3LY5A

Ddx18 dead-domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
211
Chain Sequence
b'TGAFEDTSFLVNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DDX18
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 211
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ly5A00
2VH5R 1N5IA 3A1WA 1Z63A 4H1VA 3LNCA 3CNLA 5CK5A 1P75A 1GDDA 3DM9B 4XD7D 2H57A 2XZOA 2ZU6A 4DSOA 4BFSA 2QA5A 2ATVA 4RD2A 1RC8A 4A8JC 2G0NA 2WSSD 2IF0A 4Q9JA 3IO3A 2J7PD 3OEED 4CDGA 2GWHA 2RAPA 1HT1E 3UIEA 1E0JA 4EDHA 4I1UA 1E4YA 3EW9A 2Z0MA 1IHUA 2A7QA 4JLBA 3FHCB 5FOWA 2X1VA 4URWR 3RNLA 4LJ6A 4B3XA 2VTKA 2ZRMA 4IEEA 4UXHA 2H8KA 4Q48A 4ACAA 4I1VA 3REFA 5FPKA 1LTQA 1VKJA 3SEAA 1W5TA 2GVZC 1YZTA 5EP2A 3QBVA 4JSTA 3HU2A 4P4SB 1VIAA 2J3EA 5KYKA 2CE7A 4NPHA 2DWQA 3K70C 1UBGA 5FBQB 2ONKA 2HDNB 4M2LA 1OFHA 5C46F 4Q1EA 4TLDA 4JLKA 1QVAA 4M8NE 2QP4A 1U8ZA 4EFNA 2A5JA 3OIVA 3NXSA 3BFXA 1GKYA 4BPBA 3A4MA 2NMVA 1AS2A 3AGPA 3REGA 3VNVA 2OFXA 3VR5A 3K9LA 5FPYA 4A8JA 1E0SA 4QHYA 4JJZA 1OF1A 5C2JB 3AVPA 2ORWA 4U7DA 1GL7A 4LHXA 1N5LA 1G18A 2JLRA 1FTNA 2WJJA 4FMCB 1ZM2A 1E6CA 2D06A 3NVAA 3VKGA 1JB1A 5KNCA 2O8DB 2ZUBA 3Q7QA 1CS4C 3BRWD 4MGZR 4AURA 4IOJA 1Q3HA 5FTJA 3AF3A 4QBFA 3QG5A 3P27A 1YZQA 2BC9A 2ZRKA 3C41J 3CH5A 4G5RA 5JRJA 1XTRA 1TU3A 4KCGA 5DI3A 2BCJQ 1XU4A 4RZ2A 2OXCA 3GLHA 1JJ7A 1KJZA 3KFXA 1PLLA 4M1OA 3QI2A 1OJLA 5EZ5A 5KNDA 1VYTA 2KBFA 2WKQA 1FW6A 3N5CA 1G3QA 3K09C 1N3BA 3ZGXA 3QPVA 3ZZ0A 4Z54A 4TL7A 1NSFA 2DFKB 5GJBA 2X2EA 4QJ5A 2FSGA 3B1ZA 1AZSC 2V1UA 3I73A 5FUWA 1TF7A 1OXSC 1JEEA 3GJ6A 1LNZA 3FMFA 3AKDA 1OH6A 1E99A 2OEPA 3GJ5A 2PZFA 2EVWX 5JCZA 2GA8A 1KNXA 3KJIA 5DO9A 1KAGA 5EE5B 4LX0A 4EPVA 1B23P 4FCTA 1N6OA 4JVLA 3SOPA 3KQLA 4QNRA 2QBYB 1ZC3A 1CRQA 2Q9BA 3PUZA 5TARA 5KPDA 4KYUA 4W9MC 1M7GA 4UXIA 2G1KA 4FMDB 1G64A 1SVOA 2QMOA 1EX7A 5FOTA 3FHOA 1XCMA 4LGMA 4BZXA 4BFYA 3THWB 3U44B 1Z08A 1X1SA 1ZRHA 3JZMA 4Q4HA 4YMVA 4IVQA 3K09A 3IIJA 4X8LA 5GADl 3EIEA 3PUWA 1QHHA 1GKIA 1BYUA 3HYTA 4AY2A 2WWGA 4M1SA 4A92A 5B64A 1FPMA 1T6NA 2ZU0C 5EUQB 4DJTA 1PVOA 1DAFA 1E69A 1KK2A 3AF0A 1H65A 2Q21A 3FOZA 3EG5A 5DNYB 4HDQB 4LPKA 2CLDX 1IONA 4R9UC 1FL9A 2FFHA 1XTJA 2WOJA 1IN6A 2FSHA 4MRVA 2W6ID 1U81A 1VHTA 3B1WA 1OB2A 3WP1B 2C9OA 5BN5A 5H68A 4MUAA 1TU4A 2F1IA 1A2BA 1M7BA 4U02A 2WWFA 4K46A 4UXJA 2OHFA 1TX4B 2NGRA 3EXAA 4NDZA 4TTQA 4TYPA 5HCNA 4BRUA 5HR5A 1NSTA 2ERXA 2MSDB 3THOA 1XPRA 1TQ2A 1KO4A 2YOHA 5DISB 4C7OB 1RIFA 2I4IA 4JBWA 4RD1A 1E2IA 2OV2A 221PA 4DCVA 5JRZA 4Z1MA 2B92A 4I1OA 3K0AA 5KSOA 1E98A 1GG2A 2WICA 1ZUHA 1M34E 4CT5A 1QHXA 4TQ9A 2H7VA 5FI1B 3NBYC 3RS7A 2WVJA 4ARZB 4TZ0A 2E87A 4B3BA 1FP7A 1LS1A 3OFNA 2CEAA 2ZE6A 4PSVA 4QBHA 3UKDA 4GOXA 4B6FA 2R44A 2GAAA 2ZS7A 4TZ6A 2KE5A 1W49A 4ZDJA 4PZLA 2QROA 3R9XA 2XXAB 4JBXA 4ESVA 1DEKA 2A9KA 4MKIA 1RJ9B 3LW8A 1E2EA 3QKRB 3THXB 2J0QA 3FWYA 2Z4SA 2H1LA 3RANA 1E2DA 1IM2A 2E1RA 1DS6A 1XB2A 4OL0A 1HEIA 1E2NA 1AN0A 3VR1A 1FTSA 1JEDA 1OH7A 3L2OB 2GXUA 4B2PA 1Y63A 2ZJBA 4IXMA 3RRMA 4IOLA 4NCKA 5KDLA 8OHMA 2CE2X 3W5IA 1DG3A 2CCGA 3BK7A 4OK3A 5H8WA 4LJAA 2GK7A 1E0KA 1TUEA 1G8FA 4M53A 3GMTA 5E95A 1P73A 2NZJA 2AK3A 5HKKA 4TSFD 1Z0KA 4Q1CA 1E9BA 4PANA 2CCKA 4DIEA 2D2EA 2GJ8A 1DAHA 3A4LA 1NY6A 4RFSB 2WMNB 3ZS8A 5BWMA 4NHOA 3RWMB 5F98A 2V3CC 3K0SA 1KJYA 3HPQA 2GEUA 1IQPA 3ADBA 4LDJA 4C0HA 2V7QA 4AKGA 2DYKA 5LPNA 2VSFA 4ASUD 4NCJA 5JHGB 5EZ6B 4H9GA 2RB4A 2ZAMA 2JLVA 4WZBE 4TLAA 1XEWY 1CP2A 4R98A 1AM4D 1MABB 1UBEA 2X8AA 4LWZA 5KNBA 5J47A 4WAUA 5LB2A 1GL9B 1K5GA 4MRNA 1KI6B 2OFWA 3MAAC 1U90A 2CNWA 4LJ8A 1G17A 2OAQ1 4DB2A 1W4CA 3L0PA 2FSIA 4PC6A 5A0FA 2W00A 1Z06A 3QXSA 3Q8XB 1VPLA 4DLUA 4Q47A 4QFMA 2WJHA 1R8QA 3W6PA 4LHWA 3DKVA 2BM1A 2OILA 4BECA 2WOOA 3GEEA 1TAGA 4KFTA 1E9SA 1DARA 1ZVQA 4DVGA 3HDTA 4B48A 4A9AA 1WCV1 2ZTSA 1NY5A 4JLJA 4AKIA 1Z83A 4Y0VA 5BYKA 5BN4A 3EC2A 4A15A 1E32A 2VP4A 4Q1AA 1KDOA 2NOAA 4PR0A 4OJQA 3QIAA 1ZW6A 4LJ7A 4V0ME 1P72A 2IYTA 2VSOA 3VFDA 2VA8A 3PIRA 1H8EA 2BEJA 1KAOA 1OYYA 3C7KA 2QMHA 3CRW1 2WKPA 1S3GA 1SVMA 2BOVA 5IDVA 4BGDA 4DKXA 4P4SA 2P5TB 1E1RA 4FWTA 3B1VA 4CW7A 3RC8A 1NJFA 5AJVB 3LDAA 2DB3A 3TMKA 1E2GA 2ZRDA 5AWFC 1DAIA 3PV0A 4M1MA 1R2QA 3PEYA 3AB3A 4DCSA 4UJ5A 2ONJA 1IJEA 1P4SA 4BFUA 2W2VA 2XSZA 3KXLA 2XNDA 4GT1A 4KFRA 4TTPA 1ZU4A 4PHGA 4ZCIA 1L4YA 1E0AA 2CJWB 2WM9B 2RKOA 3Q7PA 2FPLA 4B2IA 1HUQA 2OZEA 4PO1A 3SJBA 4RKFA 3RVBA 2PJRA 3IEUA 4FMBB 2GCNA 3V4FA 3MFYA 2IA5A 1WDTA 3WNBA 1S8FA 2BBWA 1XTQA 2IEYA 3FGNA 2O8DA 5DGXA 2VF8A 1D9ZA 1G1MA 1CJKC 2FSFA 4R2HA 3AP3A 3PUYA 1G6OA 3GQBA 4A2WA 4N0EA 3VR6A 4EPWA 1MO6A 4Q19A 4QBIA 1AQYA 3F8TA 2ZJ2A 5B57C 3AVWA 1ZYUA 1U98A 4G1UC 2CL7X 2PCLA 2B8TA 2RGEA 3GJ8A 4LV8B 821PA 1II9A 3P1JA 1KKMA 1KI2A 4ZIRB 3KJGA 3AVOA 4M1KA 4E03A 4NYJQ 1KI9A 3QF4B 3W3AA 1XCGB 2BMFA 4Z51A 2PT5A 4KITB 4Q02A 1J70A 5FTNA 2GAOA 1RVDA 5DN6A 2PH1A 3QNUA 3JZAA 2QG6A 1M7HA 2YC2C 5KSPA 4YLGA 2CLCX 1FZQA 3SHWA 3VAAA 1NVVQ 2AFIE 4QHTA 2GCOA 2AWOA 4UNNA 3RRYA 3RC3A 2JJ8A 5JJIA 1NVXQ 3X1DA 4B3FX 2QBYA 5EXTA 2FPMA 4YQFA 5G41A 5G3ZA 4EJSB 4A36A 1JXMA 4MRSA 2GBLC 1AQUA 5FL7D 3NDPA 3QEJA 2ZYTX 3AF2A 4BWYA 2QEQA 1DPFA 3DOFA 4PAOA 3D8BA 3THWA 3L0OA 2YKGA 2ZJOA 2DCUA 3SFVA 3U44A 4B33A 4A1FA 1WQ1R 3OAAD 1AS0A 3FYHA 1SVKA 3PQCA 1H8HD 1SQ5A 5KPJA 5CLQA 3R9IA 4FN5A 4V0NA 3A1SA 1W4RA 3LWNA 2PLRA 3DVLA 2JEOA 1ZU5A 1YKSA 1MRSA 5JLJA 1OHHD 2IYRA 4P4TA 1KDPA 3U6BA 3MJRA 3Q5EA 1NF3A 4F92B 2DFNA 5LD2B 2GZDA 5KUTA 3DZ8A 4ABYA 4QGFA 3THYB 3WY9A 4ACBA 2Q9AA 4EIWA 1KSHA 2ODNA 1GKUB 5GJWC 2AXPA 1YRAA 2VF7A 4Q4JB 4P33A 3IPYA 5FL3A 2FX3A 1MV5A 2WBLC 2JJ1A 1XWIA 1U0JA 3IQWA 3KXIA 5HE9A 3AGQA 1E79D 3U61B 3MSXA 2GBLA 2Q0HA 4LBWA 1I4DD 1N6RA 3SBEA 2IS2A 4TMWA 4P31A 4B6EA 4DLXA 2WKRA 4UKDA 1OT3A 4RJLA 3WYAA 1W0JA 2QAJA 3V00A 4QGHA 5CIWA 2D3WA 3KFVA 2O5VA 1TPZA 2OCPA 1MO3A 1ZD1A 3I3SR 1Z29A 3FPAA 4MGYR 2ZXUA 4ESHA 4MKHA 4C7OA 1CF4A 4XWKA 1SXJB 2QGZA 3K9NA 1QZXA 1FX0B 5G3YA 1P9WA 4KYIB 4UNSA 2VPPA 2JLYA 1ZD8A 3DO6A 1A82A 2V9PA 2CL0X 2A30A 2ZRHA 2PX3A 3B2EA 3CIOA 4WZ6A 5KU1A 1OIWA 2HJVA 2HV8A 2JAQA 3MUFA 3QUSA 4PQFA 1ZINA 4ARZA 1XD8A 3C4JA 2G9NA 3T5GA 1XMSA 4LUCA 1L7VC 2CVHA 1A2KC 1KYIA 1E94E 1JALA 4CYMA 2XXAA 4P3YA 3SYNA 1RJ9A 4BLOA 1JR3A 1OKKD 4TTRA 2ZE7A 3QKRA 3THXA 4TYWA 2B6HA 1Z07A 2AN9A 2IYUA 4GFDA 1E2MA 5L8VA 3KJEA 1NI3A 5DH9A 2HXSA 1TEVA 2GF0A 1YZUA 4JLAA 2FGJA 1F60A 3AKEA 2JDID 3EZFA 3O8DA 4IW3B 1ONBA 3SJAA 3LW7A 4CEJB 3RSLA 3RS4A 2J5XA 5KOYA 4TL9A 3WP0A 4PX9A 4TWZA 4NL4H 5BQ5A 5JBQA 4YMSA 3EC1A 1BIFA 1GP2A 3QXXA 2JA1A 2D7CA 3Q85A 4Q9LA 3T06B 1ZNYA 1XTKA 2EWVA 2C77A 3EA0A 2HXYA 2W6JA 3LY5A 4W7SA 4GPTA 4WIAA 2L0XA 4A6XA 4BE7B 1C1YA 2F43B 1NG9A 5FPHA 2XAUA 5KO2A 5C18A 5JWHA 4PQRA 5LB4A 2ZI5A 1S1CA 4JVSB 1OXVA 4RZXA 4D4KA 1WXQA 1TQDA 2QRZA 1M2OB 2J9RA 4RFSA 5KSYA 3A4NA 5CJPA 1T3LA 3C8UA 2C5LA 1XEXB 1ZNXA 4ILEA 3ZDQA 1VCOA 3P26A 1Z6YA 4QOSA 1S2MA 5AR1A 3P4XA 1W36D 3IO5A 2OLJA 2FGKA 3BWDD 1A5TA 3M0EA 5IRCD 4L9WA 1EFHA 3TAUA 4F7WA 1E96A 1NVUQ 3RWOA 2OESA 1MABA 3QEOA 1OXUA 1W0KD 5FH9A 1ZUNB 1G9XA 2AKYA 3U5ZB 4BLSA 1YZKA 4AI6A 1KI6A 4UQOA 1XJ0A 1QHSA 1NBMD 3MWKA 1QVRA 2ERYA 4XSGA 1RRCA 2HYIC 5TDHA 4C2TA 3FB4A 4KO8A 3CRVA 2ANBA 1W4BA 4OJKA 2OO7A 6Q21A 4FINA 2RGCA 3ZS9A 2ZR7A 3ZQJA 2V6JA 4O2LA 2OBLA 4D80A 3WYFA 2XJ4A 1KDTA 3OE7D 2QPOA 4WBSA 2GRJA 2OCBA 4HLQB 3MCAA 2GZAA 4N3NA 3FKSA 2QQ0A 5CB6A 3AEZA 1UAAA 3SQXA 2PL3A 1G7CA 1AKYA 1XJQA 2FFBA 3K1JA 5CYOA 2IXFA 3SQWA 3IBYA 1W7AA 1Q1QA 2EYUA 4Q00A 1TNDA 1FNNA 1D5CA 1LW7A 4D4MA 1UKZA 1VCNA 1UBFA 3NH9A 1JPNA 3GCGA 3GFPA 2MMCA 2ZI3A 1HA3A 1DADA 1IXSB 5FBVB 2O8BB 4ITRC 1CTQA 1I4TD 1TEXA 1QBKC 4LV6A 3I5XA 2N46A 3LLMA 4HB2A 4NYMQ 2YYZA 2N42A 3UATA 4OQMA 2A2ZA 2V54A 2CLSA 2VHQA 4LBYA 2MMGA 4M1TA 4HUTA 2YOGA 3SNHA 3UG6A 4G5GA 4OQLA 1KI4A 1QHIA 4EAQA 2NZ8A 2R9VA 1ZUIA 3VU9B 4DLTA 2YOFA 3RS0A 2BV3A 3EZ7A 5FPTA 2GXQA 1UFQA 4FCWA 1D2NA 1N6NA 4DDWA 4Z8XA 2CJWA 3IILA 2XTMA 5L3QB 3TW8B 4UNPA 3ECCA 3EPLA 2FFQA 1T5IA 4B34A 4IRUB 1E2QA 3CNOA 3FMOB 3K8YA 5SZIA 2I3BA 1DE0A 3GEHA 2PZGA 2ZE5A 4IDQA 1UKVY 1X3SA 3QENA 2V6IA 2IBMA 1F5NA 1G19A 4HUQA 1EGAA 1CJMA 4UJ3A 2HCJB 3HR7A 1KNQA 4NTZA 2JASA 2H16A 4PHTA 1G4AE 1JBKA 1NN1A 2GEDA 3U3OA 4ZDKA 4EJSC 1Z5ZA 2W83A 2P3SA 2QMUA 1CULC 1LB1B 3IHLA 4BEJA 4YONB 2P65A 3LBNA 1AGPA 3P20A 4MGIR 2GETA 3T12A 4Q7MB 2DWOA 3HYRA 4DDUA 1KO5A 4BZPA 2O8FB 1DG1G 4RZUA 5EE3A 5ELXA 3ZLJA 2QT1A 1P9RA 5EE9A 3TW4A 4LCBA 1AK2A 1F2UB 1RPZA 2QTHA 2ODEA 3LO5A 2V55B 4ZIRA 5GJCA 1UEIA 1LFDB 2CBZA 4NYIR 3T5DA 4FMCF 3T1TA 3QF4A 3K0FB 2REBA 4EKDA 3K70D 3QF7A 3BS4A 2GEVA 5F2EA 5LD2C 1I2MA 2EFDB 4AYWA 3MGCA 1N6KA 4OYHA 3TQCA 2ATXA 3BB1A 4V0KA 3AVYA 2GXAA 2ZRGA 2IWHA 2DPXA 3LD9A 5BYJA 5AUPB 4OHXA 2ZRFA 5JI3E 5KDOA 1SHZA 2YWHA 1L4UA 4EJSA 2G0TA 1HURA 3TR5A 2KI5A 3FKQA 1MKYA 3B6EA 1S3SA 2W2XA 2F1JA 4AIIA 4DLRA 3PITA 1CLUA 3QKSB 3DMNA 1KMQA 2C96A 2LWIA 4JMPA 1VG0B 4AD8A 4BZQA 5TY0A 4RZ3A 2IT1A 1HV8A 1FUKA 2GDJA 1SXJC 2F3TA 1N0UA 1CR0A 4NKRA 1OPXA 5SZJA 4GOKA 4D6PA 4DHEA 2GJ9A 1AZTA 1TADA 4ON9A 3TQFA 5GJVC 2TMKA 4DC9A 3CZPA 1OV4A 1ZC4A 2D74A 2QL6A 5B2ZA 4DCTA 4L16A 1W1WA 3MJHA 721PA 3P32A 1NMZA 3GEIA 4PC2A 2OLKA 3EAQA 2P0EA 3THYA 3I4LA 2RCNA 1ZNWA 4FMDF 2VP0A 3E1SA 3HU1A 3KKNA 1DAEA 5FOVA 4IDPA 3H4MA 4Q4JA 1D6JA 1YQTA 2ZUDA 4JYBA 3QQ5A 3R8FA 2HT1A 2G1JA 5BN3A 1PZNA 4OQXA 3TKLA 5FBRB 4DZZA 5HZKA 3LH5A 4JJKA 3A58B 4MQBA 3CR8A 4DLVA 3EPHA 1SGWA 3TNFA 3A37A 1CRPA 2GCOB 1Q20A 1ZCAA 2BBOA 4I4LA 4TT3A 4B44A 5CJ2A 2FN4A 4G0NA 3BE4A 4YC7A 3ZVMA 1NIPA 5JSZB 1S4QA 2J7KA 2IXGA 2ZR9A 2XNSA 4IOKA 4B47A 4C9BA 3LVRE 1SXJA 1FX0A 4URZR 1N6IA 1E4VA 1VG9B 1R0XA 2GKSA 3OIUA 3R20A 4HLDA 4OHYA 2J59A 4KXFB 1OLOA 2QE7A 1GOTA 3VR3A 3AF4A 3SYLA 3I72A 4BUJA 1XEFA 4C4PA 4Z1MD 1UKYA 4QHSA 1BMFA 2YNMA 3MG9A 2VL7A 2B8WA 2ZI4A 4IJMA 3EZ2A 3BC1A 3ETLA 2VLIA 5FOXA 2FDCA 1GITA 2P2LA 2W0MA 3L82B 3MWLA 4JKIA 5GVRA 3ZYCA 5IT5A 3KKQA 1P62B 5AJXA 2VHUA 3OFND 1Z22A 1KMHB 1PUIA 4PSAA 1L2TA 421PA 1G6HA 1KHTA 2BKUA 3BERA 4CEJA 3AVTA 4LHVA 1T3HA 2GJSA 2PMDA 3QE0A 3IEVA 4IDHA 2C2HA 3OIWA 4M1YA 1GRQA 2ZSDA 2ZRLA 1O3YA 3RSOA 2NPFA 4LJ9A 2Z6VA 3N2EA 3TUIC 2VYFA 4NZYA 3HU3A 2JJ2A 4HEJA 2ZRIA 2F43A 1RFLA 3VX3A 4W5HA 2ZYWX 2LKDA 2GESA 3F5FA 1GNRA 4RY2A 3WNCA 4Q1FA 3AUXA 1Z0JA 4GSYA 2PLFA 1N6PA 2Q3MA 1ZD9A 4L15A 1MT0A 4ZKDA 2QI9C 2F1RA 2ZRBA 4HZUB 1XEXA 3LX8A 1QHGA 1CR2A 4G5QA 2ZIAA 1E3MA 2C8VA 4DLSA 5HKKD 4DRZA 1W48A 1J90A 2KWIA 2F9MA 4MRPA 5B58C 4BFXA 1FOEB 3OZXA 2PBRA 4RCZA 5F9FA 3C15C 2JGNA 2ZSFA 5JECA 1G8YA 5JJKA 3DZDA 2IYQA 1S1MA 4D0GA 1JR6A 4Q4AB 4Q9HA 2XITA 4M0LA 4DLZA 1TQ4A 2AL7A 2V7QD 4LBZA 1PLKA 1G8GA 5KDDA 3RS3A 2PMKA 2V8OA 4PSKA 5J40A 1R5NA 1ZNZA 5E7JA 5EP4A 3PCRB 2YC4C 3L0SA 1JECA 1U0LA 3CR7A 3NEYA 4B75A 1BKDR 1VYVA 2CNWD 5JHHB 3F0TA 3U3RA 4A4DA 2V1XA 4F4IA 1R0ZA 3W3ZB 4NCIA 4UNQA 4E22A 3WNDA 2IW3A 3GFOA 1AGRA 2QPAA 4EPRA 4L8GA 5E4FA 2Z5FA 2JLXA 3RDPA 1AKEA 2ASEA 1TQ6A 2H5EA 2K5UA 1EK0A 4IXNA 5L3RA 5B30A 4Q03A 2Y8EA 5SZHB 4DLWA 3AVUA 5EJEA 1P7CA 1S96A 3HJNA 2RGGA 4F38A 2ZRCA 1DELA 1Z28A 4DWJA 2O8BA 4JIMA 1I2DA 5D3QA 3U4QB 4GBMA 4O2RA 2ORVA 4OI1A 4G01B 3SJCA 1DOAA 3R9WA 4ZCLA 3ZZUA 1G7RA 1QDEA 1HH4A 1U0HC 4BLTA 1QHYA 2XJ9A 3D31A 3VU9A 2J0UB 3GP8A 1J7KA 4NH0A 3IHWA 4BLQA 4QM6A 1KSFX 1H8ED 2D2FA 1P60A 4AKHA 2VBCA 4FXPA 1F2TB 3TR0A 1WB9A 1CXZA 1U99A 3H2YA 3UANA 2AWNA 1KY3A 1E1RD 1W46A 5AUOB 2F7SA 3FTQA 2NQ2C 4LC1A 4POAA 5D3MB 5L3QA 2ZITA 1Q44A 2BBTA 4CVNA 5DE3A 1EFTA 4H1UA 1HY3A 5FOUA 5DYGA 3CNNA 4TYNA 1IN8A 5K8TA 2VHCA 3B82A 3O8BA 1US8B 3QBTA 2XSZD 2XNDD 3C5HA 3UMRA 4QXAA 3BJIC 3I32A 1SVLA 1SVSA 2RGXA 1NBME 4URYR 2A5DA 3EPJA 4OI2A 1WRBA 4KBFA 2BDTA 2WJGA 2BEKA 2WWWA 3L8ZA 4A82A 1G8HA 2F3RA 2HUPA 3B9QA 2XB2A 3MD0A 3DPUA 3QG1A 4WOPA 4A2QA 1X1RA 2O8FA 3A36A 2W58A 3KB1A 3U7EB 1F2UA 1TUIA 2G6BA 4TMZA 1S9DA 1UADA 3T1VA 4F4CA 2HEIA 4QGAA 1FQKA 3FDIA 3LV8A 2LCFA 1DVRA 3K0FA 1IJFA 4V03A 4B74A 3RAPR 4X8HA 3D7MA 4DUGA 1CEEA 1MR3F 1RE0A 1Q12A 3QJYA 2HLDA 5F9HA 2FEMA 4R7ZA 1E2PA 1KZ7B 3NHAA 4LYAA 4YDHB 3AP2A 4HSEA 4BFZA 2OG2A 2OCAA 5DHFA 4HAWA 1Z0FA 4KSCA 1Q1EA 1U94A 3KX2A 4HI0E 5LDDC 3BH0A 1KSJA 4DBLC 2GJKA 1VG1A 3CB4A 3DMDA 4TMVA 1P2SA 2JLSA 3E2IA 5DN6D 2WIBA 4LBVA 1XXHE 3B8HA 4PO8A 4XWOA 4HUQB 2BHRA 4MITA 1R5BA 2IEZA 2VSXA 4JKYA 4C0LA 4PTLA 3I62A 3AH8A 2R8RA 3QKSA 2GF9A 1F48A 2CXXA 1SZPA 3TBKA 1XD9A 1EWQA 5EE0A 1OFTA 2WIAA 3HPRA 4C3ZA 2Q9CA 4Q7LA 4XIGS 2QGNA 1U9IC 3W6NA 1KZGB 1KSGA 4RD4A 2XOKA 1JPJA 2BVNA 4JBYA 4PFSA 2FWRA 3SDZA 3BORA 3WYGA 3DM5A 4C0SA 3PEWA 4TLCA 1DTSA 4QBGB 2FPKA 1S0UA 2FE4A 1F3OA 1NVVR 1YRBA 3O8CA 2IYWA 3K9HA 2AXNA 4LV5B 3O47A 2IYVA 4M9XA 4RD3A 2WWYA 3I8XA 1V43A 3TSWA 2WPDA 1OYWA 3R7WB 3X1YA 4HB3A 2P6NA 4PAMA 2O8CB 1OH8A 1II0A 1WBBA 3TRFA 3AKYA 3AM1A 4KODA 3PJRA 4AYTA 2D7DA 4Q5IA 1XXHB 4C30A 1Q1BA 2ZRJA 4PO9A 2C99A 3GLHE 3WMFA 3ND9A 2JJ1D 1BOFA 3QKTA 1Z6GA 3PENA 3R8CA 3GFTA 5JSZA 1DAMA 1LY1A 3UMSA 1WBDA 5HPYB 1G291 4JT4A 5EQTA 4CF7A 2A5YB 1KKLA 1GFIA 3BB3A 3A1TA 3T61A 4E5UA 1U9IA 3RHFA 1IXZA 5JFGA 1W0JD 1VTKA 5CYPA 2QENA 1Q22A 2DHRA 1GUAA 1CJVC 4B73A 1PUJA 4HDCA 3CX6A 1UDWA 4OK6A 1G21E 4HLCA 2XZLA 1OB5A 4TL8A 3KTAB 3I61A 4IFEA 3KKMA 3B9PA 1CR1A 3NEJA 3ZIAA 1GNQA 2WZQA 2OUKA 5CLLA 5IK2A 3LLUA 1ZAKA 2ORIA 1KMHA 3UWKA 3U7GA 2ZRPA 3TAHA 3A8TA 3QXCA 4OQNA 4U5XA 4OI4A 1J8YF 2AD5A 3IIKA 2IX3A 1JR3D 1EFRA 3LXXA 1UDXA 4Q9KA 1ZMXA 1RRFA 4RD0A 1EX6A 2RGAA 1AS3A 4HAYA 1KK0A 3L8YA 4Q18A 4YXWA 2ZI9A 3QY0A 4IDOA 3MWYW 3PEUA 4BRWA 1YR8A 2HT6A 3E70C 3NH6A 5FTKA 3G0HA 1T9HA 4KFUA 4IEIA 3BGWA 4F93B 1XEWX 5TXGA 1HYQA 1T8UA 2C04A 1EWRA 5CM8B 1BO6A 2ZS8A 2WMOB 1P2VA 3BBPA 4HZUA 3WRXC 3L43A 2W6JD 2ZAOA 3GJXC 1JXOA 1KO7A 2CHVA 3U7HB 1X6VA 3SU8A 2R6GA 3U2QA 3U60B 2NO6A 4FIDA 1T3SA 3CX7A 4JT2A 5FBLB 4M22A 2ZYVX 3OIYA 3EA5A 3B1YA 3GD7A 4JL8A 5K8IA 1IAQA 4Q4AA 2ZI6A 4PZYA 1XBTA 1TF2A 4DSUA 3ADDA 3F3YA 3K9GA 1L8QA 4JVMA 4WW0A 3FHTA 1PLJA 2ZYUX 3VX4A 4EPTA 3Q5DA 1K5DA 3FVQA 1KI1A 4B32A 3NBFA 3LXRA 3ADCA 2BCGY 621PA 3EZ9A 2RGDA 2YWFA 1WE2A 2FNAA 1TTTA 1SKQA 4QKQA 1R10A 1P5ZB 4RFVA 4LC0A 1EESA 3P4YA 4OQFA 1JJVA 3K0CC 3GLGE 1NLFA 2R6FA 1YVDA 2BKEA 5FBWB 1ZIPA 2J0VA 4IOMA 3KB2A 4XVUA 4WZAE 4D0NA 4ZV4A 3C14C 1KY2A 4Q66C 2UZ3A 3CH4B 3LA6A 1D2MA 5CDFE 1G8PA 2V4ZA 3CRMA 5E7IA 4XWAA 4HATA 3FKSD 4D82A 4RVCA 1PJRA 1OSNA 1LF5A 4S2EA 3U4QA 1JQJC 5SZKB 3CWZA 3UWOA 5F3WB 4NCHA 2YVUA 1FUUA 2GJAA 4DDVA 2O52A 4LI0A 1XPOA 1ETUA 4L4UA 2R6DA 4ZI2A 3V4RA 5FUVA 4MDFA 1UF9A 2J0UA 2OBNA 4M1WA 3CW2A 5FR1A 4KI0A 4LHZA 1E2LA 3NG1A 1YZLA 2GZHA 4OHZA 4TMKA 3CWQA 2IL1A 2QTFA 1F2TA 3LBHA 1Q3TA 4IFBA 3TK1A 1NN3A 4US1R 4GP6A 2JLQA 3X1XA 3BIFA 5D3MA 3RS2A 5C4MA 2X19A 2CDNA 3KJHA 4OI0A 1Y3AA 2F9LA 3IDQA 1GL6A 5H1YA 1OIXA 3K0CA 2OAP1 1NJGA 2PX0A 1US8A 2J45A 3GLGB 4ZI3A 1N5JA 2ZROA 1OXXK 2F6RA 3Q3JB 1N0WA 3WBKA 1FP6A 4EFMA 1EFUA 1W2HA 4MKGA 4HB0A 1Q57A 1ZBDA 4NYMR 2YWEA 1UBCA 4KVAA 4RKEA 4O0MA 1OFUX 4JS0A 1DAKA 3KKOA 3OEHA 2NO9A 2Q3FA 4J0QA 4CGZA 2XX3A 2AD1A 1N2CE 3OHMA 2QAGB 521PA 1AIPA 2FMXA 3RRNA 2FZLA 2VHTA 3ZZTA 3NC1C 2ZQ5A 4JLMA 4NE2A 1RW4A 2FJUA 4AG6A 2IS4A 4YMWA 4OHVA 3KUCA 2AX4A 1RRGA 3CF2A 1COWA 1N6LA 1RYFA 1NVWQ 3VR4A 3SN6A 4EQ6B 2B7BA 1NLZA 4HZIA 2YZ2A 2IC5A 4AKEA 4LHYA 5JWRA 2R6CA 2QP9X 4LJ4A 4DLYA 4V02A 4XH9B 1N25A 4DT1B 2P6RA 3CO5A 1LF0A 1MO5A 4WXRA 2IYSA 2QRNA 4Q1DA 2REXB 4Q1BA 2A5FA 4MKFA 2YINC 1A4RA 3QSYA 1IBRA 4K8OA 5CM9C 5JCPA 4Y0AA 1WA5A 3S1AB 1JAHA 4V0MA 4BFTA 2IUSA 5J4KA 1VCMA 3RS5A 3ONWA 2JIZA 3EPKA 1W5SA 1WF3A 3W34A 2WAYA 2P5SA 2HJGA 4URXR 2JATA 2C78A 2F1HA 4M9SA 5P21A 1X86B 2BWJA 1TMKA 1TF5A 3VHLB 3LAWA 2LKCA 1C4OA 4DCNA 3SZRA 4DDTA 4KFSA 3HR8A 3EZ6A 2CMKA 2OXRA 2R62A 1J99A 1X8JA 3U3MA 3GLFE 4CIDA 3B85A 3B5JA 2KB0A 3IPXA 1E1QA 5EUMA 3R7WA 2ZJ5A 2XTNA 4JYCA 2CK3D 1GSIA 2O8CA 3LQRA 5E3HA 3SS8A 2OBMA 2QN6A 3PG5A 4LZZA 1XFAA 2QSZA 2JCSA 1JQLB 4A0HA 1OW3B 1Z8FA 2GHIA 3KQKA 1XXHA 3T15A 3DOEA 2CHQA 3I5YA 4HDOB 1IN4A 3CONA 2XTZA 1RZ3A 4U00A 3RYTC 3CZQA 3SHFA 4A0FA 2ZE8A 1XPUA 1EXMA 4S35A 1I4LD 3Q72A 1EG7A 5FI0B 1WMSA 5J4HA 3QXJA 1VG8A 4AK9A 4XD7A 2HCBA 2ODWA 1BS1A 2GK6A 1FNMA 4PPNA 3G82C 4TT3D 4KVGA 3SI7A 4HAUA 5CIQA 2WSSA 1TL7C 2OCYC 4JLDA 1CR4A 1YU9A 4GP7A 1XD2B 2J7PA 1FMLA 1G41A 2REOA 3OEEA 3KXKA 4JZKA 4B2LA 2BJVA 4UNRA 2RGNC 1R0YA 3UPUA 4NYIQ 2EFCB 2EFHB 5TV2A 3HP1A 3NIBA 1R8SA 4HLUC 4O25A 1KDRA 1SXJD 1NN5A 3SYKA 3KTAA 4WVFA 4BFVA 1N0VC 3GLFB 4FD2A 2IYYA 5EXPA 2CK3A 4RCYA 3H84A 2QE7D 2ZEJA 3EIHA 3AQ4A 4EFLA 5AJYA 4W5JA 4Z8YA 2C98A 3I1FA 2YHSA 2KBEA 2G83A 3DEFA 2FZ4A 1XZPA 3QPWA 2FF7A 1DBSA 1NMYA 1ZJ6A 2EFGA 3B78A 2PT7A 2KJQA 3IQXA 4DSTA 1ESNA 3EWSA 3X2SA 1BMFD 2EWWA 4I81A 4B3CA 1WP9A 1K8RA 1A7JA 2VP5A 3A6PC 3WHLA 5AUQA 2DBYA 4QJ4A 3AF1A 3ZVNA 2AFHE 4P0TA 3A1VA 1E9DA 1XMJA 1OE0A 2QNRA 5GVSA 4A2PA 1Z0AA 1NN0A 1E9AA 3EASA 1UKEA 1Q1ZA 1GTVA 2ZREA 2XEXA 3WMGA 4D81A 2RGNA 1BH2A 2EW1A 5AJWA 4YDSA 4KLNA 3IKJA 4OK5A 2GCPA 5KSZA 3FMIA 4HLUA 1DO2A 2JJ2D 1G5RA 2NIPA 1G5TA 2VRWA 4ZCMA 1GILA 1E2HA 3TE6A 5J4YA 3TUJC 1HQCA 4QJ3A 2RH5A 2ZS9A 2WAXA 5EXXA 4GMDA 4MYHA 3QKUA 1J8MF 1EFCA 3CF0A 4LRWA 4JLNA 4KSBA 1P61B 1G3IA 2RGBA 2PZEA 3U7FB 3RLFA 5LBIA 4QM7A 2UZIR 2R65A 2O8EB 5FUYA 3VKHA 2IYZA 4MYTA 2IHBA 2A5GA 4XVRA 3GJ4A 2BM0A 1FMJA 5JZVA 2AHOA 4QNMA 1X8LA 1SHKA 4AYXA 3GLIE 2H17A 1OIVA 4BASA 3DHWC 4CEHB 4V0LA 2QZ4A 1NNEA 2FFAA 3ZD6A 3SR0A 3OESA 2ZJZA 1E9RA 4YMUA 3CKLA 4XTCS 1M8PA 1KGDA 1R0WA 3SBDA 3AVXA 4RSGA 1QF9A 2ZVQX 2AK2A 5J5CA 3W90A 4DSNA 2QM8A 5TMPA 3IGFA 4DIDA 2H18A 1JR3E 1R6BX 4JLPA 1XF9A 1NP6A 2IHYA 1Z2AA 1KI7A 2HF9A 3QPUA 2MSCB 5L3SB 2IYXA 3LFUA 3TSOA 4Q7KA 4I1SA 1IY1A 1AJEA 2D62A 2OM2A 2XZPA 1MO4A 2FA9A 2QAGC 3C5CA 1XX6A 3TH5A 5EE1A 4GI7A 1XTSA 2ODBA 3ZD7A 3AVVA 4US0R 2B21A 2B7CA 3M4YA 3H86A 1N6HA 5HZHA 2P6UA 3OF5A 2RMKA 5UKDA 3W9YA 2C95A 2ZETA 1NIJA 2DFLA 4MUBA 4PPFA 1XCPA 2QORA 3GLIB 2FEOA 2IUTA 2Q3HA 5FOSA 3BAFA 4GL2A 1GVNB 2J1LA 1P2UA 1KTVA 2X77A 2GTPA 4BLRA 4GNKA 3GLGA 3BFKA 2Z4RA 1PV4A 1JNYA 2KSQA 1E2KA 3AP1A 2W6IA 4TLEA 1D9XA 2IYLD 4DCUA 2ZSEA 5CDFA 5EP3A 2J46A 3KQNA 1G16A 4M4SA 3ICQB 2DWPA 2QSYA 4GRAA 5JMTA 1GM5A 1XMIA 2WJYA 5IHPA 2QAGA 1R4AA 4B3GA 2IUUA 4WXPA 1X8KA 1GAJA 5K8LA 2MSEB 1Z6AA 2WWIA 4XVQA 2YV5A 4PHFA 4MDEA 1Z6TA 1HE8B 1HTWA 4TL6A 3KKPA 5KHOC 2YJTD 1W44A 3LQQA 2ZPTX 5FUXA 3ZH9B 2QMEA 4TMTA 2ZUCA 3JVVA 5C1BA 5DIFA 4KJZA 1SULA 4CEIB 2NG1A 4TYYA 4KV9A 1T8TA 1KI8A 4PHHA 1YR6A 2NPIA 1UM8A 1E9CA 4MH0R 2FV8A 1RKBA 1OH5A 1MH1A 4EQ6A 1Z47A 2ZSAA 3KZ1E 1OXTA 4NU0A 1E2JA 4BQSA 3D3QA 4HYYA 4Q7JB 4Q01A 2HYDA 4I99A 2G77B 1T0HB 3ADKA 2G3YA 1NLYA 2I1VB 4QRHA 4DUGD 4DT1A 3TGPA 3E5HA 2HLDD 2DFTA 4L9SA 2E9SA 2WWHA 2WSMA 4II7A 3KL4A 4MA4A 1GRNA 2DY1A 1ZCBA 2QU8A 4ZPXA 3VKWA 3QVUA 3UXMA 4JL6A 3B60A 2OSBA 3LVQE 4B35A 1Z0DA 4D26A 3S1AA 1QRAA 3WRYC 2O0JA 2GVDC 4CRWB 1YJ5A 3PFIA 4G5SA 5HTKA 4TYQA 2BJWA 4CZ2A 1J2JA 4HAVA 3PXGA 2EQBA 3SFZA 5J4VA 4LJYA 3X1WA 1II8B 4TSFA 4OKSA 2VP9A 2DR3A 3EIQA 1CKEA 2PCJA 1XP8A 4GMXA 5EP1A 3BXZA 2FG5A 4AWXA 3UMFA 3TLXA 1ODFA 4G5OA 2IS6A 1CJUC 1Z2CA 4WA7A 1XJCA 3KQHA 2XOKD 1XTIA 3ZVRA 1W36B 2J41A 2WV9A 1S9HA 1Z6XA 4HAZA 4ASUA 3I92A 4LPSA 4IVPA 2NO1A 1VDZA 2J87A 2A3RA 1KI3A 4D25A 3CLVA 3PUXA 3PVSA 2QUZA 3V9PA 1QHNA 4DB4A 1E2FA 2RHMA 2NO0A 3CF6R 5DI9A 3T1OA 2WPDD 4BFWA 2N1BA 3NHBA 2WHXA 1P3JA 1XZQA 3TVTA 3M6AA 3QOFA 5FPSA 3DL0A 1QG2A 3ZJYA 2ZI7A 2NTYC 1HQYE 2QY9A 1U8AA 4PC1A 4KAXA 4N1AA 2ZVPX 4V0OA 4W5WA 2VP2A 3TVDA 2JLZA 1NMXA 4D0LB 4D4JA 1XD2A 3NWJA 4XTRA 4NYJR 2VEDA 5L3VA 4BLPA 4QC2A 4LOAA 3EARA 4X8OA 3BOSA 3T35A 2P67A 2ZJ8A 2ZJYA 3U3KA 4F91B 3FE2A 1W2GA 4A6PA 4XOIA 3GLFA 4URVR 2EYQA 2ZR0A 4R71A 5AJZA 4CT4B 3VTKA 4JLOA 1GWNA 1T0JB 1NRJB 4MGKR 3GJ3A 1ZIOA 3WHKA 4JSYA 5H70A 2PEZA 4TQUS 5HCIA 4NBSA 3QXHA 3LBIA 2OT3B 2FU5C 3H0KA 1Q21A 1ESMA 1NG1A 3KUDA 4ZDIA 2A78A 2C9YA 1NKTA 3B7GA 3L0IB 3ZIAD 4D4LA 3FFAA 1E9EA 2BIFA 3IBGA 4N0DA 3U6KA 1C9KA 3BD9A 2RHDA 3UG7A 5IK2D 1P2TA 4GZMA 1XDBA 5DSZA 1KJWA 4C0KA 1ZM3A 3J81k 1ANKA 2W2TA 2WJVA 1EFRD 1A1VA 1M6NA 2AR7A 1JI0A 4NMMA 5J4LA 4YMTA 4YXWD 2QPTA 4ERNA 1YHNA 4HAXA 4O3MA 2OFOA 4PPQA 5G53C 3KQUA 4GOJA 1G3RA 1T91A 3B1XA 1GIAA 4IDNA 5CK4A 4A8JB 3U3JA 1YR9A 3N2IA 3ND8A 2CCJA 1D8TA 1M1YE 3CM0A 1UEJA 4D2IA 1FQJA 2ZJAA 3BH7A 4TMXA 3MLEA 4M9ZA 3CPJB 3QVVA 4PXAA 2QP3A 5E7MA 1ZM7A 5TVKA 3WXMA 2O8EA 2W0SA 5G40A 1LS6A 4LK2A 1G7SA 1OFIA 2IWRA 2EFEB 4MYCA 1SXJE 5FTMA 3M1IA 2YWGA 1RYHA 3BFVA 2C03A 2Z43A 4MYUA 2ZANA 5DI3B 3NBXX 3DDCA 4IVRA 4QGGA 5ANRB 3K70B 4CEHA 3GLHB 4PAQA 4BEBA 2O0HA 4X8MA 4E09A 5JS8A 2ECKA 3TIFA 5HE8A 3DKPA 1IOZA 1KO8A 1YZGA 4DEXA 4M21A 3VHXA 4C0QC 3G5UA 3BB4A 3ASZA 1IXRC 2CHGA 3K0EA 2FOLA 3KDSE 3CBQA 2ZRAA 3NKVA 4G3XA 4XJXA 5FTLA 4AG5A 3EX7C 2WTUA 3T1QA 4PC3A 3LX5A 4Q9IA 1YE8A 2QM7A 4R2IA 5L3SA 4EPYA 4LYFA 1FFHA 5FL7A 4C0JA 5M04A 2ZM5A 2GXSA 4PC7A 2FH5B 5BW8A 1BYIA 3AV0B 3T34A 1VIYA 4EUNA 1O87A 1U2RA 1P9NA 1XNJA 3OAAA 2IS1A 4OBEA 3ZVLA 1CIPA 3SE0A 1H8HA 4C0BA 4F4JA 2R2AA 2OE2A 3TSZA 5JI2E 3MRSA 2CVFA 3RRZA 2NO7A 1KK3A 1HE1C 2IXEA 5C4GB 3VMFA 4A0GA 2JLWA 5IF9A 2HF8A 2BMJA 1OHHA 1KO1A 4TLBA 4B71A 2BMDA 3GLIA 2X2FA 4JLVA 1KIMA 4B43A 4Q4HB 3X1ZA 3ICEA 1CU1A 4KBGA 3HWSA 5JEDA 3JVUA 4K81B 5KTYA 1VYUA 1XMVA 1QHHB 2SHKA 3UK6A 4ZO4A 1XRJA 2XGJA 4GDFA 4B3DA 1N5KA 1AA9A 3BH6A 2AKAB 1NL3A 2D4HA 1E79A 1DAGA 2VQSA 4FW9A 4OHWA 5AK0A 4NP6A 2G88A 1KOFA 5JJLA 3TJZA 3CRQA 5DLQC 4TQAA 5AUNB 2F55A 3FMPB 4E07A 2VO1A 1VECA 2VIIA 3NC0C 5JS7A 3EWAA 3IIMA 4Q21A 1ZP6A 3IUYA 4PQYA 2H92A 1SVWA 4C2UA 4FWIB 3W8RA 2QQEA 3MMPA 3OEHD 3W8NA 2ZRNA 2I1QA 2QTVB 5JWOA 3SC3A 2J0SA 1NKSA 4FI3C 1SVIA 4NONA 1D2EA 2GILA 1GNPA 1DO0A 1T4GA 3C16C 2BBSA 4MRRA 5FFMA 4CEIA 4AC9A 4DEYA 3K53A 3N70A 4JVNA 1KK1A 3AVQA 4LY6A 4GZLA 4P32A 3VQTA 3ASYA 3RABA 121PA 3B13B 3PUVA 4QG7A 1IN7A 1GRRA 1UPTA 5TB5A 2ANCA 1VCIA 4PZZA 1LV7A 4Q4LA 3K0AB 2R6AA 1W36C 2VHJA 1COWD 1P6XA 2EU8A 3CPEA 2QT0A 3W6OA 1OKKA 3WBJA 4ZKEA 3GJ7A 4JL5A 3ZQ6A 3VR2A 3CUEF 4NCNA 3CX8A 4C0AC 1YZNA 1SKYE 1JAIA 1ZM4A 3O8RA 2JDIA 1V5WA 1Z3IX 3GPLA 1GZSA 3NDBB 1G5PA 1VHLA 2ZSBA 3D6TB 5DYIA 5K8UA 1MRNA 1Q0UA 5DHAA 4LJ5A 3SJZA 5JEEA 2IF2A 2Z83A 1ZM9A 3PEVA 4RD6A 2JLUA 3CRRA 5A5GA 1ELOA 3PR1A 2XB4A 2WJIA 2VP6A 4TN1A 1F6BA 1RRPA 1CJTC 2Q6TA 3H1TA 4ZDWA 4A0RA 1II8A 4P4UA 1W47A 1IN5A 1E9FA 3AKCA 4KU4A 2UKDA 1QG4A 3FFBA 1W4AA 1G7TA 5EXSA 4EPXA 2JIZD 4XSHA 1T5LA 3VNUA 1CBUA 4DXAA 1M74A 5A4JA 4FCVA 1K6MA 4KHZA 1R7RA 2GNOA 2BMEA 2WWXA 4QL3A 1Z0IA 1MOZA 4IKEA 3I8SA 4PPGA 1G4UR 2CL6X 1W0KA 5BXQC 1IY0A 2PEYA 5CB8A 1YR7A 2UVQA 4IHQA 5CITA 1SKYB 3MWJA 4HB4A 1NBMA 1UJ2A 3TUZC 5FR2A 3NBZC 3W5JA 1G20E 2C9CA 3NTUA 1E1QD 4KLZA 3CPHA 4LYHA 1G3MA 3Q9LA 4L5BA 4US2R 1HT2E 4LSGA 4URUR 1VMAA 4LYJA 3A1UA 3AUYA 1B0UA 1R5OA 3GJ0A 3WMEA 3LRPA 3OE7A 1IY2A 1LVGA 2O0KA 4B76A 4M9QA 2IK8A 1U8YA 2PJZA 1G3UA
chains in the Genus database with same CATH superfamily
3AONB 4OA8A 1R66A 1SKBA 2GRUA 2EG5A 4FGJA 5E9JA 5DM2A 1KFKB 4NEHB 1ITZA 1N9GA 4WESB 2JD2A 4RWZA 5CRIA 4FOSA 2QA5A 2ZWMA 4RD2A 2X13A 3DGEC 1ENPA 1RC8A 4A8JC 1GLVA 2G0NA 2WSSD 4KQ2A 2ES4A 3ZKWB 4YACA 3IO3A 4FYIA 4M0KA 3TZLA 1UWCA 2J7PD 4NJMB 3W0LB 2NYUA 1ZHFA 2GWHA 2RAPA 1HT1E 4HDAA 4CDGA 4EKGA 4ZGGA 5A2QA 5KTOA 3UENA 1E4YA 2ZJ4A 2Z0MA 2A7QA 5I01A 4JLBA 3FHCB 4PV7A 4URWR 5FOWA 4NBKA 5LBTA 2HCFA 4LJ6A 4AY3A 4B3XA 3JQBA 4IEEA 5GVSA 3NUZA 4YGXB 4Q48A 2VYVD 2HR1A 1HC7A 1XMPA 4ACAA 4INAA 4I1VA 5A1TA 5B12A 5I7RA 2VQ3A 4RKYA 3J81A 1VKJA 3JATB 2Q99A 2XCOA 2X5NA 5CGQB 1W5TA 2XUOA 3EMBA 3FFXA 3OQBA 1GGNA 3DBVO 3DOCA 5LQSA 3RUAA 4BNWA 4XW2A 1B74A 4PX3A 2B30A 1IFXA 2C57A 2OHJA 2R2GA 2X8BA 3BJEA 5NLLA 2CE7A 1Q16A 4EA7A 5BR4A 3K70C 3LKBA 1J97A 4GKBA 1R37A 1XV5A 1JT9A 5TF4A 2MDTA 2HDNB 3NIDB 4M2LA 2Q4OA 2BGTA 2B9EA 4RNCA 1MX5A 1UZMA 4QO7A 4UDOA 4AO7A 4QQKA 1E77A 1U8ZA 2BJHA 3OIVA 4TKLA 1E7QA 2OWDA 3BBLA 3IVGA 3NXSA 2UVPB 4G4GA 3HYSA 3A4MA 2P2ZA 1OAOC 4L5YA 5HKLA 1P4GA 1D3AA 3AWIA 3P9IA 1QYIA 2YRXA 3VR5A 4AN1A 3K9LA 5FPYA 3K96A 4ZZ1A 1UFOA 4UMDA 5IVDA 1TM1E 1FTYA 1OYVA 1NDUA 2FMKA 2OYRA 5AIBA 1T9CA 4EKYA 3AVPA 2O48X 2ORWA 4AO8A 4PLGA 4DBLE 4ZVSA 1GL7A 1QG6A 3LDHA 1G2OA 1CY1A 1UXKA 4BUZA 5LZ9A 1PKEA 1HDYA 4CKCA 5HJEA 1QSGA 2WJJA 3GGCA 1HEYA 2XVZA 5CX4A 4P3PA 3ZY6A 4UNIA 1RMTA 3SZOA 2FHPA 2E82A 5CVJA 3ZWNA 1HFJA 1KR5A 1YZQA 2ZRKA 3C41J 3CH5A 4EMTA 1MD9A 4RC9A 1Q1NA 2AEEA 3PS9A 1EA5A 1TU3A 3E9QA 4L3WA 2FG6C 5DI3A 4WH0A 2BCJQ 4UBNA 3QIVA 2OXCA 3OQMA 3UF0A 1VHWA 4M1OA 3MGAA 3QI2A 4O2BA 5COAA 1A0OA 1WVMA 5EZ5A 4BQQA 2C7PA 1VYTA 3W5AA 4Z4GA 2I4MA 1G3QA 1V25A 1TEZA 3D1LA 2I62A 2VP3A 3QPVA 4G5HA 4J2HA 3T9FA 2KMLA 3KR9A 3ZZ0A 1K2VN 1M9NA 1NSFA 1GEEA 2DFKB 2NSLA 3M82A 4TL7A 2ECOA 1RLJA 1QTIA 3ABSB 1CSEE 4J16C 1ZRMA 1Z5NA 1SH7A 4RF4A 3I73A 4LDNA 5AKXA 4KN8A 4FEAA 2QTCA 4PZDA 1JPUA 2OSVA 5CCDA 1XZEA 4BAGA 5MGNA 4FDAA 2BEWA 1EZ1A 3QVKA 2G04A 2ISCA 4WADA 4ZVVA 1RKUA 1R4NA 4ZMRA 1IZ0A 1CRWG 2X8JA 1M1YA 2BISA 3EEYA 3JQRA 3OCYA 5KVVA 1OH6A 1NWCA 3E9ZA 5D3KA 2QK4A 2DF8A 4NNJA 1KNXA 5IARA 4YJHB 4X00A 4JUAA 3VPDA 4J9VA 4J03A 1AKWA 5EE5B 3TNDA 4J43A 4LX0A 4EPVA 1B23P 4ZJZA 3KQLA 1RYEA 4QNRA 5DMHA 3PUZA 1XQ1A 1YBVA 2YMPA 4IJVA 5JS6A 3ZWXA 3LBAA 2R8YA 5EPUA 1XHEA 1MB2A 1U4OA 1ZKDA 2DJIA 2MSLA 4Q3AA 4UXIA 3MWDA 2PMEA 3S55A 1K66A 3H97A 4YRLA 4XJVA 3K20A 5BR8B 1Y8RA 2BM8A 5TQ0B 4UEJA 4ZYYA 1I36A 3JQGB 4P4GA 1SCAA 4UHDA 3K09A 3IIJA 2ZBDA 2VT3A 2DPGA 1V26A 2QTRA 5A6SA 3R75A 1W5FA 3MN1A 2WWGA 3GUCA 1B1CA 1OAAA 1DEAA 4DWOA 1MHPA 1ZUWA 4J9UE 5K51A 5EUQB 1EDZA 1Y0BA 2ZVDA 3S7TA 3JQ8B 3V7NA 2R751 1DAFA 3ZE9A 3HZHA 1ECFA 1KK2A 3RI3A 2NSJA 3TZCA 4UU0A 3B1JA 1MJFA 1T1GA 3AEKA 2EX4A 4NESA 5LA6A 4JJ7A 4R9UC 1BKYA 1DXYA 2FFHA 2CLEB 1IN6A 2XH8A 5ALTA 3QX9A 4MRVA 1UR5A 2Z2XA 5ITSA 1VHTA 1X92A 4XLLA 5BV7A 5LLDA 2ZIVB 2BGMA 1KFBB 1Z8HA 2AVDA 2W2KA 2JHPA 3EQ9A 3CX4A 1QZ3A 3OA0A 5ALOA 2LRHA 1BG6A 1M7BA 1O4VA 4U02A 5DB4A 4C05A 2DLCX 2OHFA 3BHNA 3DT9A 3FBGA 4TYPA 1RHUA 4CQJA 4BRUA 3S8YA 1NGSA 2AE2A 4Q16A 3WGZA 1FE8A 4IIGA 4MA0A 3FROA 4WPGA 4ABTA 1CETA 3PHIA 1XPRA 3ITEA 3L84A 4QBKA 4FSXA 3F4LA 2YOHA 4JJIA 4UEKA 1B43A 3N76A 3N3AC 4X71A 5K7SA 4L50A 4COOA 5B53A 1E2IA 3HKCA 3NV9A 5FFNA 1SA0A 5KSOA 2PFGA 1WPRA 5KX5F 1T35A 1BDHA 1E98A 4QTXA 4YIKA 2OD9A 5F51A 2QU7A 3LOUA 3R3HA 1Y7PA 4NXMB 1I7NA 1ZUHA 4XGKA 1MPXA 4HGNA 4CHTA 1JFLA 1SG6A 3CEPB 4TQ9A 3OFJA 1L4EA 2W9XA 3FKJA 4MI1A 3RS7A 3TZKA 3F3MA 5DHRA 1NXSA 1Q0SA 2FR8C 2HWUA 3A7DA 3AF5A 2NWQA 3UJ6A 4B6FA 2R44A 2QJTA 3AJAA 3NWEA 3VYSB 2QROA 5KC8A 4UPVA 3R9XA 2XXAB 1NU8A 2PZMA 2J5RA 2BFEB 2MYTA 4MKIA 1LA2A 1D4AA 3EW7A 4JI5B 3FPFA 4QVGA 1E2EA 2WJ4A 3IBFA 5JRZA 2EBWA 3THXB 2J0QA 1RIIA 3KZKA 3Q7TA 2RG7A 4IDEA 2H1LA 5AVZA 1I8TA 1IM2A 1B4DA 1V37A 3EMVA 4E3WA 3HO1A 1XDGA 4YQYA 1UMDB 2NUPA 1AN0A 4RSHA 4F4HA 1JEDA 1G8KA 3DCIA 1OH7A 1U3DA 1L7MA 2GXUA 5LQUA 4X1IA 3HXMA 2ZJBA 4GM4A 1YI1A 5AVKA 4IOLA 4NCKA 8OHMA 1QE0A 3C3CA 3JY6A 3P71T 2PZLA 3SYTA 1XQ6A 2CCGA 1JHYA 3BA6A 5H8WA 2R6JA 4LXGA 4F71A 2R60A 3VAZA 1E0KA 1K2WA 1PQ4A 3GMTA 5AJUA 1P73A 1CK4A 5GWXA 1RM0A 2AK3A 2DE0X 3R41A 4TSFD 1BJKA 2QVCA 4YLEA 1UBJS 2ZIUB 4KJXA 2D2EA 1SXPA 2VXOA 3AYZB 3AG5A 2QRVB 3TWOA 1A9QA 2Y67A 1ISRA 4RFSB 4JX8A 5B2EA 3H5NA 1PDWA 4NHOA 1GKLA 4P38A 2ZSKA 2CYAA 2EKBA 3DPIA 3GUUA 3HJHA 4X0EA 2V7QA 5JR3A 4GZ6A 4OOEA 1VKNA 5WRFA 4NMXB 5EZ6B 1U3WA 1IL0A 1VIVA 2ACVA 2CF5A 3AFIA 3JQFA 4DC1A 4EECA 4Q3EA 4F12A 1AQJA 4GKJB 5KVCA 5AW6A 1Y1RA 1EP2B 3PEEA 5CFOA 4B0OA 1SKAA 2AHRA 2BKXA 4TS1A 1UQRA 2MSKA 3ESQA 5DNCA 4UAGA 1KI6B 3M89A 4L0DA 2WVHA 2XWSA 2TMDA 5AM5A 5EINA 5KVQA 3Q10A 4G9GA 1OWLA 5F2KA 4GI2A 2OAQ1 4PONA 1W4CA 4ZVUA 3PCTA 7YASA 4CV3A 1I3MA 2A9FA 2FSIA 2UZ0A 4IG4A 4PC6A 5DYTA 2AA3A 3VGPA 2QRPA 1EH5A 1Z06A 1O6ZA 4DMGA 4F6LA 4MEAA 3NCTA 4P92A 1O94D 2IGTA 4JP5A 1EDBA 4LHWA 5EY5B 3OX1A 3DVQX 4B5LA 4Z4QA 2YJGA 5IHXA 2Q8QA 3GEEA 1M6HA 3ILXA 4J90A 1E9SA 2FR0A 3NHZA 3QW2A 4MKZA 4DVGA 5AHKA 4J0JA 3NAQA 3UN1A 1U7WA 4B48A 1WCV1 2ZTSA 5H7XA 3TQRA 4AKIA 1QGYA 1Z83A 5A5FA 3NKLA 5ED4A 3Q8MA 1GG5A 1E1YA 2D13A 2E1PA 1HKHA 3AZQA 3GARA 3HRHA 3KJQA 1UMCB 1TCAA 4EEZA 2BF7A 3ZU5A 3FPHA 4PR0A 3WJ1A 2QDKA 5HUQA 3PKJA 1X1TA 2IYTA 1G63A 3ET4A 3IT1A 3FCYA 4ND8A 4UTXA 2FPIA 3UWPA 3VFDA 3Q3EA 5I48A 2HEGA 3H9CA 3NANA 1G2PA 3QHQA 4AY6A 1HE3A 4JA0A 1SVMA 3CLRD 3K35A 4F60A 4CGYA 4EB3A 4P4SA 3RRBA 2CUZA 3OIDA 1VHQA 3URMA 1EJBA 3B1VA 4N6NA 4DYHA 1IG0A 4FX5A 1RJWA 1NJFA 4XWGA 5AJVB 3LDAA 3TMKA 4RMIA 1T3GA 1KDZA 3U40A 3RAFC 4WN3A 4RCVA 1GZ5A 1ZA2A 2ET6A 1O08A 3SDSA 1VKOA 3KXLA 5A4IS 3H5LA 1NHGA 4IG9A 3AHIA 4UPEA 4PHGA 2GPWA 2CJWB 2PRZA 3KOUA 4CKZA 4LRYA 5KOIA 1XALA 2FPLA 3TLYA 4P3KA 3THSA 1HUQA 2OZEA 3GUHA 3WE7A 4AZVA 4ZVMA 1W73A 4YR7A 5K4GA 4LFCB 1QP4A 3BGDA 3HKBA 1NF8A 4N5HX 3AYXB 2B8JA 3NHPA 3RVBA 2WAMA 2PJRA 5LJIA 5J2UA 5I45A 2GFIA 1P7ZA 2DTDA 2V58A 3LY8A 3NZEA 2ZKIA 3I53A 3O7WA 5IVKA 3NHRA 2BBWA 2C8JA 1XTQA 3WO1A 4AT1A 2OQVA 2I6QA 3GGPA 3KQTA 3JQEA 3RADC 1QORA 5DGXA 4MROA 4E11A 3GT3A 4PR3A 2FSFA 4W9RA 5ELMA 1XTUA 2PLWA 3OSZA 4DEVA 3M5WA 4KXUA 4I1YA 5DNUA 1M2JA 3VR6A 4EPWA 1MO6A 2UUPA 1A5SB 1JHMA 3CGWA 4X6UA 1YA8A 2ZJ2A 5EJIA 4JFAA 1ZYUA 4R0NA 4YR9A 4G1UC 3CVUA 3HNPA 4HQRA 4ENQA 1EQAA 5AIAA 2CL7X 2PCLA 4LV8B 3QVTA 1CZRA 1BXRA 3P1JA 1PJ2A 1QRDA 4UATA 2QUIA 5EESA 4YDQA 4ZIRB 3KJGA 3IMFA 1QV7A 2PVPA 3AVOA 4M1KA 3JTEA 4NYJQ 2IBSA 3HHPA 5LXTF 1QH8B 3W3AA 4R9NA 1AV7A 4Z51A 1QG0A 2H5JA 4Z6KA 3TGLA 3A1DA 4Q02A 1Q91A 1Q95A 3OJEA 4S0XA 3LT0A 3JR7A 2ATIA 5FTNA 4R1SA 1LJ8A 4R8VA 3ERCA 2F59A 4EG5A 1RJEA 2P9EA 3QNUA 3JZAA 4KL8S 4DMMA 5B1HA 1E5TA 3SHWA 2GCOA 2VWQA 2WUWE 4HJRA 4R83A 2K2WA 4ZJPA 2JJ8A 1JQ5A 5JJIA 1NVXQ 3ORHA 1IK4A 1T2FA 4JUBA 4NOMA 4CDNA 4F9TA 2QBYA 4G0YA 3WGJA 3VOSA 3B3AA 3ZNQA 4ER0A 3H5WA 1Y3HA 3M70A 2GBLC 4MRSA 4WQMA 4DMHA 3ZJTA 2ZYTX 3N3BC 1JEQB 2VPYA 5MN6A 3TBFA 1D04A 3DOFA 1OU4A 2Z30A 4PAOA 3L0OA 3QE2A 3G2NA 4P7BA 4ECAA 2M1XA 4B33A 3DVSX 1E8NA 3SJUA 3TZ6A 1AS0A 5K0EA 3N6XA 1T8PA 2A1IA 4Z9YA 3IL2A 3L06A 2GPYA 5KPJA 3T5TA 2CNOA 3UKJA 3ICVA 5HWSA 4CUZA 4AS3A 2AFHA 4FN5A 1UZAA 4MUYA 3R9IA 4AO6A 1WZUA 1W4RA 1Z26A 3LM8A 3PQDA 3GDHA 4FZVA 4QQRA 3LWNA 1T26A 2DH5A 5AJHA 3DVLA 2JEOA 2Z6AA 1RHRA 2HA5A 2I6FA 3EXIB 1KDPA 2DX7A 2WNHA 3MJRA 4P4TA 3WWDA 3U6BA 1NF3A 2W98A 3KG2A 5L45A 1EK6A 1EVIA 2K87A 1P2FA 1LU9A 4X63A 3WY9A 4ACBA 3RKUA 3RKRA 2IXTA 2ODNA 5F33A 2J8ZA 3D4PA 4H18A 4S1PA 5CEJA 2VF7A 2JVIA 1HM5A 2PZAA 2X0JA 4IEFB 4Q4JB 3BZBA 1JYFA 2WBLC 4GYYA 2JJ1A 2H8GA 4Q3KA 5HE9A 2YVLA 1APBA 3RM3A 1I51A 1YQUA 3MSXA 3OM1A 1ZONA 2H1RA 3I6MA 3SBEA 4LBWA 3SXUA 3HJAA 3STHA 4MP8A 4P31A 3BMNA 1OT3A 2D3TA 2JFHA 3R0JA 3U9SA 3WYAA 4CG0A 4GPD1 1ZGHA 2FXVA 1JHVA 4QGHA 5CIWA 3KFVA 1Q84A 1J0DA 2OCPA 3G2OA 3PD1A 1MO3A 4OMCA 3T8YA 1Z29A 4BN0A 2P2NA 4FCCA 1PQPA 3F3SA 4R16A 4GLBA 3O4HA 1FLVA 3C4VA 4K8RB 5SYAA 3GCZA 3W2TA 5G3YA 1O9BA 1QZXA 1FX0B 2PL1A 3PNOA 1QAQA 4UNSA 3QYJA 3D3WA 2GEKA 3OE5A 2DXIA 1A82A 6GPBA 1R00A 2YWDA 2A30A 2GM3A 3B2EA 5JQGB 3HA7A 3QNMA 1OIWA 1ZXLA 1F12A 4GE3A 2NT4A 3RARA 3LVBA 1FDWA 1AXEA 3MUFA 3KZOA 3NHWA 1ZINA 3QUSA 4PYMA 4ARZA 1X87A 2B8EA 3C4JA 3C6KA 3LKVA 1NATA 3H65A 3QE4A 4LUCA 3ZZ1A 3TB4A 1XYYA 3VYUB 1V1MA 1IB6A 1F17A 3UV7A 3GJSA 1U7OA 2XT9A 3VH1A 3K71B 5CVDA 4YTEA 3OKFA 2QQFA 3I0NA 3EFBA 1Z07A 2AN9A 5CLFA 3F49S 5K0JA 1USVA 5L8VA 4R2WA 1KZHA 5LQJA 2WAOA 3FBTA 2RJ3A 1W85B 2ZBUA 3MB5A 1IHOA 4G8JA 2GYVA 3OKPA 3PC2A 4IQFA 3CKYA 1MIOB 1UP4A 3LW7A 2Y1EA 3P2OA 1K27A 3MIZA 5BMOA 4D42A 4MEBA 2J5XA 2C94A 4WKGA 1DXOA 4QAQA 1LPOA 4YMSA 2JA1A 5AFSA 1U28A 3Q85A 3T06B 4Q9LA 4WIAA 3EA0A 1HFWA 4BE7B 2CNLA 4U7PB 5BNTA 5GZ1A 1C1YA 2F43B 1NG9A 4URFA 5FPHA 4J1QA 4ETNA 4RMJA 4WBNF 5LKRA 2ILVA 4TZ6A 5HFAA 1ULUA 3HBAA 6YASA 1S1CA 4IILA 1AUQA 1OXVA 1FNCA 2WLTA 1WXQA 4BO8A 1M2OB 1F8YA 5FJIA 1NDHA 1V3VA 2I22A 3R7FA 4AJNA 4DADA 4WEQA 5KYGA 1T3LA 1UWKA 1ACJA 2C5LA 4BMSA 3Q8LA 2D5BA 3HEBA 4C3VA 2YXNA 3NTXA 3ZDQA 1E3JA 5DBOA 3P26A 2Q4RA 2P1RA 1S2MA 1ZGZA 4GI3A 5LNK1 1W36D 4OAPA 2AVNA 3NOXA 3BWDD 3IODA 3KB6A 3BXPA 4GMKA 5J43A 3M0EA 4M0FA 3M5PA 4F7WA 1PZEA 5IN5A 1XI2A 1NVUQ 5B36A 3HXKA 4YBZA 3UMMA 1MABA 3JZDA 3U4HA 1W0KD 2VJOA 1ZUNB 2HGZA 4MA5A 4KUEA 4G36A 4XR9A 3RRXA 4WFIA 2X5OA 4O29A 2BEVA 4D8XA 1R6UA 4N3GA 4HNUA 3RYIB 3SVZA 1WSWA 3QFSA 5C8YB 4MIEA 3Q6NA 2Y1WA 3N0XA 4JKOA 1UDAA 3H5RA 4KUGA 2O2EA 4P4NA 1ML3A 2RK3A 3SBOA 1NFFA 4Z0TA 3EN0A 3G0BA 4B7CA 3WYFA 1Q7CA 1KDTA 2WD7B 1TEHA 1CT9A 1TXGA 4INJA 1K8ZB 4UD6A 1O6BA 3ADOA 4HLQB 1K3TA 3CVVA 1B2RA 1TMOA 2PNFA 5FDFA 3VNSA 1KMNA 3AEZA 1CZHA 1DQYA 3KVYA 1UAAA 2PL3A 2WU1A 1G7CA 1AKYA 2XNCA 3ENQA 3K1JA 4LDAA 4L2IA 2A0YA 3L7BA 1SQFA 2SKEA 1OVGA 1E3TA 2XE6A 1Q1QA 1P74A 2XUPA 1ST3A 2EYUA 1SWVA 4JASB 1SUWA 3DOJA 5FA8A 1LW7A 4NNOA 1RPTA 2DMRA 4XM1A 5ALXA 4D41A 4D4MA 1C9DB 4F4FA 5M29A 1UKZA 2PKCA 3GIDA 1ILEA 5B1EA 4CIYA 1TTPB 4EG0A 2DERA 1DADA 1IXSB 1DDIA 2GO1A 1XRPA 4R9RA 2P9QA 1JVBA 2H4HA 4ITRC 1PHRA 2WYUA 3GH3A 1AVTA 2VN8A 4J76A 4W63A 4D4GA 4HB2A 1X9HA 4G1EB 2N42A 4DPLA 2WG1A 2ZSIA 2QY6A 2H1HA 2A2ZA 2FZCA 4EA8A 5HKOA 2YOGA 1JG3A 1X1BA 2VPZA 3QFCA 3ZNNA 3UC5A 4BVLA 5KBYA 4DIKA 1BVRA 3W04A 4EAQA 5LZ4A 1KRXA 3QVLA 3ZDDA 3FBWA 2YVQA 3MUEA 3UYKA 3UNXA 2BV3A 4D8YA 1D2NA 3NUGA 1TM5E 4MWTA 3FNEA 4HYTA 3SXPA 4BNIA 1FXWF 4NCBA 3PGKA 3IILA 4LJKA 1DJLA 3I45A 5JW6A 1B1AA 1WMDA 1T5IA 2G09A 3JSXA 4CM9D 4IRUB 3RT1A 3CNOA 3K8YA 3FMOB 3GEMA 1DCFA 1WZEA 2A84A 3OT1A 3QQPA 4G81A 2I6TA 4OIFA 2ZE5A 3DFFA 4PYRA 4LOLA 1TIKA 2WF5A 1O7JA 2AI1A 3LC1O 1F9EA 3VSAA 2IBMA 1F5NA 1I7SB 3KOMA 2J5QA 2FF5A 1EGAA 3EHEA 4HH1A 1ECJA 4HUQA 3HR7A 4TTJA 3FYUB 4S0ZA 2VBIA 1G4AE 2XQVA 2GEDA 5FLYA 3IBCA 4EJSC 2Y6UA 2P3SA 3U3ZA 3H8VA 1LB1B 3BTOA 1N1GA 3DV0A 4YONB 1AGPA 2AF4C 4X7PA 2RIPA 2H4FA 3QVOA 3VDQA 1T4BA 5B1SA 4DDUA 1KO5A 3QGMA 2O8FB 1GQSA 5GY7A 1G20B 1RKQA 4MUKA 4GX0A 2QT1A 4N0QA 3G13A 1UFVA 3EEQA 3N7UA 2I2WA 4M6WB 3P9RA 4P58A 3TFWA 1RPZA 2O9JA 1GPMA 2QTHA 3D3NA 5CR9A 2ODEA 3V1KA 4BHTA 1A2OA 3SC2B 3EA4A 2W11A 4NYIR 3T5DA 3VO1A 1QRTA 4X1YA 3NHJA 3QF4A 4FHFA 4ZRMA 3T1TA 1QRSA 4TTSA 2YR0A 4H0CA 5JDCA 1R1DA 1Z2DA 2GNPA 4AYWA 4F9EA 5KKCA 1U0RA 1HYGA 1VE9A 2NZUG 3H87A 4JCCA 4LSWA 3TQCA 5LJLA 3BB1A 4V0KA 2GXAA 3NFYA 3ABZA 1A9YA 2YV1A 3HFRA 1DQSA 3EGCA 3DAHA 5GONB 2E4ZA 2XDQA 3IDAA 1P19A 3LD9A 1HZJA 4MV7A 1XRQA 5EXEA 2GPJA 1OLUA 1KFEB 4XGQA 3AW9A 2ZIXB 1C14A 3GNSA 3N1UA 3TR5A 4NBVA 5FX2A 3INTA 3SX0A 3B6EA 5TQ2A 4B85A 4BY9E 2V7TA 5BW5A 4PGMA 4JI0B 3R7SA 3DKKA 4UTRA 2YWBA 1C50A 4DLRA 5GV7A 3A6FA 5EMLA 2XI4A 2WT9A 4QQ8A 1YR2A 1XZDA 1YDGA 2IIPA 1SFRA 3ILSA 3NHUA 1RNLA 2AMVA 4RZ3A 5TY0A 2IT1A 1FUKA 4AD8A 4I9FA 1K92A 3H5AA 2AG6A 5T4FA 4NKRA 4AJIA 2HZBA 4AF6A 5LYJB 1OPXA 5SZJA 3B6IA 1TADA 5AQEA 1JKJA 2CVQA 5AI6A 1ZXXA 2TMKA 3QUCA 1VLQA 1ZC4A 4F84A 3ZH2A 4DCTA 5CVCA 3MJHA 4CMCA 3P32A 4CFSA 3DMPA 1OGIA 3ZHUA 1GLNA 1DJQA 3F6RA 5KHAA 1WUTA 4AUMA 4G25A 4BXOA 1NQ5A 2VP0A 3FN4A 3G49A 3MRTA 1D6JA 2FE1A 3EXFB 5TEVA 5IM4A 4KR0A 1VIDA 4KRXA 3R8FA 1U1DA 4A10A 1QANA 4BNDA 4NXNB 2FLWA 5K3FA 4AWAA 2IY7A 1QJCA 3TKLA 3TD9A 5FBRB 3EPHA 4DLVA 5T5QA 3CR8A 1DUIA 3QOXA 1SGWA 4KQFA 4QSMA 2QRHA 3TNFA 3WK9A 3OJOA 1WMAA 4DMCA 5CJ2A 1GARA 1ISSA 4G0NA 5F3RA 3AERA 2VAMA 4UZSA 4U8HA 2IEDA 3RUIA 1NIPA 1X94A 1EK5A 4HXFB 5ADUS 1KJIA 3Q11A 4U4AA 1B14A 2WSIA 3HFSA 1S8AA 1FQWA 4IJQA 1SN7A 1UBKS 1YCHA 2IEIA 4MWZA 3TFQA 3WZMA 2R7AA 1SXJA 2C5BA 3C8HA 4URZR 3K4PA 3MJSA 3CWCA 1E4VA 3W8DA 2UZ1A 4GEGA 4OHYA 2NM0A 4XLTA 3TEJA 1R50A 2I4LA 1THMA 3BYZA 2ZYDA 1FK8A 2BFOA 1E20A 2Y9MB 4MP6A 2AUNA 1RYMA 3KWLA 4O8ZA 4OF4A 1YE5A 2AOUA 3SYLA 3VSBA 3CCFA 4CQLB 2YL2A 1VRCA 2ZPUA 3KLOA 5FA6A 3SAJA 3KJZA 4EFKA 1QJ4A 4Z1MD 1UKYA 3U31A 1BMFA 2YNMA 2GM9A 2B6NA 1W9MA 3DAOA 2ZI4A 4E5DA 2H07A 3CEAA 2W0MA 4A0QA 1HLFA 3V3KA 1A8HA 1T6YA 1U2GC 4MVJG 5GVRA 2I87A 3KKQA 1P18A 2GR9A 1QAOA 1MAVA 4PSAA 1OILA 421PA 4EB8A 4K88A 3KZNA 1G6HA 2DVMA 5LOVF 3DLAA 3SBXA 4CEJA 2I9KA 3I6BA 3QEKA 5DCWA 3NYRA 4HH4A 1D7AA 1R3UA 2R8EA 4LHVA 4E7OA 4LMRA 4EHIA 3O2SB 5PGMA 2UXDB 3OZCA 3A25A 5LZ7A 2XQGA 4BP8A 5CT4A 2Q6KA 2VZEA 3OTQA 1EBUA 1P39A 2NSHA 4FFSA 3HU3A 3OOSA 3LQ1A 2XWPA 4ENTA 1DCTA 4W1QA 3ONDA 2W7TA 1RFLA 3UGQA 4W5HA 2ZYWX 1MB4A 3FYTA 5TQVA 2GESA 3BWBA 1GNRA 4Q1FA 3AUXA 4JT8A 1C7JA 1PZXA 3ADPA 4DJEC 3ZHVA 3DV2A 3FPCA 4JXKA 3WJ7A 1XCBA 2F1RA 2ZRBA 4HZUB 4HX2A 1QHGA 4EOGA 3IXQA 3L0YA 2ADFA 2BHLA 1BEUB 2ABWA 4V38A 2QT9A 4A7PA 2Z9CA 1DRKA 3QX8A 4DLSA 2LBPA 5HKKD 3LC0A 4HTFB 2HCTA 1PS9A 2RAFA 1GTZA 4BFXA 2E4VA 3FYDA 2C5SA 5D6NA 3TBHA 3C15C 4EGQA 5KYWB 4YUVA 3RV4A 1WX1A 2A6PA 2QIPA 3DZDA 1XLVA 1S1MA 3DL2A 1D0IA 1N8KA 4R3NA 4RGQA 5EFOA 4D0GA 5IKPA 4HEA6 3UK0A 4IH9A 3VDRA 2XITA 4OJNA 2CXPA 5EVCA 4CF3A 2PX6A 1DQZA 4LA4A 4YRPA 1DFGA 2WILA 5G0TA 3FF1A 3FI0A 1Y5MA 2FN9A 1PR0A 1KXJA 3GT7A 4CMEC 1QX4A 1R5NA 1T1RA 5CEFA 1S7CA 1XFDA 2V0CA 3EVBA 2YC4C 3IKTA 3L0SA 2EX0A 3UOWA 5L4NA 1AQNA 5JTTA 1HLDA 1JFRA 3IQEA 2AYZA 1VYVA 2CLMB 2XRYA 1XQ9A 3F0TA 4A4DA 2V1XA 3IP7A 1XAGA 1R0ZA 4UNQA 3REQB 1TD1A 1JU3A 4AY5A 5FNZA 4E22A 1A3CA 1YE3A 3MINA 3ZWDA 1FVFA 2QPAA 3VPXA 3TDMA 4EPRA 4L8GA 1YHZA 4C5CA 3QLUC 5BSUA 4UREA 1GAWA 1XLUA 3ENZA 4J1SA 4XIJA 3BMOA 5ED0A 1C5KA 3JARA 1J24A 4DLWA 1M34B 1GQOA 1GL3A 1P7CA 1ODKA 2RGGA 1DEHA 4HAOA 3TI7A 2ZRCA 4FXOA 3RIGA 1OFVA 4WFJA 4JIMA 2EHDA 3MRVA 1MX9A 3AXTA 2GN1A 3U4QB 3KYDA 3TOXA 1WWKA 3TW8A 1T2UA 2NV2B 3OWXA 2Q5EA 4DY6A 3H7AA 4ZCLA 1Y9DA 3RT7A 1SURA 5AP9A 3W8FA 4BLTA 4DG5A 3E5RA 4I55B 1QHYA 2COUA 2NV6A 4RIGA 2IV7A 4UM5A 3TLMA 1V3UA 1IUOA 1KSFX 2LR0A 5EEGA 1TTQB 4BB9A 1N5OX 3OPYA 3Q3VA 4FXPA 5KNLA 1K8QA 5E4YA 3I01M 1WB9A 1U99A 1KJJA 5HNKA 3UANA 2AWNA 1KY3A 1E1RD 3ORQA 2HREA 2V74B 5EWJB 1TO6A 3CH7A 2I7CA 4YRZA 2H5IA 3FTQA 5AUOB 3IP1A 2VKTA 3LPAA 5D3MB 5L3QA 2BBTA 1Q44A 1JDNA 5AHOA 1PJSA 1LLQA 2JBAB 2Y0EA 4XQGA 1UOEA 2YDXA 1P7VA 2AOXA 5FOUA 4JYZA 4DNFA 1KYYA 1G9SA 3ZDCA 2JAPA 1IN8A 5K8TA 3C0KA 2RE8A 3I2YX 4KXYA 4V24A 5HG0A 1Y3IA 3QBTA 5IKMA 1SVSA 2XAAA 2X6RA 1NBME 3ZCQA 1YSCA 4G8DA 3ZOZA 2CKDA 5DEOA 4CODB 3BL6A 4QU0A 5CA1A 5HS6A 3C39A 5GGYA 4QYTA 1EHIA 1U3FA 1GTG1 1XKTA 2QRKA 3RNOA 2BEKA 2WWWA 4XGIA 1FFCA 2F3RA 2NU6A 4EYKA 4JYAB 1QGED 1KIFA 2HUPA 3M3DA 3V8EA 4DTIA 2XYPA 2ZJ6A 3Q88A 4RY9A 3LBYA 4CL3A 2O3JA 3HXOA 1PGNA 5EHZA 2JAHA 1D7OA 2CB0A 2JH3A 5KAMA 2W58A 4KR3A 3RBZA 3CE9A 3CS3A 4RELA 4RTPA 3U7EB 3ILYA 2G6BA 1NXQA 1RJGA 3IV7A 4UCFA 5AXBA 1MHTA 4W5OA 4HNAA 1A7UA 3ACBA 3DKRA 3L6EA 1ST2A 3BQNB 3GA0A 4I9NA 4UUPA 5E3IA 2F64A 2OXTA 3FDIA 4LZJA 1K97A 4DR4B 3LV8A 4DCOA 2LCFA 4BRSA 2JAUA 3K0FA 1KEPA 1J9GA 2WVAA 4BDTA 3H75A 2DULA 3DF7A 5DTRA 3OPVA 5ILGA 1N8NA 1VLZA 5CLIA 1E2PA 5C3UA 1KEUA 4WL0A 4O8CA 3HLTA 2MR5A 4CDMA 2OCAA 4S24A 1I6WA 3C7TA 4NF2A 4GKVA 1RZRD 1TZ2A 4HAWA 3SSOA 4UU7A 4KSCA 1HFKA 1Q1EA 3PC3A 4NAVA 3DE2X 4NE9A 2QZZA 1OJ7A 2WM3A 2CV2A 2I80A 1E6EA 1H5UA 2YN0A 1R3DA 1XTPA 2HA2A 2R5WA 3CB4A 2XUIA 1P2SA 4TMVA 3E2IA 5DN6D 3IOCA 2WIBA 2R85A 1EMDA 1JBQA 5FFFA 1QQBA 3B8HA 2Q5FA 4XEUA 4CKXA 2ZQZA 4XWOA 2AKEA 3QVGB 1P5HA 2IEZA 3G1UA 2C31A 4JKYA 4C0LA 4JLUA 3DTVA 1ZLYA 1XT6A 2V5AA 4R54A 2CXXA 3M7IA 1WB5A 2D1YA 5EE0A 3TJMA 3BGVA 3ZTYA 4BO6A 4YRBA 2C7BA 3CTMA 2F3UA 4YCDA 2EJTA 4QA9A 3LTNC 4R6WA 1JSLA 1EXNA 5FQOA 3OWOA 3BE8A 2NZYA 3CCBA 4R5MA 2XA9A 2HA7A 1FJXA 1KSGA 3QPBA 5D7BA 2PNJA 4ZVLA 1PEAA 3GRVA 1I3KA 1QX3A 1RCTE 3DM5A 4CQMD 2BCEA 5IM5A 5JXJA 4TLCA 3PNPA 1DTSA 4J4TA 3HVHA 3PEWA 4QBGB 3CXUA 5K8CA 4MW7A 3U80A 1DHRA 1S0UA 2OXIA 1NVVR 1IQUA 1XZLA 3LUFA 3P9PA 3ROQA 5HFNA 4C20A 5JYEA 4GHWA 3NPAA 1Y7IA 4F21A 3BFJA 5I47A 2AXNA 1V47A 4BRZA 1J1UA 2H2DA 3K72B 3TSWA 5TPZD 2PSSA 2DM6A 2MT9A 1SAYA 1OYWA 3H3JA 2WRZA 3AI3A 5KOJA 4JUDX 3IE1A 1IZ9A 1C4XA 4HDNA 1F1BA 1EXWA 2I8AA 1XZAA 4ERXA 3PC6A 4R3WA 1V8DA 3TRFA 4I08A 3GN2A 2QLBA 1O2DA 3GFVA 5J5VA 5AW4A 3OX4A 2XRZA 4EI9A 1XXHB 3VR0A 3MVEA 1Q1BA 3N0VA 4O2AB 4PO9A 4YRFA 4N9QA 1QC5A 3WMFA 4BVKA 5IXSA 3Q98A 2I6GA 4DV1B 3BX1A 5B7PA 5AKKA 3O90A 3HFJA 3R8CA 2IPMA 3P5BA 4P5EA 3VXKA 5E1DA 2I2FA 1P6QA 4JT4A 1XDSA 1WDLA 3G1TA 5EQTA 4EW1A 1GFIA 3WZ2A 4XX0B 3GAZA 2REQB 3WRXC 2BH9A 4LF8B 4HAIA 4LY0A 1M33A 3ZQ4A 4BNLA 5JFGA 3R9KA 1VTKA 2IH2A 1WU8A 5AO9A 2CHEA 5TNXA 1CJVC 2PQMA 3GJZA 5AYVA 5TJHA 3A4TA 4HDCA 1G0NA 1WXHA 5JFOA 1UDWA 4OK6A 1G21E 2JB9A 4QT0A 4Y9UA 4HLCA 5EHNA 2NU7B 4BMZA 4EUHA 2C2YA 3U3XA 1GZVA 2XZLA 4TL8A 3KTAB 3GCWA 1LW6E 1ZK2A 3DDHA 4QO8A 4N41A 3ZIAA 4EVQA 1LJLA 1EVYA 1EZ4A 4RANA 4J0DA 5ALSA 1GNQA 5G2OA 5KREA 2EJWA 4QQNA 2JZOA 4EHKA 4ZYZA 2OUKA 5IK2A 3LLUA 4I3HA 1V5IA 1BMTA 3VV2A 4CMKA 3HN7A 4P2GA 3WLRA 1FJGB 1A8UA 3TAHA 2G67A 3QXCA 1AQ6A 5BYAA 4OI4A 3IIKA 4WSOA 1JR3D 1R6TA 4TLLB 1EFRA 1NT4A 3LXXA 1RQXA 1RRFA 4RD0A 4AMZA 1EX6A 1HE5A 1KK0A 3JD4A 4YXWA 4PYIA 4HBGA 4R2LA 4F04A 1KMIY 1SBHA 4KLAA 3W7AA 5FTKA 3H9EO 4KXLA 4LVNA 2AJBA 2PGIA 5JD5A 4IEIA 4F93B 4PGFA 4XB6B 4D43A 1NW5A 4V0ME 4FJ2A 3L01A 4CMIA