4CMGA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
250
Chain Sequence
b'EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTERIDINE REDUCTASE 1
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 93
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmgA00
4IMRA 2I5PO 2HMWA 1U8XX 2PR2A 3ICPA 2C5AA 3JQEA 4RZIA 3EUWA 4D0RA 4J7UA 3SLGA 4NDNE 1QSGA 2AE2A 1DEHA 1LDYA 5JY1A 3R0IA 2ZB3A 3MCVA 4ALIA 1P74A 4RVHA 1HYEA 4QSMA 4F3YA 5ILGA 3AWDA 2NLOA 1IHXA 1P3DA 4BO4A 1FDSA 2JFFA 4MVJM 3OJEA 4GVXA 2P9EA 4Z6KA 3Q9UA 4HFRA 3OBBA 2OORA 3CMMA 3IJPA 2NU6A 4RQUA 2VN8A 1ADFA 2PLAA 2W2KB 1DJNA 3WQQA 3R3JA 5K9ZA 1CDOA 1PGPA 4WE3A 5KIAA 1GPJA 2B35A 3H9QA 5K6AC 4ZD6A 1HT0A 3LSYA 4NNJA 3WLFA 5CPFA 4M89A 5HA5A 3NRCA 4E2YA 1R4NA 4BO2A 4YAKA 4OXKA 1LDBA 3GG9A 2IODA 3K92A 4GWGA 2PZJA 2CVOA 1A71A 3TOZA 4BKPA 1GPDG 2JL1A 1NX6A 3PYLA 4TZKA 4MVJA 3L6OO 2FPPA 3CMCO 4D3FA 1S6YA 3DQPA 1Y1PA 2GPTA 3NJ4A 3RC7A 3GUYA 3BMNA 4RPLA 1VC2A 4OM8A 5JPIA 1NAIA 5H83A 5C7OO 4CMHA 5F21A 4A03A 1BSVA 5F1OA 5F1PA 4L76A 1VJ0A 4AJ2A 1ISMA 3DZKA 2W4QA 4NFHA 4P4GA 3CTMA 1GL3A 2HRZA 3DB2A 3MJTA 3IDSA 2NQ8A 5EPOA 4MOWA 1GAEO 2SCUA 3ICCA 2JAHA 5JCXA 3BYZA 3KTDA 1NWHA 2DC1A 2D3TA 4MVJH 1YONA 1WMAA 3H2SA 4LGVA 3DHYA 3DOCA 4NFSA 4J3FA 4LVUA 2QYTA 2CSUA 5KJEA 4I5FA 1U9JA 1CETA 2WD8A 4E30A 4EEZA 4IZIA 4WEOA 3VHRA 5T5QA 3M1AA 2W2KA 5EMHA 4RVUA 4Y6RA 4TMFA 2C7GA 3L4BC 1JWAB 2GLXA 5THKA 1UUFA 2E49A 1P0CA 3I23A 4LVCA 3QVWA 4NK5A 2X8LA 3I9JA 5JDIC 1ZSYA 3UW3A 4M55A 3D4NA 1OMOA 2H5LA 2VZ0A 2W2LD 3TZHA 1YKFA 3E9NA 1RYEA 1R12A 4WNCA 4BUCA 3GF4A 4CMIA 1YO6A 4YYZA 4ZICA 4RF2A 4D0SA 1Z74A 1PL7A 1SMKA 3DZBA 4XR4A 4O0LA 1N8KA 4AVYA 2AEFA 1KETA 1NQOA 3LVFO 3ONFA 3KSUA 4YJFA 4MIYA 4CQMB 5CAEA 5DF1A 1N1EA 3AI3A 4WEQA 3GNQA 2ZQYA 3AUSA 4ZQGA 1NPDA 2I99A 3G1UA 4NBTA 4HV4A 2OXIA 1ISIA 4N18A 1YL7A 2X0JA 1NPYA 2V6MA 1KVUA 1C0PA 1XYGA 4UVIA 1U7HA 4XGNA 2YJZA 3JTMA 1MP0A 1OC2A 5KVVA 2BI7A 3PJDA 5J23A 2A94A 2RBEA 4AJEA 5EJ2A 4RF5A 2Q4EA 5CHEA 4DC1A 2PGJA 1ZK1A 3UHAA 1BDBA 1RM0A 3ZW9A 4D42A 4E21A 1I2CA 3TZCA 4B7XA 2E82A 1K89A 4RQTA 2NU9A 2YHUA 5L40A 1OC4A 4U0JA 4GSKA 3GOHA 4UVEA 3RD5A 1VL6A 2W90A 2RHRA 2ZB8A 3MJCA 3JD4A 3HZZA 1PQWA 4O5OA 1T1SA 4INAA 5A1TA 3Q1LA 2C5EA 3A1NA 3NT4A 5LDGA 2H63A 3JD1A 2BGLA 3WWYA 1P1JA 1JU9A 1PJ4A 3ANLA 3PHGA 4PLYA 5A04A 3IMFA 1DIHA 1ONNA 4J2HA 2EKPA 2VOEA 3F1LA 3ZGYA 3C1OA 5KJ1A 2DM6A 1IE3A 1M6WA 3GK3A 4JK3A 1CRWG 2GRAA 5BNFA 3VKVA 4RVFA 1KS9A 3WDSA 4BNUA 2V6FA 4YEDA 3O9ZA 3Q9NA 4IUYA 3E5MA 4CQMA 3NGXA 3PLNA 3WGQA 4M86A 2FN7A 4B4OA 2R2GA 1HYGA 2DBVO 4C7KA 1GEGA 2O7SA 3RBXA 1HDOA 3V2UA 3H2ZA 5KJFA 1EVJA 1BTOA 4GH5A 2I3AA 3PQEA 5B1YA 3ZWYA 4A0SA 3AU9A 1ZK2A 1Y6JA 4A27A 1P1IA 2A9FA 3DFZA 2GZ2A 3CH6A 4IGEA 1EDOA 1P44A 4ND2A 3ETDA 4LN1A 2J3JA 2PV7A 1FF9A 1SB8A 1ZK0A 2O3QA 3OEWA 4DREA 3WBBA 4R51A 1XELA 1W4ZA 3WB9A 4WOJA 3WJAA 2ZTMA 1G0OA 1DFGA 4WLVA 1NVMB 3RJ5A 2I3GA 1PJTA 3DL2A 4PZCA 3WXBA 3RUIA 4XJSA 3A4VA 3RUFA 1A4UA 4LRTB 3NJ8A 4GBJA 1PR3A 1NASA 3M1LA 5GZ1A 4RV9A 4J91A 2F1KA 5ITVA 2Q46A 3D4OA 1AN9A 4BL5A 1FK8A 1XQ1A 4RDIA 3PLRA 1DRWA 1T2CA 2O3JA 2JD1A 4KZPA 1JN0A 2GNAA 4MDHA 2C59A 2Y05A 3MZ0A 5K6AA 2Q1WA 4XRGA 3GVHA 2AQIA 4XIJA 5T8KC 2FZWA 4WLNA 1MXHA 3P2YA 3WNVA 3CEAA 4BO6A 4WPGA 3HWRA 1DFHA 1T2AA 4NIMA 1D8AA 4B3IA 5JXWA 1YB4A 4BNFA 3MWEB 1ISHA 4BQPA 3OQ6A 3H8VA 1K6XA 4O63O 3ZV6A 3VH1A 5MDHA 3LC1O 4HX5A 1IPFA 1A7KA 1KEUA 4JN6B 3PTZA 4Z3DA 1QYXA 3CKYA 4NBWA 5LDHA 2Y0DA 3DZHA 4S3MA 3RC2A 2UVDA 1V3VA 4J1SA 5L4NA 4LW8A 4CLEA 5TNXA 1E6WA 2VWQA 1ADCA 2RH8A 1IZ9A 4TKMA 4FJ2A 4QXMA 3OJ0A 5HM8A 1F14A 2FMUA 1Y9EA 3EK2A 7ADHA 4ZHSA 1EFLA 1LC0A 3PHLA 3AI2A 1UAGA 1XEAA 2HLPA 4Z9XA 1IULA 4PLCA 4KMSA 2UAGA 3VTZA 1KEVA 4U0KA 3ZW8A 3DONA 4J1QA 4OOEA 2DPHA 4CV3A 4Y6SA 3ABIA 3RKRA 1HE4A 4N7RA 2Q4BA 5JDCC 1ZK4A 3UKOA 3KEOA 2WYUA 2B4QA 5KTKA 4HXYA 2V6BA 3L4BA 5TGDA 1X15A 3TZKA 1B15A 3NTOA 4BOYA 1ZXLA 4M1QA 4YDRA 5JDIA 3PIDA 4LCEA 1VSUA 1LXCA 1RM4A 3G3EA 1O8CA 2OFPA 3LF2A 5DCUA 3UH1A 1MLDA 3D0OA 4O59O 1MC5A 4RL6A 4Q39A 3OIFA 1N92A 4J2OA 3V8BA 4YRAA 3ROPA 1E1MA 1H6CA 4OQZA 4R54A 1YB1A 3PWKA 4JJIA 4L75A 3L07A 1D1TA 3K8ZA 4MKXA 4RF3A 4F45A 4IIUA 5A9RA 1NFQA 3NX4A 4R01A 3W6UA 1BWSA 3HHPA 3I3OA 1PQUA 2WE7A 4DLLA 4S1VA 5ENDA 5C3MA 3FNGA 1E3WB 4AJNA 1AE1A 1EFKA 2X4GA 2Y0EA 1SOVA 1WZEA 1YVEI 1QYVA 2AEMA 1E7RA 4I5DA 5DCWA 5A3VA 4TROA 2B5WA 2EP7A 3BHJA 2TMGA 4JJGA 2ZKLA 2AA3A 2G5CA 3KHUA 4RDHA 1ORRA 1N7GA 3U3XA 4E31A 1HE2A 4PRKA 1YDWA 1RKXA 3OHSX 1E7YA 3WYCA 1RWBA 2B4TO 1CEQA 2X0NA 4OGWA 1VL0A 1ZNQO 1I8TA 3GFBA 4IDAA 3ZWWA 1HDCA 3BTSA 2EIHA 2QIOA 2EW8A 4R1TA 4L4RA 2NM0A 4J4TA 1PX0A 4NBRA 1H94A 1UP6A 3FR7A 3HDJA 1ISFA 3GG2A 1TT5A 3WFIA 4CV1A 3OH8A 2HK9A 1X1EA 2Q99A 2HO5A 4PIVA 1C0IA 3BXXA 1ZCJA 3B6ZA 1DPGA 3VH4A 3GGGA 1DIRA 3I4FA 3ZWMA 4BQRA 4PLGA 1GV0A 3AFMA 2FR8A 4AJOA 4IDGA 1Z7EA 4IXWA 2OHXA 2IZ0A 2HK8A 3WFJA 1A27A 1T4BA 3WMWA 1P1FA 3VZSA 5TLSA 2ZATA 1R4MB 2HAEA 2IYOA 4RPGA 4JX8A 1BG6A 1E5QA 1CERA 4I08A 1PL6A 3DBHA 1K5HA 1V6AA 1E3WA 4LK3A 4LRSB 2O3UA 5TF4A 1NBOA 1UXIA 4W7IA 4EUEA 3RC1A 3WGGA 4NMHA 5BSFA 2JCVA 2VYNA 2P68A 4DIFA 2YFQA 2D0IA 4L4SA 1U7TA 1YOVA 4D79A 3QVXA 3EVTA 2HKIA 3PJGA 3FNHA 3ZWCA 5A05A 1EK5A 3SC4A 2WYVA 5CG1A 1C0KA 4TRMA 2YFHA 2Y1GA 1DIGA 1K6JA 2Z1NA 5A06A 4II3A 2CDCA 3GEMA 2NVUB 1ML3A 2Y66A 1XHLA 2ZTVA 1H6AA 1P31A 1QYCA 2WSBA 3GN1A 4NHEA 2OP1A 4XD2A 5G0VA 3JQ6A 3QWAA 3PIIA 4NJOA 1X7DA 5EINA 1C1XA 1YQGA 4GX2A 4R1UA 4NZ9A 5IZ4A 1T1RA 3DWFA 4MIOA 1PTJA 3JQAD 3QWIA 4PZDA 2GN8A 4ID9A 3ROMA 4N5LA 4CLDA 4MKRA 1WZIA 4Y67A 5GZ6A 3W8EA 4BGVA 4E33A 4CQLB 3L9WA 2X9NA 1NR1A 2C0CA 2OGUA 1TT7A 1PGJA 2NNLD 1L1FA 3TDKA 1E1KA 1RM5A 4FBGA 2AXQA 3E48A 4E32A 1DDOA 5BNTA 3QVTA 2D5AA 5T8KA 3TFOA 1R4MA 1PZFA 2CNBA 2NTJA 3JQ8B 4PG6A 2DLDA 1BDMA 5HWSA 2HRBA 3FWZA 4J90A 4WOKA 3C3XA 4BVAA 2HU2A 4AICA 4Z9YA 4C4OA 3QWFA 1DAPA 1Q2XA 4FN4A 3S2EA 2JKVA 4CMGA 1LRLA 3GRPA 1D1SA 3WX0A 3DC2A 4CODB 3GNTA 1BGVA 1B8VA 3GAZA 4GLOA 4ZRMA 1RM3A 3LC7O 2V6GA 4MP6A 1LTHR 1NQ5A 3UCXA 4GPD1 1VPDA 3ZWAA 4AJLA 4DUPA 4F6LA 2XPCA 4BNXA 4YAGA 4UVHA 1B0AA 4NR0A 3JQFA 3X2FA 2POQX 1H9AA 1I3NA 3OIGA 5DP1A 5C5IA 1GZ3A 3AM3A 1E7QA 1XWFA 5T64A 1PSDA 1O6ZA 1ZIDA 3B1KA 3I5MA 2HMSA 1CQIA 5AXDA 4ZJUA 1ZEMA 3LLSA 1FDWA 1X13A 4MINA 2OL4A 1XG5A 3NT5A 1D7OA 3GGOA 3PZRA 3ENKA 4FFMA 2X0RA 4B7UA 3OQBA 3EZLA 1SEVA 1T25A 1PJQA 2ZB4A 5JDCA 4IQGA 4CR8A 1LLCA 3JYPA 1LX6A 4CM1A 4CQLA 1Q7BA 1HE3A 2BFAA 4IZHA 4QUKA 3H9GA 3WOHA 1WVGA 1I5RA 4CMAA 1QP8A 3DOJA 3WGOA 2W2LA 4E0BA 3UOGA 3ZNNA 3OJOA 3HN7A 4BNJA 3C1AA 3FF4A 3CZMA 3CSDA 4FQ8A 4J16A 4YRDA 4E2XA 4BO5A 3DZJA 4YXFA 4TQGA 2CF6A 3JQ8A 1OAAA 4Q9NA 1H2HA 1KOLA 1W8DA 4RGBA 1NAHA 3E9QA 3P2OA 3ZH2A 1DSSG 4YR9A 1IL0A 3KB6A 3OEYA 3AK4A 2OO5A 3H9JA 2V7PA 4A2CA 1DC5A 4PVDA 3A14A 3VH3A 5CDGA 1GQ2A 3ITDA 4TRRA 2Y99A 4IDFA 1E92A 4IJUA 1XSEA 5KJ6A 5JYEA 3VVBA 3WTCA 3U62A 2OUIA 2ET6A 2CDAA 3KYDB 1NP3A 4RVDA 4UEKA 3KSZO 5AXCA 1PS8A 1M6HA 5HRUA 3OECA 3JYOA 3FR8A 4AJJA 1WP4A 4E13A 1R4NB 1GZ4A 2VNSA 1DOHA 1EUDA 1KERA 2JAPA 2PK3A 2X5KO 1PZHA 3TSCA 1H93A 1GADO 4YA6A 3Q3CA 3E82A 2VHVA 4XWYA 2D5CA 1KVSA 3DHEA 5IDQA 4CLOB 1PJ2A 5CEFA 2GYYA 4J4HA 3FTNA 1I30A 4BMVA 2FRDA 3BMNB 4R3NA 5JAQA 2CFCA 3KV3O 3WGYA 1UJMA 2G82A 3B1FA 4HKTA 2HSDA 1QYDA 1Q0QA 3ITKA 2YQ4A 4BO0A 1K3TA 1W73A 2JD2A 4AFNA 4IXTA 5B12A 5L51A 2ZB7A 4NJMA 3LU1A 3FSRA 4K1LA 1IHYA 3DEYX 5MGBA 1BMDA 1U4OA 2QQ5A 1F8GA 4IM7A 5CPBA 4CPDA 3ZWPA 4RVSA 3F4LA 3G17A 3HFSA 4R1NA 3KRTA 3ZWXA 2PWZA 4BNZA 2FY8A 3ZCXA 3SLKA 4W4TA 1ZSNA 2J5KA 4FOOA 2C82A 2C07A 3WIEA 1SNYA 3KYDA 2VZ9A 5FFFA 1P45A 4JGBA 5EQDA 4YT4A 1XLTA 5BSHA 3KM0A 3T7CA 2E37A 1Y5RA 4IQ0A 1OBFO 1Z82A 3GVIA 3H65A 4PVCA 2VHZA 4CMIB 4BNNA 4YACA 1RPNA 1K6IA 2O3SA 3TQHA 3Q11A 2CDBA 2P5YA 2QRJA 2CVQA 2DBZA 3GC6A 3FBTA 3OICA 1BXGB 2OBNA 4YJFB 5DT9A 4PLFA 1R6DA 4CLOA 1I01A 3FD8A 4AJ4A 9LDTA 2WWRA 1W6UA 1VLLA 1JA9A 3D5QA 2NUAA 4GL4A 1K0UA 5CG2A 3RUHA 3S1LA 3V1TC 1VKNA 2ZYDA 1ULUA 1LRKA 3OJLA 1YBAA 2EJVA 4G65A 4XQEA 3ETEA 5DBGA 3B70A 1GFSA 4X54A 4BO3A 5C7IO 1UDAA 4IS2A 2EJWA 4PLVA 4II2A 3UF0A 1ZMTA 3AOGA 3HUDA 1C3VA 3S55A 2PGLA 4URFA 2O2YA 4B8ZA 3KYCA 1VL8A 4DIBA 3RVDA 1A9YA 5FI5A 2D2IA 3WS7A 3AU8A 1ONOA 5T6BA 4J0FA 1HDGO 4LMPA 2PKQO 1GQYA 3H3JA 4OXYA 5L53A 3U49A 3FNEA 4YQZA 4IJKA 4K9DA 2YUTA 2WTBA 5B4TA 4GQAA 4CLXA 3LT2A 4U5QA 2GD1O 2VRBA 4A73A 3JQ9C 3I4CA 3DBRB 2X1HA 3N74A 4BMSA 2AG5A 4R4JA 1L7EA 4F46A 4H15A 4TRJA 4O6VA 3PXXA 2B0JA 4GGOA 2CY0A 4BB5A 1M67A 3RBVA 2PA3A 4L0QA 1LUAA 3SC6A 4IDDA 4YCAA 1PJSA 2DFVA 3TZ6A 5HBRA 3M6IA 5IN4A 1BXGA 3ASVA 4HNHA 3ZHXA 2JHFA 3E6AA 3D3EA 2AQ8A 5H82A 2BFPA 2AQHA 4KWIA 2ILTA 2I6TA 4YT8A 5I8WA 4EDFA 3OFSA 1MFZA 1N2SA 4UAGA 2Y1OA 1X1TA 2NQTA 2ZIZA 3O8QA 3JYNA 3TL3A 4FD3A 1E1LA 1XU7A 3GVXA 2G17A 4YB8A 3I9NA 1W0CA 5KJCA 2VCYA 2GDZA 5EL0A 5DZSA 3GH3A 4FGSA 4IBOA 1EMDA 3DO5A 1E6UA 4Z9FA 4WECA 1ENOA 4BKQA 1PJBA 1MG0A 3U9LA 2P4QA 3HQ4O 4D3SA 2X6TA 5AYVA 1R16A 1M76A 3S2FA 2CD9A 4AJ1A 1Z45A 1E3EA 3R1IA 4K6CA 4BO1A 3C8MA 1LLDA 3JQGA 4BNTA 4ZQFA 4BNHA 1SPXA 3GEDA 4Z3KA 2NSDA 5IXYA 3F1KA 1NYTA 2EP5A 3UAGA 4I5EA 2NTVA 3DBRA 1AXEA 4ALNA 2D8AA 1LJ8A 5AOVA 3IQDB 2P5UA 4J49A 1NHGA 4DMMA 2W8ZA 1IYZA 3DDNA 4YJGA 4MO2A 4Z0HO 4J0EA 1UZMA 1LU9A 1I10A 1WDKA 2W98A 5IN5A 4YTEA 5L7TA 1R0KA 2DUUA 3IAHA 4KQWA 5L7YA 3UCFA 4E3ZA 2A92A 4D46A 1KIFA 2FWMX 1WNTA 5A4DA 1AHHA 4D45A 1PS0A 1XCBA 2O4UX 1X7GA 3IKVA 4R5HA 1PU2A 1PZGA 4XQ9A 3WICA 1NFFA 2YY7A 4YVFA 1ID1A 3INGA 3ZHZA 1HZJA 1K2WA 4YPOA 4E2WA 1PIWA 2CUKA 1SCUA 4CM7A 4WLUA 2PTGA 2IZ1A 3AFNA 4BO9A 3K2EA 4LCJA 4LMRA 1BXKA 2C20A 1V3TA 1B8PA 1IOLA 4BB6A 3NAQA 1H9BA 4EUHA 2VTEA 1U3TA 2C7VA 4J1TA 1DFIA 3AW9A 1HDZA 4MKZA 3TL2A 4BNKA 6ADHA 3ZWNA 3GT0A 5BSGA 1NNUA 3PZBA 3FTPA 2FP4A 4DL9A 3H5AA 3ONEA 1QLJA 3JQ7B 4B3JA 4DQVA 2GF2A 4G81A 5JCJD 5ENVA 2B5VA 3RFXA 4EJ0A 4IIVA 4UEJA 4XRRA 4YBZA 1PJLA 2O50A 2PH3A 1E0DA 3E1KA 4FR5A 4RPHA 3SJ7A 4QO8A 1WDMA 2PKRA 5L7WA 1EBUA 3HDYA 3V2HA 4XEHA 1JQBA 3IKTA 4PLZA 1LBEA 2Q3EA 4I9HA 1A9ZA 1NXQA 3GRKA 2DUWA 3I83A 4PG7A 4Q3AA 2HQ1A 1V0JA 4Q3DA 4CV2A 4FFLA 1YJ8A 4RVGA 3S8MA 4AG3A 6LDHA 3OF2A 3LT4A 4Y98A 3TWOA 1PQPA 3FN4A 3DFUA 4XKJA 5G0WA 3INTA 2WE8A 2X7HA 4CUZA 4TZTA 2NADA 4RO0A 3W4IA 3Q2IA 3SVTA 4MP8A 3AM4A 4CL3A 4MJLA 2HK7A 2Q1UA 1WXDA 2QZZA 3GMSA 1SEPA 3WQSB 3HADA 5DN9A 3GZNA 3SX2A 2FSVA 4W9NC 1XA0A 5BQFA 1KY5A 4QEDA 4UEOA 1LQUA 1LA2A 5IAAA 2GR9A 3GQVA 2IDZA 1QMGA 4ND5A 4CMEC 1GD1O 1EE9A 2BD0A 1AHIA 3ST7A 3JQAA 2ZQZA 2EG9A 2AQKA 2HCTA 1FDVA 3UGKA 1ZKMA 2NU8A 4RCVA 5EN4A 5CFZA 3JQ7A 2DBRA 4EEXA 2XXJA 1XR3A 3JQFC 4NPCA 5IZCC 5KKCA 4D3DA 1JKFA 2AHRA 5TRTA 4B4UA 5C7LO 4CM9D 1QXSA 2X86A 1Y8RB 5L95A 3DHNA 5F1KA 3ULKA 1T24A 1N1GA 4BS9A 4Y8VA 4DPMA 5JW6A 1HDXA 3W1VA 3OMLA 1EEHA 2Q2WA 1DIAA 4YRBA 2DTEA 3A9WA 1E1NA 3C1TA 4ZA2A 2UYYA 1NVGA 4R9SA 4TRNA 1HETA 5FYDA 2IXAA 1B3RA 1Q0HA 3GDFA 1X7HA 2G76A 5A9SA 2HMVA 3DMTC 3JQ9A 3JQDA 3UN1A 3VVCA 3FHLA 1TT5B 4DYDA 3WQRA 3AY7A 2J8ZA 2Q50A 4L9RA 4TVBA 3QRWA 3HDHA 3OA2A 4BNGA 1LQTA 1UZLA 3BMCB 3I9KA 3LT1A 1HTBA 3DAFA 4FC7A 1E77A 1ENPA 3S2IA 3FWNA 1PEDA 1VM6A 4IS3A 4ROSA 3L4SO 1MXFA 4PGFA 1RJWA 4QO7A 1T4DA 4IDBA 3K9QO 3E18A 1U3UA 4XQCA 2V65A 2J3IA 3GR6A 3PRJA 2Q2VA 5JNLA 5DOZA 3X2EA 2PD6A 3LLVA 2BFOA 1FMCA 2Y1CA 1Z75A 3QV1A 4F6CA 1YE3A 3N7UA 3DBHB 4Y6PA 4I8XA 4CMKA 1NPTO 4KDFA 1HKUA 2QG4A 3ZWOA 5BNIA 3FNFA 3C24A 4UUMA 2J6IA 5C37A 2I76A 3QE3A 4WUVA 4B7CA 1VI2A 2YDYA 1YOVB 1Y8RA 4NK4A 4ND1A 4BNVA 3DBLB 1FXSA 3NDRA 1B8UA 1XQ6A 2OMEA 2Y1DA 2OP0A 1NQAO 2X0IA 4M87A 3RKUA 4EUFA 1U2DA 1NVTA 5A5EA 2EV9A 3F47A 5L3ZA 1V3UA 4D44A 4W99A 3ZU2A 1PL8A 3P5SA 4W6ZA 4CR6A 3RASA 1EE2A 4E5PA 3D3WA 1B7GO 4JROA 1A72A 3QY9A 4KUHA 1C1XB 1Z6ZA 2A4KA 4JJFA 4PFJA 1DLIA 4Z0TA 3UICA 1Y9AA 1U2GA 3H4VA 1EVYA 1R0LA 1I2BA 4U6SA 1JVSA 1AXGA 3U4DA 2ZJ0A 3BMCA 5FWNA 3FRJA 2IE0A 3GPIA 3GEGA 3NGLA 2PZKA 4WJZA 1ISGA 5LCXA 4WNIA 1BW9A 1HSOA 1SO8A 2GSDA 4U8GA 1ULSA 1DIBA 3FPLA 1U8FO 3KZVA 5KCZA 4EGFA 2Q49A 3GDOA 3EC7A 4BKOA 3OM9A 3GUCA 4MP3A 2JFHA 3JQBC 5B4UA 1CIVA 4YAEA 4GX0A 1UP4A 1WDLA 3ETGA 5IDWA 4FPXA 1VE9A 3HN2A 3K5PA 1ISJA 4B4VA 3KLPX 2GN9A 1ZEJA 3SBOA 1ZXBA 5CP8A 3E8XA 1I3MA 1KVRA 2EHDA 1U4SA 4Q3CA 1VJTA 2J3HA 3DBLA 4CL8A 3VZPA 4FCCA 2WD7B 5I9MA 1GTMA 2NACA 2O48X 1EQUA 3IUSA 3NKLA 3ZZNA 4MVJG 4LSMA 4IINA 4ZGWA 3LYLA 3RWBA 2Y0CA 4JBHA 2AG8A 4DPLA 1UP7A 2GN6A 3M2PA 3SEFA 4CM5A 1TLTA 1YJQA 2LDBA 1U3VA 1DBVO 1AGNA 3WYBA 5KVSA 1EK6A 4YT2A 5TJHA 1EVIA 2Q2QA 1C0LA 3BMQB 2GERA 1PJ3A 1TA4A 4BNWA 4JBGA 1ZUD1 4LSWA 3VPFA 5JAZA 2H1SA 1J0XO 3JYLA 2HMTA 3C7AA 3AY6A 5IXSA 3K30A 3FI9A 3WIDA 3T4XA 2Y1EA 1YDEA 4DTIA 4H7PA 4BIIA 2YYYA 5F5LA 3RIHA 3A06A 2E6UX 3G0OA 1H0KA 1PS9A 2YDXA 1R37A 3DOOA 3RFTA 2VYVD 3UXYA 3KXDA 2JHGA 2ZTLA 2PGDA 4W9NA 5FI3A 1GDHA 3H5NA 4YJHA 1NTOA 1BRMA 3K6JA 3MTJA 4OKIA 1TEHA 3RUDA 4W7HA 3WSWA 4CMEA 1UDBA 3PHJA 2X9GA 1GCOA 4IDCA 3O38A 5EESA 5TX7A 3HE3A 3ON5A 1HEUA 4DBZA 2WD7A 1NFRA 5IDXA 2GO1A 4XGKA 4L73A 3RCBA 2UDPA 4ND4A 4NFYA 1VRWA 4OJNA 5G4KB 1PGOA 3BAZA 2Y1FA 4DYVA 5IZCA 1V35A 4CUKA 4FB5A 4AJHA 1QRRA 5L45A 3RFVA 2UV8A 2B83A 1I32A 4JP3A 3FBGA 2D4AA 2X5JO 4DRYA 3D1LA 2WDZA 2J3KA 3BMQA 4NBUA 4XA8A 1DHRA 5KOIA 1XU9A 4GMGA 4OH1A 5DBFA 3WMXA 1Q7GA 1CJCA 2HJRA 3LF1A 1E7WA 4CJXA 3VKUA 4E5NA 1XIVA 3AJRA 4E5YA 3QHAA 1PWXA 4PLTA 2JJYA 2RAFA 3DBVO 2VUTA 3ANMA 3DMTA 4MVJI 3PYXA 4A7PA 4BO7A 2DAPA 1M2WA 4JLWA 5CDTA 1JAXA 2NTNA 3E03A 3I52A 5H81A 1O5IA 2X5OA 3JYQA 2QZ9A 3PDJA 3ADPA 5G2OA 3F3SA 2QRKA 4RPJA 3P7MA 4OOFA 3PPIA 3QVSA 5TIIA 4N5MA 3D64A 5T57A 4NJMB 2O3RA 4QX6A 4AJKA 4QFDA 3WNQA 3BMOA 1LRJA 4HWKA 3ORFA 2Z5LA 5EQFA 3ZHYA 4ND3A 2NVBA 1G6KA 3RI3A 5B37A 3CXRA 1ARZA 5KVQA 4P22A 5JC8A 5JFOA 1JVBA 4ZU3A 1TVEA 2FSSA 3AUTA 2BRUA 4G2NA 1XKQA 3T7EA 5HS4A 2O2SA 5I7VA 5G4KA 1DRUA 4H16A 4J4BA 4RJTA 2EW2A 1ZW1A 1WLYA 2IZZA 2FR1A 4R5MA 4E5KA 3BHMA 1I36A 3AUAA 5COAA 3MJ4A 1BVRA 1HZZA 1N5DA 1VSVA 3GY0A 4PZEA 4Q3BA 1KYQA 3ZU5A 3I6IA 2G1UA 1CYDA 3KUXA 1Z73A 5KNLA 1JW9B 2HMUA 2LDXA 2J5QA 4MIEA 4KUEA 2XF8A 4DBVO 3T4EA 2ZK7A 1GV1A 4NQZA 1ZSVA 3AOEC 2PD3A 2YW9A 4FS3A 1H2BA 4N5NA 4BGEA 3O4RA 5JC1A 2DT5A 2Z95A 2I65A 3SXPA 4W82A 2Y67A 1A5ZA 4MVJF 4HY3A 1Y8QA 4DVJA 4RF4A 4H3VA 4DQUA 4YAIA 4FFRA 4P8RA 5ITWA 3PHIA 8LDHA 4OYRA 1IB6A 1P0FA 1R0SA 2FPIA 3PEFA 4IPTA 8ADHA 5L4LA 3VC7A 1WWKA 2TMDA 4R3WA 3RQSA 1CWUA 3V5NA 3PGXA 3EGOA 3WYEA 4B4WA 1O95A 3GGPA 3WGIA 1C14A 1PZEA 3KYCB 2R6JA 3H9UA 5LC1A 2P2SA 4KWHA 4GX5A 1UXHA 1MUUA 3UVEA 3WTBA 9LDBA 3JQBA 2OOSA 3FPCA 1JTVA 3QVOA 2X23A 1D4FA 3QWBA 4ONEA 3I9LA 3KETA 2VWHA 4XDYA 4K26A 1P33A 1QV6A 3GHYA 1HL3A 1F12A 4O1MA 4BMNA 3NT2A 2GCGA 1HDRA 4GWKA 3RROA 1NHWA 1LNQA 3MTGA 3ZNPA 1OFGA 2ZCVA 4TKLA 2DKNA 5L9AA 1ENZA 1GU7A 3HNPA 5A02A 5B4VA 3PQFA 5JAMA 5JSFA 5JCJA 3W6ZA 4FJ0A 1HLPA 3DXFA 3VPXA 1U5CA 5HTOA 2Z1MA 4L74A 4D43A 3ZWVA 2EXXA 3CE6A 4QECA 4I5GA 4PG8A 5U9CA 2AEJA 4R41A 3OETA 2A35A 3H9EO 1DO8A 3KO8A 4RPKA 4D41A 1F17A 2BHLA 3PDUA 5COBA 3VPSA 4M8SA 1E5LA 3MJVA 2PFGA 5KVCA 1H5QA 1PR9A 2WM3A 1GY8A 3K2BA 5JMPA 3O8QB 4OAQA 3PYMA 5G0UA 3QJ5A 5TSDA 3GVPA 3BIOA 2FOIA 1UR5A 4XYBA 2PY6A 3IP1A 3RJ9A 3VH2A 2YHIA 3PP8A 3IJRA 3EDMA 2IXBA 2IEDA 5T67A 4XB2A 3WJ7A 2B37A 3EHEA 3PVZA 4UULA 1X14A 4XR9A 1EZ4A 1GZ6A 4NH4A 3CPSA 5I9LA 2GZ1A 2ZCUA 1IZ0A 2DU8A 2X9VA 1U5AA 3LZ6A 1I3KA 4EJMA 1MC4A 1JLLA 4XQGA 3JQGB 1I3LA 4BO8A 4BNMA 5DULA 1E3LA 3Q2KA 1U28A 4KOAA 4BKRA 4XYMA 4WLEA 3JV7A 3MWDB 1HXHA 2VNAA 1LSSA 2DTDA 2FR0A 5FF9A 3W4JA 3K73O 3DTYA 1Q0LA 2CVZA 4MVJE 3W4KA 4YJGB 4DC0A 3DAPA 2E48A 1T2DA 4R69A 4DA9A 2YQ5A 1L7DA 2ZTUA 3NUGA 4CM9A 1HDYA 3EZYA 1T2FA 1UZNA 4MPDA 3MJEA 4DLBA 1A4IA 2O3TA 2P9CA 2VUSA 3L0DA 2BELA 1DC6A 3DTTA 4RZHA 4BKUA 2BMAA 4J6FA 4XB1A 1P9LA 1LLQA 3U4HA 3D7LA 3HB4X 3GAFA 2EGHA 2VWPA 3RSHA 2YV3A 2D59A 3VTFA 3WG9A 2VRCD 4DWVA 1FDUA 1CF2O 5BSEA 1NR7A 3ZNOA 4ZN6A 3KOUA 5G0SA 4YAJA 3HDQA 3PWZA 2G0TA 3U4CA 4LISA 1V9LA 3DZIA 1JAYA 3GN2A 3HSKA 5A03A 3N58A 2NVWA 3I6QA 3PJEA 5I7SA 5TC4A 2EEZA 2C54A 4CM6A 1ZH8A 1HYHA 3QWHA 1SBYA 5IG2A 1JKJA 4IJWA 4QQRA 1GUZA 4NU5A 4P4LA 2B4RO 5U1PA 4XJTA 4HUJA 2I9PA 4CMJA 1DC3A 1ADGA 5IF3A 2IEBA 4OHUA 5JS6A 5GY7A 2PZMA 4JCOA 3STHA 3AI1A 1TI7A 3U4IA 3DAGA 2BI8A 3DZGA 5DBIA 5G4LA 2DTXA 3H3FA 1E3IA 1WAMA 2OBYA 2HJSA 2RHCA 3NYWA 4EJ6A 4L8VA 2QHXA 1GYQA 4AJPA 2C2XA 1MV8A 3E5RA 5JE8A 1GUFA 2GUGA 4PG4A 2ZYAA 3GPDG 1TB4A 4UREA 3F5QA 4GAEA 5JO9A 1AUPA 2RCYA 1JKIA 4QTZA 5L4SA 5ADHA 1DB3A 4U6QA 4CR7A 2CF5A 4XCVA 3GZNB 3ROKA 3CIFA 3VDQA 1UXJA 4BHTA 3MEQA 4B79A 3ONDA 2JD0A 4IQ8A 5ICMA 3AOEA 3QP9A 3GMDA 3JQAB 4HNGA 2PH5A 1J49A 2C29D 5CEJA 1KEPA 2D1YA 1WMBA 2YV1A 3TFQA 4J7XA 3VDRA 3Q6IA 1N7HA 1D3AA 1O9BA 3SJUA 4KDEA 1EUZA 5I8ZA 3FCOA 3S2GA 1QV7A 4GSLA 5G0TA 2WJPA 1HE5A 5A5FA 1HRDA 2GZ3A 4WK6A 1E7SA 4XDZA 1F06A 1P1HA 1UH5A 3V1YA 4A10A 4B8WA 1EUCA 2B36A 4R1SA 5TQVA 1YQDA 2XXBA 7MDHA 2WYWA 2IYPA 2DFDA 3OIDA 4UUNA 4UUOA 3GA0A 3RC9A 1UXKA 3LT0A 4WASA 4JNKA 3WWZA 3TNLA 5A9SB 1HWYA 3W8DA 2Q1SA 1YBVA 4Z0PA 3A28A 3RAJA 4ALLA 1E7MA 1LSJA 2GASA 2EWMA 1VJ1A 4MVJD 1QR6A 1SB9A 3BZUA 1GEEA 4CUJA 1GYRA 4CLRB 3F46A 3VOSA 3D4PA 4DQXA 2GN4A 4OSPA 3JSAA 4UVDA 2VOJA 3QLJA 3EVNA 3DMYA 1M75A 5FEUA 2DQ4A 4U7WA 2VHXA 3EW7A 3QSGA 1QLHA 1KEWA 4I9NA 3CZRA 3ZU4A 3LQFA 3HFGA 1ONPA 1FJHA 2P91A 5ILOA 1FDTA 1J6UA 2EERA 4XYLA 2Q45A 4ALKA 5K0ZA 1LDNA 3OSUA 1KC3A 1YH3A 1Z7BA 3KLMX 4HFMA 3OQ1A 5TT1A 2I66A 4FW8A 1V8BA 3WSVA 4GX1A 1Y7TA 4KQXA 4Y9DA 4C7JA 1IUKA 2P4HX 2Y93A 1HSZA 2BGKA 4YQYA 4ZQEA 4CM3A 4J7CA 2WEKA 3GLQA 3PFFA 5HS6A 2VYVA 1I24A 2BLLA 2I67A 1SAYA 3INRA 1G0NA 3U0BA 3V2GA 1OZAA 1YL6A 2XOXA 4J1NA 4HFNA 4BNLA 3HJAA 3D3WB 1E3SA 2AE1A 2VHYA 3G49A 2R00C 2VUUA 3TJRA 3OA0A 1T2EA 1O94A 2BH9A 1MFPA 2VZ8A 3L6DA 2H9IA 4R16A 1KY4A 1ZVMA 2ZJ1A 3C85A 5AQ1A 4J9UE 3D5TA 3U5TA 4CLRA 1LDGA 4PLHA 1S7CA 4WLFA 3PJFA 2DVMA 3JD3A 2O4CA 4PN3A 1BW9B 3PQDA 3PI7A 2JCYA 3ZNQA 2VTDA 4A26A 1ZMOA 4CMCA 3UFXA 4OMUA 3IC5A 3I1JA 4K28A 4BGUA 2EKQA 1EVZA 1R66A 1ZO8A 2E4AA 3JCZA 4I9UA 1DLJA 1SOWA 1OOEA 3B20A 5DOVA 4BGIA 2VT3A 3GFGA 4WCFC 1ZBQA 3ZWBA 4R9RA 4XGIA 4DPKA 3I9MA 1UXGA 3OJFA 2FPGA 4PRLA 1HLDA 4ZRNA 5JY6A 1X0VA 4KTVE 4IGFA 1J4AA 3TZQA 5JMWA 1M66A 3NV9A 4KUGA 3LC2O 1ZJYA 4JXKA 4GMFA 3GZ4A 1T26A 3ANNA 4E2ZA 3ZV4A 3VAZA 1WPQA 1EBFA 3AY3A 4J43A 4B3HA 3QIVA 5I7EA 5KWEA 3RUEA 4UUPA 2GGSA 3JQCA 1YXMA 4RORA 2DPGA 2X22A 5I7FA 3B1JA 4ZQHA 5AVOA 4AL4A 4JQCA 4DXHA 4RLHA 2YV2A 3LK7A 1PWZA 3F6YA 1LDEA 2QX7A 4EBFA 4CQMD 5JAIA 3ZI0A 1NQTA 4XYGA 3GHHA 2OZPA 1KBZA 4ITUA 3TPCA 3U09A 1JDJA 2EKLA 2CMDA 1XDWA 1BHSA 1PGNA 2BGMA 4EITA 4A5OA 1KVQA 3JD2A 2VQ3A 4DMLA 2DBQA 4FFNA 4DLAA 3EAGA 3GVCA 4GVLA 4JP2A 2PNFA 4TVOA 5F3RA 3RBZA 1G1AA 2PKQP 3KVOA 4NBVA 3I9OA 4ESOA 5U4QA 4D7AA 3PHHA 3WGZA 1CQJA 3QQPA 1HF3A 4YT5A 2O23A 5DCYA 3WR5A 1YL5A 5DDIP 1YWGO 1ZJZA 4WKGA 3PK0A 4N54A 4K6FA 2YZ7A 1YBMA 4YJHB 4PCVA 3BTVA 5JBIA 5ES3A 3WLEA 5DP2A 4OIMA 3MJSA 2IRWA 2FZEA 3JD0A 1I2ZA 5JO0A 4AJIA 1E3JA 1UAYA 3BA1A 3CUKA 4HBGA 3RUCA 1N9GB 4KTTE 4DIOA 1YRLA 5CDUA 1YS4A 1PJCA 2B69A 3LDHA 4EI2A 1DHTA 3RUAA 5ER6A 3PGJA 1H6BA 2X58A 4IJVA 4XX0A 2PD4A 4MVJP 5A9TA 1JWBB 1E6EA 5TT0A 4BNIA 2QRLA 3ZDFA 2BF7A 2AMFA 3KYBA 3NEPX 4BV8A 1IPEA 1ZZEA 4NU6A 4GKVA 1KC1A 1MA0A 4TWRA 5CDSA 2UUPA 1B16A 5IDYA 5THQA 5A3JA 1LSOA 3AUUA 1F0YA 3WGHA 1I33A 1LI4A 3ASUA 1TXGA 3UCEA 4OL9A 4RLSA 2HUNA 4FOSA 4ZQBA 3TOXA 5KKAA 1NWCA 3HG7A 1MG5A 2Q1TA 4YJDA 2Y68A 3BTOA 4IMPA 4WLOA 3M2TA 4CV0A 1GCUA 4E4YA 3TRIA 2VWGA 1QYWA 2NV6A 4FGWA 5ICSA 1LSUA 4CLHA 3L77A 3Q0EA 3VPGA 4FSHA 5EERA 3TF5A 5I9NA 4E5MA 3CINA 2EGGA 3DZFA 2CZCA 3IP3A 5TS3A 1NM5A 3UUWA 5ER9A 4FJ1A 1IY8A 3BMOB 4CM4B 3O03A 5DNAA 1N9GA 3EYWA 1DJQA 5F5NA 2O7QA 4ALMA 3GNSA 4GKBA 4ILKA 2WMDA 3H6KA 1R15A 1RYDA 1SZJG 4G5HA 5GMOA 3K31A 5AXBA 2RIRA 4OO3A 3RU7A 4WCFB 5CDYA 4NI5A 4Q3NA 3GDGA 3ZHBA 1LEHA 3COSA 2AW5A 3KEQA 4FFOA 4FIZA 4NG5A 4WGGA 3C7DB 1PGQA 3EMKA 3F4BA 3MOGA 1Y5MA 3ZV3A 4YWJA 5JYDA 4QFCA 2NWQA 1A7AA 3NTRA 3TN7A 3V1UA 3G79A 2NU7A 1Q7CA 4JBIA 4FFPA 4EZBA 3L6EA 1ADBA 5BR7A 5IFLA 4JIGA 5GZ3A 1Q1NA 1U1IA 3MOIA 1I0ZA 1O89A 4P38A 1X0XA 4IDEA 4M54A 2F00A 2NVUA 3NTQA 3VPHA 4GGPA 2R00A 1DRVA 4TSKA 4ALJA 3KSDO 2J5RA 3PWSA 1B2LA 1Y8QB 4FC6A 3ZN2A 1C1DB 1F8FA 3R6DA 3K96A 1WW8A 1YQXA 5TJ9A 4R68A 5AXAA 3WGTA 5EIOA 3R3SA 2JFGA 4CM8B 2QYSA 1B3BA 1DAOA 1MX3A 3F5SA 1KVTA 1EQ2A 2QW8A 1VKOA 3E9MA 1LC3A 4DGSA 5IJZA 1MGOA 3HB5X 3NDIA 3VZQA 2HDHA 4CM4A 3H7AA 4E6PA 4HADA 5COQA 2P9GA 1ZK3A 1LDMA 1DC4A 2VHWA 4GI2A 1O0SA 2EF1A 3OP4A 4OXNA 4UVGA 2H6EA 4GLLA 2VRCA 3G1TA 2PZLA 1GQQA 2FHSA 1P1KA 4J9VA 4OSOA 4WCFA 3O26A 3ROQA 3BTUA 2XAAA 1Y81A 4P4NA 1UDCA 4HFJA 1GYPA 3ZU3A 2BFMA 4XIYA 3ADOA 4E12A 4OQYA 1YB5A 1GUYA 4QT0A 4FDAA 2C2YA 3F9IA 4WCDA 4BNYA 2JCXA 3IL2A 4OKNA 4IY1A 3IOYA 1DXYA 1U3WA 2ZYGA 3KBOA 3WBFA 4Q3EA 3IUPA 3L9XA 1B14A 1YGYA 1MB4A 1H6DA 1OI7A 4ZVVA 2BKAA 1B26A 1ENYA 2UUOA 3BHIA 4KP7A 4XZ3A 1BXZA 1SC6A 3ENNA 3RU9A 4HP8A 4M49A 4EW6A 1C1DA 3NDJA 4PG5A 1ZFNA 3W8FA 3P19A 4PLWA 3ZV5A 3H5RA 1P77A 1J5PA 5JLAA 1LLUA 1QORA 3QW2A 4CM8A 2YHIB 3QA9A 2RH4A 3PFWO 4L4XA 4CMBA 3IS3A 1BVUA 1P1RA 3DR3A 4PLPA 3C7CB 3EY4A 4XYEA 5BT9A 3IIEA 4I1IA 2VT2A 1XGKA 3AM5A 1QG6A 4EYEA 5CEEA 1EDZA 2VYND 1GR0A 4BV9A 3VZRA 1QKIA
chains in the Genus database with same CATH superfamily
4IMRA 3AFHA 1CEXA 4GQBA 5ECDA 2C5AA 3JQEA 4RZIA 3T3NA 4RY0A 2XMCA 4OQXA 1TEZA 4LZZA 2WJ3A 2ZIVB 4D0RA 3RF7A 4RTKA 4HX2A 5CA1A 2ETXA 2AE2A 2G7MC 1FTQA 3HYSA 3B1WA 2GK4A 3X1JA 3TGLA 4FDLA 1F0KA 2FHPA 4Y2QA 2WY2D 2IYWA 4IHJA 1P7WA 3AWDA 4CEHA 5HK8A 1CQPA 5LQKA 2GAOA 3RODA 1P3DA 1J20A 3RUPA 2JFFA 1EKXA 4GO1A 2PLFA 4GVXA 4Z6KA 1L7PA 2V97A 3Q9UA 1XZDA 2IYVA 3OBBA 3CMMA 4RV4A 4DMGA 1D9ZA 4A8JC 3WQQA 2VHEA 4TTSA 3ODGA 2GQ0A 5IUNC 1PGPA 1AS2A 2B25A 3FLBA 1OSNA 2X9QA 1DKLA 3EQ8A 5KIAA 4PAQA 3NDPA 2P65A 2VJPA 4EOGA 4LJ7A 3VTKA 4ZD6A 3LX6A 4NNJA 3EJ6A 4M89A 4MI9A 2GHQA 4NL4H 5CPFA 3BRSA 5HA5A 4GE0A 3SIPA 2SBTA 5K0BA 1UDXA 1ZESA 2VQDA 3S4YA 1A8PA 1B00A 3EODA 4G8BA 5TF0A 3C97A 2O52A 2PZJA 4FZ3A 1A71A 3TOZA 4CFSA 1JIUA 3ICOA 5JZSA 4BKPA 3K9FC 1NW7A 1FUEA 1GPDG 5KU7A 3PYLA 3ZWDA 1E4YA 5IKOA 4MVJA 2A9RA 1TO2E 2H11A 2PX4A 3FPGA 3T0FA 1AO0A 1IEWA 2XNKA 3HCRA 3DQPA 3K6SB 4HVTA 5K51A 5AHXA 4ZO7A 3PFIA 4XARA 1RZRA 3F8SA 3GUYA 5ALGA 4MUGA 3WGJA 1I3CA 5BSVA 5AI6A 4YJ3A 1T5DX 4D0NA 4EFMA 4QRDA 3ZLJA 5F21A 1UPXA 1OXXK 1L8QA 1PK7A 1ISMA 3ISVA 4ZJPA 3WK8A 4WDRA 2HRZA 2ZEJA 2JJQA 2B92A 3CH5A 3KUCA 1VHTA 3MJTA 2DLCX 4KREA 1KBQA 2R44A 3NI2A 2PKCA 4MOWA 2M6RA 3R9WA 2JAHA 5HOEA 1X77A 3IAFA 3JWPA 1JJIA 4RZ3A 3LI2A 2GJSA 4L9SA 4ZI3A 1BHO1 4C3VA 5KYYA 1WMAA 3D3JA 3OKPA 4ZXPA 1RABA 2C61A 3P9PA 1I4LD 4CT4B 3OEED 2XUJA 3EVCA 1J22A 4J3FA 4LVUA 4I5FA 4QQFA 2WD8A 4Q5IA 4RZXA 3VBEA 5AW6A 4IZIA 4WEOA 3GCGA 1G21A 5T5QA 5F76A 3LW7A 5EMHA 3HYTA 1JE0A 3LHKA 4DDWA 2C7GA 4JA2A 3N7AA 4BU1A 4EYKA 3GRUA 3KPJA 1IXKA 2GLXA 4LXYA 4EG5A 2GA9A 2HU7A 2OHVA 1P0CA 2I6UA 2JEZA 4LVCA 3QVWA 3QKTA 2X8LA 2A9KA 4FHFA 1ZSYA 1QGYA 3TZLA 3UW3A 1BXRA 2GRJA 3W3AD 1SK9A 2VZ0A 1L7XA 1GPLA 3NHLA 3GF4A 5DK4A 4CMIA 2CLSA 4YYZA 5A4MS 4GI5A 4DCVA 1SMKA 2VZEA 3EGEA 4M9UA 4O0LA 4DMFA 4AVYA 1YUNA 3RKSA 3OF5A 4EW3A 1K2VN 3R5XA 2NZYA 3AXTA 3RANA 2HB6A 4WNAB 1U8EA 4QXAA 1PLLA 2VJAA 3M5CA 3QU4A 1ZOSA 1NPDA 1WHTB 2I99A 2X40A 2YWCA 4O4LB 4ZKDA 4N18A 3VM6A 3KDSE 4UM8B 4EAAA 4IFIA 1JF8A 4W5HA 1XYGA 1HL7A 2D1TA 1U7HA 1V8FA 2YJZA 5K3CA 1QIGA 3P9IA 4HN2A 3VMMA 3PJDA 5IT4A 2RBEA 4ITVA 4PHTA 3OPNA 1B6GA 5DLEA 4AS2A 4G67A 2PGJA 3D6UA 1NV8A 5AOBA 1WXHA 1BDBA 2I29A 2O0KA 3TRDA 3UHAA 1H2WA 3I1FA 1OU4A 2FQYA 2Q8NA 3TG8A 1I2CA 5CYPA 3TZCA 2V74B 4FFSA 1RXCA 4L72A 4UXIA 4B7XA 2NU9A 3CUWA 3I9V1 2IV2X 1Z5VA 1S1MA 4MQEA 1CPYA 3CV3A 1OC4A 3W7VA 4WUTA 3NM4A 4U0JA 4UNRA 2CN1A 5E6RB 3CX3A 1IONA 4I6GA 3ZQ4A 2XJ9A 4LNAA 2EL9A 3JD4A 3VU9A 3HCFA 3I58A 2PQMA 1WBBA 4INAA 4EMBA 1XMXA 3KQPA 3A1NA 1EK0A 3NT4A 4Q37A 1P1JA 3I6ZA 2RJ3A 3PHGA 2IXGA 2QQFA 1N5KA 2J3DA 4WHMA 2J0UA 2G04A 3ZHOA 4PLYA 3EZ9A 4BTEA 1ZNWA 3FYSA 2E21A 3G82C 2VDPB 3IMFA 4JYPA 4L5IA 4YRNA 4QOSA 2EKPA 4QATA 4ETWA 1LI5A 2EARA 3HN6A 4B0PA 2HW8A 5JZMA 1DEOA 2IHKA 4M88A 3DKKA 4V0OA 2KJQA 3VUEA 4CG1A 5CX1A 1CY0A 2AFIB 3C3MA 2HEIA 2QVLA 4TT8A 1IE3A 3ROTA 3GPCA 4A8JB 3B1XA 1P5FA 4JLPA 3BOSA 1FUKA 3IAM6 2X9LA 3LHFA 2NX2A 3RTAA 4D4HA 5FTLA 1BMFA 5FORA 2A1TS 4Y9TA 1N2CE 6Q21A 5A0TA 1GPH1 3O9ZA 4P36A 1E9EA 3ROGA 4KPEC 4HSEA 3NGXA 2QM7A 1GU1A 5HE8A 5GINE 1G8PA 1N5LA 2DE0X 3E2IA 4E1BA 4FYVA 4FWBA 3ZLVA 1HYGA 3EBPA 3DM5A 5BN4B 1D1PA 4DNOA 2AFHB 1FC0A 2NYAA 2WJJA 3ZIAD 4C7KA 3WYAA 4N3NA 4KIGA 1X87A 1GEGA 4AZ3A 3AESA 3RBXA 1HDOA 3B1YA 4D9KA 5IMSA 3J80A 3IVXA 1QIHA 4AG6A 5B7QA 4DXAA 1XF1A 2HDNB 4WXHA 1WM1A 2QE7D 2QZSA 1G63A 2Z30A 3GLRA 3ZWYA 1MJNA 5BN3B 1K3UB 4A0SA 1Y6JA 5IJXA 1LX7A 1SCAA 2WG0A 2YFKA 3DOFA 1RNLA 5JRDS 4AMUA 2QDXA 4X41A 5FUYA 2PIAA 4YCJA 3A1DA 1G20B 2ATEA 2PV7A 3OMWA 1ZK0A 1JHPA 1RXUA 2GF9A 2QPOA 2WVHA 3OEWA 4ER5A 2AFRA 2VPYA 3GLIA 2ZUEA 3WB9A 5B57C 4AXXA 3TRKA 1Z5NA 2ZTMA 2RE8A 2XY4A 1DFGA 3P94A 3RRXA 4AAYA 3WXBA 421PA 1A5AB 3BM5A 5E4FA 1RAEA 3ITEA 3M5DA 3M9XA 3RUIA 3A4VA 2UUBB 4LRTB 1IQPA 2I2XB 4DIEA 1BS1A 4L6IA 4JUBA 1J21A 1NASA 1PTJC 1V7ZA 2H5JA 3BRQA 4ZMSA 4RV9A 5A5VA 4J91A 5FWXB 3AEXA 1C7IA 5ITVA 4L5AA 2VSXA 4JLDA 3WKCA 1WEHA 1NM5C 4LRYA 1AN9A 1BE1A 1PHRA 2Y6VA 3CVJA 2V7GA 4G07A 1XQ1A 3EVAA 4L5CA 3VR5H 5LIRA 4LJYA 1PQ4A 3RGWS 4ETMA 2D2EA 1AF7A 1ZRMA 3VPDA 2O3JA 5AICA 4DQ0A 1MOSA 4JOCA 5JH7F 4P0PB 1G3IA 4MGYR 4Y2UA 4PU0A 1KYYA 4KVAA 4XIIA 4A1FA 4YROA 4XRGA 2Y9PB 5BUQA 2FZWA 2GAFA 3E1SA 3KSBC 2BGWA 3CEAA 5I4BA 2XTJA 4QYTA 4U39A 4LC0A 2QD3A 3QKSA 1JEJA 1JDBC 3WMGA 4KFSA 5LB4A 1XRRA 3BWXA 1Q0RA 2FPGB 2OKGA 1Y3HA 2PXAA 1GSAA 5H7XA 4FYXA 4KXXA 1KEUA 2IF2A 3THWB 5G40A 2C4MA 4Z3DA 3R8CA 3VJMA 2BH2A 4UU1A 1GL7A 2OAGA 1V3VA 4L9AA 3MJRA 1ECPA 2QMHA 1N33B 4V1CI 2GBLC 2OFWA 3P9XA 5D6NA 2ZUBA 1EVKA 3E9ZA 3FUCA 3KQLA 5TNXA 2VR1A 3A9RA 4KFCA 1ADCA 1ODSA 4NZOA 4NDZA 3IILA 3G0IA 1PAUA 3HKDB 1R88A 3C3DA 1DKNA 4HJRA 2XUPA 1FCJA 3EH2A 2O8FA 1K92A 1OWMA 5FKJA 2FMUA 3Q41A 1YQ9A 5J4VA 2ZJ4A 3HCOA 5DX0A 1LC0A 1YA8A 2FYTA 3EVEA 2BHTA 3EA0A 1H1LA 2HLPA 4GOLD 4IDQA 1IULA 1GA4A 1VMAA 4OXQA 4HN9A 5DLPA 5REQA 2AJCA 4PHFA 4D6YA 1KEVA 1PZXA 2HPZA 3MPUA 2G25A 2X8WA 4WVFA 1KI2A 3GLHB 1SCDA 2RGNA 5JDCC 3UKOA 2Z57A 2HDOA 5EWMB 4QYXA 3CRNA 2PKYX 1AQ6A 2B4QA 1U8ZA 2B1IA 4DKJA 4EB6B 1KFEB 2DQSA 1OLSA 3KS9A 1GA1A 2DWOA 3KPYA 3AEUB 3NVDA 1B74A 2JAUA 1TK3A 2N46A 2IHZA 3QJYA 4JYMA 5JDIA 2BJHA 5CYOA 2CCGA 1M33A 4GKKB 4H7JA 4JSYA 5D1NA 4M1SA 5HVNA 1OR8A 2O7RA 1MLDA 4V1CA 3H5IA 1V1MB 5AK4A 3D0OA 3IQIX 4B3FX 5EOVA 4EPTA 3QPDA 3VNUA 1L1RA 2QU8A 2AZXA 1FS4A 3OIFA 5CR9A 4J2OA 2RI0A 1VI5A 1V5IA 4MO9A 2I1WA 4S1PA 4OQZA 3P5BA 2VTVA 2EG5A 1Q20A 3EF1A 4L75A 4BY9E 4XLLA 3R3UA 4ZCRA 1R0ZA 4CQNA 4R2JA 2DY0A 3DEHA 3LL7A 4BJ1A 4E07A 3W6UA 3ZCQA 1BWSA 3HHPA 4CKCB 4DY6A 4MWDA 4DLLA 1E18A 1DCFA 1JG3A 3FNGA 1HX7A 3KJQA 2Y0EA 2REQB 2ZT5A 3T35A 1SOVA 1WZEA 1YVEI 2CHQA 5H1YA 5B36A 3QTBA 2I2CA 1FU7A 4Y1GA 4K0KB 2B5WA 3F49S 1LPOA 4Z7QB 3MWLA 2Q0SA 5HUHA 4I1PA 1HV8A 1YKGA 2BY4A 2WC1A 1S8OA 3D4LA 3HC7A 4IXNA 4NMMA 4E31A 1M73E 2QJRA 1J0EA 3QUCA 4CI9A 1RKXA 3LCVB 4JYCA 4Z1MA 1UEIA 2A5LA 2B4TO 1E6CA 2X0NA 2I1LA 4KX3A 2VJLA 3RT1A 1DG3A 4HQ6A 2QAGC 1J8FA 2EIHA 3BTSA 1JAIA 3R5KA 4QULA 2Q0XA 2EW8A 3HEBA 4R1TA 5GM2A 3EJWA 5CLJA 4J4TA 2WWVD 4U7DA 5DFAA 4LY0A 3VU0A 1WG8A 3IIMA 1N7IA 4B33A 3IMGA 2PUGA 4HNAB 2IS1A 3OH8A 3TB4A 1AT1A 2Q99A 2HO5A 1C0IA 3PVSA 4GI3A 4PYQA 1DBIA 2P2GA 1D5CA 2ACEA 1J1IA 2XRYA 3R7AA 5KC8A 3KAQA 3GGGA 5D3QA 3G8DA 3I4FA 4BQRA 2EQAA 3MBOA 3ZWQA 3GUZA 2GPAA 5P21A 3TG2A 2AFVA 2H1FA 2VJNA 2YR0A 4IDGA 4OGGA 1W87A 1Q44A 1Z7EA 2IZ0A 4IXWA 4OV6B 5BMVB 2J0SA 3W5JA 4ZTZB 3CTPA 1XYYA 4DQLA 3R3HA 1DZ3A 1MA3A 1R4MB 2HWWA 2CFRA 3DMDA 2PXXA 3OIYA 4RA9B 4RPGA 1NULA 4Z4CA 1BG6A 1QO0A 2WFAA 1E62A 1MT3A 3R20A 3EGCA 1JDBB 3ES9A 1KZ7B 1K5HA 4I08A 1V6AA 1RYYA 4HLQB 4LK3A 7AT1A 4TX1A 3THYB 1NYLA 3TEJA 4B6FA 1UXIA 1AUOA 4W7IA 1TM4E 3QOFA 3EZGA 1XLTC 4FI3F 5KTTA 3ZDZB 5IVIA 4EUEA 1GT6A 3H2KA 2IXFA 3A1FA 3C87A 4G9GA 4IZOA 1IPHA 2YH2A 1SA0B 2Q4DA 3FZQA 4NMHA 4C04A 2D0IA 2BFFB 4L4SA 2FUEA 2XWSA 4D79A 1P62B 3EVTA 1I7LA 2QT1A 3FNHA 2B20A 1FLAA 1JXAA 1EK5A 2FEPA 5A05A 4F3CA 2J0QA 1PFYA 3R74A 3AHDA 1U9IA 3IHLA 5CG1A 3INNA 1NIJA 4LV6A 1GPYA 2HJ9A 2ZE7A 2Y1GA 4X95A 1JHMA 3EQ2A 3WYDA 5HUJA 1KRHA 2CDCA 3QYFA 1ML3A 2Y66A 1MOZA 2CD7A 3LGSA 4GYWA 2VDMB 1QHHA 1H6AA 1P31A 3EAFA 2WSBA 4NHEA 5EKTA 3R9KA 1UBGA 5HZKA 3NYQA 5M3BA 2IBTA 5FDFA 2O2GA 3EZ7A 4AYXA 3GJ0A 3K9WA 5FI1B 3NAGA 5EKSA 3T99A 5EINA 5J2TB 1PW5A 4GX2A 1YFJA 3Q8XB 4NZ9A 4Z2YA 3OT5A 1G41A 2JIMA 2ZE5A 5LOVA 3JAWA 4PHCA 4G0VA 1T0BA 3HLTA 3JQAD 6GPBA 2G77B 7YASA 2EJBA 3R5SA 2GN8A 1CR4A 1SPBS 2J31A 4ID9A 3CS3A 3ROMA 4N5LA 2II6A 4OP3A 3NWEA 4RHUA 5C5EA 4MEAA 1WZIA 3W8EA 3NIGB 1MO2A 1Z18A 3A37A 1JT9A 3L9WA 4CQLB 4E33A 2BCJQ 2YXEA 4RTJA 1KXJA 1SD2A 4ESEA 2CZGA 1QQ7A 2NNLD 1YGPA 3CKMA 4KQFA 2GBCA 1RM5A 2WSYB 1WUYA 5DXFA 3DLBA 3E48A 1TUGA 4PYNA 2VF2A 2XUIA 2D5AA 1L7OA 3HY4A 2CXQA 1PZFA 2VAXA 4MCHA 5H9WA 3I1IA 3WWEA 1BWPA 2W0MA 4EY3A 1BDMA 2IHUA 3FWZA 5HWSA 1JIVA 4W9MC 5MFPA 1US8B 1Y7LA 2MIIA 3C3XA 4BVAA 2W2TA 5DKFA 3P97A 3M70A 4MLDA 1ZUWA 5FLEX 4MWEA 5F7OA 1MAHA 3S81A 2R96A 3A6LA 4CMGA 2E0IA 4EWLA 1LRLA 1B76A 1AK9A 5E8RA 4ENTA 4FUTA 1KKUA 3DC2A 3GAZA 4INJA 4J76A 3L7DA 1C4OA 2PSJA 4JLOA 1F60A 4YJ2B 1Z3CA 3UK7A 4RCYA 1LTHR 1NQ5A 3AB7A 4DCPA 1R4ZA 4ZU6X 1H69A 2HFKA 3PG5A 4DUPA 4MRMB 4F6LA 4BNXA 5CLQA 3X2FA 2A5JA 4OHKA 4U2FA 5DP1A 3IT2A 1GZ3A 1K6EA 1A2OA 2Y1WA 1Z06A 4YRLA 5C8XA 1B2RA 1O6ZA 5ALQA 1L7BA 4E7PA 5JUWA 4L02A 2LKCA 3HH8A 2JLCA 3I5MA 4ZOLA 5BORA 2K7ZA 1XZEA 1X86B 4ZJUA 2SICE 1FDWA 1KYTA 2FFHA 3UJ8A 1CUVA 3E23A 4ZYTA 1LFAA 3PZRA 4I55A 4XWAA 1GHTA 1P3JA 2X0RA 4DG8A 3CVOA 2AX3A 1FX0B 1T25A 2JARA 2CZQA 1PE0A 2NV2B 2XB6A 3EG9B 4H0NA 1H4QA 4IQGA 4LHWA 1M1NB 1NIPA 4YS6A 2R4UA 2QAGB 3NW9A 1Q1ZA 4TL8A 2A30A 4CM1A 3H42B 3WOHA 2BFAA 4F12A 1G8AA 1I5RA 2QNIA 3DOJA 2IU6A 4BEJA 1L5HB 5JJBA 4Q24A 3LLCA 3WLRA 3NXKA 5ALPA 2OCYC 3FF4A 1TUIA 5FI0B 2R7KA 4J16A 4YRDA 4PGHA 4BO5A 3DZJA 5KWIA 1F7UA 2NP6A 5FHRA 5IP5A 3HJNA 3H2IA 2H18A 3H75A 5MFZA 1W30A 2MT9A 4S0ZA 3E9QA 2DWPA 3MGBA 3P9NA 5GTDA 3KTAB 5JARA 3KKEA 5HZGA 1KZHA 4ZO9A 4L85A 4EX6A 4PX9A 4QXQA 2G6BA 3H9JA 5LXTB 3PSHA 5CDGA 1SD5A 3N3AC 3UWKA 3AJEA 3O9VA 3W78A 4TRRA 5ALFA 3WWPA 1P6XA 1X8LA 1E92A 1C5KA 3B52X 1NLMA 3I6BA 3NO4A 3PNMA 1REQA 2K7FA 1PG2A 1W4CA 1QMPA 2ZBQA 5LBIA 3W3AH 1AQIA 1O96A 3TX2A 5JYEA 1F7VA 5EZYB 4FYWA 4CEHB 2MWMA 5G41A 1ZW6A 3BE6A 1XRMA 1Z68A 2ET6A 1PNQA 1NP3A 3FUVA 1TUBA 1HFJA 3G9XA 1OHHD 4ISCA 4O1IA 5D85A 1LVGA 8OHMA 5J43A 3CISA 1PS8A 4NYJQ 1DIOB 1PF7E 2CMFA 3EWNA 5ECYA 4BQNA 3JYOA 5HRUA 1BDHA 1K7EB 3CO5A 1B73A 4N0MA 4E13A 3DTVA 2E3JA 3G1WA 1GFZA 4PAGA 1J56A 1C8VB 3FYCA 3TD9A 4D96A 1R6UA 5KYXB 2X5KO 3IO5A 2D1RA 3TSCA 1PD0A 5B7PA 5FLYA 1JHOA 4WNYA 3WL4A 2A0FA 4B5LA 3DNFA 1G6OA 3AEKB 5F9FA 4MR9A 3Q6NA 5IDQA 4KXMA 1JQ3A 1JIIA 2ZPTX 3DUFA 4CLOB 3HPRA 2J08A 3G5MA 3OJXA 2EFGA 1R6XA 2P77A 3F0TA 1ODLA 4LXQA 1ZMBA 2HV8A 3BMNB 1EP9A 1VL5A 1AS3A 2ZIAA 3BIFA 3GFSA 3LYUA 1UJMA 4G97A 4LBZA 4NATA 4OK5A 1SUEA 2V7UA 3B1FA 4EBBA 5HGXA 5EHQA 3CCCA 4Q7MB 1QB7A 2J9YB 1DINA 1Q0QA 1RVV1 2NO4A 3DEAA 1CC1S 3EW9A 1VIMA 3FUXA 4NH0A 5LVAA 1TF5A 3ER9A 4QDOA 3CUTA 2JD2A 3OE7D 5GJCA 4AFNA 3KJFA 2GUWA 3FNRA 2G4VA 3W5SA 4JI3B 4EY7A 1PRYA 4DSTA 1IHYA 2RBGA 3SSNA 1OBVA 4OJKA 4RIEA 1BMDA 2QQ5A 3OESA 3ESBA 1F8GA 3KVRA 4K7JA 4LJLA 3PNVA 5KCMA 4CPDA 4K2HA 1PT7A 2A1IA 3VQTA 3NXSA 3HFSA 4LHYA 2FY8A 3O5AA 2YN4A 4KRGA 3T0GA 2J5KA 2R85A 2XA9A 2AWNA 3KYDA 1OCEA 5FFFA 1P45A 3DVAA 3EZ2A 5BSHA 1T0PA 3ZZ1A 4CKZA 2JVJA 1K8ZB 1L7AA 1QCYA 4F60A 4JDUA 1OBFO 1L3IA 1PR6A 1ZM2A 3H65A 3PF9A 2OT3B 2VHZA 1SVIA 4RD1A 3RVLA 3JSXA 2V3VA 3V4ZA 5IVHA 2XNJA 1YB6A 3QKRA 3FG9A 3AZQA 1RPNA 2EZ4A 2R66A 4ASUA 1T9KA 3RK1A 2Q4RA 2DBZA 5BUZA 5FOUA 1X8KA 2RBKA 2WVJA 4AZ0A 1Q6ZA 5DT9A 2O2DA 3FNQA 1WOMA 4CZ2A 4DR2B 1Q84A 1RKUA 1JHQA 1W4RA 3NKFA 3KTFA 3WB0A 5EFOA 3LVBA 4J2TA 5ADUS 4QDJA 1W581 2WWRA 1VLLA 5FOTA 1C41A 1GITA 4GL4A 2CUTA 1K0UA 1Q91A 1T5HX 3RUHA 2BL4A 5AUNB 1MW8X 1WCWA 3K0EA 3QNUA 3ZK9A 4AO7A 2A88A 1C9NA 1KI6A 1WDTA 1LRKA 1C2TA 1SQGA 1QIEA 3P9QA 4PQEA 4WA7A 4FB4A 2Z4RA 3RADC 2R6ZA 2R2AA 2X3FA 1SQ0A 1UWLA 3E3NA 3ETEA 4I6EA 3NPAA 3C3JA 2ANBA 3R2JA 1T8WA 2CEKA 2BEWA 4OHFA 3EUAA 1EWQA 5KSWB 1GKYA 1UBSB 2WVGA 1SBZA 4S1NA 1QGED 1VZ3A 4GS5A 1QTQA 3HA2A 3GJSA 1RLMA 1VYVA 1KI3A 4XJVA 3G2MA 2C2WA 5E6UA 5TARA 4B8ZA 2XGGA 5K0EA 2FFQA 2O57A 1ONOA 3SZLA 3G2KA 3ID6C 4KLAA 4J0FA 4LMPA 4D0GA 5FTJA 3ABSB 2PNJA 4ZMBA 3H3JA 4AU1A 1YUMA 1WXGA 3MCAA 2VCHA 4E11A 2LKDA 4GQAA 1CQZA 1N36B 4EKEA 3RS8A 1N5IA 3FPSA 4PONA 5B2EA 1B42A 1AUVA 4WOCA 2O2ZA 1J39A 3D7RA 3ZVKA 3L8FA 4QBHA 1CEEA 1L7EA 4DV2B 4O6VA 3PXXA 2B0JA 4GGOA 4KBFA 4BB5A 2VKQA 1WXWA 4L0QA 5YASA 1XVAA 1E1CA 4IDDA 3SC6A 1U5BA 4YCAA 1PJSA 5HBRA 3M6IA 3RSLA 1IOVA 4NRDA 5B6JA 2V4MA 3STTA 2JRCA 4P7GA 2DQZA 4DILA 3E6AA 3LAWA 4K9KA 1K27A 4LJAA 4RWZA 2OD7A 2XVMA 2BFPA 4ZZ2A 2MSWA 2ZRNA 3DVSX 3QI7A 4ND8A 4D8XA 5B2FA 2I6TA 1MX9A 4F5EA 1WMEA 1FFXB 3GGSA 1K8QA 2PKXA 3B6MA 2D13A 4TS3A 2XZDA 3L8DA 1TPYA 3OU7A 4N7BA 3TR6A 1SCUB 2YUIA 5TVGA 1XRSB 2ZIZA 3K1JA 4M7RA 4BXOB 3BJIC 3QFHA 1NLZA 5EHZA 3IUJA 2G17A 2XDQB 2Q9UA 3N9IA 3ZD8A 5AK0A 3NVKI 1D0SA 3K4HA 4QPCA 1KYVA 2EX1A 1S96A 5ARDA 1IY9A 3HCPA 3VA7A 3JYHA 5KQGA 2Z8XA 2CNOA 3LY5A 4FGSA 3RSFA 3DV9A 1YI8A 2WIFA 3CRMA 4EFNA 4ZO4A 4WECA 2XA2A 1U2DC 5NULA 4BZPA 2P9TA 5FULA 4D3SA 1ACMA 3CG0A 1J0CA 3GT4A 4EELA 5JYCA 1R16A 4H27A 2G06A 3S2FA 1EHCA 1KDYA 2CD9A 4AJ1A 4DUZB 4PO8A 3C3EA 4PPQA 2Q5CA 1SKQA 4BO1A 3MHTA 3BGDA 2XTNA 2Z5GA 1RPJA 1EM8B 2WAOA 2FZVA 3AETB 3LHIA 3PVCA 3BGSA 1YZYA 3RYFA 4EG8A 4Z3KA 2NSDA 3O1IC 3ROFA 4PCUA 4KO8A 3UAGA 4BL5A 5JS2A 1SCKA 1K4YA 2HF9A 3DBRA 2MSNA 3EN0A 3G85A 4CG3A 3R7NA 2D8AA 1N2EA 1WSAA 1LJ8A 2NXNA 7MHTA 1JKXA 4HRAA 2P5UA 5HF8A 1QP7A 1IY2A 5E38A 4DMMA 4AMYA 2O1XA 1KSJA 3NEAA 4F86A 1QGUA 4KCGA 3ZI4A 5CB8A 1WDKA 2RKOA 4F3NA 5KOYA 9ATCA 4E3ZA 5CB0A 1AGXA 3L06A 1L5WA 4WERA 3HZRA 2FWMX 4MI6A 5SZIA 3Q8MA 3DDUA 3FVRA 1KNXA 3KZMA 3EPHA 1XHFA 3KOYA 1X7GA 2C2ZA 4Q82A 4WD3A 4X91A 3G9UA 1U2RA 3U16A 1Z83A 2ZRJA 5DBEX 3JWHA 1KE2A 3WB1A 1U63A 1HZJA 3DR5A 1K2WA 3KEMA 2DT8A 4KYUA 4CM7A 3TQIA 4WLUA 1I6WA 1RI5A 3SP1A 1EFPA 4BO9A 3K2EA 4LCJA 1TZKA 1ZIOA 3I5AA 3Q5GA 1IWBB 2JI8A 1PN3A 4KMMA 1GU0A 4GXRA 4LZNA 3MA0A 3NAQA 4JUIA 5IC4A 2IS2A 1NUAA 1U3TA 4MCAA 3SR3A 1D8TA 3AW9A 1HDZA 1UKYA 4IFEA 2NP7A 4NENA 3RYHA 4B74A 2QWXA 5EXSA 1ILWA 3GT0A 5IM4F 3PZBA 1KY3A 5M7EA 3OZIA 4X90A 3COVA 5CXSA 2NU8B 1Y6GA 2WJ4A 4OQNA 3SY8A 4IGAA 4X24A 4Q16A 3GH1A 3K2IA 4DQVA 5INTA 5ENVA 2PGNA 3V33A 2IE8A 1YVUA 4R2IA 1FYWA 4G0XA 1AB6A 2JGDA 4IIVA 3RFXA 3RSGA 3DWIA 1T8TA 4MRVA 2NG1A 1E0DA 3B82A 2CBZA 4NVRA 2ZRQA 2ZJBA 4JP1A 2WSLA 4JB0A 1F9EA 3SJ7A 3UXMA 4QO8A 1RR6A 3A32A 3G7NA 4KGXA 4LZAA 4RJ2A 1MAAA 4ZQCB 5CT8A 3A0RB 1INLA 3HDYA 3MAJA 1JQBA 3FM9A 2NZXA 4H7DA 4XEHA 3STUA 4C5BA 4PNEA 2K2WA 1FLVA 4NXNB 2XUFA 3RV3A 3TCNA 1Z38A 4H1HA 1HMYA 4DIKA 4C7OA 4I9HA 4ARZB 2A3RA 3GRKA 4UUBA 2JFBA 1V11B 2VAPA 4NHOA 2J32A 5K01A 4L3VA 4OB6A 2CXTA 3O8OB 2YC4C 3GFTA 4O4JF 3PTLA 3VGJA 2FFRA 4L22A 3QXCA 3OCVA 4RVGA 3W7AA 4Y98A 3LT4A 5P8WA 1Y9DA 4I4TB 4LJ4A 1SURA 4G6ZA 4D56A 1IEXA 1PQPA 3FN4A 3KSMA 5A2QA 1UJCA 2HZ7A 4L9WA 5MGNA 3WJ2A 3TOCA 2BDUA 2NADA 3W4IA 3V4PB 3MJDA 2Q5EA 3ONVA 1B1CA 2C7PA 3VHXA 3FOCA 3H8WA 3L0BA 2HK7A 1LF0A 2NUBA 4KQ2A 4C2AA 3HADA 3SSMA 5DN9A 4HAWA 1CJBA 2QR2A 1U7DA 1KXZA 2PTHA 1W4BA 4ZRDA 1GNVA 3KL2A 4NWIA 4UU8A 1X9IA 3K0AB 3CCFA 5ENZA 5BQFA 1KY5A 3ISTA 2NO9A 5EJ6A 2CVFA 3AF5A 4ND5A 1QMGA 1UOEA 3E2PA 2IOYA 2GN0A 1GD1O 3GOQA 2W7TA 1L4GA 1YDMA 1AHIA 3D2BA 3WQBA 3ICVA 4DIDA 2JEOA 2ZQZA 4MKIA 2AQKA 2HCTA 4B3DA 5A4KA 2EOAA 1FDVA 1HR0B 1QRSA 3MGAA 1L5OA 2CLMB 1AVTA 1NXSA 3COPA 4MVWA 5JD4A 1JJFA 1XTVA 1X9GA 3E27A 1NMZA 2XXJA 3GRAA 5E3JA 3JQFC 5IZCC 2NT4A 4FILA 1DKOA 4RBNA 4D3DA 6NULA 5C7LO 2X86A 5KX5F 1PKXA 4BZWA 4KODA 2P6NA 4JVNA 1H2FA 3KG2A 4X00A 4QOHA 4RTRA 2C3UA 3EULA 5JW6A 2W6JA 4TGLA 2CWDA 3QLEA 2CWWA 2WMOB 3Q87B 4RYLA 2Q2WA 4WCVA 2VNJA 5DTIA 4HRYA 5EVJA 4RENA 3NC1C 4NZMA 4YRBA 2PUFA 2BFDB 3C1TA 5A3SA 5HM6A 4ZA2A 1NVGA 3LCUA 1HETA 1YVRA 2A67A 1T0JB 1QWOA 5FYDA 2QNRA 2E55A 4RL4A 2HMVA 3DMTC 3ZTTA 2ATXA 1IQ0A 1TT5B 1RACA 3WQRA 2Q50A 4XM0A 3FE2A 3QRWA 4BNGA 2GPNA 1Y63A 4A16A 2QMYA 4TV9B 1DE0A 1W5AA 3H2JA 5KNBD 1E77A 1UEXC 1FY2A 3HNOA 3KNZA 4HUQA 4E3WA 1PEDA 3A58B 2YJ4A 4RVOA 1ORWA 1XEXB 5JH7A 3KBBA 4EZIA 4QO7A 4XOUA 1T4DA 4QJBA 5JSYA 3QFSA 4WK2B 1SQSA 3F7NA 3DDOA 2J3IA 3GUHA 1QHNA 1A96A 4MAMA 5JNLA 2XQFA 1BH2A 3KXLA 3GPBA 1CQWA 2ZT8A 4LNUA 4DV6B 3CEJA 2WP0A 3LLVA 1JBEA 2BFOA 1FMCA 2D3WA 3A1SA 3ELWA 4XGQA 3IPAA 3QV1A 1G4HA 4D9FA 1XTSA 5FPPA 5TVKA 4AS1A 3L7AA 1RJGA 4XFKA 4PWZA 3UG7A 4AJ9A 4FZ5A 1NVFA 3UOWA 2X8AA 1NPTO 5B3AA 4UHFA 3ZQ6A 5C7YA 1GJRA 3EIQA 3AR8A 2R68A 4RFSB 1F51E 3K9CA 3RFCA 1XK6A 4MW6A 4BB0A 2BSQA 5HMMA 4JUAA 4ZVQA 4ND2A 4A9AA 4KB5A 5C37A 1ZD3A 2H17A 4B7CA 1XAGA 1XRQA 2YDYA 1EWTA 3M6FA 4BCBA 4NK4A 2MYNA 3O3MB 3P96A 3COYA 1FXSA 3NDRA 4PYKA 4XXHA 5IJAA 2J5XA 4F6RB 3HBNA 2Y1DA 1NQAO 4B3TB 3NTXA 4M87A 3RKUA 3KCNA 2KMLA 5IFKA 2EV9A 3BL8A 3O0DA 1J70A 4UU7A 2OCGA 2QV7A 1V3UA 3B78A 4W99A 4D44A 4GWLA 2AVDA 1Y1TA 4R1QA 1HRKA 4CR6A 1SXJA 1JECA 4JQYA 1ZVJA 4N6NA 2HADA 1USUA 3D3WA 5AKEA 2O20A 3RIGA 3TLCA 1WR8A 5LMCA 2GF0A 4RTPA 1A72A 5FJJA 3QY9A 3SE7A 1NUPA 4NARA 2A4KA 1OI3A 1TVKB 1GKUB 2C5HA 1SXPA 4EKDA 3KQOA 2OR3A 3B3GA 1MJGA 3U4DA 3MN1A 1LBQA 5FWNA 3AUJB 3VNQA 5FH9A 2NZJA 4HDAA 4LYAA 3SYTA 1N2JA 1O95C 4OMFG 2Y92A 1Z4KA 1TCUA 3P9CA 4WNIA 2R1VA 1HSOA 5SYAA 1ULSA 3VR1A 2WUWE 5JD5A 1NI4A 1U8FO 3KZVA 1U04A 1Y3DE 3W5DA 2Q49A 3VO2A 5K0GA 4YQFA 4B3MB 1EJ0A 5DI9A 1OZFA 1Z6TA 3LA8A 4GOXA 3VU8A 4JFAA 2P5SA 2B8WA 1KY2A 3UM9A 5CXXA 2BBSA 4GUDA 4YLGA 4WADA 3M49A 5IDWA 3EARA 4TWZA 2PGAA 1VE9A 4FPXA 5SZHB 1ISJA 3CLSC 4FR0A 3KLPX 1HMPA 2VPQA 2YXDA 3CH4B 3GBVA 3I05A 1P8AA 4KE9A 4PYOA 4UBIA 3DMRA 4X3OA 2QUIA 3VC1A 1I3MA 2ST1A 1XQWA 1TF7A 2KPOA 3NHRA 4PGMA 3DAOA 5ALOA 3GJQA 1Y9JA 1VJTA 2J3HA 1MGPA 2Z4SA 3DBLA 4FNMA 5GONF 3ZCUA 5JSZB 1GTMA 2O48X 4CQJA 4IVNA 1TX4B 3FFBA 1EQUA 1CD5A 1R0YA 1NXPA 3PDIB 4P3YA 4WN9A 4X3PA 2LCQA 3KU1A 1NDQA 2IV7A 4LSMA 3RAFC 1EXDA 4X8OA 4FD2A 2A1UB 2SECE 1NJ6A 3LQ4A 1XZQA 2GK3A 3HO6A 2AH5A 3GFVA 4OD0A 3JY6A 1HEIA 4A8TA 1UP7A 1N0IA 3E84A 4IIBA 5FCDA 2IDKA 2XMSA 2LDBA 3IDFA 2FGKA 3OZTA 5DNCA 5EIBD 2C88A 2J0EA 3Q40A 5KVSA 1EK6A 1JQKA 1UOOA 3N1UA 2JA1A 1SKYE 2B7BA 4GP9A 1ZM3A 1IVNA 1DT3A 2YS6A 2Q2QA 2IIQA 3QYAA 1UMCA 1JFFB 4GBGA 4OK3A 5ED0A 4OY3A 5BWBA 2Q1YA 4ZHQF 3T9EA 3S5JA 3V4OA 3KQHA 2ZZMA 1JR3D 2NSHA 2BAGA 4RLFA 1QRDA 3PGVA 4FXOA 5E9AA 4WY8A 2IKSA 4Y2VA 1RWPA 1GGMA 3AY6A 2WPDD 4I4CA 2RHHA 1KRWA 1P2TA 3ZLTA 2AMVA 2PUEA 1H4SA 3HVUA 2QN7A 4DTIA 4OL0A 3NUQA 4H7PA 2NUPA 3G9TA 3IR6A 4QLAA 2P0EA 4RJKA 3ZD7A 5F5LA 3RIHA 2WLTA 3IPCA 4JJZA 3A06A 2E6UX 1Y7HA 1PS9A 2ENUA 4PBRA 1I5OA 4WK0B 1YQEA 1CFJA 3DKRA 1XVLA 3HCDA 4G3XA 4GGMX 3STWA 1U28C 2IYNA 1KU0A 1I9GA 3GQBA 1NURA 4RIHA 1TEHA 2CL0X 4HSGA 3RUDA 1ZR4A 1L5FA 1ORIA 1Z62A 3WDLA 4ZK6A 1F3OA 1E64A 1C29B 1KO5A 3CUUA 3ZDYB 1R0BA 5EESA 4ECAA 4WGFA 1XDBA 3PGA1 1QP4A 4TYWA 2P2LA 1P8JA 1QF7A 1QHEA 5EWJB 4DBZA 1LS1A 3BDVA 4MRSA 4PZPA 1SVUA 5DB4A 3VSEA 4XGKA 2DR3A 2UDPA 1RWXA 2VDNB 3WWDA 1PD1A 2MDTA 2J33A 3IQEA 3WYGA 4EF5A 1I7QB 1E5VA 2HLNA 4LX8A 1P1CA 1E1RD 3K1AA 3BICA 4DYVA 4AMBA 1V35A 5EP4A 4HGYA 4XSVA 4F2HA 4MUBA 4X84A 4DFDA 4Q3LA 1VPEA 4FB5A 5L45A 2QPLA 4YWHA 2LRHA 3NORA 3W5HA 4JP3A 1T34A 2X5JO 3OIWA 4U9IS 3T1TA 4DRYA 3LUCA 4XA8A 5FNVB 5K99A 4Q9IA 3VU1A 3BCHA 5KOIA 3QX8A 1SXIA 4OH1A 1AM4D 2P0AA 2J6BA 2LVBA 1XEFA 1VE1A 2H9AA 2WR8A 4EHKA 1KZ9A 4LJRA 1CJCA 4G86A 3O1JC 4ZC8A 1E3QA 4MITA 1DRJA 4JI1B 4BVLA 1XIVA 4PLTA 2IOFA 2XGOA 2JJYA 4KIJA 3RB8A 4I4LA 3HYCA 5DNDA 4ZIRB 4RZQA 2DAPA 1GZVA 1M2WA 2FRVA 2NSJA 3NM6B 5A1JA 2CLKB 3RRBA 3E03A 2H65A 2YWDA 2FPIB 5IH3A 5LJIA 1ORVA 2BJVA 4P82A 3COJA 1GZUA 1UBTS 3HBFA 5I4IA 2P2CA 3ADPA 3O7MA 4LTDA 1UWCA 3R7WA 1UMDA 1OH5A 4OHPA 4Z7OB 4RPJA 2CLHB 1D07A 2B2CA 4I1VA 1XHEA 3P7MA 4OOFA 2Q6IA 4P93A 4YPFA 1I2DA 5JNTA 4I50F 2I7DA 5T57A 2VP0A 4EYSA 1WRBA 2QGZA 2HQOA 2HF7A 1LRJA 3S70A 4C0LA 2HXYA 5EQFA 4NX2A 3ZHYA 1VDMA 2QTNA 1RE1A 3FVTA 1B23P 2IIBA 3HCWA 4A0QA 2R8OA 2C8KA 3IB6A 1FRVA 2WKSA 4P22A 2B9VA 5JC8A 2IBSA 1E2FA 1JVBA 4ZU3A 4YPOA 1TVEA 3AUTA 3SX0A 4LHZA 3T7EA 4IVRA 1RXEA 1Z13A 1ISPA 1DX6A 1JRLA 2JFPA 2FOXA 3NGMA 1DRUA 4FFDA 4J4BA 5G4KA 4B48A 2EW2A 5KYNA 1WLYA