3LY5A

Ddx18 dead-domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
211
Chain Sequence
TGAFEDTSFLVNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DDX18
total genus 69
structure length 211
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ly5A00
1G8PA 3T35A 4Z1MD 3A8TA 5HTKA 1E0SA 3L43A 4LI0A 4KFUA 2J0QA 2W58A 2KB0A 5EE9A 1U0LA 5P21A 2ZI5A 2O8FA 4RFSB 4KLNA 1Z8FA 5H70A 3RAPR 3WHKA 4PSKA 4F4JA 1FX0A 1FX0B 1YQTA 1YZGA 4X8OA 4Z8YA 3PJRA 1H8HD 2QTHA 3KKQA 4GNKA 4DLTA 2YINC 3Q5EA 4DDVA 1D9ZA 2OILA 4PO9A 2ZRCA 4WZBE 1AS2A 2ZVQX 3VTKA 3QF4A 3BGWA 2H5EA 3VU9A 2JLQA 4AC9A 3LW8A 2A2ZA 3NXSA 1KZ7B 1BH2A 2J87A 3VX4A 4ABYA 1VIAA 1G41A 3U7HB 1AS0A 2QPAA 1XCGB 1R5OA 3SJBA 4A0GA 2CEAA 4L15A 2CL6X 3FMFA 1YRBA 2A5GA 1Q57A 2BHRA 1SVMA 4GOKA 5L8VA 2GJKA 4LJ7A 1YU9A 4H9GA 3CONA 2SHKA 1F2TA 1Q1ZA 3HU1A 1GKIA 2KJQA 5FOVA 1Z0IA 2FZ4A 4DLVA 5F9HA 2REXB 1BKDR 1G3RA 1U2RA 2IYTA 5FOUA 3U7FB 4QGHA 4GT1A 4JVLA 1BMFD 3QVVA 5DISB 2OBLA 1ODFA 1S1CA 4OHXA 1T6NA 3RS2A 1G18A 2NG1A 3PXGA 3EW9A 3T5DA 1SXJB 2Y8EA 3WBJA 1OHHA 1OXSC 3WP1B 4EFMA 3NC0C 1OKKD 1P7CA 1XU4A 3CX6A 1NMZA 3B78A 4PHGA 3SQXA 4QHSA 5E7JA 1W0JD 1T91A 2ZRNA 4OI1A 4RD3A 5KDOA 3QBVA 1YR6A 1TL7C 4V0LA 3OEEA 5FBWB 4DXAA 4IKEA 1IN5A 1W36D 1T5LA 3NKVA 4K46A 3WNCA 3GJ6A 1N5KA 1R10A 3TVDA 5JEEA 4IJMA 4TLBA 1IY0A 5EE1A 2ZJBA 1N0VC 1KI9A 1ZUHA 1EFRA 5FR1A 5TV2A 1CBUA 2ZJ8A 4NL4H 4M53A 2GEVA 4PR0A 3C4JA 3CPHA 2GA8A 3DZDA 1E9SA 4LBZA 3IBYA 4QBHA 4V0KA 1NVUQ 3KUCA 3WXMA 5HZKA 2J7KA 1NBMA 4TMKA 4M2LA 3GLGE 1CLUA 2XSZA 2OHFA 2OE2A 5EJEA 3U61B 4N0DA 4F4CA 2PCJA 2JA1A 1UDWA 2AK3A 1HEIA 1Q22A 3IILA 4YDSA 4D4KA 4DZZA 2RKOA 2IF2A 5JZVA 4NCKA 1M34E 2A30A 3X1DA 1FTNA 4DUGD 5DE3A 3H4MA 1FFHA 4FD2A 1NIPA 1XD8A 4G0NA 4M4SA 2G1JA 4Q1AA 2G3YA 5BQ5A 3ZVLA 3CF6R 4D80A 1FUKA 2BJVA 2J5XA 4KU4A 4Q1BA 2YNMA 2JLUA 1S2MA 1VYTA 3ZGXA 4PZZA 4IFEA 1Y3AA 4LJ6A 1N5LA 2O8DA 4TQAA 4RY2A 2VLIA 1WRBA 5JECA 5CM9C 3SBEA 1HE1C 1QVRA 1BMFA 2GEDA 3GEHA 3OEHA 3U3JA 2GKSA 1WDTA 3J81k 5IRCD 3AVOA 4D26A 2ZANA 3FFBA 2WKRA 3CPEA 1JI0A 3B9QA 4PHFA 1DE0A 3VR1A 4MYUA 2FOLA 3EWAA 1OFHA 4IOJA 3FHTA 2BEJA 4IOMA 1E98A 1XEXB 3PUYA 2JLRA 2ZRJA 2QE7A 4A2QA 1SKYE 4JBYA 4CT4B 5LPNA 3L2OB 4EQ6A 2DFLA 1EWQA 2IXFA 1GRQA 1A7JA 2OT3B 5G3ZA 1N6IA 5BYKA 1CJTC 4PANA 1PUIA 2ZSFA 3D8BA 1IN6A 4TL9A 1ZYUA 2W6JA 2C9YA 4POAA 1U8AA 1NRJB 2G6BA 5CIQA 3C8UA 2G9NA 4DC9A 4C7OA 1WMSA 2FU5C 2NO6A 4K81B 2A5JA 1G4UR 2KE5A 3ASZA 4LBVA 4HAZA 4YXWD 1P4SA 2CK3A 4TQ9A 1XD9A 2C5LA 1G8YA 3VKHA 4HZUA 1N6PA 4ACAA 5J5CA 3DMDA 4O2LA 3KQLA 2WJGA 2GVZC 1MR3F 3D31A 4LCBA 4L16A 3TQFA 2Q9BA 2XEXA 3QKRA 3QKRB 5KSOA 1XEWY 2P0EA 3AF1A 1G1MA 2EW1A 5CIWA 2PJZA 3FKSA 2FGKA 4KAXA 3UMRA 2WOJA 4JKIA 3KUDA 4OK6A 1ZNYA 3PEVA 1P9NA 1NG1A 4DT1B 4BLQA 4TZ6A 3BERA 1VECA 3QEOA 3P26A 1UAAA 2IYUA 3SEAA 4XH9B 1FZQA 4PAMA 1J90A 2HEIA 4Z8XA 4ZCIA 4BFSA 1TMKA 1KK2A 5EP3A 4NMMA 4Q00A 1KDRA 3TE6A 1XRJA 3BWDD 2XJ4A 2JEOA 5CJPA 4B48A 1VG8A 3QXCA 3EASA 4TTRA 2C2HA 4L5BA 1PJRA 4II7A 4YONB 5FPTA 4FWIB 4BLSA 4TMTA 4V0OA 3GJXC 4JSYA 3TW8B 3ASYA 1KY3A 4IOKA 1P60A 5BN4A 3BFKA 1OYWA 2WAXA 1G291 4MKFA 2DFKB 2R65A 2GXQA 3GEEA 1TEVA 3AUXA 3T12A 3UG6A 3RDPA 4HZIA 2XZPA 3AGQA 4CF7A 4CEHA 4B6EA 2ZE8A 2AL7A 1H8EA 3QXJA 4QC2A 2OCAA 3ETLA 2NMVA 3MWJA 2QU8A 4LYJA 2PMKA 1I4DD 2EFHB 4PPFA 4M1KA 4PPGA 2CHVA 4B3BA 1YVDA 3WY9A 2HF9A 3BH0A 4K8OA 3DDCA 3CZPA 3DZ8A 3UANA 2HUPA 4RCZA 1JR3D 4U5XA 3HU2A 4OBEA 4R2IA 1MO3A 2N1BA 1P5ZB 2PT5A 4A8JC 4GSYA 4TQUS 3Q7PA 3RS5A 4X8LA 2YOGA 4M1OA 1SVWA 4MYTA 4GP6A 3W6NA 4ARZA 5JJIA 4YC7A 4E09A 1ZM9A 3M1IA 3R20A 2IHBA 3X1YA 2GEUA 4BASA 1G64A 4B3CA 1YZNA 3K1JA 2J3EA 4QHYA 1NN1A 1UKEA 2FWRA 4PPQA 3SI7A 4M0LA 1BOFA 1CIPA 2L0XA 3H86A 3WRXC 3QKSA 1NKTA 3UWKA 5G40A 2VHTA 1Z0JA 1GILA 2WJYA 2O8CB 2OZEA 1U0JA 1ZUNB 1VCNA 1QHHB 1Q20A 2EWVA 2NQ2C 1SHZA 5FTMA 3MJRA 3LY5A 3BFVA 3TSZA 2ORVA 4MRRA 1G5TA 4HEJA 3SBDA 4AYXA 5EP4A 2QBYA 2FNAA 2FJUA 1G9XA 5GJWC 1LNZA 2AK2A 2QY9A 3WNBA 3FGNA 3U3OA 2ZROA 5EXPA 3TSWA 5AJVB 1HTWA 1QVAA 2P2LA 2IYXA 1EFUA 4IVQA 3I62A 1K8RA 4DVGA 1XJQA 4A8JA 1OB5A 2RAPA 4M1SA 4PHTA 1IONA 1E1RA 3OFNA 1IJFA 2XX3A 5G3YA 3SHFA 2QAGB 1DAKA 1KHTA 1OH8A 3WMFA 5FOXA 1NF3A 3AVWA 1F3OA 2CK3D 1U94A 4FMCB 4IRUB 4DLXA 3FDIA 2YZ2A 1J99A 621PA 2J7PD 4LY6A 5DSZA 3PG5A 3GFTA 2C9OA 4KLZA 4DRZA 5DN6A 5KU1A 2YWFA 4NH0A 1MO4A 2R9VA 4ZDJA 2ZYTX 2H92A 4TYQA 1JPJA 4C0KA 2BMEA 3A1UA 3W5IA 2A3RA 4XIGS 4HB2A 2WKQA 3CZQA 1II0A 3BB1A 4RD1A 1NLFA 3BAFA 4LYHA 4B3DA 4ZCLA 3CRVA 1CR0A 1YRAA 821PA 4Q9IA 3M0EA 4G1UC 2X19A 3WP0A 3L8YA 3MWKA 1GL6A 4FMDF 1NVXQ 1OW3B 1G7CA 3NH6A 2QEQA 2OV2A 4LJ5A 2E1RA 5DYGA 4JLPA 1XJ0A 1YJ5A 2IYQA 4R71A 4IW3B 3VHLB 3EZFA 3Q5DA 4ASUA 1D8TA 3IQWA 1YE8A 2J46A 2ZJ2A 3CW2A 3T06B 1UEJA 5JRJA 4TYWA 1W2GA 4EDHA 4IXNA 3W9YA 1GNPA 4G01B 4BLPA 2IS6A 2FZLA 2ORWA 3X2SA 2IW3A 1LS6A 5DLQC 1NN3A 1Z6AA 2IBMA 3KJEA 4D81A 3O8DA 1A1VA 3K9GA 4MGZR 3U44B 1EFTA 2QM8A 3L0PA 3FHCB 3GJ5A 1UJ2A 2NO0A 5HKKA 1E3MA 4HB4A 2OAP1 4PSVA 4NYIQ 3VNVA 3RC8A 3NHAA 3B1YA 2ZREA 1P3JA 2FH5B 3QF7A 3N5CA 1G16A 2ZRGA 4URWR 1T8UA 2QORA 4PSAA 1HE8B 2CLCX 5D3MB 4P32A 1IAQA 2OESA 1ONBA 4A15A 4CT5A 1OXXK 1DAGA 1E2EA 2A9KA 2LCFA 5AR1A 2OAQ1 1K5GA 3LLUA 3NDPA 3SOPA 4A0HA 3OEED 3CH5A 3QPWA 2AXNA 1UBFA 2GZAA 3M6AA 4M22A 4KFRA 1K5DA 1E4YA 4S35A 5LBIA 1II8B 3RYTC 1RRGA 4Q1EA 1XDBA 2RCNA 3Q7QA 1KJYA 4P33A 3K0CC 3K0CA 2ZRAA 4BWYA 1MO6A 5J4KA 2P6UA 3A36A 5KYKA 2X1VA 3IDQA 3Q8XB 4ZV4A 4ESHA 1DELA 3TRFA 1EXMA 1Z47A 3MAAC 1CS4C 1O87A 2WIBA 1KDTA 3U4QB 1WP9A 2WJJA 4W5WA 3K70B 1AKYA 5K8UA 3FYHA 2P65A 2HLDA 3TUIC 4QBGB 2AWOA 1P2SA 3AUYA 4J0QA 3DM9B 4NCNA 4MA4A 3R8FA 1NY5A 4UXIA 3OIVA 2KI5A 1S96A 2PZGA 5GJVC 3BH7A 3VKWA 2Z4RA 2ZS7A 4TTPA 3VNUA 2Q21A 4OI2A 5M04A 1P6XA 1QHHA 4JLDA 3UIEA 1W4RA 4IXMA 2O5VA 3GMTA 4EFLA 1UPTA 3HYTA 4Q48A 3EA5A 1KAOA 4P4TA 4B3FX 4IHQA 4W7SA 5E7IA 2E87A 1AS3A 1VCOA 4R7ZA 1G6OA 4FMCF 2C96A 1G21E 1P9WA 4D25A 4B3GA 1OLOA 3BS4A 5HCIA 3IUYA 5CYPA 4NCIA 1G4AE 2QI9C 2PJRA 5FPSA 1ZBDA 3AVTA 3W3ZB 4URXR 2VL7A 2AXPA 3MRSA 1UF9A 3ZD7A 2ASEA 4TYPA 2JJ1D 2CDNA 3QE0A 4A2PA 1XEWX 3W5JA 1CULC 5LB2A 2BEKA 2W6ID 1TUIA 1W46A 1VYVA 3U4QA 4P3YA 4UJ5A 2VTKA 1MH1A 2X77A 3AP3A 5GVRA 2XITA 3NDBB 2JJ2D 5TDHA 4Q4HA 1UFQA 2E9SA 5TXGA 3W8NA 1N0WA 3QPVA 2VHQA 4TL7A 3CNLA 4DWJA 2QMOA 1FOEB 3IKJA 1NMXA 1W7AA 3R8CA 3CR8A 1N6LA 3EPKA 4FIDA 1GL9B 3VHXA 4G3XA 3A37A 3RSLA 1DAIA 2EFDB 1Z0KA 4GP7A 1XTRA 3VR4A 2CE7A 1CP2A 5F2EA 4GMDA 4PC3A 4RSGA 2DWQA 4JBWA 4C0JA 5HKKD 3DMNA 1US8A 4IOLA 4RD0A 4DBLC 1L8QA 2RGDA 5D3MA 3AH8A 1KSFX 1B23P 1QHGA 2TMKA 2YJTD 3ONWA 1GVNB 3S1AA 5E95A 3B1XA 1MO5A 2G0NA 3K0AB 1C1YA 4RFVA 2ZTSA 3SFZA 5L3RA 1KO4A 3GLIA 4M9QA 3PV0A 5DH9A 3QIAA 1FTSA 4JVMA 5FOSA 2DHRA 4NYMR 1OHHD 3TAHA 3K0FA 4MRPA 2QP3A 4AKEA 3DM5A 3EX7C 3K70C 3WYGA 3EZ9A 4LBWA 1BS1A 2IYZA 1SVKA 2W0SA 2JJ8A 3GLFB 2XXAA 1NSFA 1KMHB 3C5CA 4GOJA 4JL5A 5J4YA 3DOFA 2NO7A 4PQYA 2Z6VA 3GPLA 3V00A 4DJTA 2FEOA 2BBOA 4ZI2A 3K0FB 4ITRC 5KNBA 4C7OB 1U99A 4HLDA 1XXHE 4ZPXA 3LXRA 4GPTA 3U5ZB 4M9SA 1KYIA 1QHYA 1KO1A 1X1SA 5EE3A 1E69A 3N2IA 2BKEA 2H8KA 2HYDA 3ND9A 4MGKR 3UK6A 4ZCMA 4G5OA 4NCJA 4UKDA 4E03A 3M4YA 3L8ZA 2W2XA 1QHIA 2ZSDA 4UNPA 1WQ1R 2EFEB 3B7GA 3R9IA 1YHNA 2D2FA 1KTVA 1XMVA 2IF0A 2W00A 2F9LA 2FEMA 3K9HA 4N0EA 2LWIA 3I8XA 3F5FA 1KI1A 4PFSA 4V02A 5CK5A 5B30A 1SKYB 3UKDA 5FPHA 4EJSA 1W5SA 4CEIB 1SQ5A 3GFPA 1QHXA 1COWA 2GWHA 4NYIR 3BBPA 3CX7A 1KMHA 4FMBB 3OZXA 4TLCA 3DHWC 3IO5A 4A6XA 3AM1A 4R98A 1WBBA 4BFZA 5SZIA 3WRYC 1XP8A 3WBKA 2GAAA 2C78A 3HPQA 2WKPA 3IEUA 5C1BA 2GXSA 2J41A 4EPRA 4LGMA 2ERXA 3TR0A 4DLYA 4UQOA 4UNRA 4ZDKA 2VP6A 3CX8A 3FMPB 2Q6TA 3PUZA 4UXHA 2ZSBA 421PA 1Z6YA 4AKHA 3QXXA 4Q1CA 4WXRA 2ZJYA 3G5UA 3G82C 8OHMA 2VSOA 2QUZA 2CL0X 4EUNA 4DLRA 4UNNA 2ZUCA 1Z0DA 4QFMA 5TY0A 1PLLA 1M1YE 4D0NA 4A9AA 2CVFA 3OESA 3MLEA 1RE0A 1U8ZA 3ZQJA 1JXMA 3S1AB 4WOPA 2D3WA 2GRJA 1KK3A 5AJZA 2DFNA 1T4GA 2WSSA 4HAVA 3U3RA 1QHSA 2ZS9A 2A5YB 4HDQB 1MOZA 2ORIA 4HYYA 2QRNA 4Q01A 3AP2A 4QGFA 3BK7A 3ZYCA 1FMJA 5BXQC 5FL7A 3C16C 3FKSD 3FE2A 1KI8A 1S3SA 4XD7D 3EAQA 3NIBA 2QENA 3B6EA 2IS2A 3SYKA 1JXOA 4TLEA 1WCV1 3L0SA 3QXSA 1CR4A 3NBYC 2O0KA 1D2NA 1DO0A 1Z29A 2IYYA 3QEJA 3UPUA 2ZRLA 1D5CA 2F55A 4WAUA 3CNNA 3P20A 2ECKA 3ZVNA 3AGPA 4Q4HB 3AKCA 3HWSA 2Q9AA 2GCOB 3B85A 4A92A 3O8CA 4Q7MB 4DLWA 1N5JA 4JMPA 1H8ED 1FQJA 4JLBA 2G88A 3L0OA 1F48A 3SJZA 2V9PA 2NPFA 2ODBA 5CB6A 2QBYB 3FMIA 3PITA 3C14C 3VX3A 1NMYA 4KYUA 4PZLA 2RHMA 2QAJA 1CTQA 1XJCA 3AVXA 5GJBA 1KSJA 3ECCA 2BMFA 1DAFA 2BWJA 4HI0E 4JJZA 4LHYA 4RKFA 3WMEA 3ZVMA 4D4MA 4NDZA 4KV9A 5EP2A 4Z51A 1E2FA 3SN6A 3MCAA 5CK4A 1ZIPA 2GHIA 5G53C 3MJHA 3EIQA 3U3MA 1IHUA 4FCVA 4JJKA 1PZNA 1OXUA 1JR6A 1CJKC 1KI6A 4GMXA 2NOAA 1FNNA 4NU0A 2WWXA 2ZI4A 1TADA 2B8WA 1U81A 2GXUA 2YVUA 3HYRA 3TH5A 3LVQE 2RGNA 3B13B 3RSOA 521PA 1KIMA 1FNMA 1R4AA 2ZR0A 1ELOA 2F1JA 2ODWA 2CJWB 1RRFA 4JLVA 4PC2A 3B2EA 4AYWA 3GLIE 3GLFA 1T3SA 3LBHA 4LSGA 5J4HA 3WHLA 2F1RA 4Q7LA 3CLVA 4ASUD 2ZJ5A 3U7EB 1XCMA 2O52A 1KNXA 3RC3A 4US2R 2ZRKA 3EPHA 5FPKA 1FPMA 1F60A 2V1XA 2Q9CA 1E2IA 3MWYW 4QOSA 5KDLA 3ZIAD 1E1RD 5FUVA 2OXCA 3E5HA 2XTZA 1E2HA 1JPNA 2GBLC 2GCNA 2R2AA 3PEUA 2WWGA 4JLJA 4DIDA 1T0HB 4OYHA 4Q18A 3B1ZA 4DIEA 1TF2A 4TMWA 3SFVA 4A82A 2GILA 3A58B 1LF5A 3B8HA 1ZVQA 4HLCA 2FMXA 4OQXA 4KCGA 3BRWD 4I99A 3VR2A 2BIFA 1IXSB 4HSEA 4BZPA 3QPUA 2C8VA 1R8QA 2ZUBA 4RZXA 1KI3A 3ZDQA 4A2WA 4W5HA 1ZCBA 3I72A 1MABB 2DFTA 3CO5A 3LBNA 3GEIA 4LRWA 2XXAB 2ZJAA 3KDSE 3TUJC 5K8LA 4Q21A 1N0UA 2RMKA 4JLMA 2BOVA 1E2NA 3FPAA 1KO7A 2CLDX 2WHXA 3CNOA 5E7MA 3W90A 5L3VA 4M21A 4OQNA 2XB2A 1SVOA 2QT1A 1OJLA 3NH9A 5AK0A 3U60B 2JASA 3I92A 3PENA 3R7WB 2PEZA 2ATVA 3T1OA 2ZPTX 3DKVA 4KHZA 1ZCAA 2CJWA 5LDDC 1Z28A 1HQCA 2IK8A 1ZU4A 3I73A 3MG9A 2VSFA 3KFXA 4URVR 4AD8A 2QN6A 1RJ9B 1IQPA 4ZI3A 2PX0A 4KXFB 4DEXA 1Z5ZA 1XEFA 5E4FA 1NLYA 3PUXA 4N3NA 4TN1A 1OF1A 3EIEA 2GNOA 3JZMA 3BFXA 4NZYA 3OIYA 4EPTA 4ZIRB 1RPZA 4DB2A 1US8B 1G8GA 2CNWD 2XOKA 2BM1A 2RGCA 4OL0A 2FSIA 1E9CA 5KNCA 4MKIA 3CRQA 1VDZA 1QF9A 2QTVB 1XTQA 4U00A 2CCJA 4EPVA 1I4TD 2Z43A 4O3MA 2QP4A 1DAMA 2JDID 2XJ9A 4NP6A 1JECA 1VCMA 3K9NA 1UEIA 4QBIA 1SHKA 2WWHA 3IPXA 2WVJA 3FKQA 2VHCA 1XZQA 3REGA 1CXZA 4KBFA 3KQUA 2ZI7A 1X6VA 4OK3A 4I1SA 2BC9A 4XTCS 1GOTA 4HB0A 3U2QA 1E2KA 1P9RA 1SXJA 5KTYA 2QSZA 1G3QA 3U6KA 2VPPA 2GTPA 2C98A 5B2ZA 3REFA 4WXPA 4IVPA 2R62A 1R0YA 1KDOA 2OO7A 1E1QD 2D7CA 3P4YA 3TVTA 1XMSA 4BPBA 2OFWA 5L3SB 2B92A 4PC1A 5J40A 4TWZA 1DAEA 1F2TB 4XWKA 2OCYC 4DCUA 3K09A 1TU4A 2JLZA 1VTKA 1AA9A 1K6MA 4M1WA 2I3BA 2B21A 2J0VA 1VYUA 1JNYA 2BM0A 1LF0A 3IIMA 2FF7A 1D2EA 4CEJA 4B3XA 1L2TA 4BZXA 1ZM3A 3FOZA 2V8OA 4Q4LA 4D4JA 4LWZA 1PUJA 1JAIA 2HT1A 1M74A 4HAUA 4O2RA 1CR2A 4A0FA 5JSZA 4UJ3A 1RC8A 3KL4A 1S9DA 4M9XA 3SJAA 1NJFA 2Q3FA 2ODEA 1EFRD 4O25A 4A6PA 1GP2A 5TARA 4O0MA 1GZSA 4LPSA 4I4LA 1AJEA 4QRHA 4WBSA 1UKYA 1ZAKA 3R9WA 4KFSA 1ZMXA 3CWQA 3KXLA 5H8WA 1CJVC 2XSZD 1RYHA 3E2IA 1OH6A 1JBKA 5EXSA 1RIFA 2QROA 1P75A 4QKQA 3KZ1E 4NE2A 5JWOA 1R0XA 1Z2AA 4C2TA 1DS6A 2KBEA 1KMQA 5FI0B 5GJCA 1EFHA 3OFND 4BQSA 2D62A 1P2TA 3LVRE 4R2HA 5FBLB 3O8RA 4JKYA 5EUMA 1ZD8A 4FXPA 1Z83A 5G41A 2PCLA 1SGWA 1YZQA 4HUTA 5EE5B 3P27A 1G8FA 1DVRA 1LY1A 1E2LA 3JVUA 1YZKA 2WWWA 1E9EA 5F98A 3OAAA 2OFXA 1H8HA 3RWMB 5JCZA 2EFCB 5ELXA 2QQEA 3T5GA 1GIAA 3DPUA 2N42A 2W2TA 5FTLA 4WZAE 4BE7B 3MUFA 2OUKA 3MD0A 4EJSB 3RS4A 1COWD 1LV7A 2B8TA 5JWRA 1AQUA 1WF3A 4LJAA 2J0SA 2ZR7A 1NN5A 1Q3TA 3PVSA 1P73A 1KK0A 4ZDWA 5K8IA 2Z83A 4PX9A 1S8FA 5DO9A 5JI3E 3A4LA 4EQ6B 4MITA 3TAUA 4QNMA 5GADl 2ZQ5A 1E1QA 2V4ZA 3TLXA 4US0R 4KSBA 3FB4A 2RGBA 2G1KA 2GBLA 5FBQB 1R6BX 4URZR 5IK2D 1Z2CA 4JBXA 3SHWA 1G5PA 1NLZA 2JLWA 2H7VA 2ZJZA 3DOEA 3LAWA 4D2IA 1MV5A 1Z6XA 4A4DA 2ONJA 1AGRA 1E9AA 2CCKA 4HUQA 1I2MA 3LD9A 5JS7A 1ZD9A 3GJ0A 2ZS8A 3LWNA 3U7GA 3SYNA 3MSXA 5EZ6B 3KTAB 5KSYA 1LVGA 2ZE5A 4WA7A 3EARA 2AR7A 2WICA 4AG6A 3LRPA 1EGAA 1MKYA 1Q21A 5UKDA 2X2EA 3NHBA 1R0ZA 2NIPA 1JB1A 2VP0A 4CZ2A 1EK0A 4C0LA 1EX7A 1ZINA 1W5TA 5JSZB 4QGGA 4YQFA 1CKEA 4F38A 3O8BA 3CBQA 4KI0A 1N3BA 3UMSA 3V9PA 3AF2A 1R8SA 4TTQA 4OHVA 1NVWQ 3EG5A 5HE8A 4PPNA 4C0AC 4BFYA 4NONA 1DTSA 1KK1A 2ANBA 3TIFA 2GK6A 2XAUA 3CKLA 3PFIA 3AF4A 2WJHA 3KKPA 1J8MF 3X1XA 3EIHA 4BEJA 2VBCA 2HDNB 2YYZA 5CB8A 3LW7A 2BBSA 3QG5A 3PUVA 3UATA 1XNJA 2VH5R 3OE7D 2CLSA 4P0TA 4LHXA 4LV6A 4XJXA 1G5RA 2FGJA 1ZNZA 1NVVR 2ZXUA 2W83A 4KSCA 4E22A 3N70A 3P1JA 4LJ8A 3LBIA 2IA5A 2ZRFA 4WIAA 2YKGA 2BV3A 2LKCA 3ZZUA 5FBRB 4C0BA 3AVQA 2IYSA 3ZD6A 2ODNA 3A4MA 2CCGA 2ZYVX 5LD2B 1TQDA 2X8AA 4OQMA 3NBZC 2GDJA 2YWHA 3H84A 4Q1FA 4BECA 2YV5A 3OE7A 1KI7A 2UZ3A 2XTNA 3WYFA 4Y0AA 3PIRA 3GLFE 3DVLA 1VMAA 4MKHA 3VR5A 4G5GA 3QKSB 3AKDA 4E07A 1M7HA 2AFIE 2QL6A 4WW0A 3C15C 2IT1A 3OIUA 1E79D 1SVSA 1E32A 1TU3A 3MMPA 4AG5A 3LLMA 5DGXA 3PUWA 3BE4A 4TLDA 5AJXA 2ZM5A 2H18A 4LHVA 1EFCA 1B0UA 4C3ZA 4GL2A 1A2BA 2IXGA 4DLUA 2FFQA 1C9KA 2GJ9A 3T34A 4XVUA 1GSIA 4QJ3A 2BMJA 2J45A 1XX6A 4Q9HA 2WBLC 1W36C 3ICEA 3NTUA 3RHFA 2XNDA 2VP5A 2FV8A 1XCPA 2XTMA 3K53A 3NG1A 4IVRA 3ZH9B 1KKMA 1W49A 2W6IA 2QG6A 3K0EA 2EYQA 3JZAA 4JZKA 1TAGA 4Q4AB 5LD2C 3CB4A 2D7DA 1N2CE 1VG0B 3IIJA 4ZKEA 1OKKA 4B47A 3CUEF 4C30A 1GM5A 4RZ2A 2ZI3A 4S2EA 3LNCA 2ZAOA 5AJYA 2Z0MA 2F3TA 2HCJB 3AP1A 1W47A 2CE2X 2QQ0A 1OXTA 5IK2A 4CEHB 2ATXA 1QZXA 4W5JA 1R2QA 1SVLA 3C41J 4JL6A 4Z54A 3EZ7A 4U7DA 4QHTA 2CXXA 2DPXA 1OE0A 2ZU6A 2WZQA 4V0MA 1SKQA 2ZU0C 5JS8A 2D2EA 4A0RA 1UKZA 1XBTA 1DO2A 1G19A 4MYHA 1D6JA 4QJ5A 3CPJB 1CRPA 2QE7D 2EYUA 3ZVRA 1M8PA 2VQSA 3I5XA 4M1MA 2O0JA 221PA 2WSSD 4TMVA 1E9DA 1Z22A 4C0HA 4URYR 1KO8A 5CLQA 2JLSA 2ZUDA 4GBMA 3SR0A 2IC5A 4XD7A 4DT1A 4LPKA 1E2JA 1T9HA 1HY3A 1ZC4A 2MSDB 4EFNA 1E2PA 3CRMA 1W0JA 2PLFA 2QMEA 3NC1C 4UNQA 1R0WA 2VSXA 5JI2E 3THWA 1ZIOA 1P61B 1Q3HA 3R9XA 1SXJE 4NTZA 4Q03A 2REBA 4XWAA 1R7RA 3VAAA 4FCTA 2FFAA 2ZIAA 3BH6A 3AV0B 4LC1A 4HB3A 1NG9A 5CJ2A 5JHGB 5FOTA 1ETUA 2PEYA 2CVHA 1GRRA 1XWIA 2IHYA 2LKDA 2N46A 2YC4C 5FPYA 1F5NA 1Z0FA 1G7TA 2IEZA 2WTUA 1E96A 2MMGA 3X1WA 2C77A 2RGXA 3A1VA 4PQRA 1PV4A 2HV8A 4ACBA 2XNDD 4R9UC 3GLIB 1ZP6A 3VKGA 1DADA 5HZHA 3EA0A 2GCPA 5FUXA 1GTVA 1LW7A 4P4SB 2HJVA 1XD2A 1GL7A 1C4OA 1Z6GA 3K0AA 5D3QA 2QP9X 1E9BA 3SE0A 3LFUA 2R6GA 5DI3B 1IN8A 2CMKA 1RRCA 3GJ7A 1OIVA 3MGCA 1UKVY 2OM2A 1J70A 1AK2A 5CYOA 3T15A 3CM0A 5L3SA 1HT1E 1E79A 4GFDA 3B1WA 1BYUA 4JT2A 2J9RA 2P5TB 4PTLA 3ZIAA 3H0KA 3RRYA 1XMJA 3NBFA 2ZSAA 4BFWA 3FFAA 4NCHA 1G20E 4YMSA 2P6RA 4HLQB 2HT6A 2VP9A 2V3CC 4C9BA 1JR3A 3NVAA 1M2OB 3GLGA 2QMUA 1Z63A 4DDWA 5B57C 2GCOA 1T8TA 4W9MC 4PXAA 1L4UA 4B2LA 1F2UB 1G17A 2ERYA 2WWFA 2HXSA 2JLYA 2O8EB 1XTSA 1HURA 4DCVA 2O8EA 1ESMA 1EG7A 2ZI6A 1A4RA 2XNSA 1N6RA 3KB1A 4Q4JA 3L82B 5BW8A 1S4QA 5FTKA 4Q47A 1XTIA 3FMOB 3LQQA 2UZIR 1T3HA 1QBKC 4Q7JB 3TNFA 4A8JB 3RNLA 1CR1A 4RJLA 3WMGA 2O8BB 1FW6A 4PQFA 4MYCA 5EXXA 5CITA 2P5SA 4NPHA 1FMLA 3TMKA 4TZ0A 1VPLA 2BDTA 2F9MA 3I5YA 1IN4A 1RZ3A 3ZLJA 1KO5A 2AWNA 721PA 3H1TA 1X1RA 4CW7A 4C4PA 5DN6D 3KKNA 4RD2A 5CDFA 1X8LA 3GCGA 5EE0A 1W1WA 5CLLA 4F91B 1KI4A 4HLUA 2WPDA 2OCBA 3HP1A 5BWMA 3Q3JB 3MFYA 4UNSA 4HATA 4V0NA 3VR3A 3TGPA 4D0LB 1S0UA 4IEEA 2VYFA 2V55B 2FE4A 2AHOA 2WSMA 3ZS8A 3TJZA 4QXAA 2ZYUX 5C4MA 4F93B 2ZEJA 4TYYA 1ZNWA 3EC2A 2GVDC 3KKOA 3NEJA 3V4FA 4GZMA 4GDFA 2WOOA 3U44A 4GI7A 4DKXA 2OBMA 3SQWA 3SC3A 3HDTA 3DO6A 4RVCA 2WMNB 1GWNA 2IXEA 4M1YA 4MRSA 3ZS9A 3LA6A 4AI6A 1OH5A 5FOWA 4OJQA 4PO8A 4EJSC 2Q3MA 3D3QA 3TSOA 1SVIA 2P6NA 1NIJA 3I3SR 4D82A 2ZRMA 2QAGC 1IXZA 1ZW6A 2VIIA 1GNQA 1ZU5A 3G0HA 2PLRA 3B82A 3ZQ6A 4CEIA 2DWOA 3ADDA 5JCPA 4FN5A 2FPLA 3AF3A 2F1HA 3SNHA 2GAOA 2FPMA 4LJYA 2ZE7A 3ZZTA 1II8A 3K70D 2WMOB 4NHOA 1ZRHA 4CDGA 3IEVA 2CBZA 4BFVA 2YWEA 4I1UA 4LDJA 2V6JA 5H1YA 3T1TA 2IX3A 1J7KA 5CDFE 1GDDA 3THYB 2O0HA 1XB2A 4B44A 1JQLB 1TQ4A 1XEXA 2V6IA 4M9ZA 3IQXA 5IHPA 1T5IA 3DL0A 1VIYA 4FCWA 3RABA 2FSFA 4OKSA 2FG5A 4Q19A 5KPDA 2G77B 3KJHA 4ZO4A 5H68A 3VU9B 4Q9KA 1IM2A 1HH4A 121PA 3BD9A 3QF4B 3QVUA 4HLUC 4ZDIA 3TK1A 1XPUA 1KY2A 4G5QA 2JATA 4C0SA 3HPRA 5TVKA 4A1FA 2YWGA 4B43A 2QAGA 2WM9B 5EQTA 1IY2A 1KOFA 2RGGA 4PC6A 4Q9JA 5TB5A 4BRUA 5FBVB 4F92B 5KDDA 5F9FA 2IYLD 1XXHA 3THXB 4LOAA 4MGIR 1NSTA 2ANCA 2OEPA 3LDAA 4BLOA 1U98A 5JFGA 2KWIA 4QL3A 1IOZA 1ZC3A 4RFSA 3I8SA 4IDQA 3V4RA 1JR3E 3A4NA 2ZRBA 2YC2C 3SDZA 3KJIA 1JEEA 1G3MA 3W3AA 3KQNA 1VCIA 1XZPA 1U90A 4F7WA 2IUSA 1OV4A 2BBTA 5KOYA 2FPKA 1V5WA 3THOA 1XMIA 1TEXA 1W4BA 3BJIC 1EWRA 4BLTA 4JSTA 2KSQA 1OFIA 2JAQA 3RLFA 1CRQA 1PLJA 3U6BA 1KAGA 1M7GA 1HA3A 3BIFA 5JMTA 2PX3A 4EAQA 1FL9A 2ZVPX 3I32A 4TT3A 1SULA 1E6CA 3LO5A 2B7BA 4FMDB 3VR6A 4B32A 1CF4A 1QG2A 1N25A 1WE2A 1Z07A 4PHHA 5B64A 1KKLA 1DARA 2R8RA 2QPTA 1Z06A 1E2MA 1Z3IX 2OG2A 4OK5A 3KQHA 2REOA 3KFVA 5DIFA 3AKEA 4MDFA 4DCNA 2QNRA 3RVBA 1JALA 1Q1EA 2ONKA 6Q21A 1GRNA 4TMXA 1TF7A 3W8RA 3AEZA 3T61A 5KO2A 1T0JB 5HR5A 1BYIA 3Q9LA 4TLAA 2C9CA 2EQBA 1W44A 2RB4A 2B6HA 3EPLA 4BGDA 1RYFA 2R6FA 1FQKA 4L9SA 2PL3A 2IS1A 3BORA 4RCYA 4RD6A 1MT0A 2HLDD 3FVQA 2JJ2A 3SYLA 2O8DB 5EZ5A 5C46F 3HJNA 1U9IA 5FL3A 4PAQA 3ADCA 2EFGA 4IEIA 4HDCA 2VA8A 4Q02A 5E3HA 1GAJA 3UWOA 2AKYA 4LHZA 1D9XA 2BVNA 3Q85A 1E9RA 5IDVA 2VP2A 5AJWA 3KXKA 5AUNB 1W0KD 3JVVA 1W4AA 2DB3A 4F4IA 3QBTA 2GETA 1QG4A 3RRNA 3GD7A 2IYWA 1N6KA 5F3WB 4KO8A 1WA5A 1JJVA 1YR7A 2WIAA 3P32A 4LYFA 4I1VA 4XWOA 5IT5A 4NYMQ 1FP7A 4Z1MA 3GFOA 1NKSA 4QNRA 3TKLA 3W6PA 4JT4A 4ERNA 2DBYA 1WBDA 4ZKDA 4DEYA 4KITB 2IYRA 2WJVA 2F43A 3CF0A 2DWPA 1VKJA 3EZ6A 4CVNA 4DLZA 1W2HA 4QGAA 5BN3A 2WV9A 3NEYA 2GZHA 5DNYB 3DEFA 1QHNA 1YR9A 3HR8A 3A1TA 3CIOA 1W0KA 1XF9A 4YMTA 2NZ8A 3RRZA 1NL3A 3TUZC 3GJ3A 1DOAA 1I4LD 2GXAA 4B34A 1MRNA 3FHOA 3A6PC 1Z0AA 2NGRA 4ILEA 2J0UB 2CL7X 1TX4B 2QA5A 1S1MA 4NBSA 3GJ4A 3QG1A 1BIFA 1Q1BA 3VMFA 5J4LA 4HZUB 1LB1B 1ZM4A 3QJYA 4EKDA 2V1UA 2BCGY 1P2UA 2QSYA 1A82A 2YHSA 1X8KA 4Q7KA 3ZZ0A 3PEWA 2CHGA 2ZRHA 2PH1A 2ZITA 3O47A 2O8FB 1KNQA 1NBME 4Q9LA 1NI3A 2OBNA 2R6DA 1PLKA 2GJAA 1F2UA 4C2UA 2WWIA 1TQ2A 4NKRA 2AD5A 3SJCA 2NPIA 1DPFA 1GFIA 1FUUA 1Q1QA 4Q66C 4OHYA 5FFMA 3K9LA 2FX3A 1N5IA 5JJLA 4GOXA 2B7CA 3TQCA 4B2PA 5KPJA 2H1LA 1MABA 2VO1A 1GKUB 4CGZA 1JQJC 3BC1A 4DDTA 1Z08A 4HAXA 2FSGA 4B75A 4BFUA 1NNEA 3C5HA 1OIWA 1OSNA 1U9IC 2V54A 4LUCA 4LYAA 1VG1A 1M6NA 2KBFA 5A0FA 3RS3A 1CJMA 1IXRC 1ZM7A 5C2JB 5KNDA 2H17A 4YLGA 5DI9A 4GZLA 2JGNA 4DSTA 3EWSA 5SZKB 1KDPA 4TMZA 3QQ5A 3A1WA 2GJ8A 1V43A 3SU8A 5SZJA 4JL8A 4MDEA 1L7VC 2H57A 2MSCB 2G0TA 1F6BA 4OQLA 2XZOA 3GQBA 2RHDA 3FTQA 3SZRA 1QDEA 1P62B 4IDNA 2OLKA 1O3YA 3W34A 4B6FA 3EC1A 4LV8B 2IEYA 2PBRA 2ZAMA 3OEHD 3EXAA 3EPJA 1NBMD 3GP8A 3OIWA 1CJUC 1A5TA 1H65A 1E2DA 4PZYA 4KJZA 2IL1A 3KX2A 2BCJQ 1R5NA 2PZEA 4G5SA 5A4JA 4BFTA 1HQYE 3RRMA 2BKUA 3IHLA 5GVSA 4KODA 1GNRA 4B35A 4IDPA 2F3RA 4LHWA 4MRVA 2ZRIA 4NYJQ 1CEEA 3PQCA 1UBEA 2W2VA 1I2DA 4XVQA 4MUAA 4AY2A 2C04A 4DSUA 1KSGA 1E4VA 1NY6A 3BB4A 2QTFA 2QRZA 3NBXX 2GK7A 2C95A 4FI3C 1GITA 1DBSA 4BRWA 1KI6B 1G6HA 1DG3A 4LX0A 2UKDA 1ZJ6A 2NTYC 1YKSA 1VHLA 4N1AA 2NZJA 3QENA 1UDXA 2IS4A 1RKBA 1KSHA 3UG7A 2GJSA 2JLVA 3THYA 5FTNA 1TTTA 3AVPA 1Q0UA 1G3UA 2BBWA 2BMDA 2IWRA 3BXZA 4Q4JB 2EVWX 3LH5A 4UXJA 1XTJA 4JYBA 1E9FA 1IBRA 4M8NE 2H16A 3AQ4A 3WNDA 3F8TA 4MH0R 2FA9A 2R6CA 4LC0A 2QT0A 1P2VA 1EESA 4M1TA 1R5BA 4AWXA 4EPYA 1DEKA 4JLOA 2K5UA 2QGNA 3RANA 3IIKA 5JJKA 4L9WA 4OHZA 1E0AA 1TPZA 3N2EA 3TBKA 4MKGA 1G7SA 2QMHA 2FN4A 3CR7A 3GLHB 2YOHA 1S9HA 3QKUA 2ZR9A 3QXHA 3VQTA 1FP6A 2W6JD 5KSPA 1HUQA 4OI0A 1A2KC 4LZZA 4ESVA 4JVSB 3FWYA 2OCPA 4RZ3A 4MUBA 2ZRPA 4P31A 2J1LA 3D6TB 3F3YA 4B33A 5FL7D 2O8CA 4PO1A 1SXJC 4JLKA 1NVVQ 2P67A 3B1VA 4YXWA 2QPOA 3PR1A 5J4VA 2D74A 4KFTA 2QGZA 2F43B 1XFAA 1AKEA 1J2JA 2XB4A 4MGYR 2EU8A 2AFHE 4OHWA 2R44A 2VHUA 3CWZA 2QM7A 4B76A 4V0ME 1Z6TA 2FFBA 5AUPB 1ZNXA 4ZIRA 4AKIA 4IFBA 3AVVA 1VG9B 3E70C 4MRNA 1AQYA 2XGJA 2C03A 3IO3A 1RJ9A 4YMVA 2I1QA 3GLHA 1X3SA 3H2YA 5L3QB 3I61A 3E1SA 3LV8A 3PCRB 5B58C 5IF9A 1JAHA 4LJ4A 1W48A 2O8BA 3KTAA 4QBFA 4RZUA 5JLJA 5JBQA 5DYIA 1G3IA 1Y63A 4JS0A 5KSZA 4L4UA 4URUR 3A1SA 2JCSA 4PAOA 3IGFA 5DHFA 2D06A 4EIWA 1ANKA 2DR3A 1KJWA 4HUQB 5ANRB 2IUUA 4AYTA 4BLRA 4XOIA 4AURA 2ZETA 3ADBA 5DHAA 4WZ6A 5AUQA 3BB3A 1LS1A 3QKTA 2JLXA 3T1QA 4QM7A 5FTJA 3L0IB 4DUGA 5JHHB 1AGPA 1UBGA 4BZQA 2C99A 1DG1G 1XXHB 3THXA 4FINA 3I1FA 5C4GB 4BUJA 1YZUA 4CIDA 2Z5FA 5EXTA 5CM8B 3X1ZA 1NJGA 1E0KA 3HR7A 3UMFA 3DKPA 4MQBA 4P4UA 2J59A 2WWYA 2JIZA 4ON9A 2VHJA 2UVQA 4OJKA 3GJ8A 1DAHA 2Q0HA 1GKYA 4D6PA 1NN0A 3B9PA 5SZHB 4G5RA 4TL8A 4AK9A 1L4YA 4C0QC 1AN0A 5JRZA 5A5GA 2W0MA 3TR5A 4E5UA 1ZD1A 3IPYA 2HJGA 2XZLA 2I4IA 2R6AA 4XVRA 2JIZD 2V7QD 2VF8A 4LJ9A 4X8MA 1TF5A 4D0GA 1Q12A 4FWTA 4NYJR 4JYCA 1G7RA 1UM8A 4YMUA 4QG7A 3T1VA 2DCUA 2ZJOA 4D4LA 5JEDA 4X8HA 2PMDA 4YDHB 2PT7A 2WJIA 2IWHA 3K09C 4DSOA 3QY0A 1M7BA 1U8YA 4KVAA 2X2FA 2DY1A 3RS7A 5HE9A 3KB2A 1G8HA 4Q4AA 2FDCA 1KJZA 3C7KA 4DDUA 2A7QA 3QNUA 4Y0VA 1AZSC 2HF8A 4TT3D 3K0SA 4TSFD 4IDOA 1HV8A 4JLAA 4US1R 5LB4A 2ZRDA 1RRPA 2J7PA 2AX4A 4OI4A 4XTRA 5JWHA 3KXIA 2ZI9A 3LQRA 4BFXA 3EZ2A 2F1IA 1GUAA 3KKMA 5L3QA 2VEDA 1YZLA 1E99A 2J0UA 3KQKA 4B71A 2FSHA 1VHTA 3U3KA 1HYQA 3K8YA 5EUQB 3AVYA 3ADKA 1TUEA 2ZE6A 3CRW1 4H1VA 4WVFA 2Q3HA 4TSFA 1QRAA 4FW9A 3UXMA 1N6NA 1ZUIA 4AKGA 2FFHA 2VF7A 1OH7A 1EX6A 3LX5A 1YR8A 4CEJB 2A5DA 5FUWA 3MWLA 3BOSA 2RGNC 4KVGA 4KYIB 4HAYA 3KJGA 2CNWA 4TYNA 5K8TA 2IUTA 3D7MA 4I1OA 4I81A 2G83A 3GLHE 1TNDA 2CHQA 3LX8A 3CRRA 3WYAA 3RS0A 1N6HA 2RGEA 5KHOC 2ZYWX 4BEBA 4RD4A 1Q44A 2HXYA 5EP1A 1PVOA 1MRSA 2JJ1A 2AN9A 4B2IA 1U0HC 1YZTA 3QSYA 2D4HA 1LTQA 2A5FA 3QI2A 4JVNA 2HYIC 1TQ6A 3SS8A 2I1VB 5FUYA 2HCBA 4EPXA 2OSBA 1WXQA 2AD1A 2WAYA 4H1UA 1XPRA 1OFUX 3TW4A 1J8YF 3QUSA 2P3SA 1OFTA 1OPXA 1OYYA 3P4XA 1SXJD 2V7QA 4KBGA 1IY1A 4XSGA 3OAAD 2F7SA 4PC7A 1OB2A 1RW4A 5HCNA 3ZJYA 1AZTA 3W6OA 2ZSEA 5AUOB 2QZ4A 5FR2A 1RVDA 4EPWA 3AKYA 2NO9A 5KUTA 1ESNA 4LBYA 3ND8A 4DLSA 2OXRA 2PZFA 2XOKD 1KGDA 1E2QA 1N6OA 1WB9A 5FI1B 3PEYA 2VP4A 4DCTA 4QM6A 3LXXA 4HAWA 4CRWB 1XTKA 4L8GA 3RWOA 3VFDA 5AWFC 2GF0A 3CF2A 4ARZB 4LV5B 4GRAA 4B74A 4DHEA 1NP6A 2JDIA 5DI3A 2MSEB 2OFOA 1W4CA 2DYKA 3B60A 5J47A 3I4LA 4XSHA 4TL6A 4B73A 1JJ7A 2VRWA 1RFLA 1XD2B 2BJWA 2GESA 4JIMA 3R7WA 5BN5A 3Q72A 1E2GA 3B5JA 5FH9A 4LK2A 3ICQB 2YOFA 1KZGB 2A78A 4A36A 3AVUA 2GZDA 4U02A 1IJEA 4Q1DA 4JLNA 2EWWA 2RH5A 3IHWA 5BYJA 3GLGB 1BO6A 1X8JA 2MMCA 1D2MA 4DSNA 3CH4B 1GG2A 1UBCA 2Z4SA 1E0JA 4AIIA 1E94E 1OIXA 3AB3A 1S3GA 1AM4D 2GF9A 1CU1A 3AF0A 3OF5A 4RKEA 1W36B 3NWJA 3IBGA 1XPOA 1SZPA 1OXVA 4QJ4A 4OQFA 1P72A 1UADA 1HT2E 2F6RA 2NO1A 3THWB 1IN7A 1T3LA 4Q5IA 1II9A 2IYVA 1JEDA 4CYMA 5HPYB 3QOFA 1KI2A 1ZM2A 1AIPA 2WPDD 2RGAA 3F0TA 4DB4A 4DCSA 4YMWA 2OLJA 3HU3A 1X86B 1OT3A 4V03A 1LFDB 5C18A 3OHMA 5TMPA 4HDOB 2AKAB 4IDHA 4P4SA
chains in the Genus database with same CATH superfamily
4FYVA 5HTKA 3E3LA 1CP3A 1FDSA 4LXQA 4CNQA 5FBZA 2R60A 4DR2B 3QFFA 4KFUA 2J0QA 3AUKA 2J3HA 3K1ZA 1LSUA 5EE9A 5H59A 1Y3HA 5DBIA 5C34B 3JQ9A 4E14A 5G4KA 1FYDA 5P21A 2CFIA 2MR5A 3LM8A 3L1VA 3L40A 4HN2A 2GS9A 2ZI5A 3H75A 4LZLA 4P92A 4RFSB 1R88A 1OUMA 2NZ2A 5H70A 1NOKA 1T5SA 5CT6A 3RAPR 1JHQA 1YQTA 2HF7A 5LZ2A 1RWXA 2PD4A 3IQFA 2ZBVA 4X8OA 4ZOBA 1H8HD 4Z8YA 2J6CA 4ZALA 4C6RA 5BYAA 1JU9A 1J97A 1OX4A 1R6AA 4ZOCA 1C41A 1GGEA 4GMFA 4GNKA 2YINC 4DMFA 4ZZ0A 1IZ7A 3KWFA 1D9ZA 2OILA 3F2VA 5G4KB 3L4SO 4OXIA 4WZBE 5IHXA 1AS2A 3CH7A 1YHYA 1E5TA 2ZVQX 3VTKA 3QEAZ 2XR1A 3VH2A 4CEJB 2H5EA 5EGSA 1GYRA 2A88A 3P7MA 1YQUA 5JDIC 1E7SA 4AC9A 1BDIA 1Y1SA 3T3HA 1EAYA 1KZ7B 1J1ZA 4KYTA 4TT8A 5ALVA 1C0KA 1AKVA 1IIRA 1VIAA 1BAPA 4MB6A 4ZTUB 3NR2A 1GR0A 2B61A 4L15A 1QUEA 1EFVB 4TTIA 1JIJA 3BCUA 3SD7A 2GJKA 3KLPX 1YU9A 5AVUA 4H9GA 3CONA 2IUYA 4F8EA 2C4TA 2MJLA 2R7NA 3QVGA 4L3WA 3P9XA 5D3KA 1ONNA 5F9HA 5A5DA 3NP9A 1H6BA 3IXLA 4PFKA 5EA2A 3U7FB 1H69A 4GT1A 4P86A 5J1TB 2Q7DA 4YRMA 1BMFD 2PZMA 5EINA 1Z2EA 3G0IA 3WS7A 2XCUA 4ZYWA 1G8MA 1G18A 2NG1A 2B9VA 3HWWA 2GYYA 3OTHA 3PI6A 3QEMB 4OFWA 1SXJB 3T5DA 1ZXLA 3RFXA 2VC2B 1ITZA 1PAUA 4DNFA 1RR6A 5CEEA 3AJAA 1TMOA 1XU4A 1NMZA 3HVHA 5FAXA 2NYAA 3B52X 1SCUA 2XPCA 3JV7A 3Q8MA 1JPVA 2GSDA 3HBJA 4RD3A 5KDOA 2BRUA 4V0LA 3DD5A 1EB8A 3FPFA 1Y5IA 1IEXA 3CISA 4ESOA 1VBKA 1T5LA 4WJZA 1WXWA 1YQGA 1JFSA 2QN3A 1HLPA 3WNCA 2NX2A 3TVDA 2C8JA 2UZ1B 3C3JA 1PJLA 4TLBA 1IE3A 4G36A 2WAOA 2ZJBA 3GZJA 1U5BA 4LECA 2GEJA 2R68A 1ZUHA 1EFRA 3Q3GE 3VV3A 4MQ4A 4AZ0B 4BN0A 4DG9A 3WMWA 1HDZA 1ODIA 2WM3A 5J2UB 2EAUA 1YIOA 5B6JA 2E4WA 2GA8A 1LDNA 3IBYA 4JP1A 1NVUQ 3KUCA 2Q4RA 4UBJA 4V0KA 4XARA 3EFEA 1NBMA 1LJ8A 2ZCUA 4CIXA 2IVFA 1FDUA 3P0RA 4H3VA 5CAEB 4CTOA 1CLUA 4KOEC 5F51A 4U2DA 1Z4NA 3U61B 2BN4A 4GOMD 2JGIA 4N0DA 4QBTA 4ZQFA 1JWAB 5K0NA 3T94A 1XZDA 3AOEA 3DKKA 1UDWA 5JSHA 4PLFA 5JJBA 2ZUFA 4D4KA 1I3MA 3IMKA 4KQJA 2OB2A 5CYGA 4XI9A 4P54A 3D4IA 2A30A 3M82A 3PSHA 2CJFA 4QAJA 4CL8A 1XLUA 3TL6A 1X9GA 3SP1A 5BSHA 4C0XA 4M7OA 1SG9A 2VWGA 1SHUX 4R2KA 5CT9A 3SVTA 3IOEA 2EBWA 2DQZA 5BQ5A 2PH3A 3F7OA 3TR6A 2W6CX 4J0DA 1P5RA 4JITA 4D80A 3G1UA 3LIIA 1V0JA 4UUNA 2GB4A 2KLHA 2N9UA 1ND6A 1L9XA 3PUIA 4PZZA 5AH0A 5A3QA 4WBNB 4IFEA 3KQPA 2ZXEA 2O23A 4LJ6A 2VS1A 3OOWA 2VF2A 3BDIA 5CM9C 3SBEA 3OEHA 4IX1A 1TECE 3WOVA 1QG0A 3WV5A 3SFTA 4K9PA 3CT6A 3J81k 3S2EA 3EBLA 1NOIA 2IGTA 4IIJF 3AVOA 3LQFA 4TSKA 4BAGA 3OH8A 3KLBA 4F96A 3E81A 3VR1A 1DE0A 4RSHA 3H9UA 4MYUA 4IOJA 5ALPA 3I9NA 7AT1A 1E98A 3AFGA 3E0QA 4JNCA 2ISCA 5FNZA 5TGDA 3L0YA 1U0TA 4CIBA 4CT4B 3H5LA 3K9CA 3CF4A 3L2OB 2UVPB 3CGWA 4QEDA 2ZIZA 1FSPA 1BTOA 1DRUA 1A97A 3OE1A 3W79A 2V98A 2FHPA 2X0FA 2VJMB 4BYGA 5BYKA 3KDAA 1WKCA 1SCIA 4PANA 4TKLA 3AWDA 4DMKA 3D8BA 3HCEA 1XZLA 4TL9A 4POAA 3RKUA 2G6BA 1RHMA 1V1RA 3ZGZA 2NO6A 5F73A 4YAIA 1CUYA 4JU9A 5JNUA 2A5JA 2EJUA 3OLXA 3CLHA 5AOAA 3PHHA 1IPHA 2C29D 2HIAA 4FDUA 4E30A 4YXWD 2CK3A 2B0CA 1K4KA 1TIPA 3AXTA 3ADPA 4MXDA 2H1CA 4ZYUA 1ORIA 2C5LA 1G8YA 3R5XA 4HZUA 4IO0A 3VXKA 1C14A 1QS0A 4O2LA 4ACAA 4MW1A 3FYUA 2WJGA 4R6XA 1V4NA 3DH0A 1M6VA 1M6VB 2Q9BA 1XEWY 5E7QA 2CZQA 3NIDB 1RJFA 2FR1A 4OK6A 3IOCA 3PEVA 1T2VA 4J2HA 4Z9AA 5DX0A 3VPFA 1FP2A 4DT1B 4KGDA 1Q19A 3BKXA 5KX5A 3BERA 5L4NA 2IHTA 1C30A 4YT2A 1NXQA 3SEAA 4GDMA 3DDHA 3E5NA 4Z8XA 4ZCIA 3H6HA 1NP7A 1KK2A 1XDZA 2VRCA 3EZGA 3HACA 4HL6A 4NMMA 3MUEA 4Q00A 4QXPA 1XLTA 2H4HA 1FTQA 3BWDD 3TE6A 1SKAA 4J90A 5CJPA 1TTHA 3PK0A 3HJAA 2I6SA 5LU8A 3N7AA 1E3JA 1UPBA 1LPAB 3QXCA 3I9V6 2C2HA 4OBXA 4TTRA 4X61A 4RK5A 3C8DA 1N1GA 5ETJA 4HYEA 3QOYA 4J7UA 3PHIA 5LA6A 3NHRA 2HHAA 4PY2A 4ED9A 2MCFA 3R5SA 4GX2A 5HK8A 2IH5A 5ER6A 4H27A 4JSYA 4QAQA 4YRFA 2A57A 1ZJJA 5GJBA 1UBKS 3AEQA 3EMBA 4IOKA 4JUFA 5DXJA 5H3HA 3T1NA 2KPOA 4E4TA 3BFKA 1HDRA 3SQMA 3PGVA 3EIXA 1G291 1C1DA 1SEVA 2PXCA 2ZYSA 1VE5A 2AQIA 4PNZA 1QJ4A 4CF3A 2AL7A 4B6GA 5FWXA 1JDBC 4BQNA 2OCAA 2PS9A 3ETLA 2A1UB 4JDPA 4X7PA 4AMUA 1KAEA 2QU8A 2NMVA 2EQ5A 3MYRA 1UR5A 3O2JA 4H7HA 1LCIA 5G1PA 3SXUB 3ZV3A 1TM2A 4M1KA 2OCKA 3C7TA 3OLQA 2OHHA 4N6GA 2QJWA 4PPGA 4RL4A 3UHPA 1YVDA 4D6YA 5CLFA 2DERA 4XAQA 1FLVA 1UXOA 4GPBA 2GN9A 3FRJA 3R6TA 4LXYA 4OY3A 3UANA 4B74A 5CA1F 3U48A 1JR3D 4KQHA 3CVXA 4Y98A 4OBEA 1PDWA 1MFPA 3QVTA 1GJRA 2P9TA 5HJ7A 3PA6A 4FFVA 1VE7A 2A1IA 3FDXA 4A8JC 3T4PA 3R3YA 1MIOB 1LUAA 1VPVA 4R3UC 3RS5A 3S81A 2HWWA 1WXEA 3SKYA 2D54A 2NXEA 3OEWA 4O4LA 4GP6A 1DQZA 1K68A 4RTMA 4YC7A 1TQ8A 2W93A 4RHXA 5JPDA 1V6AA 3X1YA 4BASA 1G64A 4B3CA 2BEUB 1P0MA 5HIMA 1U9YA 3L4KA 3FUVA 4QHYA 2RC5A 1E64A 1UT8A 2CXNA 1RBZA 3MWDA 4PGGA 3WLNA 1BOFA 1CIPA 1TC2A 1ZH8A 2GPNA 3Q4GA 5I7RA 3ZE8A 1ZGCA 2DWCA 1NKTA 3UWKA 1QNFA 2NSJA 2VHTA 2YIVX 4EUSA 4QQ8A 4D9CA 1V39A 5CDUA 2WJYA 2VKQA 3SM3A 1ZUNB 5ADUS 1BN7A 1VCNA 3KDPA 4HFJA 1FIUA 5I9BA 1HFWA 5JV5A 4MRRA 2O14A 2E6UX 2AE1A 4HEJA 5LZ7A 2EKQA 3WNBA 5LQJA 4KN5A 1O5TA 4JOBA 4BE9A 4DIBA 2OCGA 3TSWA 5AJVB 5E6RB 2DJ5A 2JI7A 4LVNA 3WIEA 2VDJA 4JK3A 2BZSA 3CRNA 4IVQA 5AHKA 4Y7CA 2HCFA 4R51A 1ZOIA 4UEKA 4A73A 4A8JA 1HLGA 1OB5A 3AY3A 1M6EX 4M1SA 4QOFA 4F9FA 1LK0A 5KC9A 1PFWA 5G3YA 4FFDA 2CT8A 1DAKA 5B7GA 2B1JA 1T2CA 5EE1A 4HK4A 1AHNA 1K3UB 4DLXA 3KYJB 2YZ2A 1J99A 4NOMA 1M2WA 5DSZA 1ENPA 4TRNA 4OAOA 3PG5A 4R1LA 1XKQA 2C9OA 2H9YA 1N2ZA 4WFIA 4B79A 2QTMA 2IIBA 5ED0A 4ZDJA 5JXJA 1OFUA 3HDHA 3DUWA 2YWJA 3DE5X 2IY8A 1ESCA 1QOQB 3A1UA 4COOA 1BS2A 1GTMA 3W5IA 3DOUA 1YT5A 1AQJA 3CZQA 2FPRA 3R3XA 3BB1A 2YIMA 4K2HA 5HMMA 3TW8A 3WKAA 3BGSA 1GGVA 3A04A 3WWOA 5CDHA 3SZ3A 4Q12A 4F6LA 3QPDA 5CUQA 2VUSA 4ZANA 5KYTA 3Q15C 2XCTB 3Q0EA 3ZJ5A 5LOVB 2Y9MB 3IE0A 4XJVA 3WO0A 3WP0A 4N12A 3L8YA 3JQ7A 4FMDF 1FRNA 4V3CA 1P1FA 1EQAA 4KR0A 1NVXQ 1HG1A 1B00A 2C0CA 3CYFA 2NZUG 3MNFA 4F6RB 1ZJ5A 5DYGA 3P0IA 2RHCA 3HVJA 2IYQA 2H5LA 3H6GA 3OHSX 4KI7A 3K5WA 2INGX 4H7IA 3VHLB 1S3IA 4OHKA 2WFLB 4BMDA 3EZFA 4TS9A 4ASUA 4RHUA 3IQWA 1YE8A 3EXEA 4F12A 1MJGM 3AY0A 2I3GA 4K6GA 5JRJA 1P2DA 3TM5A 3W9YA 1GNPA 1B8OA 4BLPA 4C7BA 2XY4A 8LDHA 2NSYA 3H4IA 2IW3A 1LS6A 5AKKA 2AMLA 4B81A 2YVQA 3DE7X 4F5DA 1PZEA 1KQGA 1SC3A 5ICGA 4WEQA 4AZTA 1ST2A 4G1CA 3DS8A 1A1VA 3K9GA 1B15A 3O8QB 5EKXA 4YRQA 1Y7LA 4AXXA 4YBRA 3ORSA 1AKRA 2Y93A 2OXTA 4HB4A 2O9JA 2DGDA 3RHTA 4MRAA 1TO2E 2GEBA 3TDNA 4MW2A 1B73A 4K9SA 1SD1A 2CMFA 2FX5A 3NHAA 2OCIA 4DR1B 2BFWA 2RFLA 3DFKA 3NI2A 3OZFA 3QF7A 5A62A 1G16A 4RACA 3QZUA 3PL1A 5B12A 2HMUA 1J7JA 4A2CA 1HE8B 2DRIA 3HADA 1ODCA 1VA5A 3EQZA 3FZEA 5GV8A 1G6KA 3GRPA 2I2CA 4XWYA 2JARA 4P32A 3RAGA 1IAQA 4JELA 1EZ4A 3O4IA 1R3DA 3AK4A 2YYAA 4RX1A 3USCS 1XVTA 4CT5A 3GJTA 2YQ4A 5ERGB 4RTNA 1DIGA 1F4PA 1E2EA 2OQRA 2A9KA 3MVEA 4QVKA 4DTIA 5B53A 4U2CA 3VPSA 2LDXA 2OAQ1 5B3JA 4A0HA 2YIDA 4MCJA 3PDCA 1F14A 4N01A 3VPCA 3OEED 3CH5A 1L8LA 3QPWA 2GZAA 1I4EB 1NBHA 5HIIA 1E4YA 2B4YA 4DLPA 3FW1A 3PC4A 4OHMA 4TKUA 2P5YA 3LUKA 1UC8A 4BP3A 2I91A 4IAOA 4DA7A 2X40A 4WZZA 1XDBA 2RCNA 1ZVKA 2G17A 1KPGA 4OGWA 2ZRAA 3RBAA 5AVKA 2E4ZA 1KQ3A 2X1VA 5FLXA 4ZV4A 3PYLA 2C54A 3TRFA 4ESHA 1EXMA 2ORYA 4LDAA 1CS4C 2WIBA 1VBFA 1KDTA 3TLCA 1WP9A 2WJJA 3BZBA 4AO8A 3U4QB 3K70B 2RHJA 4DQLA 2AUNA 1QYXA 2OZLA 1NQVA 5ARDA 4BV2A 3CW8X 1P2SA 5CNIA 5JR3A 1HTBA 3DM9B 4NCNA 2W6PA 4HQRA 4MA4A 3R8FA 3AHFA 2B4AA 4TS4A 4R71A 5DTMA 1S96A 3R76A 2AX3A 4KPYA 4MARA 1W75A 1LD3A 2CVPA 3DE3X 1QQBA 4OI2A 4ARIA 4MHTA 1QHHA 1NU6A 1ISPA 4RQBA 1W4RA 3IALA 4TKVA 3GMTA 1XJ5A 4FFWA 4EFLA 1W30A 2BP7B 3PFGA 3BWCA 1W25A 3LKBA 4DOMA 1G2PA 4NBWA 4W7SA 2FPXA 2VWPA 4E2YA 5CAEA 1KS9A 2Y2UA 1TA9A 4TZTA 1P9WA 2VF4X 1X70A 3PD7A 4C4XA 4X94A 3UF0A 1WETA 3N3AC 5HCIA 4NCIA 2QI9C 1GN9A 4IGIA 5FEUA 1FFXA 4Y9RA 1KAHA 1PGNA 3HJRA 4MLPA 5E1MA 3TNDA 2VL7A 4DW8A 1FRFS 5DYYA 1GZ7A 2SCUA 3P9SA 4GPZA 1E4EB 3BILA 3N9IA 1GTG1 3ABIA 3WQSB 4AS3A 4ATNA 3H2JA 3ILSA 1FVHA 2UZ1A 2NQTA 4ZTBA 3SZGA 1CULC 1XTBA 3G5MA 5ECDA 1UDBA 1W46A 5CFLA 1JQKA 1MTZA 2J5BA 4P3YA 1RBYA 2WP8J 1M2JA 5GVSA 2CBXA 4OA5A 2NVBA 3A6HA 4O02B 4M3NA 4RV9A 2ZIVB 3NDBB 2JJ2D 3LGSA 4Q4HA 3A6GA 1UFQA 3C6BA 3W8NA 2E2WA 5IVHA 3WOHA 3K2QA 4LY0A 2MYPA 3RJ5A 1YVUA 3CNLA 1CUGA 4X7MA 3B6ZA 2X13A 3IURA 3CR8A 5F78A 4O4JB 3HCDA 4A3SA 1D09A 1E9VA 2K2WA 4PF1A 4UARA 2PUBA 1BWRA 2AOXA 4WL0A 5DBHX 4RS4A 1MZVA 1DAIA 4KRFA 3QJ5A 1M0TA 3A7EA 4FDAA 1Z8HA 3VR4A 2C7RA 4HNVA 4PC3A 4U7JA 1VLMA 3IDSA 1V95A 2DWQA 2V4MA 5HKKD 1X7YA 2R2GA 3RYCA 3MBIA 1SB9A 1CB0A 1E63A 1XQ6A 1ZMRA 1L8QA 2GWRA 3JQDA 4HAOA 2HU8A 3KKZA 4WZBB 5DOVA 5IVDA 1F6WA 4RTJA 1Z4JA 4YTEA 1KSFX 3VKVA 3WGJA 5BT9A 3AM5A 3WSVA 2FJPA 5I5GA 2FZEA 2GO7A 2RHLA 3ONWA 2Z8YM 4HYQA 3UGQA 1EUZA 1SCNE 3A10A 5E95A 2ZYGA 4QXQA 3F6PA 1YDHA 3KFLA 3AI3A 3JASB 1CUSA 1I9GA 2POQX 3DF7A 4B0PA 2G0NA 2P9JA 1C1YA 2ZT8A 3KCNA 5CW1A 1YQXA 1GXSB 5EKUA 3BTOA 9ABPA 3INYA 4ND1A 1NZFA 3MCVA 4G0XA 2C5EA 2E4UA 1W87A 2JBAB 3AZOA 3BF7A 4TKVB 4NU6A 5A7FA 3DR3A 4M9QA 1XXLA 1Z5NA 3F47A 3HKDA 3PV0A 1SD2A 2FDRA 4FFOA 3RODA 4TGLA 4YXFA 5M2QA 3PIIA 3JCZA 4GG1A 1TT5B 1Z4QA 2GD0A 2X2PA 4TXHA 3E8SA 1U7OA 2XQKA 2VT7A 3C1UA 4OQ4A 2AW3A 1OX4B 4LBWA 3MWGA 1SVKA 3G2JA 4RVOA 2JJ8A 1YS7A 5J5AA 3SAJA 4CKXA 5K5EA 2BGGA 2XXAA 4ZZ3A 1AY0A 3IAXA 4INOA 4FOLA 5J4YA 1YXMA 4R41A 5JS8A 4PQYA 3V34A 1SJ9A 3LUPA 4IIFA 2BEWA 2Q6VA 3H9EO 2FEOA 2NP7A 4EENA 1M3SA 3Q2OA 3QLTA 4V39A 4NU8X 2VOEA 2G7MC 4NAHA 5DIZA 5EXDA 4JR0A 5LXTB 4L5IA 1W29A 4U6NA 1BU8A 2HCTA 2AXEA 3REQA 1KYIA 1H2EA 1KO1A 1QHYA 2EX4A 3W04A 1ISRA 2BKEA 3AHGA 3ACBA 3DTTA 3ND9A 3OUTA 4M6WA 4NCJA 2W11A 2JLAA 4MHSA 5F4BA 4ZU3A 2F3UA 1G59A 1JG6A 1XRPA 3L8ZA 2V0GA 3M4ZA 1C2TA 3ZWNA 2AZ4A 2JI6A 3AFNA 4RU1A 2EFEB 3AHHA 4PCAA 3ROFA 3R9IA 2D2FA 1KTVA 3AERA 3H4VA 1OAKA 2JVKA 1N34B 1QAOA 2IF0A 2F9LA 1U2PA 3REQB 2CD7A 4ZVVA 2RJOA 3CZ4A 2LWIA 3I8XA 3F5FA 3BMNB 2ZIXA 4KB5A 3ABRB 4P83A 4QOJA 5CK5A 2PKRA 2EHDA 5EFZA 13PKA 1ZOOA 3JRNA 1PX2A 2PFSA 2AV6A 3IBCA 2E89A 2EJBA 4GMHA 4YRIA 2OC4A 1SOUA 1NTOA 2O3RA 1ADJA 3IYLW 3UB4A 1PBNA 3OZEA 4DWVA 4X7BA 2W8BB 2ZTMA 5D84A 1Z4MA 3U0VA 1K6XA 3CX7A 2HU7A 3ESBA 5L9AA 4FMBB 3VC2A 3ZDDA 4R98A 4RXUA 2XIQA 1WBBA 5SZIA 4LZNA 1Y5MA 2BFFA 2I76A 4YROA 2DQSA 4E5MA 1CDDA 4H1TA 2C78A 1H5UA 2HBQA 2EKLA 1N7HA 2HTFA 3HPQA 3IEUA 3S4YA 4B4WA 5JMWA 1GAXA 4LGMA 2COEA 2H29A 3GGSA 5TQJA 5IYZA 3GFFA 1FA9A 4FZ3A 421PA 1Z6YA 1F51E 5AW9A 4URHA 2VSOA 3KJXA 3HBLA 2CL0X 4Q3KA 3V97A 1NWHA 1SUDA 4UNNA 4EUNA 1BW9B 1M1YE 1PLLA 1T8WA 3DYIA 2CVFA 3OPXA 4KGVA 4MP3A 3CIFA 1V96A 4A9AA 1U8ZA 3IL2A 2WPNA 2PNJA 4WOPA 2SCUB 4FFRA 5F2OA 4E0BA 5AJZA 3JQ7B 2DFNA 3IKVA 4KIWA 1ZQ1A 1QO9A 4HAVA 4R84A 3CC8A 3M89A 4D0SA 1Q7TA 3FTFA 1XZJA 2A5YB 2ZSUA 4RGQA 4C0BA 2CL5A 3EDOA 1M33A 4UD2A 2CYAA 1QQAA 2J4FA 4WZBA 3AP2A 3FCEA 3KWJA 3TOSA 2AZTA 1FMJA 3HFRA 1JH8A 1Z17A 3PDIA 3AXSA 4ZQHA 3FKSD 2HJWA 5IFKA 2VRCD 3FJYA 4GEKA 1XQVA 4MS1B 2QENA 3VZRA 1GA6A 1ZO8A 3JD2A 1Z73A 3D4OA 2L69A 1KYXA 2FZ5A 1UKAA 3EVEA 4Q3EA 4LFCB 4RIHA 3DVAA 4EDFA 2JHPA 1VKHA 1Z29A 1NAIA 1YZVA 1Z4OA 2VAXA 3GDFA 1HL7A 1HE5A 1VJTA 3QEJA 1TTPB 2DFPA 3VISA 3EXHC 3J7TA 2IEIA 3CNNA 4M54A 5D51S 3JAWA 2Q29A 1L7RA 5SICE 1DJLA 2VK2A 4WQMA 4Q4HB 3AKCA 2GCOB 4KN6A 1C7JA 3IA2A 2PA0A 4HMQA 3NFRA 2PRZA 4JWKA 1X38A 3VZCA 5C5EA 4BVLA 4LHEA 5DK4A 3EYAA 1KZ6A 3VU3A 4DIKA 4ZZ1A 3B5EA 4EHAA 1NVBA 4JJIA 1H8ED 3GK3A 1FQJA 5HKBA 1MJ5A 4JLBA 4NR0A 1F48A 3SJZA 3CLRD 4MZDA 3LYUA 5AJTA 4C5BA 2FUNB 1GFZA 5CB0A 3USZA 3FMIA 1IUNA 2A9JA 3Q7IA 3F5QA 2R5WA 2XVAA 3W8DA 3VU1A 2ZUEA 3E2PA 2P9YA 2RHMA 4K6CA 5H0IA 4MUJA 3RQIA 4CMIA 4FJ0A 1X94A 1NZDA 1DAFA 4JJZA 3M34A 3K16A 3VBEA 3WMEA 4D4MA 3ZVMA 5EP2A 1E2FA 1XCLA 1J0BA 1JKMA 3EGXB 1A9OA 1FRVA 3FNQA 3MCAA 3BEOA 4HC4A 2JFFA 3SZLA 3UOAB 3WDKA 5AQ1A 2GHIA 1XQ1A 1QH1A 2GJ4A 2A35A 3WGHA 4YWHA 3U9LA 4F5ZA 2H2AA 1IUPA 1S02A 5K8VA 3FKJA 1T2NA 1ECGA 4FGZA 1XQWA 2QZZA 3N0XA 1KVUA 1FQWA 4GMXA 4OJTA 2NOAA 4QFBA 5HF6A 1FNNA 4M7RA 3SGLA 2ZI4A 4DNQA 3K5HA 1TADA 4JJ8A 5FFFA 4CTNA 4R1PA 1MQSA 2B8WA 3A06A 4F3KA 2YVUA 3TH5A 3LVQE 1Q50A 2R4QA 3B13B 1HNZB 4N5NA 1O96B 3HCCA 2WVGA 1R4AA 2CF6A 2F1JA 2ZR0A 4Y6LA 1F8UA 2AQKA 1Q91A 2ODWA 3HYNA 5AW7A 2CJWB 3D6AA 2B4QA 3IKLA 4JLVA 2NAPA 3VI4B 3RRXA 1SKMA 4AYWA 3GLFA 3LBHA 1SG0A 4GGPA 4Y6OA 4AROA 2QRMA 2R79A 2XB9A 3ZY6A 1MPXA 4B8YA 4JAVC 2F1RA 4D7AA 4N49A 4IO1A 3SYMA 3BRSA 4V0SA 2ZJ5A 1SCQA 2J5QA 4GLJA 5H7XA 3SEQA 5LYJB 4J8PA 2RK4A 3CKYA 3RC3A 3A14A 3EWNA 3EPHA 4OGKA 1DJNA 3W5CA 3MWYW 5K03A 1E2IA 3HCNA 4UUQA 4QSHA 1E1RD 2JJQA 3E5HA 3K1TA 3H04A 2RH8A 3COJA 1C1DB 2DTXA 1WLSA 2PGOA 3ELDA 4ZRNA 3PEUA 2WWGA 2ZBUA 3KVRA 4FS3A 2A0YA 3GQVA 4I50A 4CIWA 1K75A 4JQOA 3DE6X 1PZGA 1PS0A 3PA8A 2HMYB 4DIDA 4XSVA 5COBA 1B93A 1QWOA 2GILA 4Y9TA 4UTZA 4C4SA 4CM4A 3T7SA 1Y6JA 3JYQA 1VHQA 5ENVA 4CV3A 2V03A 3AEYA 2AYYA 2BIFA 3ANYB 4RPJA 5EMJA 4BZPA 3QPUA 1FLNA 3EZXA 1L5HA 7REQB 4JBGA 5HFAA 3BSYA 3GUZA 4I50B 2ID9A 4JQZA 4KQFA 1MABB 2DFTA 2Q50A 4Z9BA 4HZGA 2HA3A 1OX5A 2JFXA 2BFEA 3LBNA 3GEIA 2Y1DA 3D3EA 1C3OA 2OB1A 2CC2A 4R05A 2SECE 3TUJC 1JSZA 5DHSA 2BZ0A 3WIUA 2G07A 4AQYB 4JLMA 2BOVA 4GW3A 3BQMB 3FPAA 2V0NA 2ZSHA 1HSOA 5TF4A 2D1TA 3NYRA 1PR1A 2XB2A 2BEVB 1C3EA 3O95A 5JANA 3NH9A 5EJGA 5IAAA 4EMBA 5AK0A 5AESA 2JASA 1SUSA 2QK4A 3I92A 2PEZA 3PENA 1MGOA 2O2ZA 2ZPTX 4WNYA 4X1IB 2QTCA 2D3TA 2WSLA 3DKVA 3DZCA 1V7ZA 3LUHA 1Z28A 3O03A 3WV4A 3KFXA 3M6WA 1DBPA 2Z56A 4FLEA 1P1HA 3NWOA 4MJLA 3WLQA 5BNWA 5E3JA 2XUIA 3GCWA 3PL5A 5FX2A 1T3GA 3PHBE 5TRTA 1XZMA 2RKBA 2WR8A 1B4DA 4KXFB 3CX4A 3DL4A 1NOJA 2PXHA 3V5NA 4DEXA 3EA4A 2Y0EA 2B7LA 2QTBA 4DPLA 1TK3A 4EPTA 3JZMA 3W5VA 1XC7A 3L7BA 3PP8A 4DB2A 1US8B 3FMVA 3L18A 1G8GA 2CNWD 3UYLA 4CKCA 2ZSIA 4QIHA 2FSIA 3DTVB 3M9LA 3ZLBA 2B2XA 3DB2A 4X95A 4AJHA 5CDTA 3HMQA 4UOZA 3CRQA 1QF9A 2PGXA 2BHTA 1EJ0A 1FY2A 2CCJA 1IAVA 4BJHB 1WDLA 4BMXA 4O3MA 2JDID 3VJMA 4ND6A 2QD1A 1SHJA 3NX4A 2JCXA 3RAJA 4WI1A 4ROTA 1G2OA 1NMSA 1SHKA 3KJQA 4JXKA 4NBUA 5FJIA 3WI7A 3ZDFA 2QLMA 3OM0A 3REGA 1QX4A 1KH2A 2WU3A 2H3HA 4XGQA 5HF9A 1SMKA 3E27A 2V9CA 3VAZA 5FP0A 2W7TA 3U2QA 2JIMA 1RZRA 1P9RA 4HPWA 2JFOA 2QR5A 4PZ9A 2QSZA 1QP4A 3U6KA 1L4NA 2E55A 3KAPA 4E5PA 3ISVA 4O2AA 2BELA 2DKOA 3CZ9A 3UK0A 2F8SA 4YPOA 3OZBA 1UJMA 1X9HA 4U6QA 5HUQA 3IUSA 1UC4B 3H87A 2ZBQA 4WXPA 4R3NA 4YHHB 2PK3A 1RTKA 3IUPA 2ID4A 4IVPA 2R62A 1R0YA 2AEJA 5I01A 2D7CA 4UBNA 4UTOA 1XMSA 1DKUA 3AR8A 3DZBA 1E3IA 1HDXA 2C4NA 3NVMB 4J3JA 5C1IA 4BP1A 2FWIA 4XWKA 2OCYC 3GA0A 2OR3A 4IYRA 1I13A 5CVEA 3T5BA 4NJEB 4CUJA 2HV9A 2DFVA 4QDTA 2B94A 2V7XA 3KEOA 3OJFA 5A1TA 4UEWA 3KOUA 4UBKA 4H6PA 4CEJA 3EEQA 1UAYA 4BZXA 4ETIA 3PLNA 5F2KA 3KBOA 4Q4LA 1SUEA 5D6NA 1QYIA 5AI8A 4MAAA 4EA7A 1R3UA 3A2MA 4WKCA 4UJ3A 9LDTA 1WCXA 3SJAA 1NJFA 2Q3FA 2ODEA 4O25A 2I03A 2FPPA 1DTWA 1GP2A 2H5IA 1H1TA 2OO5A 1F5SA 3VO8A 4I4LA 1ZRNA 3SHQA 2V7EA 1XE3A 4CFYA 3QVLA 1O8CA 2JLBA 3IELA 3VMFA 3HUDA 1XA4A 3KXLA 1RLTA 5H8WA 2G8LA 3DE2X 2XSZD 3OJLA 1LRKA 1TM3E 3LCVB 1RIFA 2OFPA 1PJ4A 3ZJ4A 4G4IA 4WE3A 4KMOA 2AJLI 5JWOA 1MUUA 1X74A 4QECA 1DS6A 1TAQA 1EFHA 2B3DA 1MMFB 3ZLUA 1GKLA 3OFND 1KDZA 5DW3A 3V55A 5KC8A 4KQIA 1AE1A 1EQ2A 2CUNA 2EP7A 4ZC1A 4N0QA 3KC2A 1VJ1A 3Q41A 2PZ8A 2Q4EA 4JXJA 3M2TA 4H60A 4UM9B 1XHEA 2VN8A 1T2EA 2QL5A 2OHOA 5EE5B 1G6Q1 3L77A 3U49A 2LRHA 2VLBA 1I7PA 3IAFA 3RVLA 4BV9A 1E9EA 3JVIA 3VSAA 1H8HA 3J7AC 2R11A 3WWZA 4D3SA 3LGXA 1T4BA 5ELXA 1F8GA 3H9GA 4R8VA 4L7QA 4N40A 2W2TA 3QLJA 2X7JA 3TOCA 2FR8A 4BE7B 2BE7A 1HZJA 2WVAA 1B7GO 2CZCA 2OUKA 3KE8A 1S3FA 2AW5A 5EQDA 5F21A 3UQZA 1SN7A 4MEBA 3ZE2B 2EHJA 5B6IA 5JWRA 2P0AA 4IGEA 1AQUA 2CLIB 1XZIA 1SB8A 2EP8A 2WI8A 4MPTA 1NN5A 1Q3TA 2DSTA 1GUYA 2R7LA 4MUYA 4Y1GA 1P73A 3N58A 1F0YA 4RL6A 3K4HA 4ZDWA 5K8IA 1T26A 1S8FA 3VVBA 2DKFA 1W6RA 4MV3A 4U2GA 5K6RA 4MITA 3T5TA 1Y6GA 3EXG2 2ZZKA 2ZQ5A 1EX1A 4Z4CA 4E5YA 4U9IS 4JLWA 3TLXA 4QE3A 3TNJA 1YVRA 4BIIA 1DRKA 3O84A 3LOQA 1OU0A 3GZNA 1QZTA 2ZBGA 4HAIA 3KWLA 4K2AA 5E6SB 5CBKA 3TG2A 2WZCA 3TEFA 3AEXA 4YJDA 4NG5A 5F2NA 1R6BX 5IK2D 5LXTA 3M5WA 2NT3A 2PSFA 2H7VA 2Y1CA 3FA2A 3HN6A 1SCAA 1ODTC 4D2IA 4ALIA 4Y30A 1AGXA 1E9AA 4FYPA 3EOAI 2Q5QA 3Q12A 5I8ZA 3TZLA 2HL6A 4DR4B 5JS7A 2W2QA 3U4MA 3VTAA 3GJ0A 1FFSA 4TVOA 1MOSA 1YMQA 4P3XA 3ZIUA 1NF9A 4S0XA 4WA8A 4KXYA 1UBTS 3MSXA 1RRKA 3SYNA 4HGZA 5EZ6B 3U1TA 1NW9B 4E94A 3T3DA 4ERXA 4ETMA 1IJKA 3O4FA 4BJ1A 2ASVA 4EUHA 4EZEA 3I2GA 5KSYA 2AEFA 3DAGA 4CLHA 3GZ4A 2OTCA 3EARA 4I4CA 2FLWA 2QX8A 3A6EA 4AG6A 4DV3B 3LRPA 4DR3B 1MKYA 1Q21A 1Z9BA 3RK4A 2XNCA 4UVDA 1YI0A 1WSAA 3FPHA 3B3FA 1W5FA 3QRWA 3CSUA 4N8SA 5GZ1A 1W5TA 5DDIP 1T9GR 1U8EA 3FOAA 3LC7O 4YWJA 3GPCA 5PNTA 2VYQA 3O8BA 4KI0A 1Y3DE 1L8AA 1N3BA 1CLEA 1NBIA 1TW2A 4ENTA 3AF2A 4TTQA 1HFEL 1NVWQ 3EG5A 1R1DA 1TFUA 4PPNA 5KOHA 1IU9A 5E2BA 4NONA 1SU6A 1IZYA 2Y9PB 1QBGA 2GD1O 2KM1A 3ITEA 3W05A 3WA7A 2DWUA 4K7JA 3LT2A 2FMHA 2ODPA 2XAUA 2EF1A 3AF4A 5FNVF 2WJHA 4PO3X 4BEJA 5A0TA 2VBCA 2HDNB 4Z53A 3LW7A 3QG5A 1KF0A 3DBHB 3BWYA 1VE6A 5ESWA 3HA2A 3PUVA 5B1IA 4N9WA 1EK6A 4D8XA 1JJAA 1LI7A 2YJZA 4UFPA 2L2QA 4NEQA 4Q3BA 4LHXA 3B70A 1U5CA 1NVVR 2WSIA 3FRHA 4YI3A 1W9MA 1I6MA 3T0GA 5LWQA 3FCUB 3N70A 3JRWA 4MO9A 3I37X 4LJ8A 2IA5A 4WIAA 2WLSA 4CUKA 3S70A 4L4ZA 1IVYA 4G0PA 4PBTA 3DMGA 1W0CA 2IYSA 3V1YA 6GPBA 1U3FA 4MWBA 2PMEA 2D5IA 5GOZA 2ODNA 4HNUA 2RH9B 2XWJI 2X9NA 2XUZA 4J6EA 4JEMA 2A58A 4OQMA 1IUOA 2X6QA 2YWHA 3OQIA 5IEBA 1KJ8A 4Q1FA 3DL2A 3HCAA 3RJTA 1ZRMA 1LJLA 2XTNA 3OE7A 2Z1DA 1V71A 4LTNA 4ZWNA 1KETA 2X0KA 3WGQA 3VPAA 1U1FA 1VMAA 4MKHA 4Y2XA 1U1CA 3VR5A 4G5GA 3L8DA 4JB0A 3SQWA 3JTEA 1XPJA 2AFIE 2QL6A 3E9EA 5JXGA 3C15C 3OWXA 3JS5A 2AF3C 3OIUA 4TVKA 5FULA 1SVSA 5IXSA 1TU3A 4P93A 1L5FA 2ZYAA 3LLMA 4LGVA 4AF8A 3DF9A 3PUWA 2BD0A 1ID1A 5AJXA 4EFDA 1ZR2A 2G70A 2GEKA 3DLCA 1RBMA 3RD5A 1YS1X 1WPXA 3UENA 5IAGA 1F0PA 1QTRA 3RVRA 3ZCVA 4GRIA 3EIFA 4X44A 2FFQA 4PYJA 4XVUA 5CHEA 1GQFA 4OXRA 1TB4A 5EZYA 1Z4IA 2RHGB 1XX6A 4GECA 4Q9HA 1AKNA 2HM7A 2WBLC 3NLLA 5EERA 3ICEA 1XAGA 5LLDA 3PSAA 1CYDA 3ICPA 2XTMA 1AHHA 4IVRA 1KKMA 3H7IA 3LK7A 1BGXT 2I22A 2QN9A 3MT7A 3NGMA 3UGTA 1Z39A 3UMVA 1OB2A