4CMGA

Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
267
structure length
250
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Design and Synthesis of Antiparasitic Pyrrolopyrimidines Targeting Pteridine Reductase 1.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
molecule keywords PTERIDINE REDUCTASE 1
total genus 93
structure length 250
sequence length 267
chains with identical sequence B, C, D
ec nomenclature ec 1.5.1.33: Pteridine reductase.
pdb deposition date 2014-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4cmgA00
2DQ4A 4W99A 4D0RA 3A4VA 5TT1A 1DB3A 1KVUA 1E1KA 1W8DA 2ZB3A 1R4MA 5FFFA 1F8GA 2PKQO 4WK6A 1ZW1A 4D3SA 1NQAO 3TZ6A 4CM8A 3TSCA 3PHIA 4B7CA 2BHLA 2Y67A 3RUEA 2Q99A 1QG6A 1RWBA 3C1AA 4JBHA 2GZ3A 3PIIA 2EEZA 2QW8A 4BNMA 5FWNA 2HRBA 1YL6A 1UAGA 2X9NA 3ZU3A 1XU9A 3UUWA 3NGLA 4UEKA 4D0SA 1P9LA 4Z6KA 1J4AA 2HK9A 2OUIA 2YW9A 2ZYAA 4EITA 1H93A 2Y1FA 1I0ZA 3JYOA 4EW6A 1P1IA 2X5JO 4GKVA 4GLOA 4L4SA 1ADBA 1N9GA 1H94A 3DB2A 1YO6A 3LT0A 5JAIA 5DP2A 1HDYA 4CQMA 5F5LA 4DL9A 4NFYA 1UR5A 3OEYA 1V3UA 3INTA 3UOGA 5TC4A 4DLLA 1LA2A 4PG4A 2Y66A 2AG5A 5EQFA 3ZW9A 1IL0A 4N5LA 1KEPA 1XQ6A 5A04A 2X0IA 3M1LA 4PLCA 1R4NB 4WJZA 3ANMA 5JAQA 4FGSA 2I3GA 3S2EA 4XR4A 3F5QA 4ZQFA 1GD1O 5DBIA 1EBUA 4O6VA 4J4TA 2P5YA 3B20A 5G0TA 3E5RA 2EERA 4LRTB 3BMNB 4FFRA 3ZV5A 4FFLA 1VJ1A 4A27A 1ZK1A 2E49A 1BMDA 4RV9A 3TL3A 3NGXA 4IDGA 2FN7A 2I76A 2G76A 2J5KA 2QRKA 4TRNA 3FSRA 5FF9A 2A4KA 4J2HA 3CUKA 5CDGA 2DBZA 4WECA 1V6AA 3GUCA 4R9RA 4ALJA 3AFNA 3WYEA 3ETGA 5GZ3A 1I33A 3HHPA 2CMDA 1R12A 1ZSYA 1YE3A 1Z75A 3CPSA 3NTQA 1E7QA 4OYRA 1D8AA 1NWCA 1YB4A 1EK6A 1JKFA 1P1JA 4HXYA 1GUZA 3GR6A 3KZVA 1LDEA 4J1NA 3ZZNA 1O89A 5JMWA 1U8FO 2Y68A 4TROA 2C2YA 1B15A 2D59A 2P9CA 3E03A 1T2AA 4NBUA 4RF3A 4YPOA 1ULUA 2V65A 1I2BA 1X13A 2FSVA 3GGOA 5GY7A 4KP7A 4WOJA 3LYLA 1U4OA 3H6KA 5U4QA 3VH4A 4CV0A 4DYVA 1O95A 1UZLA 2ZTLA 4MP3A 2FZWA 3FNFA 1DC5A 2FPGA 3GPIA 3OIFA 3CXRA 1QSGA 1ML3A 4CJXA 4E2YA 4KTTE 4LMRA 3R3JA 1F8FA 3DZKA 1JKJA 4XYEA 5COAA 5JYDA 1IPEA 4M8SA 1RYDA 3G3EA 3HE3A 3WJAA 1GYRA 4G65A 2QQ5A 4I8XA 5EJ2A 4TVOA 4XQGA 5JMPA 2ET6A 2ZKLA 3G79A 2ZK7A 5F1KA 3H65A 1M76A 1Q7CA 4Y6RA 4PLVA 4YB8A 5HBRA 1DIRA 4DREA 3G1TA 1SOVA 4XRGA 1MGOA 3TZHA 1B2LA 5ILOA 1OC4A 2CSUA 5HS4A 3MJVA 4DIFA 3ZWWA 4PLTA 5EINA 3WMWA 3RQSA 1BXKA 1HKUA 1AUPA 3GVPA 3H9UA 2NVUA 5L7TA 4DLBA 1ZCJA 4PRLA 2J8ZA 3JQ8B 3AOGA 4UUPA 3DBVO 4WCFC 4KTVE 1TT7A 1DDOA 1GEEA 1VI2A 2PGLA 3ASUA 3H4VA 1E1LA 4JLWA 3FTPA 3RIHA 6LDHA 2WWRA 3HUDA 1WLYA 4A0SA 2O50A 2AQHA 3PHHA 2NVUB 3UN1A 2X86A 1V3VA 3WGQA 1WNTA 5I8WA 2YYYA 1FDWA 2X6TA 2RHCA 2WMDA 1J49A 3DAPA 4WASA 4PG7A 1DOHA 5KJ6A 3O26A 3AOEC 3ZWAA 3FR7A 3BMNA 2PWZA 2Y0EA 4GKBA 1HDZA 3BZUA 4XB2A 1WW8A 4AJHA 2V6FA 4YBZA 5TLSA 4BS9A 3CMMA 2IZZA 4XDZA 4ILKA 3PHJA 4MVJM 4F6LA 3GZNA 1QR6A 1PIWA 4Q3AA 2O3TA 1N92A 2BD0A 1HF3A 4D3FA 4XKJA 2UAGA 4MIEA 1KC3A 4YRDA 2JFGA 3AI2A 3PGJA 1TI7A 4Y6PA 1W6UA 3KV3O 4DPMA 3ZGYA 3FPLA 2QYSA 3LT4A 5MDHA 4JBIA 2J3KA 2WD7B 3HDJA 5U1PA 4CQMB 1G0NA 4TKMA 1C1DB 1P1KA 2CFCA 4RPHA 1V0JA 1HLPA 3FHLA 1ZJYA 1ISGA 2GPTA 3FR8A 1TXGA 1SEPA 5L53A 1OZAA 3UFXA 1NNUA 3I9OA 2NUAA 1I3KA 3RUCA 4K28A 3RC7A 4KOAA 3ZWBA 3EZLA 3PXXA 4D46A 4PG8A 3PI7A 4BNKA 4OHUA 1Z82A 3DZIA 2DM6A 3BMCA 3W6UA 3F3SA 1D3AA 2VWQA 3S55A 4YTEA 1NHGA 5IF3A 3GEDA 2GSDA 4L4XA 3SLKA 8LDHA 3JQAA 3UCEA 3DOCA 4R5MA 3ZWYA 3AI3A 4FR5A 1NQTA 1ZH8A 1X1EA 1KVRA 5CEFA 4NK4A 1UUFA 4CMKA 3VPFA 3WWZA 4RLHA 1NX6A 4PLFA 2GNAA 3QWFA 2Q45A 4TMFA 4CUJA 4R5HA 4IIVA 1EDZA 4BNFA 5KJCA 4EUEA 3FTNA 5DCYA 3ZU5A 1IE3A 2PKQP 2JD1A 1I2CA 1LNQA 1UXHA 4XCVA 3BYZA 4BKPA 2C7VA 3WYCA 1NYTA 3JQ9C 3HZZA 4FB5A 3M6IA 1D7OA 1LU9A 2RH8A 4ID9A 3KEQA 3PEFA 2E48A 4W7IA 4H16A 5CHEA 2CY0A 2EKLA 3ZNPA 1PZGA 1YBAA 1YBVA 4YJDA 2ZJ1A 1ISJA 5DBFA 5JCXA 1HE2A 5IXSA 5IDQA 2FR8A 3Q9NA 1I8TA 4YRBA 3C7DB 5KJ1A 4UREA 2AQKA 2Q49A 4A03A 2D0IA 2Q3EA 3O9ZA 5ER6A 2VZ8A 4E3ZA 4GAEA 1MG0A 2B4RO 3BMQA 1GYPA 3E9MA 1TT5B 1B14A 4QUKA 5G4LA 1VSUA 4YDRA 3JQ6A 1F12A 1BVRA 1YWGO 4MJLA 2IE0A 1ZKMA 2D5AA 2B5VA 4XQEA 5B4VA 3NDIA 4E5KA 1ARZA 1P1FA 2NU6A 3PHLA 3Q1LA 2UUOA 1S6YA 1DIBA 2WSBA 2Q1WA 1N5DA 3NUGA 2TMGA 4I5EA 5H83A 3AFMA 1AXEA 4D3DA 1S7CA 4JROA 2J6IA 4IIUA 5IXYA 3DEYX 3TNLA 1GTMA 1T26A 1LI4A 3U4HA 1R4MB 2NSDA 2OO5A 4FFMA 1QLHA 2VT2A 4L74A 3U9LA 3BHIA 4Y67A 1Y8QB 4YAGA 2B69A 3CIFA 4RPGA 4RL6A 2VNAA 4EDFA 2XAAA 2NQ8A 1E7SA 3M1AA 4NK5A 5ENVA 3B1FA 5K6AA 4L8VA 4GVXA 4AJLA 3OECA 1EE2A 4XIYA 4PCVA 3H3FA 4CMCA 1D1TA 3GA0A 3NJ4A 4CM5A 1A4IA 1C0IA 2EJVA 3C7CB 2E82A 3LZ6A 3GGGA 3GN1A 4E13A 1YB5A 2BGKA 3GFGA 1A9ZA 5C7OO 2AQIA 3JQAB 1P77A 1U2DA 2B83A 2R00A 2VYND 3I6IA 4QX6A 1CEQA 2OMEA 4WEOA 3Q3CA 1MA0A 3FNHA 3JQEA 1QYWA 2XXJA 3CMCO 1KYQA 4BNWA 1NVTA 2NU8A 2F00A 1GZ4A 3PQEA 1U28A 3QP9A 1LRJA 1RM5A 4GMGA 1GDHA 4QFDA 1Y5RA 4E5YA 4L9RA 4OQYA 4DMLA 1LRLA 1QKIA 4DA9A 1K0UA 3ZWVA 2NU9A 1C14A 5JLAA 2QZ9A 2WJPA 4DQXA 2ZB7A 1BW9A 3U5TA 2BGLA 2O7SA 4UVIA 4BHTA 3PLRA 3QW2A 5AYVA 1DC6A 2FWMX 4N7RA 1T24A 1UXGA 1QYCA 1Z73A 4LISA 2ZQZA 4BUCA 2D5CA 3U49A 1LDBA 3ETDA 4GX1A 1DRVA 3UKOA 1IHYA 3EC7A 3OQ6A 2FPIA 3QSGA 4ZU3A 4L76A 4R16A 4R3NA 4E31A 3DQPA 3RWBA 3GQVA 1QYXA 1PL7A 5BNIA 1VKNA 2AE1A 3R3SA 4Z3DA 1PL8A 3QRWA 3MCVA 3OSUA 3IJPA 5IJZA 4FN4A 4ZQEA 2PFGA 3ZWXA 4AICA 4CPDA 5KWEA 2YQ4A 1NQOA 2VWGA 3QVOA 4B7XA 3HJAA 4DIBA 5ILGA 3GK3A 3NDJA 3QIVA 4YT4A 5CDTA 4Q9NA 2GO1A 3DZFA 4Z0PA 4DQUA 4Q3NA 3D1LA 1OC2A 4PLPA 2J3HA 3D3WB 3WOHA 2UDPA 2Y05A 1GQ2A 4PLZA 1CDOA 2BH9A 2AQ8A 3GDGA 4R68A 2W90A 1K5HA 3RVDA 3UCXA 5A9SB 1I10A 5BSEA 4Q3EA 2GERA 2XPCA 5I9MA 1H2BA 3PRJA 4FD3A 5THKA 2OL4A 1HWYA 3MOIA 4ZN6A 4QT0A 4Z9XA 5L4SA 4J4BA 1SB8A 4W6ZA 4XRRA 3TWOA 4AVYA 4AJIA 4A26A 1GAEO 1GPJA 1NHWA 2CNBA 2GR9A 2VHVA 2WD7A 1P31A 1U3UA 2A35A 2EXXA 1Q0LA 3BHMA 3MEQA 3SC4A 3DC2A 4K6FA 5B12A 2Z1NA 3EHEA 2C82A 3EYWA 2P4HX 1HDXA 1JTVA 3RROA 4NBRA 5A5EA 4UVGA 4NIMA 3ENKA 4B79A 3RJ5A 1WDLA 1XR3A 3NAQA 4AJKA 3ETEA 3E18A 3EY4A 4F3YA 1JWAB 1U3WA 1ZK4A 5L95A 3IDSA 4BOYA 5CFZA 1MV8A 3JQFC 2O3SA 3SVTA 1U8XX 4YAIA 2JAHA 4BO8A 4NMHA 2YY7A 2YHIB 4GLLA 2PGJA 4TRJA 2VHZA 5C3MA 4DBZA 4PIVA 4RCVA 4PRKA 5F5NA 4QTZA 2C54A 3NEPX 1HEUA 3V1TC 4E5PA 4GSLA 1SPXA 1PZEA 3PJEA 1SO8A 3S1LA 3U4DA 3EUWA 1EMDA 2RBEA 3KEOA 4GQAA 3U0BA 1C1XA 4CLOB 5H81A 4YEDA 2VUSA 3D5TA 4HBGA 1Z7EA 3RC1A 5BSHA 4CMAA 5ITWA 1ZK0A 3B70A 4IDFA 4CV1A 1JA9A 2BI8A 4WLEA 1FK8A 4RQTA 1LC3A 3RAJA 4FSHA 3AUUA 1P1HA 5FI3A 3G1UA 3GMDA 1E6EA 3VH1A 3HADA 3WBFA 1ZK2A 2DBVO 1L1FA 3T7EA 3H8VA 3IP3A 4NR0A 4TWRA 3AWDA 5JAMA 3JD2A 1AGNA 3K92A 3N7UA 2OP1A 1F06A 3W8FA 1PSDA 3WGTA 5KCZA 2DUWA 3RUIA 3ZNOA 1DRWA 3MJEA 3RASA 3GC6A 3F46A 5TS3A 3ZHZA 5ADHA 3RFVA 2FMUA 1LLUA 1ZIDA 5DF1A 3S2GA 1HLDA 1UXKA 1QLJA 5EESA 3W4JA 3PYMA 4AJJA 4WCFA 2EGHA 3CZMA 5F1OA 5T67A 2QG4A 1EBFA 1H0KA 3IS3A 1K2WA 4A5OA 1FDSA 1IY8A 2X8LA 2Q4EA 2HMSA 4G5HA 3OETA 1PX0A 1P74A 1DFIA 2FZEA 2ZTVA 2NM0A 4YA6A 4FGWA 4E33A 1KBZA 1HE5A 1E1MA 5TT0A 2PZJA 4BKUA 1E6WA 3C7AA 4NBTA 4FPXA 3PGXA 3V1YA 3MWDB 4URFA 4CMEA 1JQBA 5EERA 1GZ3A 3KTDA 4PLWA 3SBOA 4XYBA 1E1NA 1YRLA 3ULKA 5IAAA 2PA3A 1DPGA 3L9XA 1VJTA 1ZJZA 5JDIA 1M67A 1WMBA 1YBMA 2C2XA 4BGVA 4FOOA 3LC7O 3H7AA 4CV2A 1ADCA 3P2YA 1YJ8A 5JBIA 1SAYA 4NU6A 3V1UA 5TNXA 4J1QA 4HFRA 1E77A 3BTVA 1VPDA 3GVIA 3GLQA 1YQGA 4YJFB 1WPQA 4J7CA 3DMTA 1LEHA 3EZYA 3PIDA 1KERA 1H9AA 1Y8RB 2RHRA 3VZRA 2HMWA 2J3IA 1U9JA 3SXPA 1QV6A 1HE3A 1F14A 3OFSA 4EJ0A 1ADGA 3OQ1A 3NX4A 1ZEMA 4EYEA 1J6UA 3PDJA 1BXGB 1B3BA 1KETA 2ZJ0A 5HA5A 1SB9A 5ER9A 1E3IA 3I9NA 3DZJA 2C59A 4XEHA 3QA9A 1PJQA 5T5QA 3FF4A 4DMMA 2YV2A 1GQYA 1R4NA 1ONNA 1U5CA 1ZSNA 5JO0A 1C0LA 2X5KO 1GYQA 4HY3A 4AJPA 1XG5A 2FRDA 1X0VA 2BF7A 3CH6A 1ZO8A 4P4GA 1GPDG 1XWFA 2ILTA 5CDUA 3DBLA 4CM4B 4GMFA 5L9AA 1DJQA 2DPHA 1I3LA 2I65A 2VN8A 3BTSA 1B0AA 1PJ3A 2W98A 1UXIA 3NTRA 1JVBA 1V3TA 1KEWA 2VTEA 3BTOA 4IDBA 4YJGA 4II2A 3ICCA 3KOUA 4UUOA 5DCWA 4E0BA 1SOWA 2XF8A 4Y6SA 4CMJA 1XHLA 2J3JA 3E1KA 1EFKA 1KS9A 3ROMA 4MVJI 4P4LA 3DO5A 3HDYA 4J3FA 4HKTA 5A5FA 5I7SA 1ONOA 3GN2A 4IXWA 2DBRA 3MTJA 4NFHA 4LVCA 4XX0A 3H5AA 3QQPA 1M66A 2GN6A 3VC7A 3GEMA 3H2SA 5T8KC 5TRTA 4RPLA 1UZMA 2P91A 2VYVA 3OJLA 4XDYA 3FNEA 4D79A 4OAQA 4BNLA 2IXBA 1ZMOA 3GG9A 4PZCA 5KVVA 3PJDA 3VAZA 3PWZA 1PJLA 4CM3A 4E5NA 1YL7A 7MDHA 2Y1EA 3KYCB 4OXKA 4O59O 3WGHA 1L7EA 3TJRA 4B8ZA 4EGFA 4PVDA 5DNAA 1KC1A 4JX8A 3GVCA 1HDRA 2YFQA 5LC1A 4BKRA 4CMGA 3P7MA 3STHA 3IJRA 4IDEA 4PZDA 2B35A 1HDCA 1FDTA 4L4RA 4BB6A 4QSMA 2D1YA 3P19A 4I9HA 2B5WA 3H9QA 3GVXA 5AXDA 3OJOA 1N8KA 2EGGA 5JY1A 3OA2A 5A9RA 4RJTA 3RBVA 4KQXA 3VKUA 4BO5A 2ZTUA 5IG2A 4R9SA 4BV8A 1I24A 1DHRA 1HETA 4E2WA 3BMOB 1H6DA 4N5MA 1O8CA 1BGVA 2JHGA 5EN4A 2VCYA 4UEJA 4CM7A 4I08A 4PVCA 3JD4A 5AQ1A 5B1YA 2G5CA 5JW6A 1D1SA 4JJIA 4CMIA 3QLJA 4IGFA 1H5QA 4MINA 3VTFA 1PS8A 1K6IA 1GQQA 1Y5MA 4UAGA 1YOVA 3A14A 4X54A 4AJ4A 5FI5A 4XD2A 4BGEA 5C37A 3UGKA 1X14A 2X0RA 2SCUA 1AHIA 4IJVA 1HYGA 1XYGA 2G1UA 1VSVA 2WDZA 5LCXA 3WGIA 3DWFA 4MVJA 4YWJA 1ULSA 4CLRB 4WE3A 1U4SA 1C1DA 2QHXA 1SZJG 3HWRA 3C1TA 1RYEA 1Y9AA 4HFJA 4K9DA 5AXAA 5JC1A 3DZBA 3DXFA 1VL8A 1NASA 2H9IA 3NT5A 4IDAA 2BFOA 1JWBB 3D4PA 3AM3A 3OQBA 4J6FA 3NYWA 5JXWA 1R0KA 2R00C 4DXHA 3QHAA 3QVWA 4BO2A 3ROKA 2ZYDA 5H82A 4BNUA 1T1SA 2EW2A 5C7LO 3BIOA 4F6CA 2PNFA 1LLDA 3T4XA 2YFHA 5KKCA 4OIMA 4DC1A 4JN6B 1U3VA 2OHXA 3TQHA 3ZWNA 4IJWA 5HWSA 2UUPA 4MPDA 5AXBA 2WTBA 2BFAA 1V8BA 1JW9B 1L7DA 2B37A 1X15A 3NRCA 3LU1A 4II3A 1PJBA 1I32A 2Y0DA 3KYCA 5CG2A 4H15A 4NFSA 4XYMA 2HJRA 3GGPA 2VOEA 3WICA 1ZUD1 4JBGA 1GUFA 1Z6ZA 3AUAA 3ZV3A 5G0SA 1ENPA 3QVSA 4YAEA 3ENNA 2H5LA 4NJMB 3PYLA 3ZH2A 3RFXA 1UDBA 4GX2A 3QVTA 4D44A 4GGOA 4FQ8A 3ON5A 5IDXA 4PGFA 1ID1A 2GUGA 2EV9A 5A02A 4RORA 2W2KB 2Q1TA 3GRKA 3HB5X 5AOVA 4BO7A 1NAHA 4LRSB 4OH1A 3T4EA 1VC2A 2BRUA 1XU7A 5CP8A 3JQAD 3K30A 4UVHA 3WTBA 2A9FA 3N58A 1OBFO 4KWHA 5JYEA 3L6EA 3RC2A 2NACA 3WJ7A 3I9JA 3VH3A 1IOLA 2YJZA 4CQLA 1KY4A 2UVDA 2P4QA 2TMDA 1HL3A 2RH4A 3RUHA 2JFFA 1DC3A 1FMCA 2Y0CA 3RFTA 1R15A 3H5NA 3PP8A 4BO6A 4CM9A 2Z5LA 3WDSA 2YUTA 3BTUA 4XR9A 4RVDA 4NDNE 3GEGA 1A71A 1WMAA 4FS3A 5GMOA 1PJ4A 1QP8A 4RVHA 4AL4A 1YDWA 2ZTMA 3WX0A 2OOSA 2EP7A 3OJFA 1NFQA 3PPIA 4CMBA 1E3WB 4QQRA 1E92A 4B4OA 1FDUA 2QX7A 2EHDA 2ZYGA 3JYNA 3AUSA 4Y8VA 4GGPA 4J7UA 3GVHA 3PDUA 1F0YA 3F47A 1CETA 3DONA 3D4OA 5JAZA 4PLHA 2VWHA 4GX0A 2Y99A 4WGGA 2AEJA 1BRMA 4MKXA 3OA0A 3Q9UA 3KETA 1LC0A 1Q7GA 2Q2VA 1X7GA 4BGIA 4JP2A 3UHAA 3O4RA 2FHSA 4IXTA 4XA8A 2QZZA 1XELA 4KUEA 4HNGA 3ST7A 3CZRA 4BNIA 2PKRA 4IZIA 4M1QA 1KEVA 3PQFA 1T4BA 3IUPA 4M87A 5IZCA 4CQMD 3DHEA 3JQFA 3B6ZA 3D7LA 3WNQA 3RBZA 1Y81A 4RVUA 4J9UE 3ONFA 2VQ3A 1QMGA 4MVJD 2C7GA 3C24A 4P22A 4INAA 4Z9FA 1MXHA 1O94A 1CJCA 2GD1O 4C4OA 2AMFA 2VWPA 2E6UX 3MJTA 4DPLA 2BFMA 5DCUA 4BQPA 3OH8A 4WOKA 1A72A 2WYWA 3TN7A 2PTGA 3MOGA 4TZTA 1XSEA 4YCAA 1PQPA 1HSOA 1IB6A 1E3WA 4MP6A 4RDIA 5G4KA 3PFFA 4YR9A 4XGNA 1GADO 1NFFA 2PY6A 5CPFA 1DLJA 3ZV6A 2HJSA 4MKRA 4BGUA 5CAEA 3LLVA 2O4CA 4ZQHA 3PZRA 1B16A 3I4CA 3P5SA 1DXYA 3LT1A 4IM7A 1A4UA 2VTDA 4RF5A 1LSSA 3ADPA 3UF0A 4CLXA 2YDXA 4E2ZA 2DC1A 3OICA 5JO9A 3AW9A 3FBTA 1IZ9A 4I5GA 1XLTA 5L45A 2Q2QA 4XQ9A 3V2GA 2GF2A 2GZ1A 2PLAA 1W73A 1N9GB 4JCOA 2ZQYA 3GHYA 4DVJA 2HLPA 1HDGO 2Q50A 4OKIA 5ICSA 4IGEA 4KWIA 1GUYA 4Q3DA 3WGZA 3WMXA 4E6PA 3FD8A 4HNHA 1ISIA 1JLLA 4DWVA 9LDTA 4HFMA 1IYZA 1GY8A 5CDYA 1UJMA 2BKAA 2VYVD 4S3MA 1ADFA 1NXQA 3OIGA 3AY3A 5IN4A 4R54A 5KVSA 1MP0A 5IDWA 3O38A 1NVMB 3HFGA 5DP1A 4NBWA 3VOSA 1OAAA 4CMEC 4PZEA 1VL6A 2IYOA 5IN5A 2IODA 3JQBA 4M54A 3WGOA 1CIVA 4E21A 4B4UA 5L4LA 1KIFA 3H9EO 3ORFA 2CDCA 5JDIC 4LCJA 1T2FA 1PGNA 4FOSA 2I6TA 1HRDA 3ZHXA 3ZN2A 1PGJA 1AE1A 3EVTA 2C07A 4Q39A 4G2NA 1GCUA 2RAFA 1RM4A 5TF4A 2QYTA 3GNSA 2HCTA 1DBVO 2DPGA 3DDNA 4JNKA 2V6BA 4YAKA 1HE4A 1C0KA 2JD0A 3A28A 2Y1CA 1VKOA 3JD3A 3QWAA 3DMTC 5T6BA 4HADA 1M2WA 4TQGA 3K2EA 2GYYA 2Q1SA 3I83A 4M49A 2O23A 4HWKA 5C7IO 2E4AA 1A7AA 1DIHA 1EE9A 3ZNQA 4CR8A 3DHNA 3RUDA 3HQ4O 4I5FA 2JJYA 3JQ7A 1VM6A 3PFWO 2W8ZA 4GWGA 3I9KA 1IHXA 4M86A 3TZCA 4IY1A 5HTOA 3PWKA 3Q2IA 4I9NA 4M89A 2OFPA 4W82A 1K3TA 5KOIA 1T4DA 5KJFA 3RCBA 3E48A 2JCYA 3K8ZA 1DJNA 4MIOA 4R4JA 2I5PO 1FJHA 2PZLA 2Z1MA 4KQWA 4IBOA 1GV0A 3I3OA 4XB1A 3VTZA 1M6HA 3TOXA 4CMIB 1WDMA 3F6YA 5KIAA 2IZ0A 2PZMA 4M55A 3F4LA 1LLQA 1U2GA 4CODB 3G17A 1HYHA 3Q6IA 4R1TA 4E12A 5B4UA 4N54A 3KVOA 4XYGA 2IEBA 3FN4A 3U62A 3OIDA 3QVXA 5KJEA 3UXYA 3EAGA 2H63A 4OKNA 4MP8A 2IZ1A 4CLEA 3FCOA 4J90A 3KHUA 3ICPA 1T1RA 3I6QA 2FP4A 1I5RA 1C0PA 2O48X 4XGKA 5ENDA 2Q1UA 5CG1A 1PWZA 4FC6A 1CERA 2O3JA 4QXMA 5JC8A 1Y6JA 1E3SA 1UP6A 5T8KA 4H3VA 4E30A 1QV7A 1A7KA 1R0SA 3ZV4A 4DPKA 2X9GA 1BW9B 2FR0A 2OZPA 3O03A 4G81A 3HFSA 2DT5A 2O3RA 4DLAA 4JJFA 1EFLA 2YHUA 4U0JA 3DZHA 1HDOA 1GZ6A 4YAJA 4LCEA 4J91A 2GGSA 2BLLA 3UW3A 4BMSA 2AXQA 2POQX 1Z7BA 3ZDFA 3NJ8A 1OI7A 5I7FA 3QE3A 1J0XO 1ISHA 1E7YA 3ITKA 1LDMA 1RM3A 2NLOA 1GL3A 3I52A 4K26A 4CMHA 9LDBA 4KDFA 2X58A 5F21A 4ZJUA 4O5OA 4YACA 5A3VA 4MVJP 1B26A 4GPD1 4IINA 4QFCA 3GNTA 3HN7A 4UVEA 4YJGB 1KVSA 4DC0A 4EEZA 4CUZA 2O3QA 5K0ZA 3FWNA 1WWKA 3E6AA 3F1LA 3MZ0A 3COSA 4PN3A 1MLDA 2GN8A 1CQJA 1EUDA 3I9LA 4KDEA 1PGQA 3JQGB 4XGIA 3O8QA 2FR1A 3D3EA 3F1KA 1UDCA 1NTOA 4IMRA 3UVEA 4HV4A 3BHJA 1IPFA 1CRWG 4ND2A 4EJ6A 1HT0A 2O2SA 3ZW8A 2V6MA 5BNTA 1Q0QA 2PK3A 1MFPA 1UDAA 3NT4A 4IQGA 3H9JA 2GLXA 4ZQBA 1YXMA 1YDEA 4D41A 1Y9EA 2BFPA 3K2BA 3BXXA 3KXDA 3EK2A 4L75A 4B8WA 2RCYA 3G0OA 3RD5A 2X23A 3KUXA 5G0UA 3AY6A 1AHHA 2I99A 4MVJE 5KKAA 2NWQA 1PR9A 1R37A 5JFOA 1E7RA 4LGVA 3W4KA 3FBGA 5B4TA 1Y8RA 1N2SA 2X5OA 1CF2O 2CD9A 2PD3A 3KBOA 4MVJG 1BVUA 1LSOA 4R1SA 4BKQA 2W2LD 1E5QA 5EMHA 1TT5A 1U7HA 3GDOA 4JP3A 1QXSA 4JIGA 1NR1A 3AM4A 3S2IA 3MJCA 3EDMA 5JE8A 3VPGA 1IULA 3V5NA 4B7UA 5EL0A 4RF4A 4CUKA 1JAXA 1LJ8A 4OXNA 3RJ9A 2QRLA 1BDMA 1HSZA 2C5EA 2CF5A 3IL2A 1Q7BA 3C85A 1DC4A 1E6UA 3DBLB 4CM4A 7ADHA 2GZ2A 2ZCUA 1ISFA 5HM8A 1NQ5A 1YONA 4CLHA 3EMKA 3GMSA 2X4GA 5GZ1A 4QO8A 2A94A 3OHSX 1PEDA 1RM0A 1OOEA 3DBHA 2D3TA 3VPHA 4YJHB 1I01A 1LTHR 3RUAA 4I5DA 5A03A 5JSFA 5EPOA 5G4KB 3DAFA 3HNPA 2DU8A 5CPBA 1HXHA 2HKIA 2Y1GA 4LK3A 3LDHA 1PWXA 3H3JA 2X9VA 1A5ZA 4NNJA 1XIVA 3WQSB 2YDYA 4ESOA 3ONDA 1ZNQO 4DYDA 1N7HA 2DLDA 3QJ5A 4BKOA 1BXGA 3RI3A 2P9GA 4NHEA 1DAPA 1E3EA 4ND1A 3QWIA 2C29D 3WR5A 2J5QA 1ENOA 1DEHA 1I3MA 1P0FA 2DAPA 2EF1A 3HB4X 3NV9A 4J16A 1KEUA 4DGSA 2H6EA 3L4BC 2G82A 1P44A 1K6XA 4GI2A 4LN1A 4AJ2A 4KUHA 5CEEA 5L3ZA 1WZIA 2HU2A 4YJFA 3DBRA 3S8MA 3MJSA 3L6OO 1A27A 2YV3A 5L4NA 2UYYA 4WNIA 2FOIA 4OOEA 4JQCA 2VT3A 4WLUA 5JPIA 1OFGA 3DAGA 3LSYA 2HSDA 2HMVA 4BMNA 1ZK3A 2XOXA 4RO0A 1EZ4A 2VHYA 3IQDB 4AJOA 3TF5A 4J43A 1YS4A 1YQXA 2V6GA 4Z3KA 3GY0A 1ENZA 4B3JA 5COQA 2VRBA 1C1XB 1YH3A 1ZVMA 2VRCD 4O1MA 3TZKA 4EJMA 3UAGA 3AU8A 3GRPA 3DOJA 4ZHSA 5G0WA 4HFNA 1XA0A 5JY6A 1DIAA 1UP4A 3GFBA 3L0DA 3S2FA 2ZIZA 1NPTO 4ZICA 1G0OA 2VYNA 1C3VA 5HS6A 4Z0TA 1DFHA 4CM9D 1O5IA 4XJSA 3L6DA 3VZQA 5BSFA 1B7GO 5AVOA 4TZKA 2AE2A 5T57A 3W8EA 2AG8A 3RKUA 3QWHA 3WSVA 4W7HA 2AEFA 1SCUA 1H6BA 4WLNA 5IZCC 1ZBQA 5G0VA 4LW8A 4R01A 3VVCA 1LDYA 1EVZA 5LDHA 1ZSVA 5FYDA 4QO7A 2HK7A 1Z45A 4ND5A 1DFGA 3PJGA 2O3UA 4E2XA 1TA4A 1ONPA 2JCXA 4O63O 3GOHA 4HP8A 2P9EA 4IQ0A 1P33A 2GDZA 2DFVA 1X0XA 1EQ2A 1FXSA 3WLEA 3LT2A 1PJTA 4YQZA 1YKFA 1EVYA 4W9NA 1YGYA 1LQTA 3UCFA 1U5AA 2QIOA 1WVGA 1DIGA 1UH5A 1IZ0A 3WSWA 4J1SA 1PS0A 3ROQA 3SJ7A 3G49A 3GDFA 1QORA 1DSSG 5JNLA 5THQA 1LRKA 3JYPA 4NU5A 4FW8A 3D5QA 2CVOA 2PD4A 3PQDA 4B3HA 3VZSA 3K9QO 4BNNA 4RLSA 5U9CA 3IOYA 1E5LA 2DFDA 4JGBA 4AFNA 2NU7A 1JVSA 4I1IA 4K6CA 4QEDA 3T7CA 1NAIA 4FJ2A 1YL5A 5CDSA 2B36A 1HYEA 4UUMA 3WIEA 2CVQA 2Q4BA 3WTCA 3L07A 6ADHA 3U4CA 1MUUA 2OXIA 1H6CA 3V8BA 3ZNNA 2GCGA 4YT2A 1KVQA 4NPCA 1WP4A 2D2IA 3K96A 3IUSA 3DTYA 4J7XA 4Z0HO 3VDQA 4YXFA 4BB5A 4XYLA 1LDNA 3DBHB 1BXZA 4XWYA 4BNJA 2JCVA 3PZBA 3JQBC 4PG5A 5KNLA 3JQGA 1RPNA 4CQLB 4A2CA 2OGUA 5B37A 1UZNA 2IYPA 3DTTA 4P38A 3GUYA 3I4FA 1TEHA 1NM5A 5IZ4A 2X22A 1ZXLA 4R51A 4P8RA 2W2KA 1XEAA 1QYDA 1ENYA 2P68A 2YV1A 2Y1OA 3IMFA 4U6QA 2EG9A 2WEKA 2CDAA 3Q11A 3WS7A 3WNVA 3ASVA 2CUKA 1BTOA 1O6ZA 3EGOA 4OGWA 5JCJD 3L77A 5K9ZA 4UEOA 5L51A 3VZPA 3ZWPA 1PU2A 2R6JA 5G2OA 5ITVA 1GCOA 4IQ8A 4OSPA 4J0FA 3R1IA 1XDWA 4RDHA 4A73A 3AK4A 3OP4A 3HG7A 4UULA 1SBYA 1XGKA 3MTGA 3IIEA 4E5MA 2P2SA 4WLOA 4D7AA 1ZXBA 5BR7A 3AJRA 4ALLA 1FDVA 1P3DA 2G17A 1TLTA 2EIHA 3OBBA 1UAYA 3I1JA 3VPSA 3FNGA 4AJ1A 3Q0EA 5A9TA 1E3JA 4DQVA 5CEJA 3TZQA 3C1OA 4WCDA 3X2EA 3JD1A 4IDDA 3UH1A 2E37A 1ISMA 3D0OA 1DO8A 4Q3CA 3PHGA 5JDCC 3A06A 1SC6A 1E3LA 2C5AA 2HRZA 3O8QB 2DTXA 2WE8A 2Y93A 3WLFA 3INGA 3E9NA 1Q0HA 1T2DA 2B4TO 5BT9A 1M75A 4TRRA 3W6ZA 2JHFA 5J23A 3AM5A 1Z74A 4LSMA 3JV7A 3PYXA 4O0LA 4U8GA 5C5IA 1EUCA 3VH2A 2JFHA 3JQCA 3TRIA 2NV6A 1H9BA 1LSJA 2GN9A 4YT5A 2Y1DA 4RPJA 2X0NA 1CYDA 1NPDA 4IMPA 3KSZO 3EW7A 2P5UA 3GG2A 1GFSA 1XCBA 3MWEB 4GWKA 4DIOA 4YYZA 1BSVA 1T2CA 3JTMA 3GAZA 4WLVA 4BQRA 4EUHA 1YOVB 2VNSA 2XXBA 2LDBA 4NG5A 5DOVA 3EVNA 1XQ1A 4MVJF 2PH5A 4IJUA 1YQDA 2PR2A 3R0IA 4RZHA 4J0EA 4U0KA 3U3XA 4C7KA 3LK7A 3M2TA 4ROSA 1NR7A 4CM8B 2NTJA 3WBBA 1WXDA 4GL4A 4WLFA 2JL1A 3H2ZA 3HDHA 4RVFA 3ABIA 3SLGA 3KLMX 3N74A 4A7PA 2D8AA 1J5PA 3PWSA 1G1AA 3KO8A 1QYVA 4AJEA 1YVEI 4BVAA 1B8UA 1DAOA 5I8ZA 1OMOA 2PD6A 4CR7A 3DR3A 2LDXA 5TJ9A 1VL0A 1MC5A 3JCZA 4OL9A 1I30A 4ZD6A 3RSHA 3F5SA 1N1GA 3DZGA 3SC6A 4CL8A 2VUUA 3B1KA 4IS2A 4OMUA 3AU9A 1R6DA 1LLCA 3F9IA 3P2OA 1MC4A 3TDKA 5EIOA 3ZU2A 1B8VA 1U1IA 3AY7A 3DFUA 4DUPA 5F1PA 3LVFO 4E32A 5TJHA 3FWZA 2EW8A 4B4VA 3TOZA 2DUUA 4EBFA 3VKVA 4ZRMA 2I3AA 3V2UA 1ZFNA 3BMQB 1A9YA 1BHSA 1V35A 3OJEA 3V2HA 3E8XA 1CWUA 4JK3A 1ZMTA 5DBGA 4J9VA 1G6KA 1X1TA 2AEMA 4D43A 4TRMA 3ZU4A 4E4YA 4MVJH 3C3XA 3RU7A 3GF4A 4HX5A 3UICA 4U6SA 3HSKA 1LX6A 4MKZA 1VJ0A 2VHXA 3JQ7B 3KSDO 3W8DA 1EUZA 5A05A 4F46A 3DMYA 2RIRA 3CINA 3ITDA 2VZ0A 2CDBA 1SMKA 1P0CA 4YQYA 5A1TA 4W4TA 3OJ0A 2EKQA 1B8PA 2IEDA 3GZ4A 1NWHA 1T25A 4EI2A 1SEVA 3H9GA 1N1EA 1UXJA 4ZGWA 5DULA 4WCFB 4CV3A 2VHWA 4C7JA 3C8MA 1F17A 2O7QA 3BA1A 3JQDA 2X1HA 2I67A 1R66A 5I7EA 3OMLA 4UUNA 3GZNB 4L0QA 2ZB4A 3ANLA 1SNYA 5I9LA 1EVIA 3B1JA 2R2GA 3SEFA 2NQTA 2A92A 3KM0A 5L7YA 4BL5A 1PTJA 3DHYA 4F45A 3GAFA 3WWYA 3ROPA 5MGBA 4R1UA 4AJNA 2OP0A 3WFJA 4KMSA 5T64A 3BAZA 4OSOA 3WGGA 4ZA2A 3BMCB 3CSDA 4FC7A 4CLDA 4BV9A 1NP3A 5ICMA 2OBNA 1LBEA 4K1LA 1LUAA 4EUFA 1WDKA 2HO5A 3U4IA 4R3WA 4R69A 4RVGA 3R6DA 1P1RA 2NNLD 4RQUA 3JQ8A 1QRRA 2Q46A 5BNFA 1PJSA 4ALNA 3D64A 3PK0A 1N7GA 3K73O 5F3RA 1EDOA 5TGDA 2PV7A 1TVEA 2ZCVA 2O4UX 4ONEA 1MG5A 3KYDA 3DBRB 5DDIP 3PTZA 4BNZA 4CM6A 4PFJA 4WEQA 3L4BA 3FI9A 3QWBA 4PLYA 3WIDA 3I23A 2W2LA 2GRAA 1EK5A 1PZHA 2CF6A 3KB6A 4H7PA 4ALMA 2Z95A 4CL3A 4MO2A 3CEAA 3INRA 3W1VA 3VDRA 3H5RA 4DBVO 5TSDA 3DFZA 3RKRA 3VPXA 5I9NA 2AHRA 5TQVA 3GHHA 4DRYA 1KY5A 1WAMA 2ZB8A 1E0DA 4WKGA 2FSSA 3WGYA 5A3JA 1LSUA 3LC2O 4RGBA 3WFIA 1JKIA 4IPTA 5HRUA 4LVUA 5L40A 1ORRA 1PR3A 1I3NA 3K6JA 4OJNA 1X7HA 2J5RA 2DTDA 4YJHA 4AG3A 4BO9A 1MXFA 3JYQA 3ZCXA 3K31A 4BMVA 3LQFA 3HDQA 4MIYA 2HQ1A 1VLLA 1RKXA 4PLGA 3LF1A 1K89A 2C0CA 4XIJA 3HN2A 2YQ5A 2CZCA 1EQUA 3AOEA 4J4HA 3DOOA 4MOWA 3OF2A 3TL2A 1GU7A 3IP1A 3A1NA 2NVBA 3D3WA 4J49A 4FCCA 2W4QA 3CTMA 4U5QA 4R41A 4XQCA 2D4AA 2OBYA 2PGDA 2HUNA 2EP5A 3LC1O 4OM8A 4GBJA 5L7WA 4JXKA 2X7HA 1PS9A 5ES3A 1R16A 2IRWA 3NDRA 4TKLA 2BELA 4FBGA 2JD2A 4PG6A 2VRCA 3ZHYA 4BNTA 1NPYA 4Q3BA 4D45A 4NJMA 4CLOA 4BO1A 1I2ZA 1PZFA 1DHTA 1AXGA 4IZHA 1B3RA 4KUGA 1CQIA 1DRUA 2AW5A 3ADOA 4NI5A 4ND4A 4FFNA 4BO3A 3IKTA 2DBQA 2UV8A 4NBVA 3VHRA 4I9UA 4ZQGA 5KVCA 4IJKA 4ALKA 4W9NC 2FPPA 5DOZA 1D4FA 2HK8A 2WM3A 5DT9A 3ONEA 2HMTA 1EVJA 1X7DA 2H1SA 2YHIA 4J1TA 1LDGA 4TVBA 4S1VA 1UP7A 1O0SA 2DKNA 2NTNA 1JAYA 3K5PA 4UVDA 2EJWA 2PH3A 1TB4A 4FFPA 4NH4A 4EEXA 2NVWA 5I7VA 2I66A 2BI7A 3GNQA 3RUFA 4A10A 4D42A 3D4NA 3ZWOA 1Q2XA 2HMUA 1PL6A 1LXCA 4NJOA 3L9WA 1GR0A 1M6WA 4JJGA 4BNYA 1LQUA 5A4DA 4N18A 2WE7A 4GX5A 3U09A 3ZWCA 4BNHA 4BO0A 4BNVA 3KYDB 3DL2A 2JAPA 4CLRA 4CR6A 2G0TA 3NKLA 3X2FA 1JN0A 1JDJA 3RC9A 1MB4A 3OM9A 4OO3A 1U7TA 1BG6A 1P45A 2IDZA 3GT0A 4MDHA 5A9SA 8ADHA 2BGMA 1AN9A 1ZZEA 3KYBA 3JYLA 2BMAA 4CM1A 3JQ9A 4Y98A 2DTEA 1IUKA 1YJQA 1PQWA 4FDAA 4BNGA 4OQZA 2ZATA 1T2EA 1R0LA 5KTKA 4P4NA 1NBOA 3I5MA 4R1NA 4U7WA 5COBA 4NQZA 1VE9A 1O9BA 4FJ0A 3GPDG 4LMPA 3TFOA 4DTIA 2B4QA 2DVMA 1EEHA 3M2PA 3FPCA 1XKQA 3QY9A 4LSWA 1Y8QA 3RBXA 1ZEJA 1JU9A 3E82A 4GH5A 4L73A 4FJ1A 5IDYA 4KZPA 4TSKA 4BIIA 2YZ7A 3BMOA 1NVGA 4RPKA 2HAEA 4QECA 1WZEA 1KOLA 1GEGA 4Z9YA 5AXCA 4EZBA 3WQQA 3KLPX 4ND3A 1GV1A 1Q1NA 3SX2A 3SJUA 3GH3A 4ZVVA 3ZHBA 2QRJA 1PJCA 1Y1PA 5GZ6A 3E5MA 5DZSA 3RU9A 1U3TA 3LLSA 5LDGA 3TPCA 4WNCA 3TFQA 3KRTA 2EKPA 5DN9A 4BO4A 3KSUA 3NT2A 2WYVA 3WXBA 4Y9DA 3IC5A 4J2OA 1Y7TA 2WD8A 5EQDA 2EWMA 4OXYA 1VRWA 4WUVA 2VOJA 2GASA 1PJ2A 4XZ3A 2I9PA 4ITUA 3FRJA 2VZ9A 2NTVA 3I9MA 2HDHA 5FEUA 1MFZA 3IKVA 3LF2A 1W0CA 1E7WA 2IXAA 4YVFA 3JD0A 4OOFA 3PLNA 4YRAA 1H2HA 1DLIA 1PGOA 4ZRNA 4XJTA 3W4IA 4GVLA 3CE6A 5JS6A 2CVZA 5TX7A 1E7MA 1FF9A 4IS3A 4IDCA 2AA3A 2JKVA 2O2YA 2PZKA 4RVSA 4FIZA 3ZWMA 1NFRA 1H6AA 2OORA 3WB9A 1HZJA 2Q2WA 1BDBA 3WG9A 4ALIA 1HZZA 3WYBA 2VUTA 5JDCA 5K6AC 3QV1A 2V7PA 3WQRA 1K6JA 1PQUA 3ANNA 3PJFA 3AI1A 2B0JA 3OEWA 4B3IA 4YT8A 2GN4A 1KVTA 3CKYA 4BNXA 1PGPA 1BWSA 5KVQA 4FFOA 5TIIA 1HTBA 4WPGA 4NZ9A 3IAHA 3ZI0A 1MX3A 4GSKA 5A06A 3Q2KA 2WYUA 3A9WA 3JSAA 3L4SO 3MJ4A 2C20A 4RZIA 5IFLA 1RJWA 1W4ZA 4HUJA 4RF2A 4B4WA 4N5NA 5BQFA 3VVBA 3AUTA 3E9QA 1YB1A 4IUYA 1I36A 2F1KA 5JCJA 1V9LA 5BSGA 2NADA 3NTOA 3PVZA 2X0JA 3F4BA 2FY8A
chains in the Genus database with same CATH superfamily
3QUTA 1UFQA 2DQ4A 4OU5A 4KSYA 1K66A 2B7LA 4KQJA 2NXWA 3IEUA 3WAGA 1P9OA 2PL3A 2R48A 1DCFA 2PKQO 1WPGA 1TMOA 3I2YX 3HKDB 3M4ZA 3QLVC 1CY0A 1B0PA 3TZ6A 2HTEA 3GGJA 1H2YA 5DLDA 2GH1A 4YIKA 4N41A 3OUZA 2BHLA 2OCGA 1QRSA 3RUEA 3N1UA 1QG6A 3KQQA 5ELMA 2XQJA 3F2VA 3NIBA 3OTWA 1RHMA 3PIIA 3CHYA 3A7DA 1N2ZA 5JR3A 3PEUA 5BMVA 1OH6A 3FWYA 3GZTB 2AG1A 2VPTA 5CVUA 3ZHVA 3GI1A 4CE6A 4EHFA 1UAGA 3MFQA 4YY3B 4PV7A 3UUWA 2CUZA 3L8CA 3I30X 2JRLA 2WA1A 3YASA 2C2HA 3MMPA 3AVYA 4A0QA 1QIHA 4DILA 1THMA 4D0SA 4IXDA 1J4AA 2ZYAA 5FPHA 2BYTA 3NRBA 3I6MA 3JYOA 1RE0A 3X3HA 2X5JO 2FFHA 3R6LA 3WL4A 4NJEA 1ADBA 2C42A 4K3UA 3UA3A 1N9GA 2CNWD 1H94A 1SVNA 1JXMA 2HA6A 4E1BA 3KZOA 1HDYA 2YXPX 3KFXA 5F5LA 1U8YA 2PMEA 1E2UA 1V3UA 1OXBB 2FN4A 2XNDA 2I1VB 3OEYA 3PUVA 1CQXA 4IIJA 3PNVA 1M2VA 5TC4A 3EEBA 4PG4A 2J0QA 2Y66A 2AG5A 1ZLYA 4X85A 1L4GA 4IAOA 3TIXB 3A0RB 2YZMA 5A04A 1YTUA 2ZSUA 3IIJA 2X0IA 3NBYC 4AP5A 1M2OB 3UJ7A 3QEJA 3PHCA 2PQMA 3W5VA 2I3GA 1KQFA 2AOTB 6NULA 1TAGA 3IVGA 4RAOA 5FIUA 5I4CA 2OHVA 5DBIA 4DG5A 1PFKA 4HXGA 4DW8A 4PRZA 1P0MA 2XE7A 3KAPA 2P5YA 3O31A 5BRNA 3KCQA 2ID8A 2EERA 2OXFA 1B0UA 2PHZA 1DTSA 1UFVA 3E5RA 4KQ9A 1JBKA 1GKUB 2Z08A 1T9HA 4H1WA 1IB0A 1ZM3A 3ZV5A 3RH0A 3OLVA 1NC3A 1VB3A 4K1XA 1G1MA 5ALIA 3E58A 2E49A 4V02A 3BSYA 1BMDA 4RV9A 3C5WP 1NL3A 2C00A 4P0PB 3NGXA 5GP1A 3TB4A 3NXKA 4NF2A 1YI8A 2RGGA 2QRKA 4RULA 2ZRBA 3KOWA 3U1TA 1J9GA 2FETA 2P9QA 5FF9A 2ZRFA 3LWBA 3M70A 5EHGA 3FOEC 1PR2A 3EZ6A 2E21A 4U1RA 5H7XA 1BCSA 1S0UA 5DHPA 3AFNA 3WYEA 5GZ3A 1XFDA 2LIVA 4KSBA 4IKPA 1KAGA 3V97A 1TGYA 1R12A 1RRGA 5ARBA 4WFJA 1C30A 2CGEA 4IOJA 4M37A 1XRJA 1Z75A 5TQ0A 2FRVA 3RRBA 3CPSA 3NTQA 4B71A 2NUPA 1YS7A 4QOFA 1NN0A 3OCCA 5IVIA 4BCCA 1EX7A 2YBDA 2W6OA 3NVDA 5AVQA 1XZHA 3VV3A 3CVWA 2CLLB 1P1JA 1RAHA 2FWIA 2D06A 3JY6A 3GR6A 4JBLA 4JX9A 4NYIQ 4PYKA 3ZZNA 2IC5A 1PTJC 1I7LA 4FUQA 4G0XA 4TROA 4TYPA 4AMVA 3D6NB 3IODA 4BKMA 4F2GA 1XNJA 2W6IA 4NBUA 3WLAA 2IV3A 1J9EA 2FSVA 3GGOA 5FTWA 5GY7A 1E5TA 2XECA 3E5NA 3GXBA 3HGQA 4KP7A 1NJ5A 5U4QA 4DYVA 5HSGA 1VE5A 2QRMA 2ZDHA 2ZTLA 3I37X 1GAQA 2FZWA 3BXEA 3FNFA 3KT6A 3SAJA 3WLMA 5ALKA 1DC5A 4BE9A 2FPGA 4J94A 2OLJA 3IBFA 2HDOA 2AYXA 2PQ6A 2Q0QA 3H7IA 5CITA 1PNRA 3LUJA 4E2YA 5A4MS 5KO2A 3PLAE 3R3JA 1P5JA 4NKRA 1CZNA 1JKJA 1XRSB 3O3CA 1NMXA 1D04A 5K1ZA 4QXRA 4B6JA 1PR1A 3WJAA 5LYJB 3U7FB 4BV2A 4G65A 4EI7A 5JH7F 3RHZA 3PUIA 3P9YA 5KTYA 6REQB 3ZD6A 2C4HA 2ET6A 2GBGA 3ZE6A 1DAHA 2ZKLA 1FVXA 4YRNA 4WK2B 1HOXA 1Q7CA 4PLVA 4EQZA 3R7BA 4CKCA 2BGNA 4DREA 4FZVA 3ETNA 2W4MA 1FUIA 2NP6A 1TRHA 4JNCA 4DV5B 1AM4D 1B2LA 2GEVA 2XEXA 4JP8A 1M0TA 3HR4A 1YDMA 2GARA 4PSAA 4TV9F 4OB6A 3WDMA 2J6CA 4DOMA 3QEBZ 2PU7A 4ZAYA 1C9KA 5HS4A 4BZQA 1KJYA 1QIJA 1DU4A 4QNMA 4B3TB 3ZWWA 3R40A 4M6WA 1CR2A 2WUGA 3R3HA 5G3YA 1YI0A 1BXKA 3BWYA 1AUPA 3GVPA 4V0QA 4YCNA 3H9UA 3MRVA 3CNBA 4JLUA 4BWVA 5L7TA 1P81A 3WO1A 4DLBA 4YXFA 3BG5A 1ZCJA 4U2FA 1UT5A 1ZN9A 4BN4A 5DM4A 1EK2A 2C9MA 5LB2A 3QXXA 3DOHA 4WTOA 1IWBB 1W581 3DAYA 2OZVA 3TJMA 4I1OA 1E1LA 3U7IA 4HAOA 1Z68A 3WDKA 1QO0D 2WICA 3M34A 3HUDA 4MUNA 5E8JA 3HDGA 2AQHA 4MMXB 1MU0A 1EFVA 1SK9A 3PHHA 1TF5A 4H3KB 2H57A 3LO8A 4KXXA 2NVUB 3UN1A 2AJLI 3UWPA 5I8WA 2X6TA 2GNOA 4IJ6A 4N0MA 5K0CA 2WMDA 3AV0B 1ODIA 4PG7A 1VIAA 4BZWA 3PFIA 4D9JA 4EIWA 5KJ6A 4A8JC 1UBKS 3RABA 5HIKA 1WKVA 4MEJA 4DEYA 3MGCA 5TGTA 3GIWA 3COWA 3BMNA 3RYIA 4JLAA 1P17A 4D96A 3OLCX 2B21A 4JL8A 4NP6A 1W1UA 1DZ3A 3QFTA 4UDOA 1PWHA 2V6FA 4O2BF 2VJLA 3IOEA 3S99A 4ATNA 4Q48A 3TINA 5J2TA 3N05A 4C7XA 1P7PA 1EA5A 1YVRA 2VDPB 4BZXA 3CMMA 2ZSAA 1N6OA 4G09A 4DR4B 4ILKA 3R75A 2M2IA 3I12A 3A1SA 3OZAA 1FQJA 2O3TA 1N92A 1OI2A 3OZCA 1JPNA 2YYSA 4RW0A 4XKJA 1W36D 2UAGA 3TSWA 1TUIA 3QNUA 1JR4A 1EVEA 2XB6A 4JBYA 4QDTA 1LGYA 4OEHA 4OJYA 1NIJA 3ZGYA 1USUA 2W71A 4EGAA 5BVGB 2WD7B 1XF1A 1Z4NA 4FP9A 5U1PA 1QWSA 4K9RA 4CQMB 1G0NA 2H1IA 2RHDA 2VVTA 3EAFA 1C1DB 3N2GA 4TKMA 1MJGA 4JA2A 3GIDA 1P39A 4LDPA 3QM1A 3I5UA 1V0JA 5EMKA 1W6RA 3WMRA 1DWUA 4X44A 1ECPA 2GPTA 3FR8A 1DAMA 1TXGA 4KLAA 1JG3A 3IUQA 3SEZA 3ETCA 3VNBA 3ADKA 2J09A 4Q24A 2HNAA 2I54A 4GMXA 4KXYA 1JEYA 1KFKB 4RY0A 1KP2A 2NUAA 1Z4OA 1U7WA 3C98A 2J9ZB 3QW4B 2BZSA 4PRYA 3RUCA 2PX3A 3T95A 4YCSA 2ZUTA 3FE2A 4Q1VA 2ONJA 4Z4CA 4ZAZA 1WS6A 4PU0A 4BNKA 4Z0NA 4ZP1A 4ER5A 1DO0A 2XE8A 3NBQA 3I6BA 2I34A 3F3SA 2JFXA 1NHGA 4HWTA 3FUXA 4LHYA 1NGSA 3RYCA 1WR8A 4WNYA 1ZAYA 3BK7A 2VJMA 3I1FA 1U31A 3ZWYA 4H4DA 5E9AA 1KY3A 4NCKA 4KO8A 2AR0A 2QYOA 2IOQA 2VPXA 1OFUA 1ZH8A 4MQMA 3RIYA 3OMXA 2XIJA 1KVRA 4M9QA 3EIUA 4OBWA 4CMKA 3VPFA 4MWOA 5EJGA 2AOUA 4HWOA 2QI9F 1I6LA 2KMLA 1TC2A 1PW7A 4IIVA 3MILA 5AVYA 4Y9SA 1ZPDA 2RBGA 4H7EA 2W43A 4Y7CA 4R2HA 4BMXA 3ZU5A 5A4AA 2DF8A 4MS1B 3BCSA 4QG7A 2ZKIA 4S04A 1PK8A 1W87A 1YVUA 5TMEA 3EUFA 4XCVA 2XXAA 2IS2A 2P2ZA 3BYZA 2MSNA 3OC6A 1ECJA 3VR6H 3ZHOA 1I7DA 3TUIC 4HYYA 4YMGA 2JVJA 1EGVB 2VKQA 4QVKA 2BSQA 1LU9A 1NQUA 3AV3A 3KSRA 3UWOA 1C3JA 2P9ZA 3EIHA 2F64A 4PZAA 4IYRA 5CXSA 1CB0A 1Z12A 5CHEA 1GKIA 3FAZA 5ALLA 1VHDA 4EVQA 4NNPA 5K51A 1PZGA 1YBAA 2C1ZA 1JG7A 4UUAA 2PYIA 4TTQA 3V80A 1QHEA 4Q4HB 1X87A 2QMYA 1Z16A 4QAQA 5BYAA 3BZBA 2IYYA 1I8TA 1KO1A 1RWMA 1ZOLA 1ZI6A 2NQ2C 2QRGA 3A1VA 3H2HA 5AJVB 5KJ1A 1Y5IA 3OQJA 2CN1A 1QQAA 3B7GA 4XLLA 3A6EA 1JIKA 5C5CA 1RYHA 4E3ZA 3DTVB 4MUGA 4WFIA 1MG0A 2V0NA 1ZR2A 3P26A 3ZGXA 1GYPA 1MN6A 1TT5B 3QU7A 5SY9A 4DSZA 3K4QA 1VLHA 2WD9A 2PS1A 2WAOA 5BQOA 1UAAA 1QO7A 4R8RA 2IBTA 4E5KA 3L0YA 1SU6A 3DUFB 2UUOA 2PVCA 4E1VA 1S6YA 1VP9A 2QLJA 3A9VA 3FDIA 4M1MA 1N5DA 3AIIA 3NUGA 4I5EA 3GUVA 3NHZA 4FS8A 5KSWB 1KDTA 2I9KA 1AXEA 3N7TA 4JELA 4BRUA 1S7CA 5CA0F 1MEOA 2HJHA 3OIUA 4PM4A 3DEYX 2H5JA 3A1CA 5JTTA 4CVNA 1Z5GA 4RY9A 1LI4A 2VPIA 2VZEA 1YTLA 3T3PB 3BRSA 5D5QA 4RD2A 1NJ6A 4EKGA 2Q41A 4ACBA 2GAAA 2H2DA 1HLGA 1CY4A 3B78A 4Y67A 3K0KA 4AF7A 5FPPA 2VNAA 2NQ8A 4FGZA 3M1AA 4NK5A 2AZDA 4O2AF 3B1FA 1TO1E 2H9YA 4F21A 4RIGA 3L0CA 4C29A 2IQIA 3EQ8A 3TXAA 4EO7A 1D2NA 2ZJ4A 4GVXA 4AJLA 4G9GA 2PXCA 3ICEA 5C51B 2J30A 3GJRA 3P20A 1JBQA 1TU0A 1G8SA 2XA2A 4L8WB 2ZS9A 2EJVA 3C7CB 1K8RA 2E82A 3G82C 2REBA 4IGAA 4LEIA 4P4SB 5DTEA 4FM9A 3W3AD 5C81A 3WGVA 3GFGA 1MOPA 2WIKA 1T15A 4PWYA 1A9ZA 4M8NE 4RMGA 2LRHA 3T9FA 1QYRA 3ZBPA 4AWAA 5C7OO 5CFRA 1YS6A 4JLNA 5TVGA 1P77A 1YB6A 3RARA 1R64A 2B83A 4QX6A 3RVMA 2OMEA 3T8YA 1Y3AA 3OO0A 3FZGA 1W48A 1XKTA 4H27A 3IQFA 5DCLA 3JQEA 5KI6A 5IWCA 2B8JA 3CMCO 3MJRA 4JQOA 2X0DA 1NVTA 1OXMA 2ARKA 2F00A 2O2XA 2CV2A 3NI2A 1NE2A 4IDOA 4F0JA 1BE0A 5AVVA 2C5LA 1JDBB 3NHAA 4IL5A 5DYIA 3QLVA 2GF0A 1KO8A 2X2OA 4DMLA 3CX4A 3K5WA 1L7VC 2NXJA 3BDAA 5JNRA 4DA9A 4V1CB 2OO7A 2QZ9A 4LRWA 3EDQA 5K3FA 3ZI4A 3FYDA 4M36A 2BGLA 2NO9A 1CY1A 1UT6A 1Z4LA 2IU6A 3A4YA 4UCFA 1CHNA 2QJWA 3TE6A 1ETUA 4LISA 4JB0A 1IG0A 2ZQZA 3KUCA 2WJAA 4MB2A 3GJQA 3U49A 1GAWA 4CRWB 3ETDA 1WKBA 3OJXA 3OQ6A 3VZCA 4ETMA 4R3NA 2AOUB 3FVTA 1XLVA 2J07A 1CUWA 1XA3A 3DWEX 1SQSA 2VHTA 3LE8A 1PL8A 3KSMA 3WWEA 2CLEB 1ZGZA 3OSUA 4EFKA 3VSEA 3VO2A 5IJZA 4LYGA 3ZWXA 3QU9A 4AICA 5KWEA 2JJMA 4TGLA 1THGA 3GCDA 5EWMB 4FGUA 3WKEA 1CLUA 1UBTS 3HJAA 4I7EA 3RRNA 3HXOA 1B2RA 1NLUA 3IBTA 3ZLJA 5CYFA 1O77A 2PUJA 3H8WA 2A5FA 1D2MA 2PEZA 1VZ2A 4Q9NA 3MS7A 2GO1A 4PGHA 4Q3NA 4TMVA 3FYUB 4UTVA 3N0TA 5ABPA 2UDPA 1GZ7A 2Y05A 7YASA 2O8BB 5KTMA 4JP5A 5HZKA 5GM1A 5AKZA 2SKEA 2W90A 1K5HA 1XP5A 2WJYA 1SXJC 3HB7A 5GAJA 3RS2A 1F8UA 3UXHA 1V4VA 4Q3EA 1VDMA 3ICVA 3OZUA 1C9EA 2Q6OA 1H2BA 5THKA 2OL4A 1FYEA 1HWYA 3MOIA 1NF8A 1JJAA 5E9JA 5C32A 1RHRA 3M5DA 2DUMA 2B0CA 4ZTZB 4XRRA 3TWOA 2Q6KA 3DAHA 3IUNA 5LYYA 1NHWA 2GR9A 2Z09A 3LSYA 4N0PA 3MEQA 2WD7A 3K1ZA 4PZ9A 2A35A 3HA2A 5F51A 3SC4A 4C4SA 3CZ4A 1EK1A 2Q9CA 4RGYA 2Z1NA 3G68A 5B12A 3THXB 5BUQA 4ZMRA 2A5DA 1JTVA 3ZS9A 1OXVA 3SE7A 3RSLA 5EZYF 4WFQA 2C7RA 1O97D 4WT7A 1GQSA 2FCRA 1RXIA 4AN0A 2UYOA 1KSJA 2YOGA 4I14A 2PJRA 1TM5E 5JATA 2ERCA 1KQOA 4F3YA 3G2QA 1JWAB 2ADMA 2EFYA 2F1RA 4ZCTA 1X2EA 3AGQA 3HBFA 2AN5A 1SBHA 4V0KA 2O8EA 4LJ7A 1XZCA 1GRVA 2XVZA 2GCEA 5G3ZA 4ITVA 1ESCA 3RT7A 2CHFA 4AKIA 1D9XA 2Q3CA 4NMHA 1X39A 2IP4A 2YWJA 3CS3A 4FINA 2VATA 2IUTA 1GHTA 2FQQA 2PGJA 5JAOA 2VHZA 5EE1A 4KMOA 2IU3A 4DBZA 5DEOA 4CI9A 2O8CA 2AW3A 4IILA 1O94C 1G8GA 2C54A 4U7TB 2FUEA 3V1TC 3SY8A 1TC1A 1XYYA 1OXTA 1YB2A 1YJ5A 2DQYA 4TM7A 2HA5A 1XDGA 4L3VA 4QUAA 3OP1A 2VDOB 3EUWA 2ZSFA 1E64A 2IKSA 5CM9C 3EZFA 4JLJA 1W4LA 5FL7A 5I7AA 1C1XA 1M10A 1P4RA 3PNOA 3BFJA 3VMFA 1FLVA 4YEDA 3N86A 4AN4A 5I9BA 5EHQA 3KTAA 2WWHA 3FAKA 4PHGA 4QZVA 1W88A 3RC1A 5BSHA 4HK4A 1QTIA 2QKYA 2ZBVA 3D7MA 3U7EB 3B70A 4IDFA 1WCYA 2UVPA 4C78A 2QTRA 2IW3A 2HWYA 4FSHA 4KBFA 1GXSA 1N2BA 3RJZA 4CHTA 3RC8A 4AZSA 1P1HA 1DDIA 1J22A 3MFYA 4JOQA 3SQDA 1D6MA 1NMYA 1E2NA 2Y2UA 1MEJA 3W2FA 3HADA 2CJYA 3ORSA 3WBFA 3NHBA 1DS6A 3T7EA 3H8VA 4H9GA 3VPDA 4V0MA 2A8YA 4WKPA 1FFDA 4H08A 3IR7A 4TWRA 4AC9A 2FJUA 5JAMA 5K8UA 3JD2A 3V8NA 3PEEA 3K92A 2BEJA 3LWDA 2OP1A 1HORA 2XEDA 1VCMA 2DUWA 4X8OA 1DRWA 1WUYA 2WZQA 4P7JA 4PW0A 2B1RA 4ZT2A 3KDPA 4RD6A 3PQ4A 4Z4FA 4QGBA 1WB6A 4DLKA 2E89A 4FMDF 1ZM4A 6REQA 1QRTA 3ZHZA 1PFQA 1SCUB 1XWIA 1QP7A 3KQTA 4H2DA 2ZS8A 3RFVA 1ZIDA 3QVLA 4XUEA 1QLJA 4YPFA 1L8OA 2GLUA 1YZYA 2O5VA 4ARUA 1UIMA 2DQSA 3CZMA 5F1OA 2QG4A 3NUQA 2XWSA 1AKQA 2YC4C 2W2VA 4HYTA 1FDSA 2BP7B 5AW3A 6ABPA 2GEUA 2OTCA 1I6MA 2FHPA 2ZIWB 4G5HA 1KDPA 3W8RA 3OETA 2ZTVA 1P74A 1DFIA 3MGKA 4N5HX 4YA6A 9MHTA 4FGWA 1KBZA 3LY7A 1HE5A 3G8AA 1E1MA 1WY5A 2PZJA 3PUKA 3C7AA 3CNQS 3QKWA 2Z1DA 1ZD1A 4FPXA 4IV8A 3V1YA 4BKUA 4F1KA 1M6VB 4ML3A 5EERA 1GNPA 1GZ3A 4D9IA 2IIVA 3QEOA 1E1NA 1AMOA 1ULHA 1XVTA 2CL0X 4MPRA 4EWLA 2CV0A 1A2BA 2Y0BA 1VJTA 1SUCA 1ZJZA 4U7JA 4ZVQA 4QM6A 5JDIA 1M67A 2FU5C 2CXPA 4I1UA 4XFKA 3QOFA 3VJKA 4OG2A 5SZIA 2ZJ3A 4M1KA 5BRJA 3NH9A 1KZ7B 4IJ5A 4NU6A 3V1UA 1ZJWA 2X1MA 4HFRA 3QX3A 2OYRA 3IDOA 2FEKA 3KZNA 5J5AA 1UADA 4MHSA 1VPDA 3TTWA 1RXWA 4QSHA 1YQGA 1Y89A 2B9VA 4YJFB 1CDZA 2ZFUA 4FGKA 1F6BA 1UPAA 1V16A 2EFEB 3EZYA 3V55A 3H4MA 4F9FA 1H9AA 2K2WA 1W2HA 1Y8RB 2RHRA 2VXYA 521PA 2HMWA 2FPWA 3SXPA 1MR3F 1F3LA 2EJBA 4HAWA 5AW5A 2C4NA 4QQNA 4UBIA 2GPYA 3VNQA 2XRZA 2XCTB 4KKXB 2VF8A 4KPEC 1ZEMA 4YS6A 3FOBA 1J6UA 5EP1A 3VZBA 3LHKA 1Z83A 3B6MA 1E5XA 4MYTA 2XVYA 4Z53A 2W2OA 2HQRA 4K2HA 7ABPA 1ONSA 3QVJA 4EHBA 3FSJX 4OQQA 4DABA 2C59A 3H18A 1XZEA 1P3Y1 4DR7B 4KQIA 1M8FA 1VGRA 1G3RA 2QM3A 2C2WA 2XODA 3QA9A 1KHHA 4QNNA 1J8VA 4BAUA 2VP9A 1ONNA 5JRZA 1L5RA 2IPMA 3TTXA 1WZCA 2P2YA 5DASA 4D5EA 1NVXQ 5HNKA 1X0VA 3GBSA 1Y8CA 2EP8A 1T1EA 4LFCB 4UU8A 1JH9A 2UUBB 1GPDG 3NTXA 1M2VB 2IHNA 1XWFA 1XVLA 3NEAA 4DIDA 4C2TA 4GMFA 3PUYA 4I50B 4C05A 4NU8X 1SGWA 3T5GA 5J9FA 2I65A 1E6KA 2VN8A 2XYVA 2IK8A 4L07A 1UXIA 1YJCA 2H18A 3MINA 1V3TA 4F2PA 4IDBA 4ZHQB 3HUTA 1N5LA 4ISBA 3PE4A 5JYCA 1GNQA 2JH3A 3O92A 5MHTA 2IV2X 3FMGA 5C1OA 3DO5A 4G4SP 1R0CA 3HDYA 5IMBA 1KK0A 3LVRE 4RBNA 2GOYA 3RT1A 4C3OB 5HQ3A 3M4JA 5I7SA 3AVXA 2W83A 3MCAA 4Y2YA 1DKPA 4UPEA 2A9OA 3H5AA 3Q3IA 1M66A 3QQPA 4UEQA 4XX0A 5HMLA 5K0SA 4L7VA 5TRTA 3MWGA 4LJLA 5A3RA 1UZMA 2P91A 4Z9BA 4XDYA 4HT3B 3I28A 3A2KA 2YMMA 2B2CA 2OD7A 5DLQC 2VAPA 4OAQA 4BX2A 4D79A 4HQLA 5CB0A 1ZMOA 3GG9A 4PZCA 1P2BA 4M1SA 4L0DA 1C7QA 5HDQA 4TYYA 4CM3A 3B13B 2P27A 2GCPA 4W9MC 3C7KA 1OXSC 4O59O 1RZ3A 4MRRA 2ATVA 3TJRA 3OOEA 4ZAWA 1KC1A 3VSBA 1JYSA 4CMGA 4D4MA 3GJ0A 3DQQA 3NWOA 1DJPA 3I9V1 4GNRA 4QWMA 1EP1B 1IUOA 1SHJA 4CFYA 3ADCA 1VECA 1HDCA 2D0OB 2NZJA 1ZH6A 3DKPA 3EIFA 4KV7A 4BB6A 4CTNA 2D1YA 3P19A 3GJSA 3FVRA 4I9HA 2B5WA 2WM8A 4X8LA 3TLYA 4C22A 1N8KA 1ZGAA 4U7HA 5AM1A 2F4NA 2XNHA 1CUUA 4JITA 3EWIA 2QXTA 3KQOA 2WJHA 3P5BA 4PGMA 3VKUA 2NX2A 4HGRA 4M0UA 1YR8A 4BO5A 2L82A 2HPHA 3KZKA 1HETA 2G88A 2J9GA 4JKYA 2DHEA 5A71A 1BGVA 5DGCA 5JZSA 1WBDA 4RJLA 1WHSA 1UWCA 3ACBA 1V8DA 5K3AA 2WW8A 4YDSA 5EZYA 4EJ2A 3JD4A 3U56A 1AO3A 2G5CA 2PLNA 4D0GA 4RV5A 2V0GA 2ANBA 3L1UA 1NQVA 3R41A 4MINA 1V41E 1SWWA 3NDPA 1UBUS 1Y5MA 4OQPA 3MQ4A 1OH5A 3ISTA 3IPRA 2C3YA 4TMTA 2P79A 3BGDA 2RC6A 4UDYX 4JODA 2V5AA 2ZVPX 3DMNA 4BGEA 2NT4A 3HCCA 1X14A 1H2RS 2V3VA 3ZY6A 4O4IF 5LBTA 1QG2A 1TEXA 1HYGA 2Y1LA 4B33A 5JCZA 3AR9A 4JEIA 1N78A 2J7PD 2WDZA 5FTKA 3WGIA 1SBIA 4TS9A 1KF0A 1XC7A 1EXDA 4R7GA 3QYAA 4G0YA 4D3XA 5H9VA 4CKWA 3WBKA 1ULSA 4M0MA 4N0QA 3UT6A 4WE3A 2ZUFA 3SBXA 2XWQA 4GRDA 4I4TB 3C1TA 4HDCA 3VU9A 2JCSA 2BKLA 3IEPA 2KYRA 4HFJA 1YQ9A 3PDIA 4PNZA 3H1PA 3WMFA 1KI7A 4LHEA 3V4VB 3DZBA 4H7KA 2Q8QA 3G0GA 4J3NA 4EABA 4B6SA 5F3DA 3DUWA 4M1EA 5I9TA 1N0UA 3TPZA 3CLVA 2BFOA 1JWBB 1DZIA 1NDUA 1L9KA 5EZSA 2WSIA 2OZKA 1R0KA 2BT4A 3PGLA 2DGDA 3QVWA 4H3HB 4BO2A 4DZZA 4NEGA 3ROKA 3AVUA 1TQ2A 5H82A 1W75A 2EW2A 2Z4SA 4JL5A 3T1OA 3H84A 3BIOA 3CWCA 3O8OA 3LKVA 4EF6A 2KPOA 3OCVA 2ZI6A 3FY4A 4JSTA 4O0MA 2BMWA 3GLSA 4OIMA 3VU8A 3VYUB 3W2IA 5BR1A 2J3QA 2P0YA 3LPLA 1U3VA 1X7WA 3TQHA 2OC4A 4QEKA 1Z6YA 5HWSA 4QYIA 1IM8A 3VKGA 5AXBA 3VYWA 3I05A 3UHOA 1L7DA 3AJ9A 2A2ZA 1PD1A 4YN3A 3NRCA 4II3A 5DTMA 3G2KA 5E6RA 5K6RA 2Y0DA 1RZRA 3ORRA 2ZIFA 4IQFA 4N3NA 5IAGA 3U16A 1G8YA 4QEZA 3GGPA 4ENRA 1V1MA 4JUFA 1O7JA 1BGXT 4ABYA 1WIWA 2EFCB 3AUAA 4WN3A 3ZV3A 4AZ3B 4YAEA 3ENNA 4KN8A 3ZH2A 3PYLA 3W7BA 1UDBA 2EJTA 4DDMA 2CLDX 4RHFA 3ON5A 5IDXA 2CE2X 1JLLB 1ID1A 2Q8PA 3P9XA 4PFSA 5IT9A 3DE2X 1QBGA 5A02A 4DA7A 3B53X 4RORA 3RSQA 4H1HA 2V0CA 4RMJA 2W2KB 1SVOA 2O1EA 3A3KA 5HJEA 3QENA 4ITRC 3WNBA 4BO7A 5KU1A 3T4EA 1U81A 2VJAA 1NBAA 3DGFC 3IPCA 3LNTA 4G63A 4N9QA 1R27A 3T94A 5FPKA 2A9FA 3BD8A 5JYEA 1GAJA 1VMEA 2NACA 2FP3A 3I64A 1O4VA 4HDMA 4NNOA 1EUQA 2P2LA 3LQYA 2TMDA 3QUQA 4OGLA 5KWJA 4W1SA 3RUHA 3O4VA 1FMCA 5F2KA 2Y0CA 4RU1A 3S7ZA 3VR0A 2HC9A 3DLCA 3PP8A 1N2EA 2FFAA 4WZBA 1RIFA 2J9FB 4MV0A 4JJ6A 5CLQA 3SYKA 3UMBA 3CX8A 4CM9A 2IGBA 3G7SA 4NDNE 1EHCA 1PJ4A 2Q28A 2Z8XA 5B2FA 3WHPA 2HQSA 2OOSA 1ZP6A 4KWEA 1A4XA 3KJFA 5AVWA 1UBSB 4CMBA 2GAJA 4QQRA 4B6FA 2ZT8A 3OE4A 2VTBB 1FDUA 5DM0A 8OHMA 1JAHA 1TUBB 2CYCA 2QX7A 3QFCA 2D7DA 3EN0A 2ZYGA 1ECFA 2H00A 2PA0A 2PWYA 1P5RA 1B6RA 2H16A 1TMKA 4J7UA 4G0MA 1VPLA 2M6SA 2BM0A 5D3MA 3H2YA 3U7RA 2O05A 3O8CA 4D3ZA 2RB4A 1VFNA 3N0XA 3FDJA 4HEHA 1RQLA 2YZGA 2AX4A 4G0PA 1A7UA 2VF7A 4PLHA 4RELA 5CA0A 3T5TA 3HVHA 1DKNA 1NN5A 1MIOB 3PEVA 2QROA 4MKXA 3KETA 2FWAA 1Q7GA 1X7GA 4NV1A 3U13A 1D0VA 5IAOA 4BGIA 4JP2A 1TQDA 2QSUA 2A3RA 1FFEA 1ZJ4A 2OAQ1 2R87A 1NZFA 2ZRCA 2KHZA 13PKA 1WUTA 3FSGA 4ZODA 5AKYA 5DNUA 2JKYA 4XA8A 5E3IA 2XD4A 4D9EA 1XELA 4KUEA 4HNGA 3ZHSA 4ZIRA 5CLFA 3ADBA 4BFWA 5LQUA 1T4BA 1XX6A 1C30B 4V0RA 5IZCA 3K71B 3H87A 1J8FA 3CUSA 1SHKA 2GN0A 1B1AA 3K0CA 1QAQA 3SHVA 1RKVA 2VHJA 1Y81A 4BDSA 5HJ7A 1UMDA 2HA0A 1SZPA 4LOIA 1SBTA 3VYVA 4ND7A 5CHYA 2OXRA 2IH4A 4B3GA 4YCMA 3W0LB 4YX9A 1QANA 3KFLA 4MVJD 2C7GA 1JQ5A 2IHYA 1TFRA 3CLSC 3Q3HA 5HEKA 4GQBA 1O94A 1JHDA 2WVGA 1CJCA 4QFBA 2AMFA 1W2GA 3DMGA 2E6UX 8MHTA 2VQ6A 2YN2A 1MJHA 2OHIA 2ZUDA 3G59A 3TIIA 3H16A 3OH8A 1KJ9A 4WOKA 4BYMA 2E6KA 2ACWA 3MOGA 2P0EA 2XAUA 3UFBA 4EKEA 4QJIA 4CEIA 2VTKA 3NLLA 1C4KA 1I2DA 3ETJA 2ZJBA 1KMIY 4RDIA 2A9PA 4NCHA 3FW1A 1NFFA 2N47A 4I50F 4JC0A 2AYYA 3TQQA 3D8SA 4NH0A 4C5BA 5AMXA 1VKRA 1ECBA 1DLJA 2CYBA 2HJSA 2ZG6A 2GA8A 5AHXA 4BMZA 1JFTA 1P61B 4KO4S 4LX0A 2G06A 3PZRA 4HGZA 1FP1D 3AFIA 3O74A 3LT1A 4JLMA 2L19A 2VTDA 4HEQA 4RF5A 3WFZA 3HK2A 1AB5A 1KQNA 2NO7A 3MERA 1VA4A 2IYRA 3ADPA 4IIJB 5MFZA 2CHVA 2OUKA 3OICA 3OG9A 1EGMB 5CGQB 1S4MA 1IZ9A 4ZWNA 1U2PA 5SZJA 3H4IA 1JPJA 2EJCA 4MR9A 2GF2A 5EKUA 1NRJB 2AFIE 1N9GB 1U8UA 1WSAA 1NU6A 2FSUA 4QRHA 3TD6A 4AXBA 3L7LA 2ZQYA 2O59A 3QXJA 4H7DA 2PX6A 1U1FA 4A0HA 2PYZA 3QEMA 1G5QA 1V39A 1R8JA 2Q9BA 2HLPA 3E7FA 1ES9A 5ICSA 2AFIB 4MS4B 4JEHA 2B2NA 4C6RA 4Y2SA 2QGNA 3OPXA 1FRFS 1Y42X 4N7BA 3N8DA 2O2CA 5G1NA 1JTFA 3V4ZA 2EBWA 5TQ2B 4DLXA 3P9CA 4HNHA 5GGXA 1DG9A 3IAM1 3AVVA 1L5HA 2W6ID 4E88A 1MIOA 1IYZA 1T4MA 1OKKD 9LDTA 4PC7A 1WETA 1SQFA 2BKAA 1C4XA 1TPYA 2YOHA 1E4VA 1QOQB 3OIGA 2WK1A 1WTCA 2O0HA 2BVNA 3RRFA 4JXJA 2B3DA 1NVMB 3O38A 3VXKA 2C0QA 3VOSA 1U94A 3SG0A 1OAAA 1S1MA 4KYTA 5G41A 1UFOA 3NG1A 3PUJA 3WGOA 3WOVA 2F1JA 4M54A 4E21A 4B45A 5CA1B 5HKBA 3LPAA 3FOWA 3BOSA 3H9EO 4KG7A 5AM4A 2CDCA 4P4TA 1T2FA 4M38A 3REFA 4PYIA 4EY5A 1M0WA 4YR7A 2I6TA 1RPTA 1EJ6A 2F48A 3T5BA 3PUWA 2NSHA 2WTNA 3O47A 4YHHB 1ZISA 1YULA 4YUAA 4PHHA 2QYTA 2G7ZA 2EEPA 3GNSA 2HCTA 3Q0IA 4HLNA 4IZ6A 3DDNA 4JNKA 3WLIA 1XEFA 4CF5A 1C0KA 3S4YA 1HM5A 4EVIA 3BSSA 1RTTA 3QWAA 1YA6A 3EWSA 5T6BA 1E6MA 1OXUA 2Z2KA 4JJKA 4DLRA 2RGWA 3FF1A 1CZHA 3K2EA 3EISA 2QNIA 3GQBA 2GYYA 2AN4A 2F67A 2HJGA 2ZXFA 4P0TA 5JD5A 5CBPA 1UJ4A 4FOLA 1A7AA 1DIHA 2FAXA 1AQ6A 3GB9A 3RUDA 1F38A 3AW8A 3HQ4O 1B0ZA 4MHOA 1SZCA 4RZUA 5DIFA 4P82A 5IM4A 1VM6A 3EIOA 3TSZA 1QHNA 2D2XA 1L5NA 2AMLA 1BO6A 4GPTA 2Q0XA 1DAKA 3ZGNA 2BEKA 5FKJA 2P75A 4MQLA 4N3CA 3BJZA 3ZJVA 4RS4A 3U3OA 2SCUB 1Z0AA 4I9NA 2QU7A 2QMZA 2XUDA 3MB8A 4ROTA 5EIXA 2WKRA 1YIAA 4NATA 3TLAA 1E8NA 1XEWX 2VLIA 3LUGA 1K3TA 1KAOA 2BFFB 3PUZA 5KOIA 2JCYA 1JDPA 1DJNA 2RCNA 3TSYA 4BWYA 1F1JA 1V1RB 2BR3A 1FJHA 2Z1MA 1ACMA 4KQWA 3QX9A 4XB1A 1GV0A 3VTZA 3ENVA 3IJEB 5K3BA 4EKDA 5K8LA 3KR2A 3SU8A 5BN5A 5KIAA 3DVLA 3C8HA 1YHYA 7GPBA 4DCOA 1L4HA 4WBNF 3AO0B 1MPTA 4E12A 4MR7B 3D0RA 4KN9S 3G85A 3QFSA 1U5BA 4Y2UA 2CXXA 3KVOA 4XYGA 5DGTA 4Q47A 3SQMA 4KSCA 3UXYA 5CFQA 2M98A 4KR9A 1QZZA 5K8CA 2IZ1A 4PXSA 5IT0A 4CLEA 4LCBA 1N2CB 4J90A 2PH1A 3KHUA 4KC0A 2FP4A 3ZLVA 3GMTA 3NCTA 1LV7A 1MX9A 4B3RB 3LPMA 3NHMA 4O8ZA 5ENDA 2Q1UA 3AVPA 4MI1A 2H11A 3L7AA 4UPDA 5EKDA 1CUHA 3EB9A 1N8NA 1MH1A 4WK4B 2C9ZA 4WK0B 3PFKA 4EY4A 2J4CA 3WLTA 1F8XA 3GMIA 3N7AA 4HDSB 1UOOA 5DXFA 2R1TB 1TJNA 1E9CA 2AGVA 3OCUA 1A7KA 2ZU6A 4RH0A 2C92A 3SDSA 5C8YA 2XCIA 4DPKA 1C29B 3MAGA 2EWVA 3BJMA 4F9EA 3O03A 4BP8A 3F2IA 2ZSDA 3C5EA 2O3RA 2XHZA 4JJFA 1FDOA 3Q87B 1E18A 5DMXA 2A57A 2ZLBA 5AM0A 2BFFA 1ZD2P 5IT4A 1GUDA 2YWDA 1D07A 3DEKA 1MT3A 3PB3A 1OX4B 4JJ4A 4LCEA 1Z62A 4J91A 4BTVA 1X9HA 1UEIA 3HKCB 1U0TA 3WLKX 1OI7A 2ZBUA 3A1EA 3LCJA 4P3KA 1EWTA 3HU2A 3HABA 3OZGA 4ZCMA 1OWOA 4DQ0A 9GPBA 3F78A 1PDWA 2F8LA 1RM3A 3ITKA 1GL3A 2VJNA 2D62A 3I52A 3D5EA 3GA5A 1P6XA 3LL7A 3N2KB 3GXOA 3N6XA 3HN6A 2X58A 3DH0A 4DR6B 3EA5A 1USGA 4U4AA 4ZJUA 2XUPA 3MTEA 3U9SA 5KAMA 3L7YA 3LGAA 3L43A 4GPD1 1QV9A 1NVUQ 1XTUA 2RFLA 1KVSA 3GNTA 3EXG1 4H0CA 1XZMA 1P2VA 3GRYA 4YJGB 5DTJA 1X2BA 4RTOA 2G6BA 1P5FA 1EWYA 3MZ0A 2BW0A 1NJFA 3KSBC 5LMNB 3GUUA 3SX4A 3AKEA 4KDEA 2OKGA 1E96A 2O1SA 4PNPA 2V55B 1D4OA 1D03A 4FHFA 3SPXA 2YRWA 3SXUA 3O8QA 4ZANA 3D3EA 1B76A 1BNCA 1NW3A 2Z5FA 5CFLA 2WG0A 3HJFA 1H8ED 1JDZA 1NTOA 1JG2A 1RMYA 4GZMA 4CT5A 1WLSA 5I48A 3UVEA 2KLBA 2IYEA 2CVHA 1TTTA 3L0IB 4YJ2B 3CZ5A 2CUTA 3S7TA 1L5ZA 2ODAA 3EGXA 3MW8A 1KPHA 1IZYA 3HS3A 3A1WA 4KQ2A 2PK3A 2DR0A 4XM1A 3CN9A 3H9JA 4ARSA 1ZRMA 4RKFA 2Z9BA 4LNHA 4I4NA 4IHAA 4D41A 4ZDJA 3WL8A 1NBHA 2Q0HA 3G0OA 3RD5A 3G2OA 3K16A 4MCJA 3NBFA 2QGFA 4XLTA 4B31A 1DQPA 2C7PA 2MSLA 2I99A 4MVJE 5KKAA 5AVXA 4OUKX 5LQAA 2FW1A 5FNZA 3R9KA 2BGUA 3V8QA 3EXHB 5JFOA 3OZSA 1V37A 2F8TA 3AJ8A 4O2BB 3A1DA 4KQHA 5B4TA 1XNQB 3IQZA 3FPHA 3HO1A 4LYFA 4OGKA 4GLBA 4UATA 1H2EA 2CD9A 4HYEA 2R86A 4ZVTA 2ID7A 1BVUA 4ZK6A 1W5BA 4R1SA 2AFIA 2PQ2A 2W2LD 4MS4A 1JECA 1C7EA 4N65A 4EG6A 1O6CA 4F2HA 1XUOA 4KJZA 3KWFA 3MJCA 1Z88A 2AR9A 3EDMA 5CLIA 4CUKA 3NORA 1VBMA 1JAXA 3JALB 4LBVA 2UZ0A 3L0OA 3MINB 3VDNB 3MUNA 5ECDA 1AUOA 4IIHA 3FPEA 1DC4A 1P8AA 4BVFA 5WRFA 1DQZA 1SRQA 3MS4A 4CM4A 4RDXA 1BKSB 5IUJC 1NQ5A 2BMDA 4NEHB 1GRRA 4WD3A 4QLOA 5ULLA 3J81A 2F4VB 5IW8A 4BJ1A 2A67A 5GZ1A 5KTNA 2A33A <