4CMGA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
total genus 93
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmgA00
3HB4X 3I23A 4HP8A 2EJWA 1E7MA 3VKUA 3ZI0A 3QWIA 3AOEA 3R0IA 3AFMA 4R68A 1ZK2A 4ROSA 4E30A 4XA8A 4O6VA 2EV9A 3I9NA 4IM7A 2ZK7A 3AUAA 1ZK0A 4CR7A 5IZ4A 2PZMA 4UUPA 4PLVA 4ZHSA 4AJKA 2OBYA 2ZYDA 2XF8A 4PCVA 1JLLA 3IL2A 1ZVMA 1E7QA 5A1TA 3FF4A 1ZSNA 2VUTA 4INAA 4R3NA 4YA6A 1ORRA 1VL0A 3GF4A 5BQFA 2VOEA 3OQ6A 2DBRA 3HUDA 3PJDA 3DOOA 4KUEA 2O3JA 1GCOA 3QE3A 5AXAA 2Y0DA 4OKNA 4ALLA 5B4UA 3E48A 1CIVA 4BS9A 1NFQA 1H6DA 2HLPA 4IJVA 3JQEA 4YT4A 1DOHA 2AA3A 7ADHA 5G4KB 4E21A 2PY6A 5EJ2A 3WB9A 2VYND 3VPFA 1GUFA 1JVBA 4FFLA 3RUDA 3B20A 2DBQA 4CMEA 2FWMX 1I3MA 3TZ6A 4IJUA 1HE2A 1OFGA 1Y8QB 1U3UA 2X23A 4OL9A 3W4KA 5JDIA 2YDXA 3B70A 4J7CA 4HX5A 1UP6A 4ID9A 1KS9A 1XKQA 3JQAA 4NJMB 1WPQA 3WTCA 4DQXA 4I5EA 4B3HA 1VSVA 4A03A 1LSUA 1FDTA 1XEAA 4FJ2A 3QWAA 3QJ5A 2AHRA 4BO5A 4IDFA 4Q3AA 1YL5A 1TT5A 2OUIA 2UAGA 4Q3DA 1PL6A 5JBIA 3L9XA 1IE3A 4NPCA 3ZWWA 3DBHB 2HJSA 4CR6A 5B4VA 2X5JO 2JCXA 2Q50A 4DL9A 1RYEA 4RV9A 2BELA 4YWJA 5G2OA 4RVGA 2XOXA 2P9CA 2Y05A 4AJ1A 5KKCA 1SB9A 5IDXA 1M76A 5H83A 2BGMA 3CMCO 5C7IO 1C1DB 2VRCD 4OJNA 1K6XA 3GZNB 1ZXLA 1DDOA 1I2ZA 1QXSA 2P4QA 1PX0A 1H94A 3PHGA 1IPFA 4J1QA 2H5LA 4XWYA 3AM5A 2CDCA 1QMGA 4F46A 4EGFA 3RFXA 1Z73A 4U7WA 5A06A 1JW9B 4E5MA 4JN6B 4BNIA 5EQFA 3OA0A 2FPPA 4GLLA 3BMOA 3VZQA 4CLOA 1DRUA 4ZA2A 2I3GA 5C37A 1HDCA 2J5RA 3JD0A 4WNIA 2NVWA 2GNAA 2O2YA 3OEWA 2X0JA 4MVJH 2HRBA 4FIZA 4B7XA 4E3ZA 4FSHA 1LTHR 1VL8A 1EVIA 1ZK3A 3UXYA 4GAEA 1LUAA 1MX3A 4W99A 1PQPA 4KMSA 2ZB3A 4DTIA 4YCAA 4RDIA 5JAZA 2X58A 2EIHA 3ITKA 3ZNQA 1LX6A 4LVUA 1I24A 1KEWA 3EC7A 3I3OA 2P2SA 3JV7A 4CV2A 3ICCA 2C2XA 3U0BA 1F17A 1BG6A 3EK2A 4MVJG 4DC0A 1EE2A 5B37A 1UAYA 1PZGA 4IPTA 2D59A 4E0BA 5JYDA 1V0JA 2QZ9A 5AXBA 3GNQA 4CM9D 4BV9A 2CY0A 4JQCA 3ROKA 3T7CA 2AXQA 3PIDA 4KWIA 1DRWA 5KVCA 2QG4A 4YAJA 3OETA 1VJTA 4XQEA 1SMKA 3QRWA 4CQLB 4GSKA 2IEDA 1UZLA 4J1TA 4ILKA 3PQEA 5K6AA 4KZPA 1T1RA 1OI7A 4BOYA 3ETEA 4JLWA 3U9LA 4WOJA 2GN6A 4TWRA 4BNVA 2CVOA 2Z1MA 3EMKA 5CDGA 4NBTA 1L7DA 3FNFA 1YL7A 4OXNA 1GQYA 4HADA 2JFFA 1GV0A 4BV8A 5DNAA 5DP1A 4MVJE 2PZKA 3HFSA 4U0JA 3V1TC 3CINA 1HXHA 1R4NA 2OP1A 2FSSA 4MKRA 3TDKA 3DC2A 3VDQA 4CM4A 1I32A 4ALMA 1NQOA 4LMPA 2PD3A 1PJSA 1UP7A 3JQ7A 4YT5A 4E2XA 5IJZA 3TFOA 4GI2A 1NXQA 1YGYA 2B4RO 4HFJA 4XRGA 1B3RA 2ZB8A 4RLSA 1X0XA 4UUMA 1DPGA 3GA0A 4AJEA 3AW9A 4AICA 3VPSA 4M49A 1AHHA 1QV7A 2O3QA 1H0KA 1WAMA 2C54A 1I10A 2EG9A 3D7LA 3X2EA 3PLNA 4RPLA 1PZEA 1DAOA 3B6ZA 4NBRA 4II3A 4U8GA 2X7HA 3PIIA 4ND2A 4ND4A 3RWBA 2ZQZA 3LLSA 3WMWA 4CLOB 1GQQA 1WNTA 2R00C 5JNLA 2PD6A 4YACA 1MFPA 2HCTA 4GKBA 1X1EA 1H6CA 2HMVA 1ENOA 2FR8A 1KVSA 1B26A 4ZU3A 4EJ0A 3GC6A 5AXCA 6ADHA 5LDHA 5KNLA 2BFMA 5LDGA 4ZRMA 1TA4A 4JBHA 3P7MA 2OGUA 4CM8A 1EFLA 3UOGA 1NQ5A 3WMXA 5KVVA 5JC8A 4QSMA 1VJ0A 1AXGA 3C1OA 1EDZA 1X14A 3CIFA 1A4UA 4BKPA 5JCXA 4TVBA 4ESOA 4W7HA 4ZQBA 3INRA 4RVHA 1E92A 5GZ1A 4PZDA 1F8FA 1KY5A 3MTJA 2CDAA 5CG1A 1EMDA 2C5EA 2E4AA 3BTVA 2DKNA 1C0LA 5L9AA 2GPTA 2R2GA 2W2LD 4KUGA 4FQ8A 1U2DA 2WWRA 8LDHA 4CJXA 4Y6SA 4I5DA 4QUKA 3WGOA 5L95A 4FN4A 1KEVA 5JAIA 4IBOA 1G0OA 1KVRA 2VNSA 3F5QA 3AK4A 2RIRA 4MOWA 5ENDA 2HK8A 2D3TA 1YQXA 3QQPA 3RUCA 3KBOA 1SO8A 2X0NA 4PLHA 1XCBA 1R16A 3RBVA 4Z6KA 4XKJA 2G5CA 2EWMA 3ZWYA 5DOZA 2C5AA 1DC4A 4RO0A 2YYYA 2O3RA 3C7AA 1GFSA 1GEGA 5THQA 4I8XA 2VUSA 4Y67A 3LF2A 3UKOA 3QA9A 3NDRA 2GN9A 4CMIB 4CM4B 5JDCC 4CMKA 2C29D 1W73A 3JQAD 3H4VA 1DC3A 1ZMOA 4XJTA 3TWOA 2EP7A 2JCVA 1C14A 3F5SA 3CSDA 4A7PA 3K5PA 1C0KA 3VAZA 1BXKA 2QRKA 3FTPA 4BNZA 3GN2A 2Y1GA 3PJGA 1CQIA 3UVEA 4EW6A 1R6DA 4MKZA 5JYEA 1AXEA 3V8BA 3K6JA 3AJRA 4CMJA 1DFIA 1Y9EA 1FDWA 1DC5A 4D0RA 4GSLA 1HL3A 2Y0CA 3SLKA 1LC3A 1TI7A 4BQRA 5IDYA 1I01A 4M86A 1LSJA 2DVMA 2G1UA 4J90A 1P31A 4XQGA 1ZEJA 5GZ6A 4E2WA 1E0DA 5FI5A 5JS6A 2DFVA 5T64A 3HHPA 5JLAA 3RU7A 3OP4A 2CVQA 3A28A 3S1LA 3PDUA 3PYLA 4TSKA 4PLTA 1JDJA 1MP0A 3AOEC 4AJHA 3H9UA 4OOEA 3NT2A 4ZQEA 2ZCVA 3CXRA 5CG2A 4YXFA 5IG2A 5G0UA 5L7WA 2IZ1A 3GOHA 3E9NA 3O4RA 4OQZA 2NTVA 4BKUA 4XB2A 2P5YA 3EW7A 3WGQA 3ST7A 2PGLA 4A0SA 4K6CA 4YT2A 5F3RA 1U3WA 1G6KA 2HMSA 1W8DA 5AYVA 3VPGA 4Y6PA 2P9GA 3LT2A 4Q3BA 3HDJA 4Q9NA 3UGKA 1I8TA 2JCYA 1ARZA 1MA0A 3GUYA 3IAHA 2CDBA 4IDCA 1I0ZA 1ENPA 5A9SA 1N7GA 1QV6A 1CDOA 2GN4A 2WD7B 5G0SA 1EBUA 2VWPA 3DFZA 3K2BA 4I5FA 2ZJ0A 1XHLA 2YHIA 2B83A 4WKGA 1KC1A 3MJVA 3WWZA 2E6UX 1LLQA 5L53A 2FHSA 1ADGA 2O3SA 2A4KA 2Y1OA 3OICA 1Q7GA 1KY4A 1ZEMA 5TGDA 4IDEA 3KYDB 1VL6A 1NR7A 4FOSA 1GQ2A 2JL1A 1DFGA 1NHGA 1TB4A 1MFZA 3WNQA 5A04A 5JDIC 4MVJA 4YJFA 3G1TA 1U7HA 5AQ1A 1PJ2A 1ULUA 3AM4A 4PGFA 4BO6A 4II2A 2QW8A 2VHXA 3FCOA 2I65A 1XQ6A 3QW2A 1HE4A 3ZV6A 2O2SA 1J6UA 2FN7A 2Z95A 1SOVA 2HUNA 3A4VA 4D3FA 2XPCA 3LC1O 4LSWA 1YOVB 1VM6A 1K89A 3TZHA 3WBFA 2LDXA 3DL2A 3C7CB 4MO2A 4ALNA 1QP8A 3KV3O 4NFYA 1ADCA 3ZHZA 3SXPA 5BNIA 2EHDA 2O48X 3UAGA 4WOKA 1W4ZA 2NVUA 3DBRA 2J3JA 1R4MA 3BMNB 3RVDA 3L0DA 4ITUA 2NUAA 7MDHA 2X9NA 3VHRA 3Q9UA 2PKQP 4NFHA 1KVTA 5TIIA 1D3AA 3CE6A 3QVWA 3OBBA 1NX6A 3WQQA 1K6IA 2AMFA 3ZWAA 3QWBA 3GUCA 1RYDA 2F1KA 1D4FA 3DTYA 3ZGYA 3WXBA 4PG4A 3H6KA 3K30A 5KVSA 1E1NA 1GUYA 3M6IA 4YQYA 1PWXA 2YQ5A 4OYRA 3H9QA 3QLJA 2C20A 1MGOA 4R1SA 3PHLA 1OBFO 2D5AA 3KO8A 4ALIA 1MXHA 3DMYA 4G65A 4L76A 3W8FA 1ZNQO 4YJHB 3RFVA 3AM3A 1A7AA 3H8VA 2I66A 3ZU4A 4CV0A 3GLQA 4R01A 2H1SA 2VN8A 4FPXA 3UF0A 4BNKA 2GERA 3WOHA 3ZHYA 5IXSA 4ALJA 4RPGA 2WDZA 1XG5A 3OJ0A 1RM0A 3N74A 1HKUA 4WCFB 2W2KB 2DQ4A 2VT3A 2HMTA 1PSDA 1Q0QA 2E37A 3AY6A 3BYZA 3E18A 3ZN2A 5DDIP 3U09A 1QYXA 3MJSA 4CM5A 3QVXA 2Y1FA 3KEQA 2HMWA 4YAIA 4FR5A 1AGNA 2ET6A 3ZU2A 4FGWA 1ZFNA 1NR1A 3MEQA 1HDGO 3MJ4A 4BKOA 2I3AA 3DZIA 2GYYA 2DLDA 3S2GA 1LDEA 1GYQA 3L6DA 4LVCA 4U5QA 5L4NA 1KVQA 4G2NA 2CSUA 2YUTA 4DBVO 2NACA 3GNSA 3DB2A 2IZZA 4ZRNA 4DQUA 3V5NA 4HV4A 4KUHA 3IUSA 1C3VA 4BB5A 2GZ3A 4NMHA 4DQVA 1UR5A 1KYQA 3E9MA 2HO5A 3Q3CA 1UDBA 3KXDA 1G0NA 4BGEA 1E5QA 3FTNA 1VSUA 5THKA 3UCEA 5K6AC 3WIEA 1HDOA 3JTMA 3AUSA 1FF9A 1U8FO 4RGBA 2FR1A 4WLVA 5HTOA 5L40A 2EW8A 4DRYA 4RZIA 1Y5RA 1LSSA 2Y1CA 5ENVA 1JTVA 3EVTA 2SCUA 1LLCA 4IUYA 1NBOA 2XXBA 3M1AA 1KIFA 1YH3A 4FJ1A 2ZB4A 3DBRB 2DUWA 1YL6A 1KBZA 3FWZA 5AXDA 4MP3A 3V2GA 1NFFA 4NR0A 4BO3A 4E5PA 4YRBA 1E3IA 2OP0A 4RLHA 3ULKA 3H5AA 3STHA 4EUEA 3WQRA 3GMSA 3WTBA 4Q3NA 4UEJA 3TJRA 3OJLA 3TOZA 3BMCB 3VH3A 3X2FA 4EITA 3PWZA 3L4BA 4YAGA 5DBGA 3F4LA 4CLEA 4GKVA 3DOJA 1Y9AA 2D4AA 4OOFA 4FS3A 2OZPA 5G4KA 1B2LA 5BNFA 3ZWBA 1B16A 4KTVE 4LCEA 5ICMA 1QSGA 4KDFA 2J3IA 3OH8A 2GZ2A 2PZJA 3HWRA 1IUKA 4UREA 4E5KA 2GASA 1Y8QA 4BNUA 5CEFA 1P1JA 1N9GA 1UXHA 3BMQB 4ONEA 1L1FA 1ZK1A 1ENZA 3AFNA 3D64A 4UVGA 4AL4A 4NJMA 4M8SA 2AQHA 3GHYA 1LRLA 1Y7TA 1DO8A 2V6GA 2IZ0A 1U8XX 5EPOA 1YQDA 3ORFA 1HYGA 3OM9A 2X22A 5KJEA 1PL7A 5JMPA 5BSEA 3E03A 3E5RA 3CH6A 4MVJI 5JCJA 3DTTA 3NX4A 1IHYA 1UXKA 5JO9A 1K6JA 4YDRA 3GDGA 1U5AA 3NT4A 3WS7A 4CQMB 2C2YA 4B8WA 3GGOA 4PRKA 4TKMA 3D4OA 4XIYA 3WJ7A 4EUHA 3DBHA 1HDZA 4Y8VA 4D7AA 3AUUA 3I83A 3WIDA 2I9PA 5KOIA 1X1TA 4DYVA 1JWBB 2P91A 3HN2A 3H3FA 1NQAO 4J0FA 3SBOA 3M2PA 4D44A 3DOCA 3E5MA 2WYUA 4NZ9A 5KKAA 2X1HA 1C1DA 2UV8A 5C7OO 4OH1A 1YXMA 5TLSA 3SC6A 2JAPA 1NASA 2NU6A 5JPIA 1ISGA 3NT5A 2VHVA 3QWFA 4UUNA 3RC1A 3PJEA 1T25A 5KJCA 2UUPA 1PJTA 1PJ4A 4N5MA 4IGFA 4MVJM 1LDYA 3PYXA 1EE9A 1BSVA 1EVZA 1GEEA 1NFRA 1RM3A 4LK3A 5GMOA 2JJYA 4LSMA 3GZ4A 6LDHA 5L4LA 3OIFA 5F5NA 2WEKA 3DDNA 3GPDG 5JY6A 1HWYA 1B8VA 1NAIA 2O50A 2Y1EA 1RKXA 4XDZA 4KQXA 3TSCA 4IJKA 4WUVA 1GPDG 2ZYGA 4QXMA 3TZKA 3VOSA 3PHIA 3DAPA 4MKXA 5JAQA 4I1IA 4MVJD 5G0VA 3PVZA 1DSSG 3VH2A 4J4TA 4WEQA 1GTMA 3KVOA 5GY7A 3KB6A 3E6AA 5COAA 3D5QA 1BW9A 2W2LA 3LLVA 3QVTA 4O59O 4PIVA 4EDFA 3MJEA 2BI7A 5TQVA 1NTOA 3CTMA 3WR5A 5ER6A 3RC7A 4A26A 1E77A 1P1KA 2YHUA 4C4OA 4P8RA 1ML3A 3GAFA 4E5NA 2J5KA 4NBVA 5T67A 1VPDA 4BHTA 5FI3A 5CDTA 1PZHA 4P4LA 1VKNA 2BGKA 1DIAA 4K28A 2PWZA 2ZTUA 1N9GB 3B1JA 3I9JA 4RQTA 2UUOA 3PEFA 3ZWXA 4CQLA 3C8MA 3EHEA 5EL0A 1P74A 4IIVA 3K73O 1ID1A 1ZSVA 1OAAA 2YY7A 2PKRA 1T2FA 4MIOA 5JFOA 3RQSA 1G1AA 3W8DA 1O8CA 5DCWA 3INGA 2ZKLA 2H9IA 3KHUA 4TROA 2X5OA 2FRDA 1EVJA 1HE5A 1UJMA 3K31A 4BGUA 4BKRA 1M67A 2JAHA 3GAZA 3H2SA 3JQFA 5I7SA 3F6YA 3L07A 2J5QA 1MC5A 3RROA 8ADHA 3WGZA 2Q49A 3JYNA 3GFBA 4WLUA 2VWGA 1RJWA 4NQZA 1MC4A 4YAKA 1TXGA 3PHHA 5TJ9A 4DMLA 1NQTA 3G17A 2IYPA 2YV2A 3L6EA 2YV3A 1R15A 4YQZA 1GCUA 1YDWA 4Y6RA 3RUHA 5I9MA 1A72A 4BVAA 5A4DA 2DPGA 2DM6A 3K2EA 4LCJA 3ON5A 4D0SA 4IQ0A 3UHAA 1BXGB 1N92A 3GR6A 3GDFA 1YO6A 1NAHA 1PJCA 3SC4A 1B7GO 3I9KA 4BO4A 1FDSA 1YONA 1HE3A 2PD4A 2CNBA 4RPKA 3SJ7A 5L45A 3NYWA 4P4GA 4RF3A 4DGSA 1PZFA 4AJJA 3ZWMA 5IDWA 1ISHA 4NJOA 4XYBA 1T4BA 2J6IA 4NK5A 4BGVA 3U3XA 5TC4A 5TT0A 4BIIA 3DHNA 3D4NA 2G82A 3H5NA 1DLIA 4TRMA 4U6QA 1KERA 4GPD1 3F1LA 4XGKA 4ND1A 1YBMA 1U5CA 5L51A 3BTOA 3HSKA 3PGXA 1YJ8A 5JE8A 4A27A 5JY1A 1UZMA 4OQYA 4Q3EA 2O4CA 5L7TA 2B36A 1BW9B 3KSUA 4NNJA 1SZJG 4GH5A 3UCXA 1EK5A 3DFUA 3ICPA 4RVFA 2W4QA 3PQDA 4PFJA 1V3UA 2ZQYA 3JD3A 1CEQA 1V6AA 4B7CA 4XYGA 3UUWA 5DOVA 4D42A 3JCZA 4J9VA 1EQ2A 3KLMX 5F1PA 2UVDA 1OOEA 4FFRA 3CMMA 4BO2A 3WSWA 3BXXA 2HMUA 4E32A 4GL4A 1EZ4A 3OIDA 1LLUA 3G0OA 1N1GA 4MINA 2Z5LA 3GVHA 1KETA 1HDYA 1FK8A 1HDXA 4WNCA 4O1MA 3EDMA 3OJOA 2W90A 2Q2QA 1LA2A 3IJPA 1ZH8A 3JYLA 5IN4A 3BZUA 1JKJA 4GLOA 4DC1A 4R1UA 3DBLB 4A73A 2J8ZA 2NVBA 1PGJA 4D3SA 2AEMA 3KYBA 3WGGA 1GPJA 4CMHA 3K8ZA 3UH1A 3QP9A 1B0AA 4K6FA 4J6FA 1OMOA 4CMIA 1J0XO 1BDMA 4MVJP 4WLNA 1ZIDA 1X7HA 4RPHA 1LJ8A 1Q0LA 4H7PA 2BI8A 5JCJD 1V3VA 3FSRA 3DZGA 5COBA 2BH9A 2HQ1A 1XSEA 3ZH2A 3TPCA 4IQ8A 3KTDA 1QYDA 3ZNOA 1H2BA 3AOGA 4CLRB 5I7VA 2FP4A 1LDNA 3G1UA 4WLEA 5CHEA 5EESA 4XYEA 3NRCA 3FBGA 3MCVA 2GDZA 1R12A 5BR7A 4ZQGA 1E3WB 4BNYA 1U4OA 2IRWA 2YV1A 2E49A 2JD1A 2VT2A 4YPOA 1T26A 4Z9YA 1ISMA 1SB8A 3KOUA 1E3SA 1GY8A 4XR9A 1RM5A 2Q1TA 5TJHA 3AI2A 3KZVA 2O4UX 2ZB7A 5JC1A 1ONOA 1XR3A 4ZGWA 4IMPA 1Z7EA 1LC0A 4ZQFA 4XB1A 3GEMA 3HADA 2BD0A 4IZIA 1O95A 2WD8A 3Q1LA 4BL5A 1WDKA 1E3EA 4BB6A 4PLGA 4R54A 1VE9A 3D3EA 3S2EA 4R51A 3ANLA 4LISA 3ROQA 4GMGA 4HXYA 2Q4BA 5A5EA 1P3DA 4UULA 1BXZA 3PJFA 3GFGA 3GRKA 1Q0HA 2R6JA 1AE1A 3RC9A 1UH5A 1EBFA 1LU9A 4YJGA 1GAEO 2WD7A 3DZBA 2VCYA 4ZQHA 5HRUA 4PLPA 1I36A 5CAEA 3JQ8A 1O6ZA 1JU9A 4J9UE 3D3WB 1EUDA 4Q39A 2OL4A 3L4BC 5C7LO 2GUGA 3DMTA 1LDMA 1SEVA 3EGOA 3AU8A 4TQGA 1LNQA 1V35A 1IL0A 3F9IA 4NIMA 3UW3A 1CRWG 3KYDA 4RVSA 5A05A 4C7JA 3WG9A 3S2IA 1DB3A 2Q1UA 3PYMA 5A03A 1NVTA 2BKAA 3GT0A 4IMRA 2HU2A 1W0CA 1ISFA 4L74A 4HFNA 5A3VA 2V6BA 1Z7BA 4M87A 3BAZA 1EQUA 1UDAA 2F00A 4R1TA 2A94A 2VTEA 3Q2KA 4JXKA 1EUCA 3G3EA 2IDZA 4N5NA 3R1IA 5EINA 2V6FA 1YOVA 3AI3A 4B8ZA 1X13A 2WMDA 4U0KA 2ZCUA 4XZ3A 3UCFA 2QHXA 2Y68A 4KQWA 3DQPA 4J4HA 2J3HA 1P1FA 2G76A 4IGEA 3VTZA 3L9WA 1UZNA 2O3TA 2VWHA 4JJIA 1ULSA 4CMCA 3BMNA 5T57A 4B4WA 3GEDA 4CV3A 1O94A 4N54A 5FF9A 1DRVA 4OM8A 3FNEA 2HRZA 3N7UA 4BMNA 4QFDA 1CERA 3KETA 2RH4A 4FCCA 2PA3A 1MV8A 3O03A 1N2SA 5I8WA 2JD2A 4FDAA 4PVCA 5L3ZA 2GD1O 2QYTA 3IQDB 4GQAA 4I9UA 4L4SA 5BSFA 4RVUA 1CQJA 1PJ3A 2EEZA 2FPIA 1F0YA 3T4EA 2YDYA 1JKFA 1BVUA 1E7YA 3E9QA 4WECA 4YTEA 1XLTA 1UDCA 3KYCB 4IXTA 4YJHA 1YJQA 1Y5MA 2VQ3A 4BNMA 3RUIA 1GADO 3NTOA 3UN1A 1T2EA 2EF1A 3I6QA 2GF2A 3VKVA 2DBZA 1TEHA 1GD1O 4W9NA 5TX7A 4WPGA 2GCGA 3HE3A 4R9SA 4WCFA 2NSDA 2IXBA 2W2KA 1AN9A 1FMCA 4XGNA 1EDOA 1HZZA 1NVGA 5TRTA 3S2FA 3B1KA 4UVEA 4BNNA 2O7QA 2VZ8A 1P1HA 2EW2A 3G49A 4R1NA 5EN4A 2C07A 4R3WA 5U4QA 1LRJA 4YJGB 4DXHA 2GZ1A 2Q46A 3INTA 1E6UA 1ZZEA 3O26A 4FFNA 3JQ8B 5JW6A 2VHYA 1T2CA 2DUUA 3FRJA 3WGYA 4NFSA 3DZFA 5IN5A 3ZU3A 5C3MA 1O9BA 2ZYAA 2ZATA 3OECA 3IKTA 2WE8A 4Y9DA 3UFXA 4YB8A 3U62A 3ANMA 3WICA 4TKLA 4CMEC 1IZ0A 1RPNA 4IXWA 1Z6ZA 1ADFA 4E5YA 4EJMA 3L6OO 2X9GA 1B3BA 1DAPA 4GX1A 4BNWA 5HWSA 1IPEA 4XYMA 3ZDFA 1PQWA 4RL6A 3NDIA 5HBRA 4E2YA 1E7RA 1EVYA 3ZNNA 1R0KA 1EUZA 3I9MA 3NAQA 5A9RA 2HAEA 2GSDA 3OJFA 2AQ8A 3GQVA 2VOJA 3ASVA 4UAGA 3EVNA 5FWNA 1KEPA 3A06A 1ZJYA 2NQTA 2J3KA 3JQFC 3KSDO 1E5LA 1WMAA 4NI5A 3G79A 4NU5A 4OGWA 4RVDA 4PG8A 3D4PA 3JYQA 4IS2A 5F5LA 3DBVO 4FC7A 5CDSA 4W4TA 3VH1A 2OHXA 2OORA 3BMCA 2QQ5A 3W4JA 1M6WA 3K96A 2OOSA 2IODA 2PZLA 1HEUA 1YBAA 4H3VA 3MTGA 3DHEA 2NU9A 4J3FA 4FW8A 4H15A 5F1OA 1M66A 5ER9A 1XQ1A 4BGIA 4DA9A 1IYZA 1B15A 3HFGA 3IDSA 4DLAA 1HSZA 5IF3A 3BMQA 3WJAA 4K9DA 5EQDA 2Q1SA 4CPDA 2C7VA 2XXJA 2PLAA 1SOWA 3SVTA 2FR0A 4RF2A 3C1TA 4ZJUA 1K0UA 3OFSA 1NHWA 2O3UA 4CM7A 2HKIA 2P5UA 3QVOA 1PJLA 3QVSA 4YR9A 4E4YA 3MJTA 4P22A 2BGLA 3PHJA 5DP2A 3PI7A 4BO9A 1FDVA 1U7TA 1Z75A 3EZLA 4CQMA 4HKTA 1Y6JA 1H5QA 4KDEA 4OSOA 3IOYA 5DT9A 1IHXA 1I5RA 5ES3A 5K9ZA 2CMDA 5F1KA 1Q2XA 2YFQA 1E6WA 2DFDA 3Q9NA 4M55A 3JQ6A 2X86A 5I8ZA 2NADA 1MB4A 4ND5A 1PQUA 3W6ZA 4B3IA 4FFPA 1Y8RA 3GVXA 3LQFA 3GVIA 4GVXA 3WFJA 1ZCJA 3IS3A 9LDBA 3U5TA 4WASA 4TMFA 3W8EA 3I1JA 2OFPA 3PPIA 5ITVA 1JAYA 4MPDA 3V2UA 4CM6A 3ROMA 1PU2A 4ZN6A 5DCUA 3VH4A 4JIGA 4S1VA 3ETDA 1DEHA 4EUFA 1AUPA 1Q7CA 5LCXA 1UXGA 3DZKA 5ITWA 4MJLA 1MUUA 1ZSYA 1JWAB 1JKIA 3DAGA 1BVRA 4RF5A 1CJCA 4WK6A 2NU8A 4IY1A 3B1FA 4YT8A 1PWZA 4Z0TA 4NDNE 3F3SA 5I7FA 1IB6A 3WYEA 3LF1A 3MWDB 4PN3A 1CF2O 3LT0A 3ZCXA 1MG0A 3H9EO 4WGGA 4BO8A 4GMFA 1I2CA 4O63O 1A27A 1ZKMA 5I9LA 2PH5A 3O8QB 2JFHA 2X0IA 3Q0EA 4NG5A 4J49A 5A3JA 1PL8A 3ZWVA 4XYLA 3S55A 2G0TA 1P45A 1GUZA 5DF1A 1M6HA 1Y1PA 3HNPA 2NV6A 4DREA 3JQCA 4R9RA 2BFOA 1IULA 2ZTLA 4NHEA 1B14A 4DIFA 2EKLA 3PLRA 4EBFA 4BNTA 1WWKA 1C1XB 4F45A 3NJ8A 1OC2A 3H5RA 3WGIA 1OC4A 4KWHA 3ZV3A 3P19A 1N1EA 5U1PA 4N5LA 3K92A 5G0WA 1PGOA 5CPBA 2ZJ1A 3T4XA 3ONFA 1LDGA 4YEDA 3RIHA 3OEYA 3RUEA 1HYEA 4E33A 4PLZA 3TOXA 4B4OA 1XYGA 3PTZA 4UVIA 1WP4A 3HG7A 4HFRA 4BNXA 3JQ9A 2G17A 3M2TA 5T8KA 4PRLA 2DBVO 3C3XA 2Q45A 3KLPX 4JK3A 1WLYA 3A1NA 3ENKA 4ND3A 2PFGA 1X0VA 2C0CA 3LK7A 4FD3A 3R3SA 5AVOA 2DPHA 4HNGA 1DIBA 4L75A 2P68A 3D1LA 1Y8RB 5I7EA 1BTOA 1GYPA 4PZCA 1E7SA 1YS4A 1WZIA 4W82A 1QKIA 3GGPA 1BXGA 2DTDA 3VZSA 1LBEA 3FPCA 3F46A 4PG7A 2EKPA 4IDGA 4ZVVA 4DWVA 2VRBA 5HA5A 1QYWA 3DMTC 3FR7A 3NDJA 1B8PA 3I4CA 1KVUA 2I67A 2YJZA 1Z45A 4LW8A 5AOVA 3FNHA 1PGPA 3JYOA 3JD4A 3WX0A 4J91A 4E31A 3F47A 1WMBA 3AU9A 4CL3A 4QT0A 1ZUD1 2DTXA 1QYCA 2ZTVA 1CYDA 1DXYA 3ZZNA 2VZ9A 4CM3A 1JQBA 1I3NA 4WLFA 1B8UA 2AE1A 5CFZA 4L4XA 1U4SA 1DJQA 2VTDA 1ISIA 1MG5A 2RCYA 5FYDA 1T2DA 3LT1A 3FR8A 1ZMTA 4M89A 4HY3A 4JBIA 1A5ZA 3P2YA 2D2IA 3NTQA 4BKQA 5B4TA 4N18A 1SPXA 1PR3A 2NU7A 1LQTA 4CMGA 3MWEB 5H82A 3OHSX 1PGQA 4JGBA 2V65A 4XJSA 3TNLA 4OO3A 2RHRA 2Z1NA 4AJOA 5MGBA 4P38A 3PP8A 4CR8A 2FZEA 3DAFA 5GZ3A 4W7IA 2PV7A 1NWHA 1UXIA 2WJPA 5A02A 2AEFA 2Q99A 1X7GA 1GZ6A 2RBEA 2VZ0A 4KP7A 1N5DA 4X54A 3RCBA 4BO7A 4NBWA 1QR6A 2QZZA 4ZD6A 1VJ1A 1Q7BA 3IMFA 4B79A 1PS8A 1E6EA 3DBLA 3WLFA 3GK3A 1WXDA 4CUKA 4OHUA 4AJIA 3C7DB 4L8VA 2PK3A 3OQBA 3GG2A 1I30A 4BNHA 2Q2VA 4XX0A 4MVJF 4XQ9A 1K2WA 1YB1A 2D0IA 3ADPA 1FDUA 5CDUA 4A10A 4TRRA 1Z74A 3R3JA 1ONNA 1HZJA 3EY4A 3PFWO 5DN9A 4W9NC 1Y81A 4D46A 4WCFC 5H81A 3O38A 1S6YA 3RKUA 1GR0A 2RH8A 2JD0A 4CODB 4RF4A 3D5TA 5KWEA 4LN1A 1LSOA 1WZEA 2OBNA 3DO5A 4XDYA 3U49A 4CQMD 4CLRA 1XU9A 2EP5A 4JX8A 4QFCA 3RUAA 1HYHA 2JHFA 4GWKA 3DONA 4LRSB 5COQA 4F3YA 3F4BA 2VHWA 4DPKA 4R69A 3AWDA 5CEJA 4UEOA 4IS3A 4DPLA 3IUPA 4L4RA 1E3WA 2EXXA 2NTNA 1PGNA 5IXYA 1DHRA 3RFTA 3OF2A 1E1MA 4CLHA 3ANNA 4XGIA 5T5QA 2NQ8A 1BMDA 3H3JA 4WJZA 5DZSA 3L4SO 1XELA 4J1NA 3ABIA 3JQGA 1P1IA 3NKLA 2B69A 1IY8A 2UDPA 4Z0HO 4QECA 1SNYA 4AJPA 1KOLA 1O89A 5FFFA 1NPDA 2P9EA 4UVDA 4C7KA 1PIWA 2QRJA 3OA2A 1BHSA 4YBZA 3VDRA 4J7UA 1TT7A 4OXKA 1HSOA 1W6UA 1P44A 3H2ZA 1ISJA 2GRAA 3PQFA 3WGHA 3NEPX 5KJ1A 1UAGA 3GH3A 3GEGA 5IZCA 2B35A 2B5WA 1XU7A 1U3TA 1TVEA 1J4AA 2BFAA 4EEZA 2WSBA 2OMEA 3A9WA 3GVCA 4QO7A 3RC2A 1R0LA 3ONEA 2RAFA 3LDHA 1E1KA 1V8BA 3TZCA 4QTZA 3WNVA 5FEUA 5TT1A 1PJBA 2Y66A 4UEKA 5I9NA 1HLPA 1ZBQA 2DC1A 4BMSA 3D3WA 1AHIA 2I76A 2YZ7A 3Q6IA 3W6UA 1H6BA 2I5PO 4DIOA 2EERA 5JSFA 1YBVA 4AJNA 3KUXA 1JA9A 1LLDA 2HK9A 2NNLD 4BMVA 1DJNA 5J23A 4HBGA 2YFHA 1XIVA 2PKQO 2QYSA 3OSUA 4L73A 4IIUA 1LEHA 4S3MA 1K3TA 2FY8A 2C82A 5IAAA 3JQAB 4DVJA 4GGOA 4GBJA 1GZ4A 3R6DA 4PLCA 2B5VA 2C59A 5L7YA 3TFQA 3TQHA 2PGJA 4OIMA 2ZTMA 4J7XA 3SX2A 1NP3A 1TT5B 2OXIA 4CUJA 4J2HA 1YKFA 1SAYA 4F6CA 2BF7A 4M54A 1E7WA 5BSHA 3E1KA 2WTBA 2GN8A 4HWKA 1R66A 4CL8A 2E48A 5KVQA 3SLGA 5EERA 1H9BA 5B1YA 3RAJA 2WYVA 3F1KA 1HTBA 4OXYA 1A9YA 4NH4A 1Z82A 3JQBA 4DLBA 3GY0A 4XR4A 5TNXA 3DEYX 4BNFA 1D1TA 1N8KA 1PS9A 2HDHA 4DPMA 5B12A 2YW9A 4GX5A 1ONPA 4OAQA 3MJCA 3PWSA 4IDDA 2Y67A 4DBZA 1E3LA 3EZYA 3JQGB 4QO8A 3VZPA 5CEEA 4IJWA 1ZW1A 3KYCA 5JAMA 5KCZA 5EIOA 5A5FA 2AG8A 4FJ0A 2NM0A 2AQKA 3LSYA 1HF3A 4E12A 3DWFA 1HT0A 3BMOB 2D5CA 3ENNA 5ILGA 4OKIA 2TMGA 1PS0A 3AI1A 4XQCA 4CUZA 1J49A 1M75A 2EGGA 3FPLA 3I4FA 3LU1A 5JO0A 1UUFA 2FZWA 1FJHA 4AFNA 1VC2A 3VVCA 4WLOA 1NWCA 3VVBA 1KC3A 1ENYA 2AG5A 4FBGA 4I08A 4NU6A 4D43A 2CVZA 2AW5A 4OSPA 1F12A 3UICA 2D8AA 1NVMB 1P33A 3U4HA 2A9FA 3WQSB 1NPYA 2EGHA 3WLEA 5KJFA 1NYTA 2Q4EA 3IC5A 3DZHA 2X6TA 5EMHA 3VZRA 3WDSA 3MOGA 4I9NA 1N7HA 4DIBA 4HFMA 1QRRA 4CLXA 2A35A 1MLDA 1DHTA 1PJQA 1EK6A 4DMMA 2JHGA 4CV1A 3ZHBA 3KM0A 3ZHXA 4YRDA 2UYYA 1A9ZA 1HETA 1I3LA 3DHYA 3VC7A 3CKYA 4TVOA 4EJ6A 3GN1A 1GU7A 1V3TA 1KEUA 3BIOA 2HJRA 2FSVA 3D0OA 1A7KA 3TZQA 2TMDA 2CD9A 3I9LA 4O5OA 3HN7A 4J43A 3IP1A 3ZV5A 1GYRA 1T1SA 2JFGA 1U28A 1F06A 3QY9A 4QX6A 1QLJA 2IE0A 4PLWA 4RJTA 2VHZA 2ZIZA 1CWUA 1U3VA 2YQ4A 4UUOA 2FOIA 2LDBA 3E8XA 2BRUA 3FI9A 4J1SA 4GX0A 2X4GA 2VUUA 1QG6A 3LC2O 2CF5A 3JQ9C 2GO1A 4B7UA 1ADBA 5T8KC 3V1YA 4JCOA 4M1QA 1F14A 2PTGA 3GRPA 4CM1A 4E13A 2B37A 4NBUA 2A92A 1CETA 1O0SA 1OZAA 1LI4A 2B4QA 4IQGA 1A71A 1J5PA 4PLYA 3QV1A 4UVHA 1R4NB 4ALKA 1C0PA 2CZCA 1H9AA 4RQUA 1P0CA 3CEAA 5HS4A 4PG6A 3JQ7B 3MZ0A 5TS3A 3WBBA 2GLXA 1I2BA 2H6EA 3V1UA 4ZICA 1YB4A 3HQ4O 4LGVA 3LYLA 3BHIA 4EEXA 3FN4A 1E1LA 4R5HA 1SC6A 3RSHA 2X9VA 3PRJA 5U9CA 4BO0A 5IFLA 1S7CA 3ZNPA 3QIVA 3AY7A 3CUKA 3I6IA 1R0SA 3RJ5A 5KIAA 5LC1A 3NJ4A 2VYVA 4JROA 3RASA 3BHMA 1H6AA 2EKQA 4O0LA 3U4IA 4YRAA 3RKRA 4B4VA 2I6TA 4J4BA 3NGXA 3ZV4A 2BMAA 3RU9A 2QIOA 4K26A 1JVSA 1SCUA 4MIYA 1R37A 3BTSA 5C5IA 4WCDA 4XEHA 4CLDA 4D3DA 4MIEA 3GMDA 3WFIA 3QWHA 3WYBA 4B4UA 4RPJA 2V7PA 4AJ2A 4E2ZA 1L7EA 3IP3A 1DFHA 1K5HA 4FOOA 2W8ZA 3GG9A 4CM8B 1X15A 5F21A 4AJ4A 4DLLA 5DBFA 4RZHA 5TSDA 2IYOA 2B0JA 3S8MA 3H9GA 3TN7A 1QORA 9LDTA 2DTEA 2NLOA 2X0RA 2ILTA 3C24A 3K9QO 5G4LA 2E82A 1VLLA 3HDYA 3PXXA 3I9OA 2HSDA 2FMUA 2C7GA 3Q11A 1PTJA 5KTKA 1YQGA 2AEJA 3EAGA 2IEBA 1ZXBA 4HNHA 4DUPA 4H16A 4IDBA 3IJRA 4XD2A 2DU8A 4YVFA 3DZJA 4BUCA 3ZWPA 3FNGA 4TRNA 3GDOA 4JP2A 3LT4A 3C85A 2VNAA 4XCVA 3GVPA 3DXFA 3FHLA 4Y98A 4Z0PA 4OMUA 1LRKA 1ZK4A 4R5MA 4A2CA 4J16A 3PK0A 2NWQA 4MP8A 2DT5A 4R4JA 4N7RA 3GGGA 4RORA 4U6SA 4Z3KA 2D1YA 1DBVO 4RCVA 3ZU5A 1Q1NA 3O8QA 4MDHA 3M1LA 1T24A 4I5GA 4URFA 1HLDA 1GL3A 4JBGA 3TL2A 4CMBA 2Q1WA 1VKOA 4IDAA 2BLLA 1LQUA 3DR3A 4L9RA 1DIGA 1XWFA 1D1SA 1ZJZA 3HZZA 1VI2A 3BTUA 2O23A 4GX2A 3GPIA 3SJUA 2VYNA 3FBTA 1WDMA 3CPSA 2I99A 4YYZA 4BQPA 1P1RA 5L4SA 3HJAA 4E6PA 1C1XA 4D45A 1XDWA 4G5HA 4PVDA 2Q2WA 2AE2A 4CMAA 3ZW8A 4JP3A 5CP8A 2X5KO 4NK4A 2QRLA 3KRTA 3ADOA 5HM8A 3WGTA 2CUKA 4B3JA 5MDHA 3KEOA 3NV9A 4FFMA 4Z3DA 1NPTO 3PGJA 4FGSA 4R16A 3KSZO 2X8LA 2GR9A 4YAEA 2Y0EA 2PR2A 3LZ6A 3MOIA 2H63A 3ZWNA 5CDYA 3HDHA 4PLFA 5G0TA 2GGSA 2WE7A 3IKVA 5T6BA 3PFFA 2XAAA 1PEDA 4LRTB 1SBYA 3ZWOA 4QEDA 3CZRA 3COSA 1T2AA 1WW8A 1HRDA 2CF6A 3H9JA 3NUGA 2POQX 3AUTA 5ICSA 3ETGA 4K1LA 4BNLA 1H2HA 2DAPA 1I3KA 2VRCA 5IZCC 4RDHA 4JNKA 1RWBA 3JSAA 3RI3A 4GGPA 4TZKA 4AVYA 3ONDA 2P4HX 3C1AA 1LDBA 4TZTA 3WSVA 1DC6A 2FPGA 2OO5A 1EFKA 1O5IA 3I52A 1WVGA 2B4TO 1DIHA 3N58A 1IOLA 2W98A 3P5SA 3FWNA 3GNTA 1TLTA 5A9SB 3LC7O 4QQRA 3PDJA 4W6ZA 4Z9XA 1HDRA 2YHIB 1U9JA 4MP6A 2RHCA 1NM5A 4L0QA 2WYWA 2V6MA 2PH3A 3ROPA 2VWQA 5KJ6A 3VTFA 1DLJA 3OMLA 4JJGA 1YB5A 2R00A 1LXCA 1JN0A 1YVEI 5DULA 5BNTA 3H7AA 2JKVA 4WEOA 4G81A 4YJFB 3RBZA 1GDHA 4GWGA 4AG3A 3RBXA 3QSGA 4BO1A 4TRJA 3O9ZA 4D79A 2NTJA 3W4IA 4D41A 2Q3EA 3WWYA 5DCYA 4IINA 4CM9A 1I33A 1ZO8A 3JD2A 2O7SA 5BSGA 3Q2IA 3TL3A 1BWSA 4J2OA 5JMWA 2QX7A 3RUFA 1P0FA 2CFCA 4XIJA 3E82A 1P9LA 1XA0A 3PZRA 4YJDA 4KTTE 2NVUB 1YWGO 3HDQA 3ZW9A 3GHHA 4FC6A 1R4MB 3HB5X 3VPHA 5CPFA 4EI2A 1A4IA 4EYEA 3OJEA 3U4CA 3PWKA 3JQBC 1YRLA 3VPXA 1IZ9A 1UXJA 1EEHA 1RM4A 4AJLA 1H93A 5HS6A 5A9TA 3TF5A 4A5OA 3A14A 4I9HA 3U4DA 3NTRA 4EZBA 4F6LA 1SEPA 2PNFA 4Q3CA 4FFOA 4KOAA 5ILOA 3JD1A 4R41A 3V2HA 3RJ9A 1P77A 1F8GA 3OIGA 3ASUA 4HUJA 1V9LA 1BRMA 1M2WA 3LVFO 1C0IA 3FD8A 2BHLA 2IXAA 3EUWA 1QLHA 2EJVA 4JJFA 2Y99A 2Y1DA 3NGLA 5DBIA 3EYWA 3AY3A 3W1VA 1U1IA 2VYVD 1WDLA 3IIEA 4FB5A 3H65A 5JDCA 4IZHA 4LMRA 1UP4A 1BDBA 1GV1A 2Y93A 1NNUA 3QHAA 4GVLA 4PG5A 5JXWA 4J0EA 4Z9FA 1VRWA 1YE3A 1QYVA 4WE3A 1PR9A 2AQIA 5IDQA 1X7DA 3CZMA 1DIRA 4P4NA 3L77A 4DYDA 2WM3A 1D8AA 5BT9A 1E3JA 3I5MA 3P2OA 2HK7A 2BFPA 4PZEA 3RD5A 3TRIA 1JAXA 3BHJA 3WYCA 5TF4A 3ITDA 3OQ1A 3JYPA 3PZBA 5ADHA 4XRRA 3ZWCA 1U2GA 1FXSA 3SEFA 1XGKA 1D7OA 1GZ3A 4BNGA 3BA1A 1MXFA 3JQDA 3T7EA 2PGDA 1BGVA 1T4DA 1YDEA 3GZNA 5K0ZA 4BNJA
chains in the Genus database with same CATH superfamily
3W5UA 4C89A 1T8YA 1U8CB 1ZUWA 2FSVC 3HB4X 3PNPA 5B7QA 4B6OA 3NIGB 3AHJA 5ALPA 4FNMA 2W4IA 3H4MA 2JVIA 1GGNA 2YRFA 3PCXA 4RKWA 4MGKR 2Q3HA 4QUGA 4LRXA 4L7VA 4P5EA 3A1UA 1U3CA 3HYSA 4XA8A 4IFBA 4O6VA 2GJSA 4DDMA 1WQ1R 2DHQA 1KJZA 2BRUC 3M70A 3MCWA 3UW1A 1RU3A 3NHJA 3D8BA 1RCFA 5KSYA 2EZ4A 4U4AA 2RGUA 2H4YA 1KEEB 2ZRIA 2YNMC 3OTHA 3D6FA 4CR7A 2A3NA 2Z2JA 4PLVA 2IE8A 2OBYA 2ZYDA 4DDTA 1JAIA 2XF8A 4O02B 3P0EA 4ZMBA 3FHTA 5DI9A 1CZLA 4BZZA 2QX6A 5A1TA 2SCUB 3HJRA 1WNFA 4H60A 3VR3D 2E7ZA 2BF4A 3CUYA 5ECYA 4C4PA 3WK8A 2VOEA 2DBRA 3GEEA 4MROA 4MDYA 1UMCB 2O2XA 2WSSA 3PJDA 4KUEA 3TSYA 4WJLA 1C7IA 1MT3A 4IDHA 1S4QA 2OGZA 5D84A 2Y0DA 4CTOA 2O0MA 4JJ4A 4OJKA 1FSFA 2WMNB 3AUYA 5B4UA 1XDZA 2QXUA 3E48A 1OX4B 4CBVA 1NA5A 4EGQA 4B2PA 3PNMA 3FGNA 4WKPA 3M4XA 1H6DA 2E4VA 4K6KA 4IWXA 1J99A 4E2FA 3JQEA 4YT4A 1H0SA 1UC5B 2AA3A 3DPSA 5GQSA 1WB4A 4E21A 3WB9A 3TTVA 3R24A 1H23A 4FFLA 4PZAA 3B20A 1Z4PX 3KWLA 2WWXA 4CMEA 2FWMX 1V5IA 4MPPA 1TNDA 5JDIA 2GM9A 4ZIRB 2H2IA 4OL9A 2EBWA 5CNIA 5JZMA 1OPRA 4F8JA 1SBHA 3B70A 5IRCD 4HEJA 4TS9A 4Q02A 2C5LA 1KS9A 1XKQA 2EFEB 4R2JA 5KAPA 5TMEA 2C9DA 4DQXA 4L5YA 2BMVA 4W5OA 3NNNA 3H75A 1AQ6A 4RD2A 2ZI6A 3ZY3A 2JJ8A 1AIPA 2X8WA 1L5ZA 3KJZA 5FWAA 4EG6A 4EWLA 4RADA 4IDFA 2VDUE 4Q3AA 5B1SA 2R62A 3WSTA 4Q3DA 4KK4A 4B87A 5AJZA 1OW3B 1SHKA 1PL6A 2W43A 5JBIA 4QJ5A 2O19A 3ZWWA 3KKLA 2P62A 2HJSA 2PXHA 5AJUA 2X5JO 1O5OA 2JCXA 3FLAA 4V0KA 1RYEA 2BELA 3TIVA 4ZFNA 1AK2A 3K71B 2ZPUA 4RVGA 3RRZA 2Y05A 2NZXA 5DHUA 2ZJ2A 3W79A 5M7EA 4U3JB 2DLCX 5IDXA 5IH3A 2C1ZA 4C5AA 1XNJA 1XQWA 2V7WA 1XTZA 1CV2A 1TRHA 3UFBA 4KU4A 1NDQA 2NU6B 1KDOA 1QXSA 1GGJA 4L07A 5DN6D 3T5CA 4GOXA 4XWYA 4OU4A 4MCIA 3AM5A 1IN7A 1QMGA 1RAEA 2TYSB 3Q3HA 4S2UA 5K5EA 1Z73A 1WPXA 4YK7A 4V38A 1W93A 4E5MA 1F60A 2NO9A 5EXEA 5EJ8A 1Z6YA 1GZ7A 4OGKA 2YW2A 3KK0A 4GXRA 3UJ3X 3VU8A 3PNKA 2FPPA 4LV8B 1FFDA 3VZQA 2ZI7A 4RL4A 4UCQA 2QA5A 1I1QB 1BWPA 1HDCA 2J6HA 1GPAA 1XMPA 2GNAA 2O2YA 4MVJH 1DV2A 3SNHA 4K1XA 4FSHA 3KKKA 1VL8A 1ZK3A 1Z6QA 4YP9A 3STYA 3L6BA 3C39A 3GAAA 2ZTHA 3UXYA 2FOXA 4GU5A 2VPIA 1PR6A 3ZQ6A 1SC1A 4MZXA 4YCAA 1DKMA 4QJ4A 5DX0A 5JAZA 4LPSA 2HFJA 3ITKA 1AZLA 5ESWA 3G5AA 3OFVA 2YWGA 2JLSA 1KEWA 3I3OA 2IT1A 1OHHD 3GMIA 3JV7A 4IUBS 1XFAA 3ICCA 3RVBA 1LBHA 3EOZA 4F96A 2ISSD 4RZ2A 1G5RA 4GPZA 1ZPDA 2YVKA 1BG6A 1Y33E 2AH5A 4MVJG 2YINC 1PZGA 3VQTA 4ARUA 1D03A 2JK0A 3T3MB 4E0BA 1IRIA 4C6SA 2O8FA 2GXQA 1WXWA 3JZDA 621PA 1K63A 2H65A 3DYIA 1L6RA 1KIMA 3EIFA 3GNQA 3ZYCA 3GPCA 5EUMA 1JA1A 2CLCX 2ZRAA 4IGAA 3INYA 2WWTA 4JQCA 1PDOA 3LQQA 1FP2A 1GPH1 2GHIA 4OAOA 1VBNA 3STUA 1ZVVA 3DEKA 2ID7A 1DRWA 4UEQA 1XJQA 2PG3A 1EHCA 2QG4A 1JMYA 4TL6A 5KVCA 1PUXA 3IV6A 3H8JA 3MWLA 1TM5E 4R1QA 4S0ZA 4BFCA 2D06A 2PKCA 2YJNA 5BSUA 5B64A 5DKFA 4UNQA 4QOSA 2HL6A 3BGVA 3LKDA 1JEYA 2GPAA 5E9WA 1VG9B 1W5BA 4BLTA 3PQEA 1QHSA 2XUPA 3DA8A 5K6AA 4KZPA 4MUJA 3C5VA 3QPVA 4DB4A 4WOJA 2G9UA 1FS5A 2CVOA 2Z1MA 3F7TA 5CDGA 4AJ9A 5EJAA 3V7FA 4JV5B 4RMNA 2OD7A 4NX2A 1YL7A 3TUJC 2BGGA 4PXAA 2J6CA 5A0FA 5JNUA 1GV0A 1CUHA 3L4EA 5DNAA 1CDZA 4BV8A 4ZT2A 3HFSA 4U0JA 3V1TC 4KFSA 3CINA 4ZVNA 2DR0A 1YI8A 4F9TA 2FSGA 1TEZA 1HXHA 4CEHA 3WLOA 3FCSB 4TXMA 1L8OA 2FSSA 3A2NA 1O08A 1UODA 3DC2A 1QJ4A 4MKRA 3QVVA 3SZLA 3TDKA 5I7UA 2VJOA 1ODLA 3FVWA 1M34E 4QIHA 4Z7OB 3BX1A 1PVVA 3JQ7A 5EYPB 4E2XA 4AUMA 4N0QA 4K03A 1PHRA 1A1SA 2B4RO 4PONA 2CLLB 4HFJA 2BJWA 3WK9A 4DSTA 3AGPA 5K6RA 5AESA 2J1LA 1CC1S 1QF9A 3GI1A 1QGED 5HCUA 3TLBA 4DN6A 4GECA 5A2QA 3A04A 5K4GA 3LBAA 3VPSA 5KQGA 2P65A 4PNEA 4ZCIA 3OLCX 3UH0A 3MTBA 1ST3A 1YJBA 4BVBA 4ND8B 4QGHA 1X86B 1I10A 2J3EA 3IXMA 3ZTYA 3TE7A 3D7LA 1NBHA 2DRIA 3DO6A 4Q66C 4KYIB 1XCMA 1PZEA 4QXOA 3OPYI 3GX1A 2XE4A 3KDSE 3OC6A 3PXBA 3MIIA 4ND2A 1NM5C 1DQZA 5SV2A 2CE2X 3HCPA 1CP2A 1V11B 1QQBA 1UEIA 4ON9A 1EA7A 2GYUA 3V8QA 4EFMA 1NVBA 4D1YA 2COUA 1FVOA 5AR1A 1FVXA 2PD6A 4YACA 1MFPA 2HCTA 1Y9JA 3TX6A 3U7QB 2HU7A 4EZIA 1N2IA 3DTVD 3OPNA 3IR6A 1PK9A 2P27A 1KVSA 4QQFA 2VDWA 1BC5A 3LH5A 5DHTA 2YJGA 3HWSA 3DLPX 4PNPA 4X1YB 1E0KA 1IWOA 1RLTA 3BCUA 5DYNA 5LDHA 2BFMA 3A05A 5LDGA 3M6FA 2XB2A 1TA4A 1CHDA 4PFSA 4RS4A 3ROFA 3UB2A 3TLYA 3F7NA 1ZWKA 3M1YA 1G6Q1 3U3DA 1NQ5A 4JUAA 1PHPA 1GZ5A 3EDQA 4QSMA 4EBBA 4HGQA 3U7EB 2W2VA 1RQ7A 3A58B 1EDZA 4IIHA 4WBNB 4TMTA 1X1QA 1X14A 3M49A 1NY5A 4OJMX 4OJQA 3RE1A 4BKPA 3NC0C 4TVBA 1OWOA 3GLIE 2FEPA 4FHEA 4M99A 3BGIA 4X94A 1AKYA 2ISCA 2ZWPA 3Q85A 4RVHA 4UQLA 3HJNA 1E92A 1V48A 4PZDA 4RSHA 3QX8A 2IHTA 2W5UA 3IXQA 4EITA 4MR9A 1KH2A 2C5EA 3R4CA 4BB9A 2WSSD 2GK4A 1NYRA 3FB4A 5L9AA 2GPTA 3OIUA 4Y2UA 4EPRA 4AX4A 4UAUA 2VTBA 3PLAE 2H2WA 3OX1A 1U2DA 2K87A 1IH8A 2WWRA 2R6DA 2VDQB 5HIKA 5I3ZA 4PSKA 1YJ5A 2DJ5A 4RKFA 2WUDA 1KEVA 4BFXA 3EZ6A 3IIJA 1A9TA 1J0EA 2WHYA 4CVNA 1ESNA 2HK8A 2HF8A 1AUVA 3F6PA 3WV5A 1U99A 3MJDA 1CVLA 1OWPA 3KBOA 1FX0B 4HN4B 4UQPA 1XCBA 3FVVA 4G2TA 4XKJA 1F8YA 3PCTA 4U2EA 4FONA 5DOZA 2QTRA 1M2HA 5AKGA 1G9TA 3AB7A 1GFSA 2XT6A 2ZP1A 3O8OA 1ZY2A 2A67A 2PH7A 3FYTA 4Y67A 1USWA 3QA9A 3VJMA 3ZDEA 4DIKA 4CM4B 5JDCC 2BFEA 4P4UA 5ETJA 1MRNA 5KYWB 2OV1A 3J7TA 1K06A 2JCVA 1C14A 1DI0A 1QVWA 3F5SA 3ZOZA 4A8PA 2XGJA 2H3EA 3S4YA 3AZQA 2DCUA 2ZUTA 1RI1A 4FLFA 1G2IA 3GN2A 3UT5A 4LFCB 1OX6A 4X6UA 3UVEA 4EW6A 5I4IA 3TTTA 3BIXA 5F4ZA 4AY6A 3OU7A 4BP9A 5JFTA 2C2ZA 1ZC4A 1AXEA 2MYNA 4MR7A 4CDMA 3HSSA 3DEIA 5C4GB 4CMJA 2FH5B 2OD9A 1NE7A 1M2VA 4YJ2F 1ZJWA 1V16B 1QGOA 4KQ2A 2I71A 2Y0CA 3UC5A 2CEKA 1TI7A 2EJBA 4HQOA 4BQRA 3RRNA 2DB3A 4M86A 5E7IA 1T2NA 3OKAA 1TMGE 4QYSA 3OZ7A 4J90A 4OGFA 4XQGA 1ZEJA 3LHFA 5AJTA 5GZ6A 2JHPA 2PSEA 2DFVA 3NI2A 1BDHA 1N32B 1YHYA 4PQEA 4LJ5A 3OP4A 1UKVY 2CVQA 3WB2A 4DV3B 1O5TA 4TWZA 4EF5A 1EB8A 4S35A 5C8VA 3H3XA 3PYLA 3B7WA 4TSKA 5I5GA 4BGDA 3AOEC 2QTHA 4F3CA 3GGCA 2BGTA 2JH3A 4ZQEA 2XMRA 3CXRA 5EMJA 5CG2A 3QYAA 1RXWA 1MNAA 2N0SA 5LLTA 4HDNB 3QVUA 5G0UA 3EIEA 5L7WA 2ZUFA 1TUBA 2WVGA 1Z0UA 4P31A 2H31A 3W8NA 5B58C 4OQZA 1S0UA 3MJRA 4XIGS 1MN6A 1EDBA 2YVLA 3DYVA 1JDTA 1YQQA 3MINB 4K6CA 1U3WA 4LA4A 2HMSA 3MXTA 2VT6A 2HA2A 4PZLA 1V6SA 4BZWA 3HXPA 2GA8A 4OQPA 4KKVA 4YV7A 2P9GA 1FNDA 4QDJA 5K3EA 1NOJA 2XVMA 3UAVA 3K0AB 5ALEA 2JLCA 3W5VA 5DM70 5GIOE 1NMYA 2A8YA 3GUYA 4RLFA 4YCDA 1LZKA 2PX6A 5KHOC 1DBQA 3IAHA 3TG2A 1YRAA 2BHRA 1QP7A 4G25A 4QL3A 1PV1A 1FYFA 1WPRA 2VJBA 4D9GA 1CDOA 3BJZA 4U7PB 9GPBA 2HSEA 4M2LA 1XZNA 5DTMA 4BMYA 4DA8A 2XUFA 1AGRA 1OAKA 2VWPA 3AP2A 3DFZA 3IQFA 1JFFA 4I5FA 4TTTS 3FTEA 1LJLA 4EYSA 1QH1B 1CZRA 2E6UX 5L53A 2FHSA 1YR7A 4TKUA 2O3SA 2WIFA 3FM9A 4CYMA 4TYPA 2EWVA 5TGDA 1JDBB 1T13A 4EHAA 4ZXPA 3OC0A 2CFTA 3KYDB 3HUTA 4OH7A 4BLRA 1NR7A 4IV8A 2JIQA 1JE1A 2C2MA 2XWPA 3I05A 3PF9A 5DPMA 4EGSA 4KPGA 2W2MA 4PR3A 4YROA 4CKCA 1WMSA 2FFHA 3L7MA 4OHZA 1BCSB 1HT3A 4Y2PA 4WX2B 3AM4A 2CZGA 3MT8A 4AMZA 4OFXA 1O1YA 2R48A 1NONA 1NN1A 2M6RA 3E15A 2FGKA 1UJ4A 1HY3A 4BO6A 2IU4A 1PF7E 4C6TA 3QW2A 3N2KB 2O2SA 3S1AB 1J6UA 1J90A 2WNIA 1D7AA 3ZE9A 2FPUA 3SR0A 1JQKA 2N46A 1ZIPA 2XPCA 3SS8A 2XEDA 1H9CA 3ZDBA 4F4FA 4IMJB 2LDXA 4WADA 3DL2A 3WB1A 3WLTA 3C7CB 4MKGA 4MO2A 4RYDA 4XWWA 2W6JA 5EWLB 4HS9A 3PD1A 3ZHZA 3MJHA 3ABZA 1AQYA 1J2JA 3MRTA 4XX1A 2Z4RA 5KNBH 2M6SA 5D3MA 4A0HA 3M5WA 1OV4A 1WIWA 2ODQA 2NYAA 2VF5X 3HSYA 4K6GA 5LQKA 4FILA 1MR3F 7MDHA 3H05A 3VHRA 1SZPA 2WB4A 4M9RA 1VA4A 2PKQP 3PPXA 4NFHA 4FWBA 5KNDH 1KZYC 4C0XA 3KELA 1NUTA 4MMYB 4UDNA 4ATNA 5TIIA 1D3AA 4BVHA 3N76A 3OBBA 3K2IA 3QE2A 4GMXA 3WQQA 2CJXA 2XODA 4R0VA 2P2DA 4NCJA 2OCYC 3QWBA 2H4WA 4ZDWA 3GUCA 2IA5A 3AESB 1MOQA 2CC2A 5J4HA 2NMVA 3SWWA 1IUPA 3DTYA 3LUPA 2W37A 3QOWA 5FUQA 4RY2A 2YMQA 3IQXA 1UC8A 4JD5A 3H6KA 1J07A 3LBNA 1GUYA 3OE7A 2D1RA 1GG8A 1SFRA 5ALLA 5FUXA 1PWXA 4KJXA 2NZWA 1JZTA 5BRAA 1IWBB 1MGOA 4FZRA 4HWSA 5GVRA 1QIMA 3PHLA 4DT1A 3FGZA 3CVVA 1TQ2A 1L1RA 2X4DA 4H1HA 1ZNQO 2VHCA 1GM5A 2OCDA 1N9ZA 1TW3A 4YJHB 2O1SA 3GBPA 3H0CA 3RFVA 1H4QA 3AM3A 4CV0A 4R6WA 1KYZA 1OKKA 2A9QA 4US0R 1IY1A 1OZGA 3JWPA 2VN8A 4R01A 5A6SB 3SFVA 3UF0A 3VV2A 2GERA 3ZHYA 2ZBRA 5CB4F 3DT9A 2C61A 3KPJA 5IXSA 2GKOA 3TVDA 4ALJA 2DJIA 2IV2X 2OAP1 4MICA 1JHYA 3PVCA 1HKUA 1DMSA 1RADA 3HKDB 4WCFB 3R7BA 1R6XA 4RD3A 2E37A 3AY6A 4CG1A 5AKZA 3EVBA 3VYSB 3ZR4B 5DDIP 3P97A 3MJSA 3Q5EA 1YVRA 3AR5A 2FSPA 3QVXA 4M6WB 4ZTUB 5FNVF 1SKUA 3JXEA 2B3DA 3KQVA 2ORVA 4LBWA 4D41A 3KEQA 4DE5A 2A88A 1WXGA 2NZVG 2G7ZA 3CG0A 2VS1A 1ZFNA 2QS9A 3DE1X 4MUYA 1VCNA 3OUUA 1W0KA 3MJ4A 3RTBA 4CFYA 3FHOA 2GYYA 5IAEA 3RFUA 2DLDA 3S2GA 1NJ8A 1T9HA 1LDEA 1GYQA 4F1WA 4NAVA 1C7ZA 3W3AH 3SQXA 1UMKA 1M1YA 2FSFA 2NACA 3VNQA 3AL2A 2QUKA 1M7GA 3D6VA 2JNWA 5LXTF 2IYLD 1EVKA 3DB2A 4ZVSA 4ASUA 1H2ZA 3I6YA 2CJPA 2WILA 3A7DA 3HH8A 3I6ZA 1Z2CA 2GZ3A 4QYIA 2KW5A 4NMHA 4DQVA 2PLWA 3CF0A 3A6LA 3AEQB 4RW0A 4Y1FA 3W9UA 1KYQA 3E9MA 1DG3A 1MF7A 1QANA 1WHSA 1G0NA 2AJDA 1SC4A 3NHBA 3UCEA 1P2TA 2YZNA 3P2IA 4HAUA 3AUSA 1FF9A 5DNEA 1G66A 2B34A 1G41A 3LJKA 2Q3MA 5HTOA 1R0WA 2JLAA 2EW8A 1NNSA 1V8FA 2QY6A 2R60A 2X8JB 3C6ZA 1Q0ZA 3ADCA 1Y5RA 4H6VA 5BPHA 4LOAA 2ZRCA 1UPTA 5CGQB 2QRGA 1LLCA 4IUYA 4PZYA 1CD5A 4TS1A 3RS7A 1QZXA 2G7MC 4PM4A 1W87A 2XXBA 4FFBA 1KIFA 1KO5A 3RYFA 1PEAA 2ZB4A 3ZDDA 2ID9A 4FGLA 2P4EA 3WDKA 4E5PA 5K0TA 2EEPA 2GWHA 2GCOB 3H5AA 3Q1KA 4JL6A 2O8VA 2LWIA 4KRGA 4EUEA 4UHEA 2BHTA 4KV7A 5E9QA 3OJLA 4QREA 3BMCB 1OLUB 2WTUA 3PWZA 1JLSA 1KE1A 4EB8A 5A4FS 4MEBA 2ZIGA 1SPBS 3DKIA 1WV1A 4BP1A 4C05A 1QV9A 1Y9AA 2XMZA 2JI4A 3G5MA 3ZWBA 5FBVB 2XBLA 2ZAOA 4AWBA 2G9VA 3K20A 2B9VA 3OH8A 1CJKC 4ZT6A 1L5NA 1G6OA 4KQIA 4ZZ0A 1Z2OX 2GASA 1Y8QA 5B30A 3RSSA 2HOQA 1P1JA 3JAMA 1N9GA 1I3CA 3ADBA 3GJ3A 4ONEA 2HJWA 3MTAA 3PFKA 2FW1A 3W9BA 1ENZA 1GGEA 1KAGA 1KQPA 3ZVKA 2A1IA 4M8SA 4NJMA 5BT8A 2AQHA 3A3OA 1LRLA 1NY6A 2VEOA 4HMOA 1V5WA 2IZ0A 1U8XX 4JFRA 3ET4A 4W1QA 2X22A 3LL7A 5A5DA 3OTQA 1TU4A 2JGRA 2QNIA 5HTKA 4MVJI 3T9CA 2ZBQA 1GNPA 3JRXA 2FR8C 2XNCA 3H6HA 1PTKA 4RTLA 1WETA 1H8EA 2K6GA 3RO7A 3URMA 4BV2A 1U5AA 1GHTA 3P27A 1LGYA 2OYSA 2JGEA 3GGOA 4TKMA 1T5HX 4B8WA 1EHIA 1WG8A 2HU5A 1HDZA 2YQZA 3DBHA 3GV0A 1DT3A 3I83A 4F7WA 5KOIA 1XZMA 1WO8A 2HSJA 3ZY6A 2HWWA 1FBNA 2JAOA 4LJ6A 3JVDA 3H11A 2VA9A 4TSFA 1TUGA 2CMFA 4KFCA 1I7NA 3IFSA 3E5MA 4BAGA 4EPTA 5ITZB 2X1HA 5C7OO 1SU8A 1P73A 3FCEA 3SC6A 1NASA 4JA2A 5JPIA 1C8VB 5EWJB 2ZRBA 3WGUA 4ZT4A 3V6MA 1NX9A 4R40A 1PJTA 1TJ3A 2RHJA 3SQMA 4QLAA 1E3MA 3AG6A 4N12A 4MVJM 4MWDA 4POAA 3PYXA 1C8BA 3YASA 5BWOA 3T3OA 1NFRA 2W6CX 2WMOB 3FUUA 1U4NA 4IFTA 2A9PA 5HE8A 1XTUA 2IY8A 5GMOA 1BN7A 1KH3A 3EPPA 3K0EA 2V0CA 3IALA 3GZ4A 4N7JA 4EHIA 1E61A 3N07A 6LDHA 1QIGA 1YU6A 2C8LA 3IB3A 3O0TA 4U2FA 4UPVA 1OXMA 3ZCTA 1QRSA 1ZR2A 3GPDG 1RPJA 1XEWX 2P3LA 4BATA 4JP5A 1TZKA 1B8VA 1E98A 2ZS9A 4FBLA 5BUSA 2HJGA 3D4BA 2GJ4A 1TCVA 2O50A 3CEPB 3N8NA 1BA3A 4IJKA 1NXPA 2G36A 2B7BA 2L42A 2XVYA 3IBSA 1R5JA 1GPDG 1ADJA 2ZYGA 1RXCA 5IVDA 3VOSA 4RY8A 4I66A 1O8BA 4Y0VA 3EZNA 5JAQA 3BKXA 4PW0A 3AVYA 3F6SA 4L22A 4UDXX 5FV7A 2JLXA 3KQKA 3T06B 1XMIA 3R7NA 4EMTA 3R3YA 3KVOA 5GY7A 3E6AA 1H0HA 3LLVA 1EWTA 4GM4A 2WTAA 1KAHA 4PIVA 2XBMA 3MJEA 2GMWA 1VPLA 1VHQA 4BBAA 5A4AA 4I1UA 3WLSA 3OE1A 4MR8B 4KHPB 3QX7A 1MVLA 2NO6A 3S2SA 4DBLC 1D6JA 2TS1A 1EKXA 3GAFA 4AN1A 1L7RA 2PEZA 3ABRB 2IUFA 5FI1B 3I5YA 4IIBA 4NBVA 2W6JD 1HC7A 1VPDA 2R1UA 4HB0A 4E09A 5CDTA 1H2RS 1PRYA 1KJJA 2HYDA 3UJBA 2LKCA 5I7AA 5B55A 3FNBA 5KPDA 1JF8A 2ZTUA 4RQTA 2V7VA 1PFWA 3EXHA 4M0FA 4K5QA 1A9QA 2GVDC 2Z8YA 5EL0A 2Y77A 3H42B 3GDWA 1ZSVA 5FFMA 1QHFA 4ZVKA 4KR7A 2DCMA 1OILA 1OAAA 2YY7A 4JUIA 4COOA 4ZCRA 3TB4A 3WLIA 4MYTA 2HWUA 3NRJA 3JX9A 1T2FA 3ESCA 1K5DA 3RQSA 5AHXA 1G21B 2YFYA 2D5IA 1O8CA 4H77A 3S27A 3INGA 5KTOA 1K8ZB 1J21A 1Y4DE 2ZKLA 3MMNA 4WERA 4DEVA 3WKEA 4ZTBA 5ES4B 4RD6A 2IH2A 2WP8J 4TLDA 3HJFA 5CR9A 4UM9B 1P18A 1AG9A 2I6GA 3OE7D 1K86A 4BGUA 1S01A 5ULLA 1ZU5A 3KAJA 2CXHA 5I7SA 1FP4A 3KBBA 3L07A 2J5QA 3RROA 5LA6B 1NOKA 3WGZA 2XRMA 1BVHA 1JG3A 3GFBA 5FL3A 5ARCA 3LLUA 4L28A 3VAAA 4NQZA 1XZBA 2BOVA 1LBTA 1TXGA 1SKQA 4XCQA 5E2AA 5TJ9A 3T9EA 4DMLA 1TCAA 3NJRA 3G17A 3BFXA 2LCFA 1OKKD 2OBFA 3L1JA 1E2LA 3A4MA 4ZAGA 5H7XA 3ZXUB 2EX0A 3LY9A 1GCUA 1YDWA 1OJ7A 2H5JA 2ECQA 2W58A 2X9LA 4MV8A 3GLFB 1TMOA 2YRWA 2DM6A 3ZC3A 3I0NA 5A0VA 1BWQA 4UCXA 4LCJA 2PS1A 1HV8A 3UWSA 5AM5A 2BUCA 1Z7YA 1STOA 2HF2A 4P0QB 1IU9A 5AM2A 1AUQA 4Q47A 1WUYA 4BX3A 1UPXA 1S96A 1FDSA 1HE3A 5EJ4A 3EDRA 1LWOA 2PD4A 5A4JA 4NENA 1GN8A 3DAYA 5L45A 2OCGA 4GNKA 4P4GA 3MTEA 4HTAA 1PZFA 4D80A 1Y7HA 3GLTA 4INPA 3TRHA 1SZCA 1T4BA 3A7EA 5TC4A 3U2QA 4REQB 3D4NA 1F2UB 1W0KD 2P79A 1N33B 2BM0A 3H5NA 3FE2A 2VSXA 2EWWA 4GS5A 1YR1A 5DK6A 4XGKA 3N3BC 1JPUA 2HDNB 3TGWA 5LP6F 1U5CA 1D2EA 3D8NA 3TXXA 5L51A 3S5JA 4FDUA 3IMEA 1FQKA 1W6RA 4ASUD 3NBMA 2O5RA 2P40A 4RK6A 3LUAA 5FWYB 1WZNA 1R9JA 1EM8A 4FFDA 4LWZA 4MLCA 4Q3EA 6YASA 5JMOA 3O1IC 3EQZA 2G04A 2O8BB 3MRXA 2ZXFA 4E5UA 1XOIA 3DQQA 3A0RB 2JFBA 3KSUA 3NETA 1SZJG 4NNJA 5CUQA 3T4XA 2DXIA 3PXGA 1V37A 3ICPA 5C3UA 2DHCA 1QH9A 3F0TA 2VJPA 3PQDA 5K20A 1YB7A 4PFJA 1V3UA 1CEQA 1XEXA 3GDHA 4XYGA 3RJMA 1GPNA 2J3LA 3C0KA 1P2GA 4I6JA 4XVHA 1EQ2A 5F1PA 5H70A 4FFRA 1KJYA 4FXPA 4BO2A 1GU1A 4DIEA 2Z6AA 4G36A 1IZ8A 4YO8A 1SVLA 1EZ4A 1WMFA 4YJ2B 4HAZA 3OIDA 4WN3A 1G18A 1DBPA 3SICE 3BZBA 3LECA 3KJQA 2NZUG 2Z5LA 3ZDCA 3GVHA 4RAQA 3S5UA 2P2GA 3OE5A 5DE3A 1HDYA 4QXAA 1FK8A 1SVIA 1HDXA 3RDPA 2ETXA 4G1FA 5BMVF 4DZTA 5AW4A 2IS1A 4IYJA 1NLYA 3OJOA 4NMXB 3RS9A 3IJPA 2BGUA 3K5HA 3MCUA 3I1IA 1W47A 3IAXA 3DW1X 1EG7A 2PSSA 4UBIA 1B6GA 5G1PA 2C2GA 4CNBA 2NVBA 1PGJA 2P0EA 3KR2A 4OQEA 5FA5A 2AEMA 5HUQA 3TAUA 3R5KA 1GPJA 2BGIA 4CFZA 1QF7A 3Q10A 2ZSHA 3K8ZA 4DMGA 1ATZA 3QP9A 3STXA 4IL5A 3D8HA 4M9ZA 1HDEA 3L5KA 4LY3A 1C30A 1N1MA 5MGNA 4J6FA 5CTAA 4YQEA 1A2KC 2PWYA 1NXTA 3LFHA 1QQTA 3CX4A 3K1ZA 4O8CA 4O2BB 5EZ6B 4AUKA 1Q14A 1QDLB 3WL7A 1J0XO 5DM60 4CL2A 1B74A 4JI5B 1OI4A 4WLNA 3ZTTA 2QT0A 2R1TB 5BQ5A 5ALUA 4CIDA 2BFNA 3EJ6A 1X7HA 2IYEA 2MSCB 4RPHA 3WKCA 1VECA 4H7PA 3OX4A 1NLMA 2VF7A 2F64A 1DRJA 1Z88A 2HQ1A 3LW7A 5C7YA 5ALQA 4IQ8A 2M1XA 3BUSA 4FX5A 4YFYA 2R3SA 1BMTA 1QYDA 2I87A 1S3GA 2IPMA 3AF4A 3ZNOA 2Z1DA 2ZM5A 3C5EA 2H3HA 4BZXA 1YOBA 2WHEA 3CUEF 5KQPA 1I4DD 1LPSA 2ATCA 3KJIA 3GW8A 2ZIVB 5TV2A 3I12A 3UQYS 1Z0IA 3AR8A 3HYCA 3MCVA 5K4HA 2B20A 1OBCA 4JYPA 1R12A 1A5AB 5KTYA 5H02A 1UBSB 1ZYUA 1RJEA 4TSFD 1N5IA 1E3WB 2OXTA 2QX9A 2D4HA 2VJMB 3DDHA 2QWXA 2QI9C 5KYYA 2DPMA 1RTKA 4P4SA 5D1HA 1Z5PA 1MPXA 1T26A 4HNTA 1SB8A 2H92A 4X7PA 1ODJA 5EP3A 1ECBA 3LP6A 4PHTA 2CNDA 3OZRA 4L85A 3OOHA 3AI2A 2QTVB 2R7NA 4E7PA 3E3NA 5TQ0B 1XR3A 4ZGWA 3RFXA 3IMCA 2AGVA 1Z7EA 1DUSA 4X3PA 3RFFA 4D0NA 4XB1A 5F12A 2BD0A 2IGBA 2PUTA 4MB2A 1O95A 1ZNYA 2WOOA 4Q9LA 2VIIA 3UGTA 5HXAA 4ARCA 1QHEA 4PLGA 4CG0A 3G7UA 4R54A 3W5SA 3D3EA 3V8EA 4LX8A 4KQ9A 5CB0A 3SGLA 2ZRLA 4LFBB 3RSQA 2ORYA 1NNEA 2QD3A 1CZKA 1BD4A 5LXTA 5FCDA 4G84A 1BXZA 3ZBTA 2Q9CA 3GRKA 3H7IA 1EP1B 3ZVLA 5G02A 7REQA 1IK4A 4EKGA 4W1PA 2EBFX 3DULA 3GA5A 2ZUCA 1EBFA 1W5FA 1T34A 4YJGA 4B0OA 1Q84A 3DZBA 5JZBA 3BICA 5HRUA 3GLVA 1D2GA 2BM8A 4X9XA 1RWWA 3DCYA 4J9UE 3D3WB 1G7SA 2QMYA 1KEZA 3KNZA 2LP4Y 1TF2A 2WJ3A 3DMTA 1LDMA 5FTMA 4PHCA 4CT5A 3UMCA 3A70A 2O0JA 4LMAA 2NUTB 3UW3A 5A05A 1T2VA 3NPAA 1ODCA 3O2QB 4QWMA 5CXXA 4FWIB 3UK2A 4EF6A 3S2IA 2XZOA 2FZLA 2WAXA 1DKPA 1EFPB 2M6KA 2WQZA 3GT0A 3QYJA 2QLBA 1HOXA 4MWBA 2JIOA 1ISFA 1ZMBA 1L4LA 4L74A 1I1HA 4KJZA 2V6BA 3H5VA 4I14A 3BAZA 3DNPA 1EQUA 2IIVA 3ESZA 4HLCA 4R1TA 1X9GA 2A94A 2IC5A 5DGIA 4JGIA 3RAGA 3TH5A 4PC7A 3VKWA 2XUJA 2BHNA 3HO8A 3W04A 2ZRQA 5JQGA 3SMQA 1EUCA 2DHRA 3GLRA 4JYMA 3P71T 3VZBA 3S1SA 3C3JA 2R0QC 1BE6A 4FYMA 2FUG6 1JL3A 1V43A 1XZGA 3UCFA 1WCXA 5K01A 1L8AA 1BGWA 1ZD5A 1I6KA 1GQRA 3DQPA 3OWHA 2J3HA 3ANSA 4IGEA 1XHFA 4JC4A 1UBHS 2H4JA 4JJIA 2FPOA 2O3TA 3DEHA 1WUJS 3P4XA 3PPVA 4KO3S 5HF6A 1G7TA 3KKZA 1GRNA 2YIVX 4EZEA 4IWYA 3QOYA 5FF9A 3IIKA 4WINA 3FNEA 5AM3A 4BMNA 2E4YA 2G83A 5AW3A 4P5PA 3EWIA 4IWNA 1RKQA 3I2KA 2D62A 4FCCA 2PA3A 3HHEA 1NI4B 4FDAA 4CNQA 4OHBA 2FE1A 4Q00A 1ODSA 1CQJA 5CYPA 3QEMB 3ZE6A 3LX4A 6REQB 2EEZA 3RTGA 4EAAA 2DETA 1QNFA 2W6QA 1JILA 1ML4A 2FPIA 2ZJBA 3K53A 2YDYA 4UMVA 2QUBA 2WSYB 3JSXA 4HH3C 1E7YA 1LY1A 2Y1LA 4HVTA 1CB0A 4UC0A 3G2IA 2IYXA 5BRNA 2OO7A 4HWRA 4TV9F 3ZZMA 3UK1A 5LSAA 1G7RA 2OBBA 3ZZTA 4DY6A 5HVNA 5I6DA 4A36A 1YJQA 4YR7A 1MAHA 4B7AA 1XD2B 1VDMA 4FIDA 1II8A 1AS2A 3VSDA 3NEYA 2P9BA 5EJ9A 2CL5A 1NBWB 1XCPA 4FOPA 4ND6A 4BCDA 2ZE7A 2EF1A 3JPYA 4DG5A 4N0DA 1Q74A 2ZAYA 1WCIB 2DBZA 1GD1O 3DD1A 1GLVA 4HRYA 5TX7A 4QG3A 4NDAA 4RVOA 4R9SA 1PYGA 2W2KA 4XGNA 1HZZA 2XUDA 2JJ1D 4BNNA 2VZ8A 1P1HA 2EW2A 8OHMA 1E8DA 5EN4A 2Y2UA 2HC9A 4PC3A 1Z83A 1GKUB 2HDOA 1LRJA 5U4QA 4ZQCB 4EB6A 1WUTA 3DZ8A 5LN1A 3TSOA 2C42A 3H1FA 3A3KA 2W0SA 4II7A 2JGKA 4CU2A 3JQ8B 3U26A 3WAJA 3AVPA 4JVLA 4KFTA 2ZOSA 2WJIA 3CJQA 3A6ZA 5ALHA 4D02A 2IK8A 2QQEA 1SQFA 2MYPA 5IN5A 5C3MA 1V25A 2ZATA 3ANYB 1ECGA 3IKTA 4LNAA 3IAM6 2GAIA 1R7RA 1TYAE 2HHCA 3WICA 4TKLA 1E9SA 1GR1A 1T5BA 3QBDA 4H7HA 2D2VA 4E5YA 2RKOA 4QJ3A 4TT3A 2X9GA 3F3KA 3ND6A 5FULA 2B30A 1M74A 2NSLA 5JNVA 3RIEA 1IWPB 4KG7A 4JT4A 1QIDA 4P92A 4MRRA 4XYMA 2I6XA 5TMDA 2Q5QA 3NDIA 1NVUQ 4OM7A 5H0IA 5E7QA 3V7YA 1JPNA 2J4FA 4BIMA 3MBIA 1P4SA 3I9MA 4ND7A 3C7KA 2H0RA 3NAQA 4LTMA 2FDRA 2JZCA 5L3RA 1NATA 2BFCA 1X8LA 4P54A 2QAGA 4B33A 1YHZA 2FAXA 2WIGA 3TNJA 4YS6A 2AFHA 4GM0A 4J2TA 3QUCA 3OT1B 3ZHRA 4EFLA 4WBNF 5FWNA 4JLOA 3DV2A 1KEPA 1ZJYA 4NI5A 1A7JA 3JQFC 2C7RA 2ZBPA 3G79A 3BK2A 1KDRA 4HG2A 4LWQA 4WFJA 4PPGA 4PG8A 1F4PA 2XDAA 5F5LA 1HMYA 4IS2A 2R4UA 1JSXA 5EOVA 5CDSA 2EHJA 4LJ9A 3HCDA 3R7WA 3GUVA 2WFLB 4WDQA 2XUKA 3W4JA 2TMYA 4UDOA 3U9SA 3K96A 2PZLA 3PQ6A 2RE8A 1HEUA 1OV6A 1FDIA 1AGYA 5IKMA 5CIYA 3CRNA 3E3LA 2MR6A 2FDCA 3T1YB 2NU9A 2DUNA 4J3FA 4H15A 5DYTA 2WK1A 4HAOA 2J9GA 2IV3A 1UKAA 4GYWA 2ZSEA 4UHCA 3PGKA 3AP1A 4CF6A 5BR4A 5AI6A 1IBSA 1J8YF 4F12A 5J2TB 4F3NA 3N2IA 4K9DA 4DSZA 4CPDA 4L2IB 4CIBA 1Y8CA 4CEIB 3NYQA 4N8EA 3NTXA 4G0MA 3C1TA 4RZ3A 1P29A 5DTJA 3TX2A 1K0UA 4MJXA 1DIOB 5F4BA 3W77A 3OFSA 1SOMA 3K16A 5AOCA 2P5UA 4DR2B 2VZEA 4QU9A 3ZY2A 1PJLA 3QVSA 2GCIA 3QLVA 5DM0A 3L46A 1UAAA 2OKGA 3PI7A 3R0QA 4MUAA 3QKRA 2A59A 2GESA 4JBWA 5EE3A 1KQGA 3FOZA 2XV1A 1KP3A 2QORA 3A9UA 1ODKA 1Y6JA 2Q2OA 3C8ZA 3N2LA 4PAWA 1H5QA 2OZEA 3S28A 4OSOA 1KI9A 2XXAA 3IOYA 1GN9A 2VJQA 2GBCA 1K7YA 5ES3A 2XECA 2UZIR 4RTRA 1EFRA 2ERXA 1XKTA 2CMDA 3U0VA 3K0KA 4I2NA 4FHDA 2RBKA 2YFQA 2C2OA 5HK8A 2DFDA 2Q4OA 2PRKA 4M55A 4RKYA 3SBEA 1JQ3A 3UA4A 2X86A 3CEJA 4EM6A 4LWOA 2OCIA 8MHTA 4FINA 3V97A 1MB4A 1O95D 3DXXA 4ND5A 4PO8A 3TQOA 5B6JA 6CHYA 1Y8RA 4WWHA 3SIXA 4DA0A 4DSUA 3IS3A 1S02A 2XYGA 3M3PA 3WK5A 3W8EA 1JAYA 2B8NA 4CM6A 1PU2A 1L8LA 1U5BB 3OTOB 2O5VA 4JIGA 4S1VA 3N8GA 4RMIA 1DEHA 3NFYA 4KXQA 2QJFA 3Q8XB 5LCXA 4BBZA 3QK7A 2F9FA 2VTVA 3BS4A 3DUFA 1OGJA 3HVUA 4FFWA 4AUEA 3FOFC 4F3RA 3ZKWA 1JKIA 4TMWA 3NVKI 1BOFA 1CJCA 2NU8A 5L3SA 4ZV9A 4K9NA 3HXTA 1PWZA 2XHZA 3HMKA 3PXCX 4RHFA 1SRQA 2AZDA 2OAEA 4B6QA 3LF1A 1QWOA 4BLOA 5L3QB 3VA7A 1ZUNA 3OU2A 5CM2Z 2WSIA 3LXRA 4BO8A 3MCZA 1OXVA 3CX6A 2AOVA 3BB1A 3VSAA 1I2CA 5K2OA 3ED1A 3R5XA 1XTKA 3EXIA 2WF5A 4NG5A 1EFDN 1EINA 5ALJA 1MU0A 3VHLB 4C03A 5CA1A 3GJ0A 4FFVA 5FO0A 1SXPA 4B17A 1PL8A 4RQBA 1KI6A 3UZUA 5CFQA 3SF8A 5CYGA 5EJ6A 4QZVA 2CK3A 5AVVA 2NV6A 3RGGA 1F8UA 4V03A 2RDMA 2FUEA 2O6LA 2J85A 1LS6A 3SHFA 4ENTA 2ECOA 3NXKA 2ZTLA 4L4ZA 1VE3A 2J08A 3T7TA 4EBFA 4TS3A 4E6EA 1N2OA 8ATCA 3KSBC 3H5RA 2AJ8A 5EIBC 2B4YA 2J3DA 2O59A 1OC4A 4JI6B 1RYZA 4J75A