3LY5A

Ddx18 dead-domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
211
Chain Sequence
TGAFEDTSFLVNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DDX18
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 211
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ly5A00
4MDEA 2H18A 3CWZA 2A78A 4UXIA 1S1MA 3VU9B 3PQCA 3BFKA 5HKKA 3RS4A 4LHWA 3TUZC 2XOKA 1DADA 1XXHB 2O8EA 2IX3A 5BYKA 3WXMA 2VEDA 621PA 4PPQA 5DYGA 4GFDA 1NVVR 4KVAA 4G5OA 1G5PA 3SI7A 1GP2A 3QEOA 2ZJOA 5JCZA 4HLUA 4QHSA 1R0ZA 3VX3A 4A8JA 5JZVA 1MT0A 2WZQA 2IYUA 2CJWB 3CX8A 1Z0KA 2F55A 1U98A 2GJSA 1ZNYA 3C15C 2CK3D 3I92A 4U00A 1FFHA 2QGNA 3P4YA 2GZDA 2QT1A 3RS3A 1G8PA 1D6JA 4OHVA 1JXOA 1E2GA 4F93B 2ZSFA 1J90A 1MH1A 4TL9A 2H5EA 5FPYA 3FHTA 3GEEA 4OJKA 4I4LA 1JECA 3C5HA 2ZAMA 4TTRA 2WPDD 1QZXA 4DLYA 4OHZA 4D4KA 2FEOA 2ODNA 4BASA 3QXHA 2BCJQ 1SVSA 3OIWA 3AEZA 2D4HA 4P31A 2NIPA 1T8UA 4X8OA 3SJAA 1D2MA 1F5NA 1YR8A 5FUVA 5FOXA 4EFMA 2XZPA 1GG2A 2HJGA 1E1QA 5DGXA 4CW7A 1KK3A 4PQYA 3AF3A 2JASA 4MQBA 2RGEA 5EP1A 1G8FA 3MG9A 3TAHA 1XF9A 2OCBA 2VHUA 3DL0A 3AUYA 3LBNA 3SJZA 1JALA 4OQMA 1NMXA 1X3SA 4ZDJA 2QPTA 1Z0IA 2YNMA 2J87A 2FFAA 4Q4LA 4PTLA 3CZPA 1VCMA 2AFIE 2DWOA 2RGAA 2P6NA 1E2QA 2QY9A 2PEYA 4TZ6A 4MYCA 3L0SA 2GWHA 2YWEA 5IHPA 3EAQA 4GPTA 3QENA 1N5LA 2OO7A 4IOLA 1NL3A 2IHYA 3UWOA 3R9XA 4KJZA 1U0HC 5DSZA 1XD9A 2QSZA 4I1UA 3PG5A 1KMHB 4HLDA 2FPLA 721PA 4RFSA 2O52A 3IPYA 4TT3A 1G4AE 1NBME 2QG6A 3ETLA 3VR3A 2TMKA 2FZ4A 4OYHA 1SQ5A 4W5WA 1MRSA 3H4MA 1YVDA 5IT5A 2X2FA 3K0FA 4C0LA 3HR7A 5ELXA 3KB2A 3B82A 3A4NA 1CR2A 4KI0A 4V02A 1NY6A 3ND8A 2IYZA 3HR8A 1NLFA 3AB3A 5J4LA 4D25A 4II7A 4GL2A 4D4LA 4URUR 1GSIA 1Z28A 3B13B 2ONJA 1E4VA 5DI3B 2FSHA 2QRNA 4GRAA 4D0NA 1N5KA 1HTWA 3RABA 1CF4A 2QA5A 1G21E 5G40A 4ZCLA 1IY2A 4GMDA 5CJPA 3OZXA 5A4JA 4RJLA 1UKVY 2OXRA 2VLIA 5L3VA 5B58C 3DEFA 3BK7A 4QKQA 1OIXA 2DCUA 2G6BA 3AKDA 1A7JA 1GIAA 2Z4RA 1G3MA 1GDDA 4D2IA 2W00A 3D3QA 3L2OB 3ZJYA 2FH5B 3AVUA 4JVMA 1OKKD 4FMDF 3B1WA 4PSVA 1NKTA 1KO8A 3VMFA 2REBA 5GVRA 4TTQA 2EFDB 2IS6A 4JYBA 1VDZA 2D7CA 1QHXA 4D4MA 1D8TA 3ZS9A 1F60A 4UNPA 3K70B 1EFRA 2C04A 2I1VB 1E79A 3IIMA 2WWFA 4PAOA 3ADBA 2CL6X 3FKQA 2P3SA 3ADKA 2EU8A 3GQBA 4JVLA 4URXR 2KBFA 1MO4A 3WNDA 2XTNA 1FMJA 3G82C 2SHKA 2V1UA 3AKCA 5CIWA 2WIBA 4C2UA 2B7BA 2BJVA 1E4YA 2ZYTX 3OFND 1KDRA 2AKAB 2GDJA 2QMOA 1Q1BA 4QHYA 5EE9A 3RS2A 1F2TA 3LX8A 1NG1A 4JL6A 4RCZA 1JEEA 3BB4A 3I8XA 2WJJA 1HH4A 2A5JA 3GLHB 1G291 1H8EA 1QHHB 1E9FA 3FGNA 4LJ8A 4AI6A 2F7SA 2JLZA 1SHKA 2MSCB 1P60A 3T61A 4DJTA 5JHGB 1NBMD 3U7FB 2OSBA 1ZC3A 3THXA 4RZUA 2BBOA 1R5BA 4I1SA 3SYNA 3UMRA 3RAPR 4DIEA 4HI0E 4TYPA 1R0WA 4MGIR 1OB2A 4V0OA 2HYIC 5EUMA 1G3IA 2ZJYA 3KZ1E 4QNMA 5FPKA 4JL5A 4TMXA 2OBMA 4I1OA 2P5SA 4B43A 4YMUA 1OXUA 1T91A 2D06A 3BIFA 1P2SA 2CEAA 3W5JA 1NSTA 1WP9A 1YU9A 4D4JA 3VNUA 4OKSA 4UJ5A 1NMZA 3L0PA 4F4CA 3FKSD 5GJCA 2FZLA 4QG7A 4BUJA 5E3HA 1ZJ6A 4NYMQ 5BN3A 3EX7C 2EFGA 1LB1B 3RWOA 4CGZA 1KJWA 1IJEA 1WCV1 2PX3A 3OIVA 5B30A 3I4LA 4G5GA 3IGFA 1KI6B 3AGQA 2CVHA 4Y0AA 4XVUA 3OAAD 1XJCA 4FCTA 3EC2A 2PEZA 2QMHA 2ZR0A 3NHBA 3W3AA 4IHQA 3CRMA 1D9XA 3OESA 4QBHA 4EPWA 2ORWA 4B33A 3GLGE 1DARA 2DY1A 5JEEA 3NWJA 1E99A 3DKVA 1F6BA 2JDID 3UMSA 1OXTA 1KTVA 1ZBDA 1XEXA 2MSDB 2OILA 4GSYA 2BEJA 2CK3A 3K09C 1CIPA 3D31A 4G3XA 2J5XA 1OHHA 4JBYA 2GEDA 2QL6A 4YC7A 2G88A 2ZI5A 4Q7KA 1HE1C 3R7WA 1BMFA 4ZKDA 2UKDA 3DMDA 4XH9B 1NVUQ 2WPDA 2I4IA 2ZTSA 5HZHA 2VHQA 4V0ME 4OQFA 2HV8A 1XX6A 1JAIA 4B32A 1CR1A 1PLKA 2O8FA 1XJQA 5CDFE 3QKSB 3CNOA 2VHJA 2WKQA 2CLSA 2YV5A 2FV8A 4Q1DA 3I32A 4R98A 3K0CC 2NO1A 1MV5A 4BEBA 4RZ3A 2AXNA 2OAP1 4ASUD 1WBBA 5IK2D 2ECKA 3LW8A 1II9A 2FA9A 3IILA 3K0AB 3MCAA 4L9WA 2CE2X 2FWRA 2WJIA 3MFYA 2QQ0A 3CX6A 4X8LA 4F4IA 1L8QA 4B6FA 1NNEA 1R2QA 2XZOA 4AG5A 2OM2A 3A36A 3AKEA 2A2ZA 3CO5A 3U3KA 4DC9A 2F9MA 1Q22A 5HPYB 2WWYA 2PZGA 1U81A 3W6PA 5TVKA 3K0CA 1KI4A 4G0NA 2OUKA 2H17A 5JEDA 4PAQA 1MKYA 4PC1A 1ZCBA 3HPQA 2BHRA 4NMMA 3A1VA 1PLLA 3N2IA 2OZEA 4D0LB 5DN6D 1UKYA 3K9GA 3CR7A 3NDPA 4EDHA 1QHYA 3DZ8A 4BFYA 1KNXA 5EXTA 4CEHB 1E0JA 2FGKA 2RAPA 2WOJA 3BGWA 1SKQA 2FPMA 4O2LA 1G8GA 3NH9A 1F2UB 1ZRHA 4LYJA 2QN6A 5TARA 2OBLA 1EFCA 5J5CA 2WMOB 4Q18A 5FBVB 3PJRA 4DDWA 5JLJA 1RYHA 3FPAA 1RFLA 3GMTA 4Q00A 4FIDA 4JL8A 1XBTA 3THWB 3QF4A 5G3ZA 1OXSC 1W0JD 5BN5A 2LWIA 4DKXA 2ZJBA 1BYUA 4TYWA 1XXHE 4O25A 1LTQA 1SULA 1XEWX 2EFEB 3QNUA 3QJYA 2NO6A 4PHHA 5CYPA 3T5GA 4B34A 2XB4A 1XPRA 2DFKB 1W36D 4WW0A 3EPKA 2ZAOA 3SFZA 1II8B 5LB4A 2B8WA 4I1VA 1A2KC 3CBQA 3CX7A 3QBVA 3QXSA 2JJ2A 4WIAA 1W2HA 1M6NA 1OIWA 1OKKA 3DHWC 1E2FA 1XP8A 1AK2A 2VYFA 4BE7B 3K53A 4ESHA 4TN1A 2XXAB 2GF9A 1WE2A 3ZDQA 1X6VA 2R6FA 3JZMA 4PQFA 2O8BB 1BKDR 1ZMXA 2YC4C 3BJIC 4W5HA 4OBEA 3VHXA 2O8CA 2GCNA 3AQ4A 2QRZA 4W9MC 2QPAA 1Q1QA 2VSOA 3TSWA 2CL0X 3MUFA 1ZM2A 2VTKA 2WWWA 2RGNA 1S0UA 2OG2A 3CRVA 4YMTA 2YOHA 5BW8A 3GFPA 3SHFA 3RWMB 1RW4A 1AGRA 4FN5A 3B1ZA 5DYIA 2ZANA 3OFNA 1EFTA 4OHXA 3T12A 5TMPA 3OEED 1JPJA 2WAXA 4P4TA 3EZ7A 2CE7A 3W6NA 1GNRA 2FFQA 5JSZA 2OFXA 3PUXA 4LCBA 4NYJQ 2G0NA 3UKDA 4MRRA 5FI0B 4ZCIA 1NMYA 5JS7A 4DB4A 4L16A 3TRFA 1U99A 3DKPA 3I5XA 3L8ZA 5FOSA 4Z1MD 2BCGY 4FXPA 2WJYA 2NO9A 3EIQA 4DEXA 5JWRA 4A2WA 3MRSA 4Q1AA 2P0EA 4QJ4A 5KDLA 2IL1A 3REGA 5KNDA 3ICQB 1KIMA 1M8PA 1J2JA 5AJVB 3AVVA 3TLXA 1Q12A 1NBMA 1TX4B 3CUEF 2WAYA 5AJZA 2GXUA 2PLRA 5DO9A 3CWQA 1NG9A 4FMBB 2NPIA 1S4QA 3AUXA 3LY5A 1YQTA 4LZZA 1YJ5A 2DPXA 2GAAA 2QM7A 3BB1A 3IUYA 1DAFA 1E0KA 1AS3A 1SXJE 4R2HA 4DWJA 1KMQA 1IN7A 2BM1A 3TAUA 1ZM4A 2CCGA 3X2SA 1DAGA 4BZPA 2E9SA 2N46A 5AUNB 4QM6A 3WRXC 1UPTA 3WBKA 4A9AA 1Z63A 3FKSA 3SBEA 3TSZA 3F3YA 1QG4A 1DAHA 1W7AA 1R0YA 2AD1A 2F3RA 1P4SA 3U3OA 1A4RA 2FF7A 4Q4AB 2WV9A 2ZM5A 1XNJA 1TAGA 4M0LA 4TL7A 3GLFA 4R2IA 2NZ8A 1QDEA 4KSBA 1KO4A 3B60A 2HJVA 3ICEA 1E9BA 1KDPA 3GP8A 3OAAA 2ZJ5A 4GT1A 2QNRA 1AN0A 4D81A 3ECCA 1SHZA 2X1VA 3TH5A 4HAXA 2BVNA 4WOPA 4ZO4A 2HEIA 1CKEA 3FB4A 1NIPA 2IWHA 4YMSA 4DLVA 4X8MA 4TWZA 4TQAA 2QSYA 3W3ZB 4AG6A 2Q3MA 2YOFA 3B9PA 5TXGA 3THYA 2R6CA 1TEXA 2I3BA 2B21A 2JDIA 4P32A 5F2EA 1GRNA 2F9LA 1RVDA 3AGPA 3X1DA 1FW6A 1W4CA 1WQ1R 4TMZA 4PAMA 2RMKA 2YWGA 4HZUB 4L8GA 2XNDD 3KXKA 4A1FA 2QTHA 5H8WA 3NH6A 1IY1A 1UBGA 4Z8YA 4UNSA 4YONB 3R9WA 2J59A 5JI2E 4BEJA 4M8NE 3U4QB 1XMJA 4DLZA 2QI9C 1E9SA 3C41J 1X8JA 3T34A 4JLDA 1HT1E 3FTQA 1G6HA 2R62A 1XMSA 3DVLA 2ZYVX 1N3BA 1FQKA 1I2MA 1TQDA 1DAEA 3DOFA 3PV0A 3FMIA 2DWPA 4NYIR 2JLRA 4Q66C 4A0RA 5KPDA 4PC2A 4BLSA 2ZYWX 4DHEA 3LXXA 4KO8A 4ASUA 4PC3A 2IK8A 5IK2A 3GLIB 3E70C 1AA9A 3JVUA 3UIEA 2R6AA 1KJYA 3O8DA 5G41A 3LNCA 4EAQA 2G1JA 5CK5A 3FDIA 1JR3E 3RSOA 4CZ2A 5L3QB 1VHTA 4M1OA 2O0HA 5FOVA 4EJSA 2C2HA 1MABB 3QXXA 3GLHE 1US8A 2ERXA 3LV8A 1XJ0A 2F43B 2IEYA 3AVWA 5GJWC 1T5LA 2ZJ2A 3WY9A 1UF9A 3A58B 4FMDB 1NY5A 4R9UC 5JCPA 3T35A 4OHWA 4ON9A 1XD2A 3A37A 5AUOB 2EWWA 4MKIA 2G3YA 3LDAA 5CIQA 1W1WA 2VBCA 4V0KA 4RKEA 3SJCA 2VPPA 2O8DA 2A3RA 4LV8B 1GWNA 2O8EB 1LS6A 1ZUHA 2CL7X 1TU3A 4DCNA 1OFTA 2AL7A 4CDGA 4RD0A 1OB5A 4JLBA 1EX6A 4D26A 3KJGA 3IO5A 1CJUC 2A9KA 3FHOA 1ZNZA 2W0SA 2OLKA 1KSJA 2ZRNA 3SYLA 3GJ6A 5AR1A 3V9PA 1K5DA 3QXCA 4XTCS 3EPLA 2LKCA 1KSFX 3M6AA 3TBKA 4A8JB 4BFSA 1QRAA 4DUGD 5ANRB 1G19A 3ZZTA 2ZE5A 3GJ3A 1CBUA 3TQFA 1W0JA 3BE4A 3MAAC 1QG2A 1XTQA 4BECA 2FMXA 1GILA 4M1TA 3GFTA 2IYLD 4EFLA 1G1MA 1NP6A 5D3MA 1E2DA 1WA5A 4WXRA 3E5HA 4NTZA 5HZKA 4IW3B 1Q1ZA 4TMTA 2ORVA 1W46A 5IRCD 5JBQA 2BM0A 4B35A 2ZRGA 1SVKA 1XTKA 3EASA 4P4SA 1E9DA 2CBZA 3I8SA 1GFIA 1GKUB 1VCOA 3K9HA 1AJEA 4ZCMA 1W5TA 1KI3A 3ZIAD 5TDHA 1GITA 5J4HA 3T15A 2Z0MA 3UPUA 3QPWA 3R9IA 3IEVA 3H1TA 3BH7A 3PUYA 1N0VC 4C30A 5B64A 121PA 5CDFA 1KI7A 4X8HA 4DBLC 4BFTA 3KUCA 3EWSA 5KU1A 3TKLA 3U3JA 3LA6A 4DCSA 2JLWA 1RRCA 4KXFB 4PHTA 3TGPA 2X19A 2FEMA 3LLMA 4C2TA 1GL9B 4FW9A 4UXJA 2ZI6A 4EIWA 3MGCA 2A5GA 2IW3A 3D8BA 5BN4A 2W6IA 1DO2A 2OT3B 5FR1A 4OK5A 5L8VA 3OEEA 3D6TB 1GTVA 1XD8A 4LOAA 3H2YA 4TTPA 1N6LA 1P2UA 4WAUA 4Q4JA 4Q1EA 3LWNA 3EIEA 2ZE6A 4BZQA 3Q8XB 1NN1A 4RD1A 1Z5ZA 1EESA 4G01B 3AF2A 1VHLA 1OHHD 3GJ5A 4RFVA 1A2BA 1W44A 3Q5EA 4Z1MA 5GVSA 4A15A 1UFQA 4RFSB 4HAWA 3B7GA 1E0SA 3IO3A 1BMFD 2XSZD 2ZU0C 4JLOA 4Z8XA 2ANCA 3IQXA 3NTUA 2BIFA 4DB2A 1NF3A 2J0UA 3Q9LA 1QHNA 3P20A 4JLNA 1NVVQ 5FPTA 3K0FB 4BFXA 5EXPA 2ZRAA 2E1RA 4AKHA 1FNMA 1OE0A 1EWRA 3VHLB 1IHUA 5FBRB 1OYWA 4YQFA 1GRRA 1WRBA 4JVNA 1MR3F 2QU8A 4W7SA 2KWIA 1Q21A 2DFLA 3KFXA 4Q4HA 5JS8A 4WVFA 5LPNA 2RGCA 4BFVA 3TUJC 3IHLA 2IXGA 5GADl 3U60B 2FNAA 2JIZA 1OLOA 5FOUA 4B76A 2JLQA 1CJTC 2JLVA 1IXRC 1W5SA 4RSGA 1HT2E 2IF2A 2ZEJA 3LX5A 1HEIA 2W58A 3SHWA 1RC8A 3I5YA 1YR6A 3W6OA 3CM0A 2W6JD 3U6KA 2OESA 3AP1A 4MYUA 421PA 3NBFA 1R0XA 2FFHA 4D82A 4MUBA 1OFHA 2D2FA 1GAJA 5CM9C 3U61B 1GNQA 1Q3TA 3CKLA 1HYQA 2QORA 4IDNA 3RS5A 2HCJB 2C03A 4K81B 1AGPA 3ZZUA 3QOFA 1AQUA 1S9HA 4M1SA 2ZVQX 1JBKA 3A6PC 5GJBA 5KDDA 2OCAA 4A2QA 3PVSA 3ZD6A 1CRQA 1Z8FA 3EG5A 3IBGA 4R7ZA 4S35A 3EW9A 5E7IA 3KKOA 1KDOA 5KSPA 1ZCAA 2G1KA 3CZQA 3WHLA 3F8TA 2XNDA 4LV5B 4NL4H 2BOVA 3VKWA 5H70A 2FFBA 3CF0A 4DLUA 2GEVA 3THOA 1E9RA 1G8YA 2WM9B 2C77A 3VAAA 4CT4B 5FL7A 3T1QA 1KZ7B 4ZDWA 2DWQA 3U2QA 4WZAE 4CEJA 1I4DD 4LJAA 4Z54A 4F4JA 1UAAA 1F2TB 4XWOA 1NVXQ 4QNRA 1PVOA 1AZTA 4I81A 2H16A 4P33A 4AYWA 4N0DA 3SS8A 2LCFA 3QKRA 4BFWA 1VG0B 5DI9A 1NN0A 2XJ9A 3CPJB 2JJ2D 2ZE7A 4NCNA 1W4RA 2GAOA 1DOAA 1ZVQA 3THXB 2QM8A 3U5ZB 4IVPA 4LHYA 3M0EA 3TVTA 1LS1A 2Z6VA 4E09A 1ESNA 2GILA 2HF8A 3X1YA 2ZETA 1N5IA 4MH0R 3B1XA 1RE0A 1TU4A 2Q9CA 1D9ZA 3MJRA 4DSNA 4AKGA 4BFZA 1R5OA 1DPFA 2WVJA 4NCJA 2ONKA 3MWYW 4KYIB 3P32A 2JLUA 1JPNA 2ZJAA 3VR1A 4AYXA 2UZ3A 4URZR 2GZAA 3T06B 1SXJA 1ZU4A 3M4YA 3DO6A 3T1OA 4AURA 1R6BX 1Z29A 5C1BA 1KI1A 4LK2A 4OI2A 1XCMA 3BERA 4RD6A 2ZRFA 3KTAA 4OI0A 4F91B 1P5ZB 4GP6A 5JFGA 2IS4A 1M74A 1BS1A 3LW7A 3RS7A 2DYKA 1T0HB 3PENA 1UBEA 4NP6A 3FMOB 1IXSB 3SYKA 2IS1A 2HT1A 1S3GA 5AJXA 3PIRA 2QENA 4A6PA 4KCGA 2IYRA 3RHFA 4E5UA 3C5CA 3W90A 1CXZA 1GUAA 1LV7A 1L7VC 1XTSA 2VF7A 1N6NA 3ZS8A 3KKMA 4BWYA 2FDCA 3CF6R 2NO7A 4DUGA 1Z0AA 3I61A 2JEOA 4AIIA 1S96A 4N1AA 1XEXB 2IS2A 1RRGA 1NIJA 4JZKA 3TE6A 4NHOA 4LBWA 5H1YA 3WP1B 3BFXA 1HV8A 2EW1A 4TLAA 3SN6A 2PT7A 3KQHA 1UEIA 2OBNA 1NKSA 4HLQB 3FFBA 5EP3A 4UXHA 3ZZ0A 3R7WB 2CCJA 4A6XA 1J8MF 4Q1BA 2GHIA 2VF8A 3FWYA 1VECA 4LWZA 5EJEA 2IUTA 2JJ8A 4CRWB 3MMPA 2O8FB 2R6DA 2A5DA 2GK6A 3BXZA 3FVQA 4M1KA 1JJ7A 1E32A 3ZIAA 1Q44A 1IY0A 3HYRA 4DLRA 3AVYA 4L5BA 3HDTA 1CU1A 1CJMA 3UMFA 2O0JA 3LXRA 1KHTA 4YDHB 1ZM7A 5TV2A 4B3DA 1P2VA 1VIYA 1GRQA 3AVOA 3FMPB 4JVSB 3SZRA 5HR5A 2PBRA 3EA5A 4LHVA 5C46F 1O87A 1YKSA 4IDHA 4M53A 2V54A 5B57C 2WTUA 4FWIB 4QRHA 5CYOA 3L8YA 5HCNA 1N5JA 3WNBA 1BOFA 3K9LA 2GCOA 1BIFA 2BDTA 3N5CA 1KGDA 4LHZA 1J7KA 4RD4A 4NBSA 1A82A 3RC3A 5FTNA 1JQJC 5KDOA 2V8OA 3AM1A 1T3LA 5J47A 4HDCA 1OW3B 1AIPA 4DSTA 1P9NA 2ZRMA 3NXSA 2BEKA 2XSZA 2J41A 2XEXA 5D3QA 4O3MA 1P6XA 4OQLA 4Q9IA 2EFHB 2F1HA 4KITB 1XPOA 2DB3A 5SZIA 2W2VA 5FPHA 4QM7A 2WWGA 3UXMA 3WMGA 4QJ3A 1VPLA 2ZIAA 2PZFA 3QVUA 2C9CA 1AM4D 2AX4A 3A1UA 4IEEA 3HU2A 2ZJ8A 1F3OA 2BJWA 4U7DA 3KUDA 2ORIA 4MYTA 5B2ZA 3VR6A 1FZQA 3I73A 3QF4B 2QMEA 2IWRA 3GJ0A 4M4SA 4DDUA 4IKEA 2Z5FA 1NLYA 4ZDIA 2L0XA 3QPUA 2X8AA 4V0LA 2NMVA 3EZ6A 3H84A 2JCSA 4MRVA 1XB2A 1E9CA 4JLJA 1DAKA 2KE5A 1E1RD 4TL6A 1VYVA 5CJ2A 4DEYA 2JLYA 1E2JA 1L4UA 3ND9A 4UNQA 2J1LA 2W6JA 4TLCA 4JLKA 4KYUA 3WBJA 1LFDB 1KJZA 4CYMA 3BH6A 1XFAA 4R71A 4DDTA 1P3JA 1S8FA 4JSYA 4N3NA 5JECA 4UQOA 1OH5A 3UATA 4O2RA 4HB0A 5A5GA 3GPLA 4A36A 2J9RA 5J4KA 4B75A 1UBCA 3BRWD 5EP4A 2WKRA 1E2NA 2O8CB 1U8AA 3EXAA 4E03A 3O8CA 1E2MA 1PJRA 3QXJA 2REXB 3HU1A 3NIBA 4M9XA 2BMFA 4XSGA 2YHSA 3Q3JB 4DXAA 1Z06A 3C7KA 2EWVA 2JA1A 1G17A 3G5UA 4PO1A 4LV6A 2G9NA 3RVBA 2R9VA 3U7EB 4MYHA 1IBRA 2ZUDA 2X2EA 5SZHB 4QOSA 4LYHA 2OLJA 2P67A 3CPHA 3NEYA 1R4AA 5EQTA 2NTYC 1G20E 2G0TA 2QBYA 3A1SA 4MRNA 5JSZB 4LBZA 3ZLJA 2P6RA 3I62A 1N0WA 4ZIRA 1Z0FA 2WMNB 4D6PA 2C9OA 1SVWA 2IA5A 3OHMA 4QBGB 4NE2A 4EPTA 1TUEA 4YXWD 4KBGA 3UANA 1ZW6A 1W49A 3GFOA 4GOXA 1IAQA 3REFA 3U3RA 5LD2C 2RGNC 2CXXA 5DE3A 3PEYA 1W0KD 2CLCX 5JJKA 2P2LA 2H1LA 2ZSBA 2AWNA 2AN9A 5DHAA 2OXCA 4URVR 2VP9A 4E07A 1YZNA 2NG1A 3EARA 2QP3A 3QG1A 4QHTA 2GJKA 4A0FA 1P61B 3X1XA 4F38A 3K0EA 4W5JA 3R8CA 3P26A 3ZVRA 4N0EA 1CRPA 4DT1A 1Z6AA 4HLCA 1Z22A 1TMKA 4Q03A 3WHKA 1KK1A 1T3SA 3QI2A 3RRMA 5HE8A 2ZS7A 3I3SR 4GZMA 3P27A 3V4FA 3WYFA 4YMVA 3U7GA 3I1FA 4QGHA 1G7CA 1JB1A 2ZE8A 4A82A 2W2TA 5KUTA 3FE2A 5C18A 3CRRA 2GKSA 2XGJA 1QF9A 2QUZA 2V4ZA 1YZTA 4WXPA 3W9YA 1GZSA 1DE0A 4C0KA 4M1WA 3NVAA 1R8SA 2W6ID 5CITA 2O5VA 5FFMA 2VSFA 5FBQB 2OAQ1 4UNRA 3Q5DA 1I4TD 1XCPA 3W8NA 3LFUA 4RZ2A 4Q1FA 4AC9A 1Z6XA 1GNPA 5EZ6B 5KYKA 3GLFB 3BBPA 5FUWA 4B74A 2YOGA 4CEIA 1ZC4A 4PPNA 4XWKA 4GBMA 2NO0A 3RYTC 3BD9A 1V5WA 1XPUA 2VSXA 5JRZA 2XZLA 2N1BA 3B1VA 4IDQA 3AF4A 2Q3HA 1Z3IX 1FTSA 4WA7A 1R5NA 5AUQA 2ZRDA 3CRW1 1W4BA 3THYB 3BOSA 4GOKA 5L3SA 3IBYA 4HUQA 4POAA 1X8LA 3PUZA 4PZYA 1KY3A 2D3WA 2YINC 2X77A 1OV4A 3L82B 1OIVA 5F9FA 1U8YA 3QSYA 1G5TA 1M2OB 1G7RA 2C95A 2HF9A 4JS0A 2W83A 4PO9A 1P72A 4NDZA 2JIZD 3DZDA 5BQ5A 1E0AA 2PCJA 3K9NA 4XD7D 3T1TA 1KYIA 4DLXA 2QPOA 2VO1A 3EPJA 1SGWA 2WSSA 2GXQA 4IXMA 2FSGA 2LKDA 1JAHA 3NHAA 1NJFA 3LH5A 1OXXK 3Q72A 4JLPA 2HDNB 4OHYA 4BGDA 4XVRA 2C5LA 2ZSDA 1FOEB 4ITRC 3QPVA 2PJZA 3H0KA 4GNKA 1M7GA 1DG3A 2D62A 2QGZA 2JLXA 4LJ4A 2V3CC 1DEKA 1YZGA 1K6MA 4L15A 3TQCA 2JJ1D 4RCYA 3SNHA 1Z0JA 2FGJA 4JBXA 1EG7A 5F3WB 3CRQA 1UADA 2I1QA 2AD5A 3C14C 3SQWA 2ZVPX 4LJ7A 3A4LA 4EJSB 1WMSA 2QP9X 4Q21A 1US8B 4IXNA 1UKZA 4KODA 5C4GB 1U8ZA 4RD3A 1FX0A 3NC0C 2C99A 2A5YB 2WBLC 2WJGA 4AD8A 2FJUA 1E2PA 2F1IA 2NOAA 2AXPA 1XD2B 3KXLA 3J81k 1ONBA 1EWQA 2IUUA 1N6RA 2R6GA 1UKEA 4XJXA 5KTYA 1MRNA 1Q20A 5FL7D 2QP4A 2HLDD 4PQRA 5AJWA 2QTFA 4Q5IA 4DDVA 2O8DB 2ZRIA 1JJVA 1UJ2A 2W2XA 4EJSC 1XTJA 3W34A 1N2CE 2PT5A 2QQEA 2ZRKA 1DVRA 4PANA 4QFMA 3SR0A 4C7OA 3VR5A 2J7KA 2QZ4A 4UKDA 4OJQA 5LBIA 2IEZA 1HE8B 1YE8A 1EFUA 1RJ9A 1EFHA 2PH1A 3B8HA 2J3EA 1NVWQ 1ESMA 4HYYA 4TL8A 4CT5A 4G5RA 1S1CA 3NBXX 4XTRA 2R8RA 4MRPA 2DR3A 4LBVA 1GOTA 1T5IA 4UNNA 3DPUA 4FMCF 2WJHA 1KKLA 2ZI3A 4A4DA 3N70A 4FD2A 1J8YF 2RHMA 1YRBA 2RGXA 2V6JA 2ZS8A 2ZITA 5D3MB 3VQTA 1W36B 2A5FA 1E1RA 2J0QA 5CM8B 3NDBB 3V00A 1JR6A 1MOZA 3DM9B 1SXJD 4I99A 4P4SB 3KKQA 4NYIQ 4LJ5A 4HUTA 3AV0B 4TLEA 2GJAA 4LRWA 1TUIA 3CPEA 3U6BA 3MLEA 2CHVA 4BRWA 2PZEA 1OH8A 4B44A 1XEWY 4PC6A 4KLNA 5E95A 1W36C 4QGAA 2C96A 2XNSA 4ARZA 2V55B 2GVZC 5FUYA 1M1YE 1W2GA 2ZPTX 2AHOA 4M9QA 2ZRJA 1X1SA 2OE2A 5FTMA 1E2HA 3VR2A 4MGZR 4EPVA 1QHGA 3KQUA 1LY1A 4TYNA 1FUKA 4FWTA 4B3CA 1JXMA 3GLGA 5LB2A 3CIOA 1A5TA 4K8OA 4Q4JB 4BLRA 4NKRA 1D5CA 2Q6TA 2CDNA 1K8RA 1WDTA 4YXWA 2RCNA 2G83A 1JNYA 3VNVA 4KFTA 2HXYA 3D7MA 1W0KA 1ZNWA 2VP0A 1H8HD 5CLQA 1IXZA 2VA8A 4P0TA 1QHIA 2J0UB 3NEJA 1Z6TA 3EZ2A 3BS4A 4JJKA 3EPHA 1S2MA 2NGRA 3RRYA 4KLZA 1TNDA 1VG9B 2W0MA 2FOLA 4V0MA 5KNCA 2XTMA 4RD2A 1T0JB 1ZIOA 2QAGC 1TQ6A 4YDSA 5BWMA 1UEJA 4DLSA 3K70D 1R10A 2QROA 4OK3A 4K46A 3KL4A 4JT2A 4Q4HB 1ZD8A 4LX0A 4TSFD 3ZVLA 1MO5A 2UZIR 1H65A 5JWHA 4KHZA 3UWKA 3ZGXA 1GL6A 4KBFA 5EP2A 4NZYA 3MJHA 4YMWA 3C8UA 1E3MA 2WHXA 4HATA 1U2RA 4V03A 3OF5A 1XWIA 2IXFA 1DO0A 3LBHA 1G5RA 1JR3D 1VCNA 4OK6A 4C0HA 1KO5A 2QAJA 5FTJA 4IVQA 2QAGA 2GXSA 2JGNA 3FFAA 4PO8A 2XTZA 1II0A 5AK0A 2CHGA 3CNNA 1TQ2A 3A4MA 4FCVA 1KZGB 4C4PA 1YHNA 6Q21A 3E2IA 2ZR7A 5EXSA 3HYTA 3QG5A 1UM8A 4JSTA 1N6HA 3VFDA 4B6EA 1HUQA 4PFSA 2NQ2C 4DIDA 1XEFA 3FOZA 1W47A 2JAQA 2H57A 2ERYA 2MSEB 4LY6A 4EQ6A 1SKYB 1NLZA 4GI7A 5HCIA 1ZNXA 3NC1C 4HAYA 4B71A 1K5GA 4NCKA 4C0SA 3QKTA 3WNCA 3C16C 1NJGA 1G7TA 3U44A 3S1AA 5JJIA 3UG7A 2OFWA 2GESA 2RB4A 4M2LA 2GXAA 1JEDA 2AKYA 4XIGS 4A0GA 2NZJA 4TMVA 1ZYUA 4PXAA 1TQ4A 4IJMA 1D2EA 4AKIA 4CEJB 4HDOB 4XD7A 2ATVA 2JATA 2BC9A 2WICA 4B3GA 2BMEA 4B73A 1PUJA 3OE7D 1Z08A 4EKDA 3R8FA 3QKRB 1DG1G 5AWFC 3VU9A 1OH6A 1G4UR 1U90A 1KSGA 1AS2A 2Q9BA 1VMAA 3BC1A 1XXHA 1N25A 3QBTA 4Q01A 4BQSA 3ADDA 2GBLC 1JI0A 3ZVMA 1J99A 2GETA 2VIIA 3KFVA 4M1YA 3OEHD 4CIDA 3SQXA 2P65A 4B3FX 3JVVA 4LBYA 2ODWA 3ZD7A 2JJ1A 1FP7A 2XAUA 2YJTD 2ZSAA 2RGGA 4PZLA 4UJ3A 2AK3A 5P21A 2CJWA 3RRNA 1KO7A 2GTPA 4JLAA 4BZXA 4A2PA 3LBIA 3PITA 3AVQA 1LNZA 1XTIA 4IRUB 1SXJB 4ZI2A 3LLUA 5C4MA 5EE3A 3ZQJA 2IYVA 3B2EA 3VKGA 2GBLA 3SU8A 1RPZA 1GKIA 1YR9A 4TLBA 2GZHA 3KTAB 1P62B 2HT6A 3PUWA 4LUCA 2OCYC 3R20A 5DHFA 1VG8A 4AWXA 3W8RA 1X8KA 2HLDA 4M21A 5FI1B 4EUNA 1F48A 3KQKA 4H1UA 1IM2A 1M34E 5TB5A 3QKUA 1U9IC 2C8VA 1SXJC 3KJIA 4PC7A 3GD7A 2CNWD 2AWOA 5E4FA 2ZI4A 2GK7A 3ASZA 3ZVNA 2IHBA 4JLMA 2EQBA 4BRUA 1P2TA 1BO6A 2YWFA 1I2DA 4AYTA 4DCVA 1VYUA 4ABYA 3LQQA 5EUQB 4EFNA 2KI5A 4L4UA 2ODEA 5CK4A 3GLFE 4MKGA 3TW8B 1KK0A 1N6OA 3HJNA 4Q7JB 5JWOA 2ZI9A 2ZRLA 4ILEA 1DAMA 3PR1A 3VKHA 3ONWA 4MGYR 1KI8A 3SFVA 1O3YA 1Q3HA 3F0TA 1EGAA 2IXEA 5J4VA 2IF0A 2R2AA 4GP7A 2QEQA 1U9IA 3FYHA 4US2R 1YZQA 3A8TA 2OEPA 1JQLB 1XZPA 4TQ9A 5FBLB 1KMHA 1ODFA 5E7MA 4KAXA 4TLDA 4JJZA 1XU4A 1TADA 2RKOA 4AK9A 1RRFA 1GL7A 5J4YA 5KOYA 2PLFA 4B2PA 2J45A 1CR0A 1UDXA 3KX2A 1IONA 3RSLA 1VCIA 2QE7D 4LYAA 3WYGA 4ZI3A 1OFUX 3DDCA 3ASYA 1G64A 3PUVA 4KFSA 1NRJB 3NBYC 1YZLA 3FHCB 2BKUA 5K8UA 2WWHA 1EX7A 4PHGA 2IYWA 4PPGA 3TMKA 3AP2A 4CVNA 5LDDC 3V4RA 1WB9A 4Q9LA 1KAOA 4XVQA 1CS4C 4KV9A 4LC1A 1Q57A 5DI3A 3KQNA 5EZ5A 4Q9HA 3MSXA 1G18A 5DISB 1BH2A 5BXQC 4URWR 2BMDA 3MWJA 1Y3AA 3EWAA 2GCOB 2FSFA 4HB2A 5JHHB 2R44A 3P1JA 3K70C 1WBDA 4TQUS 4MUAA 1XCGB 3OIYA 4M9SA 4DRZA 2V1XA 5FTLA 1D2NA 3PXGA 1KI2A 2J0VA 2ZJZA 1Q1EA 3ADCA 4NYMR 4US0R 4LPSA 1H8HA 3KDSE 3N2EA 2VL7A 4IOMA 4U02A 221PA 2BV3A 3LQRA 4LC0A 3PCRB 2IYYA 4NPHA 3AH8A 2JLSA 3T1VA 3LVQE 4IFBA 2ZR9A 2WSSD 2CHQA 1V43A 2AR7A 4IOKA 2F6RA 2WIAA 4Q7MB 1T4GA 1UBFA 2FE4A 1C1YA 3L0IB 5KPJA 4XWAA 3EZ9A 1OXVA 1OT3A 4OQNA 2BMJA 2HCBA 1L2TA 1YRAA 2GA8A 2OHFA 4TSFA 2FG5A 4ACBA 4ACAA 4BLTA 3CH4B 3DM5A 4QC2A 1KNQA 1SZPA 2VRWA 1SVMA 2Q0HA 4U5XA 4WBSA 1N6KA 2VH5R 3CB4A 1G7SA 1UDWA 3O8BA 2HXSA 2ZI7A 4HAUA 4IDPA 4Q7LA 1J70A 5KO2A 4NU0A 1ZM3A 2DFTA 2GNOA 4PX9A 4LI0A 3X1WA 2OCPA 2EVWX 2VQSA 1QVAA 1E9EA 3OIUA 3CR8A 1JR3A 4TYYA 3PEVA 3DOEA 3NBZC 3NG1A 2GCPA 2DHRA 2XITA 3B9QA 2YYZA 1CEEA 3P4XA 1AKEA 3GLHA 2ATXA 1QHHA 3GLIE 1X86B 2MMCA 3HWSA 4Q1CA 4TMKA 5IDVA 3SOPA 1ZUIA 2PL3A 3JZAA 2IYSA 4B2LA 1TF7A 4D80A 1W48A 1MO6A 1PUIA 2Q3FA 2PMKA 1PLJA 1LW7A 2IUSA 1G16A 3B1YA 3MWKA 4DSOA 1T9HA 1CTQA 1P9WA 4KU4A 4C0JA 1GVNB 4DLWA 1G3RA 2KBEA 2YZ2A 3CLVA 4MGKR 1P75A 2XJ4A 4IEIA 2V7QD 1COWD 3EIHA 2GJ9A 5C2JB 2QBYB 3SBDA 4NCIA 4NH0A 3TK1A 3QEJA 3MD0A 4ZIRB 2ZREA 2FN4A 1QHSA 2J7PD 1DAIA 3RS0A 3UG6A 2VP2A 3I72A 4RY2A 4A0HA 1ETUA 5UKDA 1VKJA 2YC2C 1ZUNB 3LAWA 2A30A 3CH5A 2D7DA 2ZROA 1KI6A 3OE7A 4KFRA 3AP3A 3H86A 2PMDA 1IN8A 4BLPA 1G8HA 5FOWA 4BLQA 4DZZA 3G0HA 4DSUA 1P9RA 1XTRA 1T6NA 3K09A 4G5QA 3B5JA 1E69A 3IDQA 1R7RA 4HAZA 4AY2A 1HA3A 1Z2CA 3ZYCA 3OEHA 2REOA 4JMPA 2ZU6A 4PR0A 4HB4A 4DT1B 5JJLA 4Q19A 3AVPA 2N42A 4KFUA 1FNNA 3UK6A 2IC5A 4QXAA 2ANBA 4FMCB 3TIFA 3AF1A 3BAFA 2WSMA 3GJ8A 1HY3A 2WKPA 5G53C 1KO1A 3F5FA 3ZQ6A 5FUXA 3MWLA 1EXMA 4MITA 5LD2B 4RKFA 4ZV4A 3AF0A 3U7HB 4GMXA 3TR5A 5DLQC 3O8RA 1AQYA 1L4YA 1HQCA 2BBSA 1GM5A 3U3MA 3PEUA 3SDZA 4KVGA 5G3YA 1NSFA 2BWJA 1ZU5A 4JT4A 4PPFA 2CLDX 2PCLA 4F92B 1E96A 3TVDA 4O0MA 4Q9JA 5H68A 2XX3A 3AVTA 2B7CA 2E87A 3A1TA 3IPXA 3ZH9B 1AKYA 3K1JA 4Y0VA 2K5UA 4MKFA 1LF5A 3RC8A 4CEIB 2PJRA 2C78A 3QKSA 2IYXA 5FR2A 4ESVA 1FP6A 4IDOA 1ZP6A 2H7VA 1NN5A 3X1ZA 4MRSA 3CNLA 3QY0A 5DH9A 2ZUCA 2WJVA 3IQWA 4JBWA 2DFNA 2CNWA 3AKYA 3SJBA 3T5DA 5KSZA 2VP5A 1Z6GA 5L3SB 2Q21A 2CVFA 3K0AA 1XMVA 2V6IA 3GCGA 4QJ5A 5IF9A 4MA4A 4HUQB 3WRYC 3VX4A 1KKMA 1E98A 1YZUA 3IEUA 3QF7A 1ZINA 4C0AC 1OSNA 1T8TA 4HZIA 2FSIA 2Y8EA 2B6HA 2Z43A 2YWHA 1S9DA 5FOTA 3EC1A 2B8TA 2Z83A 2ZSEA 5JRJA 3QVVA 4M22A 4NYJR 2B92A 3C4JA 1I4LD 2RHDA 1RRPA 1TPZA 1G6OA 1TEVA 2FPKA 2UVQA 3NKVA 3QE0A 1IN5A 4LDJA 4MKHA 1IOZA 5SZKB 4LPKA 1ZD1A 4LGMA 2IBMA 4FINA 3K8YA 1SKYE 4JKYA 5HKKD 4LHXA 4LYFA 2XOKD 1Z47A 4EPRA 2EFCB 3BB3A 4DCUA 4KSCA 4CEHA 3HP1A 2QE7A 1QBKC 5CB8A 1A1VA 3FMFA 3HPRA 2J46A 2MMGA 1F2UA 1BYIA 1U94A 3LVRE 3EA0A 3TR0A 1DS6A 4ERNA 1B0UA 1P73A 2P6UA 2RH5A 3GEHA 1MO3A 2IYQA 1GKYA 3DMNA 3CONA 2F1JA 2VHTA 5SZJA 3K0SA 3THWA 3KKNA 4URYR 4OI1A 4EPXA 1NN3A 1T3HA 4MDFA 3TJZA 3LRPA 4QL3A 1VIAA 1FX0B 1SVLA 2ZRBA 4BPBA 5KSOA 4Q48A 4LJYA 4B3XA 4H9GA 4L9SA 4OL0A 1II8A 2ZRHA 4DVGA 5JI3E 1OPXA 1C9KA 2P5TB 4AKEA 4DCTA 4QGGA 1OYYA 1KK2A 3RANA 3WP0A 4C3ZA 1FQJA 1IN4A 4C0QC 1ZM9A 3O47A 2XXAA 2KSQA 1FL9A 2Z4SA 3IIJA 4QBIA 4IOJA 3RLFA 4LJ6A 1E2IA 1E2LA 1XRJA 821PA 2V9PA 2NPFA 1E1QD 4C7OB 4E22A 2O8BA 1TTTA 2ZXUA 3BORA 4PSKA 4M1MA 4Q02A 1RKBA 2GJ8A 1U0LA 1RJ9B 5AUPB 4JYCA 1FPMA 4WZBE 1VYTA 2RGBA 3LO5A 1OFIA 521PA 1SVIA 4D0GA 1EK0A 4C9BA 1CR4A 1E9AA 4GZLA 4WZ6A 1R8QA 2VP4A 4B48A 3SEAA 2CCKA 1B23P 1QVRA 4BLOA 4P4UA 4QBFA 1IN6A 3TSOA 3CW2A 5GJVC 1VTKA 1N0UA 3B85A 3KJHA 1FUUA 5FL3A 4EPYA 2FU5C 1E2KA 1VG1A 5TY0A 3AVXA 1TL7C 1KI9A 2PX0A 1ZD9A 4TT3D 1S3SA 4A92A 2GVDC 2FX3A 4OI4A 4RZXA 2F3TA 3KB1A 1OF1A 2H92A 5K8TA 1M7BA 2G77B 2KB0A 3B6EA 2WOOA 4HSEA 3PFIA 1PZNA 2QTVB 3GJ7A 2IT1A 2ZYUX 5JMTA 3HU3A 3WMFA 4ARZB 1SVOA 4H1VA 1CLUA 3GEIA 2F1RA 1XMIA 2D74A 4B2IA 4GDFA 1Z2AA 4M9ZA 1DTSA 2ASEA 2OFOA 2ZRCA 8OHMA 1Q0UA 4B3BA 5AJYA 2V7QA 2CMKA 1Z6YA 1COWA 2C98A 2C9YA 3BFVA 4ZPXA 5E7JA 4US1R 2ZRPA 4LJ9A 4TYQA 3GLGB 1RIFA 2J7PA 3GJXC 4BFUA 1XDBA 3SE0A 5K8LA 4HAVA 3PEWA 3QUSA 5KHOC 1G3UA 2Q9AA 3L43A 4G1UC 3Q7QA 4HEJA 4GOJA 1OJLA 4IFEA 1CJKC 5BYJA 3A1WA 4Q4AA 1CP2A 1G3QA 1ANKA 3BWDD 3QIAA 3E1SA 3EZFA 2YKGA 4FCWA 2ZQ5A 4PZZA 4CF7A 1P7CA 3QQ5A 1KSHA 5DIFA 1WF3A 2O0KA 4G5SA 1E6CA 1YZKA 2YVUA 4C0BA 5M04A 1ZAKA 1HQYE 3W5IA 2BBTA 2ZS9A 3BH0A 5EE0A 1LVGA 2R65A 5FH9A 3CF2A 4XSHA 2AK2A 1DELA 1Y63A 4QGFA 5FTKA 1EFRD 2J0SA 1CULC 1E79D 2GRJA 3IIKA 3KQLA 2H8KA 4TMWA 3WYAA 1FTNA 3RRZA 1TF2A 5KSYA 1U0JA 1WXQA 1M7HA 2VP6A 4JIMA 5HE9A 1ZIPA 2XB2A 3IHWA 1G9XA 1Z07A 1N6IA 2RGDA 3KJEA 4HZUA 1N6PA 2D2EA 4LSGA 1FMLA 2QMUA 4PHFA 1IJFA 1DBSA 3VTKA 1NI3A 2EYUA 3U4QA 4JKIA 1RYFA 2BBWA 5FPSA 4IVRA 5L3RA 5DN6A 2DBYA 3IKJA 5CB6A 1E94E 2VHCA 3KKPA 4V0NA 1TF5A 4XOIA 2QAGB 4YLGA 2ODBA 4J0QA 3TW4A 2WWIA 1KOFA 3M1IA 1H8ED 1X1RA 3B78A 3SC3A 2A7QA 1G41A 2IYTA 1HURA 3RNLA 3VR4A 1OH7A 3L0OA 1ELOA 4NONA 5F9HA 3TUIC 2AFHE 2WWXA 1KAGA 1XZQA 5F98A 4PSAA 2OV2A 5J40A 1PV4A 4FI3C 4RVCA 3GLIA 3TNFA 1E2EA 4NCHA 3Q7PA 3RDPA 4EQ6B 4HB3A 5CLLA 1IQPA 1C4OA 1YR7A 3GJ4A 4S2EA 4Z51A 5KNBA 1Z83A 5L3QA 2QT0A 4Q9KA 2BKEA 3U44B 5EE5B 3S1AB 4DLTA 1RZ3A 2HYDA 3LD9A 4B47A 5DNYB 2ZUBA 1MABA 1LF0A 4P3YA 4OQXA 4Q47A 3WMEA 5K8IA 2GF0A 3Q85A 4HLUC 4JLVA 5FBWB 2HUPA 2KJQA 4ZKEA 2F43A 3KXIA 4A8JC 5A0FA 4TZ0A 5EXXA 5EE1A 4ZDKA 4HDQB 2EYQA 1AZSC 4F7WA 1KDTA 1CJVC 1Z0DA 2GEUA 1W4AA 1AS0A 1KY2A 5HTKA
chains in the Genus database with same CATH superfamily
1YQWA 4G4GA 1PEYA 4BKUA 4BMXA 3CWZA 1C9EA 3QI7A 3N8DA 3FSGA 4O4IA 4CM9D 2HRQA 3RS4A 3T3PB 1OZGA 4LHWA 3OWXA 2XOKA 4GH5A 1DADA 5A2QA 2P77A 4M1QA 3MBKA 5DOZA 1PNTA 1GYQA 4EYQA 5BSEA 5BYKA 4WUVA 1Y4ZA 1KZ9A 2QJOA 2VEDA 2ZCUA 5ESWA 621PA 1HM5A 5DYGA 4GFDA 3ZNPA 4WOKA 1G5QA 5EJ8A 4XRGA 2XD4A 1RXEA 1ZWKA 1ZH2A 3L4SO 1WVGA 4ZOLB 3SI7A 3AHJA 1BKYA 5CFPA 5I51A 1PNVA 3NEAA 1V2HE 2IOHA 1JI3A 3AI2A 4HLUA 4O4JB 5AOBA 3VX3A 2HBRA 4KXWA 5C7LO 2ZGVA 2EAUA 2GJSA 2C7OA 3DLIA 4WEQA 1RI4A 4HO1X 1N8TA 4M1EA 3R4VA 1A2OA 1RKVA 2QT1A 4YP1A 4Z4IA 5BSUA 3RS3A 3CUUA 5DNCA 3PSAA 4IH1A 1JXOA 1F8UA 3PX3A 4F93B 3C4QA 2QQGA 5BWNA 4TL9A 1QBGA 3BQMB 3U9LA 5FPYA 1EDZA 4JP3A 3G59A 3ZGNA 3FHTA 4UEOA 3STHA 3NALA 4TTRA 1JLKA 4LG1A 4PWYA 3WJ7A 3U4DA 2BKAA 2C4TA 4OHZA 5TQVA 2ODNA 4A2CA 1VJRA 4RGQA 4BASA 3FZQA 1UDBA 3VH2A 2VDVE 3AEZA 3IH5A 2HMAA 2WDPA 4R84A 2D4HA 1RXSA 3EOZA 3QUCA 2NIPA 1T8UA 4X8OA 2AJTA 2AZTA 2WM3A 3PC3A 4JJAA 1YR8A 2VTBB 4EFMA 4UOQA 3QU2A 2XZPA 5HDBB 4ZYWA 4DA4A 4EP1A 4D3SA 1E1QA 2F3UA 4F7DA 1A8HA 3C87A 4PQYA 4CKBA 3U5TA 2O2DA 3NB0A 4J4HA 4N18A 5AM1A 1TJPB 1LPNA 4FGLA 5BYBA 4PBTA 3PQ6A 5HUQA 3DLHA 4LFBB 2FLVA 2VHUA 3DOIA 1P5JA 1KQNA 4FX5A 2DLNA 5EWJB 3ZEAA 3O84A 2VXYA 3S1LA 4ZDJA 4HDSA 3NAQA 3HJUA 1R9NA 1UAYA 1EX1A 3I6QA 4O4LA 3IP8A 3F9CA 4HXFB 4Q3EA 5IVIA 1DJNA 4W9NC 1SNYA 2YRXA 4UHBA 2VDRB 3C3BA 1AU9A 2RGAA 4RHTA 1CYEA 4J2HA 1J9GA 2HMTA 4B5LA 2JA2A 5MGBA 4E46A 3P97A 2GWHA 3Q12A 2HQ1A 3EAQA 4IOLA 3FPEA 1CY1A 2DE0X 5A4DA 2RDMA 3OUUA 5IVHA 5KYNA 5CCDA 4KJZA 3HTXA 2QSZA 3Q1LA 1GV1A 3PG5A 2QD1A 1G8MA 4UEKA 3H75A 1M72A 1NBME 3AR3A 2D1QA 3ETLA 2CD7A 1BZYA 2FZ4A 4IWYA 4OYHA 1MRSA 2H1CA 3UAYA 3UGQA 3VU8A 4FU0A 5YASA 1M0SA 4G9BA 4GI1A 5IT5A 2X2FA 1BWSA 1LI5A 3FI0A 3PHJA 4D6XA 5M29A 3HLTA 4CMIA 4C05A 4C0LA 2C0PA 1VL2A 4LXTA 3Q1KA 3HM9A 4L7QA 7MHTA 3A4NA 3FUVA 4FR0A 1RXWA 3BGOS 1NY6A 3I9V1 1T43A 2RSLA 4KXLA 1MJGA 3HR8A 2VSNA 4FGJA 4DMKA 4UFOA 1KEVA 4P0PB 4V2UA 4D4LA 2AVDA 4QULA 1U4NA 1Z8HA 4EBBA 3B13B 3PHBE 4CKWB 5EJMA 5ITSA 2HSGA 2FSHA 4OA8A 2HMWA 4BGIA 4HQ6A 4XM0A 4RS4A 1HTWA 3G9UA 1D1PA 2VK2A 5ALQA 2QA5A 4ER3A 5G40A 2A88A 1JQ5A 2WM2A 3N1UA 1IY2A 1OFGA 2GRAA 3ABIA 3LECA 4G1BA 2IH5A 1PIWA 2HSEA 4GVLA 2GD0A 4PF1A 2ZB3A 5CJPA 5A4JA 4MVCA 3TOSA 2G7MC 1UP6A 1Y1LA 3AM4A 1UODA 3KBBA 1VB5A 5E1OA 1X0VA 4XOUA 4QKQA 5KNDH 2G6BA 3AKDA 1GZDA 1N0HA 1Y0BA 4E5VA 1JLRA 2DERA 3HYLA 2F3SA 4JC5A 3KSBC 1BGVA 2RIPA 4XIIA 2I29A 3MOGA 2H65A 1QLHA 1D4AA 4EENA 1FJGB 1AV6A 1UWLA 1NOKA 3ASVA 3PFFA 2WHPA 2C54A 2R79A 1D2HA 3QUTA 1EFAA 3MWFA 4BVGA 4UNIA 4LF9B 3GLRA 3DT8A 4FIZA 1NKTA 2FZEA 2J85A 2BI8A 1LQ2A 2Q3LA 3FPLA 4KC0A 1CY0A 3T1HB 3WL3A 5TJHA 2J32A 3MINB 1YA8A 1Y33E 4XFDA 2UUPA 2Q3EA 4O4IF 1YQXA 3EYWA 2HBYA 4UNPA 1E77A 2X7XA 4XLTA 4MAFA 3WGIA 3QLTA 1SCUA 1U6JA 1ZJZA 2VNSA 3DAHA 3DV0B 3FKQA 3HN7A 4R3WA 4D0RA 5C34B 5I7SA 4ZV9A 1XZLA 1DIRA 3BXGA 3QHQA 1UK8A 4RTMA 2HF7A 1WMFA 2QRQA 1FMJA 3C74A 2SHKA 3KCQA 4KPGA 1C7RA 4NS4A 5J63A 3T38A 2AZ4A 2DJ5A 1M9NA 1RD4A 1PWXA 3NR2A 3OFND 5KKCA 5LQAA 3MTIA 1YMUA 1QIFA 4MULA 1TA4A 2H11A 2XBLA 4BO8A 1FXSA 2QMOA 5CT4A 3RYHB 4ZGGA 1Q1BA 2PPLA 4I55B 3ORRA 4QHYA 4UZFA 4AWBA 3DNMA 2IV7A 1XZFA 3RS2A 1IUKA 1L7QA 1PYGA 4MS1B 2W98A 1F2TA 2D5BA 3E0QA 1YI1A 1J4AA 3RF6A 2PJUA 1P8AA 3L0DA 2R1TB 5LA6B 1AUQA 4YIHA 3ABOB 4DY6A 5CDSA 5G0TA 1MVLA 1XGKA 4AI6A 4KMRA 1E3WB 1CE8A 2I54A 2MSCB 2C4NA 4C4TA 4DJTA 1DC4A 4JJGA 4EB0A 3DV2A 2RK6A 2P35A 3WIEA 3NTOA 1QLWA 3V8MA 4JB0A 5K7SA 1LDEA 1R5BA 2X6RA 3K0KA 1Q50A 1H1LA 1QIJA 3LYAA 3RAPR 3YASA 5ENVA 1MX3A 2OGUA 1EEXB 5GOZA 3ANMA 3RO7A 3WLTA 5KYTA 1S2OA 5AIAA 1OB2A 3PKIA 2IIBA 1KZ1A 3KZ1E 5E9WA 4HWPA 3JY6A 5B1YA 3GRYA 4QNMA 4BMNA 4OQ4A 3WSTA 4TMXA 4I8IA 1HLPA 1PHPA 4M0FA 5FPKA 4CV1A 1M1YB 3K94A 4I1OA 4GOMD 3UK0A 1T91A 1N2CA 5A3VA 4PN3A 3PTAA 2J48A 2ZK7A 4MJXA 3ZE8A 3RBZA 1GUBA 2FXIA 4PFKA 3RYCB 4UCQA 4Q93A 8LDHA 4UJ5A 1YJXA 3HZOA 3QVSA 2OP1A 5ICGA 3GRRA 1UQUA 1EWTA 3P2YA 3QFFA 2OQ2A 5GJCA 5T64A 3EUAA 2F62A 2OVFA 3CZCA 4V3CA 1ZJ6A 3FNEA 4NYMQ 4O4LF 5G0UA 3NOXA 2EFGA 1LB1B 5E3HA 5BN3A 2MYNA 1V95A 1KJWA 5HSGA 3I05A 4E2FA 4G5GA 1N2HA 4CM9A 1CY4A 4ENSA 2R8PA 2AOUB 3FY4A 2AJ8A 2IYEA 3A05A 4LQCA 4XVUA 5JU6A 3HJFA 1U2EA 1DDIA 2P41A 3OPNA 1XCJA 2JAWA 1ZSYA 4J0CA 3N86A 4QZVA 1QH9A 4FFNA 3TGWA 3QIVA 2IQIA 3TDMA 4QBHA 1DRVA 4D8XA 4HDRB 1I0LA 3QYPA 1VIVA 4B33A 3UFXB 1SQSA 5JEEA 1MRZA 3VSCA 4HN2A 3WGMA 2QX9A 3DKVA 3RVNA 3MCTA 5FF9A 4YUWA 1A4UA 1I4OA 1OXTA 2GN8A 4HFNA 3KE8A 4U63A 3UMSA 1K98A 3UOGA 1QFXA 5ECGC 1YFKA 4BP8A 2DKOA 3TLKA 3K09C 1VHQA 4EDFA 5JXWA 3IP5A 3CYFA 1QS0A 1LBHA 2HV9A 2QYHA 5CBPA 1CZKA 3ITKA 4JBYA 2GEDA 1F7UA 4BIIA 2YYYA 4KVZA 1A7AA 2G88A 5CPBA 1A9YA 5I48A 2XCUA 4RESA 4DJFC 4F2DA 2BEWB 1BHQ1 2UKDA 3OPXA 4XH9B 4CMCA 2C7RA 3KR9A 4PRLA 3T9DA 3PWKA 3EG9B 3MJDA 2VHQA 1ZMBA 5HZHA 4D9HA 4N49A 2ECPA 3FETA 3H1EA 2O8FA 1JAIA 4B32A 2JIPA 2DTEA 1DX6A 2CBXA 5AHRA 5FKJA 4BO0A 2R87A 2JGLA 1YV9A 3BMOA 4Y2SA 4B82A 4BXOB 4IIFA 3OI7A 4EUEA 5FB3A 5BWOA 4XSVA 1Z18A 2FV8A 5JNUA 3I9V6 1UH5A 1J8FA 5IBRA 4BEBA 1MAHA 4ARBA 2OAP1 1PS8A 3ICWA 5H81A 4ASUD 2Y4NA 4REQB 5EXEA 1WBBA 3DQPA 5IK2D 2Q5LA 2ECKA 2ZBDA 3QEMA 1II9A 3R3HA 4GHWA 3Q3GE 3V7NA 1IQUA 2QWXA 5A3QA 4RELA 1PDWA 3R6GA 1IQ0A 1JQAA 2WF5A 3MCAA 3VSDA 3L6RA 1NXTA 1I2ZA 4ME6A 5LIPA 3E81A 3HG7A 3KYDA 4JUBA 1CT9A 5FLKA 3FKJA 1VIMA 4FYYA 5DTJA 3UH0A 3PRHA 3RROA 4I4NA 2VPIA 3PNOA 2NUBA 2VJMB 4B6FA 4QXRA 1DTEA 3LPLA 2CXSA 2JD1A 1ISMA 4KWEA 4EF5A 4F06A 2PRJA 2FK7A 3RIMA 3U3KA 2SCUA 3IAHA 4MCIA 2EEZA 3U17A 3S8MA 2WWYA 3WMRA 2PZGA 2EF0A 3A0RB 4QD3A 4E1AA 3K0CA 1YIDA 4D74A 1FK8A 5JPDA 5KNCH 2HJ9A 3GH3A 4OEHA 4PC1A 5JEDA 4GGPA 1FBNA 1NUUA 3SR3A 4B4WA 4RULA 1ZCBA 2VJCA 3EIUA 1T3TA 2BHRA 1M0TA 4BMSA 1ND6A 2Y0PA 1UKYA 3K9GA 3PPXA 5K0TA 1MORA 2VT7A 3GMSA 4EDHA 5DNAA 1YTLA 5EXTA 1DIHA 3KTDA 1E0JA 1DFGA 2BMWA 2FGKA 3HEAA 4CEHB 1SKQA 3I9FA 2FPMA 4BMOB 2RC6A 5HGXA 2PYIA 1MUUA 1QZ3A 4ID3A 2AEMA 4LXXA 3EEQA 1KERA 3LYHA 5LN1A 4I5IA 3HRHA 1F0PA 1O8CA 1NUTA 3VNRA 5GTDA 3KVVA 1FJ2A 3QKWA 3H5WA 1E7WA 4JI4B 5C3MA 2HH9A 3O73A 1RYHA 2HRRA 3GMTA 4MPJA 2PV7A 4RMIA 4J6EA 4Q00A 4P5EA 4FIDA 4V0SA 4WL0A 1A9OA 1XBTA 1C9NA 3FIUA 3ZLTA 3FCOA 5G3ZA 5HMLA 4Q34A 1PFGA 3OLZA 5EWMA 4DKXA 2ZJBA 1QK3A 1RPTA 1T4CB 2FMUA 3BA6A 4M49A 5DGIA 3ZWPA 4MP3A 1HNZB 1SULA 4U2GA 3QJYA 3H42B 4UFPA 1W36D 4INAA 4KE7A 3TW0A 4W5QA 3H4IA 1FQWA 1RWPA 2DBRA 3H5AA 5LB4A 4YAGA 1TYAE 5J58A 4MV7A 1N5MA 2VJAA 3CBQA 3PF9A 3PX2A 2ZQYA 3AR8A 4BJ3A 1J1UA 1GFWA 1WJGA 2PMCA 3FBWA 5JSHA 1EDOA 3CS3A 5FEMA 2FTKE 2AG5A 3SQMA 5IWAB 5E8RA 2DM6A 5F7JA 4F71A 2UAGA 3U4MA 1QH1B 5KQMA 1E2FA 1XP8A 1AK2A 4LXUA 2H4ZA 3QNWA 2VYFA 1XR3A 1Q92A 1X7ZB 4ETWA 5K6TA 2GF9A 2HCFA 2PMEA 1ODCA 1NV9A 4M37A 1X6VA 3UAGA 2JZCA 1ZWLA 3TRHA 3ZDQA 1L7MA 1XF1A 5J5VA 4BU1A 5LUAA 1TJYA 1TZMA 2R8EA 3N53A 2WNSA 4OBEA 3VHXA 2O8CA 3L9WA 2GCNA 2BFWA 2W6PA 3AQ4A 5KX5B 1Y1RA 2XVMA 2VSOA 3ZWKA 4F2PA 2BY4A 1F17A 2VTKA 2WWWA 1S0UA 1PFWA 2OG2A 4FYKA 2P4EA 4DBZA 3ZU4A 4OGKA 5TR9A 1RW4A 1WS6A 4FN5A 4C21A 1TCBA 2CXNA 3ZNOA 3G5AA 1YZFA 3OFNA 3QPDA 2JVJA 1SJ9A 1YOVB 2CGEA 3OEED 4A3SA 5EC8A 3W6NA 2GPBA 2JGIA 1K66A 4U2CA 3NHJA 3PUXA 4B85A 4LCBA 1LJUA 4NYJQ 2JH9A 4JROA 2RAVA 5FI0B 1DXQA 4L4XA 1X8XA 1QH0A 2FWBA 2WF8A 3IKMB 4K28A 4MA5A 3MERA 3K05A 3MWEB 4ZZ0A 2AFIA 3RK1A 1RQLA 2QTRA 1W85B 3EIQA 4Y9SA 5DKFA 4DEXA 1DKMA 1TI7A 2ZUVA 4Q1AA 1XLTA 2ACWA 4QJ4A 2C5HA 4UEJA 1EM8B 3IIIA 5LU9A 3REGA 5DRTA 4ER0A 1KIMA 4DYDA 2H8GA 5KYYA 2QRGA 4BQIA 3QU5A 3P9QA 4AW9A 5AJZA 2GXUA 5IN5A 3W79A 1JLLB 1LCIA 2X0EA 1SUWA 3N2KB 2QUBA 1U9CA 3GEPA 1XZKA 3S2GA 1TVKB 3LY5A 1YQTA 4O4HA 4AJHA 4D8WA 4MV5A 1PV1A 1VJ0A 1E0KA 4X3OA 3INTA 1AS3A 1SXJE 2CXPA 4DWJA 5BPHA 4TRRA 3HRIA 3DBRA 4L50A 3GR6A 3LA8A 2HRCA 2FN3A 4ND8A 4M0UA 5ECYA 5AUNB 1WVIA 1ONSA 2VUUA 4HPWA 5CLGA 1JA1A 3TYXA 1OWOA 5A9TA 3MT7A 2ISQA 2XI4A 1XRNA 5EKXA 1G2OA 3TSZA 1Z5GA 2Z09A 4WY2A 2AD1A 3B3FA 3CUYA 5LDGA 4D3FA 3ETGA 1WHTA 1A4RA 1VKOA 2FF7A 2CSUA 5LNK1 1P2BA 1HE2A 4QDTA 1NOIA 1TAGA 4G9EA 1GZ6A 4J4BA 1K2VN 2WHEA 5CJJA 4HRYA 1WW2A 4FC6A 1KDPA 3OQIB 1YQUA 3Q0IA 4MVJG 5AW5A 5TT0A 2QNRA 2IV2X 1AN0A 1GXSA 5K6AC 3ECCA 4QTUB 4FM9A 1BRMA 1C0LA 4GS5A 4ZK2A 2OLEA 1FSPA 2YHIA 4FE3A 4WOPA 5THXA 3D5EA 3UWPA 5AI9A 2HEIA 2ZWOA 3ETNA 1NIPA 3IL2A 1ONOA 3ZHZA 3GVXA 4JITA 2IWHA 3PLRA 1BNCA 3OPYI 2CLLB 3IR5A 4M6WA 4Q3BA 4TWZA 1VSVA 3LUKA 2Q1XA 4TQAA 2YOFA 3B9PA 5FD8A 4GXQA 1MXFA 1TA9A 1SUBA 1X7XA 2IIQA 3PGLA 4HPXB 2I3BA 2GA9A 1CSEE 4QDJA 4XGQA 5DN9A 1X74A 5F1KA 5F2EA 3SYMA 2B3TA 1C9DB 5LWQA 2X4DA 3G79A 1ST2A 2F9LA 2G36A 2VOEA 1WQ1R 1Y7LA 3AW8A 4PAMA 3CSUA 3UF0A 1J25A 4EKYA 1U63A 2XNDD 2C0CA 2QTHA 3OC6A 3S28A 1X87A 1WMDA 5ARDA 3UK7A 4M54A 4N54A 5JI2E 5SYAA 2XWPA 4BL5A 4OM8A 2H2WA 5DBOA 1P2GA 3D6JA 3SYTA 4M8NE 5L40A 4HDAA 3LL4A 4LNHA 2QI9C 1EXNA 1EGHA 2P2CA 1J1ZA 3G49A 3U09A 3C41J 5DOVA 2A3NA 1SUSA 1HT1E 1NW9B 4L8WB 4KW7A 4JC8A 5D7BA 3L01A 3HCNA 3BFPA 4AO7A 3BQNB 5CNMA 1I2MA 3QE2A 1DAEA 4CDMA 5KYWA 2VZ9A 3RM3A 3TQQA 4A0RA 1QRDA 1TM1E 3ZTYA 2QZPA 3VV2A 4ZQHA 3MIIA 3O3NB 3VPHA 5LQMA 2QKYA 3ZCQA 3WGGA 3OIDA 2CLFB 3IELA 3AWDA 4ASUA 5KTNA 3DLPX 4WCFB 2P4QA 2IK8A 3DXZA 5IK2A 3JVUA 3LYUA 3UMGA 2J08A 3HKEA 3IUPA 3NJ4A 2OXFA 2R6AA 1UJ4A 4GLBA 4FZJA 3H8JA 2EC5A 3MS2A 4IGIA 5CK5A 2PANA 2DT8A 3O2SB 4IQFA 1X14A 3COVA 4AQDA 4E5SA 3ROGA 2V59A 1T5TA 5LVAA 2DY0A 2O0HA 3IUQA 1PJ3A 4QTTB 3ZGOA 4RDXA 2X86A 1D1SA 2XCLA 3HVUA 3PHHA 3QXXA 3UK1A 1US8A 4BVAA 1QYRA 3LV8A 4JC4A 1UMBB 4Y9UA 1RKXA 3HB1A 1RI3A 5GJWC 4KPUB 4JI3B 3VU0A 1Z73A 4OHWA 1SUCA 3NETA 3WSVA 2XKKA 1JZQA 1D6MA 2EWWA 4CLRA 4ZQBA 4YRFA 1EQ2A 3IJPA 4XUDA 1J21A 1RCFA 4NE7A 1Q6ZA 4V0KA 5AOAA 3CTPA 1MTOA 4ETNA 1PT7A 3A9CA 3L4JA 1B8OA 4LV8B 2AI1A 4QELA 2VDUE 1LS6A 1XQ1A 1ZUHA 2CL7X 2O8EB 1U7OA 3S8YA 1ABEA 4CF4A 3DE7X 3LHSA 3T7TA 2CUKA 2HA6A 2BFEA 3KHSA 3NFYA 3UHFA 2W0SA 3MBIA 2ZRNA 3L8FA 3SYLA 1JZTA 4IRXA 4M7PA 3FA2A 4YHHB 4XTCS 3CLHA 1KSFX 5JD4A 4N03A 2DC1A 4ISCA 3CNQS 3EOAI 1WCIA 2EZ9A 3TBKA 1QRAA 4A8JB 3G02A 3I23A 4DUGD 5DLYA 4LE1A 5AHOA 3ZE2B 3DQZA 5HJ2A 2HIHA 3JZDA 4BFCA 5A9SA 5AKYA 4Y6PA 1QG2A 2D59A 1XKTA 3OMXA 2WJPA 5F73A 4M1TA 3ZKWA 3W5DA 2G5TA 3WYNA 4ZJYA 4HDNA 4O4HF 3HS3A 1G1MA 2TSYB 1JIXA 1NURA 4MLZA 3A9SA 1QE3A 1KQPA 4IM7A 1WA5A 4WY8A 4WXRA 3NANA 3WA6A 2Z5GA 4NTZA 5EUBA 4UM9B 5HZKA 4YRDA 5BSGA 4TMTA 5IRCD 3T8YA 5EZYA 4B35A 5J9FA 5IAEA 3AIOA 1XTKA 3EASA 5DTIA 5ILOA 1GKUB 3N59A 5ESXA 5BQ3A 2WVAA 4MUXA 2OVBA 3ZIAD 5TDHA 1GITA 3AO0B 4ZEMA 3UPUA 3QPWA 1CUHA 3IEVA 3UV3A 3H1TA 4GUAA 2P4HX 5B64A 121PA 3WOVA 3VR6H 1AB5A 2BMVA 5KYKA 1PN3A 3KUCA 4QODA 5CVEA 1GPH1 1Q16A 1VHDA 3EWSA 3LHDA 3TKLA 3W3AD 4DCSA 1EVQA 1NBAA 1BVYF 2K87A 4KXFB 4PHTA 1RRCA 3LLMA 2FEMA 2WM8A 3AR5A 1O08A 4RZQA 3W5AA 4C2TA 5GGYA 2F67A 3HBJA 4ZU3A 1B3BA 1V35A 3JWGA 3F4LA 4FONA 2A5GA 2IW3A 3T4UA 5KMGB 4RK6A 5JZOA 1DO2A 4RENA 3CSSA 3OEEA 5ISMA 4Q1VA 1GTVA 1YE3A 4WAUA 4LW8A 2W4MA 2P75A 3BEDA 2JFUA 5LNK6 1UDRA 1RYNA 2QLBA 4CUJA 2BZ1A 3NHFA 3N8KA 3R9XB 4S0XA 3CF4G 3AF2A 4Y7DA 3SDSA 2ISCA 1W44A 3WWDA 1POXA 3KKLA 4FBGA 2Q7OE 2Q29A 3M89A 4RFSB 1RJWA 3B8EA 3DHVA 5HA5A 4EVSA 4HH0A 2J31A 1WKVA 1BMFD 2A57A 4TVKA 3N8GA 1XHEA 4BMVA 2J0UA 4HHEA 1QHNA 1J2TA 5FPTA 4Z3DA 4OXRA 3GCWA 3K0FB 3VPGA 5K05A 2CDCA 3BJEA 1R6XA 1PFVA 2E1RA 3U81A 2OHJA 2OYSA 4AKHA 3PNLA 4IO1A 3Q4GA 4KR0A 1HFKA 4R1QA 4Z9BA 1HDIA 4Q4CA 1E1DA 1CHNA 1ZSVA 2ARKA 2GRUA 4JELA 4P98A 4YN3A 4ZN6A 5LSAA 4ECAA 4PNHA 5ALKA 1AE1A 3FAKA 3C3PA 1MR3F 1LV8A 1C3EA 1RHJA 2QU8A 4Q4HA 3KFXA 3NC4A 4G0ZA 3LM8A 1H3EA 4G5YA 1IC6A 4EW3A 2Y0BA 4BFVA 3O4GA 3IHLA 4D3DA 1R0CA 3DVAB 5GZ1A 5DP1A 1OLOA 1BHJA 2AFRA 2B83A 4RSGA 1W87A 1HT2E 5A7FA 3S7TA 1UM9B 2YS6A 4BP9A 1YR6A 5MN4A 3CM0A 1LJLA 2Q5QA 4M8LA 4RIGA 2FF5A 3U6KA 2OESA 1YE5A 3AP1A 2DX7A 421PA 4ED9A 1R0XA 1DCMA 2AQ8A 3TTSA 2UDPA 2O2XA 3CUSA 2GBPA 4OO3A 1OFHA 2FPIA 1GAJA 2M6LA 5CM9C 5HIMA 2CLHB 1Q3TA 4TXHA 4OIFA 5K8CA 5BSWA 3RS5A 4NJEB 3WB2A 4XCXA 1Y9DA 4X60A 4PBSA 5ICFA 4KIWA 2C03A 2JS7A 2PWYA 3DXXA 3ONEA 3I64A 2MDTA 3QOFA 4D56A 5HM6A 1AQUA 1XRSB 3A6PC 3GOQA 3OZGA 2ZYGA 3R0ZA 1QIEA 2BCEA 4ZVMA 2PZKA 1HFWA 3F1KA 4F3YA 1NE7A 2VDQB 3DT9A 5E7IA 4R40A 2H9AA 1ZCAA 5IU6A 1JQEA 2FMTA 4OQQA 2IUFA 3PPWA 4CL2A 3SHVA 4EY7A 5NLLA 2XQFA 3IXLA 4GOOD 4IL5A 4IIJA 1T36A 2XNDA 1TIBA 3FW1A 4YI5A 4NL4H 1I3KA 5AW4A 4EZEA 3ZW8A 3UJAA 3FUUA 5AKXA 5KHLB 5JO0A 4CT4B 2YASA 1OMOA 2QDKA 4PX5A 1IHYA 2FSPA 4AX8A 3DKRA 1XA4A 3BRQA 3ZK7A 4HWGA 1C3OB 4KK3A 5ULLA 3ETCA 5CTAA 5EL0A 4I81A 2IDKA 2WLSA 4NBVA 2HREA 1I4EB 1SC9A 1RABA 4AYWA 1G5IA 5BQFA 4C7JA 4LXYA 3A3OA 4BB6A 1VG0B 3GT4A 3VYTB 4MV8A 1HWYA 1NN0A 3OA0A 1EUCA 1CZHA 3D0OA 3CPJB 5EZYF 1FSZA 5KJ1A 1QRSA 3LX4A 2ZYHA 2TRSB 2H9YA 1VXOA 2HLPA 1C7JA 3IT0A 3GAFA 3K20A 1ZVQA 3THXB 5IT9A 4EGQA 3U5ZB 1DXYA 2G7ZA 3RQSA 2YUIA 2Z6VA 4BBAA 2P3QA 5EZSA 1DC3A 3HUDA 4WNAB 3ROQA 3D9QX 2WZCA 2GSWA 1VLVA 2HF8A 4Y2PA 1N5IA 2HNKA 3B1XA 3MJRA 3REOA 1ZJJA 4A91A 3GV0A 4GPAA 3K32A 5EGNA 3VZDA 3MM4A 4RWEA 5FP0A 1ZK1A 4NCJA 4KYIB 1ZGHA 4FQ5A 2ZJAA 2KLHA 2BDEA 5FO0A 4HOYA 3T06B 1TKBA 4PLPA 2NVUA 2I7VA 3NI2A 3Q3VA 5FLXA 3O4FA 3O74A 4QUBA 1A98A 1K3UB 5ARCA 2ZRFA 4RNDB 5JAMA 3NBMA 5HIJA 1P5ZB 4GP6A 4MWOA 4E5DA 4EO4A 4ZHSA 1GQ2A 3LW7A 1KC1A 3VYRB 2QDXA 3PENA 3B5IA 4W9RA 4AZ3B 2VQFB 3WLPA 3GMIA 2XGGA 3AUUA 1L3BA 5MN6A 1E64A 1E4OA 1MOSA 4G5HA 4GP9A 4RTPA 1UC8A 4GZ6A 3ILXA 4YJ2A 1L4KA 3RHFA 3W5CA 3C5CA 5LBUA 3I04A 5KNDD 3QM1A 4DV4B 1JTFA 1L7VC 3FDZA 1PWEA 3OE4A 2VF7A 5SY9A 2QJTA 3IP6A 4BWYA 2Z3VA 4ZCSA 4DUGA 3L7NA 4Q16A 1D7OA 4G07A 4CFSA 2W2KA 5IAOA 3BTOA 3LI2A 3TLAA 4JU9A 2E5WA 2IS2A 1CUVA 2WLTA 2RHHA 3IHKA 1L7AA 2IUYA 4NHOA 3ANNA 1AQJA 5K3EA 4NJOA 2R1VB 2NXWA 4BV2A 4MUNA 4TLAA 5K3SA 3SN6A 5CPFA 1LX6A 3O03A 1A8IA 1RVV1 3M6VA 4E0BA 2QV7A 3ICOA 1TZCA 2C92A 4JFRA 4UXHA 1JHOA 3UAOA 4YRSA 2FHPA 2JGEA 4OY3A 4ALMA 2PSFA 4C87A 3JRWA 2QM3A 2IUTA 2XMCA 4ZJUA 2Y9PB 1R4MB 3IAFA 1PJZA 1U7UA 4QEDA 5NULA 3QFSA 1I32A 1X9HA 4PG7A 4BX9A 3ZIAA 2HO5A 3EGEA 3HYRA 3K2EA 3PWZA 3E61A 1H4QA 3HDTA 3AVYA 1CU1A 3PJFA 1RHMA 3UMFA 1EFLA 1XTTA 1XDZA 2O0JA 4DAOA 3WKCA 1V5GA 4GBED 4CCWA 3RRJA 4UPEA 3GZ4A 1EXWA 1QXSA 5TV2A 2I2BA 1P2VA 1PL8A 2ZB7A 5HKLA 1VIYA 3AVOA 4G0PA 4B3DA 3SZRA 3WDLA 5FV7A 1SC3A 3EGWA 1O87A 3K1AB 2QJFA 1EJ2A 2PO7A 2VC2B 2WTUA 1CQJB 1JEYA 5CYOA 1KYWA 3L8YA 1C9YA 4CKZA 1Z5WA 3AUFA 1RYMA 4TV9A 5ILQA 5ITVA 4RMHA 3IT3A 3VYWA 1B8PA 1BOFA 1UZUA 2CLKB 2NT3A 2ZDQA 4P82A 1GZ5A 2E4ZA 2Z57A 1M1XB 4LHZA 4B6QA 4NBSA 4MKXA 3WLIA 5FTNA 2IHTA 1JQJC 4X1YB 1NGSA 3EVFA 5DXAA 5KDOA 4HSGA 1Y8QA 1SMKA 2V8OA 4LE0A 4IIJF 4QUIA 1K88A 2X8WA 2GCEA 2R8YA 5K2OA 5K0SA 3FDXA 3N6RA 4GYYA 1HGXA 1P9NA 2G9ZA 2ZRMA 3EHDA 1XZDA 5IMSA 5K20A 1QORA 2PT6A 1P6XA 3L6CA 3BMCB 4YRZA 1BD3A 1GZ7A 1PJSA 2F1HA 5HZMA 1NF2A 3K2QA 2DB3A 2W2VA 3B9BA 2NAPA 2OQRA 3FSEA 5IJ9B 1EHIA 3WMGA 1PTJC 4OAPA 2OORC 4XZ3A 2RIRA 1UMDA 2P1ZA 3QVUA 4ZTBA 2C9CA 3JAKA 1C7ZA 1H85A 2GPSA 5TPZD 5HQTA 3GRZA 2ALJA 3HU2A 2PSEA 4N6OA 3EXIA 4OXNA 3QW4B 3NCHA 3VHRA 2XHEA 4FT4A 1JDTA 2VRNA 4AECA 2V6FA 2HRZA 4J1NA 4B6OA 5I7EA 2CUTA 2LCIA 3AR4A 1SUDA 3TIIA 1D1TA 3QF4B 3D8NA 3P2IA 1G5FA 4DDUA 4ZDIA 1NLYA 3C5WP 2WF9A 3PRYA 5BN5B 5BPFA 3QPUA 1ZI6A 2I4LA 1K89A 4RORA 2YJ3A 2GEFA 3PZRA 3D3JA 2P7IA 4Z0NA 1KWGA 1LK5A 4G8CA 4LZLA 3R1IA 4PLVA 5T57A 4TL6A 4DRYA 2WFMA 5C5CA 2QW0X 1X2EA 5A9RA 1K0FA 5JO9A 4TLCA 1U2PA 2PGDA 4JLKA 1LFDB 2PSDA 3WBJA 4OAQA 1H2WA 3AUJB 4CYMA 1OASA 4JSYA 1KMIY 3EQ6A 4N3NA 5JECA 5LZ2A 3ZGZA 2MWMA 1ULBA 1T25A 2MSNA 4Q3LA 5IULC 1SUFA 4LC9A 1GAWA 3I09A 4RLFA 4CIXA 2I7TA 1S3FA 1N1MA 5D3ZA 1UBCA 1RHQA 4JUIA 3ZCVA 1QP7A 2HPVA 1ZI8A 1P1BA 3ND7A 5L95A 4KQIA 1K8XB 5T4FA 1VGVA 3QE9Y 3RS8A 1V6SA 1HORA 4J76A 1QJ4A 1PJRA 3QXJA 1ISRA 4FN4A 1FIUA 2KPOA 3T3HA 3O1JC 3W1EA 2JA1A 4YJ2F 1WIWA 5BP7A 2JAOA 1YRHA 1ZN7A 2ZUDA 3WWCA 4NULA 1U3FA 3WBFA 4M1ZA 4R5MA 3WLMA 2WFAA 4AF7A 1OAOA 1XYGA 3NEYA 1E5DA 2QUKA 4J6FA 3DHEA 1Q77A 2G0TA 4NH4A 4ZO6A 5EQTA 3BZWA 4F9FA 1MT3A 1MC1A 1U1DA 4D6PA 2QZJA 2C9OA 1XVUA 5J2TB 3T7IA 3UWMA 2R5WA 4DN6A 1YS9A 3EWNA 3OT4A 4QBGB 1AHIA 3DEIA 2I03A 3K8OE 4XYLA 4Q82A 1ZW6A 4GOXA 4U2BA 3REFA 4KRGA 3MCZA 3QPBA 3GUUA 1NWCA 2BEVA 2CLCX 4AICA 2Q1YA 4K5QA 3AEUA 2ZSBA 4QLOA 2ZG6A 3AILA 4E5KA 3KSZO 5DHAA 5JJBA 3TX2A 2DGDA 2FEAA 2P9QA 4E07A 1W73A 1W1UA 1D4ZA 1XAIA 1VL0A 2QMQA 3AR7A 1E3TA 1H0SA 4D9KA 4QHTA 1HX7A 1B8VA 4A0FA 3IPLA 3OKFA 2FXVA 3X1XA 1Y34E 2FK8A 4FDVA 4NEGA 3PXXA 4PIPA 5JCOC 3ZVRA 1CRPA 1Y3HA 5KNCD 2R1UA 2VNHA 4AJEA 4HLCA 4P7GA 1TMKA 2YWJA 1KK1A 1P81A 4ZJZA 4E2WA 4E30A 3U7GA 2O6HA 1EE9A 4QGHA 4TS4A 2W2TA 3FE2A 5KVAA 4NFSA 4IIDA 3RHSA 3TF5A 2PUFA 1QF9A 3PDUA 4Q7EA 3E9MA 4WXPA 1G63A 2B34A 3U0BA 1Y98A 1AGYA 1DE0A 1GZSA 3HZRA 4C0KA 3NVAA 1ESEA 4TV9F 1SUIA 3LZDA 4B9EA 2YHBA 5LJLA 4J16C 5FFMA 2OAQ1 4P2BA 4FSHA 1XCPA 3CLRC 3QVXA 1VBMA 4K6CA 4Q1FA 2X0FA 1V3QE 3E48A 1Z88A 4I55F 1JIUA 3T5AA 4B74A 2Z95A 3O2QB 1ZC4A 4M3NA 4PPNA 4XWKA 4GBMA 3J80A 2GKGA 2DPMA 2WFLA 4BNYA 1TC2A 5HP4A 1N2OA 3DE6X 4FE4A 3UJ9A 5AIBA 4UBLA 2QRVA 3F5MA 5HQ3A 1HT0A 4QO7A 5JRZA 2V7GA 4W5OA 3GBVA 1EB9A 4ZRDA 4IDQA 3GJYA 1K8YB 4AB1A 3UXHA 4H4DA 3WZLA 1FTSA 2IPOA 3FD8A 2ZRDA 2LVBA 1W4BA 3JQ7B 1V8BA 1XRLA 3CX3A 2CLOB 4GOKA 3THYB 2ZOSA 5CA1B 2Y1GA 1TJ3A 2NNWB 2ZIXB 4U8HA 2VT6A 3VDNB 4HUQA 1UXJA 1N4AA 2Z04A 3CO0S 1KY3A 1IVYA 3ZJ5A 4HXYA 1AKVA 5K1ZA 3MJCA 3L82B 1BX1A 4BWFB 1BDMA 5F9FA 1KFCB 4R9VA 4D2IA 4LDAA 1HQDA 1M2OB 5GM2A 1SIBE 1JFLA 1AVTA 2W83A 3ENVA 4NAUA 2W48A 4NDZA 4ND5A 4LF6B 5BQ5A 1JHUA 5E4JA 3ZN2A 1E0AA 5F52A 4KMSA 3K9NA 3WICA 4XD7D 2C4WA 4YUXA 5HS4A 2OENG 3O94A 5C7YA 4JIGA 2DXIA 4DLXA 3E1KA 4OHBA 3WKAA 2GHTA 2E2WA 2FUEA 3GZNB 3N0TA 5J23A 1G21A 1BMQA 2ECOA 5T4HA 2GXQA 2FSGA 2XH8A 1JAHA 3H2BA 4JLPA 3ETDA 4WZAA 3U48A 2OM6A 4DIOA 3BIOA 1YBMA 16PKA 4EUHA 4CM6A 4BGDA 4NOLA 2AOWA 5JALA 4XVRA 4WXHA 2WDZA 5FYQA 3U0VA 1KY4A 1MB3A 1A5ZA 2IZOA 1M7GA