3LY5A

Ddx18 dead-domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
211
Chain Sequence
TGAFEDTSFLVNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DDX18
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 211
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ly5A00
4WIAA 3PQCA 4M22A 2O8DB 1YQTA 1KI1A 4YMWA 2WWXA 4A15A 1OFTA 5DYGA 3SR0A 5CLLA 2KWIA 2FV8A 2ODWA 2FU5C 4PX9A 3CNNA 4L15A 1NMXA 4Q1DA 3EIQA 4DJTA 1KO1A 3GEHA 3QPUA 4TN1A 1FQKA 1KK1A 1XCGB 4PC2A 4YXWA 4C0JA 1IHUA 5JS7A 5DNYB 1G20E 1BIFA 1JR3D 1ONBA 1R5BA 3R20A 3ZVLA 4C0AC 3KFVA 4B75A 4CEHA 3SQXA 4GRAA 3UANA 3I5YA 4PZYA 1XEWY 1E9EA 1G64A 4V0KA 4DUGD 2ZYTX 3O8BA 4O2LA 3OEEA 3F5FA 2IWRA 2ZJOA 5FPYA 4ZKEA 3K0AB 4DDUA 4DT1B 2G3YA 5JEDA 2NGRA 3L8YA 2B8WA 2VA8A 1Z0JA 4K8OA 1NP6A 2W6ID 1U9IA 3BAFA 3H1TA 1FZQA 4LV8B 1OF1A 4Q7MB 3WNBA 4FMCB 1MRNA 1NMYA 5KOYA 4L5BA 4P4UA 5JJKA 4BLTA 4Z51A 4A0RA 1T8UA 1A1VA 4RJLA 2XITA 1OB5A 2VTKA 1QHHB 3EZ7A 3WMFA 3KKNA 2QTVB 1G8FA 1LVGA 3LAWA 2OAP1 1CLUA 1HTWA 2YC4C 3DO6A 2FWRA 5G40A 4HI0E 4XOIA 1A2BA 2GVDC 3W3ZB 2J7PD 3SBDA 3OIYA 1G4UR 1ZNWA 3LVRE 2QAGC 2Q0HA 2IYRA 5JECA 5L3VA 5D3QA 2DCUA 2KSQA 3EARA 5DLQC 1XMJA 3ZVNA 1GAJA 1XTJA 4LYHA 4QBFA 3TUIC 2BDTA 1HT1E 2BCGY 2RCNA 5KPJA 2CVHA 4WZAE 2ZS9A 1KSGA 3EG5A 2IS6A 4A0HA 1CF4A 2Z43A 5K8TA 2BBOA 2IF0A 1GNRA 1IY0A 4W5JA 1J99A 4NE2A 1X86B 2A5FA 3PFIA 4OHYA 4LDJA 4TYNA 2F7SA 2GESA 5D3MA 4DEYA 1EX6A 1Z29A 3JZAA 4AIIA 4Q9JA 3FMOB 3F8TA 4XVRA 4YONB 5FBLB 3IO5A 4QXAA 3C15C 2WWIA 1J7KA 2IHYA 1DAEA 4HUQA 3RSLA 3W8NA 5SZIA 3VAAA 2GVZC 2ZE5A 4QBHA 5EP1A 4Q4JB 3P32A 5HPYB 1WMSA 3PUZA 3CX6A 3EC2A 3RNLA 4B3XA 3ZD7A 3PUXA 1EFCA 1HQCA 1QVAA 2CJWB 4QGAA 1H8HA 1CIPA 4G01B 1SXJC 4Q01A 5CM9C 5EP4A 2YINC 2WWGA 3OIVA 1ODFA 2ODNA 4OQFA 4DEXA 1ZNXA 4Q1BA 2DY1A 1P4SA 2CNWD 1S1CA 2OUKA 5FFMA 2IYLD 2HF8A 4TMZA 1GRQA 4JBYA 4CT4B 5AUOB 1F2TB 1FMLA 2HLDA 3EW9A 4W5HA 3K9GA 4C9BA 2AL7A 4W5WA 2BV3A 1GILA 4WBSA 3X1ZA 2OCBA 4OKSA 1CJUC 3ZD6A 1N6IA 1KDOA 1NRJB 4LPSA 4AYWA 3EIEA 4LHWA 4R71A 2GK6A 3IIMA 4OJQA 4UNQA 2G88A 2YWGA 4RD1A 2JJ1D 3QKSB 5EUMA 4OHZA 3U44B 4GL2A 3QQ5A 2BEJA 4QM6A 4AG5A 1GP2A 3CWZA 4B74A 1W47A 4RD0A 4GBMA 3K0CC 2ERYA 3KUCA 3QJYA 4BLSA 4GOXA 5BN4A 3EAQA 1GL9B 1N6OA 4DSNA 3VHLB 4PSVA 1ZM4A 2NO7A 2ZRDA 4LBWA 4KYIB 3DMDA 2C2HA 5L3SB 1MKYA 4QOSA 5ANRB 3QXCA 4RSGA 2VPPA 2ATVA 1CJTC 4G5GA 1ZU5A 1X8JA 3R7WA 4P0TA 2GNOA 2ZROA 2X2FA 2D06A 3KFXA 1NJFA 4TT3D 5FTNA 3TSZA 4B3DA 3WXMA 4EQ6A 2P65A 2WSMA 1OH8A 2PMDA 4BEBA 2JLRA 1DEKA 2HXYA 2IYXA 4M9QA 4H1VA 3PEYA 1W4CA 2ZPTX 2YOFA 2ORIA 2B6HA 2NZ8A 3CRQA 3QKRA 4LJ5A 5FOSA 1A82A 1CEEA 2H57A 4NCNA 4ESVA 2CK3D 2EU8A 1TUIA 3PVSA 3I8SA 1KI7A 4ZO4A 3W5IA 2I1VB 3ZVRA 3K0EA 4FINA 1R7RA 4ZDWA 1IN7A 5GVSA 3MG9A 4UJ3A 2WJJA 1FW6A 4ARZB 1AS3A 3MMPA 1VG8A 1N0VC 2ZJ5A 5AJZA 4Q9HA 4ON9A 3B7GA 1QHGA 2IBMA 3CZPA 1E1QA 1P2VA 1ETUA 1KTVA 2AK2A 3CB4A 3ECCA 3OEHA 1QG2A 5DN6A 5FL7D 1VECA 3K0AA 4DT1A 2R6DA 1P62B 1G7SA 5IF9A 1NLZA 2HCBA 4QHTA 3E5HA 3CF0A 4Q03A 2BMJA 3L0SA 1E99A 3JZMA 2ZRBA 3I62A 2A3RA 1EFTA 1WRBA 5LDDC 4I99A 1MO6A 4GI7A 1G16A 4TL9A 1EGAA 1KO5A 1UM8A 3W3AA 1QHHA 2Z4SA 1XXHE 1V43A 3TUJC 4LGMA 1GRRA 5KDLA 1RRCA 1E2FA 4HB2A 4PC1A 3PR1A 1GKUB 5UKDA 1E9RA 1U99A 2P6UA 4D4KA 1RFLA 5JRZA 5JJLA 3EA5A 2C8VA 4TL6A 1RVDA 3LX5A 4RD2A 2IYSA 2WAXA 1GFIA 4Q19A 2PBRA 5G41A 3LBNA 4QBGB 3SC3A 1U0HC 3TNFA 3KXKA 3TR5A 1NBMA 2XTNA 4KVAA 1TF2A 4TLBA 3QF4B 3GJ3A 5DE3A 4JLVA 2RGEA 1QRAA 1E2NA 2XNSA 3QE0A 1VCMA 2LWIA 4IW3B 2NMVA 1BO6A 2WIAA 4M21A 3AKCA 3A8TA 2ATXA 2IX3A 1RW4A 2ZRIA 2BBTA 4JVNA 3B60A 4LOAA 3RWOA 5EE3A 5E7MA 3KQUA 3FKSD 2V1XA 1FNNA 1YZKA 3MD0A 4KAXA 5IK2D 1XDBA 2BOVA 5HE8A 3I5XA 2GJSA 3QG5A 2ZUBA 4Q4JA 3TSOA 4O25A 1CU1A 3B8HA 1IM2A 1WE2A 2O0JA 2CJWA 1HEIA 4PC3A 2NOAA 4KO8A 5LB2A 4EJSB 1DAFA 1XF9A 1E79A 4JJKA 2WWYA 1AKYA 3RS0A 4BGDA 4E5UA 1T4GA 4IKEA 4ZKDA 4MYUA 4NKRA 2FFHA 4M1SA 4RD6A 5KSZA 5HE9A 2AFIE 4C0BA 2J0SA 4NU0A 1W36B 2XSZA 4PHFA 4M9SA 4RVCA 5J47A 5K8UA 1X8LA 1FUKA 4E22A 1EESA 2L0XA 3FMPB 3TVDA 2QAGA 1IOZA 4BLOA 2R44A 3T1OA 3AF2A 3D3QA 3GJ8A 2QY9A 2QG6A 3BJIC 4S35A 5KSOA 3QKSA 3U44A 2IYUA 1CJKC 1SVWA 2A2ZA 2ZRGA 3LV8A 1IONA 4TTRA 3B2EA 1VIYA 4JLOA 1UBEA 1CS4C 5FPTA 2AR7A 5CDFE 3Q5DA 4W7SA 1II8B 1CTQA 3K1JA 3MWYW 4TMWA 1KYIA 1E9BA 3CF2A 2WBLC 2JASA 2ZRNA 2IW3A 3B1WA 3FB4A 3H4MA 1OXXK 1N3BA 2B7BA 1FFHA 2QGZA 3A1TA 3KJIA 4MRNA 4QGGA 4US1R 4XIGS 3UMSA 5L3SA 1R5OA 3A1UA 3ZVMA 2MSDB 3TQCA 3B1VA 5J4VA 2XNDD 1GDDA 4JVLA 4KXFB 1ZJ6A 2GZAA 3UK6A 1Z83A 4LJAA 4RFVA 4EPYA 5KNBA 2P67A 3T1QA 5FBWB 2YVUA 5KDDA 1NBME 4MDEA 1EFRD 4HYYA 3A1VA 2F3TA 3OAAD 3BFKA 2PMKA 4TSFA 3GJ6A 1SXJA 3RSOA 3SJAA 2GA8A 4YQFA 5EXSA 4C7OA 4YMUA 3EPKA 2BVNA 2OBLA 1VTKA 2ZI4A 1FL9A 4Z1MD 1E9AA 1KI6B 1NKTA 1PZNA 1U9IC 2F1IA 4FMBB 2Q3MA 2OXCA 1AGPA 1HY3A 1U94A 4B6EA 2G0NA 3LFUA 4GMXA 5AUQA 5TB5A 4ARZA 1DO2A 5FPKA 4ZDIA 2QL6A 2IS2A 2FFBA 4CRWB 1LB1B 3S1AB 4TYQA 4RKFA 2PCLA 2OFXA 4DLTA 4KV9A 5FBVB 4D4MA 3KQNA 1SVIA 2PX0A 4V0OA 2HYDA 1P7CA 3K70C 3EWAA 3B9QA 3KKPA 2MMCA 3GCGA 4QFMA 2ZRLA 2X8AA 1OJLA 5JS8A 2BM0A 2UZIR 3CIOA 1XD2B 1KK0A 2WKQA 4KFTA 1FUUA 1UBCA 1OYYA 1Z08A 5KSPA 2W6JA 1FP7A 1XWIA 4QJ3A 1LNZA 5J4YA 4IDHA 3ASZA 1DOAA 4HAWA 1KO7A 2WHXA 1UDXA 4E07A 3QSYA 4NYJR 3U3JA 1DARA 2ZRPA 4D26A 4MGIR 5GJBA 1SGWA 2JA1A 2ZU6A 3GFOA 3VR5A 4ZI2A 4KSBA 2W2VA 1G7CA 3CPHA 1W4RA 4X8LA 3D6TB 2ECKA 1OSNA 1X6VA 1KSHA 2ZYVX 3G82C 5TY0A 1N5LA 1DPFA 4KFRA 1ZCBA 1OHHD 1T6NA 2DWOA 4L4UA 4KJZA 1OXVA 2FFQA 3W8RA 4Z54A 1T3HA 1M7BA 4Q1FA 1Z63A 3AVVA 1RE0A 4C3ZA 2F43B 2GAOA 3SJZA 3QBVA 1F6BA 1W48A 4LHYA 3AV0B 1JI0A 2RAPA 3O47A 4LHZA 5L3RA 2JLWA 4X8HA 3M4YA 2YWEA 4HLCA 2C98A 4FCWA 3T1TA 2WZQA 5GJCA 1U81A 1JR6A 3QVVA 5G3YA 4A2WA 2ZM5A 3MSXA 3WMGA 2FPMA 4DZZA 4XJXA 4PPFA 3KL4A 2B21A 2FX3A 5SZKB 1S96A 1UFQA 2H92A 4H1UA 5TARA 4C4PA 4KCGA 2HV8A 2J41A 3FFBA 1Z8FA 4RZUA 1AJEA 2YV5A 4O2RA 2AD1A 1YZUA 1XFAA 3A37A 2OLJA 3PJRA 2QAJA 4JLAA 2ZU0C 3WYFA 2OHFA 1W49A 1Z5ZA 3B78A 1Q1BA 1SXJE 5KTYA 1RRFA 2NO0A 4HZUB 5BN3A 5KUTA 2GEUA 4CT5A 3GFTA 4G5OA 4OJKA 2QBYB 4EJSA 4TYYA 2YWHA 3IO3A 3K53A 1SKYB 4GOKA 1N6RA 1NN0A 1G291 3HU2A 2X77A 5H68A 1NJGA 1UEJA 2X1VA 1JECA 4PAQA 3NEYA 1AN0A 2XTMA 4ZV4A 2TMKA 2WSSD 1G8GA 1S2MA 3L0OA 1UKVY 3LX8A 4Q7JB 4GZLA 3CH4B 3T34A 2XOKD 1KI8A 2R6AA 1AQYA 4NYMQ 5JWRA 2GDJA 2BMDA 3R9WA 1JPJA 4WVFA 4ZPXA 3DKPA 4HAYA 2IA5A 3MCAA 2PLFA 4JLMA 2WKPA 5ELXA 2AHOA 1MT0A 3VMFA 2ZJBA 4LI0A 4C0HA 5B57C 4HSEA 1H8ED 2ZE6A 1X1SA 1COWD 5IHPA 1QF9A 4HDCA 1HE8B 4JZKA 4YMSA 4OI4A 3BBPA 1II8A 3AVWA 5EXXA 2IEZA 3ZQJA 4BQSA 1SULA 3AKYA 1L7VC 4JYBA 1UEIA 2R2AA 3AP2A 4B3CA 2O8BB 3MWKA 3EC1A 1P3JA 1W4AA 1KZGB 2JJ8A 3DM5A 4LRWA 4Q4AB 3NKVA 1GUAA 2J46A 1ZC3A 2FDCA 4M8NE 1S4QA 2ZYUX 3FWYA 4MKHA 3CKLA 4PPQA 4IXMA 2XTZA 1T91A 1GITA 4R2IA 3QG1A 4MUAA 1D8TA 3TSWA 2RHMA 5J4HA 3HR8A 2RGXA 4UJ5A 1LV7A 2CL7X 4NBSA 3V9PA 4DLXA 3A1SA 4P4SB 2QMUA 3L43A 1OYWA 2B92A 3VX4A 1I4TD 2WPDA 5DI3B 2ZSAA 5H70A 1A2KC 3SN6A 1MOZA 4B44A 3ADCA 4V02A 2JLUA 4MYCA 3WY9A 4FWTA 2XEXA 1JXMA 3JVUA 3VU9A 2KBFA 5CYPA 3AF4A 5E7JA 2ZSEA 2EWVA 2LKCA 4BFYA 1TQDA 1IXSB 2IXEA 1CR2A 2WWWA 5EJEA 3B6EA 2VSXA 3RRYA 1JBKA 1ZUIA 4LYFA 4JL5A 5EE5B 1DAHA 2ZI3A 4NYJQ 1N6LA 1NKSA 2J0UB 1DAMA 3Q5EA 1WBDA 1Z47A 3S1AA 4M1WA 4CGZA 3ZIAA 2UKDA 2IF2A 3FMFA 5KNCA 4URZR 5HZHA 1MABB 4TMTA 4YXWD 4UXJA 4JL8A 4NCIA 3O8CA 4IEEA 5BQ5A 2H1LA 1XTKA 3G5UA 5JZVA 4XSGA 3W6NA 2PZFA 3V4FA 3KDSE 3K0FB 1Y63A 2C9CA 2IUTA 3NIBA 1XD8A 4FCVA 1DADA 2RGNC 4II7A 1ZCAA 3BH0A 3RVBA 1TQ4A 2A5YB 4PANA 2WOJA 2NIPA 2JLSA 1J90A 4OI0A 5J4KA 2GWHA 3OESA 1ZIOA 2BBWA 2ZXUA 1KAOA 3DZDA 3MFYA 4XD7A 1SZPA 2A7QA 3GEIA 3RS5A 4U7DA 1TQ6A 3K70D 1IAQA 2PJZA 1NL3A 3AP1A 4RCZA 4KFUA 3CPJB 3X2SA 2F43A 2Q9CA 1N0UA 2QM8A 3OE7D 2Z6VA 4HLUA 4E03A 5KYKA 5KPDA 4QC2A 1N6PA 1NSFA 1W0JA 1G17A 4R9UC 1P9WA 1TL7C 2XGJA 2J59A 4JLJA 4URWR 1E6CA 3P4YA 5DH9A 1AGRA 2ZI6A 2X2EA 2P2LA 3SBEA 3N2IA 2QZ4A 2F55A 2ZIAA 2H17A 4N3NA 4DCNA 4DC9A 2AXNA 1M2OB 2IYTA 2Q6TA 5LB4A 2Q21A 3A58B 4QNRA 3C4JA 3NHAA 3PUYA 4CVNA 1G7RA 2GXUA 3UG6A 1XU4A 1E0AA 4B3BA 4FI3C 5JSZB 3CRVA 2FEMA 3BC1A 4BFWA 1Q20A 4DLRA 4JLBA 5DGXA 5AJXA 2N46A 1NLFA 3HWSA 3BFVA 3NXSA 4RZXA 2QBYA 1JB1A 3RLFA 5JWHA 1BS1A 1ESMA 4B2IA 3BE4A 1R0YA 2GJ8A 2IYVA 2CL0X 1QHSA 4BFUA 3DPUA 3PG5A 1G5TA 4ITRC 2CCKA 3M6AA 2Q9AA 2WJIA 3AKEA 2ZTSA 1K8RA 4G5QA 1KMHB 2BCJQ 1H8HD 1W7AA 1PLLA 3UWKA 3QBTA 1AS0A 2A78A 2QPTA 1Z6GA 3OFNA 3ZZUA 2C95A 1E0JA 1MRSA 4R7ZA 4DCSA 4NH0A 1TNDA 2ANBA 5FTKA 3LBIA 4OL0A 3V00A 1X8KA 2DHRA 4CIDA 2NO1A 4DIDA 4IOMA 1G8PA 5GJVC 1GKYA 4LHVA 2HLDD 3ND8A 4URVR 5FUVA 2EFGA 4OQLA 5FUWA 4EUNA 5C1BA 3C8UA 3P1JA 4NL4H 4DXAA 1KK3A 4P33A 3LO5A 3GEEA 2Q3HA 5EP3A 3KX2A 2BKEA 1LS6A 2OT3B 4FMDF 4Q66C 3RS7A 1TTTA 1N5IA 1W0KA 3Q85A 1WB9A 1OFUX 4CEJB 1GL6A 2DB3A 1VG1A 4B35A 1KI4A 2QP4A 2PL3A 3UMRA 1KAGA 3EPHA 4RFSB 3UPUA 2XB2A 3K9HA 1OLOA 1YJ5A 4RY2A 2OBNA 1BYUA 4A8JC 1OKKA 1DS6A 1EX7A 3DL0A 4URYR 4TQAA 3UG7A 2G83A 1OFIA 4BFZA 1FTNA 4G5SA 5AJVB 2ZSFA 5L8VA 1Z06A 1LFDB 1KKMA 2EFCB 3IHLA 4XSHA 3LXXA 2WJGA 4HAZA 3SYNA 2WKRA 1R8SA 3RYTC 2J9RA 4P4SA 3ICEA 2YNMA 2DWQA 4XWOA 1Z0AA 5DI3A 3RDPA 3C41J 5DSZA 1VIAA 2DFKB 1PLJA 4PO9A 4CYMA 1WBBA 3TUZC 4GNKA 3K8YA 3WP0A 2NG1A 1EFUA 3GD7A 3QXXA 1MO4A 4KLZA 1FX0B 1FOEB 4OQXA 1HE1C 1R4AA 3IEUA 1IN4A 2ZE7A 3FKQA 3NBXX 1N2CE 4YDSA 4BASA 5SZJA 4DB4A 1O3YA 1GKIA 1ZM7A 2J0UA 3ZQ6A 3OF5A 421PA 4D25A 1S3SA 4WXRA 4B76A 1SHKA 4LUCA 2E1RA 4BUJA 4B43A 4CZ2A 1HH4A 2R8RA 3CPEA 3Q8XB 3RABA 4GP6A 3CM0A 1ZNYA 1PV4A 1P60A 1KI9A 5E95A 4IVQA 3CH5A 5B64A 1T5LA 4UKDA 3CR8A 2REXB 3THWB 1DVRA 3IBGA 3A1WA 2OSBA 4YLGA 1SKYE 1SVSA 4TLDA 4D6PA 1RJ9A 1E1QD 4KSCA 2MSEB 3B9PA 3FYHA 3OEHD 5DN6D 1MH1A 3K0FA 2FH5B 4NDZA 3GJ7A 4QM7A 2C96A 3HR7A 4HATA 4WW0A 3AUYA 1KJZA 4C0KA 3BS4A 1AKEA 1E4VA 2GEDA 3RAPR 2ASEA 1KKLA 4A92A 4K46A 3U3OA 3WYAA 4BECA 2O8DA 121PA 4IDOA 2IUUA 3TBKA 3VX3A 4A8JB 3ZS8A 3WHLA 1RZ3A 1KO4A 4A9AA 3N2EA 2P0EA 2IT1A 4R98A 3T5GA 2JATA 4TLEA 3FHCB 1DO0A 2P5TB 4LBZA 5BW8A 3H86A 1P61B 3U7FB 3D31A 4DLWA 4LK2A 1Z0DA 3EPLA 4MGKR 3NEJA 4RZ2A 4TTQA 5A4JA 1TU3A 5JI2E 2JLZA 3CUEF 521PA 3NC0C 2OCPA 5B58C 4JYCA 4V0LA 3CBQA 3VTKA 4CEIB 1VKJA 1XJQA 1Q1ZA 3ONWA 3P26A 4MGZR 4AKEA 2WTUA 3LW7A 3GJXC 3VR1A 4NYIR 3TE6A 3EASA 1XX6A 2JJ2A 1DAKA 4EJSC 2BIFA 2J0VA 1WP9A 5C2JB 3KB1A 2VSOA 1CXZA 2OFWA 2CXXA 2REBA 1DG3A 4DCTA 5KO2A 5F9HA 1XP8A 3IILA 3AGQA 4HAVA 3PV0A 1R6BX 1P2SA 3H0KA 1Q21A 1Z3IX 3WYGA 3F0TA 1ZC4A 2JAQA 3L0PA 4LJ9A 5FTJA 3GLGB 1W36C 3VR4A 2BMFA 3FHTA 1PUIA 4MITA 4CF7A 4EFNA 3O8DA 3U7HB 4PSAA 1Z0IA 1VHTA 3GLIB 3FPAA 3AGPA 3HP1A 4L16A 4L8GA 2OAQ1 2VP4A 3UMFA 2QSYA 2RGNA 2G1JA 1Z2AA 1KMHA 4D82A 1XEWX 2CDNA 1HQYE 2V7QD 1M7HA 3FHOA 2ZR9A 3VR2A 3PUVA 4FCTA 5FPSA 3K9NA 3I4LA 4B71A 4MRPA 2QNRA 1U8YA 3MJHA 5GADl 5GVRA 4MQBA 2RMKA 5FBQB 2CLSA 4HB3A 2XSZD 2PEZA 4JVMA 4MYTA 4DLSA 4LJ8A 1ZRHA 2A9KA 3M0EA 2GBLC 1DE0A 3SZRA 5JLJA 4NCJA 4LC1A 2AKAB 4LJ4A 1CULC 3QEJA 2IUSA 1YZQA 4JL6A 3QKTA 3SYKA 1OXSC 1P9RA 2B7CA 2EYUA 4OHWA 4QHSA 4TMXA 4A6XA 4F93B 4O0MA 2GCNA 2FMXA 3BB1A 5LBIA 4CEJA 3VKWA 4WZ6A 4LBYA 1XMSA 2GRJA 3AVXA 2OO7A 4DDVA 1D9XA 3I92A 2GTPA 2ZITA 3MUFA 3KQLA 4BPBA 1Z22A 3BK7A 3SJCA 4YMTA 3T12A 1XB2A 2E87A 2QT1A 2JIZA 4DCUA 3LY5A 1E2KA 2CBZA 3CLVA 4IOJA 3ZDQA 4EPWA 4KBGA 2IL1A 2XXAB 2GETA 5KSYA 4GZMA 5C18A 2QM7A 1ZP6A 3HJNA 3THYB 2CMKA 3KJEA 1LW7A 1F2TA 3EX7C 2WWFA 3DOEA 1VHLA 1YHNA 2W2XA 2NQ2C 3WNDA 2RKOA 3QENA 1GZSA 4UNRA 2QGNA 2OLKA 4URXR 1GRNA 1CR4A 1OIVA 3U2QA 3LRPA 4IDPA 1E9DA 4B32A 3U4QB 3BERA 2GXSA 2C99A 2ZI9A 1EXMA 1XNJA 1G5RA 4MUBA 4WOPA 4TSFD 1JNYA 1SXJD 2BJWA 1LF5A 3CWQA 3DVLA 2J7KA 3AB3A 1R0ZA 3SOPA 3AKDA 3C5CA 4AI6A 2JEOA 1HV8A 1W1WA 2ZJAA 3KKOA 4ZDJA 2GZDA 2FSGA 4KBFA 4YDHB 1RKBA 1G6OA 1M6NA 3NBZC 4A0FA 1U2RA 3RS4A 1I2MA 1A4RA 5IK2A 4NYMR 4FXPA 3KQHA 1US8B 3QEOA 1MV5A 1KHTA 4IXNA 3IEVA 2ZE8A 1M1YE 3TR0A 1KIMA 3THWA 4JT2A 4LX0A 5FPHA 3BB4A 4KYUA 3U6BA 1PVOA 5FR2A 1ZBDA 2VHJA 4B6FA 1E94E 2QN6A 5JI3E 1E9CA 2QORA 1XPOA 3ZGXA 1G19A 3D7MA 1AQUA 4LYAA 1XTSA 2R9VA 3Q9LA 1L4UA 2CEAA 1E98A 3SDZA 3SS8A 4EKDA 4QGFA 1UBFA 4IFBA 4Y0VA 4F92B 3RC8A 1G3UA 4PQFA 1CKEA 3DZ8A 3DHWC 1KDTA 1G4AE 2A5GA 4HLUC 4BZPA 2XZLA 3F3YA 2IXFA 2VL7A 4FMDB 4W9MC 4UNNA 4A8JA 2N1BA 2XJ9A 4DSUA 1KZ7B 3I73A 3KXIA 1TX4B 1CRQA 1ZUNB 4NYIQ 1AIPA 3U5ZB 4QJ4A 3UWOA 1E3MA 1E9SA 1BH2A 3VR6A 4P3YA 1J8YF 4QL3A 5J4LA 2RGBA 1IQPA 3AF1A 3NVAA 2ODEA 2RHDA 2H7VA 4ZIRB 1KOFA 1OXTA 1WA5A 1JEEA 1J2JA 2NTYC 5L3QB 2E9SA 2QROA 4EPTA 4FN5A 4A36A 3BIFA 3NC1C 2VHCA 1E2IA 5A0FA 1UF9A 2YOGA 3B13B 4CEIA 2DBYA 4HEJA 2FSIA 5TMPA 4M0LA 3UXMA 4EPXA 2A5DA 1Q57A 4UNPA 4TTPA 5E7IA 4LJYA 4AK9A 1OPXA 2XZPA 4A82A 1W5SA 3CONA 1DELA 4DVGA 3E2IA 1CR1A 1G3QA 3C16C 1YKSA 4PAOA 5H8WA 1QHIA 4ASUA 2R6FA 4C2UA 2V3CC 3BORA 3ZS9A 1N6HA 4U00A 1NG1A 3T35A 5JWOA 1MR3F 2J1LA 5EE1A 4PO1A 1TPZA 3TKLA 3PXGA 2VO1A 4M1YA 4HB0A 4V0MA 2BEKA 4TZ6A 1K6MA 3GLIA 4Y0AA 4OI1A 4OHXA 1S0UA 4IVRA 3EIHA 3LNCA 1T8TA 4WA7A 3RS3A 4KI0A 5AUNB 1GG2A 4TWZA 4Z1MA 4ABYA 1AZTA 4HAUA 4PHHA 5AK0A 1UDWA 2AK3A 5A5GA 1P2TA 4F91B 1C9KA 3QF4A 2HT1A 1U0JA 2IS4A 1U98A 2JDIA 3CZQA 4Q00A 1E2QA 2RGDA 1YZNA 2CL6X 2G77B 3AVOA 4UXIA 4DDWA 1DG1G 1BMFA 4ACBA 3QXJA 3AP3A 1Q3TA 5KHOC 1Y3AA 2WVJA 1W36D 1OFHA 5LD2B 2RGCA 1W2HA 2J3EA 2GCPA 4LJ7A 3SQWA 1PUJA 2NO9A 3AVYA 1NVVR 2FJUA 4TLAA 5EP2A 4PTLA 2EFHB 1BOFA 2X19A 2WJYA 1SQ5A 2GJKA 1G5PA 1P72A 3AQ4A 1YZGA 3WP1B 1UJ2A 3HPQA 5FUYA 1ZW6A 3BH7A 3VHXA 3VNUA 5E4FA 5HKKA 1Q44A 3W9YA 4JIMA 2V8OA 1W4BA 1OW3B 1R10A 1QHXA 2QPOA 2W00A 4LYJA 3BH6A 2DR3A 2OESA 4I1OA 3LBHA 2XXAA 3NG1A 1WQ1R 3I1FA 4PZZA 4HUTA 2W2TA 2P3SA 2VP9A 1N0WA 1NLYA 2C78A 2VLIA 1IN5A 2ZJ2A 1D6JA 3TAHA 2O8EB 4KODA 2R65A 3WRXC 5DYIA 2FPLA 2KBEA 2NPFA 4GFDA 1JALA 3CRRA 3PUWA 2HUPA 3Q7QA 2WMOB 2KE5A 3SU8A 4Q9IA 3U4QA 2VRWA 4GT1A 2WV9A 1L4YA 2VQSA 3GMTA 2FNAA 2WPDD 2OE2A 4AC9A 5CITA 2PH1A 1B0UA 4JLNA 1TMKA 4LJ6A 5FTMA 2RH5A 1KGDA 4D0LB 3HYRA 2QRZA 5DISB 2C9OA 1G3MA 1VYTA 3W34A 5IDVA 2PZEA 3W5JA 1YZLA 1WCV1 1QG4A 1P2UA 2W0SA 3QOFA 2GBLA 1T3SA 1V5WA 3QXHA 4JKYA 3GLIE 3GLHB 2VIIA 4RD4A 5HZKA 3ZIAD 2BHRA 2YJTD 1GVNB 4AWXA 4TMKA 2VYFA 1KI2A 1CRPA 2HF9A 1II0A 2IYYA 1TEXA 3DM9B 3LA6A 2GKSA 2QE7A 5FOVA 1JJVA 2H5EA 1UKYA 1IJFA 5B30A 4HB4A 4NONA 2PT5A 2OCYC 5DIFA 5JBQA 3AUXA 1FNMA 4L9WA 4BFVA 1G9XA 4B3GA 5BYKA 3I8XA 2ZAMA 4JSYA 1WDTA 4EIWA 1E1RA 2EFEB 1KI6A 4C2TA 2ZREA 4IOKA 1UKEA 2GAAA 1HUQA 1OXUA 1SHZA 4NTZA 4EPRA 2O0KA 1XXHB 4ZIRA 4JSTA 4U5XA 4TL8A 1EFHA 3I3SR 1G7TA 5L3QA 1FMJA 4JLKA 2QP9X 2O8FB 2ZRHA 3SJBA 4AG6A 5JMTA 4PAMA 5JFGA 1YU9A 1QDEA 3CX7A 1TUEA 4DLZA 1OE0A 1XD2A 1Q0UA 1HA3A 4GMDA 3D8BA 1W0JD 2ZYWX 3OEED 2GF9A 5CJPA 1OV4A 1C1YA 2DFLA 4X8MA 2ZRJA 4N0DA 4A1FA 2F1HA 1BYIA 5CM8B 5F98A 3VR3A 3REFA 5DO9A 4F4CA 1Q1QA 3OIWA 2WJVA 1F2UB 3TGPA 4P31A 2V54A 3CW2A 3GFPA 3X1XA 2WOOA 3RHFA 3WRYC 1TF7A 2ZQ5A 3QUSA 1G8YA 4PHGA 5BN5A 3GJ0A 2ZI7A 1A5TA 4M2LA 2JLQA 3R7WB 4MA4A 5FOUA 4BEJA 1NVVQ 3NBYC 1CJVC 3O8RA 1LF0A 1W46A 2CLDX 2YKGA 2QTFA 3GJ5A 5EE0A 4EFLA 1PJRA 5C4MA 2ZRCA 2AXPA 3QKRB 4M9XA 2FSFA 3TW4A 2OG2A 4JT4A 3A4NA 1M8PA 1XMIA 2XAUA 3VQTA 2EW1A 2GK7A 1SVOA 1PLKA 1VYVA 1ZNZA 5CYOA 3WHKA 1YRAA 5P21A 3SFZA 4B33A 2UZ3A 1VG0B 3OFND 3RANA 2O5VA 2EQBA 3AM1A 2ZRMA 4DDTA 3A6PC 4EFMA 1S3GA 3HYTA 3G0HA 4GSYA 3VKHA 4C0QC 2ZS7A 5EXTA 4ILEA 4ACAA 3AVTA 5FI1B 4D4JA 821PA 4Q9KA 1IN8A 1NN1A 4ZCMA 4KHZA 2DFTA 4BWYA 5FL3A 4OK3A 3U3RA 4HZUA 3LLUA 3I72A 2BWJA 2CCGA 2FEOA 2D7CA 3M1IA 4A4DA 4BLPA 3KQKA 3BOSA 3EWSA 2G6BA 3NTUA 3EZ6A 2NPIA 4J0QA 1W0KD 1SVLA 2OM2A 2PZGA 2AWNA 5TVKA 1Z6YA 3T15A 3ADDA 1G3IA 4HLDA 4Q18A 1RRPA 2AX4A 2KI5A 5HCNA 5J5CA 4PO8A 4F7WA 2O8EA 4EAQA 2J5XA 3LD9A 1IY1A 1OKKD 4JLPA 3W90A 2H16A 1KY2A 3A36A 3V4RA 4NP6A 1JR3A 1ZINA 2AKYA 5E3HA 1NN5A 3UATA 4M1MA 3OE7A 4MKIA 3DOFA 1FP6A 1IXZA 3Q3JB 3HU1A 5EZ5A 2R62A 3PIRA 4DUGA 2WM9B 2N42A 3EPJA 2XZOA 3BWDD 1CJMA 2D4HA 2CVFA 1N5KA 2PLRA 1TAGA 1ZIPA 3QIAA 2VH5R 2QENA 2W6IA 3EXAA 2FPKA 4QNMA 5BWMA 4ZCIA 221PA 3GP8A 3K0SA 3E70C 1Z07A 4B2LA 2QPAA 2JLYA 5TV2A 3QI2A 3R8FA 1KNQA 2O8BA 1P5ZB 3SHFA 4IVPA 4R2HA 5CK5A 5F3WB 1IN6A 1M74A 4Q4AA 4OYHA 4HDOB 4UXHA 4PHTA 4OBEA 3SYLA 3AF0A 1JAHA 3GLHA 3H84A 2HJVA 2QI9C 4Q02A 3BFXA 2O8CB 1XTRA 3IQWA 3X1WA 4YMVA 1NG9A 2VP0A 2J7PA 2V9PA 3NH9A 3AVUA 4OHVA 1X1RA 4IEIA 4TMVA 2DPXA 4Q5IA 4HAXA 1ZVQA 2IYWA 4S2EA 4N1AA 1KO8A 2ZR7A 4IDNA 3FGNA 1ZM3A 4XTCS 1EG7A 4I4LA 3IBYA 3IPYA 2GF0A 3KKMA 1E2GA 5KNDA 1YR6A 1JJ7A 1CR0A 1HYQA 1OH7A 3MJRA 4LWZA 1P75A 4PXAA 1XBTA 2C9YA 3DMNA 4C0SA 1XJ0A 1YR7A 5C4GB 2ZR0A 3CNOA 4LCBA 1KJYA 1QHYA 1EWQA 3T1VA 1ZMXA 1XXHA 2RB4A 4MYHA 4B47A 1G8HA 4CW7A 4O3MA 1KMQA 3RC3A 1N25A 3SI7A 2CHVA 4QG7A 2O8FA 2QAGB 1MABA 2HDNB 4BFXA 1F3OA 4DSTA 3QPWA 1KNXA 3PEUA 3FE2A 3TMKA 2GJ9A 2ZVQX 3T61A 3C14C 5FBRB 3NDPA 2RGGA 4OQMA 1AM4D 3PEWA 2V6JA 1ZYUA 4PR0A 4GPTA 2EYQA 2PT7A 1M7GA 3QY0A 4US0R 3UKDA 4RD3A 5HTKA 1Z0FA 1R2QA 3I61A 5JCPA 4D80A 3MRSA 4XVQA 3WBJA 3IIKA 2DFNA 5FH9A 4ESHA 2IYQA 4Q1CA 2CNWA 1SVKA 2JJ2D 3VKGA 1F2UA 2OV2A 1JR3E 1P6XA 1NMZA 4TQUS 1JQJC 3SE0A 4DCVA 4QKQA 2GXAA 1XEFA 2YWFA 2ZRKA 2YZ2A 2D62A 4HLQB 3IPXA 1XEXB 5F2EA 2ZEJA 2Q3FA 1BKDR 4Q47A 5AR1A 4KITB 2VHTA 2QMOA 2O0HA 2KJQA 5JJIA 2C03A 2JJ1A 3L82B 1GIAA 4I1VA 4Q1EA 4B3FX 4P32A 2FF7A 1GL7A 4Q1AA 3SEAA 3KUDA 1E2HA 2YHSA 4LBVA 4D4LA 1SXJB 3SNHA 2QUZA 1S8FA 4CDGA 4P4TA 4C7OB 1E2DA 3BRWD 2PCJA 2VHQA 4D0GA 2Z0MA 2IYZA 4PPNA 1HT2E 1YVDA 4A0GA 1YZTA 2HXSA 4I81A 2FZ4A 1F5NA 4BLQA 4US2R 3GLHE 1DAIA 1NBMD 2ZANA 3B1YA 5FOXA 4BZQA 3IHWA 2A30A 2ZSBA 1ESNA 1U8AA 4Q4HB 5JRJA 4QGHA 1OT3A 2D2EA 4AD8A 1KSFX 2IK8A 2HEIA 1AA9A 2FN4A 3RRMA 3IUYA 5JSZA 3MGCA 4TT3A 5C46F 1U90A 4LHXA 1Z6XA 2RGAA 4FW9A 4V03A 1T9HA 4DWJA 2SHKA 3KB2A 1FPMA 5TXGA 3ASYA 3MAAC 4C30A 3B1XA 3WNCA 3ADKA 4MRVA 3L0IB 2IEYA 1N6NA 3RRZA 4BE7B 1RC8A 4LZZA 2NZJA 2Z5FA 3SHWA 4DLYA 2VP2A 4PPGA 4F4IA 4DLVA 4G3XA 5CDFA 2CK3A 4Z8XA 5B2ZA 1OH6A 4FIDA 1ZD8A 2GJAA 2PJRA 2A5JA 3P20A 3LQRA 3ND9A 1D2EA 3LW8A 1W2GA 4DBLC 1Z2CA 1R0XA 1F48A 2F9MA 2GCOB 2JIZD 2QSZA 1E79D 3C5HA 1OIWA 3X1DA 3FTQA 3FDIA 1Q3HA 2BM1A 2XB4A 1OH5A 4PQRA 4WZBE 4PC7A 5FL7A 2CHGA 1B23P 2XX3A 3K9LA 4MRRA 1ANKA 3OIUA 1XPUA 1LTQA 3K09A 2Y8EA 5BXQC 2WIBA 3DEFA 2QQ0A 2F1JA 2ANCA 1VMAA 1H65A 3LWNA 2ZVPX 4FWIB 5KDOA 3ICQB 1AZSC 2VF8A 1IY2A 3EA0A 3KJGA 1QZXA 1NNEA 1II9A 4Q4LA 4RZ3A 4B73A 3R8CA 2JGNA 3A4MA 2JLXA 1GOTA 2CE2X 5EUQB 3AVQA 4HDQB 2ZETA 1D5CA 1XTIA 2GEVA 2W83A 721PA 3PITA 4RFSA 3N5CA 1J8MF 2ZRFA 3X1YA 3L8ZA 1GTVA 5AJWA 3KKQA 3ZJYA 3U6KA 2D2FA 5FI0B 1ELOA 2HT6A 5HCIA 1XZQA 4F38A 2F1RA 2O8CA 1GNPA 4ERNA 2JCSA 2LKDA 3U7EB 3TW8B 5F9FA 1UBGA 3AEZA 2QQEA 4DSOA 4L9SA 1VCNA 3QNUA 3L2OB 5SZHB 1FTSA 4MH0R 2EVWX 4RKEA 4XTRA 4LPKA 3GLFB 2F9LA 1U8ZA 2HCJB 5EE9A 1I2DA 1ZM2A 3ZYCA 1NVUQ 4KLNA 1D2NA 2OEPA 2V7QA 1RIFA 3WMEA 1FX0A 1T3LA 3TJZA 3H2YA 3KJHA 1ZD9A 4PFSA 2NO6A 1DAGA 4F4JA 3THOA 3W6OA 2GILA 3E1SA 4IOLA 3R9IA 2BJVA 3RRNA 1TADA 3GPLA 5GJWC 2C04A 2IHBA 2FZLA 5CB6A 2G1KA 4I1SA 4PQYA 2R6GA 3FKSA 2PEYA 1CP2A 4TLCA 2ZI5A 3TAUA 1S9DA 1G21E 1W44A 1YE8A 3JVVA 2HYIC 4HZIA 4PZLA 1KDRA 1TF5A 4LC0A 1F60A 2VF7A 2GXQA 1VG9B 1A7JA 4XVUA 1D2MA 2V6IA 4XH9B 1G3RA 2YYZA 1RYHA 1SKQA 2ZUDA 3IDQA 3IKJA 3FOZA 1VPLA 4G1UC 2ONKA 2FA9A 4OK6A 2C77A 3TLXA 1C4OA 2P6NA 3Q72A 5FTLA 3PCRB 1K5GA 4I1UA 3HPRA 5CLQA 2JLVA 3B82A 5CJ2A 1XD9A 1KY3A 4JBXA 1WXQA 4NMMA 3U7GA 4AYXA 1I4DD 4LV6A 4M1OA 3C7KA 2W6JD 1VYUA 2XJ4A 4NCKA 2G0TA 4UNSA 1W5TA 2FE4A 2ZRAA 4Q7LA 3EZ9A 2GZHA 4QJ5A 2OCAA 1G41A 1NSTA 5FOWA 4ASUD 5DHAA 4IRUB 3KXLA 2O52A 1T5IA 3B85A 3TRFA 4URUR 4JJZA 2CHQA 1NVWQ 1XEXA 1E2JA 2EWWA 4LV5B 4TQ9A 4YC7A 8OHMA 3OHMA 2VP6A 3ZZTA 3ZLJA 5CK4A 2CLCX 1E96A 1R0WA 5LD2C 4G0NA 2YC2C 3ZH9B 1YR8A 1FQJA 4QHYA 3DDCA 5DHFA 2VEDA 4IJMA 3MLEA 4E09A 2ZJYA 2V4ZA 2DWPA 1E9FA 3QVUA 2ZJZA 1T0JB 1WF3A 3SFVA 5AUPB 1E2MA 4U02A 3VU9B 3ZZ0A 2D7DA 4FMCF 2YOHA 2REOA 1L2TA 3BD9A 2J0QA 4NZYA 4LSGA 1GSIA 1E0KA 1HURA 2FGJA 2I4IA 3HU3A 3NHBA 1E2LA 2G9NA 2VBCA 5JEEA 1KJWA 2ERXA 2JDID 5IRCD 3GQBA 3IIJA 2P6RA 2B8TA 4Q4HA 2AFHE 2XNDA 1NI3A 1BMFD 2IWHA 2QP3A 4XWAA 3GJ4A 3BGWA 4IHQA 1RYFA 1Z6TA 3N70A 2P5SA 2OZEA 4DLUA 4WXPA 2Q9BA 4BRWA 3TK1A 1VCIA 3GLGA 3UIEA 1X3SA 1Q22A 1XRJA 3KTAB 4QBIA 4UQOA 5JHHB 4QRHA 5LPNA 1EFRA 3CNLA 4MRSA 1OIXA 5HR5A 2I1QA 3TH5A 3OAAA 2F3RA 1ZM9A 2QMHA 3AH8A 3K0CA 3THXB 1UPTA 5HKKD 2AD5A 2QT0A 4LY6A 2ONJA 1E0SA 3HDTA 4MKGA 1NIJA 3NDBB 4PSKA 2IC5A 1DTSA 4JBWA 2KB0A 1TQ2A 4IDQA 1RRGA 2QEQA 2ZAOA 2GCOA 2AN9A 1JQLB 2FFAA 1XCMA 3MWLA 2WJHA 1D9ZA 2J87A 2ORVA 2ODBA 5H1YA 2QU8A 1R8QA 3B1ZA 2D3WA 4NCHA 1JPNA 3MWJA 3U60B 1N5JA 2MMGA 1K5DA 1EWRA 4CEHB 1Z6AA 4M1KA 2AWOA 3RS2A 4GP7A 4TL7A 4BFSA 2I3BA 1OB2A 1L8QA 1T0HB 3J81k 5FOTA 1AK2A 4AKHA 3IGFA 4OI2A 4ZI3A 2EFDB 4AY2A 2Z83A 2FSHA 3REGA 4FD2A 1I4LD 2BC9A 3P4XA 3KZ1E 3PEVA 4JLDA 4H9GA 4JKIA 3U3MA 4D81A 5AWFC 1KK2A 2MSCB 1G18A 2V1UA 3NBFA 3FFAA 3FVQA 1SVMA 4Z8YA 1NF3A 4BFTA 1NY5A 1VCOA 1J70A 4Q21A 3RWMB 1XMVA 2VP5A 4D2IA 4M4SA 1KDPA 4AYTA 2OBMA 1ZUHA 2OILA 2WICA 1OHHA 4OQNA 3TQFA 3THYA 4B34A 4DB2A 3K70B 5JCZA 1GWNA 2BMEA 5CIQA 4DHEA 1CBUA 4DRZA 3VNVA 1TEVA 2BBSA 3CR7A 1LY1A 1IBRA 3GLFA 4A6PA 2HJGA 4D0NA 3R9XA 1TU4A 3AF3A 2DYKA 5G53C 5FR1A 2WMNB 3TVTA 3FMIA 1IXRC 2Z4RA 3NWJA 5EQTA 2QE7D 3QKUA 1E4YA 1Q1EA 5M04A 1U0LA 4K81B 2VSFA 4ZDKA 2K5UA 3U61B 4X8OA 1LS1A 3T5DA 4M53A 1NN3A 4MGYR 4BRUA 1YR9A 3ADBA 2D74A 2OXRA 4Q9LA 5FUXA 1JAIA 4OK5A 4DIEA 4V0NA 1QBKC 4PC6A 3PENA 5K8LA 1XZPA 4DKXA 3IQXA 4XWKA 6Q21A 4AKIA 4AURA 2ZSDA 1E1RD 2QA5A 1UADA 3LVQE 4B2PA 4JS0A 3GLGE 1QHNA 4A2PA 1QVRA 1ZAKA 2OFOA 4V0ME 3Q7PA 1US8A 4IFEA 3BXZA 3OZXA 5D3MB 4RCYA 2J45A 3QF7A 1O87A 1JEDA 4TZ0A 4GDFA 1E32A 2R6CA 5AJYA 3ETLA 4G5RA 4EDHA 2VHUA 4HUQB 4AKGA 5TDHA 1NIPA 2ORWA 1XPRA 1G6HA 1VDZA 2H18A 3CX8A 1MO3A 4KVGA 4M1TA 1E2PA 2WAYA 3NH6A 3VFDA 4BLRA 1JXOA 3BB3A 3QXSA 1S1MA 2WSSA 2GHIA 2ZS8A 3CRMA 3LDAA 3LQQA 2QMEA 3U3KA 3A4LA 1XTQA 1Q12A 2PX3A 2WWHA 3I32A 2CE7A 2UVQA 2XOKA 3DKVA 4A2QA 5JHGB 2W0MA 5G3ZA 1XJCA 4ZCLA 4MDFA 2ZJ8A 1YRBA 1GM5A 2CCJA 3CF6R 1UAAA 3WBKA 4GOJA 5CB8A 1XCPA 2H8KA 621PA 5KU1A 3LH5A 2F6RA 4XD7D 4C0LA 4MKFA 2QRNA 4WAUA 4B48A 1H8EA 1AS2A 3CRW1 1COWA 1KSJA 3W6PA 5BYJA 1IJEA 5J40A 2LCFA 4Q7KA 5DI9A 1UKZA 3TIFA 2FGKA 3B5JA 2W58A 1EK0A 1M34E 4KFSA 3T06B 4TYPA 3P27A 3EZFA 4NPHA 2BKUA 1P73A 1Z28A 1R5NA 3LXRA 1MO5A 3CO5A 2IS1A 4JMPA 2FOLA 1S9HA 4POAA 5EXPA 5IT5A 1E2EA 1KI3A 1NY6A 2FG5A 1G1MA 1P9NA 3QPVA 3GLFE 1GNQA 1RPZA 1N6KA 4JVSB 1NVXQ 4EPVA 4M9ZA 4NHOA 2IXGA 3KTAA 1E69A 5CIWA 4Q48A 1RJ9B 3EZ2A 2V55B 4TYWA 1DBSA 3AVPA 2QTHA 2ZUCA 3THXA 4EQ6B 1Z0KA 1ZD1A 3K09C 5K8IA 5EZ6B 4KU4A 2C5LA 1ZU4A 3LLMA 4BZXA 4N0EA
chains in the Genus database with same CATH superfamily
3FGOA 3PQCA 4L95C 2V74B 1TUBA 2RCYA 1YQTA 4AZVA 2DSNA 2WWXA 3QIVA 2RAVA 4I4TF 4MPRA 4PLVA 4XKJA 1U3UA 3JY6A 3M8KA 1KMNA 2FV8A 1Y8ZA 1QV7A 1KRWA 4DJJA 2HLPA 1AXRA 2QSUA 4Q4DA 1SQGA 4PX9A 1M1ZA 3EXG1 2V9ZA 3INTA 4W5OA 3EIQA 3IP6A 1KO1A 4NBNA 4BMDA 4PC2A 3GVCA 5ICSA 4W7IA 1YDWA 4KPFC 1GQYA 1R5BA 1BIFA 3D81A 4PRLA 3R20A 4Z9FA 3ZVLA 4A10A 1K66A 1CR6A 3KFVA 4IVNA 3IQDB 4CT0A 1AA6A 4GRAA 3UANA 4E2XA 3I5YA 1EFDN 2I80A 1OZAA 3MJSA 2I5PO 3O8BA 3OEEA 5KI6A 2IWRA 5FFFA 3N8KA 3K0AB 1P19A 1PAUA 1T8WA 4DDUA 4I1PA 3USES 2ZJ4A 1GFZA 4DV4B 5F12A 4DGSA 2XQVA 1ND6A 1G66A 1N1DA 4K8OA 4BO4A 2W6ID 4L4RA 4HH3C 2QM0A 4YECA 2I91A 3KEOA 1P7WA 4FMCB 3RH0A 2VPQA 3HL0A 3VRHA 1H94A 1QGED 1JHYA 1U7ZA 2Q2OA 3LLVA 4H0CA 1F8FA 4OOFA 4PXSA 4XM1A 2GZRA 4A0RA 1A1VA 4OXQA 2XITA 3H9UA 3FLEA 4H60A 1OB5A 2GRUA 5F9MA 3N39C 1GTRA 1LVGA 3K9QO 1UXKA 2H2GA 3MBOA 2OAP1 2UYQA 1CLUA 1B76A 1A7UA 2O06A 2DUUA 3DP9A 5HJ5A 2FP4B 5A0TA 3ZD8A 4G0YA 3DO6A 1YU6A 2X58A 1IEVA 4XOIA 1TZ2A 3AHDA 1A2BA 3V1UA 3AEUA 1XHLA 5KYUB 1J33A 1XTTA 4YT2A 3FOWA 1UKBA 2QAGC 1XQ6A 4LXXA 3ROMA 3SIXA 5JECA 4ZTZB 1C7JA 5LQUA 1SPXA 2HBZA 4KAJA 4TWIA 5ECYA 3U80A 2YNMD 4HNTA 1I2CA 5FNZA 3L07A 3ZVNA 3KSAC 4ZCQA 4CF4A 5JZSA 1H2RS 2I4TA 2BCGY 2E48A 3O8OA 1T1RA 3WYNA 4C07A 3NAQA 1R37A 1YJCA 1SBQA 5KNDD 1ADYA 4X61A 3BILA 3MJCA 3WJ1A 2PZBA 3LBFA 4P7GA 5B4TA 4PG4A 2WNIA 4A0HA 1EGVB 2FFRA 2XQKA 3EIUA 3P5SA 4H6XA 2X5JO 2BBOA 4M0FA 1JEQA 2C2YA 2A6PA 4QTUB 3ANYB 1J99A 4NE2A 1X86B 1ZWKA 4LNHA 5K2MA 3I4CA 4LDJA 2BE7A 4TYNA 1CQWA 1PZEA 3THRA 1I3NA 2GESA 4RGVA 4DEYA 2DBQA 4ZT4A 1QLWA 3LC2O 1I1OA 3T5BA 4FGUA 5FADA 1JHUA 2R84A 4YJ2B 3VSDA 3HGTA 4XVRA 3F8TA 4M0DA 5ALYA 4YONB 3S2EA 5IJ9B 3C15C 3M6XA 1J7KA 3IEVA 3RSLA 5JCOC 1Q2UA 1JZSA 3C6QA 2ZE5A 1QQ5A 1U0EA 3VAAA 4HD8A 3EW7A 1M6EX 5HPYB 1WMSA 1OBVA 3EC2A 3RNLA 3KB6A 4Q24A 3A10A 3PUXA 2JRLA 3BBLA 1P33A 4GM1A 3R7SA 2QVCA 1PZXA 2CJWB 4GMKA 4JI1B 2Z2ZA 3II6X 3ILVA 3SPXA 3EH2A 4EY5A 1HYGA 2EZ9A 5ITSA 1Z7WA 5BVGB 1CIPA 2BGKA 3OO1A 1EA7A 1SXJC 1I6WA 4QXPA 4Q01A 3R1IA 4R68A 2WWGA 5C8YA 3DLTA 1H4SA 5BSFA 1JYSA 2Q99A 1YTUA 1BN7A 4NNPA 2DY1A 1RP7A 3JQ9C 1IBCA 1P4SA 4RHXA 5HBRA 1VKOA 2XF2A 4XXHA 4MS1B 1OVMA 1GRQA 2CDCA 4TMZA 2AE1A 5CX4A 4EB3A 1BU5A 3HXKA 4HBGA 4Y67A 5T8KA 2R8XA 4YV7A 1F2TB 5HM6A 1A8QA 2HLDA 4IAOA 3COWA 3K9GA 4W5HA 4X45A 3X1ZA 4IMJB 2PUVA 4DIOA 4G67A 5B3KA 2I8LA 5BWBA 2OCBA 4OKSA 3ZD6A 1XALA 2YWJA 4LPSA 4X93A 1X1CA 3U3XA 2BGIA 1XMXA 5J63A 4C2BA 3JW8A 4MI1A 3W0LB 3ST7A 1JV2B 3L7BA 2I7DA 4L8LA 4TRRA 4AG5A 4BV2A 1F2DA 4DV2B 5EJ2A 4B74A 1QM5A 2C7VA 3L7AA 3QE2A 1JIXA 1TCBA 3HJGA 1BDHA 3QJYA 5AVOA 3CMMA 3RI3A 4H6WA 2IQIA 2Y76A 3G5AA 4YRNA 1A72A 4RPGA 1PD0A 1T5TA 1EH5A 5BN4A 1V8BA 1YF3A 5JAPA 1KQOA 4UTNA 2BMVA 3VHLB 3W5DA 1HFEL 3PHLA 2ZRDA 3SVTA 1Y34E 3DMDA 4UFOA 1SJ9A 2B35A 3IRUA 3JQFC 3OLCX 4JUBA 2MSNA 3N05A 3QXCA 1FYFA 4MQ6A 2ATVA 1Z2PX 3L7NA 2VHVA 1WW3A 4ML3A 2W6ZA 1ZVJA 4MYRA 5AW6A 1ZU5A 1GZ6A 5DV9A 4MB0A 2YVLA 4TT3D 2D06A 5FTNA 1NJFA 5KVVA 2WYHA 5ELMA 3I23A 2AN1A 1U7DA 3F1KA 5JH7A 1JIJA 2X0JA 2WSMA 3OPVA 1B7GO 3ZHBA 3UJBA 4M9QA 3W4IA 4V2UA 1CEQA 4J1TC 1W4CA 5DEIA 3EC7A 2QN8A 2YOFA 1FDWA 1TFUA 3L8MA 3LC7O 4HQNA 3CRQA 3T5TA 4AS3A 1E5LA 1O54A 4JASB 5EIWA 2DPLA 1A82A 2M6SA 2H57A 3UOWA 4JJ6A 2EU8A 1TK9A 3CZ4A 3E4CA 4ZO4A 1E1MA 1WY5A 4MCIA 2R66A 4ZQBA 1V1RB 1IN7A 1P81A 3A2MA 3HKEB 3HUFA 5JXWA 5KHLB 2VHEA 3MMPA 2VT6A 1N0VC 2W2KA 2ZJ5A 3CLSD 5AJZA 3VR2D 1TU0A 3F6BX 4JB2A 1Q0HA 3CEJA 4KE9A 4B6GA 1EDOA 2ADOA 2IBMA 2DHEA 3CZPA 4V0LA 3UAOA 3N86A 3OEHA 4WNAA 1GZ5A 2I0FA 5FL7D 3SGLA 2JGRA 5GOZA 1EE1A 4YUXA 4U0JA 2EARA 4ZAFA 4YRSA 4DLLA 3UCFA 3PHHA 3BPSA 2C2WA 4NICA 1YVRA 1A0OA 2W2LD 3K30A 2G07A 4EA7A 4Q03A 3ORHA 1SVNA 4AQ7A 3RREA 4RV5A 1VJDA 4K9RA 4BVGA 4UTPA 3TTTA 4ZQHA 1XN4A 3RHSA 4XGRA 1MO6A 1NXSA 1KEWA 2A9FA 1DDIA 1YE3A 2Q6OA 4GI7A 2Z5GA 4LRSB 1QHHA 2BGNA 2PKQO 1F20A 3OZUA 4H3VA 4N8EA 3TUJC 3MYYA 4E5PA 1GRRA 2ECQA 1DC6A 1O97C 2Q29A 3G9UA 3NP7A 2WW8A 2R48A 4F72A 1D4FA 2H0QA 1PNOA 4OQEA 2Q5IA 2WP8J 3FBGA 4DMHA 1B0PA 4RHTA 1YNOA 4MW5A 4PX2A 1FLDA 4YNBA 1RVDA 5AI9A 3GF4A 4J91A 3EUFA 3AI1A 4Z9BA 3WLEA 1R16A 4RD2A 4ADSG 4EHNA 1GNTA 1U7UA 1U4NA 1ULBA 2C4NA 4K40A 3FLAA 3STWA 4O1IA 4E6PA 3S2YA 1P0FA 3C3XA 3O21A 1Y5NA 2QLMA 1PYOA 4A6DA 4D8UA 2P78A 1NBMA 1RHMA 1RYBA 2B83A 2XTNA 1TF2A 4KVAA 1ZKMA 1QH8B 2ZWAA 2CXOA 3QF4B 3G9ZA 4ZALA 3TBFA 5JTUA 2EQ5A 3MRVA 3CTMA 3DBRA 3L9XA 3C1TA 4BJ3A 4GX2A 4J8PA 4L22A 1ZK0A 2PGDA 2VWQA 3QE0A 1J0XO 4UBOA 3HJFA 4KXWA 4WK0B 1CS0A 2MDTA 4M21A 2GHTA 1FMFA 2XQGA 3D4LA 3LLSA 1QOZA 2BBTA 2P4HX 1ZG3A 1ZIXA 3H0EA 3O2QB 2ET6A 4IDDA 5HF8A 2X22A 1F1BA 3RWOA 4CR8A 4K6HA 5EE3A 3DXZA 1U2DA 4XWTA 5E7MA 4EEZA 4AN1A 3DKIA 2F4VB 3KSMA 1FNNA 1YZKA 3MD0A 2FPWA 1RJGA 4KIFA 3A6HA 5IK2D 3V2UA 4UUOA 2ZUBA 1R9JA 9LDBA 3TSOA 3CX3A 4HVLA 2ZDQA 3IPAA 3ZHOA 3IT2A 4YUZA 1HC7A 1QE3A 2QLLA 4MMZB 4IQFA 5EIHA 1OWOA 3UV6A 3KQQA 1EQAA 1WCIA 3EHEA 3GI1A 3I6ZA 4AJPA 5HM8A 1DAFA 1N2SA 1XF9A 2Q2WA 4L74A 4P3XA 5HWSA 4QSMA 1UMDA 4MV4A 2CJFA 4EARA 4IKEA 4W9NA 3SWWA 4QYTA 3N8IA 2BMWA 2PFKA 2GASA 4RD6A 5KSZA 4X6UA 3H83A 5HE9A 3WGGA 1Y33E 1CUAA 2C5SA 1A9YA 1ZN8A 2OFFA 2XSZA 1U5CA 5K8UA 1SXIA 3IKLA 4OHUA 1DIGA 1I6LA 2QS9A 3V80A 2WA2A 4G09A 4WERA 5ECWA 1PYGA 5A3QA 5LFAA 5IM4F 3N6XA 4HQFA 1QZ3A 3RAJA 3TFOA 1B6GA 1RQGA 2R44A 1LTHR 1NVEA 3DKKA 4MQUA 1OAOC 2XRYA 2UVPA 3OEYA 5C35A 1C2TA 5ER9A 3TZBA 2F8LA 1V25A 3T7IA 3B38A 3KC2A 2Q5JA 3EXIB 3S81A 4IRXA 4KQXA 4XUGB 4WFIA 3RYHB 2X8JA 1ZEMA 3LQKA 1CS4C 1T5BA 5IVPA 2UYOA 3ILXA 4NJEA 1FYWA 5CDFE 2O5RA 5IP5A 3RRJA 4B3SB 2XUOA 1PWYE 1NXTA 4U2EA 1GA4A 3K1JA 3MWYW 1HYEA 3OFVA 3U37A 4JB3A 1E9BA 3ETGA 4DYVA 1OFGA 3EVDA 3E7PA 2CLFB 4XFDA 3PWZA 1YQEA 3WGKA 4MUFA 3FB4A 3KJIA 1OXXK 4GI5A 2QGZA 3UMSA 5L3SA 3UJ3X 2XBLA 4HNVA 1Y6GA 1QYVA 3H2ZA 2MSDB 4OSEA 3TD9A 2XNDD 1FP2A 3GXOA 4AO8A 4JVLA 2QL9A 4NZ9A 1FP1D 5L40A 5LM3A 3K6SA 1WR8A 3R6LA 2BPOA 3UK6A 4U6NA 2SCUB 5KNBA 3BICA 7YASA 3VA7A 3H1FA 4GUAA 1YAJA 3ZH2A 5K7SA 1U28C 4IXTA 4HYYA 4LRYA 3X2FA 2W2OA 3R44A 3UKOA 1PG0A 1E5DA 3ZWVA 3RSOA 4XYEA 2WPNA 5BV1A 5T57A 2PS1A 5J2UB 1GPKA 4YQFA 4TKZA 3RYFB 3IKTA 4E31A 3GPDG 1MVLA 3IHTA 3THSA 3MYRA 1M0TA 4U5QA 2ZI4A 1CZRA 1K3UB 4RK6A 1KI6B 1PZNA 4QECA 2F1IA 3KIPA 4UBNA 3AIOA 3S2FA 3HTXA 4B6EA 2HR1A 2ZK7A 3AJDA 3FETA 3ETJA 3N2KB 2TMYA 3EXHA 4MVWA 1JIKA 4G97A 1SY7A 4LOLA 4UFNA 3C3EA 4YROA 4YAEA 1UIRA 4GUDA 3S1AB 2WNSA 3I0ZA 1QBGA 1UC8A 1WUYA 4DLTA 5ED4A 5FBVB 3KQNA 2OWEA 2CT8A 2W71A 1ONNA 3E53A 4I1YA 3B7PA 3K7EA 4JQCA 4QFMA 3CURA 4U7JA 5CDGA 2UZ4A 5DTJA 1QJ4A 1OJLA 3CIOA 1AX9A 1M73E 2HK9A 3Q3GE 4URFA 4KQ6A 7REQB 1CHDA 1WOMA 1FUUA 4GI1A 3QPAA 4G84A 4KIGA 1AKTA 2P40A 2A1TS 3H19A 1UT5A 3ITEA 2IJGX 4E07A 1OA0A 4ZEVA 2WM3A 1QFJA 3U3JA 3U13A 5TPZD 5F1YA 2RGRA 1LLDA 4MGIR 3IVMA 3SF8B 1SGWA 5AVZA 3L3BA 4BQPA 3VR5A 3PJFA 4FR0A 3HXOA 4INJA 2AZTA 2W2VA 2FXIA 3ZY3A 1MFZA 1G7CA 1SU8A 3IOEA 4X8LA 1SC6A 3GH3A 3ABRB 1X6VA 2VBGA 1USKA 2B37A 2ZQZA 2Z09A 4IY1A 1QP7A 3SXJA 2G4LA 3LBYA 3RSCA 1ZCBA 1OHHD 3EZXA 4L4UA 1OXVA 1DC4A 2QM3A 2I3GA 1HEYA 1MC8A 1TYEB 3PYLA 4GECA 5E6UA 5C32A 3W8RA 3MMXA 3L46A 4NBVA 4F3TA 1KEUA 4YREA 4G0XA 4IX1A 1IY8A 1FDTA 1UK7A 1W48A 4YAFA 4BNJA 3AV0B 4BO1A 2RAPA 5L3RA 4L3VA 2JLWA 4W99A 2V03A 3M4YA 3R4CA 4X8HA 5DM0A 4HLCA 4AWAA 3T1TA 1OX5A 2NUTA 3CZ5A 5BWLA 1MH9A 4I6JA 1M2WA 3SBXA 1RJDA 4AG3A 2E49A 3AB7A 2C58A 1EVJA 4MUXA 1NNSA 1SUCA 3KWFA 4MW1A 5HUQA 1OYOA 3QVVA 4LRXA 5IBRA 1NA5A 1NZFA 4Q7QA 3BXXA 3U7JA 3ZWPA 4I4TA 3JQ8A 3WMGA 5EKUA 4ZREA 3GFFA 1X80B 3KL4A 1N2CB 5EYPB 1JL3A 2WFMA 4U6SA 5BN1A 5TARA 3WKDA 1RYMA 3MTEA 3ET4A 4PFJA 2HV8A 4A3SA 1M2EA 1Z8FA 3DYIA 1AUOA 4RZUA 3T4XA 4Z7JA 2WB2A 5ADUS 3AUUA 2AG8A 2NLOA 5BOSA 3GDFA 1VGRA 4JGBA 4JK3A 1E1DA 3PJRA 1KFJB 1U1GA 1TA0A 5T8KC 2OHFA 4O2BF 5M3BA 3C98A 2JFWA 5H02A 1F8UA 1CRLA 2NO0A 4HZUB 5EIOA 5BN3A 1OI2A 2GEUA 3QWFA 3GFTA 4Z4EA 5DNDA 3WDLA 4BE9A 3V4SA 1U9CA 1W5AA 2EF0A 1S2GA 4HY3A 3K9CA 3ZU6A 3QPDA 5JS1A 4OTZA 1SBCA 1W96A 1VHWA 3GJZA 1G291 2NSLA 3OQBA 2X1VA 5C52B 4KSYA 3NEYA 2BEVA 2EIHA 2FUNB 1TXGA 2XTMA 3RSQA 3WSVA 4YCCA 4KIWA 1G8GA 2JEYA 4LNUA 3HKCB 4ZEWA 4H7PA 1Y7HA 3L0OA 4N8DA 2CDBA 2PVPA 4J7AA 3T34A 4GZLA 3B3AA 5EJ8A 4L4ZA 1KI8A 2R6AA 1OFUA 1AQYA 3FF4A 1GXSA 3H4VA 3QEKA 2XUIA 4GC9A 4D3SA 4KWCA 1X2EA 2H7XA 1LPOA 2CXNA 2KYRA 4WOKA 3FSJX 4HAYA 3MCAA 2W90A 2H08A 3FFTA 2WKPA 3LDFA 1KDVA 1RXUA 4ZICA 3F9CA 5E38A 3AR9A 2HU2A 2ZJBA 2CVPA 4HSEA 5IDXA 3OJOA 1H8ED 1X1SA 4X24A 1BVHA 1A5SB 1HE8B 1GCIA 2J6CA 3VSCA 4ZK6A 2YZKA 3QFCA 2IEZA 1Y0BA 1YDMA 2W2NA 4GEGA 1SULA 1D1SA 3NX4A 1ZBQA 1UXOA 4HLNA 2AYYA 4ICIA 4Y2PA 3EC1A 2AUTA 4BV9A 1W4AA 1KZGB 5D51S 3HBFA 3IAM1 4M89A 5I4IA 2HU5A 2WUFA 2OCIA 1NUPA 2J46A 3N58A 3MT9A 4NF2A 2FDCA 1K6XA 4MKHA 4ND6A 4HAIA 1FVHA 1HGXA 2XTZA 2EP7A 3CLHA 4K9DA 1GITA 4R2IA 4RA9B 3CVYA 3EXEA 1KVSA 2MYNA 1V8ZA 1E7SA 3HR8A 3TECE 1LV7A 4JXKA 1V9SA 2A57A 3EA4A 3PXCX 1KMMA 4QUGA 1S6YA 2C9BA 4J94A 2PVSA 3ICCA 4GYKA 2IY9A 2OP0A 4L0DA 1LH0A 5TJ9A 1P1BA 4WJZA 2WPDA 5DI3B 4NS4A 3RU2A 1B3RA 5H70A 3SN6A 1MOZA 4B44A 3OWXA 4C22A 4ETWA 3WY9A 5EKDA 5LJIA 1A50B 3ISTA 2XEXA 4J7CA 1I5OA 2P90A 4KZPA 1XAIA 1KP9A 3VU9A 1SO8A 3INRA 1O58A 1OC4A 2EWVA 2LKCA 2NM0A 1RXVA 1WUHS 2QN9A 4ALNA 2IXEA 2WWWA 3DS8A 1QUFA 2PQ2A 3RRYA 4ZAVA 2CV2A 1ZUIA 1ZW1A 3A2LA 4NG5A 4BQNA 4DQVA 3IR7A 1FZTA 5EE5B 3F73A 2ZI3A 2R0QC 3NOVA 5E6SB 3IT3A 4MVXA 1KFEB 1YB5A 2YTZA 1MX1A 2JIBA 1Y8RB 3WMWA 4M1WA 1SWWA 1U3CA 2DLNA 2F1KA 3L7MA 3O9ZA 1NZDA 2UDPA 1UZMA 3TZCA 2MCFA 2QR5A 3W8DA 3N2ZB 5KQPA 5KYXB 5LMZA 4HQRA 4TMTA 2LV8A 5GM2A 3UMVA 2LCIA 4NRDA 4LS3A 2BFNA 4R5HA 1SC1A 4GR9A 1BXGA 4NCIA 5ICMA 1AGNA 3DMYA 2Y05A 2DLDA 2F62A 1TKAA 3UW1A 5DSTA 3O8CA 5EHIA 1D0VA 2FZKA 4ME6A 4DARA 1UDAA 3KQSA 1PWEA 2JCYA 2JVKA 3KDSE 2QD2A 1VC2A 1PGJA 3NIBA 1XD8A 2C61A 5ES4B 2I4NA 2RGNC 4II7A 1Q7EA 2GNPA 5AKGA 2DQSA 2BCEA 2I8AA 3FCCA 4B7CA 1TQ4A 2A5YB 4PANA 2FCAA 2JLSA 5F64A 3ZQ4A 5A5FA 2GWHA 3EOZA 3OESA 2ZUSA 1VIDA 2C4HA 4RVUA 3FYCA 2UXBB 1YV9A 1DAOA 1P4HA 2XNCA 5KSWB 1F0KA 1H2XA 1WV0A 4KX5A 3RUCA 4PCAA 1PL7A 3FI0A 3H8WA 1NL3A 1LBEA 3AP1A 4KXYA 5GY7A 2BFPA 3TG8A 2UYYA 4ZCTA 2X6RA 3IDOA 5H4HA 3OX4A 4BN4A 2F43A 2Q9CA 2X9NA 2CNLA 3AO0B 3ND7A 1A2OA 3EUAA 3R3JA 3OE7D 5TPWB 1J9GA 1PZFA 2Z6VA 1U2DC 1ZUWA 5KPDA 1L7QA 4WJKB 1W0JA 4EUEA 4UU1A 4R2XA 2BFWA 1P9WA 3TIXB 2CJYA 4JLJA 1E6CA 3MN1A 1AGRA 1ND5A 1NQVA 2XADA 3SX0A 3MGGA 4M7OA 3TW6A 5B7QA 4NCAA 5BWOA 2O7VA 1NC3A 1PQPA 2W6OA 3IBTA 2ZIAA 2EEZA 3M33A 3PKIA 3PSAA 1AURA 1R8XA 4MUEA 4RSRA 4Y8VA 2AXNA 1J23A 2WVHA 4AL4A 2AR9A 3KSRA 3RFTA 3VKUA 2WT9A 4BX0A 2Z5VA 4LWPA 4CFZA 5T3UA 4ZJYA 3NHAA 1SUWA 4DDHA 3PUYA 5IAOA 1ZOPA 4B83A 1GZ4A 5DNEA 2GXUA 1T8RA 3E03A 1VLMA 1RR6A 1YMUA 1TC2A 2R1UA 4NI5A 3UENA 3S8YA 4D3YA 3DLPX 2FEMA 2HGZA 4J0IA 3BC1A 1EJ6A 1JVNA 2GZMA 3HZRA 3D8TA 5DGXA 4KNYA 1M1YB 2PMBA 3PR3A 2XA1A 2EHJA 3BFVA 3QA3E 4IDBA 5JW6A 1ZMRA 1VPDA 1Q2XA 1TM7E 4DRXB 2MJLA 4YT8A 2CCKA 4FONA 3GROA 1K8RA 5K3FB 5K51A 2BCJQ 1H8HD 5DULA 2A78A 1HDYA 2QPTA 3TEMA 4IQGA 3TNJA 5BP7A 3GGJA 3LFTA 3L9WA 3SLGA 3HY6A 3VXKA 3ORYA 2ANBA 4R0VA 3K6JA 4XE5A 1W73A 2FPXA 3DFMA 3Q88A 1BWSA 1DUVG 2NXEA 1C3OA 3NHJA 2ZYRA 4UU7A 3V00A 4H3SA 3TEJA 5IKPA 2JGEA 1KORA 4CIDA 2I87A 5CLIA 3H9BA 2NO1A 3V48A 1G8PA 5GJVC 4E5MA 3F5MA 4LHVA 2HT1A 5BSEA 2YS6A 3LCJA 3RT7A 2A7XA 3ND8A 2DBZA 5FUVA 3M9XA 4H15A 1T4BA 2Q1WA 3B1FA 4MUNA 4G9GA 5FUWA 3P1JA 3MD9A 2XE4A 3R0XA 4NL4H 3U4HA 3W9BA 1Y4SA 4DXAA 3LO5A 3EPPA 3KX2A 2DF8A 1LS6A 1NU8A 5K3OA 1F2VA 1TTTA 2C54A 3R5TA 1U0GA 3BSYA 4D6YA 3A1EA 4MARA 4A6EA 2O7SA 2ZG6A 4B35A 2QP4A 4K6FA 5D00A 2PL3A 3JPYA 1KAGA 3M4JA 3UMRA 4FYXA 4O4IA 3UPUA 3ABZA 1V4VA 4IG4A 3L06A 5CP8A 3UJCA 1LJUA 1VZ3A 5CFZA 1PTKA 2RD2A 1BYUA 3KUUA 4A8JC 3DL0A 1EX7A 2PL1A 4MR8A 3UG7A 4ISCA 3IODA 3M2TA 1FTNA 4G5SA 4O5AA 2Z1MA 3PDCA 5COBA 5LWHA 3OTQA 4MR7B 2QZPA 4HXEB 3U7RA 2PLNA 2AFHB 3IHLA 1VE9A 4G1EB 5DYWA 1MHPA 1U2ZA 1Y1QA 3SYNA 5FPPA 3B6MA 1BKSB 1T9GR 1IATA 1ZN2A 3HZHA 3RYTC 4EYGA 4TZKA 7GPBA 3LQFA 2OFPA 4J1NA 4XWOA 5KNDH 2HW8A 2ZYHA 5ALWA 5DSZA 5AJTA 1PLJA 2HHAA 3ANNA 3TBHA 4CYMA 5B5SA 1ULSA 3CVXA 3PNLA 1HT3A 1QC5B 5A5EA 3HDYA 1J2YA 3RJZA 3LUJA 1IUOA 1JQBA 4QARA 2ZUVA 3SXUB 5L4NA 4RKYA 1FOEB 4FC7A 4OAOA 3EDMA 3FKQA 1QH1B 3A2KA 1P7VA 1QZTA 3Q2OA 4DB4A 3U9TA 3DZIA 2H48A 4J1SA 4V24A 4DM4A 3ZBQA 5HTOA 3GBVA 1KH3A 2TMGA 4JODA 1L4BA 421PA 3OF5A 1S3IA 1P0PA 1YRLA 1S3SA 2C4TA 2XYRA 3NAZA 4QBTA 4WXRA 3WYCA 4B76A 2P7HA 2Y93A 3GUYA 4G07A 2E1RA 3IH5A 4B43A 3A0UA 3SSOA 4EJ0A 1E63A 4FHCA 5HW0A 5G4KB 2JG3A 2QG9A 4B7UA 5F21A 4DLKA 4GP6A 4HBZA 4UTZA 1PV4A 2ZTVA 4LKOA 3FYUA 3SKVA 1KI9A 3WGHA 3WLJA 3QW4B 3A6FA 3HBLA 2ZBRA 3NBQA 4UKDA 1DCTA 3MUEA 3A1WA 1R5JA 1RSZA 4PZUA 1SKYE 5IM4A 1RJ9A 1E1QD 5DCUA 1ONPA 5DN6D 5IXSA 4WINA 2JK0A 4ZRNA 3CB2A 5JS6A 5BV7A 1Y5MA 1SHTX 4WW0A 2FWPA 1B1CA 3K5PA 3BS4A 1QKJA 4GPD1 4OA8A 4P3KA 1GQ2A 2YHIB 1WUJS 2ASEA 3ESYA 1H23A 1IUNA 1GPNA 1L4MA 2ZSJA 1YQWA 4I1IA 3I1YA 4K46A 4KUGA 4MV3A 4X7RA 1UDBA 4BECA 2QRKA 3FB1A 3RTAA 5KX5B 4ER3A 3PNYA 5DX1A 1TZBA 4A8JB 4NMHA 1RZ3A 1KO4A 3KPVA 3N2EA 3PL5A 4EJ6A 1APBA 1ILEA 5JADA 2I8CA 1JMVA 3IUPA 2RI0A 1NMQA 4TLEA 5LZ5A 1DO0A 2WTXA 1XQVA 5BW8A 1WPXA 5CVTA 4EMUA 1P61B 4UUMA 5EJIA 1YH3A 2Z1NA 2AX3A 2TECE 5L45A 1ICEA 5CU7A 1E7WA 1MVOA 1P1HA 5J5AA 4BQOA 2X4LA 3EPLA 5EIAA 4UPVA 2CBGA 2XUHA 3IOBA 4L0CA 4OU5A 4RZ2A 4ZAZA 3U0VA 3TTYA 5JI2E 1ZFNA 4OGKA 1Y80A 4P38A 4B40A 4YRBA 3FD8A 5CTJA 2PKWA 4JYCA 1QH9A 3HU5A 1VKJA 2Z2YA 1LQUA 4MGZR 2WTUA 2GCIA 3IV7A 3LW7A 1MLDA 2HSDA 5AW9A 2I6GA 3OM1A 1FYEA 2JJ2A 1DAKA 1HMYA 3O4VA 4LC9A 4XB6B 1TUGA 4CCAA 2FQWA 2J0VA 2PKRA 4J9UE 5C2JB 3BT7A 2WJPA 7MHTA 1MAAA 2REBA 2XGOA 3WS7A 4BIMA 1NXPA 2BP7B 3IALA 5DTRA 3CVWA 3PC4A 2O3QA 1U9YA 3PV0A 4JCCA 1WZNA 2VRBA 3H0KA 4O4JF 1RQXA 4JLUA 3NLLA 3V8BA 2A67A 3CVUA 4KMRA 1PR6A 4D9JA 3FMGA 3O4RA 3QNWA 3VR4A 4DKJA 1Z4IA 4FSXA 2FPGB 3DQQA 5DB4A 4UFPA 1XA0A 2ZB7A 5KYUA 1MEEA 5CIYA 4NNJA 3HP1A 4L16A 4UASA 1VJTA 2GD2A 2HSZA 3AG5A 3T7AA 3U48A 2VP4A 3MCZA 5ISMA 3I42A 1IMOA 2BGLA 2WU3A 3PFBA 4LDPA 1CUUA 3BRWA 5A4DA 1CUBA 1SOVA 2H1RA 4BJHB 2A0KA 3TOVA 4D82A 5DWVA 4D9CA 4OOEA 5EGSA 4BYMA 1XEWX 3GJTA 3GEDA 5T6BA 4PIVA 3COSA 2PR7A 4QD3A 1TYBE 2Q50A 4FP9A 1R9GA 1QO0D 4F5ZA 2QNRA 4HPWA 1U8YA 4BXOB 2FWAA 2G6TA 4ZVNA 3LPDA 1DKMA 2GLXA 2MU1A 2P11A 1NJ2A 1QIDA 3OT5A 2PEZA 1ZGJA 3L6UA 3JQCA 4JVMA 4QDUA 4QQRA 4DLSA 1QGYA 1TE2A 5FUQA 3EG9B 4B4VA 3MLBA 3B70A 1MCZA 4Z2YA 2J3LA 3U4IA 2AKAB 4YJ2A 3UJAA 4IICA 3GEGA 4MKXA 2AJDA 5T41A 2C4MA 3AHFA 3DZBA 1GPWB 3ILSA 4LYEA 1JFSA 4O0MA 4HWRA 3CVVA 3COJA 1Q50A 3H5OA 1OU4A 4UVHA 1EDBA 5C5DA 4CEJA 3Q3VA 3PBKA 4LBYA 1R6VA 5JNLA 3AVXA 2OO7A 1Z4NA 2ZYIA 1X42A 2NYUA 2OP1A 1MTZA 2X8LA 3N2YA 3OICA 3ONNA 5THXA 4D3ZA 3KQLA 4BPBA 1JB9A 2FDRA 1M34B 1XB2A 3E5RA 3ND6A 4HEA6 2XH8A 3KHTA 3R7AA 2JIZA 4AKSA 5I4CA 2CBZA 5K3SA 2YX1A 3RUIA 3GD5A 4M9CA 1EFAA 1RQRA 2QRHA 1UJ4A 1CP3A 4N3GA 5FV7A 1YS6A 4CQJA 3SXPA 2H2HA 4RE5A 4UDOA 2ZDHA 2XE6A 4BNYA 2PQ0A 3PJDA 2BGUA 1IZZA 2ZXFA 5ALPA 3V42A 1MUUA 3KJEA 5EWLB 1PFQA 3KZMA 1EFVA 1F2TA 4GVPA 2WWFA 1D6NA 3DOEA 5DBOA 2NTEA 3ZV5A 3WNDA 1MV8A 3ONVA 2JD0A 2X5KO 3QENA 3HR4A 3IA2A 5DWDA 4P1ZA 5GIOE 5JDIA 3G17A 4MQ4A 4EJMA 3VPCA 1E9DA 3BERA 3N07A 2PSSA 4O2BA 1U5BB 3VNQA 3DEJA 4E3WA 1XNJA 2B4YA 4UEQA 2R2GA 1G5RA 4OMFG 1ENZA 4ZZ0A 4TSFD 3Q7SA 1SXJD 2BJWA 3SYTA 5CLHA 1R0ZA 5T6MA 2Q5QA 3AKDA 4EM6A 2R86A 3HBAA 1AK9A 5IULC 2GZDA 1CLEA 4ENWA 13PKA 1M2NA 1M6NA 1RKBA 2IE0A 1EX1A 1SCJA 3A4VA 4FQ5A 5H82A 5JVDB 4AY3A 2JGJA 1P1CA 5JSKA 1X1DA 4NYMR 1B42A 3VTAA 4FXPA 4GKJB 2ISCA 1RLMA 2EHDA 4NXNB 3H99A 4IXNA 4R2WA 5B1DA 1KIMA 3ZDDA 5AVTA 5FPHA 3JQDA 3BB4A 1L5ZA 3U6BA 1PVOA 3V8VA 3HVUA 4EG3A 1G19A 4LYAA 2OHJA 3RFCA 4E4TA 4MVJI 1XTSA 2P9EA 1H2YA 4NE9A 1RRVA 2CW5A 3PC6A 1E98A 3SS8A 4EKDA 3G02A 2XYQA 4QGFA 1N78A 1G3UA 3LY8A 1NYTA 3DHWC 4YMHA 3C3JA 1N2OA 1T9KA 3F3YA 5EESA 2XIQA 2VL7A 4UNNA 4X20B 1DB3A 1P0CA 4DSUA 2O54A 2Q2NA 2HB6A 3I73A 2QLFA 3GFRA 1TX4B 2OAEA 1ZUNB 4BCDA 4LK3A 2WRZA 5CJJA 4IILA 4CBVA 1J8YF 4QL3A 4WOJA 1O1YA 1QMPA 3QNMA 3CH6A 5J4LA 2JFOA 4DAEA 2IY7A 1E66A 1T9ZA 1U7WA 4I2VA 3NVAA 1S8NA 3AHIA 4CTOA 1IVYA 2H7VA 2RHDA 4D0RA 1IZYA 1KOFA 2IZOA 2ZB8A 2IU0A 2TRSB 1J2JA 1R4MB 5D7BA 2HWWA 2E9SA 1I9CA 3AFOA 4C3OB 5KQGA 3EULA 3R7BA 3OT1A 1E6WA 4JHLA 2GD1O 1TAUA 2HQBA 4H16A 3DW1X 3WK7A 2YOGA 1TCUA 7AT1A 4MV9A 2M6KA 4KXUA 5DNUA 4CEIA 1GAXA 4EPXA 2D5IA 4FBGA 2NW6A 4TTPA 3UPDA 3HV0A 4CE6A 4LGVA 4G8BA 2PZKA 1YIDA 4O4LF 2GPSA 3CKKA 4LSMA 1C1HA 3TM5A 4A82A 3AM4A 1CR1A 4MZDA 5K0CA 3M5DA 3C16C 1XZDA 5H8WA 2I2DA 2R6FA 3KAJA 5E1OA 1CE8B 2QX4A 2Y2UA 4XLTA 2IIVA 5SYMA 2CUKA 2VH1A 1D2RA 1KEEB 3BORA 3ZS9A 4C2UA 5LYYA 3VI4B 4Z4GA 5JWOA 1ECGA 2J1LA 3FTPA 5AI8A 5I7RA 1KY5A 4HNRA 1SELA 4S1NA 4R8MA 4Q1VA 3SNKA 1PBTA 1ZX1A 1L1FA 1DKUA 1A8SA 3OZBA 2OQ2A 1XPUA 2NU8B 5A71A 4H27A 4HWPA 4ZYWA 3PJGA 4OHXA 1S2LA 3HYCA 3WNVA 2X4IA 1MD9A 2QTCA 3VR5H 4EUKA 1AV7A 2R7NA 3CLRD 3R3VA 4K9LA 3ULKA 5BMVF 3RKSA 3PC7A 3B1KA 1QCZA 2W6PA 3EE6A 1AZTA 5THKA 2AK3A 3JQGB 1O9BA 4FNOA 1C9KA 3QF4A 1YBMA 4OD0A 4OQPA 3T3EA 5A5GA 3DW3X 3K9FC 4WNCA 2X8WA 5F1PA 4H7KA 4IIEA 3VV3A 1TKRA 2RGDA 1YDEA 2G77B 1DG1G 1JSRA 2V3WA 1J2RA 3QXJA 3H16A 2EIXA 2WVJA 1O97D 2I4OA 5AVKA 4V0QA 3WR5A 4OHBA 1MFPA 2I1LA 3U7IA 2JAPA 2X7HA 3KPUA 2GCPA 2AVDA 4H6VA 5JV5A 2X14A 2IIPA 2D1QA 3DHNA 5TS2A 1HSOA 1NVVR 4ZOLF 2FJUA 4OYLA 1AXEA 3AYXB 1WCWA 2DPMA 1RHRA 4Z2AA 3AQ4A 1UXIA 1PJCA 1QGOA 1SQ5A 3MT7A 1M8KA 1Q7TA 3AF6A 1SBHA 3ESAA 1UMBA 5G1PA 5H3CA 4LZOA 1OR8A 2Z8YM 3EUWA 1Q44A 3LQ4A 4HFMA 4E2YA 2XCQA 3PGMA 2O3TA 3MTAA 4HDSA 5T5QA 1EJ0A 5DBHX 1XYVA 1OW3B 4WNYA 4JI7B 4XW2A 2FN7A 3WSTA 2HI0A 4LYJA 3TTUA 3FZQA 3WXBA 3OPNA 4NECA 2FZVA 2PT6A 4CL3A 4A8PA 5K0ZA 5IHXA 2W2TA 4DQLA 1GN8A 3OQ6A 5J2UF 3TZEA 4ABTA 1IN5A 4BMPB 1Y9DA 3TAHA 1WEKA 3NHZA 2R65A 4KODA 5EHNA 4Y