 4AMBA 3GLFB 1LSSA 4RAOA 1RYZA 2ZE6A 5DBOA 5LA6A 5KTRA 5KTYA 1Z3CA 2EZ8A 5FO1A 1DE0A 4K9KA 3TRFA 3JQ9A 1RJGA 5ALPA 5EQTA 1THTA 1ULZA 3GQBB 3AVUA 4M1TA 1ONSA 5C34B 1MZPA 1VL8A 3BMNB 3E5HA 3WA6A 1YMUA 1DC6A 3HYTA 4MULA 2DQZA 3UQYS 3ZBQA 3F4KA 3URKA 5BOSA 2JJ1A 4JLUA 2CXOA 1EHIA 4P86A 4U2KA 1PGOA 1QYIA 2JLXA 3NHUA 3VPXA 2BKLA 1SUDA 2R6HA 2LCQA 4W5TA 3CLTC 4AKSA 4JYAB 1XWIA 1CJSA 3O75A 5EHIA 1RLTA 3FUWA 4LSGA 2NTEA 2C84A 4ENSA 1DPFA 4JYCA 1C9MA 4AZWA 1N1GA 2IZ5A 4E4RA 4EI7A 2A0FA 3O8RA 2WYHA 2ADOA 3H16A 3GZNB 4LE2A 1E6MA 1E8DA 2B4YA 3IV9A 4QPDA 2PD6A 4XD7A 1XZKA 2D8MA 1SWVA 1KK3A 2VTBB 1JQDA 2EG5A 2B6NA 1OIVA 2Z04A 3IP9A 3K09A 3SHFA 3SYTA 3WAJA 1GQOA 3O2SB 5LL6P 1MC4A 1Q16A 1NDUA 4E5VA 2XCUA 5AI9A 1QYCA 1XRJA 3SR4A 2JI4A 3U49A 1V5EA 4G97A 3K1AB 4DARA 2BTQA 1T5TA 3KBOA 2XUZA 4XB2A 2HHHB 5LP1A 1X7YB 3KB8A 1ODLA 4RDHA 2CKDA 4J0GA 5ALTA 3TQQA 2CCJA 3HGQA 4K26A 3P19A 2O8DB 3HHEA 3DAHA 5ALZA 1AKTA 3B9PA 1N0HA 4AWXA 1VYHA 2AJCA 4UFPA 2GBIA 2W43A 3HWSA 4MUYA 5BSUA 1E1MA 3HFSA 4H0NA 5DHFA 1R50A 4AF8A 1WBBA 1EHYA 4A6PA 4WKNA 5HQ3A 3IBSA 4JXKA 1BQ3A 1VSTA 3IEIA 4QDUA 2YYSA 2X42A 3H6HA 3ZE7A 2XA9A 4L8WB 5LZ8A 4G1VA 3SSAA 2RBEA 4QQFA 2I8AA 4EJ0A 2O8BA 2HD4A 1W36C 4PR3A 5F77A 3PQ8A 16PKA 1GTZA 1DBWA 1YASA 2PZLA 2YZKA 3T8YA 3ZUPA 1UWKA 2WC1A 3H65A 5JY1A 1MENA 1B6TA 2IYYA 3LY5A 2HJRA 5T41A 4BRZA 1N2EA 4CLOA 1ECFA 1O89A 2P2DA 3NP7A 4LDAA 1FP2A 3HH8A 2FW1A 4ZT3A 3ZU6A 4AVYA 2F1RA 4KTVE 5JXIA 2PN1A 4IP0A 3KT0A 1HTTA 3BE5A 4KGVA 5AM0A 5FWAA 5REQA 5E3HA 4BUJA 3A9UA 4QPNA 4YCDA 2OXCA 3WOVA 2JCBA 4EA6A 3E0XA 4RZ3A 3MS4A 1Z75A 4PVCA 4D57A 4LDRA 5EJ5A 1O7JA 3FSGA 1ORWA 1ABEA 4M98A 4XYBA 4PLFA 1EUCB 2Q62A 1Y81A 3NDIA 4UULA 2IOFA 4DNPA 3AJ9A 2Y6UA 3OCCA 2YMPA 3AOEC 3MMZA 2YWCA 4RIGA 4IZHA 4KQXA 5AHKA 3C3AA 3ZD7A 3MAJA 3C7KA 4Z99A 2WKRA 1QVWA 2YN4A 3CT6A 3EPRA 1VPDA 3MQFA 4OJNA 1YZVA 3KM0A 4M1ZA 5IDXA 3CKLA 3PGA1 2NZ2A 1UXKA 2GPJA 3FWHA 1RZ3A 4NEGA 3CWQA 1RAEA 5JO9A 4GYKA 3TLAA 3X2FA 3ZE0B 4E7OA 3I2GA 3QH4A 1SXJE 3U7IA 2DWCA 2OV1A 3EF3A 1N6LA 2OPBA 5EE3A 3L0PA 3WY9A 1NBAA 3PHGA 5FBRB 5JCJD 5D84A 3E4CA 3JASB 4EY8A 3AUXA 2VBGA 3BXFA 3VZSA 1U0GA 4BJ5A 4AN4A 2AW5A 1RQRA 3AVOA 4JC0A 4MHTA 4C0SA 3T6KA 3AXSA 5BQ3A 4I5FA 4YHBA 2G1AA 1Y6ZA 3L1JA 3E9QA 3QE4A 3WYEA 1Y7IA 2NGRA 2IBSA 3OQ6A 4I14A 1U8XX 1HDXA 3LPDA 4TYQA 4FW8A 4TMYA 3SG0A 1T3TA 3DYVA 4UD2A 3DV0A 3TZ6A 1IRXA 3EAQA 5KPDA 1SKQA 2J67A 2QUIA 2ZYUX 1BW9B 1CS0B 1UMCB 3O5AA 5F1PA 3LOQA 4AUEA 4RTRA 4DMRA 5AJUA 3UHPA 4Q9IA 3IT0A 1K4YA 3X1XA 5KNLA 5LMUB 3RASA 3KKNA 2OBNA 2PGOA 2VXBA 2HSEA 1TTHA 4LQLA 2PBLA 2QTRA 1LDMA 2J9RA 2ZYWX 3EG9A 1UJBA 1MC5A 3IVMA 2XZLA 2JZNA 3BIOA 3NI2A 4EX7A 5L6MB 1T3SA 4EHNA 5IXSA 2UZIR 3RADC 2BTOA 2EKPA 1TCAA 1F3OA 1BX1A 2NQ8A 5DYYA 2C58A 3SD7A 4PPQA 4A0SA 3WDSA 1CUVA 1A7JA 3IUJA 13PKA 4OREX 3SKYA 4RPIA 3ZDXB 4EG7A 2ZTHA 4NY1A 4DTIA 3Q3CA 1WDKA 2ZKLA 3ND9A 5TQJA 2WQ6A 2XBLA 3RREA 1J90A 5J2UA 1EQ2A 1FE8A 1GTL1 2B8JA 3PHHA 2YRWA 1J23A 1YUNA 2CFTA 2OXTA 5CDTA 2J3IA 1U65A 3PQ6A 3O82A 5SZIA 4ANFA 1W9MA 2RHMA 1RYNA 3FSEA 3BB4A 1RKQA 4KKVA 2RBKA 1M83A 2H4ZA 1MEJA 2CB9A 2F3SA 3OA0A 2I2FA 4EKGA 2CEKA 2R7AA 4UMEA 1ZLXA 2BKUA 4H0FA 4JGBA 2NYAA 2FSFA 4RD4A 3T7KA 2VHTA 4P7BA 1E2MA 4KLNA 3TTUA 3W6UA 2RE8A 3IKJA 2EU8A 4QE3A 5CJPA 1CUXA 1Q1NA 3LKZA 3H19A 5G53C 2C3UA 1GPUA 1WV0A 2WMDA 3BD8A 1JXOA 1C3OA 2X6TA 2FX2A 2FRDC 2E5WA 1I10A 3QJYA 4JOBA 4RDIA 2HTFA 3O1IC 4X8HA 2IS6A 4UCQA 3VKVA 4B9EA 3D31A 1UINA 2C95A 2IP1A 4Q02A 4ZVMA 1DO0A 1NZJA 3LJKA 1D6JA 1M1YB 1P2UA 1W29A 2L18A 3MCVA 5AM2A 3I0NA 3ED1A 1S4MA 1NBME 3RVRA 4EY5A 1VLQA 1ZNQO 2AX4A 2F3UA 2W2QA 3OQOA 4LF5B 1I01A 5BXQC 1QJCA 2G8LA 1MT3A 1OGIA 2NO1A 3HM2A 2AN5A 3G68A 1P8JA 1XU9A 4RK7A 1JPVA 1X7ZB 2GJ9A 4IDPA 3WIVA 4BMPB 4CE6A 1G38A 1UDWA 1H6CA 3I30X 4BMNA 3FLEA 1UAGA 3FTPA 4QYIB 3D3KA 3L7LA 3WNVA 3HBNA 4FVTA 1V96A 3QBVA 4L7QA 4ML3A