4CMGA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 93
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmgA00
2ZK7A 1WPQA 4DPLA 1C3VA 4RCVA 2NVBA 4XQ9A 5K6AA 2YY7A 4NU6A 3Q11A 4QFDA 1FMCA 2IZ0A 4WCFB 5T6BA 3PJEA 4CJXA 1E1NA 3OIFA 3F4LA 3E18A 3GUYA 3RC2A 1PTJA 5A04A 1UJMA 1SB9A 3VPXA 3WGIA 2B5VA 1C14A 2FHSA 6LDHA 5AYVA 4RLSA 2WE7A 1OMOA 2WYVA 4CLRB 3RUDA 4CL3A 4RL6A 4BNLA 1JKIA 1GADO 2WSBA 1JA9A 5TX7A 4Q3DA 3D1LA 3E1KA 4CM7A 2OGUA 4DIOA 4TKLA 3BTSA 3EC7A 2GNAA 3K92A 4FDAA 3OECA 4RO0A 3K6JA 3MWDB 4JNKA 3E9QA 1EQ2A 1U5AA 1BWSA 5TC4A 1WMAA 1XYGA 2RH4A 5LCXA 4J2HA 3ZHZA 4EDFA 2GN4A 4E4YA 2Q4BA 3R1IA 3ZHXA 3GAFA 3TDKA 1YB5A 3AWDA 4JK3A 4ALKA 3G49A 1H6CA 4JJIA 2D0IA 1E6EA 2HK7A 2VRCD 3E48A 4FBGA 4OQZA 3ONFA 3OQ1A 1SAYA 3AW9A 4FGWA 2HMVA 4GAEA 2VYND 4IDGA 3QHAA 3L0DA 1UP7A 1AHHA 3UXYA 3LLSA 2JL1A 1X13A 5DP2A 5U9CA 2DVMA 1I2BA 2C5AA 3P7MA 3G0OA 4GWKA 4ILKA 4D3FA 3HZZA 4IZHA 3DZBA 2X5KO 1LSUA 4XRRA 4RF5A 4R69A 3QWBA 4BUCA 1OC2A 2BGLA 3GNQA 1A7KA 5L3ZA 2OOSA 2X0RA 3I9KA 1L7DA 3ITDA 3ORFA 3LT1A 3N74A 1XU9A 2R2GA 1Q7BA 3COSA 4J49A 4JJGA 1FDVA 1OI7A 2VTEA 3GRKA 1XIVA 4KUHA 1L1FA 4EITA 1ONPA 1NX6A 3JQ7B 5JAZA 4L74A 2OUIA 4GQAA 1A4IA 4WLNA 5DCWA 3Q9NA 5AXCA 4PLWA 2HUNA 2JD2A 5F1KA 1LSOA 1LQUA 1ZW1A 3WGYA 3D64A 1HRDA 4MO2A 2BLLA 3VPHA 4J1NA 2VWGA 4I08A 3ZWCA 2HMSA 3DZIA 4YRAA 5ICSA 1K6XA 5CP8A 2NVUB 3KZVA 3DHNA 2GDZA 3PDJA 2O50A 2VZ9A 3KUXA 2JFHA 2DM6A 2YFHA 2AHRA 4FC7A 4NBTA 1E5QA 2EW2A 4WLVA 4DXHA 2Q50A 3WX0A 3GVPA 2DUUA 4IBOA 1DJQA 1Y6JA 2ILTA 2AEJA 7ADHA 3DAPA 3MOGA 3I4CA 1A7AA 2NTJA 4PLTA 3TZCA 1DFHA 4WOJA 1BG6A 4EI2A 5I9LA 3EUWA 3F4BA 5A5EA 4TRRA 4ALMA 4D79A 3OEWA 1UUFA 2E82A 2DAPA 4R9SA 5KWEA 4EBFA 4PN3A 4R1UA 1ML3A 4ZQGA 3ZN2A 3JQ9C 8ADHA 1R4MB 4LMRA 4Q3AA 2DBZA 3SJ7A 2IEBA 1E3WA 4C7KA 3INGA 3M2PA 5BR7A 2H63A 2X9VA 1SC6A 1X7GA 1P1IA 3JD1A 3PP8A 4YJHB 3E5MA 5HWSA 3SVTA 1I36A 1NAIA 1P1KA 2GCGA 1NPDA 3BMQB 2CVZA 3DDNA 4NFSA 4TZKA 2O48X 3U09A 4G5HA 1ZEMA 1P33A 2PZKA 1R66A 3MEQA 4FOSA 4RF4A 4YAEA 5A9SA 2P4QA 2VUUA 3FWNA 2GUGA 4CMHA 1T24A 2CZCA 4CM8A 3QWAA 1GU7A 5H83A 4W9NC 3VC7A 2BRUA 4E3ZA 5CDTA 2BH9A 1PU2A 2QG4A 3DAGA 4OKIA 3KSUA 4YPOA 5CFZA 3BMNA 4DBVO 4B4WA 2X5OA 4M55A 2CVQA 1JAXA 3PRJA 5HTOA 2P9GA 2C29D 2YUTA 3H9UA 4HXYA 3I6IA 5CDUA 2QHXA 1U1IA 5CG1A 4PLVA 2C0CA 4YBZA 4XA8A 1R37A 3IKTA 3RIHA 3TWOA 2Q2WA 3WIDA 2BFMA 3DZFA 1ZZEA 2Y1GA 2J3KA 2X58A 4DUPA 4ZQBA 3IUSA 4H15A 3WYBA 2GPTA 3PYLA 1F8GA 1W4ZA 3MTJA 1ISJA 1JKFA 4EUHA 4BQRA 5KCZA 1ZK4A 1ENYA 2X0IA 3HN7A 5G4LA 2J5RA 4DIBA 4BHTA 1GDHA 1NPTO 4FFOA 1N92A 1GAEO 1X15A 3WDSA 3TQHA 3VPFA 3U5TA 1PIWA 3H5AA 3FBTA 3OH8A 3DONA 4I8XA 5JY1A 3NT4A 4MVJI 1E7YA 1Q7CA 2Y99A 4UEKA 1WXDA 1F0YA 3QV1A 5AXDA 4N5LA 1YXMA 5TNXA 3WQSB 3NDIA 4CM1A 5K0ZA 2O7SA 3PHGA 5TGDA 2B4TO 5EJ2A 3VVCA 3ROKA 2G5CA 3LZ6A 4CMCA 3DZJA 2IZ1A 3BTUA 3AOGA 1HLDA 1XA0A 1M75A 3FNGA 4Q3EA 3MCVA 1YBVA 3DBLB 1EVYA 1BW9A 2QX7A 1CDOA 5BNTA 2PV7A 3PWSA 5TT1A 1BXKA 5BQFA 3SJUA 1UZNA 3WFIA 1Z6ZA 4E2YA 4YYZA 3ZV4A 4IZIA 4AJIA 4MVJM 4OYRA 4IDDA 4CV3A 3SEFA 1MFZA 1JKJA 3SX2A 4MP6A 5KJFA 4XR9A 1ENPA 1V9LA 1YDEA 4XDYA 1HYGA 3RUAA 3PLNA 4J7XA 1ZXLA 4EJ6A 1P1HA 2R6JA 3VH4A 3A28A 1U7TA 3ZWAA 1ENZA 1EBFA 4R16A 2QRLA 1H2HA 1YKFA 4UEOA 5L45A 3HUDA 1E5LA 1D7OA 1PZFA 3WXBA 4FCCA 3WQQA 3UH1A 5L7TA 5JE8A 1B3RA 2YQ5A 3OEYA 5JDCC 5I7FA 3JQ9A 4DBZA 2JCXA 1QKIA 2AG8A 4ZQHA 4HV4A 3PFWO 3PDUA 2VTDA 5BSGA 4B4VA 3DBRB 1EFKA 1ZVMA 4BNUA 3PHHA 3UKOA 3PFFA 3EAGA 4FQ8A 1YL6A 1YDWA 4G2NA 1K89A 4RPGA 1LLCA 2CF6A 2X4GA 5A3JA 2VNSA 4RQTA 2BFPA 1P3DA 1SOWA 2FWMX 1WZIA 5G4KA 4UULA 4CMEC 1GPJA 4E2WA 1EE9A 3JYOA 1TI7A 5FWNA 4KTVE 1KYQA 3NEPX 2YDYA 1EMDA 1VJ1A 2I67A 4BNIA 3JD3A 5DF1A 2RH8A 3WOHA 5H82A 3OIGA 3W8FA 3RD5A 3V5NA 3JQAB 4JXKA 5B4UA 1ZK2A 2PH5A 4D3SA 4EEXA 4YT5A 2P5YA 3IJRA 5A4DA 2ZTMA 1UDCA 3AFNA 4C4OA 3H2ZA 4MKRA 3DAFA 4W82A 1EK5A 1JLLA 1B14A 3QJ5A 4F3YA 1SPXA 2VT3A 2UV8A 5T64A 3DFZA 4M87A 2EIHA 4BNNA 1NHGA 4BNXA 1UAYA 1AXEA 3JTMA 4L4SA 4HFNA 3GH3A 4OM8A 4YCAA 4KDFA 4GGPA 4NBUA 4ZVVA 3UF0A 2OMEA 4NQZA 5BSHA 3DC2A 4JBIA 4IJKA 5AXBA 2LDXA 4KQXA 3RVDA 4DLBA 5GMOA 1T1RA 2O3SA 4FPXA 4FJ0A 2NLOA 5DZSA 2Q4EA 5I8WA 2YV1A 5CEFA 1P9LA 2Y0CA 1I30A 2B5WA 5EN4A 4R54A 1YONA 4OSPA 5ENVA 3EY4A 4OGWA 4WUVA 3FSRA 1D1SA 1PGPA 1QP8A 2X8LA 3IOYA 5HBRA 2NUAA 4DIFA 1JDJA 4LCJA 1ZSNA 2FR8A 1Y9EA 4P8RA 4PLFA 4E2XA 1E77A 4ZGWA 2D4AA 1CRWG 4ND1A 4IDFA 1FDUA 1H6AA 4NBRA 4OSOA 4KDEA 5A06A 1O94A 2JFGA 1M6WA 4U5QA 3GGGA 4Z9FA 1A71A 1H2BA 1YB1A 3LLVA 4W4TA 3ENNA 2OZPA 3LVFO 2NACA 3HB4X 5L7WA 4BNHA 3GNTA 4BNKA 4Z6KA 3HSKA 3LU1A 2PR2A 3MJVA 1J49A 4L76A 2AE2A 4QO7A 4E5YA 2P9CA 2JHFA 2PD6A 5FYDA 2W4QA 4XGKA 1CIVA 2WYWA 4WLEA 3U9LA 1E3EA 1HETA 3Q1LA 1A72A 4DYVA 2W2LA 3HE3A 3KRTA 3NTRA 3K2BA 2EERA 1I2CA 1UXGA 4WEQA 5JO0A 4J43A 1A9ZA 1FJHA 1PZHA 4CMIA 2Q1UA 5A03A 1EVIA 3GAZA 4IMPA 3NT5A 2VRBA 3I6QA 4HP8A 4XJSA 1F14A 1DOHA 5KJEA 3GVHA 3WYCA 1Y7TA 4YQYA 5DOVA 2TMDA 1C0KA 4NG5A 3HB5X 1DBVO 1Q7GA 1GTMA 5F1OA 1XEAA 2BGKA 5CEEA 3CINA 4AJLA 3RAJA 4BO0A 5EMHA 1Z7BA 3TN7A 4D43A 3S2EA 1ZMTA 2DFDA 1GUYA 3H9EO 2DQ4A 3VPGA 2O7QA 3VZQA 1LRLA 2GGSA 2E37A 2ZB3A 2GLXA 4AJPA 4FSHA 3EZLA 3GDGA 4N18A 5LC1A 2NWQA 1QYXA 3C24A 4GKVA 4D0SA 1LEHA 4E33A 1N1GA 1V8BA 2GD1O 3WS7A 3T4XA 2J5QA 4NFYA 2QRKA 2PTGA 5FI5A 3RC9A 2V6FA 4JP3A 2CSUA 3WSVA 3STHA 4O6VA 3QVXA 1GV1A 2VYVA 3W1VA 5ICMA 4NJMA 1U4SA 5HM8A 4BKUA 1HEUA 3QWFA 3DBHA 4QXMA 4BB5A 2BI7A 1RM4A 2FZWA 1SO8A 3GHHA 4A0SA 4RPJA 3DWFA 2C82A 5F5NA 1O89A 3JQDA 4NBWA 1V6AA 3EW7A 5IF3A 3QLJA 4YQZA 3GA0A 1QYDA 1F17A 4XB2A 5EINA 3U49A 1W8DA 4ZHSA 2ZCUA 3A1NA 4QQRA 5IG2A 2ZQYA 5K6AC 3GZNA 5JMPA 2A92A 3WLEA 3BHJA 1YBAA 1TLTA 4IS2A 8LDHA 5G0WA 3RBZA 1EBUA 1EK6A 3C7AA 4XQGA 1TXGA 4GX0A 5JAQA 4I9NA 1PL8A 4ESOA 3W6ZA 3U4CA 2O3RA 4ZQEA 2JCYA 4BNGA 2I6TA 1WVGA 3TZQA 4NR0A 5JLAA 4JBGA 3VZRA 4WJZA 2VWQA 4CR8A 5C7LO 4B7CA 3I9LA 2D5AA 1J0XO 4BGUA 2FRDA 3E8XA 3EVNA 1N8KA 4EUFA 1EUZA 3JYNA 3PJGA 2P4HX 5KTKA 4CUKA 4IIVA 1IUKA 2W2LD 1ZCJA 4OAQA 4MKXA 4AL4A 4J1SA 3K31A 1DJNA 4BQPA 2Y0EA 5JFOA 1M6HA 2J6IA 2Y1DA 1R12A 4B3JA 4KZPA 4URFA 2HAEA 3MJCA 2NU8A 1DFIA 4MVJE 2W2KB 3JD4A 1RJWA 4II3A 4CQMB 1C0PA 2BF7A 3HDYA 5T8KA 1TA4A 3G79A 4OJNA 4UVHA 5IXSA 3TNLA 2X7HA 3OICA 4J7CA 4AJ4A 5JPIA 3RCBA 3AUAA 1NR7A 2B36A 4R1TA 2CF5A 3GR6A 3H3FA 2FP4A 3GF4A 3RUIA 4DA9A 4NFHA 3WGHA 3OM9A 5TF4A 3D3WA 4EEZA 1IL0A 1EEHA 2YDXA 5DCYA 2XXBA 1DEHA 1PZEA 3GOHA 3GC6A 1OAAA 1LDNA 3KLPX 5GZ3A 3IL2A 4OKNA 1D1TA 4WGGA 4G81A 2BHLA 1X14A 2YJZA 1HKUA 1Z45A 3DTYA 2PZMA 4II2A 4F45A 3JQ6A 1PJ4A 3DOOA 3L4BC 2HO5A 2Q1SA 4YR9A 1T2CA 2OP0A 3DZKA 1U3TA 3CH6A 3OBBA 2VYVD 4A10A 1OFGA 3KM0A 1D4FA 1NHWA 4CV2A 5I7SA 5TT0A 1UDAA 1BGVA 3T7EA 1B8VA 1Y9AA 3K30A 1T2AA 4AJKA 2B69A 2E6UX 4KMSA 3W4IA 4F6LA 2P91A 1Y8QA 1RM5A 1U9JA 3ZDFA 4D46A 4FW8A 1DDOA 5CG2A 5JCXA 4PLYA 1NBOA 3UHAA 2RHRA 4PLPA 5JC8A 2VCYA 2VOEA 3PIIA 3WLFA 3DOCA 1DIAA 5IDYA 4A5OA 4AJOA 2J3IA 4HADA 3DMYA 4D7AA 4K1LA 3IC5A 1DRUA 3GRPA 4HX5A 4N54A 5DT9A 1PR3A 4PG6A 1DB3A 3RSHA 4RDIA 3E9MA 1XDWA 5HA5A 2HCTA 4UVIA 3O9ZA 4DQUA 2C59A 5TQVA 3RROA 4WCFA 2ZB8A 3QVSA 1TVEA 1NNUA 2GF2A 4RVFA 1DRWA 1YQGA 2EKPA 3TFQA 4TKMA 2GO1A 1ZK0A 3WMXA 5CHEA 1GZ6A 1X0XA 1E3SA 2Q3EA 4YJGB 3Q6IA 1PR9A 2EF1A 2EV9A 3FHLA 3ZH2A 5JC1A 4WASA 2OFPA 2VN8A 4WKGA 4BIIA 5C7IO 4CLRA 3K73O 4KUEA 1V3TA 4LN1A 2EHDA 4WNIA 3WQRA 3UUWA 1BDBA 2Q45A 5L4SA 1B26A 4XIJA 2Z95A 3TZ6A 1R16A 3WSWA 4YAGA 3C3XA 2H1SA 3O03A 1YOVB 5THQA 3H8VA 1EQUA 4P22A 2ZTUA 3CSDA 2V6BA 2EP7A 2AQ8A 4OOFA 2DT5A 3ZW8A 4WNCA 3PIDA 1I0ZA 3ZWWA 2VHYA 3EGOA 5GZ1A 2IXBA 1H0KA 3QP9A 4ZRNA 2FSVA 1LBEA 1ADGA 4IXTA 1HSOA 4YJFB 4FR5A 2D1YA 4CQLB 3HFSA 1R4NA 3O4RA 3GZ4A 3JD2A 3KSDO 4YA6A 3OSUA 1E6WA 1P77A 1J4AA 1M76A 1PQWA 2VT2A 1E92A 1LDMA 4NH4A 4CLEA 1SOVA 2UVDA 1RM3A 2TMGA 3PQDA 4RVUA 4N5MA 4CM4A 2YV2A 2NU7A 4H3VA 4N7RA 3R3JA 4ZD6A 3G3EA 3WMWA 3WBBA 4BGIA 3NRCA 3W4JA 3KYBA 3PTZA 3ZV3A 4XQEA 2EJWA 2P9EA 3L07A 4E5PA 3X2FA 1MXHA 4XZ3A 3L4BA 1TEHA 5CDSA 2VOJA 3GGOA 2QRJA 1XG5A 4BV9A 1BDMA 3HDJA 4L9RA 1PS9A 4E32A 1AN9A 3LYLA 2YV3A 5JY6A 3S2IA 4U8GA 3KYCA 3LT2A 2XAAA 1X1TA 2BMAA 4OHUA 1QLJA 1ADBA 3SLKA 4AJEA 5KOIA 1GD1O 4Z3DA 2O2YA 2NVUA 4RZHA 2FR0A 3VZPA 2ET6A 3ONDA 4YT8A 4BMSA 2Y05A 4XGIA 2Z5LA 2H6EA 3VAZA 1I5RA 3Q2KA 1F12A 3JQGA 2B0JA 3RJ5A 1KEWA 2CVOA 4EGFA 3T4EA 4A2CA 4MP3A 4O0LA 4PG5A 3ZU5A 2C7VA 1PWZA 5I7VA 3QIVA 4RJTA 3M1AA 4YAIA 2FZEA 4MPDA 3IIEA 1H9AA 4CLXA 1ZK1A 3FBGA 4UVGA 3QQPA 5BT9A 2J3JA 4CUJA 4CLOA 1T2DA 2HK8A 4GMGA 2FSSA 1GEGA 3RKRA 1P0FA 1C1XB 4Y98A 4R5HA 5TS3A 1S6YA 1R4MA 4BKQA 3UOGA 3W6UA 4CL8A 1E1KA 4K28A 2VUTA 3KBOA 1KERA 3O8QB 4YJHA 3WTBA 1GUFA 3I9JA 3WR5A 4NHEA 3BMQA 3F6YA 5T5QA 4BMVA 3JQ8A 4DC1A 1ZKMA 3HQ4O 3F46A 3KLMX 5KJ6A 2NU6A 2ZJ0A 2GYYA 2X86A 3DHEA 1HDXA 6ADHA 1S7CA 2BFAA 3PWKA 3B1KA 5JS6A 1XR3A 3FTNA 1GEEA 5L4LA 1DIRA 4IJVA 1F8FA 1BXZA 1Q0QA 2B35A 2NTVA 3ZV5A 1T2EA 4IQGA 3FNFA 1IY8A 1E3WB 1T1SA 2C20A 1IE3A 4L0QA 3D4OA 3ZHYA 4BKPA 1ISMA 2AE1A 4Q3NA 3ROQA 3I1JA 3H7AA 3NTOA 1LSSA 5JW6A 3WGQA 5A9SB 1HE2A 5F1PA 3E5RA 4J9UE 2UDPA 1Z73A 4W6ZA 1HWYA 3PZRA 5DCUA 3KSZO 1ENOA 4TSKA 4EYEA 2VUSA 3NJ8A 1PJQA 2BFOA 2OP1A 3LK7A 3GDFA 4U0KA 3PQFA 4B3IA 3JYLA 2NQ8A 2ZTLA 3AUSA 2I66A 3B1JA 3LF2A 3RUEA 4XYEA 3NUGA 3NYWA 3A06A 3F47A 2JD1A 3BMNB 3ETDA 4DGSA 1YBMA 1E3IA 4Y6RA 1K6JA 2RAFA 4GWGA 2ZB4A 3VDRA 3GUCA 4M49A 1HLPA 1MG5A 3BTOA 5F3RA 3DFUA 2VHWA 4DWVA 1X1EA 3LF1A 3K9QO 4LRSB 1L7EA 3Q9UA 5BSFA 2VZ8A 1ZMOA 1JVSA 1ARZA 4AFNA 4N5NA 2GZ3A 2IZZA 3DBLA 4ZRMA 2DTXA 4D44A 1B7GO 5FEUA 4AJ1A 1QSGA 5CPFA 4K6FA 4UUNA 1G6KA 1M2WA 4E30A 3PHLA 4IGFA 4DREA 1LC3A 1DIHA 4BMNA 2D5CA 2C7GA 4AJ2A 1Z75A 1KVQA 1IPEA 2GN8A 2PGJA 4XYGA 1HDGO 4A27A 1P1JA 1I33A 2O3JA 3C7DB 5JAIA 3R6DA 1Y5RA 4TMFA 4I9HA 1X7DA 2HMTA 3GEMA 3RKUA 5EQDA 1PL7A 3QWHA 4OL9A 3TZHA 1R15A 2C54A 2GASA 4IUYA 1BW9B 1PJSA 1VL0A 4I5GA 5THKA 1Z7EA 2RIRA 4PZCA 1GZ3A 4NBVA 2NNLD 5TLSA 3EVTA 1G0OA 5DULA 3ZW9A 3DBRA 1N1EA 4YWJA 4BNJA 4BO4A 2X9GA 5H81A 4BNYA 4GBJA 4YTEA 2IRWA 1GQYA 3Q3CA 4FFPA 4IIUA 4MDHA 2I76A 4TQGA 3ASVA 2DLDA 1ID1A 4YJDA 1QG6A 2EXXA 3S2GA 3E6AA 3K2EA 2WE8A 4KWIA 1AGNA 1PQPA 3E82A 2XPCA 4BB6A 1CQIA 5EESA 5CDYA 1TT5A 5DOZA 4B7XA 1MG0A 3L6DA 3LT0A 4R01A 2B4QA 5B37A 1NM5A 2JCVA 2AMFA 3JQAA 4R1SA 4YAKA 3KEQA 3UFXA 4DPMA 3ETGA 1MA0A 1KC1A 2AEFA 3WJ7A 1YL7A 4ND3A 1JW9B 1QXSA 4Y67A 3KYDB 1E1LA 2W98A 5JBIA 3X2EA 2X22A 1XCBA 4HNGA 2OBYA 1DLIA 3INTA 5JCJA 1IZ0A 4A26A 4CLDA 4A7PA 3TRIA 3OQBA 4XCVA 5C37A 2EP5A 1HDYA 3PGJA 4BO3A 4Z3KA 2Q1TA 3PWZA 1D3AA 1HDZA 2JD0A 5JAMA 2Y67A 4NIMA 3ICCA 4BNVA 2QQ5A 3FF4A 1U2DA 2PA3A 3V8BA 4FOOA 1U7HA 3OP4A 1LQTA 3HDQA 2HJSA 5KKCA 4E5MA 3I9MA 1Z74A 9LDTA 3OF2A 1VKOA 1WWKA 4YACA 3V1UA 1NWHA 1UR5A 1P1FA 2YZ7A 4D0RA 3ADPA 5K9ZA 4E6PA 4QT0A 2CY0A 1XELA 1U4OA 1B16A 2DBVO 1UDBA 3OFSA 3V2GA 3GQVA 2CFCA 4U6SA 1VM6A 3RI3A 1B8PA 1BHSA 3ONEA 4XEHA 4C7JA 2IDZA 4BS9A 2UUPA 3PYXA 3E9NA 2G17A 3NGXA 4BVAA 1NVGA 4JQCA 3RUFA 2YHIB 4J16A 3EYWA 3GDOA 5IDQA 4U7WA 3ZI0A 3HFGA 2C5EA 2DC1A 3GVCA 2OBNA 1ZIDA 3DR3A 1DIBA 5C3MA 1ZSVA 2D59A 3D4PA 4NK5A 3LQFA 1UXHA 2GZ1A 1PL6A 3ON5A 2AG5A 3G1TA 4LW8A 1RKXA 3ANNA 3BXXA 3I23A 3ZWMA 3B1FA 2AEMA 4BKOA 3KETA 3G1UA 2O3TA 3PI7A 2NV6A 2B83A 1PJBA 3I4FA 4BO5A 3AU9A 4I9UA 1ZJYA 1VL6A 1LLUA 2NM0A 3ADOA 4OH1A 4PRKA 2QZZA 1XLTA 3NT2A 2CDAA 4W7IA 4ZQFA 4RZIA 4ZJUA 4BNMA 1HSZA 1WAMA 4CM6A 4YT4A 2E4AA 4CMBA 5IZCC 1EDOA 3AM3A 4LGVA 4JX8A 3EDMA 4J90A 1K6IA 1BMDA 2UUOA 3NAQA 1K0UA 1PGQA 4MINA 2PD3A 5CPBA 5KVQA 4UVDA 5FI3A 1I01A 4NJOA 2FR1A 1HTBA 3GVIA 3KHUA 4D41A 5TJ9A 1DIGA 5T8KC 1VLLA 1W6UA 3P19A 2BKAA 3O38A 4KP7A 1DRVA 3U4IA 4YRBA 1NWCA 5IN5A 1XHLA 4CODB 1YGYA 4X54A 7MDHA 2OO5A 3V1YA 3DL2A 1CETA 4DC0A 3FRJA 2QW8A 4XYLA 3UAGA 4AJJA 1KY5A 1VE9A 5A02A 4L8VA 5G2OA 3S55A 3JQAD 1DC6A 3FNEA 1BRMA 3I9OA 3PVZA 3JV7A 4OMUA 3ZGYA 4UEJA 3IS3A 1K2WA 1EFLA 5IDWA 1B15A 5JCJD 4PLCA 3SC4A 1MLDA 1M66A 3D5QA 1A4UA 4TRNA 2WD7B 1M67A 2WM3A 3OA2A 4HNHA 1RM0A 1ZFNA 5U4QA 4IS3A 3DB2A 1ONOA 1B0AA 4L73A 4UUMA 3ANMA 3LC7O 2V65A 3W8DA 5KVVA 2PY6A 3FWZA 5U1PA 3HNPA 1NAHA 1P1RA 3KEOA 5A3VA 4LSMA 2C07A 1CWUA 4QUKA 3C8MA 2ZATA 2RCYA 3F5SA 2LDBA 1DAOA 4IDCA 5L4NA 1YWGO 4MOWA 4W7HA 3C1AA 2C2YA 3TZKA 2XOXA 3WNVA 4JN6B 1HT0A 2GRAA 1CF2O 5EPOA 3TSCA 3CMMA 1GL3A 1QMGA 2GN9A 1E7MA 3G17A 4IM7A 4EJMA 2P68A 3IQDB 3WGGA 4PRLA 4AJNA 5B4TA 1HXHA 3RC7A 1VRWA 4QFCA 4J7UA 1IYZA 2HDHA 3IP3A 2VNAA 3JCZA 4XKJA 1T25A 3ICPA 4CPDA 3VH2A 3A14A 3FPCA 4WLOA 2Y68A 1NFFA 2J8ZA 1HE3A 4FN4A 2ZIZA 3S2FA 4B4UA 2WEKA 3P2YA 4O1MA 3WJAA 3ZWBA 1LNQA 2R00A 5JO9A 3BMCB 4KOAA 1E6UA 4Y9DA 4DLAA 5CEJA 2Z1MA 2V6GA 4WCFC 5AOVA 1HE5A 4M89A 3OJLA 1KETA 3OA0A 1MUUA 1W73A 3FPLA 5LDGA 3UICA 2PZJA 3BHMA 4CLHA 1DC3A 4J1QA 3CUKA 2Y1FA 1DHRA 4MKZA 3NJ4A 4Y6SA 4MVJF 4RQUA 4RLHA 5IJZA 1LA2A 4M1QA 1LU9A 2ZB7A 1I24A 2HSDA 3GG9A 5JSFA 1BVRA 2A9FA 1EVZA 3IKVA 3I83A 5A9TA 4GLOA 2BELA 1WDMA 4WLFA 4DQVA 3JQBA 2OL4A 3NTQA 1NQAO 3BMOB 1I32A 3H4VA 5C7OO 2NSDA 3HN2A 2PWZA 5LDHA 2DPGA 4S1VA 3GZNB 3PLRA 2V7PA 4ALIA 1XQ6A 4GGOA 5IZCA 4RVDA 2Y1OA 3U3XA 2W2KA 4IDEA 1UP6A 4ND2A 3QRWA 4CQMA 2XXJA 5A5FA 1N9GA 2OORA 4B79A 2FPIA 3AOEC 3MTGA 3ZWPA 3Q2IA 2ZYDA 4E31A 4TWRA 2PKQO 1H5QA 4R9RA 2PNFA 3I3OA 3UGKA 4H16A 4BNTA 3H5NA 1FDSA 3QVWA 1C1DA 5KIAA 4J9VA 2PGLA 4QSMA 3NDRA 1ISHA 2I5PO 1HDCA 1RWBA 4D45A 2B37A 4IPTA 4IQ0A 3RUCA 3FCOA 9LDBA 3S8MA 4DYDA 2J3HA 1U28A 1ZJZA 3CTMA 2I3AA 3RJ9A 1CYDA 3CZRA 3FI9A 4B7UA 3U4DA 4RVSA 2WYUA 3LC1O 4NNJA 5T57A 1R6DA 2X1HA 4Z0TA 1B8UA 4R4JA 3WBFA 1YRLA 2IODA 4KWHA 2ZCVA 3KVOA 3VDQA 3QE3A 5IFLA 5L51A 2WJPA 3ROPA 1LRKA 4J4BA 1PX0A 3ETEA 3KB6A 1MP0A 1Y8RA 3CEAA 3ASUA 3GGPA 1YVEI 1DC4A 2DU8A 3AY7A 3BA1A 3FR8A 4R3NA 3WIEA 1I8TA 2HQ1A 4XQCA 4ALNA 1CERA 3JYPA 3M2TA 1C0LA 4I5EA 2JFFA 3KO8A 1HE4A 1XKQA 1KVTA 2YFQA 3TPCA 3RU7A 3RU9A 3V1TC 3HWRA 1GUZA 4CV1A 4GPD1 3W8EA 1ISIA 3C7CB 1U3WA 4JIGA 4GX1A 3ZNQA 1T4BA 1PWXA 1B2LA 1Z82A 3DZHA 4DTIA 2GSDA 3PPIA 4TZTA 2QYSA 3PHIA 3UCEA 1TT7A 1WP4A 3QW2A 1DSSG 2PLAA 2Q46A 3F5QA 3F3SA 4MIEA 4RPHA 4E21A 2O23A 4UUPA 3KTDA 5ILOA 1ZO8A 1BXGB 1AUPA 1NP3A 1UZMA 3AI3A 5ITWA 2DTDA 2FPPA 2FPGA 3VKUA 1DC5A 2Q2VA 1KOLA 2AW5A 3H9GA 2CNBA 1KY4A 3ST7A 3BHIA 4IINA 1WDLA 1KS9A 4RPLA 1O9BA 4LVCA 3ZU3A 2CD9A 2HLPA 2EWMA 2IXAA 3BZUA 4LCEA 3RFVA 3UN1A 4YJGA 2EGHA 4PLZA 1MC5A 4P4NA 2Y66A 1IOLA 1ADFA 3N7UA 1EUDA 2NTNA 4BO9A 1NASA 1QLHA 2X9NA 2O2SA 3RC1A 1RYDA 1Y5MA 1NFQA 3OETA 1VSUA 2NADA 4CMKA 2HMWA 2G82A 1GPDG 1ULUA 4DQXA 2X0NA 1G1AA 4HKTA 1IHXA 2I9PA 3IDSA 5ADHA 1D8AA 4PG7A 3DXFA 4CQMD 4BO8A 1LLDA 4QO8A 1YOVA 1KEPA 3PGXA 1H6DA 4XX0A 1DHTA 3QY9A 2YW9A 4J2OA 2A35A 5AQ1A 2JAPA 3ZNPA 1PJLA 1NXQA 1PGNA 1NTOA 4IY1A 4B8WA 4J0EA 1LI4A 3GPDG 4XYMA 1P31A 5ER6A 3U0BA 4LK3A 2ZYGA 1KEUA 4XR4A 3AOEA 5DNAA 3OHSX 2ZJ1A 5MDHA 3OJFA 1OBFO 4YJFA 3I52A 4JBHA 5KJCA 4CQLA 3IMFA 1MC4A 5B1YA 1LRJA 1PJ2A 1JU9A 3K5PA 1E7QA 3DEYX 4FJ1A 5TSDA 3W4KA 3ZWXA 3RBVA 2VHXA 4PFJA 4BO1A 3AY6A 5L53A 1UXKA 3EZYA 5TJHA 3WWYA 1LLQA 3AM5A 1YO6A 4CMGA 3RUHA 1QRRA 5HRUA 2VHVA 3AY3A 2X6TA 4R1NA 1FF9A 4XGNA 5KJ1A 4LISA 1IHYA 4MVJP 1AE1A 4NMHA 1EDZA 3QVOA 4J4HA 3S1LA 1GY8A 3N58A 4MVJA 1N7GA 2EG9A 1VKNA 1V3VA 1R4NB 3ANLA 4GVXA 4E5NA 3D0OA 3B20A 3HDHA 3JQ7A 1DO8A 4PCVA 4TVBA 3NDJA 4EUEA 4MVJG 4ZICA 2AA3A 1WZEA 2RBEA 1PS8A 4CM4B 1XWFA 2Y93A 4GMFA 2VQ3A 4UREA 4HFMA 5L7YA 4S3MA 3HADA 4F6CA 1CEQA 2PKQP 3M6IA 1JWBB 2OHXA 2G1UA 3GFBA 2Y1CA 4UVEA 2NU9A 3L6EA 1SBYA 3WB9A 2FN7A 1RPNA 2EW8A 5J23A 5I8ZA 1UXJA 1AXGA 4RORA 3GNSA 4ROSA 3P2OA 1J6UA 4BOYA 5AVOA 1P0CA 1SMKA 2G76A 2UYYA 2C2XA 5I7EA 1LXCA 3PZBA 3ZCXA 5CAEA 2PGDA 2O4CA 4P4LA 1PJCA 3T7CA 2Y0DA 3KYCB 1ISGA 3IJPA 1C1XA 1GQQA 5ER9A 3UVEA 3OJOA 2A4KA 4YB8A 4FIZA 3A9WA 3O8QA 3KXDA 3WTCA 3GMSA 2W8ZA 3ZWOA 3JQGB 2O3UA 2DPHA 5C5IA 1ULSA 3H6KA 2G0TA 3SBOA 4JJFA 1DPGA 3LSYA 2D3TA 3TL2A 1SZJG 3BAZA 3GY0A 5JMWA 5JYDA 3CE6A 1MXFA 1HYHA 4FFNA 1MB4A 2NQTA 4U0JA 3GLQA 3MJEA 4OOEA 3VTFA 1U3UA 1HZJA 4XD2A 2IEDA 3IUPA 4CLOB 1OZAA 4YRDA 1PQUA 2EKLA 1BTOA 1W0CA 4I5FA 1VPDA 1VSVA 4RF3A 4J6FA 5COAA 4TRJA 3VH1A 4DVJA 4E2ZA 1O95A 3AU8A 3CKYA 3ZNOA 3AM4A 1VL8A 3K96A 4FC6A 4IDBA 2GN6A 3DOJA 4BNZA 3JQ8B 4W99A 1LSJA 2O4UX 4FD3A 5JXWA 4I1IA 5TIIA 1GCUA 4WOKA 1MX3A 3OQ6A 1V0JA 1NVTA 1YQDA 4MP8A 4GH5A 3OJEA 3QVTA 1MV8A 1VI2A 5DP1A 4EZBA 2ZTVA 2AQKA 3JQCA 3AK4A 5F5LA 1CJCA 1DAPA 5DDIP 2QIOA 4CM8B 4EW6A 1ZH8A 4D42A 1YH3A 4IDAA 5IN4A 1I3NA 1QV6A 2XF8A 4CM9A 4GSLA 5MGBA 4L75A 3MWEB 4ALJA 4RVGA 5G0UA 5EQFA 3ZNNA 2IYOA 5BNFA 4L4XA 1DXYA 4MVJD 4A73A 2SCUA 4HY3A 1GYQA 4HUJA 4GKBA 2AXQA 4FB5A 1KVRA 4R5MA 4Z0HO 5L95A 4INAA 5A05A 4WK6A 2B4RO 4JLWA 1I2ZA 3V2HA 4FS3A 1KVSA 1KVUA 1YE3A 2DFVA 5CDGA 1MGOA 2DTEA 3TL3A 3BYZA 4YT2A 4XRGA 3A4VA 3WGTA 2Q1WA 1BVUA 1NYTA 3GFGA 5A9RA 1UAGA 5I9MA 3L77A 3AI2A 3QWIA 5G0TA 3GEDA 1JVBA 3C85A 4AVYA 1EZ4A 2WTBA 4QTZA 5L40A 3CIFA 3PYMA 4BO7A 3CPSA 4M86A 4NK4A 1T26A 1U8XX 4Q3BA 3K8ZA 3RASA 2BI8A 3EK2A 3F9IA 4WLUA 4ALLA 4HFRA 5BNIA 3OIDA 3L4SO 2DUWA 1QYVA 4Y8VA 4YVFA 3MZ0A 1GR0A 5GZ6A 1DLJA 4R68A 1ZXBA 4TRMA 4B4OA 4ONEA 5EERA 4CR7A 1WMBA 3PHJA 1I3KA 4HWKA 4M54A 2UAGA 5IDXA 3JSAA 4JP2A 1GFSA 5F21A 4P38A 2PKRA 2YHUA 4I5DA 4ND5A 1XSEA 2CDBA 1LX6A 1HF3A 1IB6A 1FDTA 4Z0PA 4PG4A 1T4DA 5G0VA 4PZEA 3L6OO 1E3JA 1T2FA 2E49A 2VHZA 2FOIA 1YJQA 2QYTA 5JYEA 1ZEJA 1GYRA 2IYPA 3WFJA 1RYEA 1O8CA 3TOXA 1ADCA 4BNWA 3L9XA 4GX5A 4AG3A 4QX6A 3RBXA 5DN9A 1WNTA 4YDRA 4IXWA 1FXSA 1B3BA 2RHCA 5JDIC 4LSWA 1XGKA 1R0KA 3NGLA 3I9NA 2H5LA 4DLLA 1A27A 3D3EA 3GHYA 3B6ZA 1AHIA 4WPGA 3FTPA 4CMAA 1ISFA 1OC4A 1YB4A 4J91A 3CMCO 4PVDA 3KYDA 1PJ3A 2P5UA 2PK3A 4WE3A 4AICA 1U3VA 4CM3A 2HRBA 4J0FA 3SLGA 4GSKA 3L9WA 3RFXA 1EE2A 1H9BA 3LT4A 1FK8A 1JQBA 4CM9D 4DMMA 1H94A 2JHGA 2W90A 4DRYA 5ITVA 2DKNA 4W9NA 2WWRA 3IAHA 5G4KB 3U4HA 3EMKA 1R0SA 4ND4A 4YXFA 4QEDA 3AFMA 3UW3A 4FGSA 1TT5B 1JTVA 3WGOA 3JQFC 3BIOA 5DBFA 3H9JA 3JYQA 3ENKA 2PFGA 4AJHA 5KVCA 4RDHA 4K9DA 1UXIA 3JQEA 1IZ9A 1NPYA 3ZWYA 2VWPA 4O63O 1E1MA 3DTTA 3B70A 1IULA 1NFRA 1O5IA 4KUGA 5L9AA 4JGBA 5A1TA 1K3TA 4QECA 3ZWNA 1JN0A 1O0SA 5GY7A 3WYEA 2WMDA 1YL5A 5EL0A 2PZLA 3ZU4A 4ITUA 1PEDA 1N2SA 4DL9A 2YHIA 4XYBA 1HYEA 2R00C 2QZ9A 4IJUA 3DHYA 2BD0A 3P5SA 3GT0A 1YS4A 3OJ0A 3VTZA 3QSGA 1V3UA 4PGFA 3C1TA 3DMTC 4Z9YA 1QR6A 1HL3A 4HFJA 3GG2A 4HBGA 3SXPA 3KV3O 4Z9XA 4FFLA 1FDWA 1SB8A 3OMLA 4MVJH 4NU5A 4WCDA 5IZ4A 1Y81A 1F06A 4OQYA 2EEZA 2Y1EA 3GN1A 2EGGA 1SEPA 5G0SA 3AUTA 3JQBC 4FFRA 4ZN6A 1R0LA 5EIOA 5FF9A 3D5TA 3NV9A 4JCOA 3RQSA 3H65A 4J3FA 5FFFA 4R41A 3I5MA 1GZ4A 4K26A 4BGEA 1NQ5A 1LUAA 3VHRA 2I65A 4E0BA 3E03A 1WLYA 3UCXA 1CQJA 3ZWVA 3F1LA 4PZDA 4GL4A 1TB4A 3PQEA 3M1LA 3HG7A 1A9YA 3DQPA 5ILGA 1C0IA 1H93A 1SEVA 3CXRA 4PG8A 4XB1A 1K5HA 5TRTA 1J5PA 1I10A 1XU7A 1LC0A 4PIVA 5T67A 1ZBQA 1P44A 4M8SA 2E48A 5JDIA 4IQ8A 4J4TA 4BV8A 1KEVA 2DBQA 4OIMA 3D4NA 3D7LA 4LRTB 4NZ9A 3ZZNA 3SC6A 5JDCA 2CDCA 4DPKA 4RPKA 1E3LA 2HKIA 3DZGA 3NKLA 2AQIA 4Y6PA 2HJRA 4NI5A 2F1KA 3VOSA 3WICA 4E13A 3LC2O 3FN4A 1PGOA 2JJYA 2WD7A 3HHPA 4CMIB 1NQTA 2HU2A 2FY8A 2NVWA 2ZKLA 1HDRA 2I3GA 2P2SA 1P45A 2HRZA 4UAGA 3EHEA 3ROMA 1E7SA 2CMDA 1VJ0A 2X23A 1IPFA 3TOZA 3FD8A 4CMEA 3VZSA 4OO3A 1QYWA 3F1KA 4O59O 4LMPA 3O26A 4B8ZA 1QORA 1GV0A 1I3LA 3RWBA 4BO2A 1Q2XA 5B4VA 3QA9A 3JQFA 3H5RA 2J5KA 1NQOA 3BTVA 3VKVA 1U2GA 2PD4A 1LDEA 1PGJA 4PLHA 4XJTA 2Q49A 2X5JO 4OXYA 4PVCA 4NPCA 1P74A 2GERA 2D2IA 3V2UA 1YQXA 3AJRA 4TROA 4WECA 5I9NA 4JROA 4BNFA 1ZNQO 2X0JA 4BL5A 1O6ZA 2VZ0A 4RV9A 1E7WA 4B3HA 4GVLA 4ZA2A 2I99A 3BMCA 3TJRA 2JKVA 2OXIA 1KIFA 2WDZA 4MJLA 3U62A 3PJDA 2JAHA 3H3JA 4NJMB 2POQX 3CZMA 3FR7A 1PSDA 3INRA 1PS0A 3DBHB 3DMTA 1YJ8A 1DFGA 4MIYA 4CM5A 5BSEA 1QV7A 1QYCA 1OOEA 1LDBA 3WWZA 1UP4A 2F00A 2PH3A 3GVXA 4PLGA 4MIOA 1GQ2A 4J1TA 3VVBA 5JNLA 2GZ2A 4CV0A 3MOIA 3BMOA 1E0DA 1JWAB 3H9QA 1LDYA 1EVJA 4RF2A 1NVMB 1X0VA 1N5DA 1VC2A 4D3DA 3JD0A 5HS4A 1UH5A 4L4RA 3PEFA 4NDNE 1E7RA 5KVSA 4E12A 4IGEA 1VJTA 1WW8A 2BGMA 4ZU3A 1GCOA 3WG9A 1ZSYA 2FMUA 1Y1PA 3ZU2A 1V35A 5KNLA 4XDZA 1U8FO 3NX4A 3AUUA 3R3SA 1ZK3A 2H9IA 2A94A 5IXYA 1I3MA 4UUOA 5AXAA 3GPIA 3GK3A 1U5CA 3VH3A 4F46A 1WDKA 1BSVA 4A03A 4RGBA 3Q0EA 1N7HA 1EUCA 4BGVA 2V6MA 4E5KA 3H2SA 4RVHA 4BKRA 4EJ0A 3MJ4A 2HMUA 1X7HA 1SCUA 4U6QA 1N9GB 3PXXA 1G0NA 4R3WA 1UZLA 4XWYA 3WNQA 4KQWA 2EJVA 2Q99A 1LDGA 3LDHA 5COBA 5DBGA 5ENDA 2WD8A 3C1OA 3PJFA 4TVOA 3MJSA 4O5OA 1A5ZA 1HZZA 1KC3A 5B12A 3MJTA 1C1DB 3RFTA 4IJWA 4OXNA 1Q0LA 1KBZA 3IP1A 1Q0HA 3WGZA 2O3QA 3GN2A 4FFMA 2VRCA 1PJTA 1JAYA 4R51A 2HK9A 3D3WB 5COQA 1LTHR 3DBVO 3ULKA 2VYNA 3AI1A 4FJ2A 4GLLA 4Q39A 2EKQA 2Z1NA 4H7PA 4ID9A 4DMLA 4GX2A 3UCFA 2ZYAA 1Q1NA 2VWHA 1NR1A 4Q3CA 3TFOA 2DBRA 2IE0A 5ES3A 2ZQZA 1GYPA 2YQ4A 3ZV6A 1ZUD1 1XQ1A 5DBIA 4CMJA 4CUZA 3GMDA 1ORRA 4G65A 1BXGA 4BO6A 2AQHA 5KKAA 3PK0A 1Y8RB 4GI2A 1SNYA 1PZGA 4P4GA 3ZHBA 4CR6A 5IAAA 4YAJA 2CUKA 2YYYA 1MFPA 1Y8QB 3FNHA 4YEDA 2GR9A 3R0IA 4Q9NA 3ITKA 3KOUA 4OXKA 4KTTE 1LJ8A 1ONNA 3GEGA 3TF5A 2Q2QA 5HS6A 4XIYA 1H6BA 4IMRA 3VPSA 2D8AA 4LVUA 4WEOA 4K6CA 3DO5A 3HJAA 1HDOA 3ABIA
chains in the Genus database with same CATH superfamily
4WY8A 4WIAA 1JNYA 1Q1AA 1TCVA 4Z51A 1ZGGA 5MFPA 3CVXA 4FP9A 2D62A 4ZU1X 4RCVA 5AJTA 5K6AA 3M89A 1PLKA 4UBIA 2YY7A 4UTPA 3Q11A 4QFDA 4WCFB 5IABA 1M1YE 2XZDA 2R25B 5AVJA 3T52A 2YJTD 4B1FA 4XIIA 5KOYA 4CJXA 3T1YB 3AL0C 1O95C 2BDUA 3ND8A 2QN8A 3C16C 3F4LA 2NP7A 4DR2B 2J5BA 2XQVA 2X41A 3GJTA 3E61A 3Q3JB 3BOSA 5B1SA 3H9CA 2PMEA 3TH5A 3THWB 3EZNA 2I22A 4KQ1A 4N3NA 2V9ZA 1FX0B 1N2CA 3WGIA 4GC5A 2O6HA 4L8WB 4YCBA 2FHSA 1OMOA 1FS5A 3FBWA 4KH0A 4RL6A 3CLSD 2QP4A 4BNLA 2WUFA 5EMMA 3VKWA 3ZGLA 2F9FA 5IFKA 1GADO 2VRNA 1E96A 1L5WA 2XSZA 4Q3DA 1FVOA 4MWBA 4WN9A 3E1KA 3ZGVA 4AXBA 4GM0A 4CM7A 3GUUA 2P69A 3ZWDA 1T4GA 1W7AA 2HBZA 2X5NA 3EC7A 4BEVA 1H65A 1QIIA 3K92A 3KQOA 4FDAA 3OECA 3CLRC 1G8AA 1AIPA 3L05A 4RO0A 3MWDB 4RWEA 3WL6A 2VDQB 5CA1B 1AQNA 3HJFA 1EQ2A 2C77A 4MR8B 1BWSA 2XA2A 4P2BA 5TC4A 1XDDA 3TKAA 2MSNA 1XYGA 4JMLA 4X3PA 2D6FA 3Q7SA 2VCHA 1RRGA 3ZHXA 3PQ7A 1X7YA 1YB5A 3KOXA 5DJ5A 5HFNA 2WFZA 2NW6A 4L22A 4GRDA 4NICA 4JVNA 5FPKA 2PAAA 1ABBA 2RGCA 1E6EA 1U6IA 2HK7A 3ANYB 2V54A 3KBBA 2W9XA 4O2AB 5KTTA 3SU8A 1F5SA 5E2BA 5B1IA 2X8JB 3ONFA 4M1YA 4OQZA 4BC1A 5B6PA 5IT5A 3FTQA 2GPJA 2HMVA 4IDGA 3QHAA 3FLEA 2EZ4A 1J0CA 1TM7E 4OQNA 2BBOA 3UOAB 1X13A 3N8HA 3SIWA 5DI3B 3H2KA 3OQNA 3QU2A 1J70A 2K7ZA 1KGDA 2PGXA 2ZBPA 3G0OA 3MJFA 1UODA 3P7MA 4ILKA 5D85A 5CB4F 5JRJA 2XUZA 4UE2A 4JL5A 1KI6B 3E22A 4K8OA 1VOTA 4JH0A 4PF1A 2L69A 1GXSA 4MZXA 5KTNA 5JJLA 4JI2B 2WVHA 4NZYA 3BXZA 4XPIA 3WIOA 1I6KA 2X0RA 3KLNA 3A8TA 4N8SA 3VR1A 1I4WA 2AUNA 2QDKA 3KYJB 3ORFA 2Q8QA 3L92A 3N74A 4DXAA 1Q7BA 1KDYA 4J49A 3IUQA 4PAOA 1FDVA 1OI7A 1Y3DE 2FUCA 2HSEA 3GRKA 3RSSA 5BV2P 3RADC 2QPAA 2Z30A 4FNAA 1R6BX 4XSHA 4LJLA 1DAKA 4WLNA 2OUIA 1A4IA 1CR4A 1PUXA 1YR3A 2WHEA 4ZYUA 4L15A 4DB4A 2P3LA 2NUPA 5CXQA 1ZW1A 2XYQA 2YY5A 4I9GA 3D64A 4QXQA 4M0UA 3KU4A 5DIZA 3SCZA 3SM9A 4DDWA 2AG0A 2LVBA 2E3JA 2FFRA 2ZR0A 4PNZA 3KUXA 2JFHA 4FC7A 3HYRA 2AHRA 5CITA 1N6RA 1RYMA 4NBTA 2VPYA 3BZBA 5GIOE 5KQMA 2Q50A 3WX0A 3FCEA 5IU6A 3OG9A 5EHQA 3ZZUA 4C4AA 2AYZA 3CH7A 3ROGA 5KWVA 2ILTA 1JEAA 1G4AE 1H2RS 2EKBA 2C8KA 3DAPA 7ADHA 1F7VA 2NTJA 4MEJA 2CXOA 4O4IA 1CK4A 1SXHA 3T3MB 3QSYA 1FP4B 1BG6A 3DLPX 5I9LA 3I01A 4KR6A 4RULA 2QN9A 1NVXQ 3EB9A 4R81A 2OMKA 3GUZA 5FJJA 2BSXA 2IXEA 4V0SA 2JFZA 1DAHA 3D1JA 3F4BA 3P27A 4TRRA 5BSUA 4QPCA 3OWOA 2XB9A 3OEWA 4NU0A 2G7MC 3X1KA 3AONB 4EBFA 2Q4DA 5HUHA 1CULC 1G5TA 4BTVA 2FPRA 8ADHA 1R4MB 4I5IA 2QRZA 1E3WA 5BR7A 3INGA 1W19A 4LHXA 3W6PA 2ZSAA 2RKWA 1X7GA 4Y2TA 3SFZA 2C0PA 4Q05A 1HPLA 3W5AA 2RH9B 4YCNA 2GCGA 1UKYA 1PR5A 4NFSA 5LD2C 2XSZD 2O48X 3AHCA 1P4RA 3LUJA 5AK0A 2XMRA 1P33A 1R66A 2Z2JA 3QUCA 2HEIA 4AZ0B 4RF4A 3RKSA 3TOVA 4K5QA 4YAEA 3UB4A 5A9SA 1KK3A 1DKLA 3H97A 4X64B 2H7YA 1JDUA 3ZDXB 3PKZA 2BFBA 4FGLA 3TTUA 2D7JA 2XMDA 2NP6A 3VC7A 1BEEA 4G0OA 2VA8A 2RHBA 3EWIA 4OKIA 3WRWA 4GUDA 3KSUA 4UM7A 5LPNA 5FWXA 5BRNA 3E4DA 2YR0A 2NYVA 3NXSA 4R2HA 5GGXA 3ZCUA 1K4KA 2HF7A 3DV9A 4WESA 2X5OA 4DBVO 1KMCA 2QW1A 1ZH6A 4EEKA 5IM4A 2PJRA 2BFDA 2XUAA 2C29D 2I4LA 2C42A 1IHDA 2H2IA 4Z4IA 1HQCA 4KYTA 3NWEA 3KCNA 1QCYA 2QHXA 5JAOA 1KE1A 4L0CA 2Q6LA 3CVUA 1OD6A 2W22A 1WSBA 4IHJF 3CCCA 3RIHA 1CS0A 1SBIA 4Q4JB 1IRXA 4XLLA 5ALRA 2Q2WA 1Z4LA 3PCRB 1TMYA 1V45E 2BFMA 2H1VA 3WDMA 1TO2E 3LBIA 3IVCA 1T5LA 3FZEA 2A5GA 5JZSA 2X58A 1N5JA 1G9TA 5E8JA 4UM5A 2B1IA 3CW2A 3MXOA 1E5XA 4GLBA 3SXUB 3P0JA 2C0QA 3PYLA 1U3GA 1J24A 4OP3A 1F8GA 1W4ZA 3MTJA 4RBNA 4UHEA 5ALXA 3SOPA 4BQRA 1YQWA 1ZK4A 2ID7A 2QOEA 4JR2A 5G4LA 2IU0A 3MXTA 3L2OB 3IE2A 1G21B 4FFOA 2SCUB 1GAEO 3DEJA 1XMPA 5FTJA 3WDSA 4BP9A 1MO6A 2WW8A 1YI1A 3VPFA 1L7MA 2PMFA 1AUXA 3K0HA 1IXKA 3MBOA 3ZDEA 1M8FA 4Z4HA 3D7KA 4M1EA 5BVHB 2WHXA 4BMCA 1V6CA 2RMKA 3IHWA 3JWJA 3QV1A 4GNRA 5AXDA 4CEIA 3EF3A 1WZUA 2PRYA 4EG5A 1S01A 2W2MA 3C8ZA 2XH8A 3O1HB 2B4TO 5EJ2A 3TR0A 3IQHX 1O97C 3QITA 4QEKA 3OTIA 3B85A 5KEIA 3I8XA 2XA1A 4TV9F 3AQ4A 3BDIA 3FNGA 1W88A 1THMA 1XRQA 1WL8A 2X8AA 4NAVA 3T3GA 3VTAA 4NRDA 4AK9A 5BNTA 5J4YA 1O08A 1VXOA 3PWSA 2ATCA 3W1EA 2PJUA 1KMMA 3ZC3A 1KIMA 4F0JA 3EXFA 2OA0A 1RACA 4OHPA 4RZXA 3ZV4A 1SKUA 2JFBA 3MYRA 1QK3A 3OPXA 1X87A 5BN4B 3N86A 3SEFA 1MFZA 2QM0A 3MTIA 4B35A 4BRUA 1XZEA 2ESRA 3FLMA 4XR9A 4ANFA 1V9LA 4RHFA 4BUZA 3PLNA 3UG7A 2R6JA 1WBDA 3E84A 1V16B 2WWXA 2H29A 4I3FA 3CM0A 3ZZ1A 5IRCD 3IUBA 4G24A 1U7TA 5DCLA 2QKYA 3A9RA 4F12A 1L4EA 3I62A 2IYQA 3OZDA 4ETWA 5DU2A 1Q95A 1SKAA 1D7OA 2WHYA 4V3CA 3WXBA 3WQQA 4EGCB 2I7XA 3R5JA 3UH1A 5L7TA 3RH0A 3QENA 1NC1A 3DWGA 2YQ5A 3K0CA 3U60B 3LKDA 3SG0A 5CGQB 2XJ4A 3JQ9A 4LYJA 4GPTA 1QKIA 2AG8A 4I1YA 4RIFA 1EGHA 1ISPA 4BNDB 1R8SA 1CD5A 3PDUA 1N6NA 3UNXA 1W36C 5HUJA 3IEPA 1J23A 2HIMA 4Z9BA 5CBPB 5G1PA 1YC5A 2VDNB 1EKXA 1GNQA 4BVHA 2FN8A 4BNUA 1L5OA 3A11A 4FQ8A 1ANKA 4G2NA 1X80A 3WIUA 1VLQA 1Y82A 3IKMB 4OQEA 2HHHB 1QOQB 2AOVA 3C41J 2X4GA 3D6AA 4BWFB 1AC5A 4MDFA 4N76A 1VHWA 5JSYA 1YS9A 3N7AA 4ZKEA 4UULA 4JUAA 3C15C 5KC8A 1FOEB 3AFHA 4YAUA 2WIAA 5HJ2A 1C3OA 1EMDA 1VJ1A 1YRWA 3WQHA 4H17A 2XA9A 1ZESA 3SYMA 5DF1A 5IKOA 1U2GC 4R6WA 3V5NA 2B6NA 4LF6B 5AKHA 5I9SA 3H1TA 4K46A 1SPBS 2PH5A 3BDVA 4YT5A 2JKYA 3X1WA 2GN2A 3H2ZA 2HQSA 4MKRA 2Q4TA 2HC9A 2L0XA 4OM7A 3NIFB 4F3YA 1Z5OA 3PX7A 2QP9X 4QG7A 4EKDA 2RGBA 2VT3A 5ARCA 4DSAA 1F51E 5KSPA 4OLAA 3HO6A 4HYEA 3DFZA 3FE2A 2HFKA 3O8OB 4M87A 4L08A 4F1WA 2IYVA 1UAYA 3DNFA 5K0EA 3I42A 1RYBA 1Z26A 4XH9B 3S81A 3CVVA 1RMTA 5GJWC 4UNIA 5DGXA 2ZJYA 4KDFA 3NWBA 3TLGB 4GI5A 3R9XB 2YRXA 1E6CA 2XWPA 4KXXA 5I5GA 1B0PA 2A1TR 2LDXA 3JR7A 4KQXA 2ZBEA 3V34A 3CSUA 4BQEA 1GZ5A 1L6IA 3B7PA 2B25A 3O4HA 4HS9A 1Y6ZA 4PPQA 3FOEC 4FJ0A 4F91B 3TI9A 3PTAA 4JJ4A 1KQ3A 1VJDA 1VKHA 2QMEA 3DC7A 2QT9A 5CEFA 2Y0CA 1KOGA 4K2HA 1U0LA 3BC1A 2O52A 3UT5A 4ENUA 2O2XA 1QWSA 1A04A 3KQHA 1YONA 4FYWA 5A5GA 3KJZA 3FSRA 1QP8A 1SKYE 3E3LA 5DI9A 2OYCA 4X66B 3CF4A 4MWGA 3IMGA 1RLUA 4O4LB 1JDJA 1G8KA 3PE4A 4LCJA 4DIFA 5HSGA 4UUBA 4E88A 4NCJA 1V37A 1A76A 4EOGA 5C8ZA 2CK3A 2C3OA 4BDTA 2CT8A 3U5ZB 2P2LA 2YY6A 1CRWG 4EI7A 4FEEA 3AC0A 4D4KA 3LX8A 4RK5A 4U5QA 4M6WA 5AI6A 3VZDA 4PCAA 5C8YF 1RHKA 1ZHOA 3QYAA 3OOHA 5K3FB 1YB1A 3EW9A 4W4TA 2OZPA 1XPUA 4DMHA 5L7WA 4MRMB 4KLZA 3HDGA 4ZV9A 3LU1A 4L76A 3MJVA 2RB5A 3TSYA 1FP1D 2AE2A 2P2YA 2EQ5A 2JHFA 4OFXA 4REQB 5FYDA 4YPVA 2HL6A 1CIVA 4G8BA 1EESA 4OKSA 1V4BA 2WYWA 2IXDA 5K8IA 1DC7A 3CLUD 5IJXA 1E3EA 3U9LA 2PUEA 1RLMA 4RLQA 2GUWA 4AP5A 3KJEA 3BX1A 4QDTA 3EG5A 5FADA 1M6EX 2XT0A 3HE3A 3OEHA 3S1AB 5JH7A 5JNUA 1UDRA 1UXGA 3K0FB 2X42A 4W1PA 5HIJA 1CQJB 4J43A 1FJHA 1PZHA 4Z4CA 4C7OA 4OXXA 3L8EA 1DL5A 2ONZA 3NHSA 1SKQA 3NT5A 4UQOA 3I6QA 4S1OA 3TEFA 3QG1A 3ILXA 1Y3BE 3KFLA 2I6UA 3CVWA 1T1JA 4HDNA 5KJEA 5GWXA 3TKLA 1XNRB 3GVHA 4JI1B 2JLWA 4WFIA 3WMRA 1Y7TA 1LBHA 2YWRA 1WMDA 1JNXX 3QOXA 2LCQA 1WA5A 1JTEA 4RJKA 4HXEB 5K20A 1GTMA 3P4UA 4EQ6B 3KAKA 1QBKC 2O8DB 4AJLA 2OV4A 5EMHA 2XYVA 2XQJA 3LE8A 3QFFA 1U8YA 1Z7BA 3ES9A 5CYOA 3WMEA 1RXYA 3PRYA 2ZZMA 1E9EA 2DFDA 1KI9A 1L5SA 2DQ4A 3L43A 1M0WA 4KXNA 3VZQA 3LM8A 3CUYA 1UMDB 2XOEA 3UB2A 1W4RA 1J22A 3RTDA 4AJPA 1X2BA 3EZLA 2Q21A 5AKZA 3LTNC 3U3DA 1QYXA 5H4GA 5I5EA 5I01A 5JBQA 2JGKA 3M6VA 4D0SA 3E9RA 2VXCA 4WZBA 4LRWA 1O7JA 1C3LA 3OOEA 1H4SA 4LI3X 1QTQA 4JKYA 4NH0A 3N9IA 2IY9A 2J5QA 1L5RA 1VA4A 1YHZA 2QEQA 4NFYA 5FI5A 1TF2A 2V6FA 5EIAA 3DP7A 2XCSB 4RTNA 5CK4A 1U6JA 2O1WA 3ZE0B 1GAWA 3QPAA 3STHA 3D2LA 1GV1A 1NR5A 2XD9A 4Y1FA 3VX4A 1KFEB 3E58A 4D80A 1OWNA 5D87A 3A70A 4HH0A 3KKEA 2FE4A 1PNRA 4L2IB 5HM8A 3GCXA 3IVGA 4BKUA 3HYSA 4BVGA 3KR0A 5DHQA 3KLOA 4BB5A 2BI7A 2CFOA 4S0ZA 1F8XA 1K1EA 4PSCA 1M34A 1M1ZA 1MVOA 2VYCA 1E0SA 4HLDA 4EHFA 4FX5A 4OHBA 4QGFA 2C82A 3G1WA 2X0DA 2V4MA 1VZ2A 2BGUA 3CY6A 4S1PA 1RQLA 1NVBA 2XNCA 1G66A 3QLJA 2R65A 4YQZA 4FMDB 3GA0A 1GU1A 4OHWA 1UJ6A 2CK3D 1W8DA 5AI8A 4Z7NB 4Q18A 4G36A 4TL9A 3SS7X 4DEVA 4CTJA 2HW8A 1MBZA 2WPNA 4C5AA 4DDVA 5JMPA 2A92A 3WLEA 1USGA 2BDTA 3CKKA 1W4AA 2Z56A 3GJYA 1P9OA 1TLTA 4DJTA 3O8CA 4IS2A 4ES6A 5J2UB 3NOVA 3A1TA 4MWZA 2VK1A 3R23A 3L0OA 1W85B 3C7AA 3ISTA 3K9LA 4XQGA 3W1WA 3NBFA 2RGYA 1PL8A 4ESOA 4ZMRA 3LQYA 4FSDA 2O3RA 5KQLA 3NC1C 1AB5A 4M9ZA 1UMKA 2JCYA 4UUQA 1DJOA 2XT9A 1JFTA 1THGA 3NEYA 3TZQA 1NZJA 3V9AA 4QGSA 3TECE 2HSGA 5JLAA 3BSYA 1CUFA 5L3VA 5K2OA 1OBVA 2Q0XA 1J0XO 3BCUA 2F4VB 1N36B 1Z8FA 2Q0SA 3E70C 3EVNA 4F3RA 3RG2A 4H60A 2P4HX 4ZAFA 1F6BA 3OBIA 4MGIR 4JKIA 3OEHD 1NOIA 4HQLA 5LZ4A 4KHPB 1RC1A 3K31A 1Z2PX 1V1MB 5DHFA 3WYBA 2J6IA 1OV4A 4A23A 1V96A 2HCFA 2EC5A 1XCLA 4HH1A 4B3JA 2ZWPA 4KZPA 4URFA 4NCHA 2QJWA 2NU8A 4URVR 3THXB 1Q11A 3WI7A 4BZXA 1XD9A 2EOAA 4RK1A 3BWDD 2CV2A 3HDYA 2BF7A 2AUMA 4CN8A 1TVKA 2QX9A 3UK2A 2ZIUB 1D6MA 1SUDA 4GE0A 1E66A 3D2AA 4J7CA 4AJ4A 1VG9B 1P75A 2M32A 4S05A 2GPWA 1IBKB 4FD2A 2GNPA 3PRHA 2WJJA 3EULA 1PBNA 1ZM9A 3ESBA 5H8WA 4Q93A 1GNLA 3OM1A 4DJ5X 3V9PA 1Z4JA 4MV0A 1F3OA 3HXPA 1NRXA 4W1QA 5JZMA 4HL6A 1MIHA 3D3WA 1UJ4A 4E15A 1QP7A 1PP4A 2YDXA 2VJLA 5DCYA 3MRTA 1RBYA 2C2HA 1XWIA 3UA4A 3TIIA 1U2PA 2I6SA 4RHTA 3KLPX 3NYRA 3URMA 3IL2A 3N39C 1K7SN 2YJZA 3DTYA 4I1OA 3JQ6A 3W2IA 1GQOA 3DOOA 2HZ7A 1CUWA 4TMWA 4PXAA 3NC4A 2RC6A 4IGIA 1W75A 4YR9A 2WYHA 1U3TA 1QX4A 3PI6A 5DHRA 2N47A 1KEZA 5CDFE 2VYQA 1MAUA 2D2VA 3GO4A 3SSNA 4J0QA 5FUWA 4JYZA 4PIMA 1N8TA 5LMCA 2AOWA 1BGVA 3K30A 1ORHA 5ICFA 1T2AA 2B69A 4F6LA 3W4IA 3U3JA 2XTJA 1IQPA 1TADA 4LQDA 3ZDFA 1XXHB 5J47A 2CVHA 2NZYA 5CG2A 1QCCA 1C7RA 1NBOA 1Y9ZA 4GM4A 4PLYA 2W8BA 3LPLA 4WTOA 3X1JA 3ZI4A 2ZAIA 3QBDA 5JTTA 5JC8A 3I2GA 3WLAA 3WLFA 3LWNA 1L5NA 2ZYUX 2J0UB 2SKEA 4YUWA 1DIAA 3FI0A 1FFDA 4ITRC 5K45A 4UCWA 4EF5A 4TWJA 4Q02A 3DMYA 3DLCA 4KXWA 4K1LA 5M3BA 13PKA 3S4YA 4QC2A 1BE8A 4WKCA 4JENA 3ZGZA 1QH1A 3KS9A 3IOCA 4H1HA 2FPPB 1E5VA 4L3VA 4M9QA 2EFHB 2X1LA 3DLBA 3FDXA 1ZIOA 1RSZA 1T4CA 2PKCA 2YWXA 4LY6A 5HHTA 5HUQA 5CB4A 3PGLA 2QPOA 3UJAA 4DSZA 1WOYA 4UAUA 1DRWA 2EKPA 3ED5A 4MV4A 3WL5A 4F4IA 4TKMA 2GO1A 1OI4A 1SUFA 2VS1A 2JFUA 3X43A 4CRWB 1VMKA 3O2SB 4BFYA 2Q9AA 3LXUX 1KBQA 4GRAA 4HZUB 1D07A 2Y4NA 1CY1A 2EV9A 4KKVA 4L5YA 1J20A 1XZNA 2HWWA 5ADWA 2OFPA 3BA6A 5EXXA 1RXEA 4BIIA 4CLRA 1HM5A 4FR0A 5THXA 2GF9A 4KUEA 3R8CA 2EHDA 4WNIA 1J9EA 4U3JB 1BDBA 1ZP6A 3EXEA 4M38A 3CW9A 3CCFA 3IPLA 3GD7A 4NBSA 1PZNA 4IFIA 4P92A 2J9FB 3J7TA 3BSWA 1R16A 4C4ZA 2EQBA 3WSWA 1KEEA 2ES4A 4M0PA 4MR9B 1UKVY 1PV4A 3KALA 2QTHA 4KFRA 4MI3A 1QAQA 2NV0A 4II7A 5BSTA 4KQMA 4E4TA 2BEUB 2OQRA 1IWPB 4JOSA 1AO3A 4LA4A 3D8TA 2ZTUA 3B3GA 4MW9A 2WT9A 3W2HA 1T29A 4A36A 1YASA 4MPPA 2EP7A 1TQHA 4QNRA 1E1CB 1ZVKA 2G83A 3MMPA 3PA8A 2H2WA 1UF9A 3Q7TA 3QYPA 3DYBA 4KW7A 3T1TA 2WTUA 5KAMA 5ALYA 4LHVA 4QARA 1VLMA 3M4YA 3QJGA 4QWWA 3S40A 3VV3A 1C50A 2FSVA 3F7NA 4YJFB 5CX1A 3B36A 1TAHA 4B5LA 1T4MA 1TKRA 3HFSA 4KYVA 2W70A 1XKLA 2WJAA 2CNDA 3W04A 3IGFA 4YJKA 3RNLA 3P0EA 1P77A 4ZALA 1HDEA 1JAHA 1E92A 1TU3A 4P33A 3EVDA 2TMGA 4RVUA 1G9SA 4Q4HA 3O4IA 5AJVB 2NU7A 5AK5A 3WC4A 3T7RA 3WLOA 2O1SA 3MILA 4ZD6A 1XTTA 1VZ3A 1OI2A 2Y1KA 3UMRA 1VB5A 1N9KA 3NRCA 3N8DA 1XEXB 1TKCA 2BTQB 3WNDA 4KRXA 3IR5A 4XQEA 2G8LA 1G291 2Y1WA 2XB2A 3G5AA 4AURA 4YLEA 4ZT6A 2CKMA 1R1DA 1DKNA 1DTWA 4IL5A 1D4OA 1YB2A 1IXYA 2HXSA 1KJNA 1F1BA 1BDMA 2IY7A 1RT9A 3KTFA 4G8DA 2VFAA 5ESWA 1GTG1 1Y1TA 5EXDA 3LP6A 4ZRDA 4FNMA 2E1PA 1AN9A 1VPLA 2FA9A 2XRMA 2FPWA 4KSCA 3BCHA 1RI4A 5ECWA 3NBUA 2I1VB 1NDUA 4G1VA 4MYUA 2XAAA 2HIHA 5HTKA 4DR1B 2X6QA 4EVSA 1W93A 3TS1A 2QVGA 3SOZA 1RHUA 5JBNA 5LP6C 4MUAA 6ABPA 4U2EA 4DLKA 2FN9A 1KJJA 3DEFA 4QUDA 1DADA 3OZCA 1FXWF 3NKVA 5BORA 3T4EA 1EVQA 3EQ9A 3PBKA 4M0FA 2QRQA 4KXQA 4PG5A 3NLLA 3HCRA 3LHIA 4ZCQA 3EXIA 1PWZA 2P3QA 3A0RB 3HCDA 2EG5A 4YAIA 4KE9A 4M7WA 2W4IA 1DBSA 4MPDA 3A9UA 5FBQB 1TU0A 1XLUA 4K88A 4P0QB 10MHA 3WKDA 2F3SA 1Z3IX 2J3JA 4ROTA 4CLOA 1OGIA 2PHZA 2M6RA 3V3KA 4ZVRA 4COKA 3W2FA 1Y0BA 2PT5A 3DPSA 4G1EB 3O9MA 2X7XA 4MGYR 5L3QB 1G6Q1 1LQ2A 3IOEA 4R5HA 4QTUB 1S6YA 4K81B 2A6PA 5EWLB 3UOWA 2DB3A 1Q77A 2JEOA 3ED1A 4Q6WA 3G23A 2DY0A 2JLSA 3PL5A 2VUTA 3O8QB 4EKIA 2ZROA 3OKCA 1RYZA 5C1PA 1E9BA 3AP3A 5T5QA 3IR6A 4DC1A 3ZQUA 4ATNA 4OLHA 3HYCA 4QU0A 4ZKDA 1K7XB 2ZJ0A 3CX6A 2JLYA 3NJRA 2E18A 4Q4CA 2P6UA 4WUTA 1ISRA 2CGEA 2XWSA 3L0CA 5FBRB 4LDNA 3HCWA 1XZ8A 1JZTA 3JVVA 2Q28A 3KOZA 3L8CA 3PWKA 2XQIA 3A6DA 4HRAA 4H7KA 1XR3A 1VSQA 2BFEB 1Y7LA 3TD2A 2L17A 3B1VA 3IOMA 1Q0QA 3JAKB 4E6EA 4IQGA 2A9OA 2IYAA 4L0QA 4JBYA 1XFDA 4PQRA 2DJIA 3SHVA 4ADSG 2VSOA 4G5OA 1M1YA 5IH3A 3NTOA 2AFHB 4PZYA 1FSGA 5IJ9B 3HBMA 5B2EA 3WGQA 1EE1A 1T5DX 4ZJZA 1L1RA 3E2PA 1Z73A 4S2EA 3FGZA 2C99A 4GP7A 3FJOA 1ENOA 4NQRA 4TSKA 4RTOA 1CZLA 1U5BB 1USWA 1X7WB 3P32A 1OLXB 3GDFA 3OZVA 4ZJPA 4CIAA 5CU7A 1VPWA 2H51A 4LJSA 2ZTLA 3CBGA 2I66A 2CN1A 2RGNC 4N8DA 2VR1A 3Q88A 3CF6R 2VTBB 2VQDA 3N8IA 2OK7A 1RNLA 3NUGA 3F47A 4QODA 4WBNF 5CNIA 5HM6A 1BE6A 2WICA 5CRIA 4TL7A 3UJ7A 3TR5A 5LJIA 1IOZA 2C9BA 2QTCA 2XB6A 3PQ5A 4FMPA 4BN0A 4D99A 5EXEA 1EWQA 1XTJA 3GUCA 2JBAA 3JWIA 3OEEA 4RK4A 4W6QA 1CUIA 1HLPA 1MG5A 3AHFA 3BTOA 1GN9A 1JG1A 1PWYE 2VHWA 2ZU6A 3CNNA 4LDQA 5IVIA 3VGJA 1I6LA 1W5FA 3ENZA 1ZM7A 5LQRA 4W9RA 1L7EA 4HEA1 5IVPA 7REQB 1JT2A 2KQUA 3TZBA 4YRSA 1DEOA 2JI4A 2Q7OE 3PEYA 3MB8A 4AFNA 4OREX 2AZXA 2GZ3A 2IZZA 5A4KA 3MGKA 2WIBA 2R4TA 1U8ZA 1B7GO 1RJGA 1R0RE 4V38A 4AJ1A 5BVGA 3MMSA 3O31A 4MEBA 4MW4A 1OWPA 3V4LA 4MKIA 2ZFUA 1K2VN 1O03A 1QUFA 3OZTA 3GXBA 4JT8A 1M2WA 2I7VA 4IGFA 4MPJA 5TEWA 5AW4A 3U6KA 1S2OA 3P5BA 2WWGA 1Z75A 1KH2A 1UL1X 1H66A 1KVQA 2WD9A 4LAFA 5ADVA 2JIQA 2OCXA 2PGJA 2VZLA 1IEXA 3ORSA 1OBOA 1I33A 1ESNA 5FV7A 4KXFB 2BPOA 3IDFA 5T6MA 1LJUA 4TMFA 1X7DA 3GJ6A 4JJ8A 4MQFB 1SXQA 5EQDA 1R15A 2GEDA 1OAOA 3B3FA 4IUYA 4HAYA 1TIBA 5DGIA 2J45A 3DMRA 2H2DA 1ZGBA 4TTQA 2RKBA 3SFVA 1JKXA 2OZVA 3PFNA 3COZA 2XNSA 3W9BA 1Z0DA 2PLWA 3S28A 4NBVA 4KPFC 1E5TA 2NNLD 3DMNA 1QQTA 4RM3A 1WQ4A 4YMTA 1G0OA 2OBLA 4G1BA 1N1EA 1DQSA 2AOUB 3H7IA 4YWJA 1NW4A 2XYRA 1Q22A 2CLDX 2I6XA 2X9GA 3BRWA 3CLHA 3CO5A 3K1ZA 1DBWA 1PDOA 3QY0A 4WL0A 5CUQA 1GQYA 3B52X 4W5OA 1DV1A 2OLKA 2ZJ7A 3EPJA 1U9IA 3KQVA 4HPWA 4L6CA 3U3ZA 2OV3A 3Q3CA 4Q9IA 4IIUA 4YUXA 4MDHA 4TQGA 1KRHA 3ASVA 1HV8A 1XDGA 2CDRA 2FGKA 2C92A 2IEAA 2GZAA 4UFOA 1LS1A 3RS4A 1QG6A 2EXXA 2C1EA 1J00A 4ZOLF 3AT1A 3LHKA 1CF9A 1M6VA 2WE8A 3GFSA 1QIKA 4N1AA 4NS4A 4TS4A 5J59A 2QT0A 2NYRA 2XPCA 4RKFA 1QG4A 1TJPB 2Q6VA 3IA2A 4OUDB 4FZ5A 3CURA 5F51A 2AEEA 4UMFA 3LQKA 1BS9A 3A7EA 1XK6A 1WXEA 3L6DA 3LT0A 4R01A 2DR2A 2JCVA 5FOQA 3HLKA 1Q44A 3IVRA 4R1SA 1YBHA 2AKYA 3SE0A 1P0MA 3SZOA 1I7PA 1VSTA 1YL7A 4RDCA 4Z7QB 5LD2B 3FSGA 1LKZA 5CA0B 1VI5A 3RAPR 1E1LA 1O6GA 2OAQ1 5JBIA 1T8WA 1XCBA 4P3PA 3RANA 1FXWA 1QWOA 4HNGA 4LJ8A 3INTA 4XUDA 5LZ8A 1IZ0A 4RFLA 5GQSA 4IF4A 3R09A 1XWWA 4W5JA 4XCVA 2R6FA 5BWBA 1KAMA 3DE5X 1FYWA 3H3XA 1RYFA 4HHEA 1HDYA 4QHYA 4DV5B 4PYJA 4Z3KA 3TLJA 1D3AA 1MNQA 3MQFA 3EGCA 4ESHA 4ZDKA 5I48A 2DFLA 3ICCA 2ODNA 4N3AA 2R6AA 3R44A 2GHIA 2PZGA 1QPBA 3F5FA 3OEED 2FFAA 2I2FA 4I2VA 3V8BA 3OP4A 2Z2KA 1EFPA 1LQTA 5AKLA 4DSTA 1RP1A 4MV7A 2QTRA 1Z74A 2JAUA 3AILA 4ZVSA 1ITZA 2QM8A 3MHTA 4DMKA 2CMHA 3V1UA 2OXEA 1OX6A 1U0FA 1YR8A 2YZ7A 1TEZA 4IH1A 4A6XA 3TGWA 3ANTA 4QOHA 2UZ3A 2CL7X 1P19A 1T1GA 4AS2A 4PYIA 4YP6A 2KHZA 4KMMA 3OFSA 3TZLA 3IT3A 3GQVA 3EBLA 3B9RA 1R8JA 4FEYA 5HE9A 1ZM2A 3D0RA 4KDCA 1VM6A 3RI3A 5KYWA 4L28A 1JFFA 2AMVA 2ECPA 4XEHA 3TOCA 4C7JA 3RS8A 1M3SA 1M73E 3BJRA 4BVAA 2O59A 3QUQA 2GJKA 2QVBA 4S04A 4PBSA 1TF7A 5EJGA 1ZNYA 3GDOA 4F92B 1LBSA 3KZ1E 1ZR2A 4MITA 1FBNA 4IAOA 2YH2A 2OBNA 2QQFA 5K0NA 3DR3A 1DIBA 4FDTA 3EDOA 5P21A 3CPJB 4PGMA 4BV3A 5DXJA 2AG1A 2MDTA 5T4HA 2CNOA 2QQEA 4XDHA 1V41E 1PL6A 2FH5B 2AG5A 3TMKA 2GKGA 2QG6A 2D06A 4OY3A 2A9QA 3ZWMA 4EX6A 3EX7C 2EAUA 4KQKA 4PZPA 2O3TA 4MO9A 5H4HA 3UM9A 4DG5A 1DBPA 1XZHA 3I4FA 2V1XA 3U7GA 5KTMA 1QH8B 1ZJYA 5B3JC 1CNEA 2NM0A 5BYBA 4OX9Y 1VBNA 4PBRA 4PICA 3QKIA 2M6SA 3NT2A 5TQ0A 3EZGA 1T0BA 1UWKA 2DFKB 1TZ2A 4GZ5A 4ZJUA 1C7IA 1F8YA 1WAMA 3H5WA 4YT4A 4CMBA 1BMTA 1Z7WA 1CFZA 2ZUVA 1XMXA 2VT6A 3BRWD 3ZJTA 4F6RB 1BMDA 2UUOA 3NAQA 2CXXA 4MINA 3FYTA 2PD3A 3Q0IA 5CPBA 5KVQA 3VI4B 2FSGA 5LA6F 4NJOA 1EK0A 3KHUA 4HLCA 4Y6LA 4ZZ3A 4WBNA 2RGAA 1YVPA 4NE2A 1VLLA 2C9MA 4FCWA 5EWJB 3LOPA 3P19A 4B73A 3KWJA 4EHNA 3H2IA 4YRBA 2IYEA 4F2DA 4CODB 1KDOA 3PC4A 4B82A 5EHIA 7MDHA 1CETA 3FRJA 3USES 4XYLA 3UAGA 1L4MA 4AJJA 3S55A 1GNVA 1H42A 2OD7A 3SC2A 2VF4X 4TT8A 2R4UA 1DC6A 2PL3A 3SHFA 1BRMA 5ULLA 2C96A 2GTHA 4HGOA 2ZBDA 2JJ1A 3A1WA 3RRNA 5IBPA 3FSGD 4OMUA 4A8JC 3U7EB 3ZGYA 2H4JA 2Q3DA 4M9XA 4MYSA 3HMKA 2QA5A 4N39A 2NO4A 5IDWA 1YUMA 3PVSA 2JZCA 1WXXA 3LVQE 2BR3A 3ONVA 4QHSA 1W36B 2WKQA 1DAFA 4LDAA 4TRNA 3ZXUB 3CWQA 3FFXA 5AIAA 4HNHA 5EP3A 1ZFNA 2HN9A 2QLJA 5SYAA 2WHRA 1MO3A 3FNIA 4ID3A 2ZJBA 2AZTA 4L73A 2WRZA 1F38A 2REOA 3W8DA 1QFYA 4CGZA 1V1RA 3FWZA 4Q1EA 2XNDA 3T5AA 1P1RA 3DCNA 3MINB 4QUKA 3C3AA 3C8MA 3PC7A 1SD1A 5PGMA 5L3SA 4KREA 2RCYA 3QKUA 5CA1F 1DAOA 3VOBA 3CUVA 3X1DA 5L4NA 4PG8A 1CG6A 4XARA 5EJIA 4DW8A 1F4PA 3ZGNA 1NE2A 4TTPA 2ECFA 5DO9A 1EEXB 2G88A 3PC3A 5AOAA 3UEOA 4XTCS 3RTCA 1CF2O 2V74B 5EGNA 1X8XA 1GL3A 1WULS 4IV5A 5G41A 2J3DA 3GGDA 3NWOA 4IM7A 3IQDB 1JJVA 4LHZA 2AI1A 4AJNA 3CRRA 2I4MA 2VDMB 4WKBA 2H54A 2BEWA 3IP3A 3S0JA 1ZY2A 3JCZA 3ESQA 4IGKA 4ZO4A 3BGWA 3L7BA 2J0SA 1Z8NA 3HJRA 2PYZA 3FPCA 1RHJA 2LNDA 3ABSB 3Q98A 3R0XA 5DPMA 2Y68A 5FB3A 3S2FA 5KOJA 2ZIZA 4DBLC 1YKGA 3ZWBA 5ALTA 1QO9A 2BF4A 3MFQA 5HCIA 2R00A 2RB4A 3BMCB 3UJDA 4Z2YA 4BN4A 3RHTA 4HZIA 3L7YA 1G5QA 1HE5A 3GRZA 3OJLA 4ZOLA 3LHSA 4OPMA 3OE4A 4J1QA 1I5OA 4U1RA 2PKWA 3DTNA 4MKZA 4Y6SA 2ZJZA 1RBQA 2ZR7A 4K3UA 1LA2A 3IMKA 1ZNXA 3ABZA 3CT6A 1LU9A 2LR0A 4M1QA 1QIJA 2GK4A 1Q5PA 2HSDA 1FB5A 2IU4A 3HPRA 4M1SA 5C3UA 4E7PA 4Z7JA 3UWDA 1BVRA 4DFDA 3WBJA 5EKUA 3VHXB 2YYZA 2H3EA 5FBVB 2RAPA 1ECFA 3I83A 4GLOA 2BELA 3LRTA 3CA8A 3EA0A 2OFFA 4E1VA 1RWXA 3G9UA 5AKIA 5LQCA 4INPA 5C8DA 3NTQA 3BMOB 1ZLYA 5FO1A 3BXFA 3F78A 3X3HA 1A50B 1GTL1 2DERA 1T15A 2PWZA 1L5GB 5LDHA 2ENWA 4F9FA 5JRDS 1XMVA 3PLRA 2IYFA 4FKMA 1ZUHA 3UYLA 3MN1A 5TGTA 5IZCA 2IV7A 4OGFA 5FOTA 2HCRA 1GARA 4UPVA 5DNUA 4C30A 4Q21A 1DI0A 4RANA 1ODCA 1U11A 3OSZA 1ICIA 1IZZA 2GBFA 1M2EA 1T8RA 2XXJA 3O1LA 5A5FA 3E2IA 2KLBA 2FPIA 3DDWA 3Q12A 3QVKA 4JUIA 4I14A 2ZYDA 1P17A 3OZRA 3ZHRA 1Z0ZA 4ZOEA 4Q4DA 1CUAA 5FBZA 3VYTB 2PV0A 3G82C 3I6BA 4CGYA 2PG3A 4D9MA 4HCJA 4TL6A 1FDSA 2JJ1D 4F93B 2OLEA 2PGLA 4QSMA 3T5CA 1ISHA 3RIMA 3LC0A 4WVFA 4XX1A 1MAWA 4PPGA 2BR4A 3DMFA 4XM0A 4DN6A 3IAM1 3JXEA 3MA0A 1KFBB 4GI1A 3H17A 5F2KA 1PSWA 1XEWY 2H5IA 3FCOA 3F73A 3S8MA 4WJKB 2J3HA 4PRZA 2I3AA 2XKBA 2YX1A 2OG1A 3GJZA 3RREA 5CD9A 2OO3A 4J76A 2WYUA 3LC1O 2Z5FA 1RABA 5BXYA 2XNDD 3NYQA 4XW2A 1YRLA 5FOXA 2Y9MB 1UOQA 1KO5A 1D0SA 1M5TA 3ENVA 4IIHA 3I0NA 1RC8A 3T9AA 2JGNA 3SQMA 4EB6A 2ADOA 4AO6A 3QE3A 2A4MA 5BWMA 1JX6A 3LY9A 4Q1DA 2EZ8A 4J4BA 1HFJA 2VBFA 3KB6A 1GFZA 2KMLA 1MP0A 2QIPA 3V1KA 1C7ZA 1HRKA 2QR2A 5IJWA 4MWDA 2C7OA 3DQQA 1DC4A 1WIWA 3FR8A 3R7BA 3AW8A 2HQ1A 3T9CA 4RJLA 3DCYA 3JYPA 1XO1A 1JV2B 3H6HA 1XKQA 4HDCA 3LXXA 1USIA 2AKAB 2W2VA 2P75A 3DVRX 3OPNA 4PE5B 3HWRA 3IBCA 5AVZA 1RU3A 1OGJA 2BMVA 3GFFA 4G8JA 4X92A 2FSUA 4JIGA 1GT91 5A5DA 1SIUA 1T4BA 3H8SA 3O0TA 2GSDA 2JA2A 2QYSA 1W0JA 1TT7A 3OUZA 2PLAA 4RPHA 4PW0A 4OYLA 4E21A 1E32A 1ZGHA 5LA6A 2UUBB 1F9EA 1NMSA 3KTDA 2CUTA 3BIJA 2IXFA 3EUEA 2BEJA 4B3CA 2AF4C 3PCXA 4HPXB 4DMGA 2RK4A 1IN5A 1KK2A 1N6KA 1IN1A 2FPGA 1AQUA 2RI1A 1OFUA 2Q2VA 1EDEA 1FLNA 1QIHA 2I8CA 1SUCA 4LVOA 2CNBA 1KY4A 2G6TA 2NX2A 3O8BA 1XVIA 1DTEA 1ZL0A 1P5HA 3FMFA