4LDJA

Crystal structure of a gdp-bound g12c oncogenic mutant of human gtpase kras
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
170
structure length
170
Chain Sequence
GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In situ selectivity profiling and crystal structure of SML-8-73-1, an active site inhibitor of oncogenic K-Ras G12C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords GTPase KRas
total genus 62
structure length 170
sequence length 170
ec nomenclature
pdb deposition date 2013-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ldjA00
3DOFA 3KQLA 4A92A 1CRPA 5IK2A 4M9XA 2ZRHA 3IEUA 2YWFA 4DRZA 4KFSA 2F3TA 1EX6A 3SI7A 3W5JA 1YRBA 3VHXA 4MGIR 5GJWC 3A6PC 2IBMA 5K8UA 5KSPA 3QVUA 1RYFA 5CDFA 5UKDA 1E2PA 3VFDA 1Q22A 1HT2E 4NONA 3BB3A 2BIFA 2GAOA 3KJGA 3VKHA 1CF4A 2ZJ5A 1CJVC 3VU9A 2FFBA 1JJVA 2BWJA 2GDJA 5CM9C 1T0JB 4ILEA 1OXUA 1Z6TA 2FPLA 3RSLA 5KUTA 4B71A 2XSZA 4OQMA 3SS8A 1NNEA 3SFVA 4I1VA 4JBYA 2XB2A 3E70C 5H70A 3GD7A 3QPWA 4P31A 2V7QA 3A58B 4LYJA 5CITA 2GBLC 4G5SA 1ZM2A 4G5GA 4OL0A 2GXUA 4BEJA 1NIJA 2IYWA 4NBSA 4L4UA 2QMOA 4D0GA 3CB4A 3KFXA 4XWOA 3FMPB 4M1KA 2O5VA 1OH7A 1EWRA 2KB0A 1OJLA 1W36C 1D2EA 1KI7A 3CRW1 1Z2CA 4QHYA 4JVLA 1AQUA 1UM8A 2C95A 1R2QA 2VO1A 3AVOA 3I8SA 4CGZA 3FHCB 3U5ZB 2EQBA 1PZNA 4DUGD 1E9EA 3GLIA 3R7WB 2YWGA 1NVVR 3DDCA 5FBLB 2GEDA 4N0DA 4E22A 1P5ZB 2QENA 5BW8A 3CW2A 3HU3A 5DE3A 1KYIA 3NC1C 1CXZA 4BLRA 4AKHA 3U3JA 1UKEA 5JHGB 3V4RA 1KY3A 3KB2A 3MFYA 721PA 4ZCMA 4Q7JB 2JATA 4NU0A 2FSGA 3U7FB 4JVNA 5ELXA 1SVKA 4GZLA 1XU4A 3ONWA 1ZU5A 3O8RA 3ADBA 1IN8A 1YHNA 1FNNA 3Q5EA 2ZIAA 4TLAA 1OB2A 4ZIRB 2G88A 3KJEA 5DIFA 4DLXA 2PX3A 3NXSA 2VF8A 2ZRMA 3AKEA 3W8RA 2HYDA 2V1XA 2XTZA 4Q48A 4UJ5A 2ZU6A 4EPVA 4HDOB 1KI6A 2OM2A 2XXAA 4PO1A 3WNCA 1P3JA 4JLVA 1KO7A 2DY1A 2WPDD 4ACBA 3K0AA 1DADA 1YZGA 2KWIA 4OK3A 4ZCLA 1BH2A 3OIWA 3THOA 3GLGE 1KSFX 5HZHA 1HTWA 3RDPA 1GNRA 5F98A 2YKGA 2BCGY 3C7KA 4HDQB 2J9RA 1E1RD 2FG5A 2OG2A 3NHBA 2P6RA 1OB5A 3BOSA 4MDFA 4Y0VA 3E5HA 3PUWA 1KOFA 4QJ5A 2IF2A 1VPLA 3PCRB 1F48A 1II8B 4F38A 2P67A 2XJ4A 1PUJA 2JJ2D 4AK9A 3X1ZA 3ASZA 2R9VA 2FPKA 1WXQA 2DHRA 2A2ZA 2H57A 1XTIA 2FSHA 1KO5A 4HUQB 1IAQA 2QA5A 4QGGA 5AUPB 4RZ2A 4E5UA 1A5TA 4BLQA 1X8JA 4NYMQ 5KSOA 2IEYA 2IXGA 4EKDA 1OXXK 4JS0A 5FI0B 2QTFA 2RKOA 2XNDD 5HKKD 4QGAA 4OQFA 1TTTA 2O8BA 3VX4A 1KI3A 1II8A 2HJGA 1NP6A 2QMEA 5J4KA 5M04A 1IN5A 4IRUB 4TL6A 4F91B 2GCPA 4OYHA 3LY5A 3H2YA 3C15C 2V55B 2GK7A 4TMXA 3FE2A 1GILA 1QF9A 2GEVA 1S0UA 4QFMA 5C4MA 4RSGA 5FR1A 1EFCA 5FUVA 1G6OA 3TMKA 5C1BA 4BFXA 521PA 2TMKA 2WJGA 4NH0A 1NBMD 3A1VA 3U3KA 4D6PA 4HZUB 4GZMA 3TW8B 1IN4A 3QIAA 2KBFA 4YXWD 2BVNA 1OYWA 4MUBA 1OE0A 1SVLA 4BEBA 4URVR 2UZIR 2RAPA 3TSOA 4PPGA 1FW6A 2R62A 3CX6A 5KNCA 3IHLA 1QHIA 1QZXA 1VHTA 1KO8A 2C9CA 3CH5A 4FIDA 1IHUA 1U99A 2XJ9A 3KQUA 2IC5A 4RVCA 3EPLA 3GFOA 3PVSA 3ADCA 1T5LA 4C0BA 3UWKA 1VYUA 2Q9CA 2QGZA 1WCV1 4Q7KA 1KJZA 1DG1G 1RRPA 4LRWA 2GJAA 2RGDA 4O2LA 1H8ED 4TQUS 4WBSA 3GLIB 3KKQA 5HZKA 4TLCA 3GFTA 5L8VA 3OEED 3CKLA 2IXEA 5CIWA 1II0A 1CU1A 3FHOA 4XJXA 2LCFA 1WE2A 2D2FA 4MUAA 1G3QA 1NL3A 4U02A 5CLQA 1YKSA 2CBZA 1KHTA 1BO6A 2R6FA 2WWFA 4QG7A 4EIWA 3A1TA 1GWNA 3NG1A 4N3NA 2NPIA 2QE7D 1F3OA 4FMBB 3EARA 1BOFA 1FFHA 1R0XA 4NKRA 1JQJC 2EFGA 2CEAA 3T1VA 3VR2A 4EPTA 5A5GA 3U6KA 2ZJBA 1I4TD 1W36D 1TUIA 4BPBA 2EW1A 2EVWX 1Q21A 4NYIQ 5EQTA 5SZJA 3SN6A 5KNDA 3BE4A 4ZO4A 1H65A 1UKZA 4DCVA 2CJWB 4A2QA 2CLCX 1MH1A 3EC2A 4DB4A 2OBLA 2QUZA 4M1OA 4HI0E 4ZDIA 5BN5A 1D6JA 1SKQA 3TSWA 4D2IA 3CM0A 1FUUA 5HCIA 4A8JC 2HDNB 3SQXA 5IT5A 1E98A 3CWZA 4CIDA 4KSBA 4I4LA 4QBGB 2ZITA 1JAHA 3ZS9A 4O25A 2F7SA 1SULA 1JEDA 1JNYA 3GEHA 2WBLC 4EPRA 2ORWA 4Q7MB 3LX5A 1JI0A 2YWHA 2Z5FA 2ZSEA 1KK3A 2SHKA 3Q5DA 4BE7B 2W00A 3TJZA 1GZSA 3RHFA 4HLUC 4TYNA 1Z0KA 1XD8A 2MSCB 3SYNA 2CVFA 2JDID 4I1SA 2P65A 5CB6A 2VSXA 1E4YA 1UDXA 4QHSA 1YR8A 5EXXA 4IW3B 3ZIAD 3H86A 3MJRA 4MKFA 3X1YA 3B13B 4FMCB 2QM8A 3LRPA 4YMSA 4MRPA 1DELA 3NKVA 3SHFA 3CZPA 3P26A 2ZRLA 3AF2A 4GT1A 4MGZR 4HB3A 3ZQ6A 1N5KA 5DO9A 3QKTA 1T9HA 1E99A 1DBSA 4DIDA 2GCNA 2PMKA 2R6CA 2IYTA 3K9GA 4US2R 2ZJZA 3AB3A 2FF7A 2JLRA 3KUCA 2ZJYA 3MUFA 5EE9A 1LF5A 4F4IA 3SJCA 2JLXA 1FUKA 4IOLA 5J40A 1E1QA 4GOXA 5JWHA 3LD9A 4OHVA 2JCSA 3NWJA 4II7A 3FOZA 4BFVA 2C8VA 3B1XA 1M2OB 4HLCA 3UMSA 5BXQC 2NZ8A 5GJBA 2A5DA 4C7OA 2FZLA 1KNQA 1N5LA 1XTQA 3LLMA 2NPFA 4FMCF 1KI1A 1Z6YA 2I4IA 2HLDA 2IK8A 3LFUA 1TL7C 1ZM9A 1NVVQ 2IYQA 4LJ9A 2V6JA 4XTCS 2J7KA 3WBKA 4JLPA 1N5JA 3QKSB 3LWNA 3QQ5A 5JZVA 1OXVA 1OXTA 3TAHA 2GZHA 1EXMA 1ZUNB 4PHFA 3CF6R 1KZGB 1RJ9A 3MGCA 1XTKA 2IYUA 1IQPA 3QEJA 4URYR 4ABYA 4ASUA 2PEYA 2V3CC 1K8RA 4GOJA 5CIQA 4HB2A 1OT3A 1QRAA 2HT6A 4MYTA 4EJSB 2I1VB 3I1FA 3N70A 1MO5A 1VHLA 2GVZC 3OE7A 4RD6A 2H1LA 2WZQA 5JCZA 4EJSC 1N6OA 4G5RA 4MGYR 1TF7A 4MKGA 4TMVA 4XVQA 4ERNA 4TTQA 4YMTA 3ZDQA 1FQJA 3THYA 4TYWA 1OYYA 2VBCA 3LAWA 3SBDA 2H16A 1RVDA 3GEIA 2DPXA 2R65A 4GI7A 1KJWA 4IDPA 4B75A 1IY2A 5HTKA 2VHQA 2BV3A 3G5UA 1E32A 2G77B 4OK5A 2A30A 3BC1A 3HJNA 2D06A 4CT4B 1P7CA 3DZDA 4KU4A 1HQYE 2K5UA 1KDTA 1R0YA 4G5OA 4D4MA 1DO2A 1OH8A 3NDBB 2VHUA 2WOJA 2BEJA 2WIBA 4IDQA 2VL7A 4QRHA 1A7JA 3RAPR 4MRRA 1E0JA 4B74A 3BWDD 1G19A 1N0VC 1SVWA 4D0NA 2GTPA 1G3MA 2JLQA 4M1WA 4XH9B 3IEVA 1T91A 3L0IB 2HCBA 4OJQA 2FGKA 1WRBA 4XTRA 2YZ2A 2HXYA 3K0AB 3OEEA 3VR4A 2D62A 1KI9A 2VHTA 4BRUA 3OIYA 4TSFD 3WBJA 4URUR 1FTSA 1NN5A 1Z28A 5HCNA 2CK3A 5H1YA 4Z8XA 4PAQA 2ZROA 3TR0A 4EPYA 2G1JA 4CRWB 1CKEA 3CX8A 1BYUA 3NH6A 3EW9A 4Q4JA 1FL9A 4DKXA 5TB5A 4NYMR 1DAFA 1Z22A 3QXXA 4V0OA 2C78A 4Q7LA 1I4DD 1JQLB 4UXJA 5EE5B 2QP3A 5DHAA 3VNVA 4D25A 4MKIA 2O8DB 4URXR 3HPRA 1R8SA 4HAVA 5FOTA 4UJ3A 2HEIA 2GZDA 5JRJA 3OFNA 2WSSD 3NEJA 5KDDA 4IFEA 2GJ8A 2JEOA 2ZI9A 4JLNA 3B85A 1KKLA 2X2FA 2C5LA 2OCBA 1KI6B 2XXAB 4IHQA 1NLYA 5CK5A 3K53A 2ZRCA 1DVRA 2ZTSA 4GL2A 4Q9KA 2P6NA 1VG1A 1LFDB 2WJVA 2WWGA 1KGDA 1MO3A 1NLFA 1SXJC 1AZSC 4LV5B 3UIEA 5H68A 1ZNZA 1S9HA 1UEIA 3W8NA 2CMKA 2V8OA 2WJHA 1AIPA 5FPHA 4A9AA 2PMDA 4TMWA 3M6AA 4PQYA 3F5FA 2NO1A 4Q66C 1AS2A 2JLSA 2J46A 3EIQA 3EPJA 1PVOA 1VMAA 4IOMA 4TMKA 1AJEA 1DAHA 2WHXA 3K70B 2JLYA 1WP9A 3DOEA 2HV8A 5EXSA 2WAXA 4CEHA 1GL9B 1M6NA 2YC4C 2KJQA 3B1WA 4LBVA 5HR5A 4LPSA 4F4JA 2W2VA 1YR7A 3NHAA 1XXHE 4JLOA 2WJYA 2X77A 4POAA 1C4OA 5IRCD 1ANKA 2IX3A 2HJVA 2JGNA 3KL4A 4PO8A 1ZD1A 3MJHA 2BKEA 1IBRA 4WXPA 1W4BA 2CCGA 3PIRA 3FKSA 3QKRA 4KFUA 1F2UB 4MH0R 2ZSBA 4TMTA 1PUIA 2OFOA 5TY0A 2BEKA 2GJSA 4B2IA 5J47A 2CNWD 1IOZA 1E79D 3SE0A 4IKEA 3WP0A 3GLGA 4CEJA 2FNAA 1E2GA 3M1IA 1IONA 1DAIA 1VKJA 1W0KD 4M22A 5AJXA 3EC1A 1Q44A 1TF2A 3LBHA 1CULC 2F6RA 2J3EA 1HY3A 1CR0A 2QTHA 4OHWA 1JR3E 1E1QD 1J8YF 4RY2A 2GA8A 1HEIA 4M9SA 3PV0A 2BC9A 4OQLA 3CPJB 4M8NE 2HYIC 4IVQA 5TVKA 4DLYA 1XD2B 2C9YA 1IJFA 1FZQA 2O8FA 2EFDB 2HLDD 2Z4SA 3W6NA 1ZNYA 1KMQA 5LBIA 5CYPA 3D8BA 1N6KA 3BH0A 3ZH9B 2R6GA 5L3SA 1NVUQ 2EFEB 2QMUA 1X6VA 1V5WA 5SZIA 1MABB 4R98A 4Q9JA 2A7QA 1KZ7B 2ERXA 4E07A 2DFKB 3A1SA 3GQBA 3T1TA 2DCUA 2J45A 2YOHA 2O8CA 2RGNC 4AKEA 2J0SA 3OZXA 4ASUD 4D4JA 1GL6A 3JVVA 2ZJOA 4DLTA 2O8FB 1S8FA 3F0TA 2P5TB 4OHXA 1E2EA 1GUAA 2ODWA 2G83A 1JPJA 4Q1DA 5A4JA 1P4SA 4C30A 5KYKA 1UKYA 3C16C 4DZZA 1KI2A 3SJZA 4CEJB 1VYTA 1U9IC 4DSUA 5L3QA 1P9NA 1YR6A 1QG4A 1LS1A 1US8B 2QAGA 3VR5A 5B64A 2CHQA 3LVQE 5DHFA 5FUYA 2O8DA 5IK2D 1U8ZA 3RRYA 2OV2A 1GRRA 1ZM3A 2ANCA 4WZBE 1OFIA 4TYYA 4DDVA 4GOKA 3A4NA 3LH5A 5E95A 1KK1A 2QAJA 4DLSA 5HE9A 1KMHA 3CR7A 2QRNA 3AF0A 3MCAA 1BKDR 4PPFA 2GWHA 3NVAA 5EUQB 4BRWA 1XDBA 3EX7C 1ZC4A 4DCTA 3U3MA 2NQ2C 1N6RA 5DI3A 3EZFA 4LBZA 2JLUA 1G5TA 3GP8A 2WJJA 4QBFA 1ZIPA 2VYFA 3C5HA 4C2TA 1U0JA 3N2EA 1ZCAA 2LWIA 1ZD9A 3I4LA 3Q8XB 4TL7A 1Z63A 4DVGA 3FTQA 1GKUB 2O8CB 3GCGA 1T6NA 3I92A 1N0WA 5KOYA 2WMNB 2XZOA 1COWD 5ANRB 3I8XA 3PEWA 2FSIA 1WB9A 5K8LA 1TMKA 4HLDA 1XP8A 3KTAB 1RC8A 1WBDA 2GRJA 2WWIA 2XEXA 4Q01A 5B2ZA 4B3CA 2VPPA 3MSXA 4AIIA 1S3GA 1QHHA 2N1BA 3P27A 4AYXA 4RFSA 1G17A 1OW3B 3PXGA 2ZXUA 2GBLA 3OFND 3VKWA 4XVUA 1R0ZA 2GILA 4LJ4A 1HE8B 5KPJA 1NKSA 4PPNA 2KE5A 1MRNA 3ZZ0A 2ZRIA 2DR3A 2GNOA 2VHJA 4P4SA 3I3SR 4LY6A 1TU4A 1NLZA 1NN1A 4M9ZA 2ODEA 2IS6A 3SOPA 1YZNA 4KYIB 3ND8A 4A8JA 3PUXA 4NTZA 4Q1BA 4EFNA 4B32A 1N6PA 1XMVA 3C41J 5JJKA 4HAXA 1QVAA 3B7GA 4RCYA 5EE1A 2UZ3A 3B6EA 3EZ7A 1K5DA 1NI3A 1EFRD 4JJZA 5FTJA 2QNRA 3SJBA 5AWFC 821PA 4U7DA 1NN3A 1DPFA 3AP1A 2BM1A 3RS3A 4M2LA 4ACAA 2VA8A 3SJAA 4KO8A 3REFA 4BFYA 3W9YA 4AG6A 3HR7A 4JKIA 3L43A 4M53A 2O8EA 3MWLA 1DG3A 4X8OA 1UADA 1KSGA 1T8TA 3TVDA 2CCJA 3K09C 2W0MA 3TUIC 2OO7A 3F8TA 2ORVA 3DMNA 2ZSAA 1J70A 4LUCA 2N42A 2AN9A 4LBYA 3B8HA 4CYMA 1U2RA 1OSNA 4GNKA 3NBZC 4MRVA 1E79A 4FCTA 4A0GA 1I2DA 2GXQA 3VR6A 5E3HA 1W0KA 2CLSA 4B2PA 1OHHA 2YOGA 4QBIA 3RYTC 2ZSDA 3EIHA 2IS4A 3D3QA 4ARZB 1JR3D 2HUPA 3EG5A 4NCKA 1E9AA 3AVVA 2IHBA 3A1WA 2OXCA 3DVLA 3Q3JB 4B3BA 5BN4A 2AR7A 3D7MA 4OHZA 4P4UA 2Z0MA 1IXRC 4R2HA 3AKCA 2J0QA 2C96A 1LV7A 1E96A 2REOA 1HQCA 2DWPA 3IKJA 4OI4A 5JLJA 2ZI5A 4DLVA 221PA 3CF0A 1G7CA 3VQTA 2IEZA 3FWYA 5FL3A 1CEEA 1Z6GA 1SVSA 3EA5A 3Q72A 1XEXB 1W0JA 3IO3A 4C0AC 1I2MA 2CVHA 2PCJA 2W6JA 1JBKA 2XNDA 1VG0B 1XPOA 2E87A 1MT0A 1TQDA 1E4VA 4HUTA 3ADKA 4JYBA 5CM8B 3HYRA 3SBEA 1XJCA 4D80A 4UNPA 2V7QD 2XNSA 1OIVA 5JBQA 1Z2AA 5FTMA 2WM9B 2OT3B 1ZNWA 4XSHA 4NPHA 2QY9A 1AKYA 4HZUA 4NYJQ 4G0NA 2FFHA 4RZXA 4QGHA 1F5NA 1CRQA 1TNDA 3VMFA 5C4GB 4DLWA 1CJTC 4KYUA 3LDAA 3PUYA 5KDLA 1QHNA 1OIWA 1Z6AA 3H4MA 4YXWA 3KB1A 4FWIB 1G16A 3PEVA 2G0TA 4Q1AA 4B35A 3IUYA 2HXSA 1KSJA 1E9RA 4JVMA 4A2WA 3IPYA 5FOVA 4EUNA 3U60B 3SDZA 2ZRPA 2ANBA 5EXPA 3U7GA 2D3WA 3EWAA 1NBME 1TU3A 2XAUA 4RJLA 3UATA 3AH8A 3L82B 1HURA 2F3RA 1H8EA 1EG7A 1QBKC 1R10A 3SYLA 1P72A 3QI2A 1GAJA 1E2JA 3UMFA 4A1FA 1DEKA 1E9FA 2AK3A 2WV9A 3NBFA 1L7VC 4IEEA 4KFTA 2VEDA 4FINA 2RCNA 4LYHA 3TQFA 1M34E 5G3YA 2OZEA 8OHMA 3T35A 1AQYA 1XCMA 1Q3TA 2ZAMA 3SC3A 5FUXA 3RS4A 3B9PA 3RWOA 3HPQA 2GXAA 1GRQA 2QE7A 5HPYB 2JLWA 1RJ9B 4HZIA 5FL7D 2O8BB 4B48A 4YONB 4JLBA 1Z47A 1O87A 4ON9A 2ATVA 2CL0X 4BECA 2V54A 1FX0A 2WICA 3SEAA 4FXPA 2WPDA 5F9FA 1UEJA 1OPXA 2VF7A 5BYKA 4OHYA 2XTNA 5C46F 4ZV4A 1BMFA 2KI5A 1YVDA 3NC0C 3WRXC 1E1RA 3I32A 2BCJQ 3X1DA 1EK0A 2W58A 2YC2C 4DCUA 2PLFA 5LB2A 5TMPA 2V1UA 1QHSA 2B7BA 5E7JA 5DI3B 5EZ6B 4LHWA 2ZVPX 1E2LA 1G8GA 5DGXA 5K8TA 1ZBDA 2PZFA 1G7SA 1T8UA 3EIEA 2ORIA 5HE8A 2RGXA 3TH5A 5JJLA 1KAOA 2WIAA 3SZRA 1R5OA 1JEEA 2FGJA 1CP2A 4LJ5A 1D9ZA 1W5SA 5KSZA 4IXMA 1Q20A 4Q00A 1LY1A 1T4GA 2QPTA 4GDFA 1SZPA 2BBTA 3ZVLA 1E9BA 1A2KC 2Q9BA 1RRCA 2X2EA 4PSAA 4JLKA 2LKDA 4CW7A 1NRJB 3IBGA 4IVRA 1KMHB 4AI6A 3DPUA 1SQ5A 4ZDWA 1GFIA 3ZVNA 2ZETA 1D9XA 4DCSA 3QVVA 2XB4A 2X19A 3KJIA 1RPZA 4G3XA 1FTNA 3H0KA 3EZ6A 5AJYA 3FDIA 1E9DA 1NMZA 1NBMA 1VCMA 1ZU4A 4LV6A 3TAUA 1AA9A 1E2MA 2BMDA 2XGJA 3TRFA 2OILA 3TSZA 3AEZA 3AF1A 4P4SB 1S96A 4Q47A 4G01B 2J0UA 4QNMA 2GEUA 2IT1A 2FX3A 3BGWA 4OK6A 4QGFA 1EWQA 3K8YA 1JAIA 3IDQA 4DSOA 4FWTA 4Q03A 2EWVA 3F3YA 4N0EA 2Q9AA 2FU5C 5CDFE 4EQ6A 1RZ3A 1YJ5A 2B92A 1JALA 2NO6A 4NE2A 3MWYW 2CLDX 121PA 1KY2A 1G1MA 5KO2A 3AUXA 3DKVA 3V4FA 2B21A 2H8KA 1XBTA 3EA0A 5FBVB 1ETUA 3SHWA 4Q9LA 5JFGA 2PBRA 1FPMA 1KNXA 4E09A 3K9LA 4EQ6B 2ZS8A 4CEHB 3TK1A 2FFAA 2Z4RA 3WMGA 2WKRA 4PZLA 1TF5A 1RKBA 3GEEA 1E9SA 3BD9A 1DTSA 3RWMB 2W2TA 1Z0DA 3KXKA 4LJYA 1EFTA 2XX3A 1OH6A 4BZQA 4HLQB 2QP9X 4CZ2A 3IQWA 2QMHA 5DN6D 2D74A 3KKNA 3LQRA 3RABA 1CR4A 3GLHA 2X8AA 1D2NA 4YC7A 3R8CA 3EAQA 3VNUA 2P6UA 3P4YA 1BIFA 3G82C 2ZREA 1V43A 5DYIA 1AS3A 2IXFA 4BZXA 3ZD7A 1W5TA 1NKTA 3MLEA 3GJXC 3KXLA 3VKGA 1ZVQA 4A0FA 4DDTA 1P61B 3AQ4A 4DLRA 2QTVB 2ZE8A 3QEOA 3B1VA 4PX9A 4UQOA 4B3FX 4HB0A 4QM7A 5GADl 4XD7A 2LKCA 2R6AA 3VR1A 4HLUA 3ZLJA 3AVPA 1ODFA 2WVJA 3K70D 2D2EA 2FJUA 2MMGA 1BYIA 4OI1A 2IYXA 1NJGA 1W4RA 2VLIA 4WXRA 1W49A 1PLLA 2JDIA 3AUYA 4JKYA 1T0HB 1U8YA 3DM5A 1G5PA 3CO5A 1M7GA 1XMJA 4B33A 2FEOA 2ZJ2A 3KXIA 3ZIAA 4XVRA 5FL7A 1HV8A 2IA5A 1W36B 3J81k 4D82A 1FP6A 1CTQA 4KBFA 5D3MA 3KQNA 4PHTA 1R8QA 2ZI4A 4YDSA 3W90A 5JJIA 1NG9A 1KI8A 5JWRA 3LLUA 1KDRA 3U6BA 4D26A 3ASYA 3GPLA 1II9A 4PFSA 2BOVA 1ZP6A 4L5BA 1UBGA 3X1WA 4A8JB 1QG2A 2D7CA 1P9RA 5LPNA 3HR8A 4LOAA 4DUGA 2ZS9A 1VECA 3RLFA 2B8TA 1P2TA 4HUQA 4FN5A 3PQCA 3OIVA 2NO7A 2GETA 2QM7A 4GPTA 1Z06A 4MITA 1DAEA 1NF3A 4HAUA 1E2FA 3TKLA 3B2EA 4UKDA 3IIMA 1TEVA 1KDPA 4QJ4A 1E2NA 3NBYC 4DIEA 5E7IA 2JASA 3UG7A 1W7AA 3THXB 2PT5A 4JL8A 5KDOA 4QOSA 4BFUA 3OIUA 4GFDA 2QBYA 1JXMA 3EWSA 3L0OA 2VIIA 4LWZA 1TEXA 3PJRA 2DYKA 1XFAA 3K0CC 4NYJR 3QF7A 3CNOA 1RRFA 1NVWQ 3AGQA 1KI4A 5JRZA 2ASEA 5FBQB 3AM1A 1M74A 4NHOA 5JMTA 3OF5A 4W5HA 3RC8A 2W83A 3V9PA 2PEZA 1TUEA 1QHGA 2QBYB 1G291 4B43A 4AD8A 1U8AA 4KVGA 4ZKDA 4DDWA 2PCLA 3T34A 4V0MA 2ZUBA 4JYCA 4AKGA 3JVUA 4D0LB 2BMEA 4EJSA 3K0SA 3R8FA 4ESVA 1P73A 1Z0FA 1IJEA 1A82A 3ICEA 4B6EA 4QJ3A 4PC2A 4HAWA 4LHVA 5EE0A 3CRQA 4TT3D 1S9DA 3QXCA 4XOIA 3QE0A 2ECKA 1TPZA 4TZ6A 5GVRA 2C98A 2C04A 4I1UA 1FX0B 1GTVA 2EU8A 3QG5A 3VTKA 3CX7A 4F7WA 2QEQA 3QXSA 2AFIE 1Q12A 4QNRA 3L8YA 2RGBA 4B44A 2XSZD 5BWMA 2RHDA 5JSZA 4NCNA 1DS6A 2OCYC 1CIPA 1KDOA 2DFNA 1K6MA 1GITA 4ZI2A 1YRAA 4J0QA 1R7RA 1W2HA 1D8TA 2WWXA 4JBWA 2D4HA 3BFVA 2HF8A 4E03A 4Y0AA 1NMXA 2R44A 4EPWA 3AF4A 1Q3HA 2WWWA 5L3RA 1DAGA 4OJKA 2J87A 3JZAA 4MGKR 5DN6A 1G6HA 1PJRA 1SKYB 5JS8A 1FMLA 3BB1A 4ZIRA 3ZD6A 621PA 2R2AA 3IBYA 2BDTA 2Z6VA 3GJ6A 2GAAA 2WKQA 1UF9A 2A78A 1OH5A 2BBOA 4WW0A 3DL0A 3WMEA 2RHMA 2A5JA 1BS1A 3CBQA 1P2SA 3CNLA 3HU1A 2BM0A 1K5GA 1NY5A 4JIMA 2VP0A 1L4YA 4TWZA 1X1RA 1YZKA 5AUOB 3K70C 3SQWA 6Q21A 5FOUA 4CEIA 3KZ1E 4JSYA 4OKSA 1AGPA 2AWNA 3O8DA 1GNPA 4B3GA 1GG2A 1W48A 3QXHA 2Q21A 3C4JA 3IILA 3D31A 4C0KA 3BXZA 4ZI3A 3U4QA 2DB3A 3UKDA 2ZRKA 4YDHB 4NCJA 1SXJA 4JL6A 1XWIA 5TV2A 3QKRB 4MYUA 2NIPA 5KTYA 1HYQA 5GJCA 2Q3FA 4FCWA 4B2LA 2QT0A 5G53C 4EPXA 3GLFE 1XZQA 1Z83A 2JJ1A 4LCBA 3R20A 4U00A 3W34A 3BJIC 3NBXX 2VHCA 4C0JA 1EX7A 4RFSB 2CHGA 1X1SA 5LDDC 5AJZA 2IWHA 3PITA 4RD0A 4L9WA 4D4KA 3FKSD 5FTKA 2X1VA 2ZU0C 1G4AE 2FPMA 3AGPA 3ZGXA 4P3YA 2GF9A 1F6BA 1N5IA 4LV8B 2IYLD 2CL6X 2ZYTX 1MO6A 5J4HA 2GVDC 2R6DA 2XZLA 4DWJA 3K0EA 3T61A 4HAYA 4D4LA 4PHHA 1N2CE 5H8WA 4KCGA 1R4AA 2XITA 3NIBA 1R0WA 1W4AA 3OEHD 4GSYA 3O8CA 4QXAA 2QQEA 4US0R 4XIGS 2Y8EA 1F2UA 4GMXA 4B47A 5JECA 2ZR9A 3I5XA 3PENA 3AP3A 4V02A 2EWWA 2P2LA 4RKFA 3PG5A 1EFRA 3MMPA 3U4QB 1KIMA 3NDPA 1NIPA 2WAYA 1N6HA 2OCAA 4BGDA 1GSIA 2VH5R 1IN6A 5BQ5A 3DHWC 3Q85A 4FW9A 3RS0A 2FV8A 1CJKC 3FFAA 1XTRA 1FMJA 1EESA 1QHXA 1OF1A 2WJIA 4PXAA 2ODBA 3ZJYA 2RMKA 1N3BA 2ZYUX 1GKYA 1Q57A 3EASA 4DLUA 1E2IA 1FNMA 1Z0JA 421PA 4P4TA 4HEJA 1Z0IA 4UXIA 2IYVA 2ONJA 3K09A 3SYKA 1VG8A 4B34A 2ZRFA 1E2DA 3BH7A 5L3SB 3IPXA 1XEWX 5FTNA 3UWOA 2J0VA 4K81B 2QL6A 1ZYUA 4JLAA 2OBNA 1YZUA 1YZLA 2IHYA 4AURA 1YQTA 3QKUA 4ZDJA 4P32A 4Z8YA 1CLUA 3L0PA 4MDEA 2FEMA 2YOFA 2JIZA 1W46A 3RVBA 2CE2X 3ZYCA 4CF7A 5J4VA 5L3VA 1ELOA 1DAMA 4H1VA 3RC3A 1SXJE 3TUZC 3GJ8A 3U2QA 3ZVMA 2QGNA 3N2IA 2OXRA 3BRWD 4ZDKA 3G0HA 2VP6A 1VTKA 2AKAB 4LX0A 2B7CA 4LHYA 1M1YE 4B3XA 4LPKA 1YU9A 2HCJB 1UKVY 4Q5IA 3PR1A 1US8A 4JSTA 5CJPA 2ZRAA 4A2PA 4JZKA 4LK2A 1CJMA 3Q7PA 3ECCA 3BERA 3LQQA 1X8LA 4R71A 2YNMA 2ZJAA 4RD3A 3CR8A 4TQAA 4M1TA 3ADDA 1JJ7A 4KFRA 1J7KA 4A0RA 4D81A 2IUTA 3I5YA 2I1QA 5EP2A 2VSOA 3DEFA 2A3RA 3FB4A 4OBEA 1B23P 1H8HA 4AG5A 1COWA 2EFHB 5AR1A 3LBIA 1CBUA 2AL7A 4LHZA 1ZCBA 3LW8A 3RRZA 2MMCA 1W2GA 3QF4A 2IW3A 3MWJA 3ZS8A 4QC2A 2ZRJA 4BFZA 2O8EB 1QDEA 3B5JA 2GHIA 1Z3IX 3DZ8A 3A1UA 3S1AA 1E9CA 5DH9A 4UNQA 3EXAA 3A37A 5G41A 4PQFA 4Q21A 1B0UA 3CZQA 4WZ6A 1RFLA 5JWOA 1XTSA 2PX0A 2OAP1 3GLHE 4S2EA 2VP2A 2PZGA 4MYHA 1Z5ZA 3BH6A 4PZZA 3PUZA 3QXJA 2E9SA 3LVRE 2ZE7A 1Z07A 2P5SA 1G3UA 1NVXQ 3OESA 3VR3A 2FZ4A 4HB4A 1XRJA 4FCVA 2YJTD 2OHFA 5G40A 1QHHB 4PSKA 1RW4A 1XXHA 4Q4AB 5EZ5A 4DLZA 1S2MA 4MA4A 3RANA 3CUEF 4RD2A 1D2MA 3HDTA 3PEYA 2QQ0A 4B6FA 2FFQA 2H18A 1XZPA 4NZYA 2F9LA 3WNBA 3RS2A 4TSFA 4NL4H 5D3QA 2ZQ5A 1TX4B 2F1HA 4KLZA 1ONBA 4RD1A 1AK2A 1NG1A 1NSTA 3HYTA 5JSZB 1XPRA 4UNSA 1XNJA 1W47A 3LV8A 1ZW6A 5B57C 5FOXA 3VU9B 3CRRA 1NJFA 4KBGA 4Q4JB 4Z51A 5KNBA 2B8WA 4H9GA 4TTRA 4EAQA 3CWQA 2W0SA 1E0SA 2G0NA 2ZI3A 2ZUCA 2ZSFA 2MSDB 5FBWB 2DBYA 4DSNA 4GP7A 2F1IA 2F43A 1FQKA 2AHOA 2WSSA 1GIAA 1ZC3A 3I62A 4Q4LA 2EYUA 3GJ4A 4QM6A 3AVYA 1OHHD 4KXFB 2QP4A 4IFBA 2F1JA 1UAAA 3FMOB 4LSGA 3IHWA 3WP1B 3T1OA 2O52A 4I1OA 2V9PA 1C1YA 5A0FA 3OEHA 2F43B 2JAQA 2AX4A 4IDOA 2H92A 2REXB 4ESHA 3GLIE 4Q4HA 5GVSA 4NYIR 5IHPA 2W6IA 1TQ2A 3U61B 2OFXA 1JPNA 2G9NA 2RGNA 5FPSA 3P20A 1TADA 2AKYA 2XTMA 5JI3E 5GJVC 1AN0A 3QBVA 4C0QC 1R5BA 2CHVA 2W6JD 4ARZA 1LS6A 4M1YA 1U81A 1F2TB 3WY9A 3BS4A 4X8HA 4L8GA 1WF3A 2PLRA 3B1ZA 5CK4A 3X2SA 4BUJA 1HA3A 2ZANA 3LNCA 3FYHA 5KHOC 3CRMA 4O0MA 4KAXA 3H1TA 1U9IA 2I3BA 1J99A 2C03A 1OKKD 4G1UC 3UPUA 1VDZA 4R7ZA 2E1RA 3K0CA 1KKMA 1Q1QA 3MG9A 2J41A 2EYQA 3LW7A 1HT1E 2WMOB 5JEEA 1N0UA 1W44A 3NEYA 2HF9A 1P62B 3CLVA 5EJEA 3DKPA 2B6HA 3P4XA 3GJ0A 2AK2A 4IOKA 3S1AB 4EDHA 2CL7X 2WOOA 3KKPA 1SXJB 2BKUA 2F9MA 4JBXA 1XEFA 4C3ZA 4YMWA 3ZVRA 2ZRGA 2A5YB 2AD5A 1T5IA 2H17A 1MO4A 2PT7A 3E2IA 4V0LA 2Z43A 2OSBA 3BB4A 4KLNA 1A4RA 1CR2A 2JJ2A 4Q1FA 4WA7A 4RKEA 3FPAA 1UBCA 2REBA 2OAQ1 1T3HA 3CPHA 1HUQA 2FN4A 4M1SA 3EZ9A 1Q1BA 5FUWA 1XEXA 5LB4A 3TIFA 2QSYA 3K9NA 5AUQA 3ZQJA 1F2TA 3RS5A 1E6CA 4IEIA 3W3AA 2CK3D 4LDJA 2FOLA 4IDHA 2J1LA 3RRNA 3EZ2A 3ICQB 1KSHA 1H8HD 3B9QA 1SVIA 4DSTA 2ZRNA 4Q1EA 1ZMXA 4NMMA 4RD4A 2ERYA 5EP1A 2C9OA 1XJQA 4Q18A 1S1MA 4UNNA 2CE7A 1ZD8A 3O47A 3TQCA 3GLHB 4DT1B 2J59A 4H1UA 2NZJA 1GRNA 1MRSA 2RGGA 4DEYA 3U44B 4S35A 2XOKD 3UANA 4KV9A 4LJ6A 4TYQA 4P0TA 4PC1A 4RZ3A 3TNFA 4EFLA 1OIXA 1O3YA 2OCPA 2H7VA 3NTUA 5KSYA 3R9WA 1WQ1R 3FMIA 3TW4A 3THWA 2GXSA 3AKDA 2ZYVX 3K0FB 4WAUA 2H5EA 2IUUA 3GJ3A 1RRGA 3VX3A 3EPHA 2J7PA 3W6PA 2CXXA 1GOTA 2DWOA 3LX8A 4DT1A 4QKQA 4X8MA 3U44A 4I99A 2IF0A 2O0HA 5CJ2A 1NY6A 3AVXA 1DE0A 4XD7D 3B78A 1G9XA 4PPQA 5FI1B 4A15A 2GCOA 3HU2A 3L0SA 3FKQA 4M9QA 3RNLA 2IL1A 4C9BA 4NCHA 4EFMA 4O2RA 1TQ6A 3SU8A 1VIYA 4AC9A 1E94E 2CCKA 2ZE6A 3N5CA 4TLDA 4GP6A 1DAKA 4Q4HB 1QVRA 3B82A 2BHRA 2FA9A 2GZAA 4JT2A 4C0HA 1R5NA 1Z29A 3TVTA 2QAGB 2Z83A 3RSOA 3FMFA 1G8HA 1WA5A 4JLJA 4AYWA 3K9HA 3WNDA 4RCZA 1ESNA 4KVAA 5F9HA 4HATA 3W6OA 2GCOB 3LA6A 5TDHA 4B76A 4FMDF 3QOFA 3CPEA 3CRVA 4M4SA 1WMSA 2FSFA 2WSMA 4PHGA 4A6XA 4F92B 4L15A 5AK0A 2ZRBA 4TYPA 4N1AA 3GLGB 1KTVA 1JECA 4NCIA 2CNWA 3VHLB 3PUVA 3FFBA 1UDWA 2A5FA 4JVSB 2GKSA 3WYGA 4V0KA 3T5DA 1TQ4A 4W5JA 2VP5A 4Q9IA 1XX6A 3OAAD 4DCNA 4PAOA 4G5QA 1Q0UA 3Q7QA 4JL5A 4U5XA 3AP2A 2RGAA 3DO6A 1ZINA 2J5XA 3AVQA 1GVNB 3LBNA 1A1VA 4DC9A 3CF2A 2VP9A 2IYSA 4C7OB 2OLKA 3TGPA 3U7EB 1EFHA 5EXTA 3C8UA 4BFWA 3E1SA 4QBHA 2IS2A 3CNNA 4HSEA 5DNYB 3REGA 2BBSA 3WYAA 1S3SA 2YINC 2KSQA 5JEDA 3VAAA 3U3OA 5DSZA 4YMUA 5FOSA 1OXSC 2NGRA 5K8IA 1QHYA 1FP7A 1ZUIA 1JB1A 4PTLA 1MKYA 3GLFB 2JA1A 2AD1A 1AZTA 2PJZA 4RFVA 1OFHA 4X8LA 5CLLA 5KU1A 2RH5A 1J2JA 3P32A 4XWKA 1LVGA 3H84A 4Q1CA 2JJ8A 2F55A 1L4UA 1X3SA 2Q0HA 4OQXA 3P1JA 1KK2A 3KQKA 2JLVA 3B60A 4LHXA 1T3SA 3O8BA 4MRNA 1C9KA 5DISB 1MV5A 4JT4A 3AV0B 2QT1A 3AF3A 2ZI6A 3CIOA 1Z6XA 3IQXA 3IIKA 1G3IA 5D3MB 1G8PA 3L8ZA 4Q02A 4LJ7A 4JLMA 3HP1A 4KI0A 2XZPA 3TBKA 1ZM4A 5EP3A 4QL3A 4KJZA 1N6IA 4A0HA 2C2HA 1JR3A 3SFZA 5BN3A 2MSEB 2YVUA 4IDNA 3K1JA 4UXHA 2PZEA 4WOPA 1L2TA 3WHKA 3MRSA 3UXMA 1EGAA 2QZ4A 5IF9A 1ZJ6A 3AVWA 3W5IA 2IUSA 4PC7A 3TLXA 3B1YA 4JJKA 1U0HC 3TR5A 2ATXA 3KX2A 4AWXA 2NG1A 2DFLA 5AJVB 1KJYA 2DFTA 1Q1EA 4BLPA 5CYOA 4LYAA 5DI9A 3T12A 3KJHA 1PLKA 2QORA 3BIFA 4A4DA 1XXHB 1XD2A 4Q4AA 4K8OA 5FPYA 1GM5A 2ZR7A 2BJVA 4Q19A 1LF0A 3OHMA 3KUDA 4CDGA 5FPKA 4PAMA 5JI2E 2ZM5A 1YZTA 3SR0A 4URWR 1D5CA 3M0EA 1AKEA 3X1XA 2OEPA 1W1WA 2VRWA 3A4LA 3QUSA 4PSVA 4V0NA 2A9KA 5EUMA 5FBRB 5J4YA 1G21E 2YV5A 1G3RA 4JMPA 2XOKA 5CB8A 4FD2A 5FOWA 1DOAA 1U94A 4NDZA 1SKYE 1ZM7A 1J90A 2RGEA 1G20E 1P2UA 3KDSE 1G18A 2D7DA 4IXNA 4DHEA 3QG1A 1VCNA 2RGCA 2J7PD 4IVPA 3R9XA 3KFVA 3MD0A 4PC6A 2IWRA 3UK6A 2HT1A 1G8YA 2Q3HA 1Z0AA 4GMDA 2VTKA 3EPKA 3GJ5A 1P60A 2IYYA 4I81A 1AS0A 4ZPXA 1VCIA 3QY0A 4KSCA 4W7SA 4F93B 4BZPA 1RE0A 1IN7A 5AJWA 3AVUA 4MYCA 3LXXA 5B58C 2WKPA 1OFUX 2V6IA 3UMRA 1SXJD 4OI0A 2QU8A 3CONA 4DXAA 1IY0A 1U90A 2NO0A 4DDUA 4C0SA 4B73A 1LW7A 3ETLA 1G4UR 2JJ1D 2IYRA 2VP4A 4WZAE 4LZZA 4LGMA 2YYZA 5JS7A 3THYB 2F1RA 3ZZUA 1XB2A 2NTYC 4C2UA 1F60A 1ZRHA 2AXPA 4A6PA 3GLFA 3PFIA 2BBWA 4LJ8A 2FH5B 4Z1MD 1R6BX 5C18A 1RYHA 2QG6A 1ESMA 2OBMA 3KKMA 5SZHB 4LC0A 5FPTA 3A36A 2ZAOA 3QSYA 5BYJA 2BMFA 4TN1A 1BMFD 3OAAA 2ONKA 1LNZA 3I61A 1IM2A 4BASA 1TAGA 2WWYA 1GKIA 1XEWY 1P75A 4PZYA 1GP2A 4TLEA 3R9IA 1UBFA 5JHHB 3DM9B 1E69A 3U3RA 4BLOA 5LD2B 2QN6A 1A2BA 2G1KA 4TT3A 4TLBA 2ZUDA 2AXNA 3BFXA 4LYFA 4BFSA 5FTLA 5KPDA 1OLOA 1IXZA 2ZJ8A 3FGNA 2ZPTX 2IS1A 1W0JD 4BFTA 1E3MA 1VCOA 3LXRA 4HAZA 1M7HA 5IDVA 4P33A 4XWAA 2C77A 4OI2A 3QKSA 1GNQA 1SHZA 2ZR0A 3R7WA 1E2HA 2OESA 1ZIOA 4KITB 1G64A 4K46A 3BK7A 5F3WB 1KAGA 3I72A 1W4CA 1G41A 4W5WA 4F4CA 3OE7D 1G7TA 4B3DA 2ODNA 1U0LA 1WBBA 4W9MC 2V4ZA 5J4LA 3AKYA 3BORA 4PANA 5FR2A 5L3QB 1ZAKA 3ZZTA 1E2QA 1NSFA 3TE6A 1DARA 4C0LA 1SVOA 3QPVA 2OLJA 4LI0A 3V00A 4LBWA 3NH9A 1Y3AA 2PH1A 4JLDA 3LO5A 1X8KA 4LC1A 2GJKA 4Z54A 5DLQC 4CEIB 1MR3F 2R8RA 2YWEA 1MABA 1E2KA 3FHTA 3A4MA 3D6TB 3MWKA 4ZKEA 3WMFA 4IOJA 2JIZD 4BQSA 1X86B 5F2EA 3AVTA 4V03A 2BMJA 4US1R 3GMTA 3IO5A 1UPTA 1CJUC 1L8QA 5FH9A 2ZE5A 2JLZA 3T5GA 5TXGA 3Q9LA 5TARA 3MAAC 2DWQA 5SZKB 2A5GA 4M0LA 1RIFA 5G3ZA 5J5CA 4FI3C 1M8PA 2G6BA 2L0XA 4LJAA 2OE2A 3BAFA 1EFUA 5LD2C 1N25A 1XTJA 2G3YA 2W2XA 1VYVA 1ZUHA 1XF9A 3C14C 4KODA 1U98A 4TTPA 2QROA 4YMVA 3L2OB 3I73A 1XJ0A 2O0KA 1G5RA 2UVQA 3KKOA 5E4FA 4C4PA 2NO9A 2IYZA 1ZNXA 3IGFA 1S4QA 2YHSA 1S1CA 3BFKA 1MOZA 1Z8FA 2GK6A 1Q1ZA 2QI9C 2AFHE 2PL3A 3TUJC 1NN0A 1XCGB 1P9WA 4DB2A 4HDCA 5EP4A 1XD9A 3KQHA 4A82A 3QPUA 4Q9HA 1FOEB 1E0KA 1XMIA 1G7RA 2O0JA 1SHKA 3WYFA 2PJRA 3PEUA 4URZR 4M1MA 1DO0A 4MKHA 2VSFA 3FVQA 3K0FA 4ZCIA 3WXMA 4CVNA 4KHZA 5DYGA 3C5CA 3WRYC 3ND9A 4DJTA 1AM4D 1NMYA 3QBTA 2QAGC 1N6NA 3WHLA 5B30A 1E0AA 1SGWA 5E7MA 4O3MA 1YE8A 2QPOA 4TMZA 5C2JB 3M4YA 2ZEJA 4OQNA 1J8MF 5FFMA 1UJ2A 4YQFA 1LTQA 4ITRC 2ZI7A 3THXA 4HYYA 2KBEA 3HWSA 3QNUA 4PO9A 3GJ7A 1N6LA 2ZVQX 1SVMA 5AUNB 2GJ9A 3BBPA 5EE3A 2WWHA 4MRSA 2EFCB 2NMVA 4CT5A 1CR1A 1KO4A 2N46A 2OUKA 2FDCA 1T3LA 1M7BA 4L9SA 2P0EA 4R2IA 1GL7A 2Q3MA 5JCPA 1OV4A 4UNRA 2QSZA 1IY1A 4PR0A 4BLSA 4A36A 5P21A 3W3ZB 1VIAA 3QENA 4RZUA 3RRMA 1IXSB 2BJWA 1PLJA 2QPAA 1KK0A 3QF4B 1OFTA 2P3SA 4Z1MA 3SNHA 2CDNA 2Q6TA 2FE4A 4FMDB 4TQ9A 1JXOA 1YR9A 2J0UB 2ZYWX 4PC3A 4DBLC 1VG9B 4TL8A 1HE1C 2VQSA 1Y63A 2QRZA 3DMDA 2GF0A 4V0ME 4QHTA 3QJYA 4WVFA 4YLGA 4BLTA 1GDDA 2RB4A 3IIJA 4AKIA 4MQBA 1UFQA 3RS7A 3THWB 1KO1A 4TZ0A 4M21A 1Z08A 2GESA 1XPUA 1LB1B 2AWOA 1HH4A 2W6ID 1PV4A 2UKDA 3T06B 1XMSA 2CJWA 3CH4B 4BWYA 4XSGA 2OFWA 2FMXA 4GRAA 1YZQA 4IJMA 3UG6A 1CS4C 4R9UC 5HKKA 1XCPA 3U7HB 3KTAA 1G8FA 1P2VA 1P6XA 2ZRDA 4TL9A 1AGRA 2ZS7A 4AYTA 4L16A 1JR6A 2WTUA 2C99A 3GFPA 4GBMA 1UBEA 3T15A 4AY2A 1OKKA 3JZMA 1I4LD 4DEXA 4NP6A 2FWRA 1WDTA 2NOAA 3A8TA 4WIAA 4PQRA 3T1QA
chains in the Genus database with same CATH superfamily
3URKA 4EY5A 2YHUA 3EVCA 4A92A 4V1CA 2XEDA 2JARA 3VVLA 3NFRA 1RCUA 2ZRHA 3IEUA 4HWGA 4UVHA 5TQ2A 3RBZA 5IDYA 3SI7A 3S7ZA 1A27A 1C1DA 4TKUA 3VHXA 1CIJA 3LCRA 5GJWC 4NENA 5FWNA 4HDRA 3PS9A 3QVUA 3NJ8A 4QYIB 4ZOLA 1VB3A 3MQFA 2ID7A 5L4LA 1QG6A 1RYFA 2GEBA 1FC0A 1ZOOA 4CG3A 4LMPA 4L5YA 5EUBA 1HT2E 1ZUNA 1I7NA 1PTKA 5D6OA 4I9FA 5I45A 3R75A 1GR1A 3P52A 4CCYB 3GNTA 4F72A 1C7EA 1VJ1A 4F9TA 4QFCA 5IDQA 2WSLA 3NHMA 1HSOA 4JUCA 3PDWA 4HN2A 5CM9C 4ILEA 1OXUA 2QRJA 1EUDB 5KUTA 2Q6VA 3E18A 2X76A 4OQMA 1GG9A 5H82A 3SFVA 3TCXB 1FJHA 2DTDA 3DZFA 1PKXA 3L7IA 4RTQA 1LI5A 1T3GA 5H70A 4QLBA 2I4LA 3RJTA 4P31A 3F47A 5ER9A 5K0CA 3A58B 3Q0EA 2JBHA 3ZNPA 5CITA 3JQFC 1BCSB 2G7ZA 1THZA 4OL0A 3TIGA 3LYUA 1IZYA 1E64A 3IH5A 3UJ8A 3MS4A 5LMZA 5IM4A 2IYWA 2V59A 1C0LA 2HNAA 2Q4RA 4XWOA 3IEMA 3KAKA 3MCUA 4CMEA 4K9PA 3WK7A 4BPRA 5LYJA 1ZPDA 3TRKA 2KB0A 2XTJA 3G1WA 1OOEA 3CUSA 4ZJUA 2JKVA 5LNK1 1TRKA 3A9SA 1W36C 2BMWA 2HA3A 4DV4B 1SC4A 3M8KA 5K99A 2WPNA 3E8XA 1L7EA 3V8VA 1RPAA 2DERA 4YPOA 2PUCA 3AVOA 4JNKA 4WACA 1PZNA 1TCVA 2C4NA 2O7QA 2X5KO 3NPMA 5LZ9A 1DINA 1PQUA 1QF7A 1YQDA 3DXYA 4DWOA 3GLIA 3R7WB 1CFZA 1RRVA 3DDCA 4MI9A 5FBLB 2C8LA 1QORA 1GLVA 3G9TA 3UMVA 1P5ZB 4RGYA 1QYIA 3G9UA 3HU3A 4N5LA 1KYIA 3QRWA 3RIHA 2IGBA 1UKEA 5JHGB 1MXFA 2FX2A 1OI7A 1ZOLA 1KY3A 2OG1A 3I9NA 4L73A 4NABA 2Q9UA 1AGYA 4ZCMA 4Q7JB 6ADHA 2JATA 4HNAA 4NU0A 2O2SA 5AXBA 2FSGA 5JC8A 1CUYA 1MLDA 2B25A 4TXMA 1SVKA 5CPFA 2WV7A 4HJXA 5DHTA 1OB2A 2ZIAA 4GOOD 4Y2JA 2G5GX 4ZPJA 4JQSA 1IZ9A 1KEUA 3HBJA 3JAWA 4DLXA 3NXSA 1GLGA 1KU0A 1HOTA 3AKEA 2SICE 1UP7A 1XZKA 3WXBA 4QA9A 3H11B 4LXIA 3RTDA 1SIUA 3ABQB 3ZCVA 1KI6A 3FPCA 2CXRA 4PO1A 2KS6A 4D8XA 1F0KA 1P3JA 5HG0A 1JDBC 2QUJA 4DY4A 5HBRA 2OQIA 1GQQA 1KO7A 3HDVA 4M0UA 1OLSA 3E9RA 3R7LA 4ACBA 4NESA 1B15A 1RWWA 4OK3A 4BNGA 1BE6A 1PI3A 1H3NA 3OIWA 4LHSA 1TA9A 4H6WA 1BJTA 3THOA 5LU9A 5KTRA 4I5FA 5B1YA 4WVLA 3BIWA 2FUCA 2BCGY 3TI7A 3C7KA 3EXHB 3JVEA 2J9RA 1FP1D 2OG2A 1FYFA 4H3HB 1YDHA 3ZOZA 1OB5A 4DYVA 5ADHA 4P0PB 2PIAA 4OOEA 2PRKA 1OA1A 3E5HA 3PCRB 1VPLA 3KZOA 2P67A 5EHQA 4AZ0A 2B5WA 4HJRA 5AKGA 4ZT6A 3ASZA 2FPKA 1EUQA 1JSCA 4L74A 4IV0A 2FSHA 1FNCA 1MG0A 3TD9A 5AUPB 2VTEA 2P77A 2P30A 3L18A 3ETDA 4E5UA 1QP0A 3A9UA 3FYCA 1LK5A 3K0BA 4BLQA 5KSOA 3P0HA 4ZARA 1M2EA 2VJAA 5CT8A 3O9VA 1NYQA 1PZGA 5HKKD 2XNDD 3IE2A 1XRQA 5C32A 4QGAA 2W48A 4BNJA 3BQNB 3OZAA 4OM7A 3VOBA 3VR0A 1FZTA 2HJGA 1NP6A 5J4KA 2GTHA 4EZIA 5DBFA 4IRUB 1WD5A 3Q6MA 1T9CA 1UUFA 3LY5A 1RAEA 4EGCB 4L57A 1LRKA 1XVIA 1BH6A 2NACA 5HS6A 3FUCA 3FE2A 3HZRA 4YV2A 1S0UA 5IZ4A 3QKWA 4UUNA 5FR1A 3ZJTA 2J5QA 3QE2A 521PA 4L95C 1BDMA 2VYCA 2TMKA 1I33A 2I7TA 2XNHA 4J3NA 1UJMA 2R7LA 3UAXA 1ODSA 5PGMA 2P4SA 2FY8A 5DEIA 3UXYA 1HLFA 2Z95A 2BVNA 3Q2OA 4UUAA 3GEMA 4QOJA 1WB4A 3PTLA 3SIWA 1SOMA 3WGQA 3C3WA 4QVIA 2EGUA 2XJ9A 2F8LA 3GFOA 2Q8QA 1XNRB 3WICA 4IGFA 4KPGA 2I87A 2JGRA 4C0BA 4BMSA 1Z7GA 4BQFA 1JDPA 2H54A 3GQBB 3NIDB 4QDUA 2RGDA 2A1TR 1H8ED 2YV2A 3NS7A 4O2LA 4O8CA 4PS0A 1BFKA 4TQUS 1AMNA 5EIWA 3ES9A 3MT7A 1L7AA 2QQ5A 4F1KA 1TMYA 4GKJB 2NO4A 2IXEA 4X1IB 1DO8A 1II0A 2PNFA 1VLLA 5ER6A 1ST2A 1K8ZB 1XUOA 5AQ1A 1WE2A 2FW9A 4FKMA 4U02A 5CLQA 3ZWKA 1YKSA 4YDQA 4MV5A 1BO6A 1GTL1 2Q1WA 4EIWA 3A1TA 4OOFA 2H07A 1P19A 2NPIA 5JCJD 1EWKA 3LY7A 1VPTA 1J8QA 1TJ4A 4S1PA 1JQJC 3T3DA 2RHHA 4QBTA 2CEAA 3T1VA 3FOBA 1NPTO 3PTZA 2ZIXB 3OM1A 5SV2A 4AF7A 1YKGA 4OO3A 3L0CA 4IFTA 4EHBA 4D46A 1JH8A 1J2YA 3SN6A 3EW7A 4CL2A 3NHLA 4FFLA 2PWYA 3TPFA 3PTAA 2CJWB 1W0CA 4TKLA 1YR3A 3OM9A 1RP1A 5ARCA 4DC1A 4ZD6A 2GZ3A 2H52A 3R6DA 4CQLB 3QEAZ 4M1OA 3GGSA 2M2IA 5DHRA 5F2OA 4ZDIA 1PL6A 4LY9A 1K98A 4MPPA 4D2IA 3TSWA 1P1JA 2X4IA 4MS4A 3OT5A 4A8JC 2QR2A 3CGWA 2BGUA 4MIEA 4R8SA 3D6UA 4WLEA 5EG5A 2WQ7A 5IT5A 1ZI8A 2C5HA 4GXTA 2ERCA 2L82A 1A4IA 1DJLA 1ODIA 1Z13A 4CIDA 2I34A 1N1GA 2B4TO 1QKKA 2P6PA 3FIJA 3IAS1 2ZITA 1RKXA 1FQWA 4TS1A 1GPLA 1TAHA 3WR5A 3ZS9A 3ZXUB 4PWZA 4K6OA 4G9BA 2ILVA 1XKXA 2HMTA 1XLWA 1YI0A 3CS3A 3EZLA 4ZXFA 1XL0A 1NNUA 1JI0A 2VI5A 5BUSA 5LDHA 2Z5FA 3P9KA 4ZANA 2ZSEA 3P2IA 1IAVA 2GPAA 3PZRA 4Y3UA 3NHWA 2W00A 2QTCA 4FFDA 3TJZA 3WGTA 4DSZA 3MINA 1UQUA 4QNNA 3HXLA 4YRAA 3JASA 3RHFA 4CM9A 4TYNA 3SYNA 3AT1A 3T3NA 3T7KA 2CVFA 4I1SA 1RWOA 1YACA 2VSXA 2P7HA 3HP4A 1ONPA 4H3VA 4XGIA 1UDXA 1O7JA 5ED4A 2XGMA 4QHSA 3PQ2A 4P34A 3AERB 3H86A 3MJRA 4L75A 3B13B 1Q1NA 1EPUA 3DP9A 3DZIA 3FYDA 5GONB 2CC2A 3TEMA 5AVVA 8LDHA 1UK6A 5LLDA 2AEFA 4RHFA 5FWDA 5ESXA 4A6EA 1DELA 1X80A 3RBAA 5E2BA 1SPBS 3AF2A 1SUDA 2B30A 1V8DA 3W6ZA 4GT1A 2QZSA 3IODA 4FFVA 5ADWA 3FUVA 5EIFA 1N5KA 5ISMA 2C7PA 4LWPA 2MYPA 2YCLA 2PZMA 4EB3A 1QFJA 5A9TA 4IUBS 4US2R 2ZJZA 2E89A 4RZIA 5HZMA 2ZJYA 1ZGAA 5EE9A 2INGX 1H9AA 2CMDA 4MGHA 2ZAIA 1PDOA 3O8QA 1ZGCA 4BUCA 3STHA 4UM5A 1W29A 3BTOA 4YJFB 4PSDA 2RAVA 4P3OA 3UAZA 3WJ2A 4COKA 3RSGA 1X80B 4EARA 1BROA 3EK2A 3L8MA 3WKCA 4BNLA 3II6X 3VUFA 4HX5A 1KNQA 2HY7A 2XDWA 4PG7A 4RDCA 1KI1A 2JH8A 3JD1A 5F23A 3ZWXA 2G1AA 4F4DA 1ETHA 4AJ1A 4DLKA 4P54A 2QMZA 2P2DA 3QKSB 5ICSA 3QQPA 2ZSIA 4NZNA 3WX0A 2OOKA 2I66A 3DVSX 2W22A 4IMJB 4PHFA 4BMVA 2Q99A 3CF6R 3BXEA 1QU3A 3VJLA 1GQRA 2QYHA 5AKYA 2C83A 1KZGB 3NWPA 5LOVB 1ZH4A 2F4NA 2RH8A 3ANYB 3C45A 3LT2A 4WINA 3RJ5A 4ABYA 2V3CC 3ESBA 2XI4A 4U7JA 1OT3A 2JEZA 4MVJF 3N70A 4BNDB 1VHLA 2ZSJA 1EUZA 1S7CA 2H1LA 2WZQA 4ONEA 3OCJA 5BMVA 5I47A 5TIIA 1UKBA 4GLJA 1WTCA 4EFKA 4DM3A 2OL4A 5CDGA 1XK6A 1FQJA 1XZCA 3OZEA 2J33A 3A1FA 3R3SA 4ND2A 4CIWA 2H16A 1QPGA 2QIPA 4E5YA 1KJWA 3GOHA 4M0CA 2BV3A 3UYKA 3ICCA 2ZVJA 1EGHA 1CY6A 1FQOA 2ZYRA 2NT4A 1XDUA 4OK5A 3HJNA 1W6RA 3VTFA 1LC0A 3VYUB 1P7CA 3DHEA 3Q12A 1U2GC 1HQYE 1BX0A 2K5UA 3L41A 2V7TA 1D6MA 4D4MA 4XDHA 1DO2A 3PNBA 5DGCA 5JRDS 3O4JA 2WOJA 4M98A 2B4AA 3DCIA 3C24A 3OX1A 1F17A 1U2EA 1WUIS 2AW3A 4IDQA 3AIOA 2G08A 1VRWA 1BA2A 4RD6A 4TKZA 5F7OA 4NCAA 1N0VC 1UDAA 2VAVA 3OPYB 3WWCA 4RK1A 3TIXB 2VXCA 3CX3A 1T91A 3AHHA 5I3CA 4X3CA 3FNEA 4UHKA 1BVRA 2FGKA 3VR4A 3PDIA 5HPYB 3K0AB 2O59A 1TLFA 1SVUA 2D62A 1CUWA 4L85A 1LJLA 3FDZB 1L3IA 4TSFD 2W2PA 1VJRA 4URUR 5FEMA 1Z28A 2WQ6A 1WETA 2CK3A 3ZGYA 4M1QA 4JOCA 1WXGA 1ST3A 1CKEA 1NQWA 3CX8A 3A25A 1V1MB 2HDHA 3NH6A 3EW9A 1PR1A 1DXOA 3EVGA 3IMCA 5TB5A 1DAFA 1Z22A 4BO4A 4WEOA 3ICWA 3F5SA 4E2XA 1VE5A 1I4DD 1ZONA 2QP3A 2Y4NA 2IU6A 4YO8A 2O8DB 2FHPA 1XQ1A 5E8RA 4UBKA 2JBAB 5FHRA 5GP1A 2FMHA 3HJTA 1OYOA 3LXMA 4I1PA 4B45A 4HWRA 4W8HA 5IS2A 4OSOA 4J0HA 2GZDA 4UJ3A 2HK7A 1HT3A 3OFNA 1V9LA 3QEMB 5JRJA 1RBQA 5KDDA 5CW2A 3A3YA 1ZHFA 4IFEA 2GJ8A 3NCHA 4F0JA 3EULA 1KKLA 4KBYA 4UCFA 2C5LA 3D54D 3GP3A 3NATA 4QXPA 4EI8A 2ZDQA 2C5BA 3K53A 2BFDB 5H3LA 3QVLA 2ZTSA 3OHPA 4XCXA 5U4QA 4GL2A 4KWIA 5FBZA 4EW1A 1AZSC 2DECA 1F51E 5F5LA 1UEIA 3W8NA 1M76A 1PQ4A 4Z7JA 2HADA 1UZNA 3Q7EA 5LA6F 2V8OA 3GCXA 2C2YA 4P2BA 4F2HA 3MHTA 1CEYA 1NOKA 2CNOA 3EQ2A 4ND8B 5FPHA 1KRWA 5CXUA 2C5AA 3CXUA 1HM5A 3KOUA 4WV3A 3M6AA 3I3OA 2BSQA 1DC4A 2KW5A 5DN9A 2J46A 3V1UA 3FCYA 3VSDA 4WFJA 4IOMA 3BHIA 3VISA 1PVOA 3QEKA 3JYHA 2C7QA 2R5WA 4LEIA 3KEFA 4J03A 2PA3A 4D92A 3QOXA 5HUHA 1GG5A 5HIIA 2O50A 5BV0A 1GL9B 2YC4C 2IUFA 3W7BA 4LPSA 2DJ5A 5BVHB 1DXQA 2XOEA 1HSZA 2W2VA 1E66A 4NNPA 4WCFB 4E6PA 4F4JA 3NHAA 3M34A 1F4LA 1YQXA 1JFTA 2JI9A 3UT5A 4POAA 3A3NA 1ANKA 4YRKA 1ODLA 2GLXA 2HJVA 2WYIA 3DE2X 1P2FA 4I6GA 4PO8A 2PQ2A 5F33A 4DREA 1ZHOA 6AT1A 3MJHA 4UAGA 3HMKA 1IBRA 1X1BA 4TXJA 3PSHA 3FKSA 3QKRA 5KTPA 1L3BA 1WW2A 1ZIDA 2ZSBA 5G02A 1EGMB 3CKMA 4QPDA 4YN3A 2BEKA 4XIYA 5TY0A 3HTXA 1T4MA 4GBGA 4EB8A 4B2IA 1IOZA 1E79D 5H0IA 4IKEA 3K1AA 3M1IA 5I9IA 4M22A 3H6KA 3P2JA 3S8EA 2GARA 1X7WB 4ND3A 1TF2A 3ANNA 3DR5A 2J3EA 2C2GA 3QV1A 1NVGA 4JVOA 4N7BA 1JIIA 5HK9A 4OHWA 1JR3E 1I1QB 4R2MA 1J8YF 3OZTA 4G23A 3RVQA 3WO1A 1MGPA 2GN0A 4RK7A 3ZY3A 4M9SA 3LDGA 3UHAA 1MP0A 2N47A 3CPJB 5REQB 4H7FA 4BB5A 1EVLA 1YB7A 4ZEWA 4X94A 1OI3A 1F8FA 1XKTA 2G9RA 3FRHA 3KVOA 3MTEA 4EYOA 4IIHA 2ZG6A 4AW9A 4MYDA 1YVRA 5CUQA 5FORA 3RI3A 3ZH9B 2FN8A 5L3SA 3QLTA 1NVUQ 4IV5A 5CNMA 3HEAA 1QQ5A 4D8VA 1OZAA 5JADA 2KPOA 4OXKA 1XSEA 4O4JF 5IYZF 5TPZD 1KZ7B 2ERXA 3WYDA 3GZNA 1WOYA 1Y5LA 2PXCA 4GW3A 3W6UA 2DCUA 3CTMA 5E3JA 2YOHA 1KKUA 3L7NA 2RGNC 5REQA 2YWBA 3OZXA 4XEHA 1R0SA 4WA8A 4KWCA 1QQBA 1IL0A 1NA5A 1YE3A 5EQDA 3JVVA 4QXRA 2PKXA 1S8FA 1QFXA 2Q7XA 4XLLA 5CR9A 5K51A 3AX6A 1PS8A 1CHDA 1W34A 1YXMA 1ZS9A 2G83A 1YL7A 2I2FA 2ODWA 3LCUA 4G56A 3HO8A 4UARA 3ZKWB 4RAQA 4WDRA 4IZOA 3RVJA 1YB1A 4KGDA 2YJ5A 4KFCA 3ZGNA 4K3VA 3SJZA 1ZISA 4DSUA 5L6MB 3P0JA 3Q4GA 3D2BA 1LS1A 3VR5A 5B64A 3ZGLA 4UULA 1ECCA 3CE9A 3LVQE 2GERA 4RY8A 1I7SB 2ZW9A 1Z38A 1L0BA 3CV3A 2ANCA 3M49A 4BKQA 4TYYA 3ZTTA 5FX2A 3QNWA 4NRDA 1ZRMA 1W2WB 4DLSA 4YAKA 5K0LA 3K6KA 1CQZA 1M6HA 2V0NA 3Q3CA 1JDZA 4PPFA 2GWHA 3NVAA 1E6EA 4TWAA 3IBSA 1Q2UA 1ZC4A 4DCTA 2XT6A 2A88A 4RA6B 2GN1A 4UM8B 2HQ1A 3PDCA 1QH1B 1SD2A 3BWMA 1KFBB 3A27A 2CN1A 4QXQA 1N5MA 5ILOA 1DSSG 1ZCAA 2KQUA 3NJ4A 4OHUA 3S2ZA 4AX8A 1ZD9A 2I1LA 3I4LA 5AHOA 1Z63A 1RJDA 5FA8A 3P9NA 1X9HA 5HDBB 1V5FA 1T6NA 2C5FA 2JCXA 1MT3A 2JAXA 2WHPB 1N0WA 3I92A 3NNNA 1EVQA 4ZQIA 1COWD 5HRUA 3E22A 5D85A 5ANRB 2FN3A 4O4IF 3S1SA 2OD7A 1P1KA 2AVDA 2EG5A 2QL7A 1TMKA 3DE3X 4HLDA 4Y0NA 3WGYA 1XP8A 4HQNA 4YLYA 2JAHA 1MB3A 2R96A 4JNCA 3KTAB 1RC8A 3NHRA 1KMNA 2BEWB 2I9KA 5DYWA 2VPPA 5KVVA 4AIIA 1S3GA 1QHHA 2JHFA 2N1BA 3N87A 4P83A 2I78A 5BN5B 3PXGA 4FBGA 2A92A 4JUIA 4XVUA 3W8FA 2H1RA 2POQX 1BMDA 3EISA 1VBKA 2EF1A 5K0TA 4PPNA 3CVJA 3DVAA 4H4CA 4JI5B 3BIJA 1DQRA 3E2MA 4PYKA 4P4SA 2Q7DA 5IXJA 3I3SR 5K9ZA 1ZVVA 3F9RA 5F52A 3AMVA 1BWPA 1EP1B 1F9EA 2RB5A 1FP2A 1T6XA 2ODEA 3BULA 1NTRA 3IJ5A 2SKEA 1QK5A 5FADA 4X64B 3ZJ4A 4KYIB 1QBGA 1LBQA 4JT8A 1WY7A 4A8JA 3PUXA 2D5LA 4Q1BA 1VPVA 4Q93A 1KDYA 4B32A 1N6PA 1OV6A 3VM6A 2DMRA 4UBNA 1QVAA 4JELA 5EE1A 1NWHA 1UEXC 3B6EA 5ELMA 3TB6A 1DJNA 1J8FA 2G7MC 1X1EA 5FTJA 4MUFA 3UB4A 4TWIA 4CUJA 4DR5B 5DLPA 5A0TA 1SN7A 2BM1A 2H2GA 3ZWQA 4I50B 3WDMA 3K16A 3EUFA 3ABIA 4LTNA 1ACLA 2Q62A 3IS3A 1SBZA 2CUKA 5FA5A 1H1DA 1F38A 4Z0TA 3FWZA 3V7YA 5KTOA 4B7XA 3W9YA 4AG6A 4JKIA 3L43A 2NSYA 2FVYA 5F77A 4E30A 1B8NA 3E1GA 3L1HA 1NX9A 1ZA1A 3HG7A 5AO9A 4YR7A 4HXFB 3TX2A 2VVTA 2CCJA 2I2AA 1XVUA 1PK8A 2WNIA 2Z04A 2W0MA 2ZBQA 3BGIA 4GI1A 4LECA 3G8AA 3W1EA 3WGOA 4WOBA 4B3RB 1YA8A 5BWNA 4WLUA 1C14A 4INPA 3UAOA 1J70A 1EKXA 4HD8A 1XQYA 3OBIA 4MEAA 3NBMA 4LBYA 2CNLA 1HTTA 5DW0A 4HDRB 1Z25A 2JIOA 2DQSA 4GNKA 2QVZX 2X3YA 4FCTA 4U7FA 1R6DA 5IJ0A 2C5GA 1KMMA 5DZSA 3WL5A 3G0CA 2HWUA 5B5SA 4LVUA 3ESAA 1XR3A 4DILA 1CUBA 1ZJZA 2ZSDA 3FDFA 3D3QA 3EVFA 2IS4A 1ZFNA 1EXWA 2HUPA 4NCKA 1PWHA 1QO9A 1V39A 1GNSA 2E6KA 5GZ6A 3EBLA 3Q3JB 4NMWA 1B1CA 1K5HA 1ZEMA 7MDHA 2HJHA 1SFRA 2J4DA 4TGLA 1HOXA 3AKCA 3HFRA 3GAFA 2J0QA 4Q34A 4YRGA 1LV7A 2DWPA 2J9YB 4IYRA 4OI4A 5JLJA 1YV9A 221PA 3CF0A 3FWYA 1MJNA 5FL3A 3P9QA 5LQSA 4D9JA 1CEEA 1J25A 4M8LA 4ZYYA 1KP3A 3KHKA 1I3KA 4Q4DA 2HIMA 4KUGA 1I2MA 4C0AC 1T24A 2GF2A 3IUPA 4C7XA 3LUHA 4CCAA 5B6IA 3TEJA 1JBKA 3IXLA 4DY6A 1AMOA 3FCSB 4R54A 1DBPA 4RYLA 4XFJA 1BWRA 1E4VA 1UJ5A 4DAOA 1LJ8A 1AQIA 4E4RA 4HUTA 2B2NA 4JYBA 4YT2A 5FEUA 5KQLA 1V1JA 2IEAA 2XYVA 4FT4A 4RJJA 4ZWNA 2QV0A 1NPYA 4CMEC 5HM8A 5MGNA 2RK4A 2YV1A 2B4KA 1ZNWA 4J3JA 4PG4A 2OQVA 5CH3A 3RD5A 1C3VA 1GFZA 2Q45A 1Q1GA 4NPHA 2QY9A 1SCAA 2Q6LA 3GFSA 2FFHA 1F5NA 2X7HA 1CRQA 1FF9A 2QKYA 3QLUC 1YDEA 4LSWA 5BSMA 3IJRA 3VMFA 3WK4A 4EHNA 2JI6A 3LDAA 3GV0A 4JMLA 1QHNA 3ZGOA 2PWAA 1N78A 3H4MA 2GZRA 1KOGA 1S4MA 4YXWA 3GEPA 2ST1A 1NMEA 2G0TA 3HKCB 4D43A 1CUCA 2HZBA 2Z6UA 3HCRA 1W6UA 3R2JA 2CMGA 1EZZA 4CKBA 1CNEA 1IXYA 4KVZA 3TXAA 4R1NA 4M0DA 1JHYA 3DBIA 5EMKA 3CCFA 1OZGA 2JGAA 4PLPA 3U7GA 5HJ7A 1XDZA 2WT9A 5DX8A 3G8CA 3FKJA 2XAUA 1UZUA 1N2JA 4RJLA 1M66A 2W2KA 1HZZA 3GBPA 4J8PA 4LNAA 1O58A 3IB3A 3L79A 3B3QA 2DQKA 2NXWA 2QTLA 1NAHA 2RK3A 1W7AA 3JATA 1FFXA 3D2LA 4DR7B 1IULA 4BNYA 1E2JA 1J9EA 1DEKA 4BVLA 5C81A 4IEEA 1POXA 4OQ4A 3TYXA 2VEDA 4FINA 4QDKA 4BNUA 5TMBA 5I6DA 3ZDDA 3CUTA 3ZE8A 1Q7CA 4NOKA 2HX1A 1XHFA 2OZEA 3FPKA 4WD3A 3UOGA 1WMBA 4A5OA 1XCMA 1Q3TA 1UC4B 5JD3A 3RWOA 4AF6A 3HPQA 5C51B 1RJ9B 1ZCZA 3L1UA 3C5WP 2NW6A 5FL7D 1ULBA 5LQKA 1O9BA 2ZWPA 3GAAA 4LZNA 1CYDA 3RVPA 3TKYA 3VNBA 4LF9B 1O94A 1E6KA 2V54A 5JISA 2REQB 3THRA 2CXQA 2H4ZA 1OPXA 3NIWA 4G1VA 1UK8A 3P2EA 3RG2A 3T5CA 4PICA 3MELA 3TLGA 4X91A 5BPFA 1EFKA 2Q1SA 4WEQA 5DASA 4E0BA 1SQFA 4MUKA 2JA2A 3O9ZA 3I32A 3TZBA 5ALWA 4ZAXA 3WRXC 5EJ7A 5IKEA 3FUTA 1Q84A 2WIFA 3UICA 5C7OO 1NR1A 3EMDA 2W58A 4BO6A 1QFSA 2Q6KA 4RKQA 3KUXA 4YAJA 2YC2C 4P98A 4PYQA 2YW9A 2FZWA 4X84A 5IBCA 2YJZA 3BXGA 1IY9A 4MB0A 2B7BA 1ONNA 3IESA 3E15A 4JJ8A 5E7JA 4B85A 4BJ3A 3F6YA 3FZQA 2R4TA 4OHVA 4RF2A 1E2LA 1VSTA 2HMUA 1IB6A 1S6YA 1ZBDA 1T8UA 2PZFA 5IFLA 3MD9A 2CSXA 2J30A 2P35A 5JJLA 3HU5A 1KAOA 2WIAA 1L7MA 5TJ9A 3ZZMA 4KO4S 4AZSA 3NVKI 1MQSA 3WMWA 1R4MA 2ODQA 2Q2VA 1W5SA 5HF6A 1Q20A 2VDUE 4Q00A 1T4GA 4R1PA 3IC5A 1UP6A 2BBTA 1E9BA 3T3MB 3H99A 5FCDA 3N39C 4OSEA 2X2EA 4REQB 3VVCA 2WP8J 2QVLA 3AJRA 3VJKA 4CW7A 1NFRA 2EZ8A 1E2UA 3IBGA 3GWGA 2O4UX 1KMHB 4IVRA 4PU0A 1O95C 2UUAB 1XTVA 3TNLA 4AI6A 4X97A 3I2KA 4BIIA 1GFIA 4EHAA 2ZETA 1YAJA 1D9XA 3IBTA 5CA0F 4WWHA 4UTNA 4AJNA 2GRAA 3M2PA 3UTCA 1B1AA 4RM2A 2OM6A 3MTIA 4KPFC 4IIEA 3FDIA 3ODPA 3Q5GA 4C7KA 3TBFA 4ES6A 3VR6D 4ISCA 4AB1A 1WCWA 2OILA 3MQ2A 1I7PA 3I6BA 5ESWA 1U5AA 3C5EA 1S96A 3KJQA 4I3GA 2AXQA 4QNMA 2FX3A 2OYRA 4CFYA 1LLCA 4UVEA 4LISA 4OHRA 4OK6A 2EZUA 2XV1A 2X8JA 3DMGA 3ESQA 3KB6A 2B37A 3FJOA 3AF5A 4DF3A 5BSRA 5KTMA 3PR3A 3IDQA 4Q03A 2EWVA 3F3YA 5HHTA 5K3AA 2Q9AA 1L9KA 3TNYA 1GDHA 4EQ6A 3A4TA 3BE6A 1ISPA 4MIOA 1JALA 5K4AA 2NO6A 4AMBA 1W8DA 2CFOA 2Y3IA 4FGKA 5LP6F 3SF0A 121PA 1OGIA 3HCNA 4GQIA 1YZFA 4HMQA 4ZVMA 1JW9B 4C3UA 2ODPA 3WA6A 2WZBA 5LUAA 3EUAA 5JR3A 4GR5A 1XBTA 3EA0A 4U0KA 1ZESA 4KWEA 2AQHA 4IIGA 4ECEA 5FBVB 1ETUA 4GO1A 5IC6A 3RFUA 5JFGA 2VXBA 5DLEA 3EGXB 2RHWA 1KNXA 4WZAB 4G5FA 5LQMA 4OAQA 1M3SA 4EQ6B 4OGKA 3ZBQA 4EY3A 4R6XA 1TF5A 2IIQA 1P77A 3WLKX 2K7FA 2AC4A 2P9CA 2NWQA 4GS5A 2W2TA 1UR5A 1TA0A 1Z0DA 5D7NA 1C3OB 5TGZA 1EFTA 2H63A 3CC8A 3EGEA 4F9EA 4DR3B 1XNQB 4NVRA 3N3AC 1M33A 4B8YA 4BZQA 4HLQB 1L5SA 1LDMA 4FR5A 2QMHA 4ZCRA 5DN6D 2NVBA 4JB8A 1LLDA 3R76A 3KKNA 3T7CA 3GRCA 4H7KA 1AHIA 4DYDA 4OMFG 2ABWA 5HGXA 1QC5B 3FSGA 1B7GO 3JQ9C 4KPEC 1X87A 1E58A 1Y5NA 3WC4A 1F2VA 3L7MA 5BVGB 1E6LA 2ZREA 3L06A 4BZXA 1H2FA 3BRSA 3ZHYA 1V4VA 1VI6A 2BI4A 3T38A 1QIIA 2DTEA 2Z58A 2HHJA 3A4IA 5KZMB 3LHIA 1KVSA 3S4YA 3CBGA 3ZWNA 4B6SA 3HV0A 2DWCA 3ADPA 3D3WB 4LYGA 2IBSA 3QEOA 3RKUA 2P9QA 4N65A 3WK9A 2C3YA 3DO5A 1QC5A 2LKCA 2R6AA 1SXPA 4M0EA 5CFMA 1J23A 2FUG1 2FZVA 2H1CA 3IHTA 3AVPA 2HLPA 1GPYA 4DDHA 3NHPA 2K6GA 1FFGA 3K70D 1P7YA 3EPJA 1M0WA 1RBMA 2JFXA 2MMGA 4JBHA 4LMRA 5L53A 1VC2A 1USIA 4TXNA 1W4RA 2VLIA 4HAOA 2QDKA 4IMIB 3CNQS 1CZHA 4BWGA 1PLLA 3AUYA 1UBSB 4UBIA 4XPZA 3B20A 1LRJA 4FDMA 1U8YA 2GHTA 3U4DA 5AW2A 3NUGA 2GMWA 1JLRA 3CO5A 2O57A 1M7GA 3L4BA 1A9SA 4B33A 2Y1XA 2WMDA 2FEOA 4CMBA 1PG0A 3O3MB 1OI2A 3J81k 1V1RA 1TFRA 3CUWA 4GGOA 4LZAA 5IJXA 4D82A 2R25B 3W2FA 1YBFA 3LECA 4QT0A 4ALKA 1CUSA 3SZGA 4FDTA 3KQNA 4RBNA 3KRTA 4B0PA 4OXYA 1R8QA 4ROSA 4EP1A 4EO7A 5JJIA 5JWRA 1JJIA 1KDRA 1NJ6A 4D3SA 2YZ7A 1BQEA 3ASYA 4G1BA 3V00A 4AMGA 4W8GA 4PFSA 3OE5A 2WUGA 3OWOA 3R8XA 1KC3A 4L5BA 4GUDA 3WFJA 1UBGA 2PUFA 5IANA 4C05A 5LPNA 4XASA 4DUGA 1EVIA 2WF7A 2D1RA 2CLOB 1V41E 5SY4A 3B48A 4GX2A 4L9AA 3JQPA 1P2TA 1QP4A 4WNAA 1PN3A 5BSTA 5KOIA 1A7KA 2GETA 4GPTA 3UMMA 1GL3A 2G76A 1GSOA 1QG0A 2EJCA 4MR8B 1E2FA 1Y7IA 2YZNA 3B2EA 3DWGA 4CI9A 5JMWA 5M7EA 4WKGA 4DBLE 1IM8A 3UHPA 5H59A 1JXQA 3OZUA 4BMYA 2OCDA 1V96A 4UD6A 3KU4A 1TW2A 3R24A 5E7IA 1G63A 1ND6A 5C8DA 2F3QA 1OZFA 2QYSA 2A9QA 1PX0A 2JASA 3UG7A 1AHNA 1B41A 1Z7WA 1ESEA 3EXG1 4JL8A 4WUVA 3RR2A 3THXB 3PCXA 1GSAA 2G09A 3OIUA 2WIKA 4UQPA 3EVBA 3EWSA 3TFOA 2RJOA 1JR2A 4A8HA 2A1UA 4GAEA 1PSWA 3H2IA 3PJRA 1ORWA 2OZLA 1PX2A 1G60A 1G42A 3ACCA 3AZQA 1RACA 3HKEB 3QF7A 4QPZA 4YI5A 5C8XA 4MI1A 3AR6A 3AGQA 5DM60 2UUBB 4ZEVA 2EG9A 1NU6A 2ASEA 1RWPA 3D6MA 3AM1A 1H5UA 3EFHA 2W42A 1M74A 1Q17A 1SBTA 3R6LA 4LAFA 1BD3A 1U0RA 5JMTA 3NANA 2QLBA 3ZX4A 1FSPA 1KVRA 4K6KA 4LZPA 4XCQA 2JW5A 1ZWLA 4JI4B 5F5NA 1P1CA 3A1CA 1U8AA 1Y6QA 2R8BA 1R0LA 2ONZA 4KVGA 3E9DA 3WDKA 4ZKDA 3U3DA 2P2YA 1AKNA 5DM1A 4BJ5A 2PFGA 4JXKA 1YJCA 3C70A 4V0MA 5JMPA 4CTKA 3JVUA 2NU7A 4EJSA 1T36A 5ECGC 1Z16A 4B6EA 2FKAA 4ZGBA 2HI0A 5DDIP 1YZVA 5DSTA 4PC2A 2BFAA 1TTQB 3QHQA 2Y77A 3CRQA 5EE0A 3I23A 4G86A 2AOTA 4OG2A 2VAWA 3GDOA 2B4QA 1RM5A 3FYSA 1EX1A 3QG5A 1MCZA 1DFIA 5BR8B 2BFEB 1DP4A 1Q12A 2RGBA 1TZ2A 2XSZD 3MGAA 1U5BB 3LBAA 1CUGA 2Q3EA 1JFVA 1XZHA 4AICA 4UOEA 1CIPA 1PJ3A 4X5OA 4EGSA 1K6MA 1GITA 2P2SA 2AG6A 3BFJA 3NUZA 4XRGA 3F5QA 4E1BA 1R7RA 1W2HA 1D8TA 4XKJA 1V45E 2ZUWA 4OA8A 3QX9A 1NMXA 4DCGA 5CH8A 3RJMA 1K86A 3N2LA 4YTEA 6GPBA 5CFOA 4Q37A 4RPHA 1QKIA 1TK2A 1XCLA 4N6GA 4OJKA 1HL3A 2SECE 1QK4A 2XA9A 3A11A 5AM0A 1G6HA 4PHCA 3H3XA 1PJRA 1NUHA 3TINA 5TMEA 3OU7A 4P1ZA 5FQOA 4EGAA 4BQRA 1UWCA 2LGJA 621PA 4GRIA 1I30A 4IBOA 2Z6VA 5LP1A 4G25A 2WKQA 2FZ5A 3UJCA 3WQQA 2X4GA 5DNVA 2Z8YM 3ZV5A 4DQUA 1JI3A 2P79A 4YHHB 1N8NA 2VOEA 2XBUA 2XYHA 4WW0A 2FPIB 5CNIA 3W8DA 2FEXA 4JENA 2A5JA 1UQTA 1BW9B 3HU1A 2BM0A 3R3WA 2CDRA 4LOHA 3LRTA 5CB4B 1VLJA 1Y3BE 3I58A 5IEJA 3D3JA 5TNXA 1G8SA 2UZ4A 4CEIA 1R8JA 3AEQB 4J1QA 2J67A 3DEAA 2AWNA 3OETA 1EP9A 3O8DA 4WESB 4B3GA 1GG2A 4Z4EA 3EWIA 3C4JA 3KVRA 5J1SB 3O8OA 2FWNA 3U4QA 4FBLA 3TB4A 2ZWVA 3VR4H 1OXMA 2VJNA 4FD3A 5TV2A 1QTRA 3QKRB 1PGJA 2NU8B 1OLXB 1R50A 3V4ZA 5GJCA 4ZHSA 2F8TA 1FBTA 2X2PA 4J0DA 1XZQA 3NONA 1KZ1A 3N2KA 4L22A 3NBXX 4NU6A 4PBRA 5SICE 4D9MA 4C0JA 5BR7A 4H15A 2XUQA 4QPPA 2CHGA 4P5DA 5LDDC 5AJZA 2IWHA 3PITA 3HVJA 2Y71A 4RMHA 3FKSD 4YCJA 2X1VA 2ZU0C 4BEVA 1G4AE 2FPMA 4ZJZA 1IH8A 2V7PA 1F6BA 1N5IA 2Z1NA 4RL6A 4JBNA 3D4OA 2ZCJA 1LSOA 3KR2A 1GXSB 2ZYTX 1EXNA 5JCOA 5J4HA 3B7PA 3I5MA 1BCRB 3IKMB 3BE5A 2L19A 3EG9A 3FTDA 2JGDA 4WSOA 3EXG2 3IAAA 1POWA 4Z86A 3RRJA