3LY5A

Ddx18 dead-domain
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
216
structure length
211
Chain Sequence
b'TGAFEDTSFLVNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVELIVKLRFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLGNGINIIVATPGRLLDHMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTRRQTMLFSATQTRKVEDLARISLKKEPLYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-dependent RNA helicase DDX18
publication title Comparative Structural Analysis of Human DEAD-Box RNA Helicases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 69
structure length 211
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2010-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ly5A00
3QY0A 2OILA 1DAIA 3X1DA 1RYHA 3QKTA 5FI1B 3SI7A 3VR4A 1KY2A 2J5XA 1CBUA 1Q20A 421PA 2CE7A 4YXWD 1E9SA 3CM0A 1X8KA 2RGCA 5FPSA 1U90A 5SZJA 2QE7A 2DWQA 1E1RA 3W3AA 1FMJA 3C4JA 4POAA 1E0AA 1E0KA 2WIBA 4OJKA 2HLDD 4LYHA 3AV0B 3DM9B 2WKQA 2R62A 3SHWA 1W36C 3VX3A 4EJSB 1KO8A 2FJUA 3TJZA 4KO8A 3K0SA 4A6XA 1JR3E 2F1JA 2JCSA 2ZRCA 4J0QA 1U2RA 2QE7D 4GSYA 4DZZA 4P4UA 4QC2A 4IW3B 3B1ZA 4PAMA 5FI0B 3VU9A 4LJ9A 4P31A 1YJ5A 4B32A 2OFXA 3OIVA 4RKFA 2ZYUX 4TLAA 3TNFA 3W5IA 1FUUA 1Q1QA 1Z6YA 3GPLA 2CLSA 3ZVLA 5FTNA 3CRRA 1VG1A 3KJHA 2FX3A 5TARA 1XPUA 1LS6A 2BC9A 3BE4A 1JEDA 3FFAA 3I73A 1Y63A 4B43A 1T9HA 4PC7A 3ZVRA 3TAUA 4A0HA 1G3RA 1XD2B 4KSBA 2GCPA 4LBVA 2QZ4A 5F2EA 2XXAB 1YZKA 3W8RA 1NJFA 621PA 2ZU6A 4LV6A 2IS2A 1U81A 2A5FA 2XB4A 4JJKA 1T3HA 3QUSA 4GMDA 4B2IA 4B44A 2WJJA 3KKOA 2W00A 2NIPA 3QVVA 1LNZA 4Q18A 1RRGA 4OHWA 3TK1A 1BMFD 4Q4HA 4RCZA 1DOAA 1KY3A 2VHUA 5JS7A 1X1RA 1VTKA 3K0EA 4JVMA 2MSDB 5DN6D 3NBXX 2PCLA 2ZE5A 1Z0AA 2C9YA 3SQWA 2WJHA 4URYR 4DB4A 4AIIA 2VF8A 4RD1A 4EJSA 4IRUB 2FSHA 1P2TA 2OFWA 2OCYC 2IK8A 3GD7A 4Q4AB 5JZVA 2PMDA 1KI2A 4Z1MD 1KK3A 4Q7JB 3RABA 1CTQA 2XZPA 1DE0A 5JWOA 4C0LA 4MH0R 1Z47A 2P6NA 2GZDA 1B0UA 1KDPA 2C9OA 3B1YA 3AGPA 1EXMA 3AUYA 2QTFA 3G82C 1Z0FA 3QQ5A 1P9NA 2EFDB 4D26A 2CMKA 4LJAA 4HB3A 5KDDA 1IHUA 4EPRA 3PUWA 4II7A 4LHYA 3L8ZA 5E7JA 3KFXA 3FKSD 2QN6A 4CRWB 4WBSA 2KJQA 2QAGB 4TQAA 4LYFA 3CIOA 4OL0A 2XXAA 1PVOA 1ZC3A 1DAEA 3U6KA 3EX7C 5JLJA 1TMKA 4D80A 1RJ9A 1UBGA 4DRZA 1G6OA 3GLFB 3OIWA 4FMCF 2DFKB 2QQEA 4DSOA 2AKAB 2V6JA 2VTKA 4CVNA 1RFLA 3KKMA 1KGDA 1JAHA 3BS4A 3OIUA 4IJMA 4JT4A 5CM9C 5FPHA 3UG7A 4C2TA 3IIMA 2GAAA 3Q72A 3T5GA 3IO3A 1P62B 2D3WA 2H17A 1M7GA 3REGA 4NHOA 4HLCA 4BWYA 1WXQA 2GAOA 4ESHA 4UQOA 4FCWA 5LBIA 1EX7A 4KU4A 3D6TB 1NN1A 2C77A 4EJSC 2QT1A 5L3RA 4URXR 1CR2A 4KSCA 3VR5A 2A5JA 4FWTA 3EC2A 3RSOA 1CP2A 2GVZC 1HURA 3VR1A 2VP9A 1KJZA 2A5DA 3HPQA 4LHZA 1DG1G 1D9ZA 1W44A 1GIAA 1Z0JA 4ZO4A 3TQCA 3AF3A 2CVFA 1Z3IX 3L0SA 4KLNA 2AWNA 3NG1A 2WHXA 5AUNB 1ZUHA 1E2MA 3GMTA 3Q85A 4Q4AA 1KI1A 4MKHA 2KSQA 4LHWA 4QFMA 4CEIB 3OFND 4H9GA 5FR2A 1G41A 5DYGA 4RKEA 1JBKA 3EIEA 5DNYB 1UDWA 1T91A 1X86B 1RZ3A 2VSOA 4B33A 2G1JA 2ECKA 2AD1A 4JKIA 2RAPA 1GM5A 3UMRA 4V02A 4XTRA 3HU1A 5C4GB 3H1TA 2OM2A 5FPKA 1RVDA 4GFDA 2H18A 4Q19A 4RJLA 4UJ3A 3R9XA 2Z5FA 3EA5A 4JIMA 2D2FA 5IK2D 2O0HA 1VG0B 1P9WA 3LVQE 4HDOB 1W48A 2QAJA 1KI7A 1E2EA 2CNWA 2P5TB 3QENA 2NZ8A 4O2LA 4A8JB 3IIJA 1NLYA 3ASYA 3C14C 4Q1CA 4QBHA 5DH9A 3LLUA 3X2SA 4D6PA 2IYQA 3EZ6A 3AKCA 5JI2E 4DCTA 4BFZA 5KDOA 1G7SA 1XMVA 4HYYA 4Y0VA 1VHTA 5J47A 1JR3D 4RD0A 1OH6A 2ZRDA 3IEVA 2NMVA 2GK7A 1QHNA 3K70B 1ESMA 2RGNA 1CR1A 3ZD6A 1WE2A 1M34E 4RZ2A 3DMDA 4CYMA 4DLWA 3EZFA 1II0A 5D3MB 1E69A 4HATA 4QBFA 2NPIA 2VBCA 3AVYA 3SJAA 1COWA 1XMJA 3B82A 3QG1A 3QKSA 4LJ5A 4LJ6A 4WZ6A 5FBLB 1NY6A 2GJSA 3TR5A 4GL2A 3AEZA 4WXPA 1Q57A 3EW9A 2C95A 1GUAA 2Q9BA 2GCOA 4IOMA 2BMEA 2WPDD 4PO1A 1LF5A 1E4VA 3M6AA 2QI9C 4OKSA 5C18A 3RRNA 1G8HA 4LOAA 3LW8A 1UKYA 2O8DA 4BUJA 2FV8A 3O8DA 4DBLC 3PUXA 4V0NA 5KPJA 3OEHA 4OQNA 5B30A 2HT1A 4R2HA 2ZSEA 2KE5A 3KQHA 4BECA 3EPLA 4MA4A 3A36A 3QBTA 1KI8A 3DM5A 4TL9A 3FDIA 1XBTA 1CJMA 3BORA 1F2UB 1E2KA 1Z22A 3FE2A 3FMOB 4GMXA 4OK5A 3SZRA 3AVXA 4EQ6A 4N1AA 2RGNC 1AZSC 1L4YA 4MRRA 3P26A 2R6DA 4MYUA 2QPTA 2QPAA 1H8ED 2YJTD 3U5ZB 4QM7A 1X3SA 3F8TA 3VR2A 1NVVQ 5HCIA 4C7OA 1W46A 1KZ7B 1XXHA 3FWYA 1U8YA 1FTSA 4XSHA 1P5ZB 4TL6A 2JLRA 3ONWA 1N5JA 1CR0A 3PUVA 5L8VA 2YHSA 2QM8A 5CJPA 2W2TA 2V54A 3BH7A 5HKKA 5HPYB 3QVUA 3ZH9B 3BFKA 3CB4A 3SBDA 1SVOA 2ODNA 4HAWA 2IEZA 1I4DD 3LXXA 4QHYA 1NL3A 1S8FA 5DHAA 1WQ1R 2ZRNA 3DMNA 3CWZA 4WIAA 1FTNA 1G7RA 1X8JA 2XNDA 1NP6A 4NONA 1Z0KA 1Q44A 4AG6A 4LDJA 3LV8A 5HKKD 4FI3C 2F55A 2C78A 4HEJA 1TQ2A 4KVGA 1XF9A 3T06B 3PEYA 4EFNA 4OQXA 4NYIQ 4Q1BA 1JQJC 3SN6A 3THOA 1ETUA 3TSZA 4OHZA 4AG5A 2GEVA 1KK0A 3AF0A 3BH6A 1NVVR 1X1SA 2OXRA 3GJ4A 1F2UA 1G19A 1V43A 3W90A 1G21E 1KO7A 2J0VA 1SXJE 2W6IA 3K70C 2WJIA 2I1VB 2O0KA 4PXAA 4IHQA 4RZ3A 5KTYA 2QMUA 2QBYB 1I2DA 4UXHA 4Z54A 4KBGA 4JSTA 1GP2A 2ZEJA 4HZUA 4LJ4A 4PFSA 4QOSA 2J3EA 1C9KA 5GJCA 2HJVA 4D25A 3CNLA 2VA8A 3WBKA 2B6HA 3U60B 1US8A 2UZIR 3BWDD 4JVNA 1KSJA 4IDNA 3AVPA 3BGWA 2QROA 1MRSA 2ORVA 4BFYA 4LBWA 1DO0A 3A1TA 5ANRB 1N25A 2ZRGA 4EIWA 4A15A 1NN0A 2JJ1A 3NBYC 2V4ZA 4L4UA 5EXXA 3RC3A 1TF7A 1IN8A 3UMSA 3RNLA 3O47A 1E1QA 1OFIA 3U44B 3KXIA 1NKSA 1P73A 2FSIA 2EQBA 3SR0A 1GITA 2MMCA 5BWMA 4XWKA 4P32A 2R6AA 4PPFA 3BH0A 1BKDR 1D2EA 3EZ7A 4NYIR 2EFGA 2JJ1D 2QMEA 3CRQA 1WCV1 1G8FA 2YC2C 3GCGA 2FZ4A 1QHHA 2GF9A 3B8HA 4KYUA 1UKEA 1OXVA 4TTPA 4US0R 3X1ZA 4B6EA 4BLQA 4CF7A 5SZIA 5BYKA 3I32A 4PHHA 5FBQB 2AR7A 1N3BA 4V0LA 2FSGA 5C4MA 4MKIA 2BCJQ 4ASUD 4TMWA 1G5PA 1E2PA 1G4AE 4L9SA 4OJQA 3HWSA 5A0FA 1Q3TA 2B21A 4M9QA 1TX4B 1Z28A 3GLIB 4PPQA 3RDPA 5DIFA 4OHYA 5DGXA 1E2LA 3I72A 4YMVA 3NH6A 1KMHB 1AK2A 2W58A 3OE7D 4PSVA 5KOYA 5DO9A 5CYPA 1VECA 5TB5A 1J2JA 4UNRA 4LHXA 4AK9A 1ZD1A 1DO2A 3OEEA 1IY2A 4IXNA 2JA1A 3IQXA 4MUBA 1JQLB 2Q9CA 4CEJA 2W6JA 3V00A 2VP5A 2O52A 4Q4JB 4GOKA 2ZRFA 4OK3A 3N2IA 1T3LA 2GBLA 3THXA 3QI2A 1EFTA 1AZTA 3S1AA 2Q9AA 1DS6A 1JB1A 2DFLA 2FMXA 1AGRA 1UDXA 4PC6A 3U44A 1H65A 5FOXA 2REXB 3L43A 3OEED 2RGGA 1TUEA 2KWIA 2Z6VA 4GPTA 3TUZC 1MR3F 3RSLA 1DEKA 3PITA 2J7KA 4G5QA 2V7QA 1AS2A 1R4AA 2N42A 3QF4A 1E2QA 2QT0A 1IN7A 3VR3A 4A4DA 4CEHA 4HAXA 2JDID 4LYJA 5EP2A 4X8HA 6Q21A 2A30A 2VO1A 5L3QB 3SE0A 1CF4A 3SBEA 2UZ3A 4I99A 1E9AA 2H8KA 4JL5A 2D2EA 2J7PD 3KX2A 2ZRPA 2RMKA 4B3DA 3AVUA 1RYFA 4G0NA 4PAOA 2V7QD 2QSZA 2GJKA 4IDOA 4B2PA 4N3NA 4UNQA 4MDFA 2VPPA 3I4LA 3NKVA 4IXMA 2P2LA 1K8RA 2IHBA 3TBKA 4NZYA 3GLIA 3EC1A 5F98A 4DDVA 1R6BX 5CB8A 1E2HA 2ZJ8A 3LBHA 3B13B 1VG8A 4I1SA 4NCJA 1Z0DA 4PR0A 4GP6A 4JSYA 3K9LA 1KO5A 3K1JA 5D3QA 5G41A 5JSZA 1KK2A 1IN4A 1GRNA 1ONBA 4TYQA 2W2VA 4BFXA 1GL6A 2I4IA 3BOSA 4B3XA 2GBLC 1ANKA 3NEYA 5FOSA 1NVXQ 2IUUA 1E3MA 1TF2A 4GBMA 3QBVA 3U7GA 1WP9A 2RCNA 1KTVA 5LDDC 1P72A 1Z2CA 3F0TA 2V9PA 4NH0A 3KQNA 5FBVB 3CRVA 2WAXA 4KLZA 3AVOA 3N5CA 3HR7A 5AWFC 1CKEA 4LK2A 3EPJA 3GLHE 4YMTA 2QP3A 3IHLA 2F3RA 4R7ZA 2IYZA 2BHRA 2ZJZA 3GJ6A 4B75A 1UFQA 3BC1A 2CHGA 4JLKA 2A5YB 2XJ9A 2VP4A 3AB3A 4D2IA 1W2HA 5FUXA 3T12A 1WMSA 3ZQ6A 3UG6A 2NQ2C 4JVSB 1Y3AA 2YWEA 1ZC4A 1M8PA 2J9RA 2PLFA 3NHAA 3RANA 3EWSA 1OSNA 1EGAA 2V55B 2P6UA 1N5LA 1RIFA 5FL7D 2QL6A 3P32A 1CXZA 3OAAD 2GEDA 2NG1A 4B48A 3TMKA 3Q5EA 4DUGA 1N5IA 3WYGA 1XTIA 3PXGA 3ZS9A 3U3MA 1A4RA 5DLQC 721PA 4DLYA 4C0BA 1TNDA 1G16A 2W2XA 3BBPA 2LCFA 3SU8A 2ZJ5A 4IDQA 1DPFA 3I1FA 3GJ5A 2PT7A 3B9QA 1U9IA 1AJEA 2EWVA 1XB2A 1FMLA 2PEYA 4KFTA 1KDRA 2XZLA 1T0JB 2GVDC 2G0TA 5BW8A 4UXIA 1W5TA 2YC4C 2IEYA 2WBLC 1GWNA 1XCGB 3ND9A 4I1OA 2J45A 2ZE6A 1XNJA 4JZKA 5BN4A 1DARA 2BBSA 5FR1A 2QEQA 3GEIA 1TTTA 1Q1BA 1VIYA 2ERYA 1E2NA 4Q9JA 4B3CA 2DWPA 2VP0A 2WVJA 2NGRA 2XITA 1RW4A 4M53A 1MH1A 3HJNA 2HXSA 1N0WA 4A1FA 1VDZA 3MJHA 1A7JA 3VMFA 3EARA 2AFHE 2I1QA 2HDNB 4IFBA 3BJIC 4OQLA 3MWKA 1F3OA 4DIEA 3L82B 1W36D 4MGIR 2NPFA 3EPHA 1UPTA 1XPOA 1MO6A 5DI9A 3Q5DA 2ERXA 4WVFA 2ZSFA 2ORWA 4F93B 2IS4A 3AF4A 2WOJA 3DDCA 3MRSA 3VNUA 2P5SA 4AYWA 2EFEB 3DOEA 1MO3A 3CPJB 3JZMA 1ZM9A 5GVRA 5LB4A 2FOLA 3FB4A 3C41J 5DI3B 4LJ8A 1F2TA 2P67A 4K81B 3GLGB 1U9IC 1SKYB 4E09A 4GOJA 4X8OA 2YOFA 2EFCB 4RD2A 3AF1A 4DVGA 4IKEA 3VKGA 3CH4B 3TIFA 2B7BA 3DKVA 1W0JD 4I1UA 4XWOA 1IN6A 4DCNA 4QHTA 4D82A 4M21A 5HCNA 4JLBA 2OEPA 4LI0A 4GNKA 4EPYA 1QF9A 3FFBA 4M1TA 4YMWA 3W6OA 2OV2A 1JJVA 3QOFA 4Q4LA 5EJEA 3RVBA 2C99A 3U3OA 4DT1B 2D7CA 4C4PA 1A1VA 1AKEA 5P21A 1E1RD 3A4LA 1ESNA 2AXNA 4URVR 1D9XA 4Q9HA 2Z83A 5FOWA 2RB4A 2C2HA 4FMDF 5KHOC 3VHLB 4AC9A 2CXXA 2OESA 4Q47A 4BZPA 1G64A 5F3WB 4TYPA 1MOZA 4V0MA 2YZ2A 3VHXA 3ZS8A 2IA5A 3FYHA 3KQLA 5LD2B 2PJRA 2ZJAA 2HYIC 2ZRHA 2YWFA 2ZJ2A 3LAWA 2ZYWX 4W5JA 4F7WA 1XFAA 5HE8A 1A2KC 4HUQB 3MWYW 4LGMA 1ZD8A 2OLJA 2J0QA 1SVMA 4UXJA 2WWIA 2X8AA 2B92A 4HAVA 4E5UA 4TYWA 2HF9A 4JLVA 4BZQA 4HDQB 3T34A 5J4YA 2J0SA 2JLZA 3RC8A 2ZSAA 1VCNA 3RWOA 3A1SA 4NDZA 1Q1ZA 3BK7A 3LRPA 1FPMA 4WW0A 1WBDA 1J90A 1NY5A 1T0HB 1UEJA 2ASEA 3R20A 4TLDA 4MYTA 3ECCA 1EFRA 2QP4A 1ZU4A 4LRWA 4B74A 1W0KA 2FFHA 2ZTSA 5EE3A 2ZS9A 3AF2A 5TDHA 2AK3A 1OXTA 4Q9IA 4A92A 3B1XA 4LYAA 5TMPA 4PQRA 1NN5A 2JGNA 2EYUA 3ND8A 2AD5A 3ZZTA 4I4LA 1VCMA 1XZQA 3LX8A 4NCHA 3SHFA 2WWHA 4CIDA 1R8SA 5JCPA 2JLXA 2QGNA 3HYTA 4K8OA 2F1IA 4PC3A 4TMXA 5DE3A 1E4YA 4NP6A 2ANCA 3K0CA 4G5GA 4JLPA 2FGJA 1F6BA 4P4SB 3W34A 4AKHA 4QG7A 2ZITA 2A2ZA 5E3HA 1OIWA 2BKEA 4EDHA 3SS8A 2REOA 4PSAA 3SYLA 2HUPA 1N6LA 2IC5A 3QKRB 2JLQA 1XXHE 4JLAA 4IOLA 3BB3A 3T61A 3A58B 3CR8A 1XD2A 2OBMA 4WOPA 1R5OA 3REFA 3GP8A 3T1VA 3WYAA 3P4XA 1FZQA 3IBYA 4FINA 4R2IA 1M7HA 1P75A 2G0NA 1NBMA 2OT3B 2OZEA 3WMFA 2CK3A 1ZM3A 2H1LA 2IYSA 3Q9LA 4IEIA 2XTZA 4QBGB 2ZRAA 2DHRA 3KB1A 5E7IA 2KB0A 2V1UA 2L0XA 1R0YA 5CK4A 4A2PA 5KPDA 1NJGA 1NMZA 2PCJA 2ZI7A 2QMOA 1FP6A 2EW1A 1HY3A 1KI3A 1UADA 1G291 1XTKA 4FXPA 2YINC 1JPJA 1LS1A 3AUXA 3ETLA 1XEFA 4FW9A 1E6CA 4TMVA 2JLWA 3N70A 3K0CC 2ZXUA 3MAAC 4GP7A 5KNDA 5TVKA 2C98A 4ON9A 2HEIA 4LZZA 2IHYA 3QG5A 2J41A 2VHTA 5LD2C 5JRZA 3VNVA 3C8UA 4B2LA 1CRQA 3T1QA 1L2TA 1TQDA 4XTCS 2WSSA 4D4LA 1IXZA 3KZ1E 3IPXA 5L3SB 1Z0IA 3CLVA 4TYNA 1ZM4A 4FWIB 5HE9A 3QKRA 1IONA 5IRCD 2BJWA 3KQKA 2G88A 3SFZA 4LSGA 5K8IA 4WZBE 2Q6TA 1IM2A 1WBBA 2QAGA 1IJFA 4JBWA 4WAUA 1LY1A 4ZDKA 3C5HA 4PANA 1BO6A 2IXGA 2P3SA 2WSSD 3DKPA 3IIKA 4KFSA 3U4QB 4Q7LA 4FMCB 3FKQA 1J99A 3TR0A 3GLFA 4M1SA 1E2DA 1YR6A 4HB2A 4R9UC 2JJ8A 2GNOA 2RGDA 2XOKA 1ZU5A 2BIFA 4YQFA 2AKYA 3CRMA 2DFNA 1NG9A 3CF0A 5IDVA 3IDQA 4KAXA 4LPKA 1TAGA 2VRWA 4DC9A 2F1HA 1O3YA 4BASA 3QE0A 5LB2A 2ZR9A 2YWHA 4IOKA 4B6FA 4OK6A 2X2EA 2DR3A 1RRFA 4BLSA 3MD0A 3AVQA 4R98A 3FHTA 1G3UA 2CNWD 2XOKD 3KXLA 1GOTA 521PA 1OB2A 2JATA 1D2MA 4D0NA 3FHCB 1PJRA 4FMBB 1DG3A 2IXEA 2NO7A 3KJEA 2GZHA 3LX5A 4KI0A 2FEMA 3ZDQA 5DSZA 4AYTA 1XCPA 3H2YA 4YMSA 3WMGA 1F60A 3CW2A 2DCUA 2VIIA 4B3FX 3D8BA 3U7EB 4K46A 3M0EA 3PENA 2Z0MA 4JMPA 4UJ5A 1BS1A 1N6NA 5HTKA 1S2MA 4OI1A 1BYUA 1OFTA 1ZMXA 4F4CA 4CEIA 1XEWX 1G5RA 4PZYA 1ZNWA 1E0SA 1TEXA 1H8HA 3AKDA 2JIZA 4C0HA 3QJYA 1P6XA 2LKCA 1M1YE 2IS6A 1T5LA 5CM8B 2VF7A 1VG9B 2QAGC 4KFRA 5J5CA 2OXCA 1COWD 3GJ7A 5AUOB 5L3SA 1YR7A 4DCSA 3EIQA 1G3QA 4FD2A 1YQTA 4YC7A 2GXAA 1OFHA 5C46F 1S9DA 4QHSA 4OI2A 3FPAA 1ZNZA 1H8HD 2A3RA 2ZETA 1ZINA 1Q22A 1G8GA 2C9CA 3H84A 4BEJA 3TUIC 3NDBB 3R8FA 1XTSA 2Q21A 5CLLA 2VHJA 1XTRA 1G1MA 2Z4RA 2IL1A 4PX9A 4MGZR 5H1YA 3H0KA 4A8JA 4RCYA 3V4RA 2GEUA 4S35A 5AJVB 2RGXA 4LC0A 3OEHD 1YZGA 2RGEA 4ZCMA 1S3SA 3EZ2A 3EG5A 3B1WA 1U8AA 1OE0A 1QDEA 2BBWA 1D6JA 1IBRA 4LBZA 5G3YA 1EWRA 4QNMA 3CZQA 3MLEA 3PFIA 3E1SA 3IO5A 3BB4A 4JLJA 3K0AB 5H68A 1OLOA 3FMPB 3QXJA 4TQUS 1JEEA 3LA6A 5D3MA 1KIMA 5EE1A 1NSFA 5HZKA 3R8CA 2W0MA 4LHVA 5JRJA 2OBNA 1G3IA 5JFGA 2YVUA 2G77B 1T8UA 1W4AA 3K70D 3PUZA 3X1WA 1OF1A 2OBLA 1YZTA 4RFSB 1P2SA 5AJZA 4HSEA 2ZANA 4LUCA 3ZLJA 1P60A 1G7CA 1S4QA 1P7CA 4KBFA 2WWGA 2ZAMA 3CF2A 4GT1A 2ZYVX 2JLYA 5G3ZA 5JWRA 3TKLA 3T5DA 5JWHA 1AKYA 2F1RA 1CS4C 3V4FA 1KJWA 2ZI9A 3NXSA 4A8JC 4HUTA 2ZRMA 5JEEA 5H70A 1IXSB 1I4TD 2GCNA 5EE0A 2XNDD 3U7FB 3I61A 4BFWA 3QKUA 4ZIRB 3SJCA 2GDJA 1C4OA 1KSFX 4E22A 4MRPA 3K9NA 4YDHB 3MG9A 3B9PA 3LQRA 2QMHA 1YE8A 4WZAE 3K9HA 4IVPA 4GDFA 1GL9B 3R7WB 1W2GA 4MKGA 1PV4A 1E2FA 4Z8YA 2F6RA 4WXRA 5EE9A 2IX3A 3U3RA 4QKQA 2GKSA 1Z07A 4B3BA 1ZCBA 5ELXA 2VQSA 3Q7PA 1IY1A 2G9NA 2B8TA 1M2OB 4NBSA 3AVWA 4Q9KA 3CR7A 4XD7A 4JKYA 2WWXA 1OH7A 3RS3A 2W6ID 1TQ6A 1Z2AA 3W8NA 2Z4SA 4IDPA 4QJ5A 4PHTA 3GJ0A 4UKDA 3RS7A 3TQFA 4EPWA 4Q21A 3H86A 3QSYA 4A6PA 4JLDA 1EK0A 3UXMA 1DTSA 1M74A 2CLDX 4ITRC 2G83A 3CZPA 5BXQC 1UKVY 4RFSA 1S3GA 4F91B 4MITA 4HAUA 2YOGA 3ZQJA 4DIDA 1N6KA 4OI4A 2EFHB 3LFUA 2AK2A 2ZYTX 4PHFA 4M1MA 8OHMA 2CBZA 2J87A 2WMNB 5EUQB 4DKXA 3A4NA 2TMKA 2ONKA 2V3CC 3P1JA 1KO4A 3BXZA 3I8XA 4DLSA 4DXAA 5CLQA 3I3SR 1JI0A 4CGZA 4HI0E 2FPMA 2VP6A 1E1QD 4Q9LA 1NRJB 1G3MA 1GRQA 3GFPA 1Z8FA 4Q03A 3U7HB 4M9SA 5JBQA 2PZFA 1CEEA 1G5TA 2VH5R 2WZQA 3KKPA 1OIVA 4P4TA 1XDBA 2RKOA 221PA 1S96A 2WOOA 4IOJA 3GEEA 4NE2A 3VKWA 3GJXC 2MMGA 2ZE8A 2A78A 1N0VC 1OXUA 3CX6A 3ZIAA 5A4JA 2R9VA 3X1XA 5F9HA 2ZRJA 3Q3JB 4BRUA 1IXRC 1UM8A 4JJZA 1P61B 1OJLA 1KOFA 2FH5B 3CWQA 2QRNA 4NMMA 3SOPA 2KBEA 1CLUA 3ZZUA 2H92A 1IAQA 1XX6A 3PUYA 5DYIA 2BJVA 2QBYA 4URZR 5JEDA 4KFUA 1G9XA 3KB2A 5E4FA 2QRZA 4FCVA 3IBGA 3THYB 4W5WA 2DB3A 3LDAA 3QF7A 3HPRA 1HE8B 3A1WA 3ZYCA 3WYFA 4ZKEA 1DELA 1U98A 4M9ZA 1YZLA 2NZJA 5F9FA 1UKZA 4NU0A 2OHFA 1K5DA 2OSBA 3DOFA 3KTAB 4P0TA 4DJTA 3CNOA 5KSOA 4QM6A 2ZRKA 3ZD7A 4S2EA 3TH5A 2GJAA 3ICQB 4O25A 5GJBA 4Q48A 1NVUQ 2IXFA 1VYTA 1KK1A 1ZNYA 2ANBA 1JJ7A 4RVCA 2WV9A 5B64A 1KI6B 2AFIE 3LBNA 4OBEA 2W6JD 2ZRBA 1N6OA 3O8BA 3DPUA 3QPWA 3GFOA 3ICEA 4X8LA 2FA9A 4TT3A 2PX0A 2ZE7A 2JAQA 1VCOA 2ODWA 2ZQ5A 4TL7A 4BPBA 1NMXA 3PR1A 4DCVA 2YOHA 2P0EA 3W5JA 4ZI3A 4BE7B 1XPRA 1VKJA 5CK5A 2X1VA 4Z8XA 4AYXA 4C0JA 3VKHA 1ZCAA 4XVUA 2WAYA 1JR6A 3OIYA 4PQYA 3B85A 3DZDA 4XJXA 3QXHA 2O8FB 1SZPA 1SXJB 1OH5A 3KQUA 1M6NA 2BV3A 2QNRA 1GKIA 3RWMB 2ZIAA 2C96A 4V0ME 2R2AA 5KNCA 3THWB 2PJZA 2G6BA 3TE6A 2PZGA 4TZ0A 4KYIB 5M04A 3SDZA 2NO6A 1KMHA 3Q8XB 2F43B 4HLDA 5AUQA 2JASA 1FOEB 3TSOA 4ZV4A 4TMZA 1N6IA 2WWYA 3D3QA 2BM0A 2PBRA 1KAOA 4QGHA 3TSWA 3VQTA 5AR1A 3NH9A 5EUMA 2GILA 3HDTA 1BIFA 2JLVA 2GK6A 2WJGA 4Q4JA 4TTRA 4GZLA 2AL7A 5FFMA 1SVIA 4DLTA 1TQ4A 1GFIA 1IQPA 1PZNA 1R8QA 3G0HA 1OT3A 2IF2A 1TPZA 5JJKA 4ZKDA 4EFMA 1HE1C 3EASA 1YR8A 2PT5A 2QQ0A 3HU3A 2NOAA 4QGFA 2GTPA 1QG2A 3WNDA 3AH8A 5CYOA 2BWJA 2IWHA 1GTVA 1T8TA 1NKTA 2VLIA 4RD3A 4FN5A 5L3QA 1S9HA 4CW7A 1U0JA 3UATA 1SHZA 4A0FA 1EFUA 3E5HA 3V9PA 1HUQA 5IT5A 2V1XA 3IQWA 4C2UA 2O8FA 3FGNA 3IILA 2RHDA 2GXSA 1UBEA 2FN4A 2OAP1 3UPUA 4LJYA 1PLJA 2OG2A 4Y0AA 1XWIA 2D74A 3FMIA 2NO0A 1PUJA 5A5GA 1QG4A 4HAZA 2A5GA 5FTKA 4BFUA 4IFEA 5KYKA 2FG5A 3T15A 2XB2A 2F43A 4XIGS 3L8YA 4MYHA 1ZYUA 1E99A 4D4KA 3T1TA 4V03A 1XRJA 3DL0A 3EXAA 4DUGD 4URWR 2VEDA 1KHTA 4I1VA 4IVQA 2QORA 4DDUA 2ZS7A 1BH2A 2J59A 5EP4A 4BLOA 2XEXA 4KITB 1G7TA 2WSMA 5EZ5A 1KKMA 4BLRA 1KNQA 4KODA 1D5CA 1R0XA 2B7CA 5CDFA 1NLZA 5C1BA 1MRNA 4U7DA 1FL9A 1KI4A 3UANA 4LWZA 2YNMA 1E9RA 3BFVA 5FOVA 1W49A 3UWOA 4AY2A 1R2QA 2VP2A 3PIRA 1EESA 4AD8A 1YRBA 3A37A 3NEJA 3Q7QA 3B7GA 4QRHA 4URUR 4A82A 4TLBA 4DLVA 1FP7A 5AJYA 1II8B 1E9BA 2IUTA 4PPGA 2XSZA 2E1RA 2QTVB 2YKGA 1V5WA 4U00A 1KAGA 2ZROA 1WA5A 4LJ7A 1PUIA 1GNQA 1GILA 1W4BA 3VU9B 1KKLA 1OV4A 1P2VA 5CJ2A 1UBCA 2IUSA 2GRJA 1VYVA 1WDTA 5EE5B 3RS2A 4AURA 2VHCA 2O8EB 2CJWB 2ZPTX 3HU2A 5GADl 4RZXA 1ZW6A 3AKYA 3NDPA 1YR9A 3KJIA 3B6EA 3CPHA 3DEFA 4KCGA 2GJ9A 3A8TA 2IYVA 2BMDA 1MV5A 1GRRA 1YKSA 2PL3A 4MYCA 1G8PA 1Z06A 2BBOA 1AS0A 1SGWA 3NC0C 3PCRB 4L8GA 5FPTA 4DEYA 4TTQA 4EFLA 3WNCA 1E98A 3WRXC 3F3YA 2A9KA 4DSTA 3U2QA 4M0LA 4YXWA 2XNSA 1D2NA 1OKKA 5JJLA 2AXPA 2R6CA 4QGGA 4PZLA 4RFVA 3GLFE 1XU4A 2EYQA 4PO8A 1R10A 3WHLA 4CT4B 4E07A 3GLHB 5KU1A 1G4UR 4Q4HB 3UKDA 4B34A 1N5KA 2RGAA 1E94E 4IDHA 1OKKD 4EAQA 2IYRA 1Z5ZA 3OF5A 4MGKR 4DDTA 3MSXA 2F7SA 1I2MA 4I81A 4G5RA 1GSIA 1R0ZA 1Z63A 4IEEA 1MT0A 1UF9A 3OZXA 4US1R 4JL8A 1KI9A 2UKDA 4NYMQ 1U8ZA 2QTHA 3LQQA 1N0UA 2H57A 1II8A 4TMKA 1NG1A 1QBKC 4BQSA 1HEIA 4ACBA 3H4MA 1GG2A 3BB1A 4UNNA 3RAPR 2FFBA 4KVAA 5LPNA 2HV8A 3QEOA 3RRMA 1NIJA 2O8EA 1NSTA 1UEIA 2CJWA 2R8RA 2ZR0A 5E95A 4ERNA 5DI3A 1M7BA 1GKUB 1YRAA 1E0JA 3MJRA 3SFVA 3GLGA 1OIXA 3DVLA 2FU5C 2SHKA 1JAIA 3ZVNA 1FNNA 4EPTA 2PH1A 4TQ9A 3A6PC 2JJ2A 3O8RA 3BRWD 1XD8A 1BOFA 1XTJA 3PQCA 4O2RA 1GDDA 3IPYA 3LW7A 1N6HA 1RJ9B 3RRZA 4B71A 1BMFA 4ZDIA 1XMIA 2PLRA 1LB1B 1NN3A 3JVVA 2WM9B 3SYNA 4OHXA 2QENA 3SQXA 5DN6A 2GXQA 2IWRA 3K8YA 4HLUA 2ZJBA 2DPXA 4GOXA 4DLZA 1EFRD 5JECA 3RHFA 2JJ2D 1U94A 1W0KD 4NYMR 4H1VA 4C0QC 3HYRA 121PA 4DT1A 3GLHA 4FMDB 1L7VC 3L0PA 3WBJA 3MUFA 1CRPA 4AKIA 1ODFA 4Q02A 4PO9A 4P3YA 1VPLA 3U61B 4Z1MA 5HZHA 2C04A 1R0WA 5FPYA 4V0KA 4M1OA 2WIAA 1XEXB 2ATVA 1JECA 1SVSA 1VHLA 4C0KA 2IS1A 4HUQA 4P33A 1A82A 4GRAA 2Y8EA 2ZVQX 2XJ4A 3QXSA 2BVNA 3FKSA 2ONJA 3UK6A 2ORIA 4C0SA 4D81A 2CLCX 2X77A 2GWHA 4QBIA 3KKQA 2UVQA 1CIPA 1TU3A 1U0LA 2CHVA 2JLSA 1YZQA 3AQ4A 5H8WA 1N2CE 4M8NE 3BERA 4WA7A 1GZSA 4ARZB 3TVDA 2OLKA 2EVWX 1HT1E 2WTUA 2PZEA 4NCIA 3U3KA 1EFHA 3PJRA 3LWNA 2CEAA 2W83A 4HLUC 1NBMD 2VSFA 3CF6R 3ZVMA 2CK3D 2IW3A 1GL7A 2D4HA 3A1UA 1CULC 1VIAA 1J8YF 2CE2X 4H1UA 4JYCA 5EQTA 1P9RA 2E87A 1NNEA 1B23P 3BD9A 5SZKB 5DHFA 2KBFA 1AQYA 5GJVC 1CJVC 1TU4A 1DAFA 1OXSC 1OXXK 5KNBA 3KFVA 4MGYR 3I8SA 5J4LA 4TLEA 2HCBA 3SJZA 4BGDA 4G5OA 4QL3A 4UNSA 4MQBA 3P27A 2FPKA 1P3JA 5IF9A 3EWAA 1HQYE 1EWQA 5FUWA 4UNPA 4P4SA 4KXFB 3FHOA 3OFNA 1R7RA 3MWLA 1X8LA 4NTZA 4PAQA 4D4JA 2MSCB 1NI3A 1XEXA 3EIHA 3DO6A 4ZPXA 4JS0A 2IYUA 2WKPA 1DAKA 1JXOA 5FTJA 3TAHA 1SVKA 3QKSB 4Q7MB 3EAQA 5CITA 5BQ5A 4C3ZA 1Z29A 2CCKA 3ADCA 3LO5A 4M4SA 2WWFA 4TL8A 2P6RA 4M1KA 3NBZC 3TVTA 1QVRA 2FE4A 1KO1A 1SQ5A 2B8WA 2WICA 3B2EA 5FH9A 1E9EA 1S0UA 2GCOB 5B57C 3B78A 4QXAA 4ABYA 3W6PA 4DHEA 4BFTA 2Q0HA 5IK2A 1E9FA 1G8YA 4Q1DA 3L0IB 3FVQA 2MSEB 2BMFA 2LKDA 3CX7A 5E7MA 1XD9A 3VAAA 2O8DB 4ARZA 1SKQA 2HJGA 4TYYA 3VFDA 4NCKA 2FSFA 3W9YA 2ZR7A 4JVLA 1OYWA 1KMQA 1WF3A 3B1VA 4W7SA 3TUJC 3U3JA 4DDWA 3J81k 1E79A 2ATXA 5FL3A 1JR3A 4QJ4A 2G1KA 3T1OA 1E2GA 2JEOA 4Q66C 4QJ3A 1HQCA 1XJCA 4L15A 4ZI2A 4EQ6B 2J0UB 3RLFA 4LC1A 5JHHB 2GETA 4X8MA 1RRCA 2BCGY 3AKEA 1TADA 2QG6A 821PA 3IEUA 1T3SA 3C16C 1E79D 4JL6A 1XTQA 2IYYA 5SZHB 5KO2A 1R5BA 1AIPA 2CCGA 2EWWA 4D4MA 5AJXA 4C7OB 1QRAA 1XXHB 4G1UC 2FNAA 4AWXA 3ZJYA 2ZU0C 4A9AA 2PX3A 1W1WA 5CB6A 3BFXA 1DAGA 1W4RA 1IY0A 3WHKA 1KZGB 1S1MA 2WPDA 4ACAA 4U5XA 5BN3A 3K0FB 2CCJA 1ZM2A 2AWOA 2IT1A 2CHQA 4A0GA 2V8OA 2JIZD 2N46A 1HT2E 4F38A 2JLUA 1LF0A 1S1CA 2ZJOA 3KL4A 3MCAA 4JYBA 1X6VA 1KDOA 1TF5A 3EZ9A 5JHGB 3U4QA 1MO4A 3M1IA 1YHNA 1HA3A 4B76A 5KSZA 2VYFA 2ZREA 5B58C 3U6BA 1G20E 2ZI3A 1GAJA 4LV8B 2D06A 1DVRA 2C5LA 2OUKA 4EUNA 3LBIA 4N0EA 4RY2A 5CIQA 1E96A 3VTKA 4MRVA 2Q3HA 2BEJA 1ZNXA 2ZI5A 4OHVA 3KUCA 4KV9A 1R5NA 3NWJA 5FBRB 3D31A 3WY9A 4PSKA 4YONB 1F5NA 1DBSA 1H8EA 1JXMA 2OAQ1 4HB4A 2VHQA 4M2LA 1E9CA 2D7DA 1CJTC 1NMYA 4A2WA 4LV5B 2BOVA 4CT5A 3QPVA 1QHSA 4XOIA 5FOUA 1UJ2A 3BIFA 1NLFA 2J0UA 3TW8B 3SYKA 2FF7A 3GLIE 1VYUA 1GKYA 4GZMA 1FUKA 1ELOA 4GI7A 4JBXA 4HZUB 1LVGA 4EKDA 2QSYA 4TSFA 5TXGA 2H5EA 1KSHA 1HYQA 2YYZA 5EP1A 2FGKA 2ODBA 2QGZA 3GEHA 4N0DA 3PEWA 1US8B 3IUYA 1E2JA 3TW4A 3ZGXA 4CZ2A 5FUVA 1OHHA 4OYHA 2DFTA 3KJGA 4L9WA 5KSPA 2HCJB 3ADKA 4G3XA 4TSFD 1K5GA 3LH5A 1Z6XA 3GQBA 3K0FA 4A2QA 1FW6A 1SVLA 3G5UA 2GXUA 2WJYA 2QPOA 1OHHD 5AK0A 2RGBA 3RRYA 2FDCA 4B3GA 3HP1A 2FZLA 2BEKA 3MWJA 4LBYA 1CJUC 1FX0B 1WRBA 2DYKA 4C30A 2OCPA 3W6NA 1G18A 5FOTA 2P65A 3D7MA 1QHHB 3AVVA 2IYLD 1N6PA 3B60A 4AI6A 4OQMA 2GA8A 5AJWA 2Q3FA 5GVSA 2HF8A 1YZUA 4HB0A 4LY6A 4PC1A 4BZXA 2V6IA 2WJVA 1G17A 1J7KA 1PLKA 2OCAA 4ZDJA 4XH9B 2I3BA 3VR6A 3AM1A 2IBMA 4FCTA 1L4UA 1XP8A 4YDSA 3K0AA 3QPUA 5C2JB 4XWAA 1OH8A 3ADBA 5JI3E 4US2R 2ZJYA 4DB2A 4YMUA 1HV8A 2NTYC 3JZAA 1IN5A 5G53C 4AKEA 3LVRE 3I5XA 5J40A 3E2IA 3SNHA 4XD7D 1W4CA 4NL4H 4ZCIA 4ZDWA 1QHXA 2ZVPX 4AKGA 2XAUA 2QP9X 4DLRA 3C15C 2K5UA 1AA9A 4XVRA 2FPLA 1W5SA 3LLMA 4CEJB 5B2ZA 1YVDA 3L0OA 2E9SA 3PVSA 4TWZA 2QM7A 1EFCA 3AVTA 4Z51A 5L3VA 2DWOA 3THXB 4G01B 3S1AB 4IVRA 1QHIA 2QA5A 4KHZA 1WB9A 4DLUA 1Z6TA 4BFVA 4JLMA 1UAAA 1E2IA 2G3YA 3R9WA 3QXCA 4FIDA 1ZVQA 3QIAA 1II9A 3TRFA 1FX0A 1RPZA 3QNUA 4ZIRA 3R9IA 4PZZA 5CDFE 4C9BA 4NKRA 3BAFA 1SHKA 5TY0A 1Z6AA 2EU8A 4HAYA 4ASUA 4B73A 2J1LA 5BYJA 1CU1A 3QF4B 3AP3A 1TL7C 1LV7A 2BBTA 1SVWA 2AN9A 4CEHB 4ILEA 5KSYA 1T4GA 2R44A 4BLPA 3R7WA 1K6MA 4BFSA 1RKBA 4L5BA 2ZAOA 2Q3MA 4LPSA 3ZIAD 1U99A 4PPNA 3NIBA 3IHWA 2F9MA 1Z6GA 3I92A 3CONA 4BEBA 1A2BA 1OB5A 4QGAA 2XX3A 3NC1C 3OE7A 3C7KA 1E32A 1GVNB 3P4YA 4PHGA 2BMJA 4MKFA 2XTMA 5EZ6B 4RD4A 4DWJA 4XSGA 3GJ8A 3NVAA 4L16A 3KDSE 3JVUA 3L2OB 4KJZA 4JT2A 2F3TA 3OHMA 3NBFA 4DSUA 1RC8A 1I4LD 3HR8A 3WRYC 5JSZB 4M22A 4RSGA 3OESA 2X19A 1LFDB 3W3ZB 4B35A 4M1YA 1FNMA 4D0GA 1FQKA 2QUZA 2XTNA 1T6NA 3CPEA 2F9LA 1D8TA 1J8MF 3LY5A 5KUTA 4Q7KA 4F4JA 5CIWA 4NPHA 2O8CB 1MKYA 3ZZ0A 3FMFA 5IHPA 2R6FA 2ZUCA 2D62A 1AGPA 5GJWC 5UKDA 4TN1A 2FFAA 4ZCLA 5FTMA 1OYYA 3PEUA 1AM4D 2OFOA 2X2FA 2O8BB 4LCBA 1G6HA 1ZRHA 2JDIA 2DBYA 3UWKA 3B5JA 3EPKA 1GNRA 1XZPA 2HT6A 4TT3D 3WNBA 3UMFA 2IYTA 5KDLA 1XCMA 1QHGA 1DAMA 2J7PA 1JPNA 2AX4A 5DISB 3X1YA 3IKJA 2ZRIA 2A7QA 4JLOA 4JBYA 4QNRA 2BM1A 1AS3A 4M1WA 4G5SA 1JNYA 3T35A 3MFYA 2LWIA 4RZUA 2GJ8A 2NO9A 1QVAA 4Q1FA 2OO7A 3NHBA 1E9DA 4M9XA 1JALA 1TUIA 3WMEA 1DADA 3THYA 1KDTA 1HTWA 2DY1A 4U02A 1MO5A 3LNCA 3WXMA 3LD9A 5HR5A 2OE2A 1O87A 4ESVA 2VL7A 4JLNA 3AP1A 3ADDA 2ZI6A 5JCZA 5JJIA 5J4HA 3F5FA 3QXXA 4MRNA 4D0LB 1ZM7A 3KTAA 2ZUDA 2FEOA 2ZI4A 1J70A 1Q21A 4HDCA 3I62A 1T5IA 1NF3A 4W9MC 1SULA 5BN5A 3GLGE 5FUYA 1Q12A 1SKYE 1KNXA 3CH5A 1ZIPA 2ZSBA 1KI6A 3MGCA 3K09A 1XJQA 1HH4A 2ZSDA 4LX0A 2H7VA 1LTQA 2O8CA 1VCIA 2ZRLA 3GFTA 1ZD9A 5EP3A 2CL0X 4O0MA 1TEVA 1W7AA 1ZAKA 2XZOA 5K8TA 3KXKA 1PLLA 2AHOA 4RD6A 3A4MA 4DLXA 3UIEA 1W36B 2O8BA 2C8VA 2FFQA 1DAHA 4TMTA 2YV5A 3ASZA 1W47A 1VMAA 4BLTA 3FOZA 5EXTA 4Q01A 4DEXA 1ZJ6A 1OFUX 1Z83A 5G40A 2QY9A 2WKRA 1SXJA 1Q3HA 2REBA 3A1VA 4DCUA 2WMOB 1IJEA 4PQFA 5FTLA 2GESA 3EA0A 5FL7A 2CVHA 4PTLA 1EX6A 1KYIA 3C5CA 3OAAA 4EPXA 3THWA 3SC3A 4YLGA 4O3MA 4E03A 1P2UA 1NIPA 1OPXA 4F4IA 4MRSA 5FBWB 4EPVA 3TGPA 1SXJD 5EXPA 4Q1AA 1YZNA 4MDEA 3KKNA 2OCBA 3RYTC 4BRWA 4PC2A 3WP0A 5JS8A 1CJKC 2H16A 2IF0A 5K8LA 3CBQA 3CRW1 2HXYA 4W5HA 2CL7X 1F2TB 4CDGA 1ZUIA 1Q0UA 1FQJA 1AQUA 1MABB 2FWRA 1NBME 2ZUBA 3E70C 3N2EA 4NCNA 5TV2A 1QHYA 1XJ0A 2ZS8A 4HLQB 2YWGA 3K09C 4Q1EA 3SEAA 2R65A 3TLXA 1KJYA 3GJ3A 3M4YA 4NYJQ 3IGFA 2HYDA 3RS5A 3CNNA 2KI5A 3DZ8A 2GF0A 2PEZA 5AUPB 3AGQA 2WWWA 1P4SA 3AP2A 4XVQA 3SJBA 3RS4A 3I5YA 2CL6X 2RHMA 4TZ6A 1YU9A 2ODEA 2PMKA 1U0HC 3CUEF 3P20A 3PEVA 1L8QA 3CO5A 1N6RA 4V0OA 3QEJA 1NVWQ 3LXRA 2BDTA 2IYWA 1F48A 2W0SA 4OQFA 3VX4A 1XMSA 2NO1A 4HZIA 1SXJC 4F92B 1UBFA 3MMPA 5EXSA 4R71A 1XEWY 3RS0A 2BKUA 3FTQA 1LW7A 1ZBDA 3CKLA 1CR4A 1Z08A 1ZIOA 3CX8A 3PG5A 4C0AC 2QU8A 1ZP6A 2CDNA 1KSGA 3DHWC 4OI0A 1OW3B 2XSZD 1RE0A 4TLCA 3K53A 3PV0A 5JMTA 2GHIA 2VSXA 2C03A 2GZAA 4MUAA 2IYXA 4A36A 1IOZA 1EG7A 1AN0A 1ZUNB 2ZM5A 5K8UA 1FFHA 3KUDA 2R6GA 4NYJR 4Q00A 4A0RA 2J46A 1C1YA 1GNPA 2XGJA 2O0JA 4Q5IA 1BYIA 1QZXA 3WP1B 1A5TA 4B47A 4DSNA 5J4VA 1Q1EA 3O8CA 1W0JA 5J4KA 3NTUA 2RH5A 2O5VA 2HLDA 2Z43A 1RRPA 3K9GA 2N1BA 1MABA
chains in the Genus database with same CATH superfamily
1CUJA 3GCZA 4KGDA 5JG7A 3X1DA 5IABA 4KFCA 1PGPA 3L46A 4EL5A 2J5XA 4ZYXA 4HH4A 3WJAA 5CH5A 1B8UA 5FULA 4HFJA 4YXWD 1E9SA 3MWEA 4YT4A 5FPSA 1HLGA 5IP5A 4ADSG 3T0IA 1MRZA 2C5SA 2DWQA 4POAA 2EBHX 5EHQA 1DQYA 1E0KA 3OZRA 2D0DA 3IX7A 1FXWA 2VAPA 3QELB 4LYHA 2SKEA 3AV0B 2OQRA 1H2RS 3PNYA 4ZT5A 3DM9B 4NENB 2WKQA 3C5WP 3GMDA 1VLZA 4EGAA 2RHBA 5JMPA 3VX3A 4EJSB 4C6TA 4D46A 2J5BA 2JCXA 4PLZA 5IAOA 4DANA 4RY0A 1SU7A 2GUGA 4A6XA 2DUJA 2ZRCA 4QX6A 4ER5A 4TKZA 3JRNA 4OXIA 5E38A 4CM9A 3RIEA 5LXTF 4C76A 3ITEA 4GSYA 3CO0S 2DLNA 4BNGA 4QC2A 1CIVA 4V2UA 3IP5A 5FI0B 3VU9A 4P31A 4B32A 3BPSA 4URFA 5HK8A 4BNFA 1LDYA 4QEZA 3R6GA 3W5IA 5H80A 2R66A 4GZ3A 4EKGA 2WTNA 3QH4A 2CLSA 4X5OA 2UUAB 3B7WA 4IWYA 3OT1B 2IOHA 1YQEA 2O2XA 3CRRA 3AG6A 3C4QA 4CUKA 3C3EA 5TARA 2QX4A 2X4DA 3FFAA 4HO1X 1JEDA 2FX5A 2G04A 5C9ZA 2GCPA 2GS9A 1NVFA 3CE6A 4LBVA 5KOIA 3TQTA 3W77A 2NO4A 2ZU6A 4NU5A 4JK3A 4XDGA 4GXRA 4HWPA 3WYBA 4XJVA 2BYTA 1L7NA 2C2OA 2ZKLA 2ATCA 1UK9A 3PXDA 1IUOA 1X1CA 2A59A 2RGUA 3CN9A 1S7CA 4MINA 1ECJA 4XB2A 5EHGA 1YUNA 3QPAA 1QORA 4CL8A 1SCUA 1T43A 4EATA 4I6EA 3UK2A 4DMUB 4Q18A 1YAJA 1V1MB 4BLWA 1DOAA 4YYEA 1WPGA 8ABPA 2OHOA 3K1TA 3TLEA 3K0EA 4DCSA 4JVMA 3EZGA 4RACA 2MSDB 1Q11A 4EM6A 4ENSA 5DN6D 5DHUA 1DBWA 2C8JA 2ZFUA 3PXUA 4MPPA 5DGTA 3SHQA 3FOBA 2DE0X 3QX7A 4A10A 2ZM6B 3TL3A 2UZ0A 5JZMA 1EP9A 3MT0A 1WXIA 1P6UA 2WYUA 3BE6A 4F3KA 1V16A 1MQ8B 1P2TA 3CQ9A 2FN7A 3DC7A 1IFXA 2PUJA 1C1HA 1SEVA 1JLSA 3Q1LA 4YFVA 3RABA 2WNHA 3I9FA 5H3LA 3WGNA 5JWOA 4PZ0A 2GZDA 3E22B 4FFRA 1VL1A 1NJ8A 2PR7A 1KYVA 1QX4A 4P7KA 1O6CA 1Z0FA 3V55A 5JPIA 1LSUA 1GRCA 5F1KA 4D26A 2FVXA 5I7WA 4BJHB 1Z0UA 5AJUA 4O8CA 5AI4A 4EPRA 5KDDA 1W52X 2BR5A 3STUA 1LC0A 4LHYA 3DV2A 3FYDA 3L8ZA 4NEQA 2V6FA 4EG1A 3L1JA 3M1YA 2ZSKA 3FCEA 3IV6A 3O21A 2QAGB 3WS7A 2GHTA 4LYFA 3TW0A 3W8EA 3UXEA 2F62A 2XMQA 1UC9A 1XFDA 2VRBA 2WA2A 3LT2A 5E2IA 4UNIA 1HSOA 1DAEA 2C07A 1BGXT 2VDWB 5JLJA 1TMKA 2CUTA 2AZTA 4GR5A 2QLBA 4RO0A 1FTYA 2G08A 1KIAA 1N5MA 4G4JA 1OFUA 3NTQA 2Z2YA 1U63A 2HWXA 3KKMA 3OIUA 4IJMA 4JT4A 2X8BA 5K3SA 1C0PA 1QCYA 1NP3A 1GG5A 3Q4GA 4G07A 5LC1A 4NEHB 1FXUA 1ZGZA 1P62B 4TTVA 2D3WA 2KLHA 3UT0A 1Z5OA 5FADA 1SURA 4HLCA 4LZNA 5K3FA 2AN1A 4V1CA 3R3VA 1MENA 4UQOA 5CLGA 2B4YA 4XKJA 5L3RA 4IH9A 1HL3A 1SELA 3HCRA 3X43A 2FKNA 3EC2A 2A7XA 1CP2A 1WHSB 2EJWA 1VPDA 3KDAA 1CUSA 3MWGA 4UBOA 3RREA 2PBZA 2VP9A 2ZVJA 3TPZA 3NHJA 3RBVA 5G1OA 4F21A 4OUDB 1GIAA 1A9TA 1Z0JA 4ZO4A 3CZ4A 4AO8A 5FUQA 1I33A 1JWLA 2HCFA 1FRZA 2YASA 1YI8A 3JARB 3JR3A 3OZGA 4B31A 3L0SA 1DIGA 4DR7B 2AWNA 4V0RA 1FEZA 1JN0A 4P2GA 4QECA 5AUNB 4Q4AA 1WKVA 2FPIA 5ED0A 2KSQA 2HF7A 4YAGA 4LMPA 2XDQB 3AY0A 1G41A 5HGXA 3HDVA 3I3OA 3H16A 4AS3A 1OX4A 3EY4A 4H7HA 3N86A 4BMDA 2XUDA 1ML3A 1X86B 2F8LA 4LOIA 3INNA 2O1SA 1MGOA 1M67A 3DV0A 3K0HA 1E3SA 1JAYA 2PD6A 4L95C 4JGGA 1AKMA 4B4OA 2H18A 4Q19A 3CISA 4RJLA 4BJ6A 4ZOLB 5ADUS 1FLDA 3V48A 1ZHOA 1X7XB 2YXLA 3IQZA 2X22A 3NYIA 3GU3A 2PR2A 3I9LA 1RVV1 4W9NC 2PX4A 1MQ9A 2PA3A 5TQ0B 2UUOA 3O26A 4GMHA 5AXAA 1Z6PA 4LRSB 1U3WA 4KXUA 4OBXA 4B4KA 1DBPA 2C29D 1LSOA 2CNWA 1N2HA 2HB6A 3T7DA 1DT3A 5I9LA 1QU3A 3UBTA 4H15A 3PGKA 4HDSA 4F9FA 4NBNA 2UZ1A 1AUOA 4GUAA 4Q1CA 2CJYA 1CRZA 1FFEA 3X2SA 1NW4A 5CEJA 3SKXA 3QY9A 1Y0BA 5HRCA 3EZ6A 1UBOS 3NKLA 2HN9A 3A70A 2Z3ZA 4X95A 3WB0A 4EG7A 4ND3A 4EHKA 3X1JA 4H7FA 5KDOA 1G7SA 1MAVA 3I9OA 3QEKA 1VHTA 1PDOA 1CUXA 3CUYA 4INZA 2NMVA 1FMTA 2G8NA 2GK7A 4Y9DA 2I4OA 5LQMA 4MQFB 4C1NA 3ZD6A 1C0KA 3AI2A 1WE2A 1U28A 2CXPA 4RZ2A 4EITA 4CLOA 4NICA 4TV8A 3EZFA 1N5RA 4KGZA 4G8DA 1L8XA 4L08A 4HATA 4QBFA 5DZSA 3Q8KA 3V4OA 3AVYA 1KDYA 4BYGA 1C7IA 3A0RB 3DBLA 4HGPA 3SJAA 1WU7A 1COWA 3B82A 3QRWA 1UJ6A 5IBQA 3GHYA 3OM0A 1GPLA 3GJRA 4EEZA 2X9NA 4CMEA 1N2CB 1R0SA 3IQDB 2O8VA 1V3UA 3J80A 2BMEA 3QOWA 3JSXA 1JAXA 1LF5A 2WVHA 1CNMA 2QI9C 1C3LA 4OKSA 4YAWA 5C18A 3DEZA 1FU4A 5JAOA 2BT4A 1UKYA 3FDJA 2O8DA 2FN9A 3QWFA 1QXSA 1WXGA 2YZMA 4UTZA 1OAKA 3WKAA 2GYUA 1Z4JA 4OQNA 4I9FA 5DGIA 2HT1A 1TEZA 3KEMA 4X1KA 3NT4A 3T3NA 2DJIA 5A06A 5MN6A 3D6JA 5EGNA 4BAGA 2JGRA 3M9LA 1D09A 1LPMA 3A36A 4HNGA 2I4TA 1SWVA 3K6SA 1MG5A 4HAIA 2WHRA 3D0OA 2QRQA 3CUTA 1MIHA 2BZGA 3LHSA 4GPD1 1GGNA 3V1UA 1K4YA 1G8SA 1XBTA 1F2UB 1MBZA 3RNOA 3SZRA 3UK6A 1TO2E 4DUYB 2CDCA 3LGXA 2RGNC 1KVTA 4X90A 2OHHA 3P26A 5L4LA 1L7PA 1BN6A 2QPAA 1H8ED 2F2TA 1WB4A 1IK4A 3B7PA 4G0OA 1TCVA 4IDCA 1LFAA 5A5FA 3RAFC 4IO0A 4G81A 2ZRQA 4MI6A 3F8TA 4C43A 3SZMA 2ODAA 3VR2A 2YRFA 4N18A 5HCUA 4CF3A 1NVVQ 2C3OA 1KIFA 5HCIA 2J33A 1FF9A 1JQ5A 1W46A 1U1CA 2RIRA 3LK7A 4JEIA 3PFFA 5JVDF 4X97A 3M5DA 1HI9A 2WJAA 5KYWA 4FHFA 1J07A 3OT5A 4Q6BA 2FUCA 2C4NA 2QD4A 2IUYA 3MTAA 4MS1A 4Y0NA 2I6QA 2O2GA 4YRCA 3KUUA 4NBKA 4TL6A 1WSWA 1GUYA 1N5JA 1NYLA 3FI0A 4X44A 4BUCA 2QM8A 4B4UA 5HJ5A 5HUQA 1SK9A 3ZLUA 3BH7A 3ZH9B 4DA4A 3BFKA 4X7RA 3QITA 1YL7A 1PJLA 3JTEA 2FRXA 5B1HA 4RH3A 3CLUD 1B6TA 2WIDA 3GW8A 3H5RA 3NHWA 5FA5A 1UP4A 4QHYA 3MHTA 4KR7A 2A4MA 3EVZA 4UBMA 2ZRNA 3P52A 1ADJA 2H4JA 3DMNA 3KELA 1C8KA 4BBPA 4WIAA 4KLRA 4YRQA 2AOWA 4Z7QB 5KYUB 4MW9A 3SQOA 1Y4UA 1Z0KA 3BTSA 3IP7A 4BDTA 2V96A 4LDJA 4RSMA 2Q2NA 1HG1A 3PPYA 3U4IA 3OBBA 2JBAA 4FPXA 4FI3C 4G41A 1WZUA 4KWTA 5HKKD 3PNSA 3WB2A 1ULHA 3W2FA 4HTFA 3CKMA 4ATNA 5IH3A 2JFGA 2MOKA 1PKEA 2IEDA 4YRKA 5IF3A 3NOOA 4R6WA 3KZNA 3SN6A 4NYIQ 1JQJC 1ONSA 3LLCA 1L5SA 4RA6B 4FOOA 4ID9A 4PFQA 2JLBA 4H7PA 3AF0A 3BH6A 3LPCA 3MPUA 4PSCA 4ICIA 4LGYA 4UDYX 3WK8A 2OXRA 3GJ4A 3GRKA 1G19A 1V43A 4EWLA 1KO7A 5AKKA 3OPNA 2W6IA 4L5JA 4AUNA 4DPMA 4DZRA 4DV3B 2WJIA 4OOFA 1G55A 2O0KA 4QUHA 3DMFA 3NPAA 5BNTA 1RHMA 5KTYA 1I2DA 4NS1A 1JEJA 1NV9A 1W76A 3FW1A 4J16C 4PGFA 3WY9A 3NDIA 3TQQA 3VR6D 2FSPA 3CLUC 1A8QA 2J3EA 5ILGA 3UICA 5D7BA 1GCOA 3HKCB 1U2DA 3CNLA 2AR9A 3K6RA 3WBFA 3TM4A 2XUZA 2BKVA 3B36A 3WBKA 4EKNB 1US8A 1E7QA 2AN4A 3KBBA 1CZUA 5BO5A 3AVPA 3LDFA 3PC4A 4B7XA 2WNIA 4F8JA 2ORVA 4UTXA 3ED1A 1C3OA 2ZRGA 3AFOA 2CXNA 3VOBA 4L4UA 2VJYA 3A1EA 3RM3A 1RBQA 1SPXA 5AICA 2XVAA 1TF7A 2OECA 4G8BA 1V8BA 1DXQA 4GPEA 1Q74A 3O47A 1NXOA 3Q7TA 4IDAA 1E1QA 3IBSA 4P6VF 4RVOA 5EKSA 1OFIA 3U48A 3NWBA 3TLYA 3SQXA 3K9CA 2AF3C 3BCSA 2H0AA 1NKSA 3R44A 3WLNA 4MGHA 1IZ7A 5A04A 4XWKA 4YDQA 3TFOA 1J8QA 4MO9A 1PS8A 2OD2A 2X42A 2AMJA 1FLAA 1D2EA 2EGHA 2XF2A 2EFGA 3EZ7A 2EV9A 2QMEA 4OQZA 4QD3A 3V6LA 2PUEA 4B6JA 3FRJA 2G67A 3B6IA 3OICA 2RJOA 4EX6A 5DBGA 2PTGA 3SE7A 1TA0A 2EJBA 4J75A 2PX5A 4K9NA 4OXQA 1FYFA 3DQZA 2AB0A 2XF8A 5HQJA 4YAUA 1QIHA 2W22A 1U2TA 1HWYA 3HJTA 3LCMA 4QUEA 3EEFA 2AMVA 3GRFA 4LMBA 3KYDB 2XD9A 3GZNA 3MB8A 1EA5A 1SAYA 4S24A 2BCJQ 4XGRA 3F46A 5T57A 1VI5A 5C8YF 5JNWA 2B5WA 4QFDA 1WXWA 2XGMA 2VPWA 1C1DB 2QN1A 4WERA 1VC2A 3C2QA 2HO4A 4HFRA 1TX4B 1Z28A 1TM4E 3HV2A 3LNTA 4JROA 3FFXA 3NKFA 3RDPA 3V33A 4B3RB 5DIFA 4QOJA 4ZK6A 3TLAA 2CV1A 3RJMA 4ILKA 2JG3A 4U3JB 7REQA 4H6PA 3CSSA 3GCWA 2WMYA 1XKTA 2JI4A 1KMHB 1RI3A 1FNSA 4XPIB 4PSVA 1XTPA 2E4XA 5KOYA 1MLDA 1U2GC 2PMCA 3QBDA 3RADC 3HLKA 1OLUB 1QUFA 3JW8A 5CCDA 3ZH2A 3K2QA 5DIZA 3N75A 4UNRA 1K7XB 5KIAA 1RCUA 3DUFB 2IODA 3L04A 1P17A 3KQYA 2D1YA 2UAGA 4KRGA 4BGUA 3IQXA 4ENTA 4FMPA 1JQLB 4Y6LA 5A3SA 2Y1WA 3BF8A 1QH9A 5U4XA 4Q4JB 4EMUA 1U8CB 5CVUA 4LFBB 1T3LA 3QI2A 2HMSA 5AVVA 4QUKA 4HQOA 5BR4A 1JB1A 1XQXA 2FMXA 3NLLA 3O3MB 4FFWA 4JUBA 1H65A 3LYLA 4LMAA 1NQAO 2REXB 4KE6A 3OEED 1Q0HA 5LP6C 2RGGA 3KSRA 3MIZA 1C3VA 2BFDA 4BU0A 3GFFA 2V7QA 2D00A 3A6GA 2IDJA 3ELUA 3FNGA 4DLVA 3VR3A 3LQFA 3KOYA 4FC6A 4HAXA 3TCKA 4A4DA 3OLXA 5EP2A 5BSKA 2C92A 2VO1A 2GT1A 3SE0A 3ZU4A 3EN0A 3HYCA 5NLLA 4LZWA 1CUHA 1U5BB 1VKRA 2OCIA 2ZRPA 3GFQA 3LDHA 3KX2A 3AVUA 3ZPXA 1GCGA 1J49A 1R4MA 3PXXA 2QSZA 4ZVMA 1VGRA 3N8KA 4N3NA 4LVNA 1SBIA 4L6IA 2EBWA 3AFNA 4IXMA 4ZPJA 4N3CA 2ZDGA 4XGNA 4RVDA 5KVSA 3EC1A 5GONB 4OP3A 3ZGNA 3L6BA 4DDVA 2GA9A 1IMJA 1CUFA 2IY8A 2O7RA 4NCJA 1VG8A 2CV2A 2AQ8A 1FMCA 1Z0DA 1XZJA 4MA5A 4GP6A 3K9LA 5JQGB 1C9MA 5HHTA 4L9AA 1OASA 1KO5A 3K1JA 1W0CA 5D3QA 5FEMA 2BFCB 2I3GA 2DOKA 2JZCA 5G41A 4CNQA 3MLAA 3S2YA 1RLMA 1GRNA 1RMYA 2BKAA 2CXRA 3QXGA 3C1AA 4RK1A 4XFKA 4C14A 4LJRA 1U0OC 2ZT8A 1IMOA 2YN2A 3RAEC 3BOSA 1O94C 4MVYA 3VUFA 3I9V1 5CHYA 2IHVA 2O06A 2O1XA 1RWPA 1NVXQ 1T5DX 3NEYA 5DNEA 2IUUA 3T41A 5LMZA 3QBVA 1E59A 4YDRA 1VBNA 4O4HF 5J2UF 3LPNA 4CTMA 3U7GA 3NNSA 5HF9A 5IAJA 4N8SA 1LC3A 1PAUA 4LXTA 5ULLA 1U3DA 4F6RB 5FBVB 3HVRA 4WPGA 1HTTA 3HN2A 3VNBA 3QHPA 1J9EA 1K66A 1AHNA 2Q1UA 3N5CA 5AWFC 4MCIA 1JR4A 2OCDA 2I7TA 3LFTA 2FK8A 1C9JA 5AKEA 4B9EA 3NOVA 3BIOA 4YLEA 4EZIA 3TECE 3GLHE 5CA1B 4QLOA 4C7XA 5ADHA 3R6TA 4BQIA 4R7ZA 3BRSA 2BHRA 1B6SA 4XASA 1T34A 1RXWA 2CHFA 3BC1A 1FXWF 2G1UA 5F7XA 4X62B 4Q37A 2A5YB 3A6KA 4R31A 4H27A 4V38A 3WKBA 4B8YA 5IMBA 4JUAA 4DR2B 2GR9A 3H8SA 4XGKA 1QZUA 5J3JA 1MW8X 3T12A 2TRSB 2B2NA 4MB6A 3FTNA 1ECLA 3G0DA 4LY9A 3T9FA 1K0FA 4A3SA 2OY0A 4OX9Y 1ZC4A 1F5SA 4QTTB 2CKMA 4HNQA 3E9CA 4Q3EA 4Q9DA 1RWMA 2FEWB 2HNKA 2JEYA 2JGFA 1M6YA 1R74A 3EVEA 3RASA 2PNJA 3CEAA 5L4SA 1OSNA 4WX2B 3IMGA 5FL7D 4G25A 3TXYA 5KREA 1CXZA 1C41A 1PJBA 2H0RA 2NT3A 3A06A 4WXYB 4JLWA 3WV5A 1U80A 3H8JA 4KYTA 2NVUB 1EUDA 3OQVA 3BIWA 3F7TA 3OZVA 2QW1A 3QNMA 3WYGA 1K3FA 5CTJA 3T7SA 2PT6A 3JASA 3OUTA 2XWPA 2AFIB 3BE8A 5HSGA 1G16A 3BBPA 4IQ8A 1I3CA 3WO1A 3OKFA 3BJEA 3H11B 4IDQA 5IUNC 3AILA 5C1IA 3SDBA 1ISJA 2PT7A 3VZQA 1AQJA 1AJEA 2EWVA 1XB2A 4LS3A 1UBTS 1DBIA 4GVLA 3I52A 3EH1A 4ZTZB 1W5TA 2JFWA 3T54A 4GUDA 2FN3A 1USIA 5WRFA 2ZE6A 4JZKA 5K5EA 3JD3A 3TPCA 2AS0A 4NIMA 4Y1FA 1DARA 2BBSA 3GZJA 3W1WA 4DE5A 1RM5A 5IW8A 3GEIA 1EP3B 3AW8A 1VIYA 5FBZA 2QIPA 2EJUA 3Q9SA 2AT1A 2DWPA 2XECA 4LYDA 5BMVF 3GN2A 3HJNA 2HXSA 4RHFA 4A1FA 4LF9B 1K8XB 1VDZA 1ZK1A 3GIDA 3MJHA 2E2WA 2MIIA 2YY5A 4KDFA 2AFHE 2I1QA 1Z7BA 1PX0A 2C00A 1I2CA 2FHPA 1F3OA 5K6AC 4EHLA 1PWXA 1ZKMA 1UQRA 4C7JA 4FFBA 4CU5A 2DQKA 4MGIR 4XARA 1UPTA 3KEGA 3L07A 1CY0A 1XPOA 4GWGA 1PS9A 3EFOB 3RU7A 3R6WA 5DI9A 2XYQA 1OLXA 4D0RA 4PZUA 5KX5A 2ZSFA 1VJRA 4QARA 5ALQA 4D1YA 1ABBA 3E9NA 3EQ7A 4PO3X 4C2TA 4Z86A 2ZYSA 4KQMA 2Q4RA 4XEHA 2PVCA 3GNLA 3BMQB 4HP8A 3S5JA 1X7DA 1MO3A 3CPJB 4CN9A 1QU2A 4G37A 1BDMA 4HQLA 2JFVA 1U6JA 5T3UA 3ESQA 3FB4A 1T5BA 2E4ZA 5JSFA 1F2TA 2P67A 3GLGB 1U9IC 4OHUA 1WY5A 3HXMA 1SKYB 1SG9A 1XZHA 5I5EA 4GOJA 4GM0A 1ZMRA 3C5EA 1YULA 3K5WA 3LUFA 4YHBA 1RWKA 1T6ZA 2M9MA 5EJ2A 3RW9A 2VLBA 4BNKA 4DMRA 3VKGA 4MUGA 3K30A 2WF7A 3DKVA 4I1UA 5CR9A 1GQOA 2HRQA 4PTYA 5DMXA 5HOEA 2P27A 1GQRA 2R00A 1B16A 1ZA2A 4B0PA 5K6RA 4EPYA 3UA3A 2XLBA 3B6MA 2QLMA 3ORHA 1WEHA 3QX8A 1YB4A 2ZULA 2VPXA 3I2JA 3W6OA 2V4MA 3D64A 3RUFA 4Q4LA 4CTKA 1XSEA 1KS2A 2O3JA 2CXQA 4DT1B 4IV8A 2D7CA 3L8HA 4ETNA 2CJPA 4A0QA 2GASA 3A4LA 3DGEC 4GXTA 2HIHA 1D9XA 3T4EA 2FTKE 5LNK1 5FOWA 5BN1A 2C2HA 2O2JA 3NT5A 3VHLB 1O97D 2OESA 5F3WB 4RK5A 2X0EA 1U7HA 4LNAA 1XV5A 3BA6A 4DA7A 3FYHA 3Q3VA 2XT6A 3TQFA 3UJBA 3D5EA 1GV0A 2ZJAA 1N32B 4PCLA 3CZ9A 1OFGA 1Q95A 2JAOA 2NVBA 3LAWA 1YL5A 3RYIA 1IXYA 4F7WA 3FZGA 3A14A 2O7NA 1VPWA 1TJ4A 2OZPA 3HZRA 1L4NA 1TVKA 3R5XA 3RC9A 3LVBA 1GAEO 1H42A 2NLOA 5EI5A 1DC6A 3B89A 4BZQA 1FYWA 2HQRA 4HDQB 5JALA 1JHAA 1GY8A 3RBZA 3AESB 1K5HA 3N3BC 4EY3A 3NNDA 3RWOA 4KLAA 1Q1ZA 3BK7A 4DCOA 5H9VA 2YS7A 1K63A 3VM6A 4DNPA 2AVNA 1J90A 1U3UA 1CWUA 1JB9A 1PDWA 1T0HB 2PLAA 3ABZA 2PZAA 1UEJA 2J6BA 3F74A 1Z4OA 1W75A 1CETA 2HJSA 4TLDA 1YONA 1QIKA 1JFFA 3DLPX 1EFRA 2YQ4A 4ZTUB 2XB9A 3G8CA 3ILHA 4KXVA 1O97C 4M38A 4QPJC 5HFJA 3SPXA 4B74A 5DLEA 2P77A 1B8OA 2IXAA 4OFBA 3SDSA 4A16A 3KQPA 1U8UA 3Q11A 2AK3A 1H66A 1OXTA 1VSQA 2JH3A 3O4GA 5G0SA 2BRUC 3W5AA 2PA0A 2VJQA 4GI5A 1KJNA 2I8AA 2KX7A 1ZNQO 1N2IA 1EUYA 2EYUA 1B0ZA 3FNQA 2H7YA 3FPGA 3ND8A 3ZZTA 1VCMA 4CMGA 2EDAA 2E85A 3MTJA 2G76A 4EHIA 4YAIA 5LXTB 1R8SA 2YMPA 3LECA 1NQUA 1M66A 3EW7A 3HYTA 4F2PA 3PVZA 4PC3A 4TMXA 5AMXA 1MF7A 1Z9BA 2Q1SA 3BL6A 2R6HA 2WD7B 5DE3A 3ZWMA 4NP6A 3A26A 4LZAA 1KR5A 4JLPA 2DP4E 1ODLA 4P4SB 3JX9A 1UBNA 5JFOA 2ZITA 1DJNA 1V11A 2HW8A 3FNBA 5AI9A 1N3YA 1YC5A 2RAUA 5AHOA 3SYLA 4B7ZA 1YRWA 5DT9A 3U9LA 5LU9A 1PYDA 3E9YA 1NMQA 2O6LA 2BCEA 1XXHE 4BNLA 2FLWA 2J3HA 7GPBA 1Q2UA 2RI6A 4FLFA 2IX9A 5IVKA 2OBMA 1UM9A 1C9DB 2X0JA 3DEYX 3T3EA 3GP8A 4U0JA 1FC0A 1EKXA 4NOJA 4TV9A 1K89A 3P0JA 5BRNA 1DU4A 1P75A 4TYMA 3CLRC 4WLFA 1WULS 1ZM3A 2H1LA 4RGBA 1F1BA 4PWZA 2CJFA 4QBGB 3N7UA 3UUGA 1T3TA 5E7IA 3VJLA 2O7SA 2KB0A 2G71A 3TDNA 3ME5A 2I6SA 1R0YA 3LX6A 1TW2A 5LUBA 4BNZA 4WBNF 2J32A 2JD0A 1NJGA 1NMZA 1Z34A 5EKXA 3SXPA 3IKLA 4QPNA 4EHJA 4HBZA 5KQMA 1XMOB 4QYMA 3DTYA 1QO0D 2EW1A 2P9TA 4RJJA 4YJFA 3RI3A 3ZD9A 2AZDA 2P9ZA 1KI3A 2E5LB 4IXWA 4OB8A 1YQWA 4JR0A 2WVGA 4CKXA 1WS6A 4Q93A 2XMGA 3GFRA 3N0TA 1G0NA 3OA0A 5I9BA 1YB7A 1HGXA 4FW9A 1NDQA 1PTJC 4TLLB 1Q7CA 4RMGA 4R1PA 1U7DA 4LMRA 2JLWA 3G59A 1IPHA 1QLJA 1R9MA 2IPMA 2WILA 5DPMA 2AN3A 4FJ0A 3RSFA 3FOEC 3JD4A 1FFCA 4NBTA 5TVKA 3MJ4A 1NXSA 1OZHA 2B4AA 4WLNA 3NZEA 4IRXA 5EKDA 3VR5D 4CODB 1GFZA 1WSAA 3T3HA 8LDHA 2VHTA 4R1TA 2GTIA 3S55A 5LD2C 1K8YB 2UU9B 2PUGA 1P2DA 1YDMA 4FW8A 3LSTA 3RHSA 1ZHHA 1CRQA 4QOFA 1TQDA 3O4VA 2F3UA 2JF0A 4H7DA 4LE2A 1Y8ZA 2ZUSA 4O5AA 3WICA 1AZLA 2QQGA 3BZUA 2XCOA 3KQKA 1Q16A 4BMSA 5BN3B 2H8GA 1LZLA 4I66A 4LSGA 2DUNA 5K8IA 5IZ4A 2Q6TA 1IM2A 1EK5A 2C1EA 2NUTB 4P3NA 2XLCA 1GUBA 1IJFA 1O89A 2IKSA 4NNJA 4WAUA 3C5HA 4ZDKA 1DXHA 4CV1A 1BO6A 1EDBA 1L4EA 2IXGA 2RK6A 3D1JA 4Q7LA 5DRYA 3X1MA 3FKQA 2PJDA 3SYRA 4RMJA 3TR0A 1VL2A 4M1SA 1DPGA 1RXSA 3LYUA 4R9UC 2J3IA 3HBMA 3TG8A 2GNOA 3HNRA 1H1TA 3A3NA 4YQFA 3CRMA 1SQFA 3SJ7A 3BHIA 2DFNA 1NG9A 4Z9AA 3C1UA 2Y4NA 4FT4A 4UVHA 1CY8A 4WA8A 1WD7A 2ADFA 4LPKA 2YZGA 3I2GA 4J0EA 2OB1A 4ZYWA 1O3YA 1FS5A 3ENQA 4FSDA 3ZHYA 4BASA 1PJ2A 2QVCA 2ZR9A 4IOKA 4U9IS 4S2UA 3WR5A 2ZB8A 1NV8A 1X1AA 2LPMA 1NPDA 3TZLA 2Q7OE 4R98A 3U7JA 2DSTA 1EGVB 4GXQA 3A11A 4Z4EA 3JQRA 4FR0A 4Z4CA 3OLWA 4PGMA 3HA5A 1OA0A 3F9CA 4ZT2A 1C29B 2IXEA 3EGDB 3GJSA 3ZGLA 3IUBA 2GZHA 3LX5A 5T6BA 2FEMA 2VK2A 2XV1A 4E3WA 5CFQA 1F9EA 3H2YA 4AYTA 1U0SY 2JVJA 1BNCA 2BZ1A 1F60A 3C3PA 3CW2A 2AOVA 4IIEA 5TQ2A 4B3FX 5K8CA 3U7EB 2Z0MA 2A5LA 4TKUA 4E31A 4CEIA 3ANXA 1ZMXA 3AHGA 4UD2A 1ZIYA 2IOFK 4Y9TA 4MAAA 3EVFA 5ITZB 3SHTA 2WU1A 1SC6A 2Z08A 4C0HA 1CY1A 1FFBA 4X7BA 3IHKA 2VF7A 1VG9B 2QAGC 2J31A 2HQ1A 3LBAA 4JLSA 3WGKA 3PNPA 2E5WA 3IMCA 3GJ7A 5AUOB 3PI6A 5BW5A 3EIWA 1YR7A 1W34A 3MJFA 3QNWA 4FKMA 1G3QA 3CZ5A 4LYEA 4YC7A 3AUFA 1PDVA 2RKWA 4J7UA 4X91A 3UJ8A 3ZKAA 2W8BB 5FNZA 1H8HD 1J42A 2A3RA 2ZETA 4TRJA 4JT8A 4WN3A 1Q22A 3SXJA 4HDNA 3VH4A 3RSHA 3A9TA 3ILXA 5COBA 5D3ZA 4BEJA 3C7DB 2Q21A 4OM8A 5CLLA 4BNIA 1XTRA 1GCIA 2DHQA 3UF0A 4HQ0A 2IL1A 1PL0A 5IFLA 3H0KA 4RCYA 2VKQA 5AI5A 1G8JA 1JEQA 3HMKA 1ZUD1 3GLTA 4JOBA 5T7BA 2PKEA 1S8AA 2RGEA 1RBMA 4LC0A 3M9WA 3HJRA 4ND7A 4MHSA 1VE7A 4HGYA 1JIXA 3AUAA 4NF2A 1TYCA 3TGWA 1TTQB 1WXEA 3EZ2A 4C2AA 3EG5A 3CZMA 1U8AA 3C85A 3ZJ4A 1QH8B 3BKXA 2BBWA 1ZRSA 3FTPA 3H8WA 4Y2PA 4M6WA 2VDKB 3AF5A 2VPZA 1FNCA 3L06A 4J29A 5G3YA 3OZ7A 3F6YA 4QNMA 3WLHA 3MLEA 1E2BA 3ND7A 3FWZA 4JAVC 5HIJA 3LA6A 5D3MA 1Y7IA 1KIMA 5AKIA 4DIUA 1NSFA 1NP7A 1F3LA 1U9YA 2HBQA 2VJDA 4ODIA 5BQ3A 2J5RA 2W0MA 3Q8LA 2YVUA 1ZOLA 5K3AA 3X1WA 3SEQA 4CM8A 5AJZA 1WZNA 1P2SA 3RPEA 4ITUA 1SHUX 2GNAA 2NN3C 2ZANA 3G9UA 2CLMB 5EIBD 5HRUA 1H6CA 3V4LA 1KWGA 1NUSA 3ZHBA 1Q6ZA 1S4QA 4KBFA 1TIKA 2VFAA 4J9UE 2V6MA 2YIDA 4ZEWA 4H1WA 2V03A 4R51A 2OPHA 3LFHA 2JW5A 2AF4C 4IJQA 4IIBA 4HT3B 4D9MA 3TKLA 3DJFA 3PT9A 3G9XA 3PDCA 3H5WA 4ZARA 5JWHA 3TOZA 3V4FA 1THMA 4MUKA 4WKGA 5DEOA 5K0EA 1C30B 4WT7A 3USZA 2J3KA 4CF5A 2I66A 3NXSA 2YVLA 5EL0A 4IHJF 1HZZC 4WECA 2ZRMA 4R40A 1QGAA 1ZSVA 2IXBA 3ZUPA 1LGYA 4UBKA 1AUXA 1YCFA 3PUIA 4REQA 2GCNA 3GNQA 2XNDD 1ZH0A 3H9GA 3QKUA 4LKRA 5CNIA 3H2HA 3SJCA 4ZIRB 3OFVA 4B3TB 3E61A 3KTDA 1V2GA 3K9NA 4MRPA 2PWBA 4O4IA 1DC8A 3B9PA 2QMHA 3B5IA 4CLXA 4IGKA 4XB6B 3WZMA 1BQ4A 1K7EB 5IXJA 3K3PA 4YMGA 4MKGA 4UUNA 1E2FA 1GEGA 4QICA 1VRVA 2B3DA 1Z8NA 3PYLA 4LA4A 1M34B 2GKSA 1Z6ZA 2QM0A 1EHIA 3ACBA 1IY1A 4J2HA 4OX9B 1BVRA 1PJAA 4HXGA 5DVZA 4XQCA 5KNLA 4Q9KA 5JVDB 1EQAA 4I19A 2WWXA 1YZVA 4F5EA 5A3RA 1OH7A 4DQLA 2ID7A 1YJXA 2FX2A 4AJHA 4BGEA 1DQRA 5TMDA 3GRCA 5I8PA 1K2WA 2FY8A 1C7JA 2Z4SA 4FONA 4IDPA 1GZVA 3GJ0A 4O02B 2Y27A 5F51A 2B61A 3WZ2A 1OBHA 4XYGA 2CUNA 4A6PA 1EK0A 4YRRA 3SEFA 3I6IA 2C82A 3UW1A 4YX9A 3MYYA 4YR7A 4H4DA 4KZKA 3CKKA 2I2FA 2PMFA 5BXQC 1UKVY 2P9CA 1BA3A 4MITA 4HAUA 2YOGA 1BXRB 4PU0A 3WIDA 4CE6A 2CHUA 2GJ4A 2HADA 2WQ6A 2JHGA 2VQ3A 3RD5A 4RMHA 3T3IA 2ONKA 1RQ7A 3P1JA 3BXZA 3SZLA 4FDAA 2X9QA 3KB8A 3PKZA 3WYCA 2HU8A 3IVMA 4D6XA 4QXOA 2RDMA 4Q9LA 3BG5A 4MIYA 5D6OA 2P6PA 2ZJ6A 1BTOA 3K0BA 3EUAA 1Z8FA 4Q03A 3OKAA 3UY4A 1CEEA 3P0EA 4YYZA 5B58T 2PK3A 1E18A 3DHNA 2C5GA 2BTEA 1S96A 1SMKA 5K2OA 3GEEA 2MMGA 2ZE8A 2PSFA 1N0VC 1OXUA 3CX6A 3G2MA 3ISVA 3JQBC 2R9VA 3NASA 2ZW9A 5LUAA 5AJHA 1I5EA 4N6OA 4P9NA 4BFCA 3LT5A 4BRUA 3T9AA 3VDQA 1UM8A 5AO9A 5E9JA 1P61B 1GTZA 1YRQA 5BSMA 3ZGOA 2FH5B 3A9WA 3SC2A 2QRNA 2BFEB 1BHJA 4NMMA 4CF6A 3FTDA 4YROA 1XX6A 2QDKA 5LCXA 1P3DA 1A9ZA 2BJVA 3WWYA 4DB4A 1CE8A 1HOXA 3T9CA 3HM9A 1GGMA 3BMXA 1UXOA 4KFUA 5JEDA 3UK0A 3K31A 4V0QA 1USVA 4FCVA 1XYYA 1Y7TA 3UGQA 4FN4A 1BW9A 1O5OA 4G9EA 3M83A 4DA0A 1HE8B 4DRYA 4KAAA 1GUDA 3OSZA 2D4AA 3L40A 4RIGA 4IIJA 1O4VA 4NU0A 4XR9A 5ERYA 1WVMA 2OHFA 2XMRA 4EG8A 1Y3FE 3ORSA 1JXAA 4Z2YA 2TSYB 3GR6A 5ED4A 2OBFA 1ODSA 4B4DA 1X7WB 2GJAA 4DYHA 4ZHQA 3ICQB 4Q48A 5AXCA 1NVUQ 1MJHA 2IXFA 3DNMA 1KK1A 2ANBA 1PSWA 1T9GS 4Q3NA 4WNYA 4E32A 2PIAA 1T5SA 4W5TA 4RVCA 3NAMA 3ETHA 3K1AA 3KZXA 1UWLA 3FTCA 2FQWA 3LBNA 1J4AA 3VU0A 3MUOA 1NHGA 2W6JD 3G2LA 4LEIA 3DPUA 1UOPA 3ICEA 4NC9A 2PSEA 2B4TO 2WIFA 2WSBA 1G1AA 4IQFA 2XHEA 2INGX 1MCZA 4BE7B 5L6LB 4KIWA 4R05A 5CXSA 1KP2A 3HJUA 1NYQA 2X1VA 4N9QA 2AX3A 3BIXA 4AYXA 3CURA 5C8YB 2EQAA 4W1SA 1A69A 1GZ6A 4N5DA 4CQLA 1JR6A 3BFJA 4PQYA 3DZDA 4H7IA 3QXHA 2AA3A 4P35A 1PYGA 2WI8A 4ZAYA 5E7QA 4RA9B 2HFJA 4JIGA 1OH5A 3KWMA 1VRCA 2W2OA 3KQUA 3ROXA 1U9CA 4BX2A 1C9NA 1GKIA 4AQ7A 2WV7A 2ZIAA 3OWOA 3GA7A