3LY5A

Ddx18 dead-domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
211
Chain Sequence
TGAFEDTSFLVNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DDX18
total genus 69
structure length 211
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ly5A00
2ORWA 2WKPA 2ERYA 2WKRA 3CF6R 3OIWA 4TMTA 5AJVB 3I62A 1CJTC 3U4QB 4NE2A 4QJ4A 2CNWD 3PUYA 1WBDA 1C9KA 1SVOA 2CCGA 2J0UB 2IS1A 3A4NA 4UXIA 1Z63A 1OW3B 3BOSA 1KI6A 4MRPA 1U99A 2FEMA 4OI2A 2PX3A 1A7JA 2FSGA 5E3HA 3SDZA 3Q5EA 3K0CA 1Q3HA 3DKVA 2F55A 2FF7A 1W44A 3PXGA 1JPNA 3AUXA 3CPEA 2JLVA 2F1IA 2FX3A 2A30A 3AKYA 3EZFA 1ZM4A 3TE6A 4XVRA 1OXSC 2WJGA 1GFIA 1A2BA 4ITRC 3NBYC 3FKQA 5FTJA 1G9XA 1GTVA 1MV5A 4BLRA 4YLGA 4RJLA 2ZJAA 1YZLA 3QVVA 2XX3A 2GJ8A 1N5KA 1T6NA 1N6PA 2FV8A 2P67A 3QKRB 2QG6A 4HZIA 3LBHA 2Z5FA 1TADA 2R9VA 4CGZA 1UADA 1LS6A 3CBQA 3SS8A 4B32A 3IILA 1A2KC 2O0HA 5KTYA 2P6NA 2GCOB 1T5IA 4NCHA 1AS2A 4XWKA 5AUNB 2OAP1 2EVWX 3AF2A 3VKHA 1F2UA 3CNLA 3RS3A 1U8ZA 3LWNA 5IDVA 1HQCA 1N6HA 1XMSA 1MT0A 3EA0A 5FL3A 1G5PA 2G6BA 2CDNA 4BEBA 5JSZB 4POAA 1F6BA 4XWOA 3KQNA 4C0JA 3FKSD 5C4GB 2O8BB 3U6BA 1HV8A 4A8JC 1I4TD 2HYIC 1IOZA 2YWFA 3L0PA 4Q5IA 5B64A 2WJIA 2PBRA 4V0KA 2OSBA 2VL7A 1E2QA 1QHSA 4Q19A 1XMIA 3RRYA 4IDNA 2ZRPA 2OLKA 2ZU0C 4PSAA 4TQ9A 3G5UA 4M2LA 1EFUA 1T3HA 2IXEA 2UZ3A 4D0GA 5L3SA 4B3BA 5KU1A 3GLHB 3PENA 1CS4C 5K8TA 1J8YF 1P72A 1QHIA 1R8SA 1NKTA 1AKYA 3B9QA 2AKYA 2FGJA 1Q57A 2G88A 3BIFA 4R9UC 4B47A 1DPFA 2UKDA 4AKEA 1WDTA 1E2FA 3GLIA 4OHXA 4D6PA 3FYHA 2BMEA 1KDPA 4L4UA 3OF5A 2GESA 3T61A 4Q4LA 1E2PA 1EFRD 1XWIA 2N42A 4A0FA 1XXHA 2MSEB 3BERA 3SEAA 5BXQC 4NCJA 4M9SA 4B6FA 3CNOA 2D74A 5FH9A 3W5JA 2GHIA 2QAGB 3TSZA 4CDGA 5L8VA 4MKHA 3ZZUA 4NDZA 4DJTA 3T15A 1AS0A 1P9RA 2Q9AA 1E2DA 3QG1A 3W3AA 5DI3A 4TYWA 2CVHA 1ZNZA 2W0SA 4E5UA 2B8TA 2XNDD 5J40A 1N5IA 2JDIA 3WP1B 4FW9A 4O0MA 2QGNA 3RANA 2QUZA 4XJXA 4CEIA 3K1JA 2XTNA 4OK5A 3DM9B 4XTCS 3DZDA 2JLZA 3AP2A 2IX3A 5HCNA 3VX4A 1XB2A 2D06A 1W36D 1E4VA 4M1OA 3ZVRA 2ZYTX 2BM0A 2VBCA 2IHBA 4Q4AA 3RS4A 3RYTC 1U81A 3X1YA 2P0EA 4LRWA 4C2UA 5TARA 4M1MA 2YZ2A 4KYUA 4GOKA 2GEUA 2ZRFA 4RFSB 4UNRA 3QKTA 3K70D 1J90A 4DIEA 5F98A 2DB3A 1E2GA 1R5OA 4ILEA 5FTNA 3U61B 2PMKA 4HUQB 1X8JA 1MH1A 2WSSA 4LHZA 4MYHA 2XJ9A 1KYIA 2VRWA 2GBLA 1SVLA 4X8MA 5GVRA 2ATXA 2J7PD 2WBLC 4JLNA 821PA 2JIZD 3U60B 2FNAA 1Z08A 4Q4HA 4FWTA 1UEIA 2FFHA 1HH4A 3MWKA 4PHTA 4ARZA 4YDHB 4CIDA 2ZSEA 3OEED 4OJQA 3AH8A 1MRSA 4S2EA 5KUTA 3BAFA 1QVRA 2GJSA 4DT1A 2NQ2C 2WIBA 4I1OA 4L9WA 1JNYA 4OHYA 2HEIA 2FPLA 2W2VA 3B2EA 5EP1A 5F9HA 1E0JA 3C8UA 4OYHA 3ICEA 2QORA 1U0HC 2AK2A 5HKKD 4LSGA 5AJXA 2ODEA 2ZUBA 3FKSA 2ZQ5A 3GJ4A 3H1TA 4YMTA 5J4KA 4C2TA 5DHFA 5SZJA 2ZE5A 4KAXA 5TDHA 2ZJ5A 5AUQA 2ZRAA 1KGDA 1GILA 3UG6A 2EFHB 4DWJA 5L3SB 2ODBA 3U3JA 2ZI5A 4PXAA 4GZMA 3KQUA 4MYCA 4LDJA 1E9FA 4R2IA 3ASYA 5AJWA 2ZM5A 4FCVA 4ZIRB 1XXHE 2GF0A 2BKEA 2C9YA 4G5QA 2MMCA 2EWWA 3HR7A 1RRCA 2V9PA 3K09C 4R71A 2JJ2A 2VF7A 3LBIA 1UAAA 2FFQA 1KI2A 2YHSA 4Z51A 3I73A 5DO9A 3GLGB 2LWIA 1ZD9A 3NBFA 4R98A 5E7IA 5BN3A 1IXZA 3ETLA 3HR8A 4PZZA 3VR5A 4LC0A 1EGAA 5H68A 1EFHA 1A5TA 3IQWA 5JWRA 1E9RA 1LV7A 2V1XA 1IXRC 1E9CA 1JQLB 2KB0A 4GBMA 2XJ4A 2ZRNA 2ZI6A 4CEJB 4V02A 4DCTA 4PHHA 2CHGA 4U5XA 1G8PA 1SXJD 2E9SA 3B7GA 3HU2A 1XTRA 3GPLA 1XF9A 3KX2A 4EQ6A 2EU8A 4LBWA 3QBVA 3GLIE 2IHYA 5SZKB 5D3MA 4LCBA 1XX6A 1HEIA 2ZRLA 3MWLA 2HJVA 4LJ6A 4NYIR 1JECA 1US8A 2ZSAA 3OE7A 5JFGA 1M2OB 4OHWA 3U3RA 1BMFA 3AF0A 1Z29A 2FDCA 1OH8A 4MYUA 2ANCA 4BECA 1R5NA 121PA 4ZKEA 4DVGA 1HURA 4GMXA 4LUCA 1II9A 2C96A 3NBXX 5C18A 3BRWD 2XSZD 4JLAA 5KO2A 1N6LA 4G5OA 1ZP6A 4ZDIA 3O8BA 2XOKA 4A6PA 3ADDA 4MGYR 2W58A 3WYFA 2KBFA 3C5HA 1MOZA 2G1KA 1ZW6A 2OEPA 1KTVA 4B48A 3P26A 3RS5A 1S2MA 2Q6TA 1ESNA 2EYQA 3FMFA 4LV5B 1Z6AA 4XH9B 3QOFA 3SBEA 1NMYA 3LDAA 4G5RA 4TLEA 3CZQA 5CITA 5F2EA 3GLHA 1N3BA 1KO4A 2BIFA 4IVPA 1GAJA 2BBOA 3FFBA 3K09A 2ZVPX 1W4RA 4MRRA 1XPRA 2VP9A 3EWSA 4JVMA 4YMVA 5C2JB 3OFNA 5HPYB 2BVNA 3O8DA 4F4CA 4DUGD 4LJ9A 2QP9X 4LY6A 4OK3A 4UXJA 1RW4A 4A2WA 4GDFA 3N70A 2IUTA 1WQ1R 3LAWA 4WVFA 2Z4SA 4KFSA 3TSWA 1YR6A 1K5GA 1G21E 2GK7A 3PEUA 1GKYA 1FW6A 5JHHB 3CZPA 4B3FX 3HDTA 3K0AB 5LB2A 1E32A 2HT6A 1DO0A 1BO6A 1WA5A 4DUGA 2PEZA 5D3MB 1BYIA 3X1XA 1CBUA 1EESA 3I5YA 1G3UA 3DKPA 2GWHA 3L0IB 4XOIA 2ORVA 2F9LA 1P2TA 1RIFA 4Q1FA 1B23P 4BE7B 3WXMA 1W5SA 1HYQA 1SXJE 2PJRA 3GJ0A 4Y0AA 2BJWA 4HB2A 4FMBB 2QPTA 3Q7QA 5DIFA 2ECKA 4U02A 5FUWA 1M8PA 2VHJA 2NOAA 2WKQA 2ZI3A 2BDTA 4LWZA 3SR0A 4JIMA 1U9IA 1XEFA 3V9PA 4IW3B 5LPNA 421PA 1PUIA 2D62A 2W2XA 2W6IA 3WNCA 1YRAA 2JLQA 3UWKA 1RVDA 5DI3B 4IXNA 1KDTA 4C3ZA 2GRJA 4L8GA 5FI0B 2R8RA 4ZO4A 3AVUA 3DOEA 1IY2A 2J0QA 3KTAB 3LVRE 2F3TA 3AVYA 1MABB 3DO6A 1NBMA 1R4AA 4XTRA 5EJEA 1FZQA 5J5CA 5EE5B 2RGBA 2W6JD 1PJRA 4G5SA 4BFXA 1XP8A 5JS7A 2R6GA 1G19A 1II8A 2IW3A 3THYA 2AKAB 221PA 1KMQA 2GZAA 4PO1A 1KSHA 2XSZA 2B8WA 4Q1EA 1JR3E 2XNSA 4Q9JA 5AR1A 4RD3A 2IYZA 1E0AA 2PT7A 3I8SA 4QGHA 3TVDA 5C1BA 3NEJA 4ZCMA 3P27A 1RPZA 4C7OA 4WXRA 1QZXA 1KAGA 1W47A 2QE7A 5C46F 1FUUA 3ZD7A 1OHHA 3W6NA 1FX0B 3KXKA 4QM6A 1Z6TA 3X2SA 4LV8B 2Q3FA 4JLBA 2IYRA 1E9AA 2O5VA 1UKEA 2JLRA 4DCNA 2XITA 1TNDA 3GFPA 2KJQA 2NG1A 3C16C 2OT3B 3TVTA 1OIWA 5J4VA 5FOTA 4PC1A 3U2QA 4ZV4A 5IF9A 2VF8A 1XEXB 4LPSA 4MDEA 4CEJA 4PPQA 5JJLA 1PUJA 1VHTA 1WBBA 3QXXA 4MUAA 4TLAA 1KMHB 4ACBA 1UJ2A 2QTVB 2WPDD 2AXNA 2IYUA 3N5CA 4M1SA 4CT5A 2CCKA 1E94E 3DPUA 3AVWA 2WZQA 3KXIA 2GILA 4RSGA 2FH5B 1CR4A 1GITA 3TW4A 2CMKA 4ASUA 4A15A 1E1RA 3R7WB 5JHGB 1L2TA 2V55B 1P2UA 3AF4A 3IO3A 4HAZA 1G64A 4EPTA 3W3ZB 2FFAA 1JXOA 1LNZA 1W5TA 3QPWA 2QT0A 1VG9B 2BHRA 4FXPA 4AWXA 2DPXA 1D2NA 3CIOA 5JLJA 2ZRBA 3VMFA 1G3QA 2IYTA 4FIDA 5JCZA 5LD2B 4OK6A 5KDLA 1X6VA 1XD2B 3NVAA 4J0QA 2L0XA 1CXZA 4OI4A 5FBQB 8OHMA 3BE4A 4TYQA 1W2GA 1Q20A 4TMXA 1S1MA 3D6TB 3JZAA 3IKJA 2AFIE 2NO7A 4F7WA 5KHOC 2FN4A 5P21A 4V0ME 2DWPA 1R10A 1CKEA 3T12A 5EE0A 4EQ6B 2ZRCA 3WMGA 4FMCB 2R6DA 4TTRA 1E2MA 4Q02A 3SJCA 4AG6A 3AGPA 4LJ5A 1G8HA 3D31A 2KI5A 2FPMA 4LV6A 1GDDA 1NN3A 2QRZA 2P3SA 2ZRGA 3GP8A 1JAIA 4IDQA 1RJ9A 3A36A 3AVPA 1ANKA 1S8FA 1KSGA 2IK8A 1R7RA 1VCMA 4UNQA 2HCBA 3WHKA 2J46A 1KIMA 3B1YA 4MKIA 4US2R 2C78A 4OQFA 2OCBA 3GQBA 1LVGA 4B73A 1G18A 2QAJA 1JB1A 2BCGY 1W36C 1LY1A 3HPRA 3RLFA 1X1RA 1NY5A 3P4YA 3NG1A 2CL6X 1YZTA 2D4HA 4DDWA 2OCPA 3R20A 2AFHE 5FL7A 1J2JA 3FE2A 3RDPA 1AIPA 1DARA 3AM1A 1SKYE 4LHVA 5HE9A 2QU8A 3U3KA 2MSCB 3UK6A 5CYOA 1F2UB 1GRQA 1VCOA 1XBTA 5HTKA 2ODWA 2RKOA 3QJYA 1ZUHA 5DLQC 3A6PC 3LV8A 3TUIC 4L9SA 2ZS9A 4Q9LA 3REFA 4FINA 4HB0A 3THWA 4BLOA 5JBQA 1LFDB 3A8TA 3QEJA 1ZYUA 2R62A 3WMEA 4Z1MD 4JLOA 4OHZA 2ATVA 1NI3A 3AB3A 5EP2A 3TRFA 1CJMA 1II8B 1Z0FA 4PC3A 1GZSA 4MRNA 3KL4A 4Z8XA 5B2ZA 4Q66C 4Q21A 3EPJA 1Z2CA 2GKSA 4GP7A 5FPKA 4KJZA 1MR3F 3LH5A 5CDFE 1QRAA 2I4IA 4JBYA 5SZIA 4DSOA 1CJUC 2NO0A 2CEAA 4M21A 1GM5A 2XGJA 3A4MA 1W0KA 1YKSA 5EXPA 2C2HA 2IYWA 2WSSD 1EFTA 3E1SA 2ZTSA 2JLWA 5FBWB 3ADBA 1P7CA 4N0DA 5EE1A 4AURA 3TNFA 1P4SA 2QTFA 4RFVA 5CIWA 4KO8A 4YQFA 1W7AA 1Z0JA 1ZU5A 1W2HA 3BH6A 5K8IA 5A4JA 1DAHA 3EPKA 2JCSA 1NIJA 4IFBA 3WP0A 3LXRA 5CK4A 2BJVA 3X1DA 4U7DA 3MCAA 4ZCIA 4PZLA 3P32A 1SHKA 4G01B 2BEKA 4MITA 2Q0HA 2IYVA 3GJ8A 5FUXA 3ZZTA 3K9HA 4A0HA 4HB4A 2YOGA 1ZD1A 2W0MA 3KKMA 4CVNA 1YVDA 4W5JA 3AF3A 3U5ZB 3B82A 1U98A 4AKGA 5JJIA 4P31A 1OXVA 1SVWA 2OE2A 3O8CA 2C5LA 1NP6A 2OCAA 1S96A 3BB3A 2BEJA 3LW7A 2V7QD 4LYJA 4X8LA 4BZPA 1YE8A 1W0JA 3MGCA 2VO1A 1T0HB 5EXTA 3VR3A 1H8ED 2OFOA 2KWIA 3FGNA 2JATA 3F3YA 5FR1A 1ODFA 5H8WA 1GKUB 3P1JA 2ZRKA 5FOWA 1R8QA 3EARA 1EFRA 1CJKC 1J70A 4HDCA 4BFUA 3SJZA 3UANA 1WXQA 4B35A 2QN6A 1Z8FA 2VLIA 3QKSB 2WJJA 4NCKA 4RZ2A 4F91B 2R2AA 1UBCA 1YZQA 2PZEA 1XJCA 2ORIA 4EIWA 4BFYA 2J41A 1F48A 1OT3A 2NO9A 2DFTA 3RRZA 3M1IA 3QI2A 5B57C 3VTKA 2WWWA 2ZAOA 3DL0A 3KKPA 3OEHA 1CP2A 1JI0A 2IWRA 4HUTA 1N25A 3IPXA 4H1VA 3I5XA 2QP4A 4PANA 3FHOA 5K8LA 2WV9A 3OAAA 2ZJYA 1QHNA 3DM5A 1DAFA 1MABA 2OLJA 2WWFA 2Z43A 4NCNA 2H57A 2EWVA 2O0KA 1YR7A 2F9MA 4EFMA 2QMEA 4ZDKA 1DS6A 1N6NA 4IKEA 3ICQB 2QRNA 1UFQA 2O8BA 2QE7D 1KSFX 4AYTA 1KZGB 3LQQA 1DE0A 2VSOA 1Q44A 3QUSA 4P4UA 1E1QA 3HJNA 4F93B 2PL3A 4DSUA 2RGEA 2REBA 1MO5A 4JLPA 1FP6A 5J4HA 3EZ7A 2QGZA 3AKCA 3AVTA 3B78A 2X2FA 4UJ5A 4ZKDA 4B3CA 4D26A 2R65A 1G17A 1ZCBA 1SXJB 2H8KA 2ASEA 4ARZB 1ZIOA 3REGA 1JEDA 3RRMA 3WY9A 4XVQA 3K0FA 3QF4B 3VAAA 1P75A 2HJGA 3KDSE 4PQRA 1QG4A 1S3SA 5FUYA 1EX6A 4IDHA 1IN5A 1AQYA 3AEZA 4TWZA 4AI6A 4JKIA 4GFDA 1N5JA 2O8CA 4CW7A 3T1VA 4ASUD 5TXGA 1KKLA 4C0AC 2GCPA 3IIMA 4M22A 1KHTA 3B60A 4BLSA 1W48A 1Z5ZA 3H86A 1W1WA 2WM9B 1QHXA 4BFVA 4DLUA 4P32A 4A36A 1Q1QA 1V43A 1OFTA 1OLOA 4DZZA 3T1QA 1GSIA 4AC9A 1KI4A 1OJLA 1XCPA 3ZDQA 1RKBA 4HLUC 5BYKA 3TAHA 2XZOA 1JR6A 4TLBA 1G291 1NMZA 3U6KA 1FQJA 4DLXA 2GJ9A 3SYKA 3X1ZA 3BFVA 3VR2A 1FUKA 1JJ7A 2ZYVX 2VP0A 3CRW1 1YJ5A 4TL9A 2FEOA 4KITB 2ZPTX 5E95A 3PV0A 4DC9A 3LQRA 4RD0A 2PLFA 1MO4A 2IA5A 5FTMA 5TMPA 2P6RA 2V54A 3RAPR 4JKYA 1NG1A 2RB4A 2HV8A 4LJ4A 3V4RA 4Q4HB 5IRCD 3CR8A 4KVGA 4PAQA 5BN4A 1AK2A 3EIEA 4B71A 5J4YA 4EPRA 3F5FA 3EX7C 1R0YA 4JSTA 2RMKA 4V0LA 4B44A 2AD5A 4WBSA 4YMSA 3THXA 1OH7A 2J9RA 3NKVA 4KCGA 3RC3A 4A8JA 2RAPA 2NZJA 2W83A 4CEHA 2A2ZA 3NTUA 1G41A 5JJKA 1EX7A 3GJ6A 4MQBA 4K81B 4MKGA 1BH2A 2CL7X 1J8MF 4AG5A 1T9HA 3P4XA 1CIPA 4I81A 1NVWQ 2FPKA 2GA8A 1TTTA 4A4DA 3IGFA 4L15A 2FSIA 4D4MA 4RZXA 2JJ8A 1E98A 2QQ0A 4IOJA 4HAXA 1GL6A 1XEWX 4EKDA 4C9BA 4GNKA 4KODA 1I4LD 1ONBA 1Z22A 3IDQA 1KK1A 3FMPB 1OF1A 3ZVMA 5AWFC 4DSNA 2WSMA 2A5FA 4IDOA 3AQ4A 3BXZA 4DB4A 1NL3A 4B75A 5IK2A 1CR1A 4OQLA 1NG9A 3BFXA 3CH4B 4B2PA 2P5SA 1JXMA 2ZR0A 3U3MA 1FTSA 4P4TA 2WTUA 4CEHB 1WE2A 3LX8A 2CBZA 3WRXC 2HLDA 3EIQA 1IN8A 2GZHA 2YNMA 2ZI7A 4LI0A 5KNDA 3A1TA 4ACAA 1W46A 3W5IA 1D2EA 3VU9A 1S3GA 4FCWA 2EW1A 3OIUA 2CK3D 5JZVA 2D7CA 3EA5A 1GVNB 4Q4JA 1NLFA 3LNCA 1G1MA 1BKDR 1Z06A 3KJEA 1OKKA 2ZR9A 1K8RA 3QSYA 2XZLA 2OESA 1NN0A 1P61B 4IOKA 2F43B 1DAEA 5JI3E 2FSFA 1DAIA 1QBKC 2B21A 3LW8A 1OYYA 2YVUA 4BQSA 3S1AB 3H4MA 1UBEA 4MH0R 3GLIB 2DBYA 4V0MA 1ZCAA 1XNJA 3L2OB 2VHUA 4MDFA 1RRPA 2FSHA 2NGRA 2P2LA 4KFRA 4Q1BA 3TAUA 3DDCA 5ANRB 2Q9BA 2JLSA 1O3YA 1H65A 1XCGB 1Y3AA 1KI3A 2NIPA 1UPTA 3CX8A 3HP1A 2VH5R 3OIVA 5BWMA 3UXMA 4XSHA 3NC0C 2JA1A 2QM7A 2J5XA 3SFZA 2YV5A 4NBSA 1RFLA 2QTHA 3CF0A 4NPHA 4AYWA 1NLYA 4PHFA 1NF3A 4GT1A 5EZ5A 4O2LA 2B7CA 1H8HD 2F1HA 4W9MC 3VHLB 4C0KA 2ZU6A 3N2IA 1X86B 4KXFB 4DLYA 2GF9A 2ZIAA 5JSZA 5J4LA 2DYKA 1DAGA 2JJ1D 1K5DA 2H16A 1Z0KA 2IC5A 2OZEA 4IEEA 4OKSA 4DEYA 2XB2A 1VECA 3B6EA 1DBSA 4RFSA 3THXB 2GTPA 3EZ6A 1YZUA 1ZM7A 2FOLA 2GJKA 4QXAA 1I2MA 4Q00A 1ESMA 4ZIRA 4X8OA 4O25A 5UKDA 1GP2A 1ZAKA 3W6PA 1PV4A 1GNPA 2WOOA 3M4YA 1IJFA 4HZUA 1TQ4A 4URXR 2QNRA 4ZI3A 3SE0A 1FMLA 1NKSA 4OJKA 1JQJC 1R5BA 4C0BA 5FR2A 2FZLA 2REOA 2W00A 2YOHA 2ZSFA 4WA7A 3RRNA 3SHFA 2YWEA 4DLRA 3K70C 1TF2A 5EQTA 4TQUS 3PG5A 2ZJZA 3B1WA 5GJVC 3MUFA 5AK0A 3CR7A 4EFNA 3CONA 1KO5A 1Z2AA 4R2HA 4O2RA 2WHXA 3BORA 2WIAA 3IEVA 3JVUA 1YZGA 2QAGA 1IN7A 1EWRA 1S1CA 2FMXA 4DLSA 2XTZA 2HYDA 2PZFA 3C7KA 1N5LA 3OFND 2NPFA 3BS4A 3BH7A 2JASA 3FWYA 4Q4JB 3RS7A 3CRQA 3CH5A 5HR5A 1ZBDA 4JL8A 1EFCA 1DAKA 1D9ZA 4FCTA 2DWOA 1US8B 3RABA 4LPKA 1V5WA 1ZNYA 4A0GA 2Z4RA 4UQOA 3U44A 3CWZA 3PJRA 2JEOA 3SBDA 1O87A 2ZREA 4DLTA 2BMDA 2HUPA 4FWIB 2AK3A 4IJMA 1G7SA 2G77B 4TMVA 2ZJOA 3DHWC 4MKFA 4NYIQ 2C04A 2O0JA 1KDOA 5DHAA 1SQ5A 4KSBA 3PUZA 4CF7A 2ZAMA 3BD9A 4V0NA 1AN0A 1P2SA 3KZ1E 2ODNA 4F92B 4UNSA 2DCUA 3KFXA 3MLEA 2Y8EA 2GXSA 3W6OA 1FX0A 2J0SA 1ZNWA 1GRNA 5H1YA 1XD9A 3K9GA 4K8OA 3UKDA 3LVQE 2VSFA 5TB5A 1QHHA 1I2DA 1WP9A 1DTSA 4ZDJA 4JLDA 3VR6A 5JRJA 4HLUA 4DIDA 2XTMA 3IHLA 4S35A 1EK0A 3VHXA 5LDDC 1WRBA 1G4AE 3I8XA 1T3LA 1IXSB 4Q9KA 5KSZA 1FTNA 1NSTA 3VU9B 2J3EA 4JBXA 4O3MA 2WWIA 5CLQA 1U8AA 1KY3A 2LKDA 3X1WA 3A1VA 1BS1A 4ERNA 621PA 2NO6A 4KU4A 2PCLA 4NMMA 4QC2A 2E1RA 1DAMA 1N6RA 1WCV1 4HZUB 3ADCA 4TLDA 1JR3D 3KTAA 1R0XA 2OV2A 2RCNA 2ZROA 4WIAA 3AF1A 4EPWA 1Z6YA 5FI1B 4B74A 1XPOA 3RS0A 1E2LA 3D7MA 4TSFA 4KFUA 5J47A 1U8YA 4HAUA 1F3OA 3GLHE 4NP6A 3PFIA 3U7EB 2O8EA 1KJWA 2J7PA 2C99A 3FHCB 4M9XA 4JLMA 4B43A 3BH0A 1TU4A 3K9LA 3F8TA 1FP7A 1Z0DA 3ZIAD 3VNUA 3HWSA 4RD2A 5FOXA 3HYRA 4Q48A 1KK2A 5DE3A 3CO5A 3SN6A 3QF7A 4H9GA 2WWYA 3W9YA 4DB2A 5CJ2A 4TT3A 2QBYA 1SVMA 3ND8A 2H7VA 4NYMQ 3AKEA 1TUIA 3QENA 4UNNA 1SVKA 2BOVA 1E1QD 4QFMA 3ZGXA 1CJVC 1OB2A 1MKYA 3E2IA 2JLYA 3EZ9A 1XTJA 2D3WA 3NC1C 1UKZA 3RWMB 3TUZC 1FNMA 3FVQA 1ZM2A 4Q7KA 3KUDA 1E0SA 3L8ZA 1VIAA 4XIGS 1TU3A 4EJSC 4B33A 3CPHA 4DRZA 4DCVA 5IT5A 1MO3A 5FPTA 1M34E 4FI3C 1KNQA 1FQKA 1RZ3A 2C77A 3BGWA 1KK3A 4LHYA 1E2IA 2PX0A 2QMUA 5C4MA 1M7BA 2WWHA 4AIIA 3EAQA 5L3VA 3TBKA 4Q9IA 2ZRIA 4QL3A 2UZIR 1E2EA 1E2JA 4CZ2A 2Q9CA 1Z83A 2J0UA 1E9DA 3A58B 2ANBA 1LTQA 3U7GA 1AA9A 1OFUX 4BLTA 1R2QA 4PQFA 1TX4B 2BMFA 3RHFA 4JL6A 3DOFA 2QENA 4KVAA 2C8VA 2OBLA 1Q22A 1VTKA 3RVBA 2OO7A 3GEIA 2IS6A 4A2QA 2WAYA 1SKYB 1A82A 3TH5A 5KSOA 4EPYA 1HA3A 2Z83A 4QNMA 5G3ZA 3EXAA 1G6HA 4AK9A 3C14C 3OIYA 1G5RA 1U9IC 1S4QA 1ZU4A 2ZEJA 4B76A 4GZLA 4XSGA 1X8LA 4NYJQ 1OPXA 1CRQA 4RZUA 4D2IA 1CRPA 4QBFA 1BMFD 4LBZA 1M74A 2QROA 1N6IA 2FJUA 2ZS8A 3R7WA 5JMTA 2GXUA 4NONA 1VHLA 4A2PA 1OHHD 2I3BA 4KBFA 3T1TA 1RRGA 2QI9C 1KY2A 2C95A 2YOFA 3BK7A 3WYAA 1LB1B 2YYZA 2XOKD 3CM0A 4V0OA 1OV4A 5EP4A 1ZD8A 3L82B 1G16A 1M7HA 3OZXA 4GI7A 2F3RA 2ZRDA 2A78A 3GFTA 3WHLA 1N6OA 2G0TA 4WXPA 5KPDA 3VR1A 2QMHA 4IOLA 1MO6A 4JT4A 2J59A 2AR7A 1RRFA 3ASZA 4PO8A 1CR2A 4CEIB 3K0AA 3R9WA 4YONB 2YC2C 3D3QA 1TQ2A 1ZM9A 2C9CA 2OAQ1 1IBRA 2IYQA 5JCPA 2EYUA 4US0R 3QQ5A 1F5NA 1P9WA 4WAUA 1W49A 1NVUQ 1P5ZB 4PSKA 1IHUA 2VP6A 2ZE6A 1NN5A 2IT1A 3CX6A 4NYMR 4LJ7A 1D9XA 4A8JB 3SQWA 4TMKA 4MA4A 1NJFA 2CVFA 3CB4A 1N0VC 3O47A 3IBYA 5GJCA 4GOJA 1IQPA 4HAYA 1NIPA 3GJ7A 1E2KA 4B3GA 4DBLC 5G3YA 1XU4A 3LBNA 2VHQA 3PEWA 4DLZA 1HTWA 5FUVA 3TIFA 3MFYA 1XD8A 1NRJB 2EFCB 3CRMA 3QY0A 4PPGA 3QPVA 3B9PA 3UMRA 4PTLA 4A6XA 4DDUA 3Q85A 5BYJA 4D80A 3AVOA 2GJAA 1HT1E 2RGXA 2A5JA 3HYTA 2O8DA 4QNRA 2VPPA 3T1OA 4FMDF 3SU8A 2E87A 4QGAA 1E99A 2ZI4A 2JGNA 2IYSA 4LYAA 3Q72A 2ZANA 1A1VA 2F6RA 1FPMA 4G5GA 3BFKA 1YQTA 4QG7A 2YKGA 5KNCA 5CM8B 2CHVA 3NHAA 4TL7A 2VYFA 1T5LA 3K0SA 4OQXA 3U3OA 2F1RA 1SZPA 5B30A 1XZPA 2XB4A 1E96A 3EPHA 1ETUA 1CULC 1GL9B 4ZI2A 3THOA 2A3RA 1M7GA 4B2IA 2B7BA 3VQTA 3MWYW 2IF0A 1UKVY 1ZUNB 5H70A 3MJHA 5EZ6B 4QBIA 2WAXA 4TTPA 3V4FA 2OFWA 2HXSA 1OFHA 521PA 3V00A 3GMTA 2GDJA 4QHSA 2IS2A 2XNDA 1ZC3A 1T4GA 2RGGA 3ADKA 4FD2A 1HT2E 1YHNA 4TSFD 3SI7A 3C5CA 4G0NA 3K0FB 3E70C 4Q1DA 1BYUA 2ZE8A 2R44A 4PPNA 4D0LB 2AX4A 1VIYA 3E5HA 1RJ9B 2ZUCA 4QM7A 3KQLA 2FZ4A 4AD8A 3DZ8A 1X3SA 3N2EA 3QBTA 1SKQA 5FPYA 4AYXA 2OFXA 2OBNA 4KLZA 1U2RA 3CX7A 5DI9A 2J45A 3SYNA 2XZPA 3R8CA 5L3QB 3ZD6A 5LBIA 4B3XA 4D81A 3TR5A 2VQSA 1QG2A 2QT1A 1S9DA 1W0KD 2WJHA 4PSVA 1Q0UA 3CRRA 4URYR 2H92A 1Z0IA 3CNNA 2XXAB 4D4JA 4JMPA 1SULA 4HDOB 2BBSA 1DADA 4XVUA 1ZIPA 1T0JB 4B2LA 4HAVA 5FBRB 2P6UA 4HDQB 3CUEF 3K53A 2ONJA 5JI2E 2V3CC 4M9ZA 1TQDA 2DY1A 3C4JA 1XEXA 3L0OA 3H2YA 2BM1A 1Q1BA 2QPAA 3DVLA 4DCUA 4PAOA 4PHGA 1VYVA 1OE0A 4DEXA 3B85A 5HKKA 1HY3A 1J7KA 4E07A 5DISB 4C0SA 1KDRA 4R7ZA 2IYXA 2NO1A 4EPXA 4ESHA 2CE7A 2HLDD 2ONKA 2ZR7A 4X8HA 3R9IA 1J99A 2GXQA 3RSOA 2QSYA 4OI1A 2QA5A 5KSPA 1KK0A 3I3SR 4Q47A 5KDDA 3H0KA 5K8UA 1GIAA 4Q18A 4WZAE 2A9KA 2N46A 2AHOA 2VP5A 2Q21A 3KB1A 2Z6VA 1OH6A 5CK5A 1TEXA 2RH5A 4C0QC 3WYGA 1XMVA 2A5GA 4OQMA 3ZQ6A 1CF4A 2PEYA 2QL6A 3UG7A 4WOPA 4BFTA 3SHWA 4F38A 5JEEA 3THYB 1D6JA 4MUBA 4LYHA 4BZXA 5BW8A 1N2CE 1C1YA 1KO1A 4DDTA 3TR0A 2BWJA 2ERXA 1YZKA 3IBGA 4NKRA 4B6EA 4PZYA 1P9NA 4TMWA 2DWQA 2X2EA 2A5DA 3EASA 4AY2A 1E79D 5FFMA 5FBLB 1H8HA 4LX0A 4URUR 3PCRB 2V4ZA 2YINC 1VMAA 4KYIB 4RD1A 5E7MA 4DKXA 1IJEA 1JBKA 2V6IA 2BV3A 1U0LA 3ZJYA 4I4LA 4W5WA 1TF7A 2Q3MA 1EXMA 2ZJBA 3CF2A 3LLUA 3RWOA 2IUSA 3FMOB 1AJEA 2PZGA 1F60A 2OUKA 3T06B 1RC8A 4NTZA 3UMSA 1E3MA 4TZ0A 1FMJA 3PR1A 4M9QA 3I72A 5KYKA 4CYMA 4RY2A 5L3QA 1G3RA 2CJWB 2CL0X 2UVQA 1G5TA 2WJYA 5EE3A 5HZHA 3UWOA 2LCFA 1GL7A 1L7VC 2REXB 5EP3A 3DEFA 1JAHA 3IIJA 2D7DA 2RHMA 2ZVQX 4QOSA 3TLXA 4I1VA 2MMGA 1WB9A 1QHYA 1UBFA 2QMOA 4NU0A 5AUPB 3NH9A 3MMPA 2YWHA 1E2HA 1G3IA 2GETA 1TPZA 1ZINA 1P2VA 4P4SB 5CIQA 3WNDA 3FFAA 3F0TA 1F2TA 4URVR 3LX5A 4D25A 2J87A 1TL7C 2IL1A 3SOPA 5JEDA 3NEYA 1PZNA 3SJBA 2ZRHA 3ECCA 1EG7A 1KI9A 1U90A 1XRJA 3GCGA 3K9NA 4FMDB 4JLVA 1DEKA 3AKDA 4TZ6A 2Z0MA 4Q1AA 4TMZA 2EQBA 1KI1A 1AZTA 3R8FA 2GNOA 3IEUA 4BFZA 2ZETA 3NHBA 4QJ3A 5BN5A 4JVLA 3UIEA 4JYCA 4TN1A 4TLCA 1CTQA 3PUVA 3KXLA 2G83A 2H17A 1HQYE 4CT4B 2GAOA 3PQCA 1MRNA 5CB6A 4CRWB 3HPQA 3RS2A 4ZDWA 4MRVA 3S1AA 1OXTA 4DHEA 2QP3A 2ZUDA 1FL9A 2BC9A 1YR9A 3JVVA 1B0UA 1Q1EA 2CHQA 4PC6A 2C03A 4GL2A 1KSJA 4JT2A 2CJWA 2XAUA 4EJSA 2JJ2D 2RGNA 4LBYA 4LBVA 1XTSA 3U4QA 5FTLA 1RYHA 1NSFA 4PAMA 3R9XA 1GUAA 3T35A 1Z0AA 3W8NA 4HUQA 3T5GA 1AZSC 4E09A 4TTQA 4M1KA 4IDPA 2PCJA 4IHQA 3THWB 4BPBA 2HXYA 1RE0A 4HLCA 1G4UR 1WMSA 3MG9A 3MWJA 3QEOA 3SNHA 3ZVLA 3Q5DA 1E4YA 1DVRA 1Q1ZA 2JDID 1VG8A 1DOAA 2SHKA 4HYYA 5M04A 2HF8A 1XCMA 1YR8A 4LGMA 1QF9A 3FTQA 1UDXA 1NBMD 5CM9C 2KE5A 3NWJA 3Q9LA 3OAAD 4GOXA 4OQNA 1LS1A 3A37A 4KBGA 5EXXA 5EE9A 3MRSA 4PC2A 2P65A 2VHTA 3TMKA 1E0KA 3GLGE 2H5EA 4GP6A 1JR3A 1DG1G 4IOMA 5ELXA 2I1VB 3K0CC 4YXWA 5A0FA 2OHFA 4M53A 3A1WA 5FTKA 2I1QA 2OM2A 2QQEA 3LRPA 4GSYA 2IWHA 1VYTA 4QHTA 1M1YE 2ZYUX 1L4UA 3B1XA 1NBME 3SFVA 2HT1A 3L43A 1OXXK 4UNPA 4H1UA 3CRVA 2MSDB 2FGKA 4QKQA 2O8EB 3B5JA 2ZJ2A 3HU3A 5JRZA 2J1LA 2D2EA 3VR4A 5BQ5A 4OBEA 3UPUA 1G7RA 3LD9A 2J7KA 3IO5A 2IYLD 5A5GA 3AP3A 3MSXA 4II7A 1E1RD 1IONA 1T3SA 2FA9A 3I1FA 2VP4A 3TSOA 2YC4C 1GNQA 5G53C 2N1BA 2O52A 2PH1A 2Q3HA 4F4IA 4A82A 2K5UA 2VTKA 1K6MA 5TY0A 5JECA 2F7SA 3I61A 3B8HA 1G8FA 1KJYA 1P60A 4RD4A 4IXMA 3MD0A 3SYLA 1IM2A 1LW7A 3FB4A 3BWDD 5JWHA 3MAAC 1G6OA 4QGGA 1FFHA 2XEXA 1PVOA 1KO7A 3I32A 4EJSB 2FFBA 1ZMXA 1KMHA 1OYWA 1NLZA 1XPUA 1QHGA 3CWQA 3I4LA 1OKKD 3LLMA 4TYYA 2X19A 4JLKA 4BWYA 2QBYB 3QE0A 1E69A 3BB4A 1C4OA 2FU5C 2ZYWX 3T5DA 4RKEA 721PA 1E79A 3NH6A 4JJKA 1SXJC 1TQ6A 3W8RA 4DLWA 4M0LA 3EZ2A 2QEQA 4BGDA 5TV2A 2IBMA 2RHDA 1Z07A 4D82A 3KJHA 1R6BX 3IPYA 1D2MA 3QF4A 4JS0A 4JVNA 4XWAA 3ZVNA 4LYFA 1D8TA 2GAAA 2JLUA 3KKQA 5AUOB 5F9FA 2NZ8A 3QXSA 2IEZA 2VA8A 1XJQA 2G3YA 4NH0A 4LZZA 2ZE7A 3B1ZA 1KZ7B 2RGAA 5F3WB 1F2TB 2VIIA 3KJIA 5B58C 1IY1A 4UKDA 1ZRHA 3AUYA 3QKUA 1CEEA 4K46A 1KKMA 2EFGA 3Q7PA 3QG5A 4PC7A 3J81k 2XXAA 3FOZA 2GEVA 5KOYA 3KJGA 3SQXA 1NVVQ 4MYTA 3KQKA 3SC3A 2CLCX 3OEHD 4QRHA 5E4FA 1KI7A 3RC8A 2PJZA 3CLVA 4Z8YA 4Z1MA 4LHWA 1IAQA 3A1SA 4WZ6A 4ZCLA 2PT5A 3GFOA 4NZYA 2EFDB 3G0HA 1QDEA 4TQAA 1KAOA 1XXHB 1T8UA 4I1SA 3QXCA 1CR0A 3QVUA 5FBVB 4P33A 4LC1A 1COWD 3KUCA 3NDPA 2JAQA 4Q03A 3O8RA 1ZM3A 2C98A 1JJVA 1N0WA 3A4LA 3W90A 2B92A 4A1FA 5KSYA 4YC7A 2GK6A 3WNBA 4A9AA 3TGPA 4D0NA 2BMJA 1E9BA 2IEYA 4QBHA 3JZMA 5AJYA 3AP1A 2V1UA 2O8FA 1FNNA 1COWA 3NXSA 3ZZ0A 4GRAA 1YU9A 3UATA 4N1AA 2RGNC 4US1R 2HDNB 2AWNA 4EAQA 4N3NA 1OXUA 4BASA 2D2FA 1GWNA 3IQXA 1KOFA 4TYPA 4G3XA 4M4SA 4RD6A 4TT3D 5FPSA 3TQFA 4URZR 5DN6D 3DMNA 4DXAA 2R6CA 3RNLA 1XTKA 2GVZC 4JYBA 5DH9A 3U44B 3H84A 4P4SA 5CJPA 4PX9A 3DMDA 4KV9A 1VPLA 2A5YB 2HF9A 2H18A 5DYIA 4V03A 4RVCA 2LKCA 1RYFA 2V7QA 3LA6A 5HCIA 3KKOA 1S0UA 1S9HA 1W0JD 1SGWA 4OI0A 2WMOB 3ZH9B 1BOFA 1SVSA 4M8NE 4Q01A 4TL6A 2ZS7A 4HATA 1I4DD 3TJZA 3BB1A 4P3YA 1SHZA 1T91A 2GCOA 3GJ5A 3K8YA 4XD7A 4PFSA 4Q4AB 2OXRA 3EWAA 5HE8A 5GJWC 4YMWA 1EWQA 2CK3A 3BBPA 4M1YA 3Q3JB 3VKWA 2IXFA 1XZQA 1CU1A 3IUYA 4NYJR 1JPJA 3G82C 4IVRA 3Q8XB 2HCJB 1W4CA 2DR3A 2IF2A 3TW8B 5TVKA 1UKYA 3D8BA 1PLJA 2GZDA 4XD7D 2CXXA 1Z28A 1DO2A 5JWOA 1A4RA 1XJ0A 5EUQB 4ABYA 2FE4A 4JVSB 1LF5A 4G1UC 4P0TA 1T8TA 3LXXA 3AVVA 1TAGA 2QSZA 5LB4A 1OH5A 2CE2X 4JL5A 3ZYCA 1HE1C 2X77A 4QJ5A 3PUWA 4HLDA 3SJAA 1XMJA 4HEJA 3EC1A 4OL0A 5FOSA 1TMKA 2OCYC 1E9EA 4UXHA 4W5HA 1Y63A 1VKJA 5G41A 1YRBA 3QXJA 2KBEA 1OIXA 4UJ3A 5DSZA 5FL7D 2ZITA 5KNBA 3B13B 1AGRA 3VFDA 1R0WA 4N0EA 3EC2A 1PLKA 4ZPXA 4PR0A 1WF3A 5L3RA 4DT1B 2ZSBA 1UF9A 5FOVA 4RZ3A 1G7CA 2OG2A 4QGFA 4BRWA 1L8QA 4EFLA 4L16A 1Q12A 3PITA 3WBJA 4ESVA 2OXCA 4YDSA 4NL4H 5CDFA 4QHYA 4BEJA 4EUNA 2QZ4A 4A92A 4MGIR 3KKNA 4L5BA 1NVXQ 1Z6GA 5DNYB 4PO9A 1GOTA 3RSLA 2AN9A 1VDZA 2JIZA 2WWXA 1XFAA 3PEVA 3FPAA 1Z47A 2AWOA 1XTQA 2ZRJA 2O8DB 1G7TA 3TK1A 5GJBA 1P6XA 3ZIAA 5KDOA 1Z3IX 5DN6A 4KI0A 2WPDA 3I92A 1VYUA 1NY6A 4BFSA 3QNUA 4KSCA 2RGDA 1GG2A 2EFEB 1W4AA 4ON9A 4C0HA 3GD7A 3K70B 1HE8B 1II0A 1G20E 1CLUA 3T34A 2G0NA 2H1LA 4HAWA 3EIHA 4D4KA 2BBTA 1NN1A 2OILA 3GLGA 4HB3A 3AGQA 1ZVQA 4LJYA 2A7QA 1JALA 3M0EA 3OEEA 4EDHA 2NPIA 1GNRA 1UDWA 2ZJ8A 4U00A 1KNXA 2X8AA 5DGXA 3WRYC 4BZQA 3LY5A 2VSXA 1VCIA 1NVVR 1PLLA 1X1SA 1P73A 4E03A 4Z54A 2NMVA 2VHCA 2GXAA 3GLFA 3LO5A 4M1TA 3W34A 1AS3A 4HSEA 1GRRA 4WW0A 3EW9A 1QHHB 1QVAA 1HUQA 2V8OA 1Z6XA 5HZKA 1OIVA 1U94A 1ZJ6A 2QM8A 3P20A 3LFUA 2RGCA 3PVSA 1SVIA 3WMFA 3KQHA 2C9OA 3EG5A 1YZNA 4BLQA 4I1UA 5SZHB 2YWGA 3BJIC 1G8YA 4BFWA 4C4PA 2TMKA 4FMCF 4JSYA 3K0EA 2IS4A 1E2NA 4JLJA 5GVSA 4C30A 4BLPA 1GKIA 3KB2A 1XTIA 2WOJA 2FWRA 2VEDA 2WJVA 4Y0VA 2WVJA 2DFNA 2CLDX 1VG1A 3OE7D 2BCJQ 2GVDC 3CW2A 2V6JA 5AJZA 3TUJC 2PMDA 4GPTA 1AKEA 3BC1A 4EPVA 4DDVA 1KO8A 3GEEA 5G40A 3M6AA 4GMDA 4IRUB 2KSQA 3ZS8A 2WICA 4E22A 3AV0B 3QXHA 4Q7MB 4Q7JB 5KPJA 2J0VA 4IEIA 1IY0A 3C15C 4C0LA 4JZKA 5FPHA 4A0RA 1U0JA 1W4BA 3FHTA 4LHXA 1G3MA 2CNWA 2F1JA 3ZS9A 2GCNA 3ZQJA 1OB5A 3PIRA 2CLSA 4C7OB 4MGKR 2X1VA 1VCNA 3AVXA 4AKIA 4YXWD 3UMFA 4LOAA 3ND9A 1KI6B 4DCSA 2O8FB 2IYYA 2ZSDA 4DSTA 1NMXA 1P3JA 3FMIA 4LK2A 2IUUA 4OHVA 1NNEA 4DLVA 4URWR 4TYNA 1TUEA 5IK2D 3TKLA 4D4LA 3PUXA 4F4JA 1AQUA 2DFLA 1BIFA 1LF0A 2R6AA 4NCIA 3AVQA 3B1VA 1W36B 1IN6A 2CCJA 1P62B 2QAGC 2ZRMA 4NHOA 1E9SA 4MGZR 1IN4A 1XD2A 1ZNXA 2G9NA 4KLNA 5CYPA 1UBGA 3GJ3A 4BUJA 3GJXC 4RCYA 2NTYC 1N6KA 3QIAA 4TL8A 3EPLA 3L0SA 5EUMA 1OSNA 1ZC4A 2AD1A 3U7FB 1ELOA 1N0UA 3WBKA 4Q1CA 2ZXUA 4FN5A 2WMNB 3GEHA 5EXSA 2VP2A 3OESA 2OBMA 4RKFA 2QPOA 5CB8A 3GLFE 3QPUA 3ZLJA 3CPJB 3CKLA 4JBWA 1UM8A 1R0ZA 2DHRA 1VG0B 1TF5A 5GADl 4JJZA 3L8YA 4KFTA 1DG3A 5LD2C 4IFEA 5CLLA 3IHWA 4HI0E 5D3QA 1M6NA 3NDBB 3QKSA 2AXPA 2P5TB 1JEEA 4PPFA 1H8EA 4B3DA 3A1UA 2JLXA 2PLRA 3FDIA 2W2TA 4W7SA 3QKRA 1E6CA 5JS8A 4I99A 1D5CA 2DFKB 1FOEB 4LJ8A 2W6ID 5IHPA 3ONWA 1X8KA 2O8CB 3VKGA 5FOUA 3U7HB 4MRSA 4PQYA 4KHZA 3KFVA 2G1JA 2GBLC 4B34A 1L4YA 2BKUA 3TQCA 1XEWY 2W6JA 5E7JA 4Q9HA 1Q3TA 3VX3A 4YMUA 2FG5A 1Q21A 2IXGA 3C41J 4QBGB 2GEDA 2AL7A 1KJZA 2QY9A 2R6FA 4RCZA 2YJTD 3SZRA 3MJRA 4LJAA 2F43A 1SXJA 1AM4D 1TEVA 1OFIA 1UEJA 2JJ1A 2ZI9A 3PEYA 4AKHA 3HU1A 1AGPA 3NBZC 3IIKA 3GLFB 3NIBA 1XDBA 4WZBE 1KI8A 5DYGA 6Q21A 4HLQB 1DELA 1NJGA 2B6HA 4M1WA 4IVQA 4Q7LA 3VNVA 3OHMA 1G8GA 2BBWA 4BRUA 2WWGA 1ZUIA
chains in the Genus database with same CATH superfamily
4C01A 3A0UA 3G2LA 2OQRA 5AK5A 2ORWA 2WKPA 2ERYA 1C2YA 4UM7A 4A27A 2JVJA 3CF6R 4TMTA 5AJVB 2VK1A 1CJTC 3U4QB 4NE2A 1CY0A 1C9KA 1SVOA 3UQZA 4IHJA 2HY7A 3A4NA 1ZGBA 2DERA 3BOSA 1XHEA 2XVZA 2ECPA 3K16A 4P0PB 3SDZA 3OUTA 1WXFA 2AEJA 2HO5A 3BIWA 4GWKA 2WZDA 4UCQA 5JLAA 3WLRA 5JY1A 4AS1A 3PX2A 2XXBA 4KO3S 3PE4A 4W5TA 1C81A 1I9GA 1V5IA 2JLVA 1UH5A 2TYSB 1AKQA 3HBAA 3TTVA 3MIIA 1EDEA 4YALA 1XT6A 3O84A 3HADA 2YCLA 3EZFA 1DBQA 4L07A 4LZLA 1I3CA 1ZM4A 3GU3A 3B89A 4XVRA 4ILKA 4LISA 1OXSC 2BL4A 3L40A 4MJLA 4ADSG 4CIVA 5KQMA 5TVGA 1RWPA 3LQ4A 4MVJA 2YIJA 3M7IA 1URPA 4ITRC 3FWNA 5HFNA 2I2CA 3E9MA 2NYVA 1XTVA 3NBYC 5FTJA 4ALNA 1G9XA 1SNYA 1E64A 1TYCA 4HVTA 2GYUA 3UMGA 4KQMA 1W87A 2XX3A 4DJ5X 1VBFA 3QKRB 2YUTA 3N28A 4WA8A 3BTVA 2Z5FA 4FGLA 1JXQA 1QCCA 1ZIYA 1P31A 1UADA 2F8LA 2OB1A 5FYQA 4CBVA 3UC5A 2GEKA 2C84A 3SS8A 1M2FA 2O0HA 4A10A 2O3TA 2DEUA 2FUEA 4O6VA 4NCHA 2OWEA 4XWKA 2ORYA 1IHYA 1VGRA 1XRSB 2EVWX 1F2UA 2J8ZA 3CR3C 4GWLA 4ER0A 4N65A 2HW8A 3VKHA 1RT9A 2OQIA 2QLBA 3NBAA 5AM4A 3L6OO 3FF1A 3FUXA 1TAHA 3Q0TA 4L78A 2O3RA 4DSZA 5EJ9A 1D07A 1MT0A 2CW5A 4WH0A 1LV8A 5HKLA 1V8BA 2EGHA 4CM6A 3D3WB 5F52A 1R0LA 3ESYA 2CDNA 2CLKB 1CEQA 2ENWA 1QH1A 5JSZB 1SG6A 3B6KA 3K71B 3TEJA 5A1JA 4F45A 4EEXA 1HE3A 1KMIY 2CD9A 3B12A 3V4VB 1XRQA 2BH2A 5ALIA 2X41A 4AJJA 2LIPA 3JRWA 1HV8A 1VKZA 4DAOA 5A4IS 2GN4A 5DCLA 1PQPA 3R5KA 5AESA 4BO6A 1JVSA 3JCZA 2CHUA 1XMIA 4IDNA 5HRCA 5FWXB 2ZRPA 2ZU0C 1I30A 3TTTA 4PSAA 2NVBA 4R05A 3G5UA 2FCAA 2QXUA 3T7TA 3KSMA 4B3BA 3PENA 4DL9A 1E6KA 1TGVA 2ZWVA 1E6UA 3T3DA 1AKYA 5ALHA 4DV2B 3BTUA 3EHEA 3HSYA 3H5WA 1SIBE 2G88A 2K2QB 4RVSA 2HU8A 3U3XA 2DOKA 2JK0A 1OWPA 4YDRA 4NICA 2NQTA 2UKDA 2HB6A 3MWGA 5GWXA 3RQSA 2QW0X 1JHXA 4D6PA 2YMPA 4ZAVA 4BFLA 5IUNC 3UF0A 3WYEA 4CM1A 1RKQA 1J0XO 3HYCA 1MHTA 1DV2A 4V39A 3SR3A 1PF7E 5JXJA 4A0FA 2OO5C 3BERA 4AY3A 2C3YA 5BXQC 1RZRD 3A9RA 4M9SA 2D8MA 2D74A 3BTSA 1BWRA 3CNOA 2A86A 1O03A 2I2BA 3TSZA 3W5JA 2HCTA 3VUEA 5I7AA 5L8VA 4H1WA 4NDZA 1BTOA 5C5CA 4Z3OA 1V2GA 1FRNA 4UAJA 1AK1A 1E2DA 2P6OA 5DI3A 1S8NA 3HKDB 4TYWA 5B3AA 4DMCA 1Q7TA 2KS6A 1HYHA 4H16A 3VI4B 2XNDD 5CURA 5D86A 1N5IA 1NDHA 2HH9A 3FCCA 1PN3A 3HEAA 3WP1B 5I3ZA 5IJ9B 2QUZA 4CEIA 1CUVA 4KXMA 1DIGA 4OK5A 3LPLA 4P4LA 4GXTA 1H2EA 5AI6A 3DZDA 1YDHA 2R97A 2VNKA 5HCNA 2IX3A 2QV7A 2AN3A 2PXCA 3AUJB 3M4XA 1KXJA 1XAGA 2A84A 1Z56C 3H5NA 5C37A 2VBCA 3GRYA 1GUZA 3IOBA 3Q1LA 4GHWA 3UH1A 2AZXA 2PVSA 1PGNA 3RS4A 5ICCA 4OATA 4LTDA 1TAUA 5JXGA 1AQNA 2XNKA 4FTWA 5LQDA 3OSZA 3GHYA 3H1EA 1Z2OX 2P0EA 2QIOA 4C2UA 3QQPA 3FSRA 2QTLA 2IV7A 4RFSB 1R0RE 1V8DA 2FDRA 1QO0D 3NBMA 3WSWA 1MJNA 1WTCA 1XSEA 2GK4A 3IXQA 2CZCA 4KB5A 4QD3A 4E6EA 4CM9D 5FTNA 1DZIA 4IRMA 3U61B 4YJ2B 4PN7A 3EVGA 4R69A 4R1OA 4I55B 1GLGA 3KXDA 4R1SA 1L5NA 4LHZA 2XJ9A 2VRWA 4FOTA 4C05A 2J7PD 1AHIA 3UN1A 2HU2A 3R7NA 1UPBA 3DAOA 3LUDA 3NKFA 4HQFA 3O5AA 3V2HA 4Q4HA 3ZR4B 3WDLA 4D9EA 2FFHA 1ADJA 1OAKA 1XU9A 5F7JA 1G5IA 3MWKA 5DTQA 2PXAA 3VZCA 3NGMA 2IXBA 2IUYA 1MRSA 3MAGA 3PICA 4K2HA 4S2EA 2IP2A 5FYDA 3BAFA 1QVRA 4UHBA 4XYMA 3V7UA 5EGSA 2NQ2C 2VXCA 3I1YA 4HNGA 4K9QA 4L9WA 4WCDA 4BVLA 4LHSA 2FR8A 1T8WA 3B2EA 3QTBA 1CK4A 1WULS 2RHCA 3ICEA 4DJJA 3AEKA 1JT9A 1Q1NA 2XIJA 4LSGA 5AJXA 1IC6A 2DP4E 2GLUA 2ZUBA 3ZWNA 2H1RA 2WZBA 1R66A 1HLFA 2B4AA 1OILA 5AUQA 1PGJA 4JHLA 1P6QA 1Y3BE 3QMWA 1GILA 1PQYA 4JU9A 4OFZA 3UG6A 1J2RA 4CM8B 5L3SB 2VCYA 5EYPA 1DRJA 3EEQA 3IE1A 1M3SA 2LW7A 2XGJA 3ZV4A 3JAWB 4DV4B 3KQUA 5TMEA 4AWBA 4R2IA 4DNOA 4ZIRB 3H2HA 4P84A 4ZI5A 3WFZA 1XXHE 4EEKA 3N39C 2BKEA 3H2KA 4QZVA 3NALA 1M5UA 3HR7A 1K4KA 1THMA 1W35A 1RRCA 3V6LA 2X1MA 5L95A 4LY0A 3F6EX 5L9AA 3OQHA 2JJ2A 5EPOA 4WKNA 1UAAA 3WGUA 1EIWA 1L5FA 3AERA 3PKZA 5T64A 5IP5A 2HUNA 5EFOA 4B5KA 1J20A 2F9FA 1XWFA 2QQFA 3NBFA 5BN3A 1IXZA 3RU7A 2ZK7A 1Y6FA 1EQUA 4PZZA 4RULA 1EUYA 4I5IA 4AJ1A 2HZ7A 5H68A 1LC3A 5JWRA 1MW8X 4QQKA 1E9RA 1C9JA 2V1XA 3C3BA 5TQ2B 2Y1OA 4R1TA 4ZMRA 4PICA 3GRPA 3L02A 2XDWA 4I36A 2QR2A 4GM0A 2P9QA 4U2CA 4L5JA 3ZOZA 3OFSA 4DCTA 3ZXYA 4ARBA 3T3EA 3LPMA 1Z33A 4MPJA 5KHLB 4WX2B 4AG3A 3KX2A 4Z9XA 5I51A 5IJWA 2YMMA 4LZPA 1KOGA 2IHYA 3FVTA 5SZKB 1RAHA 3IR5A 1U2GA 3TTSA 2ZRLA 4LJ6A 1K86A 2HJVA 1WKBA 1A98A 1BDBA 1EP2B 1DU4A 4OMFG 4X0EA 1L5VA 4XLTA 3AF0A 2FDCA 2P91A 4L8VA 2AIRA 1GU0A 1R5NA 4DVGA 1QC5B 3S6JA 5FULA 4MVJM 4K8RB 4UOQA 4F97A 2ZB3A 3DLAA 4RPHA 3WXBA 5IAOA 3RB8A 7REQA 1PJBA 3CJTA 3DEIA 5JSQA 2XCTB 1VMDA 1ZP6A 4H6PA 4CF4A 2BN4A 4P3PA 1QPBA 1TE2A 1R9MA 2W58A 1QFXA 3WWDA 2CLMB 1MOZA 3OURA 2VFAA 2GHQA 2OEPA 1G9SA 3CS3A 1R6VA 3BE6A 3QU4A 5JG7A 3RS5A 4P3NA 4N7RA 3JQRA 1KIFA 4DC1A 3F71A 5C1IA 4BX3A 1VI6A 1SEVA 3P9QA 3E81A 5F2EA 2CJFA 3ZBPA 4X7PA 4ED9A 5CVJA 1VLVA 3KYCB 1XPRA 4HDMB 3GGOA 3GJYA 3BKWA 3EWSA 3G8CA 1C4KA 4TMYA 4YMVA 2PT9A 1C7EA 1A04A 2QTMA 4FEYA 1K8XB 2P3OA 1J9GA 3D1VA 3K1ZA 2YRWA 4FYHA 4LJ9A 2QP9X 5AI5A 2AFRA 3GVIA 4FDLA 4UXJA 4LRTB 2PLAA 1HDRA 4CUKA 5JJBA 1O0BA 2D2XA 4GDFA 2I7TA 3CRNA 1U0FA 4G67A 4IHKA 1QTIA 1G21E 2GK7A 2EJUA 2FX5A 2Q0XA 5KOJB 2WNIA 2Q5OA 1FW6A 1L4FA 2QE6A 3KB8A 1DO0A 4GL4A 1ULZA 1BO6A 4REMA 3ZE0B 1QZTA 4DUGA 1M2VA 1QGED 5KYWA 3KLOA 4NBVA 3MGGA 1A8PA 3EQZA 3I5YA 1CY6A 3CLRC 1W94A 5D6OA 1HYBA 3DLPX 3M83A 3KBBA 2F9LA 3L1IA 1P2TA 5AHXA 1DXYA 4U7WA 3W5CA 4NBWA 1SCIA 5AVVA 4JUAA 4KQGA 2HWUA 1B0ZA 2QJWA 1RYBA 1GR1A 2CLOB 3PZRA 5CNMA 3SXUB 3ILHA 4C06A 4YV0A 2Q3CA 3PDCA 3PDIA 4Y0AA 2BJWA 3EOZA 5ESXA 1I4OA 3ZJ4A 2ZYGA 3Q2KA 3Q7QA 1I6MA 4U02A 1T4DA 4X9XA 5BQPA 2NOAA 5DX8A 2WKQA 2FF5A 4TRNA 3ZDXB 4A8PA 1JWLA 1HSOA 4O1IA 4B87A 1UPFA 1PUIA 1JB9A 3C3YA 1VFNA 4AF7A 1LZKA 1A9ZA 1N9ZA 1I2CA 1YRAA 4NOJA 1L5RA 4P34A 1RVDA 3O90A 5K45A 3L8MA 1Y37A 1ZXLA 1KDTA 5DSXA 4R54A 5CCEA 1V41E 4IUYA 3MQ4A 1IPFA 3UPTA 3GUCA 1RYMA 3DOEA 1BQ3A 3IQZA 4UU7A 5C4IA 1M6YA 2I2XB 2HCFA 1QP0A 1R9JA 4HT3B 3CLUC 4H3KB 4NLLA 4TGLA 1SIUA 5EJEA 5EE5B 5EZYA 1DQPA 2RGBA 1RFGE 3S81A 4JYZA 2B83A 3Q3GE 4G4SP 4QXMA 1AC5A 1XMPA 2R6GA 2H48A 2VPZA 5IZ4A 4N48A 4C21A 1JKJB 3ZNOA 4F56A 2FAXA 1TGYA 3TDNA 3TQIA 5DM60 2O2HA 4EW3A 1KMQA 2O1XA 5C31A 3X44A 4PX3A 1HPLA 2B8WA 4Q1EA 4RHUA 1KAMA 5EUBA 3WWOA 4D8XA 4Q9JA 4FKZA 3CW9A 3IERA 4I4NA 2IYZA 1E0AA 4N7BA 3CVOA 1A4IA 2O2SA 3NEJA 4UPVA 4WWHA 4XPIA 2ZGVA 1RPZA 1IRIA 4WXRA 1IAVA 1CERA 1QZXA 2GZ1A 4LDPA 3QJ5A 4K2AA 3T54A 1FUUA 3WB1A 3ZD7A 1ZL2A 4BKOA 2F8TA 1CJCA 3ZCVA 3CZ9A 2I3ZA 2HCRA 1DBPA 3I8OA 4BNYA 3GPDG 3KXKA 4H6XA 5FAXA 3LYLA 3VKFA 1GAWA 2DQYA 1Z6TA 3KPUA 4ZCSA 3K9FC 2IH4A 3TZCA 4MUGA 2B94A 3OFKA 3U9SA 2Q3FA 1YUBA 4OU4A 3KPYA 1DEAA 2H9YA 2V5UA 3Q87B 1DUVG 1EDBA 2KJQA 4KN8A 2BUAA 4HH4A 4EG6A 5J4VA 4BHTA 5FOTA 3U2QA 5AKKA 3BF8A 5IF9A 4G0ZA 4TV9F 4CKBB 3ZWQA 2DSTA 3VOAA 1F0PA 4DDHA 4CEJA 3D4NA 3LYAA 1PUJA 3QXXA 4TLAA 5AK4A 1AURA 1UDCA 2IU3A 1E7MA 3B9BA 1UJ2A 2WPDD 1FP2A 2ZTVA 4F6RB 1P19A 2IYUA 5DNCA 2CCKA 4BQPA 3DPUA 3KV1A 4W9RA 4C03A 2D3TA 4RF2A 1H1DA 1GPNA 5IAEA 3KXIA 5ALQA 4CFYA 1W36D 3VI3B 4WZAA 1CR4A 2EERA 1ZPDA 3PS9A 2Z6QA 4YRKA 5JHGB 2DMRA 4BRSA 1LTHR 4PWZA 1T9KA 2PJUA 2VDMB 3AF4A 1TCAA 3IO3A 1JFLA 4HCJA 2JHAA 2C2KA 4EPTA 1QOQB 1USGA 3CZCA 4JX9A 4A5OA 1AMNA 3JD4A 3JSAA 5F9MA 2BHRA 2BSXA 3DLBA 1NW4A 5JLJA 3NBQA 3UJ3X 5LD2B 5KDLA 3R23A 3AY6A 2UVDA 2ZUVA 5K7SA 4Y6PA 3U09A 4XDHA 4GPEA 2A0YA 2IU4A 3LX6A 3VZBA 2YDYA 3G2JA 3C70A 3R3VA 4KACA 3RRJA 2HJHA 1SK8A 1HG1A 2FN4A 2WF6A 4HRVA 5K51A 1WXXA 4COOA 4HBGA 4ZHQA 4O2AF 1QIIA 5ADUS 2E5WA 4IBOA 2MDTA 4H35A 3NGLA 4WLEA 1QVVA 1K88A 4EQ6B 2R6DA 3JZFA 3OKPA 4Q02A 4AULA 3SJCA 4KIFA 1PRYA 3D31A 2EZ8A 3GG2A 1OASA 2W9XA 1GDDA 1YV9A 1Z3CA 2QRZA 2EF1A 3H9UA 3KHTA 4B09A 3AL0C 1JAIA 3IL2A 1MC1A 1XZBA 3VVLA 3OSUA 5B1IA 3PHGA 3QUTA 1VCMA 4P98A 3IA7A 4UNQA 3UMYA 1RJEA 3WHKA 1PS9A 2GAFA 3B1YA 4US2R 1JA9A 2C78A 3U16A 3GCXA 2D1YA 3SKVA 4TKUA 3NAMA 1C0EA 3LS2A 5F4ZA 2QAJA 1JB1A 2I6TA 3MXTA 3OUZA 3R4VA 4KPUA 1Q15A 3HPRA 5DEOA 5EZYF 4Z0NA 5I7EA 3QV1A 3RLFA 3P4YA 2IY7A 3NG1A 3LWDA 4TTTS 1YZTA 3S7TA 4F6CA 1GNTA 2AFHE 4XB6B 3RDPA 3KJQA 4IIDA 9GPBA 2Z3VA 2QU8A 2PS1A 1SCNE 2UVPA 4CDMA 4PIPA 5HTKA 2ODWA 3QJYA 4A0SA 2PFGA 5DLQC 5JQGB 4LTNA 2NXWA 2PDAA 4ND6A 3S8MA 4Q9LA 3REFA 3F5QA 4OX9B 1F8XA 3FHJA 2B4QA 3QEJA 4IDBA 3DBVO 1QCZA 4L0CA 2O7NA 3NKLA 1NI3A 2ECFA 3QYJA 2G1UA 4I4TB 1QIHA 1Z68A 3HFSA 3TRFA 2LD4A 2GBGA 1GZSA 1ACJA 4Z8XA 2Q3EA 5B2ZA 1GGVA 1H1LA 1QKJA 1ENOA 1V1JA 1Z2CA 2ZXEA 2RG1A 4D96A 3NHSA 2GKSA 3ICWA 5CVEA 1WG8A 4M8SA 5LU9A 1CUBA 1EP1B 1U9YA 4KJZA 4OVKA 3UB4A 1CJUC 5CFZA 3C7TA 2Q5FA 1GM5A 5EXPA 1L4NA 2C2HA 4LZNA 2AHRA 3EGXA 5B7QA 3IKTA 1PK8A 1YA8A 2P77A 3ESAA 3HB7A 4X94A 5ICFA 3TQSA 4DQ0A 2ZTSA 4J1SA 5H59A 3ADBA 4EHDA 2ZKIA 1V4NA 3TNFA 1Z5OA 4KXQA 4KRFA 3EXIA 2EIXA 4U0KA 1CQIA 5ES4B 1Z0JA 4WFIA 4EGQA 5A4JA 1FU4A 1QFSA 3E3MA 3WP0A 1SEPA 2D00A 1JG1A 2P9TA 3ISJA 3LXRA 3R76A 4YRNA 4U7DA 5CMLA 3WL7A 2PLWA 1R12A 1LVHA 1J5XA 4OH7A 2HSGA 3NRBA 4MITA 1GQSA 3PJDA 2IYVA 3KSUA 3BDIA 5FUXA 3I6YA 3N8DA 1HK7A 3TDMA 2YOGA 1ZD1A 4GF5A 2W0MA 4PLGA 4AL4A 1RQNA 1YVDA 2YN0A 2M6RA 4X1OA 3U5ZB 4XUCA 3VYTB 3G23A 2FPWA 4XYBA 2R00C 4PBTA 1OXVA 1SVWA 3O8CA 3IALA 2C5LA 1ZY2A 1S96A 2XCQA 1ZCZA 1E6MA 2C5HA 2C7GA 1YE8A 3H8VA 4HNHA 5E9WA 1T0HB 4KQIA 5FBHA 3WHIA 3FGNA 4EI7A 1FVFA 3F3YA 3S28A 2DFPA 4XA8A 1ODFA 5FR1A 4ZJYA 2WA1A 1L4KA 1N2IA 5LQCA 5EC8A 3UGQA 2DJ5A 4JLUA 4ZOQI 5JISA 3WB9A 4BV9A 3C3EA 3DFUA 3EARA 5HF9A 1EFRA 3UFXA 5KX5F 3OQ1A 4OGLA 4ECEA 1HO3A 1ORDA 1Q14A 2P68A 4IMRA 2EF0A 1WXQA 1Z8FA 3ABZA 3DO8A 4YT5A 5LN1A 1M1NA 1JDVA 2IVZA 3K1AB 2JBAB 4NZPA 5TQ2A 4ND8B 2ORIA 1PWHA 1VA5A 2W4IA 1UQUA 4BFYA 1KH1A 3CVYA 1F48A 2HNBA 4FGZA 1O97C 3NVKI 4LRSB 3NTRA 4QT4A 5KYGA 8ATCA 2CYCA 3IR6A 3HB9A 2NW6A 3VTKA 2HMYB 1T5HX 4UDNA 3OEHA 4GKAA 5K0FA 2NSJA 1N25A 3DA8A 3FCAA 4H1VA 4HWTA 1ZGGA 4BV2A 1ZK0A 2OCKA 2Z2KA 4RNCA 5BWNA 3OAAA 1M66A 3ENZA 2ZVJA 4HXEB 5LXTA 5TE9A 4Y1RA 2H4FA 1RBYA 1EQ2A 2EOAA 1YR7A 4W5NA 3KU1A 5FNVA 1MBZA 3DEKA 3DBRA 1JQBA 2C7VA 1ST3A 3L7DA 1DS6A 3VDRA 4ZDKA 1U11A 4BX8A 4TS1A 2QRNA 1UFQA 2DLNA 4KQ1A 3RIEA 4ER6A 4AYTA 1RQ7A 4NH4A 1KZGB 5FLKA 5C7IO 4JEIA 3FLAA 4HUJA 1HNXB 4OUDB 1IQ0A 3E9ZA 2HO4A 3OZVA 3QUSA 4P4UA 1W581 4DMHA 3HJNA 1EWVA 3IAAA 2BD0A 3W6UA 1FYEA 4WECA 3H3JA 1YFLA 2REBA 4JLPA 1FP6A 1PFQA 3LLSA 2Q0SA 3EZ7A 4MXDA 5JU6A 4YWJA 3B5EA 3D4LA 3CUUA 4NOMA 3AVTA 1LZLA 4ZKDA 3ESQA 3NXKA 3HI6A 4JJIA 4NFYA 3WLIA 3OQMA 4YREA 3UMCA 2RHWA 1SXJB 3TZKA 3F7OA 1ZJWA 5HGXA 3N0TA 3TPCA 1ZIOA 4Y9SA 4RVFA 5IJZA 4QDUA 1JEDA 4GKBA 3ROPA 3W0LB 3IURA 3PHHA 1JQDA 4HGNA 2ACEA 2FLKA 4IF6A 2WHYA 2HJGA 3KDSE 4XVQA 5K09A 3ITDA 1QG4A 4GVLA 3I6MA 3O8QB 4RTQA 1QYRA 1CV2A 2ZT7A 3G3EA 1AQYA 3AEZA 4ZVKA 3PK0A 3BD6A 3GGSA 1U8TA 3PFWO 4A2CA 1C0PA 3R6TA 3IIIA 4GFDA 4QBKA 2O8CA 4TQGA 4G0XA 4Y2YA 3SYTA 1OLXA 3QVLA 1XTBA 1SO8A 4C0AC 4YIKA 4J2HA 1AKWA 4D45A 1QYDA 2ODPA 3ID6C 3V2UA 3ORFA 1GYQA 2H1OA 4ITVA 4ZOBA 4OFBA 4ALLA 3H86A 3ENVA 3MCZA 4ND7A 1UIMA 1A9PA 1QHXA 3QFRA 4GS5A 4MV5A 4MJXA 4P32A 3GD5A 5IJXA 1A7UA 3TF5A 5J43A 2I78A 3T0GA 1X13A 1X2EA 5BT9A 4DZZA 4MUKA 1DPGA 2X1LA 1RTTA 4NPCA 3HO8A 3KM0A 1ITZA 1GSIA 3ULKA 4AC9A 1OJLA 1E2UA 5I3CA 1XCPA 2QSJA 2RH4A 3MJCA 1KZ6A 1VMEA 2FWBA 4L4YA 2V5AA 3KQYA 2J3HA 5I4KA 2P11A 3I0NA 2DKNA 1G291 2UZ1B 5KJEA 4R0MA 3M6IA 2C97A 1I7DA 1Y8CA 3VR2A 4TL9A 1JJ7A 3DBRB 4KITB 3SM9A 4K6OA 5HNKA 3L8CA 2WIJA 2BFPA 4NV1A 4RD0A 4EY4A 2FZEA 3RSHA 1T5TA 1MO4A 2E49A 1JLLB 2PH5A 2POQX 1Y98A 5CPFA 4B3IA 1NG1A 2I8LA 2CFRA 4Z3KA 3VHQA 3V4RA 1IH8A 4Q4HB 3RVQA 1TFRA 2M32A 3EAFA 4Z53A 1ZMTA 4J8PA 3D7SA 4KDFA 2EBFX 3LSYA 2Z9DA 1YVRA 3NCTA 4KVGA 2B98A 4RV5A 4B71A 2O1EA 1EVYA 2BTQA 4P6VF 2D1QA 4F9EA 5J4YA 4LDQA 4ZAXA 1EEXB 1XDZA 2IY9A 3E1KA 3F5FA 1Q0SA 3OVMA 3NONA 5FB3A 5SY4A 3KWJA 5BOSA 4V0LA 1BKSB 2WSLA 4B44A 3KQMA 4WBSA 4D8TA 1OH7A 1EGHA 3D0KA 3RC3A 4A8JA 1A8HA 5EMJA 1DXHA 1MH9A 2W83A 4I3HA 3QEMB 1BHQ1 1NMEA 1XZLA 9LDTA 3O4GA 4ALKA 3F6SA 3GJ6A 3HLTA 4MQBA 5K4AA 4C4XA 2C42A 5LXTF 5M29A 3ZV5A 2QTAA 3H9EO 3M89A 2CL7X 5HTOA 2GN1A 5MF6A 2YZ7A 3IVGA 1O8BA 4GNRA 3U26A 3TR6A 1CIPA 4I81A 5ALEA 1DCTA 5HEKA 4QECA 1H93A 3TSYA 1LC0A 1WUKS 3LQFA 4EMUA 1NBAA 5CVVA 1BWSA 4A4DA 4D3XA 4L15A 4BO9A 1YULA 2FSIA 2OO3A 3W1VA 2O8CB 1E98A 4GICA 4H15A 1DX9A 1UEXC 1E3WB 2XNHA 1PGPA 4KODA 4PRKA 4W1RA 1I4LD 4ODIA 4XB2A 4Q24A 2ID9A 2FY8A 3OA2A 3RVDA 3E5NA 3KUUA 2XMCA 1BAPA 4PU0A 2QYTA 3PBKA 3THSA 5LMNB 2BTOA 2VA9A 4IQGA 3L7CA 5H5JA 3PKJA 1BX1A 3EUAA 5LM3A 2EHJA 1JXMA 1WV0A 1FTSA 2ZUWA 4LRXA 4ZJZA 3LPNA 5LYJF 1IVYA 1WE2A 2I1WA 3IOMA 3NYRA 2NXJA 3CGWA 2A9OA 2CBZA 2OV1A 3D8HA 3SMVA 4YR7A 4OAQA 2JI9A 3N8GA 2GAIA 2GZHA 3NPAA 4FNAA 3AHIA 4JA2A 3TO5A 2YDXA 3TFOA 1PEDA 1W46A 2ONZA 5HWSA 2YMQA 1MHPA 3NQ41 4G0VA 2EW1A 1DHTA 4MQLA 4JYAB 3ANXA 4WZBB 1ZH8A 1G8KA 2PZLA 5E1BA 3DV0A 3K5IA 1PW5A 2OMKA 3V33A 1NLFA 3LNCA 2D1RA 1K8RA 5KEIA 3QSYA 2ZJ7A 1BA2A 4HDKA 3VJMA 4DN6A 2CNLA 5EJ8A 5CT4A 1KC3A 2DHQA 2V6BA 1KJ9A 3OKAA 2DZDA 2FSFA 1TZKA 2B21A 1TCCA 2ZSIA 4K6FA 1IHDA 5D00A 3FYDA 1JW9B 3F2IA 3Q8WA 1ECCA 1DJMA 2R84A 4QEZA 3L6RA 4PBSA 5DLEA 2OG1A 3M82A 3WIBA 1E3SA 4Y2TA 3L2OB 1PT6A 4MDFA 1TA0A 2NGRA 4N3BA 4Q1BA 4S1WA 4YRLA 4PCLA 5FPQA 1IUPA 3TAUA 4AZ3B 6ABPA 2ID8A 3MJFA 4RVOA 4P5PA 5DF1A 2J0EA 1VPEA 4HO1X 2NIPA 1UPTA 3CX8A 1XOIA 3HP1A 5BWMA 4RL4A 3OCWA 1JEYB 1KC1A 3WRWA 5I7FA 1QGUA 2JA1A 5IMBA 2QM7A 5DP1A 4B4WA 3MT8A 3FUVA 1JILA 4X3OA 4DM7A 4FDVA 3ZLVA 1NF3A 1UDAA 2AC4A 2E0IA 3WLFA 4GT1A 4EECA 1WUTA 5C1PA 1Z62A 3E0QA 2XUJA 2F1HA 2IITA 4CODB 1A5SB 1H4TA 1B76A 2WU1A 4Y3UA 3WSVA 2ZU6A 1GL3A 4CMEC 2B61A 2N9UA 2I7CA 1ZOPA 3N2IA 1MJHA 2HQBA 4LVNA 1CIJA 4U2FA 1FFXA 1NXPA 1AY0A 2YL2A 4KC0A 2H16A 2IC5A 1Y3DE 2OZEA 4IDCA 1CD5A 1GVHA 1NVDA 5D84A 3B6EA 1DRWA 4XUGB 3O2SB 5CT9A 3BA6A 1I1HA 3LUKA 5HUHA 3IJ5A 3EZ6A 1YZUA 3GJTA 4W4TA 2F8MA 2OPHA 4EFKA 4GMKA 1EZ4A 1FQOA 2H65A 2L42A 1ESMA 2I6FA 4FJ1A 5AKEA 3KP1A 3H5VA 1PFUA 5TS3A 1GP2A 1ZAKA 1JDPA 1D4AA 3ZWXA 4HZUA 2ODAA 4G97A 3GJZA 1JRLA 1JA0A 1ML3A 2KLHA 1A2QA 4EY8A 4C0BA 1R5BA 4EARA 5AW3A 4G86A 1RI2A 3RRNA 3QU5A 1UBLS 3WGKA 3O1HB 3GWGA 2AZ4A 5JDCC 3B1WA 3O2JA 3MUFA 4R8RA 4DM4A 5DHUA 5KVCA 1NXVA 4HNUA 3BORA 2H08A 5TQ0A 2WIAA 3N1UA 4B0OA 4C7MA 4DM3A 3DBHA 1IHXA 1MEEA 3JVUA 4K3VA 4CV3A 3L4KA 4IFTA 2QAGA 1IN7A 1KVTA 4NBRA 3G68A 4M6WB 4FD3A 4DLSA 4E2XA 3S8YA 2HYDA 3HYNA 4RH1A 1O95D 3L7YA 3R7AA 2HWKA 1TM4E 2IE0A 3Q3EA 4ZP1A 5INTA 3BS4A 5HDQA 3UGJA 1GT91 2ZIWB 1TZJA 3RS7A 1EWYA 2RFLA 2BGNA 3SBOA 1EKXA 1UAGA 1JQAA 1YHYA 1ZBDA 3TLJA 4JL8A 1NR5A 1WKCA 3C39A 2BEVB 3WVNA 3KQWA 5DX1A 2QD4A 4EUFA 4Y67A 2DWOA 3RHSA 3U7RA 3KR9A 1V5WA 4X6XA 3GEBA 3L6CA 4CN8A 4UQOA 3C1OA 3U44A 2JEOA 3RVPA 4D9KA 4DG5A 1VL2A 2HA6A 5T4HA 1ZN2A 2WJZB 3AHDA 1JBQA 1UJMA 1Z45A 1ATIA 2A1UA 3B6IA 3WB0A 4DLTA 1LPOA 1P17A 1VE6A 1USKA 3OEYA 4CMEA 3BXOA 3FIUA 3UMJA 5JY6A 2CDBA 4OREX 5EHIA 1G4HA 3P4UA 3T7SA 3QMPA 4BRZA 3SOZA 3OMWA 1DZ3A 1HXHA 2BGRA 1TECE 4DWOA 1GXSB 1U2DA 1KDOA 3ROEA 2WYUA 2I2FA 4RJIA 2AE2A 1QH9A 1P2SA 3WICA 3KZ1E 1YASA 2HHLA 3NHRA 2X0FA 3TX2A 1Z2NX 3VOBA 4UNSA 4LEIA 4S0ZA 2CLFB 2FZKA 3HG7A 1RMYA 2NADA 3DFKA 2VK8A 4RTRA 4FB4A 5H1YA 3UKDA 4ZXPA 1ZKDA 2C2ZA 3LVQE 3QTLA 6ADHA 3JAMA 3O1LA 1I2DA 1KP9A 1WP9A 1UODA 1SCKA 1DTSA 1GPH1 2TRSB 3D8NA 3FDJA 2E21A 3KZCA 4JLDA 3RTCA 3VYUB 5DXJA 3AOEA 2CY0A 4HLUA 4EBFA 4EVQA 4DIDA 4YROA 3PX7A 4B3RB 3DBHB 3CFYA 1EK0A 5DLDA 1UC8A 1WRBA 5TQ0B 2GD6A 1L5GB 5BYAA 5I4BA 1VLQA 2JLAA 2DF8A 4ZQFA 1C29B 1B4DA 4FZ3A 2OYSA 5I7VA 1NE7A 4K05A 2RJOA 5COAA 2YR0A 3FROA 4DCGA 2N3ZA 2VSYA 5FORA 4AUKA 3Q3VA 3FVRA 4RHEA 5AOCA 1KY3A 5G02A 5CEFA 5K2MA 5JJ5A 4FEAA 2I9KA 4G0OA 3DB1A 5JATA 1JXAA 4HYTA 1D03A 2FK8A 3F74A 1GTL1 3AWIA 3MERA 3EVZA 1SUPA 4UU1A 4J0KA 4QASA 1Y0BA 4MCHA 4W9NA 4ZK2A 1ORTA 3DPIA 4R83A 4FDAA 1PUXA 1Z25A 5A2GA 3AF1A 1Z6YA 4IDDA 3UAYA 1L9KA 1OZAA 2ISQA 2JKYA 1RIIA 3BCRA 4PLYA 4BYMA 3NM4A 3ZK7A 1WHTA 1E2LA 1FU7A 3ONEA 1I24A 3D7MA 2QK4A 4RQBA 4GYYA 3ROKA 1C1HA 4OGFA 5J47A 2Y0BA 2VHEA 3GLHE 4N49A 4DV0B 5EXDA 1CVLA 4NP6A 2J7PA 4B43A 2IIBA 3IAHA 4P7KA 3BH0A 4F1JA 1EBBA 5K6TA 1B3BA 2PY6A 2V7BA 4TWIA 3K9LA 1TVKB 3F8TA 4F46A 2AJDA 1Z12A 3OD1A 4FFLA 4RD2A 4DYHA 2WINI 3HYRA 2IHNA 2CL5A 2JGDA 3CO5A 3R44A 1WZCA 3P9IA 4H9GA 1QBGA 2WHQA 2WWYA 1C80A 4TT3A 5MGBA 4YCNA 1MPXA 4RGYA 2W98A 5GPBA 4ZO7A 4B6OA 3ESRA 5COQA 1BA3A 1P8JA 1ISFA 4ZCPA 1DBRA 2A0WA 2IHVA 1UP7A 3HUUA 2Z2XA 3SVTA 7GPBA 3B3AA 3MILA 3Q0IA 1LRKA 1SM4A 3H05A 3OE5A 5EZQA 3SHOA 2ADFA 3N05A 1ZZGA 3NC1C 2B1GA 3TUZC 2C2OA 1DBIA 1Q95A 3ZW8A 3GFRA 1UK7A 3PXEA 3BWMA 3L8ZA 3ILSA 4NEHB 3H2ZA 4U6QA 3SP1A 2WW8A 3SY8A 3WK4A 4UVIA 3KZVA 3WKAA 3ANYB 4R1UA 4DCVA 1RYEA 2DULA 3HL0A 2VTDA 4V0QA 3G8BA 5FPTA 2O7QA 4W6ZA 2J9ZB 3QHQA 4XM1A 4RM2A 1D2CA 1PZFA 5JUWA 1WPGA 2QU7A 2W11A 2XF2A 4AFNA 2JGAA 2WF7A 4LHYA 1E2IA 2QMUA 4CMAA 2O20A 2WWHA 1RCTE 2YN2A 1R8JA 4QL3A 4U7TB 4U8GA 4L4ZA 1G20A 2IZZA 3BWXA 4M37A 2WP0A 2ANBA 4I9FA 3G2MA 4FN4A 1H23A 4F12A 1XFDA 4I9GA 1FCJA 1P7PA 4BO7A 1OWOA 1R2QA 4IF4A 5DM2A 1R6TA 4EZBA 5HK9A 3L01A 4P08A 2O2YA 1RYNA 3F6CA 4JL6A 4KVAA 1CY4A 3RHFA 4NK5A 3UA3A 1ZVVA 1GFWA 3KEMA 3PPIA 4L5CA 2FE1A 4OOEA 2JLUA 2OO7A 1XQ9A 2GI4A 2PR2A 2IEIA 2WAYA 4KQFA 1SKYB 4MPRA 3B53X 4A2QA 3GRCA 4GI1A 5CW1A 1X1AA 1NMQA 3SDBA 1N4DA 3TRDA 5LL6P 2IZ1A 2Z83A 1Z13A 2VRCA 4QNMA 3IP3A 4LYGA 5G3ZA 3EXAA 1G6HA 1Y81A 2OV8A 1XP5A 3EVAA 1I13A 3G8YA 4G07A 3ZHZA 4GW3A 1G5RA 1A9TA 5AM0A 5JV5A 1ZU4A 2ZEJA 3SKXA 5A6SB 4A03A 4B76A 3KL2A 3FI9A 3CZAA 2X9LA 2CD7A 4QGBA 3A3KA 4PZEA 4W9NC 1FFYA 1PJ3A 1CRPA 2G67A 2JL1A 4LBZA 3IELA 1M74A 3V4SA 1CQPA 4WN3A 2R8XA 4M7RA 3R7WA 4ZZ0A 1NOIA 1ZR2A 3HCCA 4NONA 1HSZA 2JD0A 4XEHA 3KAKA 1RPNA 3CSUA 3L7KA 3MZ0A 4GKVA 5EINA 3TCXB 3UK2A 5KTOA 2GO7A 4KBFA 1L1QA 3T1TA 2QI9C 2C95A 2Q5CA 3BK7A 4KE9A 4JQZA 3TXYA 1LB1B 2YYZA 4AU1A 3CM0A 4LZOA 1OV4A 3L05A 3GDFA 1R0KA 3L82B 4DEVA 5KTPA 3K6SB 1G16A 1RABA 1M7HA 3VBEA 1A88A 4AX4A 3OZXA 1KEZA 2X4IA 2NNWB 3RUHA 5LQRA 2ZRDA 3E3NA 3GFTA 1N6OA 1WCXA 2QYSA 4RACA 3T8YA 2XWJI