3UJPA

Structure of mntc protein at 2.7a
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
TEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNVKDVPSVVLTEGIEPIPIADGPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLEQVPANQRFLVSCEGAFSYLARDYGMEEIYMWPINAEQQFTPKQVQTVIEEVKTNNVPTIFCESTVSDKGQKQVAQATGARFGGNLYVDSLSTEEGPVPTFLDLLEYDARVITNGLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Mn transporter subunit
publication title Arginine 116 stabilizes the entrance to the metal ion-binding site of the MntC protein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
total genus 77
structure length 274
sequence length 274
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3ujpA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3ujpA02
4HN9A 4MO9A 1M34A 2AFHB 3NU1A 5BVHB 2XQVA 5JPDA 3MWFA 1PSZA 4LS3A 3EIWA 2MINA 5KOHA 4WN9A 4G07A 1G21A 1G20B 3CX3A 4N01A 3AERB 5CX1B 1QGUB 4K3VA 4ND8A 1QH8B 4DBLE 4B8YA 3HJTA 4WESB 2OV1A 1M1NA 3AESB 3MFQA 4UDOA 1H1LB 3MINB 3U7QB 5I4KA 1MIOA 3AEQA 3ZK7A 4FKMA 1L5HA 1EFDN 3MD9A 5JJ5A 3G9QA 5GGYA 3TLKA 5HDQA 2WHYA 2R7AA 4OXQA 2Q8QA 2PS3A 4GICA 3UJPA 5JG7A 5KOJA 3PDIA 4H59A 1QH1B 3HXPA 4UTOA 3ZTTA 1M34B 3R5SA 4INOA 1KAEA 1N4DA 4WZBA 5CR9A 5AFSA 5M3BA 4OVKA 2MINB 1N4AA 5KOHB 2WI8A 3AEUA 1G21B 4FILA 1M1YA 5B58T 2XV1A 4TKVA 3ZK8A 2XUZA 4ND8B 1K2VN 4TKUA 4H0FA 2O1EA 2OV3A 3AETA 2OGWA 3GI1A 4IRMA 4G09A 2PHZA 1XVLA 1M1NB 3BE5A 4WZAA 1MIOB 3AEQB 4BBPA 1L5HB 3PSAA 1K7SN 1N2ZA 1K0FA 2ETVA 3LHSA 5KHLB 2AFIA 4M7OA 1KARA 4WNAA 4CL2A 5KOJB 3PDIB 4MX8A 1N2CA 3AERA 5JOQA 5BVGA 2XDQA 5HX7A 4NNOA 5M29A 4WZBB 4WN9B 3AEUB 1M1YB 3K1AA 5FLYA 2X4LA 3TEFA 4TKVB 3AEKA 3HH8A 5GGXA 4UTPA 3AETB 4MLZA 2M6LA 4XPIA 4PM4A 2QI9F 2RG7A 4WZAB 3TNYA 4OXRA 1FP4A 5M2QA 2AFHA 2PS9A 4PAGA 5BVHA 2PS0A 2AFIB 2XH8A 3MWGA 4FNAA 2R79A 2OSVA 4WNAB 1G20A 1ESZA 2PRSA 5CX1A 2YNMC 1N2CB 1QGUA 4HMOA 3ZK9A 4INPA 1QH8A 4NNPA 5BVGB 2XDQB 2XY4A 4HMQA 4WESA 2Q8PA 3AESA 1H1LA 3BE6A 3LI2A 3MINA 4FI3F 2M6KA 4MDYA 3K1AB 3U7QA 3AEKB 4UDNA 4TKUB 4LJSA 1KAHA 3EIXA 1TOAA 5M34A 1PQ4A 4XPIB 3ZKAA 3R5TA 3PSHA 1K75A 2YNMD 4HMPA 1QH1A 1FP4B
chains in the Genus database with same CATH superfamily
1URPA 2O3RA 3AINA 4QYMA 2QRGA 3PJDA 5B3KA 3JS5A 3ZH2A 3Q7QA 3TL6A 4L8WB 4N01A 1N77A 3E5NA 3UJAA 1PNQA 3AQ4A 3RUCA 3KSBC 1P9RA 4C0AC 2FN9A 3O7WA 2GUWA 3SM3A 3PEUA 5J5CA 3HCWA 1TGVA 4FFPA 5CNMA 1AGNA 1EFUA 3IA7A 2ZYAA 1N2SA 2MYNA 1XAIA 4DIKA 1Y1PA 5JJ5A 4BGDA 1Y3AA 4P5PA 5AXBA 3A28A 5CH3A 5DGTA 2WJHA 2TECE 4RVOA 3LKBA 3VI4B 4BNFA 2B8TA 1X38A 5TDHA 2O8DB 1Y1TA 2RHMA 2BE9A 5DW0A 3KP1A 4P3YA 4N82A 5E2IA 3WYFA 4Z54A 3I37X 1X8XA 4XQ0A 5A4AA 1C9NA 1PFVA 5ECGC 2PV0A 1L3IA 3AJAA 2G88A 4WZZA 2JJ1D 5B58T 5T8KA 3FTQA 2QAIA 4K6MA 4UFOA 3F1LA 4FCVA 1V0JA 2J4DA 3IURA 2PKQO 2DGDA 4DWWA 1CUJA 3K70C 5SZKB 5AKJA 3N8IA 4I66A 5JDCA 1BMFA 1TZJA 1SHJA 4IMRA 3WQQA 4GQBA 5DK6A 3SNKA 4TQUS 1KS2A 3KQYA 3P4XA 2GBLA 3SZOA 5A5DA 2LIPA 2NW6A 2NM0A 2Z98A 4HYYA 4MIEA 5ALMA 4CMEA 4IVRA 4XVCA 4HAYA 2YZGA 1EFPA 2ZUUA 1ENOA 5EC8A 2C5HA 1COWA 4KEAA 2AMJA 1F20A 5CT4A 1RXCA 3F4KA 5E6SB 4DRYA 3W1VA 4RELA 2ADMA 3IE2A 3LUDA 4OQ4A 2C9MA 4FYHA 3U4CA 4YAGA 4MQBA 1OIWA 4E1AA 3WK5A 2PL9A 3W90A 3O9VA 1RCTE 1Z6GA 4G5GA 3PIIA 2JJMA 2GM4A 5THQA 1W59A 4IDHA 2FY8A 4JHXA 1P1JA 1H22A 3RW9A 4JLAA 3G5TA 3INYA 2PFGA 1W0KA 1M2OB 5GGXA 1IG0A 2B0JA 3EK2A 4Q82A 5SYNA 3VOSA 2MYUA 1JDSA 4BNNA 3JAKB 4TLBA 3IT2A 4LF5B 2DFTA 3FYUB 1MO6A 1PZHA 1N9ZA 3TR6A 2PS9A 3SPXA 4JVMA 2FHPA 4PHGA 4AT1A 3TNDA 4A10A 1NRJB 4EJ6A 1E96A 2HPAA 4MIOA 3ASVA 3P9ZA 1YHZA 2C9CA 4XW2A 2UUOA 2ZFUA 3H9QA 4Q0MA 3AF6A 2A59A 4BNVA 3IQZA 1IHOA 1X19A 4ZVRA 3AG5A 4IIFA 4HH0A 5G0VA 3ORFA 2HWYA 3NTXA 4N8SA 3U7QA 5CBPA 1O95D 1V39A 3I9FA 4LPSA 4MHTA 1E3WB 2E5FA 1DO2A 2HA7A 1JFRA 2ZIAA 4BTVA 2POQX 2RI0A 2PEZA 1Z33A 4JMPA 4U6SA 5AVOA 3N2EA 1R3DA 1O4WA 5B2FA 3FFXA 1KI2A 5DTRA 3TLCA 2AZXA 3DZ8A 2F1IA 5AVQA 2DZDA 3CF4G 2BBWA 1WQ3A 2R6HA 5FNVA 1GQFA 1NX6A 2EFCB 3A6ZA 3V33A 4DT1A 3VNQA 2PD4A 3M4ZA 5JNUA 3I4CA 2A84A 4HAXA 3SBXA 4RHTA 2KYRA 4QBKA 4GKKB 1OPRA 3OPNA 3PA6A 3T54A 2GHQA 1SXJC 2ZVPX 4BYGA 3EEYA 1QGYA 2B9EA 3KYCA 1IXRC 1OT5A 1EFVB 3UHFA 2WTXA 3FLMA 1A5SB 2BIFA 2C29D 1KQPA 3K9WA 1JEEA 4PVCA 3ZE2B 4B2PA 3UUEA 1MTZA 1KDOA 1N8KA 4C2TA 1K92A 3LX5A 5EE3A 2KQUA 4FDLA 4MQ4A 4HEA1 4N0QA 1T5LA 3F49S 1P5ZB 1O08A 4GC5A 4PHHA 3UJPA 4F2WA 4MRMB 4J0GA 3QEBZ 4H1VA 1W0JA 5K03A 4YRGA 3ETGA 1CY1A 3QFFA 1LEHA 1KERA 4ND6A 3QJYA 4M7WA 4H4EA 1TD9A 4JXKA 5L6LB 2DBZA 1FUUA 2VEOA 4DWJA 1K08A 3AKYA 1JQEA 3A6JA 2HA2A 1XQYA 2L82A 5C46F 2PUWA 3P9YA 1C81A 1SKYB 4BTEA 1XRRA 1K8RA 3N8DA 3K4PA 1EVEA 1VPDA 4OBEA 3U3XA 3UW1A 5IYZA 4JLJA 1U04A 1Z13A 3DZGA 3KOOA 4A5SA 2ZYHA 3L1UA 4J9UE 5BMVB 3CNEA 2QXTA 1JIUA 1P60A 1KHHA 2A0FA 2V03A 4CM8A 1JE0A 4KFTA 2C4HA 2LW7A 2OORA 3AF3A 5D5PA 3RS0A 2FAXA 2WAXA 4A27A 4EPXA 1NZJA 3OOHA 5ED4A 4AKEA 4G37A 1EVZA 1UKEA 3IT0A 1VKJA 2HF8A 3R7BA 4LF6B 2EFYA 4QOJA 2W9XA 1NSFA 2ACEA 2F00A 4ZD6A 4CDMA 4URXR 5E2AA 1VG0B 3BAZA 5TVKA 4E6PA 4BKMA 5AVSA 2P2SA 1AQLA 5C8VA 2A67A 1N6NA 1TD1A 1DAHA 2ATIA 3P9RA 5ERGB 2OXTA 4DLBA 3LPAA 1T4BA 1HE3A 1RXUA 1ZM3A 1FDIA 2XMGA 3LUFA 3MWEB 2GCGA 3TQOA 2JDIA 4D57A 4E0BA 4ENTA 4J9VA 5JYCA 1DL5A 2V7VA 1OI3A 2QTGA 1QZ3A 2VYCA 2WU1A 3KUXA 3PEFA 1K6MA 1M6HA 5HIIA 1W6RA 4AP9A 4ERNA 3KR0A 3TW8B 1YQUA 3GA0A 5HUHA 3HDYA 4UTNA 1MD9A 5JEDA 5M2QA 4FWTA 4RIHA 2HWUA 1EA7A 1YS2X 4JL5A 3PX2A 5LNK1 1UXOA 3USES 1TDJA 3RLIA 1I6KA 2GZDA 3MQ4A 4D9FA 1ZO8A 2ZRGA 3LXMA 4IO0A 2Y66A 1ZOIA 2Y1DA 1WZEA 2XTNA 1X7XB 2H4HA 2Y4OA 2P11A 3NP7A 4ICIA 4QKQA 3EJ6A 5E6RB 5LZ8A 5JRZA 3RFXA 1NMEA 4Y1GA 1MQ8B 3PWZA 4GUAA 2OGUA 3MJRA 4ZCLA 4JU8A 1KDVA 3MCTA 3HWX1 5DSTA 4R2HA 1J1IA 4XVUA 1PJ8A 1QFMA 2O4UX 2R4QA 2R5NA 3MCAA 3FR8A 4B6PA 3PQ7A 1DC3A 4UDNA 4XIIA 4C4AA 1JMYA 4HFJA 1ZICA 4Y9TA 3MSCA 1EHCA 4JT8A 3HG7A 2SNIE 4ZZ0A 3OTOB 3SF8B 4GW3A 4GM4A 3C6BA 1B14A 3DFKA 3R5HA 1TO1E 3VDNB 2VTBB 3R7AA 2GN8A 2G9UA 2VI5A 1TLLA 1KZ1A 3BWBA 3OE4A 1T24A 3OTHA 1ZH2A 3AHIA 4JCCA 2X5OA 3HVJA 1G8HA 4IV8A 4TLEA 3PR3A 1RCFA 1U2EA 2RGRA 3AERB 3W9UA 3C7AA 3RSFA 3HEMA 4RMIA 4F60A 3P45A 4X5OA 5AHWA 4BFZA 3Q6MA 4MW4A 4F9FA 3LJKA 1FU8A 3MS2A 4HH3C 3V9AA 4F1JA 1LRJA 5HCNA 2ZIZA 1QBGA 2GPBA 3H6HA 3SU8A 3ZX5A 4MZDA 2NIPA 4ZHQA 2P4HX 4BO7A 1KOFA 1PJ3A 2EG9A 3CNQS 2FPPB 3R7LA 3SI7A 1FXWA 1Z7EA 2EXXA 2C5SA 3MGCA 4RVHA 3TB4A 2Q28A 1Z2NX 3KYBA 4EMUA 3PT9A 2WUGA 1TM7E 2BLNA 3P52A 4LOIA 3IP9A 2H2IA 3H11A 4DLKA 3FWPA 3U4QA 5HWSA 2YZ7A 3LX6A 2QMQA 2AS0A 3ZIDA 4FEGA 4CNQA 2ZPAA 4AMBA 4QYWA 1I36A 5BR7A 1PX0A 4IINA 4Q3EA 2JLCA 3KEFA 4C6HA 3A1VA 2PD3A 2XCSB 3COVA 1W30A 3PEYA 2O59A 4ZT7A 2BGWA 1OWPA 3E84A 2Y3IA 3FCEA 2CKMA 3UXEA 2V7XA 3IE1A 1W5TA 1MB4A 1QB7A 1P45A 3KAPA 2ODQA 4HVLA 5EA2A 2E4AA 3LY8A 2GHRA 1P73A 4JEIA 3K2EA 3PNSA 4AZ0B 3LQ4A 3MJEA 5K6AA 2E4WA 3V4FA 4FR5A 4Q24A 1YFZA 2YC4C 3IQGX 1TC1A 1AN9A 3KFXA 4X84A 5F1KA 2QRJA 4UE2A 3RT1A 4C76A 4CZ2A 1LK7A 5KB3A 2ISCA 4MMXB 3HFSA 3OHMA 4F38A 3OIYA 1F8XA 3B12A 1NQXA 1KU0A 4BO1A 1MAAA 3F3YA 2XCIA 1KFEB 3DDNA 1XGKA 3ORRA 1FB5A 4D9HA 2NZVG 2FSPA 3W5VA 2Q3BA 4GM1A 2QVYX 4ZAFA 6GPBA 4WZBB 5JISA 4E1BA 4XWOA 4ZPJA 2EQ5A 3A11A 1EFHA 1SKBA 1JX6A 1DEAA 3FFAA 1JHOA 5EKSA 1Y5LA 5G1NA 1EUQA 3BHJA 3GFQA 4IXDA 3AVYA 5LP6C 1Q14A 1T10A 3QY0A 4ZEOA 2CBXA 2XR1A 3NIFB 3K0FB 5B7QA 4D26A 2BLLA 4IQ4A 1SAYA 4X6XA 4FOTA 4TVBA 1GGHA 4J75A 1M72A 2I67A 1U3CA 2NXEA 3T7CA 3NM6B 3IEXA 5TQ0A 1LNQA 3I23A 2MSEB 3OI7A 5I9IA 4QULA 1CZOA 3AF1A 3RSLA 3FXAA 4UUBA 3TXXA 2A4KA 1DT3A 1U2TA 3DMTA 1FTYA 1VI6A 2J9ZB 4J3JA 4FNMA 3RC7A 4BU0A 5DNEA 1I3OA 2HDHA 3O3MB 4RD6A 2NQTA 2Z2KA 1HLDA 1ATIA 1Y9ZA 2YYAA 3PRHA 4DY6A 2LDBA 3W3AD 4BTLA 4X65B 1ZKDA 1CIVA 2Q1YA 1DI0A 3B7GA 3RSOA 4YAOA 3LA6A 1V1MB 4B43A 4INAA 4B75A 3NTUA 4HDRA 5F9MA 2VAPA 4IKOA 1JG6A 1KY5A 1R5BA 2I7CA 4KDRA 4PNHA 4M21A 3RJ9A 5ITWA 2W6IA 2WJPA 3VZRA 1JPVA 4U8HA 3WZ2A 5I45A 1AB5A 1MABB 2GBCA 3CE9A 3LA8A 1V7CA 4P86A 4YDRA 2AFHB 1M2FA 4YROA 4MDFA 2WHPA 3EDMA 3TOVA 5LXTA 2DRIA 2XMZA 1G17A 2XGMA 1NN1A 1CQZA 1UZNA 3NHFA 4MGZR 5JAUA 1U6JA 1GZ3A 3I9V1 5DBOA 16PKA 3T4PA 5CBKA 3T4EA 5C8YF 2VLIA 4X0EA 2QGNA 3QKRB 3MUEA 5E6UB 1XYYA 5IDQA 1XFAA 1Z4NA 1J2YA 1V6SA 3B51X 1GVHA 3DOJA 5FPTA 3UICA 3FBTA 4XDYA 5KWEA 1RSZA 5DBIA 4UEKA 4I4IA 3VPSA 3OPVA 4X41A 3L5OA 3M70A 3WLOA 1AO3A 1G60A 1NUPA 3CX6A 4FC6A 2AJ8A 2DG2A 3PENA 3H7AA 2Q3DA 4WOKA 2ZTUA 1SKYE 2AV6A 5F5LA 1LC3A 3W6UA 1SU4A 4U7TB 4MGHA 2MYTA 3URMA 4AJPA 3SC2B 4ZTZB 4W9MC 1KY3A 2VPQA 1ZD2P 3CLHA 5A4DA 5H81A 1EUDB 4LRUA 5KAPA 2J7PD 2R8PA 4O2BB 4UZEA 4LE1A 3L9WA 2P2LA 4WKNA 3HTXA 4QUAA 1O96B 4PSKA 2LE0A 2G1PA 3LDUA 3IBCA 1OQAA 1U2ZA 3HPQA 4CG3A 1NVVR 3X1YA 2BMAA 2LD4A 1AUXA 4DLRA 2JPDA 4ILKA 1GUDA 1KQ3A 5BT8A 1L3BA 2ZXEA 5DNUA 1PGNA 2V54A 4UCWA 1ZGJA 2B82A 3G17A 3L6RA 1L5ZA 4YP1A 4DFDA 1ONBA 1A71A 5IDWA 3REQB 5AIBA 2HF2A 4LDQA 3VX4A 1JIJA 2VF4X 3NDBB 1CEQA 5KNBH 4RVDA 1BDJA 2XWJI 3W7AA 2P67A 2R25B 2BEKA 1J00A 4BFYA 4Q7KA 3MJ4A 1VSVA 3SVLA 1IRIA 3SN6A 3KKNA 1N2CA 3KJHA 1IB6A 3PJGA 3LT5A 4H31A 1Q1EA 3KKEA 4KI7A 4DV3B 1XCGB 1V4VA 4NNOA 2XKAA 4MNTA 4ZAYA 3BWYA 1F8FA 1U90A 2WKRA 3CLRC 3OPQA 4GRAA 4UNQA 3RTAA 3TEFA 1WUTA 1ZL2A 3T3MB 3UG6A 3G2JA 4MICA 3RIMA 2CMKA 5C3UA 1P4SA 4IXWA 1LW7A 4RS4A 4Q47A 2PUGA 1V6AA 3L02A 5D3QA 3PPYA 2Q3CA 3FPGA 2CMHA 2EATA 2BM0A 1YI1A 2F3SA 1KMHA 1W581 2CNWA 4YA6A 3T5CA 1O57A 1Z5OA 5EMJA 4C4OA 1WB9A 3OEYA 3H16A 2FWJA 4L9AA 5ICEA 4F96A 3MZ0A 3DOCA 1SQFA 2VP0A 1A5ZA 4MTCA 1TEXA 3E8SA 2C97A 4N5IX 4RHFA 3ZYZA 4D3SA 3BHNA 1YS7A 3CR3C 1ZK1A 5G1OA 4DPKA 3TECE 2LCQA 1DZIA 3FMIA 3JALA 4YCNA 3QWAA 2ZU6A 5JARA 1U8FO 5H02A 3PQCA 4BZXA 2OZVA 1XZNA 4K6FA 4ZALA 1ESMA 4R2IA 4DPLA 1RAIA 4B3IA 2FUG6 2IUFA 4LK3A 4KIUA 1YR6A 4NEQA 3CM0A 4I5GA 3GDWA 3K0AA 4OV6B 4QFBA 4YTEA 4HS9A 5JXWA 1KMNA 2AWNA 2G76A 4KYTA 3QU7A 1OJ7A 5ULLA 5K6TA 2IH5A 3IX7A 4BAZA 4DGSA 1PZEA 4WE3A 4D0RA 1UC5B 2GA8A 4PLGA 2Q4TA 2LVBA 1DBPA 1ODJA 3ASYA 1E2LA 5JCJA 1WHTA 3LCJA 2Q5IA 4O4LF 4OBBA 3WBFA 3WL3A 1J49A 5BOSB 5C7YA 1YCGA 1U98A 2G1AA 1YDGA 1L4FA 2WF9A 3N74A 3P4UA 2RAUA 4HDNB 1PWEA 1USKA 4MR9A 4YR7A 1EDZA 3A1UA 2ZPUA 4J43A 3RVDA 2FCRA 1OVMA 4CM7A 1VPEA 1OF1A 3S2IA 1UMBB 1V6CA 3V34A 4HZUA 5AKXA 3T7RA 4R1MA 4Z1MD 2AG5A 4AJKA 2A92A 4KK3A 4EWLA 2P90A 4UDYX 4DDHA 5TPWB 2VJQA 2BI4A 1TQ4A 3LO5A 4WFKA 2BV3A 3V3TA 1SKUA 3VO8A 4AWBA 1D9XA 1BOOA 1VCNA 1PVVA 3KPYA 4DIBA 1RWBA 1Z12A 2AZ4A 4J16C 2RK3A 2WHXA 1UKYA 5FBQB 4A8JC 4H7EA 2C2WA 4BWGA 4ED9A 1FDVA 4TS1A 4JVLA 3CJQA 4FILA 3Q7EA 1JHDA 1MOZA 2C4WA 1J4AA 2J08A 3LP8A 1IQRA 4NX2A 4ND8B 2F1HA 3UHPA 5I4BA 3IP6A 4YDQA 3KT3A 2K7ZA 1A8UA 3LW7A 4X6UA 3JARA 1XVLA 3FSEA 1IAQA 1UJNA 1YL6A 3JVEA 2VK8A 2K2QB 5EL0A 2D1FA 4WZBE 4IYJA 2WJ6A 1HETA 4OUKX 3A0RB 3PXDA 3BGIA 1G5IA 3V00A 3X1XA 4DAOA 5KREA 3BBPA 4CM9D 2YHIA 3HL4A 1SBZA 1Z2DA 1HDYA 3MMZA 5DRYA 5ESRA 1PIWA 3S1AB 3NIGB 1NVWQ 3LPCA 3LUHA 4YMWA 2G9RA 4D4KA 2YXEA 1RQRA 3AFNA 3LVRE 4HSGA 3RIHA 1AS0A 2BMVA 4HXYA 3TSWA 1RC8A 1RMQA 3MMPA 4G0WA 1AT1A 4YBRA 3AUXA 1NLYA 4NBRA 1C7EA 1G66A 1S6YA 3MCVA 4R05A 5DYWA 4DSAA 9ATCA 4XD7A 1NDQA 3VYWA 3U81A 4YLEA 5G41A 2CXOA 4D3XA 5TY0A 4D46A 1G9TA 2DT5A 3VDQA 1U9IC 3DVRX 2NUAB 1QK4A 3ZLTA 4KN6A 3VNBA 2GEUA 3KXIA 2J9YB 4DVJA 3ZZ0A 2AFRA 2DP4E 4JB3A 5AI5A 2F43A 2VRWA 1ZUHA 4ZIRB 3VSBA 4ER5A 3QLUC 5F9FA 1ZITA 4QECA 3ZE9A 1NBWB 2V58A 2IOYA 4TZTA 1DUSA 1HE8B 1B2RA 2RB4A 1BJKA 2W6JD 4HUQB 4D8YA 4D02A 4ODIA 4P32A 2GAOA 3UMRA 5AK3A 4MUIA 3ZHXA 2A5FA 2ZJBA 5HP4A 4UFPA 5JS8A 2ODWA 4F2DA 1N1DA 4Q4AB 2AFHE 4LQLA 3LKZA 4LXGA 4E2YA 4Z4FA 3PC6A 1GPUA 3H1GA 3JQAA 4I50F 4LCBA 4RY9A 3E03A 3C7CB 1QE5A 2WY2D 3KAJA 4TL8A 4D6XA 5CP8A 1ECFA 4P3OA 5K8JB 3LUKA 4UTZA 3ILVA 4RJLA 2J0EA 4F7WA 4HNQA 3AHFA 1V43A 3I8SA 4J1TA 4LA4A 3ZVRA 3NAZA 1VG8A 1IHPA 1ORDA 1Z4KA 2FXVA 3IQFA 2ZJOA 5BORA 4HH1A 4KU4A 5BQ5A 4WAUA 2XNDD 4X64B 2W2OA 1WLSA 1C80A 4OGGA 4PV7A 4WN9A 2Q6IA 2JEZA 3WGHA 2BGLA 2Z57A 2QT1A 4C21A 5REQA 4RIEA 1OLSB 3VMFA 1WCWA 1P44A 2X0RA 3LLCA 3DEZA 3ZWCA 4B48A 2ONCA 4NTZA 3GJ3A 2QORA 2I4NA 4WIAA 2YZNA 2J32A 2C0PA 4QBFA 4ENVA 4ETNA 1K8ZB 3THYA 1W73A 3K31A 3VYSB 2BR5A 4MJXA 1QS0A 3MTDA 3VYVA 1F2DA 1PJZA 1MQSA 3TLMA 4CT4B 2WUVA 1QDEA 6AT1A 1SC3A 2AG6A 2PLAA 3B48A 1CDZA 4GI7A 3IXMA 3HI4A 5FWAA 1PEYA 2B98A 4IOJA 4IIHA 4MV7A 4EKDA 3NWBA 3BD9A 2C9OA 3K9QO 3H4MA 4J7UA 4EG4A 4Z6KA 3AOGA 3Q87B 1IULA 2AOTB 4RABA 1PEKE 1B2LA 4IUCS 4S04A 2Y0PA 4ZYXA 2REQB 1TX4B 1JT2A 2DT8A 1Y1LA 4LV8B 1U1GA 3EZLA 4JOBA 1YZQA 4YT8A 4TMTA 3KG2A 5EQJB 1SZCA 1XJQA 2C1EA 3JWIA 3KBBA 2VP6A 3NHLA 3PD0A 2ZKIA 4QDZA 4V0RA 4LUCA 3CYFA 5HTKA 3ZOKA 3KJXA 3OEED 1H8ED 1NJ5A 1T8PA 3TFQA 1T4CA 2DPGA 2PH3A 3KJEA 1IXKA 3PQ5A 1N57A 4IZIA 4XTRA 1D2AA 1K6EA 1RPTA 4LRWA 4KMMA 3D6FA 3ZW8A 2ECOA 2O20A 1K68A 2VNKA 2QUZA 1GL3A 1ZIDA 3UHOA 2H4YA 2OBBA 2WYWA 2XVAA 3T7TA 2G1JA 4J4TA 1TF2A 2AOVA 2J3QA 4NOLA 4TKVB 2HZ7A 1LV8A 4HGOA 2M6LA 1JH9A 4L5YA 2AD5A 1TJYA 2F48A 3ISJA 3M6WA 2D13A 4X93A 4E08A 1R6VA 2QUAA 1FZQA 1ZSYA 1Z5GA 3ADDA 4DHWA 3I42A 5KQPA 1PI3A 1B16A 1CERA 2NGRA 3ITEA 3WB0A 1B00A 4X6LA 4ZV7A 1SA0B 3L41A 1SVIA 3HBMA 3NLLA 2JLSA 3CONA 4J2TA 4MCAA 3QE9Y 2UYQA 1TPZA 3UBTA 4OSOA 1U80A 2XIQA 2XQIA 4DJTA 2EV9A 2JJYA 1Y3FE 1J8DA 3GN1A 2Q3FA 3B1WA 1YCHA 4QPJC 3ETNA 3VR0A 3ZE1B 4RPJA 1T9DA 2R84A 3OQPA 4B3DA 2BFCB 2XITA 4Q7EA 4QUDA 5GAJA 1FS5A 4S1TA 4PFQA 3EJWA 3ZY5A 4E5PA 3ZDXB 2G5PA 1Y4DE 4CKCA 3RS4A 4MHSA 2B25A 2J41A 3Q8MA 3WZLA 1MXFA 2OB2A 4TTIA 1LI4A 4CCSA 2HD4A 2YWFA 4EAAA 2LWIA 5AKZA 5B53A 1G9XA 1Y63A 3BG5A 3V80A 1XZLA 4W4TA 1Z68A 3EPRA 3E22A 4CDNA 3EBPA 2JJQA 4AZ3B 1Z29A 2JLAA 1GARA 1X7YA 4O2AA 4H1UA 4WUVA 4L3VA 4RY0A 3QPVA 4Q1CA 3RDPA 1H42A 2QP4A 5L51A 2RH8A 4QLBA 5CA0F 3KAQA 3WX0A 4RGYA 2RC6A 2QD1A 2BDEA 2SECE 5DN9A 1FDSA 5KDOA 3FRIA 5IXSA 1LVGA 3RKRA 3TTUA 1PW5A 1QJCA 3R23A 4JYMA 3EIUA 1AV7A 4PN3A 5F73A 3IOBA 1ZZEA 3Q9LA 4FP9A 3K6JA 2W4QA 2ZR0A 4Y1EA 2FSVA 4HS4A 2J5KA 3W5JA 5L4LA 4JEHA 2J6IA 3ITNA 1WM1A 3IPRA 1W36C 4DNFA 2M9MA 3GD5A 4LRYA 4KSCA 5EJMA 4BMXA 1JR3E 2HJWA 2VRCD 2NU8B 5KU1A 2GXUA 2Z43A 2MCFA 2IHTA 1N6RA 4O8CA 2EEPA 1M2KA 3DT9A 3RHZA 2O1WA 4BPBA 1F2VA 3R5JA 5KYTA 1VE3A 1TUEA 5IM4A 1RC1A 3O2JA 1JU4A 3PUXA 3B6ZA 4FUTA 2IV7A 1H2ZA 1XT6A 3NGMA 2I66A 2WA1A 3GJQA 3INGA 4BX8A 5IC4A 2C7GA 1V26A 3HKCA 1MO4A 3NATA 1Q17A 1GEEA 2VHWA 1TE2A 2IELA 2VJMA 4F5EA 2HU5A 1XNGA 3VC2A 1EFRD 3A6DA 3TUJC 2WD7A 5T6BA 2HYDA 4WCFB 1XD2A 5F23A 4ZQGA 4LHVA 3PZRA 1ID1A 1KJJA 4QYIA 2HRRA 3IBSA 3N2GB 4J1QA 1M9NA 1QAQA 4MW0A 1NXSA 3IEIA 4QUKA 4DRZA 1FDOA 1HDEA 1UP4A 1B0PA 1P0PA 2QJRA 2C4NA 1B23P 2H11A 4MGKR 4AULA 2UVPB 2OCYC 3OT5A 2X8JB 3WRVA 4MKIA 2XE6A 3GU3A 1E4VA 1E7WA 2ZQYA 3C97A 4AK9A 4C5CA 1N2BA 5EQFA 4MUFA 5AM0A 5DP2A 4DGQA 4PY2A 2FPUA 4PIMA 1PK7A 4AU1A 4ZO4A 1U0GA 5ENVA 3W7VA 2I54A 2NVUB 3QVVA 5FBHA 3NNDA 5SV2A 1X77A 5JROA 5A04A 1CF2O 2C31A 1TK9A 3G0CA 3HYRA 2OBFA 4EIWA 2L69A 1KQNA 1P0IA 2JRCA 4D3FA 3B1KA 5E7JA 2RK6A 3KO8A 2IF0A 4C7XA 4GM0A 1UBGA 4ES6A 1OGYA 2Z2YA 2CXQA 1Y5RA 1L4MA 5ITVA 1JXAA 4OHMA 4QUIA 1NKVA 1PS8A 1O9BA 2Y1LA 3HB7A 3OIFA 3OP1A 5TQ2B 4I6EA 3EODA 1OZAA 3IUPA 1AGYA 1QYVA 2E4YA 3TKLA 1DJMA 1G55A 2OESA 1ZU5A 2IPOA 2Q0QA 4ITRC 1DIGA 5IU6A 1WOYA 4M3NA 1SVWA 2O2JA 3UKDA 5GV7A 3PQ2A 1HYBA 3ZE0B 3PNLA 1UBEA 5BRJA 4P93A 1YJXA 3DBLB 4AJ4A 4KX5A 1ZIPA 2TRSB 1XZMA 3T61A 3GVIA 1GVNB 1V9CA 2IDKA 3KV3O 4QDTA 5DNWA 4EGQA 2RBEA 2XNSA 3V1KA 2IUTA 5JMTA 3QVLA 3LT4A 3MEQA 1ZH0A 1MW9X 2IE0A 2W4IA 1UM9B 3EEFA 4TLCA 1JJVA 5INTA 1N34B 1MIOA 4JYZA 1E3EA 2O07A 3DH0A 3VU3A 4CQMD 4IILA 5L3QB 4KNYA 1X74A 3O3OB 4P4UA 4POAA 1NBEA 4GOLD 2FWAA 2PY6A 3LZCA 3VNVA 1HE2A 1JU3A 2OK8A 4FD3A 1T9BA 1JHAA 4TN5A 1W49A 1B6RA 1OILA 5TF0A 1KH2A 2GZHA 2VT6A 3CCCA 1WMDA 3FTCA 3ABOB 3AZPA 4L8YA 1LBSA 2JIOA 2JK0A 1S8OA 5ER6A 1ZM9A 5HQ3B 4XVQA 3WK6A 4QGGA 4YJKA 5K20A 1CC1S 2J3KA 3GUUA 1PAUA 3H4VA 4IBOA 1L8QA 1LVHA 1OMOA 3GMTA 1FFHA 1RR6A 2IXEA 3LUAA 4X7PA 3HJFA 1KPIA 4YQFA 2OV3A 2QA5A 2ZLBA 1FTWA 2WE7A 5I8ZA 2RGGA 3ZGXA 1LS6A 4COOA 2QDXA 1ZCFA 1P9OA 1P62B 2FJUA 1IZ0A 2JRLA 3D2LA 2QTRA 4IX9A 5CHEA 2AYYA 3TQRA 1JP7A 3QHAA 3TNJA 2HJGA 3EXIA 4L4UA 3ZDDA 2HWKA 1R0SA 1KARA 2OO5C 5DF1A 3UM9A 7MDHA 2DXIA 5EIHA 3HZOA 4QC2A 4R1SA 4ENUA 2LKDA 3W8EA 1Z88A 1RHUA 3VU8A 1CS0A 1PNOA 1VL5A 4XIYA 5CCDA 3FD8A 2IYVA 2JJ1A 3F6CA 3DAOA 5JI2E 2WQ7A 2HFJA 3E7XA 3IXQA 3BJRA 5K0EA 4A0RA 3E2IA 5H59A 3B3AA 4N48A 2OUKA 2ZYIA 5FWXB 4AJIA 1EVLA 4Z9XA 2VTKA 3KVNA 3WB2A 4KO8A 1C9JA 3AM3A 4R83A 4U0JA 1KTIA 2H4XA 3DYBA 3FSRA 1EJBA 2D1SA 3F8SA 3I28A 3L4EA 5DT9A 3ADBA 2Q9CA 1ABBA 2Q49A 5ICGA 4X20A 3T1TA 4KXNA 1DQPA 2FFRA 4IDDA 1PL7A 5TVGA 3WLHA 5CM9C 4NMMA 1SN7A 2XOEA 1DQZA 3W4JA 1VA5A 4B2YA 1DCKA 4PLZA 2O3UA 3E0XA 3KXDA 1IY2A 1HLFA 3V8RA 3AFIA 1O5TA 4OQLA 4PLHA 3A6GA 4JLSA 4DN6A 2GKOA 1GKYA 1RU3A 3BFXA 5EZYF 4DTCA 3HA2A 3H42B 4K9DA 2FSFA 2O2GA 2VJKA 2OQRA 4O08A 3VU1A 4DM3A 4I4TF 5K4GA 3KJFA 4EABA 1YASA 2VSXA 3QXSA 3GLIA 2GJ4A 4JJGA 1IOZA 4RPIA 3PFWO 1DRVA 4KR0A 5JASA 3HVIA 2H57A 3R3WA 2V98A 3V2HA 1VJDA 4XWKA 2V7TA 1K75A 1UBKS 3SSOA 1SOUA 4I5EA 1DC5A 1WL8A 2HDOA 1NT2A 3IAHA 1E99A 5C5CA 4G5RA 4TWAA 2FFJA 3BK2A 4RPHA 5C8YA 2WG1A 1NXXA 5JSQA 1KKMA 4L5AA 3TTWA 3DLBA 3L43A 1TPYA 4TL9A 5H16A 3WE7A 1PT6A 2A1UB 1W1IA 2WJIA 1A9XA 2ANCA 4K6KA 2D1QA 3WB9A 4CRWB 3LU1A 5AVWA 3EA0A 4DPMA 4W7IA 1YUBA 2GD0A 4IDGA 4QTZA 5GONB 2F1JA 2YIDA 3GRFA 4YV0A 3SXUB 1QHIA 5HRAA 1I5EA 1DCFA 2J0UB 3CTPA 3FNGA 3G02A 3ZEIA 4BMSA 5EP4A 2J3DA 1IOVA 3BPSA 3ZIUA 1RM3A 4P31A 3A0UA 3RYCB 3I5YA 4GI3A 4JI0B 3L0OA 4BQPA 2DX7A 3D6JA 4AROA 1KPHA 4QXRA 3QUQA 1QVAA 1ZXLA 4N7MA 2HPZA 3O2QB 2OHFA 1N75A 1SXJA 5BXQC 2XEXA 4TRMA 1QIDA 3KT6A 4IV0A 5FOWA 3U7EB 4BLQA 4EPYA 4B3MB 3OOWA 1DC8A 4R8VA 5LBTA 5TGTA 1I33A 1TYCA 4LMPA 2HDWA 3R20A 3T06B 4B4WA 4DMRA 2GJKA 3OTWA 2I4LA 3E35A 1IXYA 4CR6A 1E32A 3R77A 1LQ2A 3S7TA 3COPA 1SVKA 1P80A 3WJ7A 3GLQA 3ZN2A 1YBAA 2UV8A 1D0IA 2VSFA 1WW3A 3BXFA 1WEHA 3KOZA 4L9RA 3R7DA 1L8XA 1PJQA 4B3GA 3AMVA 3SDZA 1FPQA 1L5HB 1SZPA 5GV8A 3T5MA 3PSAA 1X14A 2NUBA 5DYIA 2HJRA 1BXRB 2ETVA 3PFIA 1E1YA 1E98A 5JNTA 3ANLA 4G1UC 1XTJA 3UFXA 3KB2A 3A2MA 2H3HA 5JOQA 4NKRA 3D8BA 1FOEB 3FUCA 3AR9A 2VNIA 4A0GA 4F2GA 1HR0B 4DCNA 4FGWA 2DH6A 3MERA 3H19A 1IN1A 4ZOAA 2IC5A 4A92A 4YPOA 4E09A 1EK0A 3QOFA 2V6MA 4Q48A 5LCXA 3BWMA 4GOMD 4R54A 4J0IA 3RYIB 5ETJA 3FCXA 1VG9B 1P2DA 1TZ2A 2RJOA 3RFCA 2GK3A 4BNWA 1ZESA 2AB0A 2O2YA 3L4KA 4YLYA 3MS4A 1XCOA 4YHBA 4O3MA 3KNZA 4XQGA 1YVDA 3GDOA 2IEZA 3FVWA 1AH2A 4MV6A 5L9AA 3ZU3A 3PB3A 3QI7A 1RTTA 4YJ2F 3AT1A 2BFBA 1P2UA 3MWGA 3W1EA 4A6XA 4NE9A 4BFCA 1ZUD1 3ZXUB 2DY0A 1ZISA 4G65A 1PZNA 4WNAB 1G5RA 3C3AA 5CCEA 5JMOA 2A14A 1XCBA 4H17A 1NURA 2VP4A 1E2FA 1Z0DA 3PLNA 4GO1A 3M0EA 1ORHA 4GPEA 1ICEA 1Z6TA 3D6AA 2SCUB 5KC9A 2C8JA 2JLYA 2FMKA 3BB1A 4ZT4A 1CF9A 3AEKB 2RGWA 4D0GA 4ID9A 4R6WA 1KAHA 3Q3HA 4BZWA 4HRYA 1WTCA 1G5FA 4TXJA 1VJ1A 4BO0A 3DEKA 4C6SA 4NZPA 1E3QA 1HL7A 1OBFO 2Q07A 2ZYWX 5B6IA 2DQSA 1AKRA 2JAHA 2WPDD 2P6NA 2IZZA 1JEQB 3TQSA 3MJFA 3ROMA 1GEGA 3EZGA 2JLQA 1JXQA 3U7GA 3CX4A 1NP6A 4Q1AA 4O4LA 4TRJA 2X8BA 4CF5A 3I62A 5ARCA 3PEVA 2ZCUA 1VSUA 1JVBA 3L49A 5B1SA 2XB9A 1G20B 5JW6A 4OHZA 2CXTA 5KNDA 2FU5C 1QH8B 2XBMA 5KYUB 4OJNA 5HJ2A 2PJUA 3H2GA 4HADA 4C20A 2SKEA 3H1BA 3OCWA 4G2TA 5DJ5A 1D1QA 4MUXA 1VE9A 2YV4A 3VTAA 2Q6VA 3IKJA 2VZLA 4HLQB 2I8AA 3NKFA 3DF7A 4LFCB 1Y7IA 4OCZA 2FR0A 2WHYA 1N1EA 3ORSA 4TUYF 5LOVF 3Q3CA 1Y7PA 5EWJA 4K9QA 1I9CA 3L0PA 2R68A 3S2YA 4BO8A 3JAWB 2HO4A 2BFDB 1RQXA 2O0MA 5TEWA 4YQZA 4F6RB 3O1HB 3AIKA 4OHRA 3SBDA 3OOEA 2ZIXB 2ZDHA 2O57A 1PEDA 3ST7A 3MOSA 1NQUA 1KKUA 1TIKA 3F9IA 3QFHA 4W99A 4D82A 3FYCA 1CUWA 3AK4A 5A3SA 1BCRB 3CV3A 1D4FA 3IMFA 3T9EA 1LPNA 3ZVLA 2V8OA 4NECA 1DTSA 5SYAA 4FW8A 3R3SA 5D3MB 3IERA 3HK2A 4IMPA 3T5BA 1IPEA 3NXKA 2W22A 1IN6A 1WW2A 1Z4OA 4AO7A 5IH7A 3RC8A 2DWPA 1CZLA 2J45A 5KX5A 1Y89A 1LBEA 1QAOA 2YYSA 4XOIA 2PKWA 4N5HX 3CH5A 2XKBA 2CVHA 1ZCJA 3AUYA 3EZNA 2P9TA 2QTNA 4NE7A 4NZNA 2ZAIA 4ITVA 1UDWA 3H0CA 3W5AA 1CUEA 2FEWB 5EG5A 2W4MA 2NVBA 3I01M 4ZAZA 3WBBA 4ZCMA 4AY6A 1ACJA 2G17A 2VPXA 3OM1A 1M1YB 3WBKA 1PLJA 4F71A 3GFGA 5IDVA 1Z25A 2JZCA 2V6FA 2QTAA 3DM5A 1YK0A 1V8DA 3VYRB 1EBFA 1W85A 4PBRA 1I2BA 1E9EA 3A9SA 4US0R 3TTTA 4WN3A 1YE3A 2JFGA 2XWBF 1USVA 2RG7A 3HU5A 4MV4A 2YX1A 3NBAA 3PE3A 2BM8A 1FNBA 2PH1A 3BSWA 4M1SA 3RRNA 3VR5D 1OB5A 3C4VA 5LUBA 1QYIA 1DQYA 3K09A 2QTMA 3ZCQA 1L7BA 5FTLA 1GGNA 3SVTA 3DFMA 1WMSA 1YZLA 2GFIA 1P8JA 2AX4A 2HSWA 3WLIA 4NFHA 4UQPA 5L95A 4KAAA 3DOHA 1LPSA 2C98A 2KSQA 3RC9A 1E79D 1TQDA 2ABWA 2OK7A 4QDXA 5J40A 5LP6A 4XEHA 1L7PA 2RD2A 2NSJA 4NZZA 1XXHA 4HDSB 1JQ5A 4QQ8A 2IQ5A 4I50A 1RPNA 5TSDA 4JI1B 4XWYA 1NE7A 3QFSA 2IUUA 3GP8A 2V3CC 1H0SA 4QYXA 1QRUA 2VHYA 5FR1A 4RE5A 4GSKA 4WXMA 4YCJA 5C1BA 4REQA 1HF3A 5I9NA 3DXZA 5KNCA 1LDEA 5BN3B 2P77A 2ILTA 4P0PB 3LV8A 4MYHA 3HFGA 4F45A 2F3RA 2IYSA 5IBPA 4KITB 1QP4A 3JWGA 3OQIB 3E9YA 4TQ9A 2REOA 4P7BA 5EHNA 1PHPA 4ZCRA 3HDVA 2JLRA 1IIRA 1QV7A 3VJKA 4EMSA 4EMBA 5CVCA 3C45A 4HWTA 2RC5A 4IF6A 1CJVC 4FX2A 3DL4A 4DCJA 5H7XA 1CJBA 4MPJA 2BL4A 1JDZA 3MUNA 4H4CA 4ILEA 4Q3BA 3TZHA 3W4KA 4C6TB 3B9BA 1DJQA 1KL7A 1IQ0A 1KJ9A 2IZ6A 3NHWA 4IMJB 5CITA 1VJTA 3C8HA 1HEIA 3OZGA 4Y8VA 5TLSA 2QLNA 1D2EA 1T3SA 3GJYA 3BXOA 5CH8A 3PHHA 1SZDA 3ISVA 5JH7A 1ELOA 4QT0A 3FUXA 4JC5A 2CUTA 4JFAA 4U2CA 2IX3A 4RWEA 1CFJA 3GW8A 3HFJA 3ZKWB 1NN5A 3K35A 2CWDA 3SC4A 1L7DA 3OJWA 2W11A 4QOIA 4PEVA 5ITZB 3U6KA 1J5EB 1SHZA 1PL6A 4M0KA 3D4PA 2HZBA 2IY9A 3OPXA 1Z3IX 4HYQA 3HVUA 2NU9A 3WMFA 1AQYA 5JZVA 2XYPA 1RACA 3L7JA 3FWNA 2R1VB 2GESA 5TNXA 4NYJQ 1XQ6A 5HF8A 1K2VN 3BULA 1KIAA 1KDTA 4OLJA 5EGNA 4IIXA 1YMUA 1FUEA 3IV7A 2D8MA 1B93A 5IAOA 3UXYA 3E4CA 4CLRA 2BYTA 1CRLA 1KZGB 1K5PA 2PZGA 2OAGA 3HY4A 4NBWA 1U7WA 2QPOA 3EZFA 3IAEA 4KCGA 1FLVA 1JEYB 3DHVA 5DXFA 1RBMA 4V0QA 1PBNA 3GH3A 4K9LA 3ZDYB 2PMKA 1CB0A 1E4EB 3FE2A 4EY7A 4HNHA 3SYKA 4MV5A 1E2DA 2BBSA 5F12A 4Q6BA 1F7UA 2Q4EA 2ZI3A 3HO1A 3TDNA 2J7PA 1K3UB 4F93B 3GLHA 2Y1KA 1TCAA 1UKZA 1NMYA 2V7WA 4FVTA 2VDRB 2ZT5A 4K2AA 3WGQA 1IQUA 2X1MA 4UHJA 4UNRA 2X2PA 4X45A 1FQOA 4MV1A 5BR1A 3DNPA 2P8JA 2ZBEA 3LY5A 3U5TA 1ULSA 2KM1A 2M1ZA 3C8MA 1L6IA 1NATA 4ARCA 4X1KA 5IARA 2RI1A 2CJWA 3I8OA 4DC0A 3KHTA 4N18A 4PQRA 4IP0A 2WM8A 1YOVB 3U7FB 1Z16A 2FZKA 3LQ1A 4KWEA 1GDTA 5IT5A 4FYXA 5FBZA 5EJ4A 4MS4A 1Z5ZA 5E7QA 4F2HA 1HO3A 1QIEA 5AJHA 2V6BA 1BS9A 5K6RA 2DKOA 3ZDAA 2FDRA 1QUEA 1PNRA 3NB0A 1RZ3A 4JLNA 4TYQA 3IPCA 3IEKA 3DMYA 3TI7A 3ML1A 4Z1OA 2YS6A 2H48A 5DBGA 1Q7EA 2CEAA 1CE8A 1VYHA 3H2SA 3B6KA 1QIJA 1ZN8A 3C74A 5ALWA 2NU7B 3C48A 3UHAA 2IXFA 1WR8A 3PNKA 3BH6A 1WD7A 4HTFA 5ILQA 4H77A 1CCWA 5TJ9A 3OA0A 1G20E 1QGED 5JNVA 4BVFA 2CNKA 2OAP1 4MVJM 1EH5A 5AHRA 5AIAA 5DH9A 1Y81A 4ENPA 3P2KA 4MW1A 2I4IA 4KNWA 3G5LA 3WV4A 2AJLI 1RWNA 2YQZA 3TBFA 3WRWA 4HGYA 2WWIA 5I9LA 1ZK2A 1IHUA 3SHTA 3DYVA 5D84A 2NO1A 2YR0A 4RV9A 4AVYA 5EHZA 1RS0A 3W0LB 4Q4JB 5BWMA 5KAMA 1OKKA 3QXJA 1X0VA 2Z9BA 4I55B 4NZMA 1QF7A 3LCMA 1NA5A 2V96A 2VKQA 4P92A 4EKGA 2WZDA 3DAPA 1JMKC 1LFAA 4KXMA 5FEMA 3N70A 5I7FA 5IZ4A 2QD3A 2WWRA 2B1GA 1U1IA 2G7ZA 1W44A 3IKMB 3ZVNA 3MJCA 3ILXA 3LNTA 3PCXA 3BX1A 3KE8A 2OXRA 4KPGA 3IQXA 5FBKA 1WZ2A 5JZSA 4RPKA 1T5TA 3PX3A 4JDUA 1QIIA 5E4YA 4A5OA 1N25A 1XCJA 3NFRA 4JL6A 5F3WB 5A3VA 5KCMA 1NVEA 3EH1A 3K4QA 4DJFC 2ZI6A 4N49A 2ZJ1A 1R4MA 1ADCA 3A1FA 3FYUC 1RHQA 1IMJA 3L7NA 3QLEA 3SHFA 2VYNA 5C7OO 5B57C 3U09A 3FHTA 4IJQA 1WDWB 3VU9A 1JDUA 1E9RA 3PVCA 3H5AA 1D0VA 2P9ZA 4JVNA 2JGRA 1N0UA 5FAKA 2D6FA 3RBVA 2HXYA 1Q16A 1ST3A 5FCDA 4OI0A 1TYDE 3GRVA 3A2LA 2EKPA 1RT9A 2I8CA 3GP3A 3KZXA 3BB3A 1UXKA 2IT1A 3W8RA 1T2NA 2Q9UA 1GZSA 1OTYA 2PSSA 3I12A 1H8HD 3DOIA 4AF7A 3FOBA 4QUBA 5BUQA 2OG1A 3DUFB 3VR6D 2NG1A 2ZJ3A 4IIUA 1FEZA 2WOJA 1ODLA 4R2XA 1M1YE 4J16A 4FHDA 4FZ5A 4LYJA 3EARA 2JFYA 3H5WA 1K4KA 4MX8A 3G6KA 3N0VA 3RD5A 1DP4A 5K0CA 1EVQA 1GPWB 3X1JA 4RK1A 5BT9A 5J5AA 4DR7B 1AKUA 4L5IA 4WLFA 1NW4A 2XLBA 1VE6A 3LO8A 3VHXA 1NIPA 2E1PA 3M8KA 3FIJA 4Y9DA 5C37A 4H7KA 3EXG2 3RNOA 4IQFA 1SBNE 3F5DA 1J25A 3UQYS 1QIFA 2IYAA 4HWGA 1QFYA 1ZJYA 3RTDA 1YHYA 2CHFA 2FEPA 2V6JA 1I1OA 2B8EA 3BMNA 3GVPA 3CB4A 5B3AA 1XNRB 2R85A 1BH6A 3N75A 2XCUA 4KRGA 1UZMA 4O0MA 1PT7A 1SD2A 4KYVA 5CB6A 2B4RO 3EHDA 1UAGA 1I2ZA 1KI7A 3C3DA 1O6FA 1BMTA 4FD2A 2HLDD 2OP0A 1MC1A 2P79A 4LKRA 1RKBA 2NSLA 4HVTA 4Y6RA 1CZKA 1E20A 5KYKA 2MWMA 2HIAA 1MB0A 2HF7A 2WAYA 1NMQA 2F3TA 4UBNA 1Y8RA 3MM4A 3QVJA 1R5NA 1T15A 1C14A 1U3WA 5BUSA 3TGWA 1RWWA 1G5HA 4M6WB 4YI3A 5EUCA 5BNWA 1SBQA 1KEEB 3HBAA 1HQYE 1RZUA 4HN2A 1O94D 2G07A 3QLUA 2JIBA 4FKZA 1X3LA 1OAKA 1P2FA 4H9GA 1SC9A 3PGA1 2Q1UA 5FL7A 3TAHA 3IKVA 1QQAA 3DEAA 4CLOA 3O8LA 5IVDA 3U80A 3WWOA 2X0JA 4ZYZA 4A4DA 1FVXA 4IUBS 4J2OA 1SXIA 4MP6A 2EBWA 2OHHA 4BQSA 2I6XA 5ESXA 2C0QA 2BONA 1NYRA 1OXVA 1P7PA 3BFVA 4DARA 2W6JA 1E3TA 2JH3A 4X92A 4L4SA 3QTLA 3EQ8A 421PA 4BXOB 3VUFA 2GWHA 2V7UA 3PZBA 3AUJB 4MITA 3DDWA 3K6SA 4DCMA 4A1OA 4Y2QA 3T38A 3O8QB 2VS1A 5THKA 3TJMA 1VHQA 2OXEA 4FHZA 4K46A 5JMPA 3HACA 2HHCA 3P8ZA 1NQ5A 2NO6A 5ILGA 3EGOA 2WTNA 2IP1A 3O26A 4D6PA 4PZDA 3Q2OA 2LXNA 5HJ7A 2HA3A 2QSJA 2VDOB 4JEUA 3VPAA 3WHPA 5KVVA 2GNPA 2EIXA 1QF9A 2VAWA 2WWWA 4QJIA 2I6GA 1N7IA 2V9PA 4X8LA 4CMIB 2VZ0A 3ET4A 3OA2A 1ECLA 3BEOA 1CVRA 4P08A 3THRA 3F8WA 3DZBA 1R8QA 3FMGA 1HTTA 3N6VA 2XNDA 1SOAA 1VRWA 4TV9A 1Y6QA 2Q41A 1Z28A 5DHRA 1WY7A 4H7HA 4FX5A 4XGRA 3DV0A 1RWKA 4ZCPA 1VA4A 1GU0A 1Y1KE 2EJTA 4ZVLA 1BFKA 3ZWYA 2MMCA 1WRBA 3KOXA 3Q40A 1EAYA 4CUKA 2FPKA 2G72A 3EEQA 2IA5A 4LI0A 1UOQA 3H2IA 1YS1X 3R44A 2H5IA 4YYZA 3HM2A 4JUBA 1E1NA 3NIBA 1K27A 2HA0A 1PFWA 3C87A 2QW0X 5BURA 1N2HA 4QGBA 5DOVA 5JSZA 4HNSA 4PR0A 2PJDA 4W6QA 3JZAA 2IE8A 1TFUA 1GTVA 5CD1A 3ZD8A 4JZKA 4RHCA 2FWBA 2RGBA 1HA3A 4H7JA 4XXHA 3WL4A 2GXSA 1XZGA 5BWBA 1QVZA 3G7UA 4MPDA 1THMA 3OE1A 4MRAA 2CF6A 2YXBA 1KYYA 3D2BA 3DZHA 1IK6A 3I09A 2NTNA 4C0HA 2ZGVA 1IH8A 2PIAA 5E1BA 1N0HA 5LJIA 3W2HA 1I2AA 1A2KC 3FVQA 4KQXA 1TKBA 4XDHA 3BXPA 3PHIA 5FYQA 2ZSFA 3GVHA 1P0FA 2DH5A 2JFQA 3M6LA 1U4NA 2G40A 2JKZA 2Z30A 2BKLA 1VBFA 2GF9A 3PUJA 5EE1A 1Z17A 3NVKI 2AIRA 4KDFA 5BSVA 4TLAA 3H87A 3ILSA 4WY2A 4DZRA 4DXHA 1UUFA 5EJ7A 3ZHZA 2QG6A 3C98A 1PT9A 2NU6B 3ABIA 2OC9A 3FPSA 4NJMB 4CMKA 2X41A 4YXFA 4JCOA 1CTQA 3B9RA 1OREA 3OEEA 3F7OA 4XX0A 1VI2A 2VF8A 3AY6A 2FP3A 3C6KA 1ZIXA 2XA1A 1XROA 3C24A 3IQDB 3OJEA 4HXFB 3VJMA 3W05A 4IUDS 4M37A 2IHKA 1LJLA 3CU5A 1WUHS 3N0TA 3PCRB 4Y7DA 5FIUA 3ZGLA 5HQTA 3UKJA 1PJSA 4BLVA 3EG9B 4IFIA 4MW7A 2W6OA 3Q8LA 2C83A 2OFFA 4B6GA 4REOA 3Q10A 4DCOA 5ALKA 4F4DA 4N5LA 2BI8A 4UD6A 5AVJA 4UM9D 2HU8A 4X3OA 3R7WA 3CGGA 5CDFE 1OCEA 4ESVA 1C2TA 5MGBA 2X1HA 4IJVA 3BN3A 1ZK0A 1J9ZA 1GV0A 2QT0A 2Y68A 2VT7A 2WFLB 4ZQHA 3UEOA 3KQUA 4Q37A 2Q0HA 2QJOA 4M8LA 1RHRA 3WGNA 1JSXA 2R7MA 3MILA 4O4JB 3CNNA 2FPLA 5DI9A 5DM1A 5FB3A 5ICCA 2QQGA 5AJTA 2Z4SA 4LQ4A 3RIYA 4EHDA 1WXGA 4QNMA 2E5LB 4PANA 1GN8A 1D6NA 4CNBA 7YASA 3WWPA 1DAOA 1NVBA 5CX1B 3I76A 3PL1A 1QWSA 3G2KA 1NXVA 1PTJC 1M6VA 4WY8A 4YV2A 4B2IA 1MX3A 5A4FS 4OFWA 2WBLC 5C1PA 4QDJA 1QHHA 2ZYSA 5A05A 3P9NA 3QHQA 1K7FB 1M1NA 2BFEB 4ZT5A 4L07A 4O29A 3DCJA 4GNKA 3TSOA 3UUWA 3F2IA 4MVJE 3MCWA 3L04A 1CLUA 3L5KA 1CEEA 1VYTA 4Y1FA 4FYWA 2AKEA 2CXXA 2O7RA 3DDHA 2JW5A 4EX6A 4ISCA 4ARZA 3ZD9A 4IQ8A 4K9NA 1M34B 1Y3HA 1H6AA 3DFFA 3R5SA 4WOJA 3TB6A 1QMGA 4CFYA 1WNTA 3FVRA 4YMLA 1F0NA 2OGZA 2D1TA 2R00C 3GK3A 4Z0HO 4GI1A 1EG2A 4B7XA 3QELA 3C1UA 4IHJF 1QGOA 4K3UA 4LYAA 1ODFA 1QV6A 2FG5A 3AYZB 3RFVA 2FDXA 2R6CA 4IJMA 3U39A 1E9FA 3UBMA 3IC5A 2CGEA 4Q66C 3SEAA 4AY4A 5IWAB 1XTBA 2H18A 2HA4A 2ONKA 1TIBA 2ORED 3GGSA 4NV3A 4RADA 4MW9A 4TKLA 3R3ZA 4L7VA 1XNHA 4JVSB 4TVOA 2DQZA 1DRWA 3QKTA 2G25A 1ATZA 2Q0SA 3L0IB 3EVDA 5DTIA 1WPRA 5KTTA 1CT9A 4G4SO 3THWA 2EYQA 1C7ZA 1W4RA 3CRRA 3IXLA 4CM4B 4UPVA 1TCBA 3KTAA 3LSYA 1N2GA 3H99A 4MVJF 1N3IA 1BJTA 4WUTA 2XT9A 3WG9A 3WYGA 4FYMA 3PIDA 4L28A 2YWJA 5C4GB 1F2TA 2VT3A 3IT1A 4KUEA 5ADHA 3K05A 1N5JA 2IU6A 1NV8A 2NYRA 2H7VA 1DLIA 1GAQA 5F7OA 4DDMA 3HMQA 1U11A 2ADFA 2JASA 1B76A 4PAMA 2VRCA 3D2AA 4WLUA 1W4CA 1HT0A 1WMFA 2QQFA 4H18A 5CM8B 5KDDA 2VAMA 2QYTA 2KLHA 3WL5A 2EP8A 2O8BB 1I5OA 2CYBA 3PNPA 1CDOA 2GD1O 1GGEA 4FTWA 4WA8A 2CJFA 1S2GA 3IMKA 2X9VA 3JZIA 2FUEA 2NUPA 2WPNA 2GT1A 3TCKA 1SU6A 3SX0A 3LQFA 1DOAA 2AF3C 1UINA 1Q0HA 3E4DA 4P58A 4QICA 4YJ2A 2QSZA 1NU6A 2Y0EA 1VBNA 1EFRA 1P2VA 2XH8A 3LWNA 3VAYA 3IMCA 2VSQA 2OCXA 1U7PA 1FP2A 3MXTA 1I1HA 5EXTA 1LK0A 3PXAA 3PR2B 4YRQA 1WVIA 5EQTA 1CXZA 3WIUA 3MHTA 3V1NA 4I8XA 1N5OX 2XDQB 1YB7A 2JA1A 1AQNA 4X1YB 1H0RA 4QVIA 3NV7A 3O8CA 3CG0A 3GT3A 3LXXA 2ATVA 3I73A 3V9PA 3TD9A 1A2OA 1HZZC 2VQ3A 1MZPA 3HRIA 4CCAA 2VUSA 2OBYA 4Q3KA 1VCIA 1GPH1 1E8MA 1XNJA 1XZDA 2CLMB 3FN4A 3EXEA 3D3QA 5HGJA 4UE6A 4ZJZA 1T2VA 4JYPA 1G8GA 1NVGA 2J3LA 4MO9A 3R9IA 1QQ5A 1WJGA 1X42A 2ROQA 1E7QA 2HHAA 3H2KA 1ZPDA 3H8SA 4R1LA 1VDMA 3V4VB 4AAYA 3E9MA 3OZTA 4KO4S 5JATA 3KQTA 4AYXA 2QRZA 2C7PA 4QQRA 2FOIA 2GEJA 5H4HA 4LJKA 4UVEA 2R97A 3MXOA 1DXYA 3D6VA 2AXEA 3FNEA 3OM0A 3ROGA 2WIBA 3W3AH 3G2OA 4YRKA 121PA 2GEFA 2QY6A 3GVCA 4EYOA 3DZCA 1IBKB 1ORTA 2X14A 3I3OA 5JYEA 2YWRA 1J8QA 1N2EA 3HL0A 3OU6A 3OT4A 1U1EA 1I6WA 1NDUA 1RPAA 4GKAA 5CLGA 4DM7A 1UBLS 1XCMA 5A5VA 1PQYA 2X77A 5FULA 5B1EA 4IJWA 4TUYA 5EPEA 3H5IA 1JKJB 4OXKA 5B6JA 5LOVA 1YVPA 2ZBUA 4XZ3A 1DCMA 4FONA 4ATNA 5FTJA 3M6XA 4NG4A 5P21A 3ZIAD 2V5UA 3W5DA 4ZVKA 1PR9A 2EBUA 2Y2VA 1EFKA 2HSDA 3INTA 2GXAA 4K9MA 3O03A 2B7CA 4QU9A 2Z8YM 1PFGA 2GM5A 2OBLA 3FF1A 3IAM1 3WJ2A 2QENA 5DX8A 3RGWS 3VPBA 1QANA 1L5MA 1FP1D 2X3FA 3DKKA 1U7OA 2JAWA 3AF0A 3OO1A 2WYIA 4K86A 4WQMA 3OAAD 1HTBA 4ALKA 2FSSA 3THXA 4U6QA 3AP3A 3PEWA 3GGDA 2Y92A 5IVHA 2P91A 3IJPA 2FV8A 2QX6A 2XMSA 3DEJA 1YMVA 3WLKX 3A1SA 4DQDA 2PZKA 1MA0A 2C4UA 3BL6A 2H07A 2HF9A 3WAJA 1UDRA 1V7ZA 1VGVA 2IHYA 3QVGA 4YPVA 1XVTA 3DW3X 2AC4A 3QWHA 1KTVA 3AW9A 1RP7A 1R5OA 3FHCB 4RLFA 4ZQCB 3NBYC 4I3HA 3A1EA 4BV9A 1EB9A 2WINI 1YDWA 3EVTA 2J6HA 3EE6A 3M6FA 2QUBA 1UT5A 4LRTB 4ETIA 1ZI9A 4IF4A 5IKPA 4LJYA 5EIXA 1SIBE 1MRSA 1FW8A 4L57A 3SMQA 4RTMA 2AHOA 2JCVA 4KFSA 1ZRSA 1SWVA 3E58A 1DJNA 1JHMA 4YDHB 2ZOSA 2WG2A 3AVTA 2B6HA 5KYWB 3GNSA 1PU2A 5JJIA 4BN4A 4M0LA 3QTTA 5G0TA 2XMRA 5E8JA 1JHQA 3X2FA 4HYTA 3CS3A 1X1QA 4OMUA 5CB8A 1XZPA 2EZ4A 2OO5A 3I92A 2JS7A 4MW2A 5BV1A 2EC5A 2H51A 1MH1A 3D8NA 5BR4A 3RS3A 4KH1A 4QOSA 4G0MA 2GTHA 4MKRA 2HH9A 2GS9A 4URUR 3KQVA 2QLLA 3DM9B 4KAXA 2VYFA 4MEAA 2C3UA 1YTUA 3CR8A 1CUGA 2ZRBA 1GKIA 3ZXYA 3L8FA 3SM9A 2YJTD 3QLJA 3FM9A 3BE4A 1QTIA 4MQMA 4RZ3A 4IIVA 4TSFD 2VWQA 2ATXA 1S2IA 2GPWA 3GFRA 4PTLA 1N6KA 2GZSA 2DLCX 2WG0A 1PWXA 3PP8A 5KHAA 2JARA 2NACA 1JR3D 3BB4A 2IXAA 3BGVA 3D8SA 4IICA 9LDBA 1YR2A 5FUXA 5K9ZA 1NY6A 2DR0A 1QCZA 1G3MA 2IL1A 5DWVA 3V3KA 2B8WA 4L8GA 5DISB 3SIPA 1FZTA 1D1TA 1LI7A 2FZ4A 4RTSA 4Q9DA 3GBPA 3BHIA 4LXQA 2H17A 5BYBA 4CMGA 2FOXA 2XQVA 4J7AA 4B3RB 1GLGA 4KR6A 1R0RE 2OKCA 2K2WA 2QNRA 1LU9A 3EIWA 3NNSA 3PFCA 4IGEA 4MSUA 3TGPA 1GNQA 1TVEA 4P81A 3SYTA 4YRTA 2ATCA 3UPDA 1PRYA 1XQWA 1BU8A 5KOIA 3KEMA 4N76A 1YS6A 2FJPA 1QHGA 4Y1RA 1A9QA 1I7SB 2VR1A 4QHTA 3FB1A 4II3A 1XRSB 1K7YA 3DGFC 1GR0A 1YNOA 3D8TA 4EFDA 3CLSD 4WJLA 3JWEA 1WF3A 4OXXA 4NBUA 3EG5A 1BWPA 3NGLA 4LX0A 2HCBA 4U4AA 2PS3A 3DEIA 4HJRA 1F38A 4HUTA 4R0NA 1BD3A 5BW6B 2GHTA 3HCBA 1DADA 4GPBA 1Z36A 2AJBA 3IHKA 1BEEA 3B5EA 3CNBA 3T94A 4BRZA 2HN9A 3NG1A 5EPOA 2D00A 1BQ3A 5M3BA 1F8UA 1KH1A 1H93A 7AT1A 2FE4A 2FE1A 3PNMA 5J2TF 4XFJA 2Z5FA 4ZVSA 2A35A 1Q20A 4YCDA 1GU7A 1PVDA 1WD5A 2CMGA 4H4DA 4IV5A 1E9SA 4KSBA 3STYA 3TKYA 3ON5A 4IFEA 2PKRA 2X8LA 4PFKA 4ER6A 1LQTA 3BIXA 3HN6A 3WISA 3WFZA 2TSYB 5EAIA 4AM8A 1K63A 1VLHA 3H2HA 3M49A 1W88A 1NM5A 2CXNA 2I2AA 3BXZA 3GJSA 2QTLA 3NHAA 1LPPA 1NF8A 3NBKA 1WVMA 4MYDA 4O4IB 5AOAA 4BKQA 4YUWA 4BE9A 4Z7JA 5HF9A 3DVQX 1UPCA 4Y2RA 3ZGVA 4ZCTA 2YCLA 4MINA 5I7AA 4B35A 2VEDA 1JIIA 3NJ8A 2Q1SA 4R0VA 2JAOA 3FMOB 4TV8B 1EP3B 3DTVD 1I2DA 3V1TC 4BB5A 1W7AA 4Y2YA 1L6RA 2BT4A 2XQFA 1P0QA 2XVYA 3DT6A 3NBMA 2Z3ZA 4MMYB 4Q00A 5JAQA 1FVFA 1KJWA 2E21A 2HRCA 2Q99A 1GCIA 1B15A 4FS8A 1PKEA 2QPTA 4TXNA 1KE1A 3A1DA 1M54A 5IFLA 2VDQB 2KI5A 4ZO7A 2WW8A 4YRNA 4OK5A 4UM8B 2BTQA 1AGXA 3I5AA 3NRBA 3TLGB 4BB6A 3ZE8A 5B1YA 4ZCSA 3I9KA 3QPDA 4G5XA 5HW0A 5LQAA 3PGLA 3DLHA 4G1VA 2C2OA 5EIOA 2ZREA 4OUDA 2X4GA 1BVRA 1KYXA 5F7JA 5TXGA 5JEEA 2R5WA 3VU0A 1FP4A 1XTZA 1II8B 1E4OA 4DHEA 1L9KA 2QYHA 5CIYA 1MB2A 2AC7A 4KXYA 2POCA 5KTOA 1EK5A 1YZUA 4I6JA 2C54A 4GEKA 1E7RA 1ZX1A 3WFJA 4UREA 5EP2A 1R74A 1ZD3A 2KJQA 3OUUA 4MH0R 3BMQA 3MJTA 3K4HA 2OUIA 3HY3A 2FK8A 1ODSA 1HE1C 3ZY3A 5EP1A 2PX0A 4XGIA 3SEZA 1OOEA 4ZI7A 2PBZA 4F97A 1PFQA 3MS7A 4FHGA 4C43A 1AM4D 4YP0A 2B78A 1NRWA 3D64A 3DLPX 3JY6A 4LYFA 4RLHA 2WM3A 2W6ZA 1YGYA 5J4VA 2HCFA 4YT4A 1W9MA 2VQEB 4RC9A 4MQEA 4ETMA 1XWFA 2FEXA 3H86A 1DXOA 2OLEA 2QTHA 3D7RA 4LCJA 1LSJA 2CXSA 1EIZA 4BX0A 1R66A 1O3YA 3UYLA 4EUNA 1IZZA 3CZCA 3PKJA 2HNAA 1NQTA 4NDAA 2LPMA 3CZ5A 1S7CA 4O2BF 4WCVA 4LHZA 3I6ZA 2YFKA 4B84A 3F98A 3HR4A 3LTEA 1YZ3A 4DTIA 4ZOLA 1WMAA 2YKGA 4KWTA 2QW1A 3VOAA 2J7KA 4M9QA 2YQ5A 3KE9A 5D5QA 4Q1VA 5FI5A 3SE7A 4EUHA 5JBIA 3ECSA 4YCMA 1OSNA 4KQHA 4RIFA 1RTKA 3REOA 3TAXA 1XRJA 2FPGA 4OGFA 2V6GA 3R9XB 1DX9A 4FYVA 2RHJA 3JQ7A 3RS9A 1GQQA 3GMDA 3UMSA 4CMCA 1GUYA 5KSZA 2A1TS 5ELXA 1T8RA 1N9GA 2WUWE 3IRVA 3R41A 1R4NB 1VDZA 4I1SA 4E4TA 3VDXA 1YR8A 4NARA 5HOQA 2WPDA 3HXPA 4EI2A 5H80A 3U40A 1Z6PA 1KK0A 3KZ1E 3PYMA 1FNCA 2JJ2A 5TF4A 3IKTA 3SJUA 1ODIA 2C5EA 4WNYA 2E1RA 2PGXA 1D4ZA 3EZ6A 3OZIA 2VUTA 4KMRA 1GZ7A 4N0MA 5EWLB 1QPZA 2G5CA 4YP9A 2X22A 4GLBA 4BQIA 5B5SA 4XTCS 4WT7A 4A9AA 1W4ZA 4C08A 2WNIA 3D0KA 4JITA 4RJTA 3IDZA 2C59A 1ZD9A 3KDAA 3Q2IA 4WZAA 4DWVA 4QBGB 1BEZA 3UGTA 4CEHA 4BQQA 5HKKA 4JLPA 4MGEA 5MF6A 2WJ3A 3TX6A 3SFVA 1C4XA 2P5SA 3I6MA 1NC3A 2AMLA 1FFXB 1DKUA 3WYNA 3WQHA 1YK1A 5BWLA 3HU2A 1PW7A 3QLTA 4JOSA 4OG2A 1GILA 3HWRA 2YJ3A 1RP1A 2FX3A 1SXHA 2JIPA 1M83A 4IFTA 2P75A 4AJNA 4A2WA 5IULC 1KOGA 4M88A 2QV0A 4NI5A 1BU5A 1GLNA 4LWZA 4TRNA 1D03A 3EAQA 3KIPA 2G1UA 3IP5A 4PZCA 1BE6A 1F2UA 3D6HA 2QOEA 4IW3B 4DILA 1Z7BA 2DHDA 1HYGA 1S9HA 3DEYX 3UK1A 1WLYA 3U0BA 5F1YA 2NTJA 1SHLA 2YC2C 3DMRA 1W8DA 3IYLW 1ORVA 1ZSVA 5H8WA 3F5FA 1XJWA 3SSAA 1GZ6A 1FRNA 4DVGA 3EIOA 3IUMA 3V8VA 2HBYA 3G2PA 1CBUA 3WHKA 1SMKA 3SS9X 5EIWA 2CXRA 3OCCA 4J94A 1KI3A 2NYVA 4FWIB 1CDEA 3G59A 4KHPB 4C6RA 3G2HA 4YFVA 4RDHA 2D2VA 4K9RA 2ORIA 4IPTA 2PS0A 1RBYA 2ZBQA 2DFLA 1I3NA 2KBEA 4RDCA 4BMZA 3BE8A 3VH2A 1L5NA 4M55A 1J9GA 2B0CA 2PYZA 1A2QA 1UFRA 1FS6A 3ZH9B 4UBOA 4ESHA 5LQDA 2X8WA 2QS9A 3EHEA 1FTQA 3RS2A 9LDTA 5J4YA 2AEEA 5CA1A 3N6XA 5FHRA 4CF4A 2VQFB 4QA9A 4F46A 5J2UA 3W6PA 4CKWB 1ILWA 1IVYA 1YI8A 3K16A 2H31A 5CNKA 3I2FA 1OZGA 3GGGA 3X44A 3KK0A 5ENDA 4EI7A 3FHLA 3JVUA 5DLYA 2M32A 1ECPA 1S1MA 5B4TA 4PCAA 1FTNA 3JSXA 4X9XA 2HAEA 4HMPA 2Q1WA 2YJNA 1C3EA 3S2ZA 4OHFA 3ORHA 3FF4A 3KWFA 4ECAA 4BX9A 4FOPA 3Q7PA 1E0AA 3RRJA 4C4PA 1X70A 1IM8A 1XTVA 1V8FA 2P3LA 4WCFC 3IUJA 2I55A 3CRW1 4R2LA 3PQ3A 1E79A 1YQQA 3L8MA 3SZUA 4PNEA 5F51A 4GP7A 3WP0A 2ZI5A 3PR1A 4G3XA 3T3PB 4R4JA 3S6JA 3V48A 5LM3A 4AQYB 5AM4A 3CX8A 5U4XA 5ITSA 4BVHA 4PZ9A 1Z0JA 3IPXA 2BGTA 2NO9A 5AW1A 3KOUA 1UM8A 4O1IA 1D07A 4J6FA 4NBVA 3WWYA 3ZLBA 1T4MA 2GAFA 3A6FA 2FSGA 4S0XA 4XB1A 1M2WA 3FVVA 1HFJA 3OZUA 2PCLA 1G7RA 3QPWA 4UHEA 4YRDA 3ZHVA 3HJBA 2WV7A 4NAUA 1CQPA 1JFLA 4R1OA 4Q9HA 1MO5A 2FWNA 3NH6A 2QZZA 3HKBA 1Z18A 4WW0A 2OZLA 2IW1A 1N4AA 4RQTA 1FC0A 1K9SA 3AOEC 3AB3A 3INNA 1X80B 5AJVB 4AB1A 4D79A 1LBHA 5CT9A 3ROPA 2AZDA 3CF2A 3C1TA 4LSZA 2H8KA 3A14A 3CT6A 4LZWA 1L4LA 3EOZA 4PYMA 4BKRA 3IUBA 3BSSA 1E0JA 2FKAA 5BSKA 2XAAA 3BTVA 3D0OA 1M8JA 4EHKA 4ZAXA 1Q12A 1VOTA 5IHXA 2WQ6A 5TV2A 1O0SA 2IGBA 4YJGA 2O8EA 4R8KA 2VYVD 2Z1NA 1VBKA 3SLKA 4YUAA 4ZHSA 3MUFA 1VLZA 1MX9A 5TJHA 3OEHD 3RYHA 3TJRA 3FNQA 4IHKA 5CVTA 4CCYB 2W2MA 2HGZA 5I7WA 3PWKA 4FOLA 4KVZA 1SPBS 3WTBA 4O4HA 2IP4A 4KZKA 4R16A 3CE6A 3EDYA 3QKSA 3H6KA 1N8TA 4O2LA 3TIVA 3WWCA 4EA9A 1NW5A 3MG9A 3RH0A 4MXDA 2F4NA 1Z6XA 2B7LA 2IIBA 3S40A 4CEJA 2O48X 3CB2A 3TVTA 1FYXA 5BW8A 3WICA 2GYVA 2ISQA 3ED5A 1C29B 4YRIA 3GLTA 2NSHA 4OK3A 2PVSA 3ZCUA 5FJJA 3QVOA 1MX5A 2P78A 1NW7A 3DV9A 3LUCA 1J0CA 4FGUA 4MQFB 2YNMC 4RK5A 1R9MA 2PKCA 1PP4A 3EEIA 4O5OA 3WO1A 4RL4A 5ECDA 4X71A 4WLVA 2I1QA 1N3YA 2Q8PA 4UXJA 4C7KA 2IUSA 1R6BX 2W8BB 3S0JA 2MSCB 3HABA 3Q0IA 2VOEA 3EFOB 1EB8A 3A4YA 4WK6A 3UQZA 4KKVA 3MBIA 4PSCA 4XVRA 1HDCA 2H1IA 4C3ZA 3SHQA 5AOBA 4B6RA 1H2HA 3EGWA 4BC0A 3W2EA 1PFKA 1GTRA 3K0SA 1LLDA 3L1JA 1NJGA 5TQJA 1J0DA 3TNFA 4MUBA 3I5XA 4TMWA 2O8DA 3SC3A 3EISA 2EF0A 3LBYA 4MQLA 2Z58A 4YPFA 4N0DA 4ZT2A 2Y71A 2CLOB 3ESXA 2ZI9A 4UASA 4QOHA 3L0ZA 2CV1A 3DEHA 2YJGA 5DSXA 1UZLA 4DA0A 1G8KA 2H4ZA 1FJXA 2AT1A 5EERA 4BO6A 5B64A 1CRWG 1J8YF 2P35A 1ML4A 1O5IA 2ZYRA 2W43A 3HGMA 2EHJA 4NL4H 3P2EA 3GBSA 5HZHA 2FPXA 2A2ZA 1PL0A 1Z75A 1X1AA 3LG2A 2VP3A 4K9KA 5EMMA 4UTRA 4JYAB 4KLRA 4YN3A 1AZWA 3G9QA 5CXQA 3T1YB 1L5WA 2QYOA 3P26A 2PGAA 2V3VA 3IP3A 1O5OA 1G0OA 2DWUA 2EERA 2OZKA 2A1TR 2P0YA 5E6SA 3WRYC 4DLPA 3CRNA 5JAHA 2ZRKA 2OQVA 3ICOA 4QTXA 4QT4A 4XYEA 1ADYA 1QVRA 2B1IA 2C2HA 3AV3A 1QR2A 4Q9KA 2OCGA 3CH4B 4IDPA 4IRUB 4Q1DA 4B74A 4UVIA 1SBYA 1W25A 3EVFA 4XKJA 5DX1A 5DIFA 3WGKA 2WSYB 1SM4A 4RJJA 2EJVA 3NUQA 3MGAA 4UNPA 1T35A 1Z37A 2CBGA 2EBHX 3DVAB 4Q9AA 1RXIA 1M2OA 5CAEB 4EGSA 2DFKB 3O0DA 4C2AA 1N36B 2Q62A 4U2EA 5EMLA 3JAKA 2VJOA 3A8TA 3FYUA 3O91A 2AA3A 2QJTA 2RAFA 3EWIA 4KE9A 1P72A 5F1PA 3IEMA 2WF8A 3CN7A 4XYBA 2X23A 5D1HA 4UQOA 4RV4A 3RTCA 1GAEO 3I83A 4BUZA 2H5LA 4BNLA 2AKAB 2HEIA 2CLKB 3G1TA 3EXHB 4B34A 1Z08A 3EIQA 5T64A 1NG1A 1VCMA 3HYNA 2LBPA 4Q6WA 2AN4A 1XZQA 2V55B 2P2CA 3AIIA 4WOCA 1PQWA 1C1XB 4DEXA 3VVLA 1S8FA 1B6SA 4TMZA 2H29A 2ON6A 2JVJA 2WILA 3GT4A 4IG4A 5LA6F 3AG6A 3U7RA 2H1VA 1E3WA 3IVCA 1AKEA 1IPHA 5AKHA 4WINA 1WETA 3M4NA 3FDXA 1MJFA 2IPMA 3Q6NA 5BV8A 4OOFA 1V3TA 4BBAA 3VZBA 3I0MA 1T0JB 2K87A 2W93A 4YAIA 1BIFA 2N3ZA 3EXFB 1GUFA 3QPUA 1PGJA 2G5GX 1DEHA 1UK9A 3FTFA 1UJ6A 1NX9A 4P33A 3VR6A 1U9CA 1T3TA 2WIAA 2XZPA 1DBVO 1MT0A 1MPTA 1SUIA 1ULUA 2C2YA 3A31A 4B4VA 2JZOA 3EY9A 5I48A 1TCCA 1R8XA 3CW8X 4M76B 2JHFA 4KAJA 5FPSA 1U3DA 2IX9A 3ZWVA 1SVSA 3GAFA 1L1FA 3P2YA 3CWZA 4GQIA 5FI1B 1JEDA 2Q8NA 3KZKA 3QMVA 1SVMA 2FUNB 5F2OA 1EFVA 2QTFA 1IN5A 3CRVA 3OFNA 4YAFA 3AVUA 4HX5A 3NOVA 2FFQA 4Z4IA 1GPKA 2EJCA 4L16A 1LV7A 1S2LA 1I2MA 4F9EA 5KQGA 4EG1A 4I14A 3RWOA 4OHYA 3ND6A 5LZ5A 5KNBD 3I2JA 3GOQA 2C5LA 1RI1A 4MRMA 3LL7A 2H7YA 2EQBA 4TOIA 1E8DA 1LI5A 3C2QA 4MW5A 3TCNA 1MJ5A 3Q6IA 2EX4A 4HT3B 2QGZA 1H85A 2B4KA 1YE5A 2R8EA 2MTBA 3VR3D 4AJ1A 2HLDA 4ZRNA 4IFBA 1RAFA 5CCBA 1CZHA 3IAAA 5CFQA 3DZIA 3ABZA 3PBKA 4HQ0A 4ZYWA 5CEJA 1VFNA 3JASB 4K3VA 3VKWA 4DUZB 4DQXA 5FV4A 3PC8C 1PFUA 4UMVA 3OBBA 1X6VA 5BMVA 3JAMA 3E7PA 1U0HC 3GL9A 4S1OA 2C57A 3AH8A 2XDWA 5HILA 2YVLA 4BLRA 4C3UA 4NYJR 3DB2A 3SQOA 3D0RA 4KVAA 4OJQA 1L5FA 4R69A 4C78A 5LDDC 2QL9A 3IDOA 3NONA 5FF9A 3B5IA 4G85A 3UAGA 2I5PO 2XECA 2JHPA 2QVCA 4W5JA 4CKYA 2W0MA 1JI0A 1YSCA 5G40A 2AOXA 3V8BA 2H0RA 1BWSA 1Y5MA 4PFSA 4ZJYA 1PN3A 1VB5A 2MINB 3KKLA 5FYDA 4N3AA 4CFZA 5KOHB 3I2HA 4K1LA 4JJ6A 3OC6A 5DFAA 3WKAA 3EMDA 2WOOA 1C50A 1FA9A 2BSAA 3MWEA 4XLLA 4TKUA 2PEYA 2BR4A 5G4KB 3GCDA 1MKYA 3IAS1 1ZMOA 1LBTA 5ALZA 3VMMA 3JX9A 3SC6A 1JEAA 5IDYA 3KC2A 4EB3A 1R64A 3TW8A 1UWCA 4RO0A 4Z5XA 3R6GA 1PJ4A 1JWAB 1NC1A 2VHVA 4KQFA 2D2IA 4OHPA 3V5NA 4E94A 4F12A 1BA3A 2ZSHA 2A4MA 1PGOA 3VRHA 9MHTA 3OJFA 3P0HA 1S4QA 3MFYA 5KOJB 1NIJA 5CT5A 1A5AB 1X7XA 1XKXA 3CC8A 3MC1A 4Y0VA 3JPYA 4DUGA 2OGSA 2MDTA 4NEHB 5E6RA 5ALEA 1I1NA 1AU9A 2ZUSA 3AFOA 1N5LA 4XQEA 5HMLA 1L5RA 2VTVA 1XELA 2OOSA 1QTRA 5CJPA 1SELA 2KBFA 3GEEA 3CIFA 5FTWA 5GOTA 3ZNPA 3EEBA 1ZQ9A 1RWVA 2E4XA 2GD2A 2GH1A 2JCBA 4IJUA 2FWIA 1GP2A 2ZS8A 3SF8A 5JSHA 2TMKA 5A4JA 3C8DA 3F96A 1CLEA 2C42A 2ISSD 2XTJA 1TU0A 1NVTA 1NYTA 4UCQA 1EMDA 2ZS9A 1A77A 2P27A 4PYRA 2XD9A 2LCIA 1WCIB 2YRWA 2R6ZA 3QX3A 5FPHA 2HIMA 1C9DB 3LBAA 4MI9A 4HDCA 4PNZA 3O92A 4QBIA 2LCFA 3K1JA 5DCLA 1Y8QB 3ZWOA 5M7EA 1BDIA 2NAFA 2C20A 2XZLA 4HDOB 4LZAA 5AUNB 1CDDA 3DQZA 4XDZA 2FPMA 2I7TA 3IDAA 2FSUA 5JCOC 4N65A 2DKNA 5BYAA 4N3GA 1I0ZA 2HU7A 2AFIE 2CNDA 4M9CA 3RYFB 2FPPA 3TQFA 5AVTA 3GPDG 2P5YA 4GBJA 3LK6A 4EUFA 2LNDA 1U31A 4GMKA 5JDCC 2GEVA 3TCXB 2OM2A 4FC7A 4RA9B 4WZ6A 1FPMA 2J6BA 2P4UA 3KV1A 1DKRA 3UMFA 4MKFA 3ZJ4A 1RZRD 2JCSA 3HBFA 4D97A 2ZWVA 4X61A 3MSXA 2RGUA 1DJPA 3A3OA 2AQHA 4TMKA 1P1FA 1KEPA 4BU1A 2J3EA 4BJ6A 3ZI0A 1W1UA 3C3BA 3VO1A 1FSGA 1JTVA 1P2TA 1QO7A 4YGXB 4IY1A 5B36A 5CDYA 4Q3OA 1JQAA 4M22A 5HFNA 5JNWA 2HFKA 4CM3A 3VNSA 3II6X 3MMNA 4A0FA 3SOZA 1HH4A 1RYBA 1QX3A 4AZ0A 1UAYA 4DSZA 3G5AA 1DEOA 1KI4A 1Z0KA 3GFFA 4H3VA 3UAZA 4DA6A 1QRSA 2ZROA 3OZSA 2ZE5A 4U3JB 1JKFA 3P9SA 5EJ9A 1UMDB 2IRWA 4DLSA 1T0HB 3ZDCA 2RAPA 1NQVA 1NVAA 3PWSA 1PYGA 2QR3A 1V3UA 1UC8A 4IDCA 4ZO9A 3N87A 1NNUA 5AKLA 5FLEX 3UCFA 1Y37A 1R12A 2JATA 3RJZA 2I65A 1PTJA 2ZUCA 3ZI7A 5D01A 1I6MA 4DREA 1ZC3A 1J8VA 1DWUA 1WU8A 3AYXB 4WZBA 1XTPA 2B36A 3LCVB 5KNLA 1VE5A 5JR3A 4DG9A 2Q5CA 3TZQA 2FG6C 1UPBA 3W7BA 4R8MA 3V4ZA 4GPAA 3WLNA 1QM5A 2I6TA 1GT6A 2ZRNA 4GYKA 5C53B 2C9YA 4C22A 4LJ9A 1QQBA 2PT9A 4B3BA 3K0FA 3UT0A 3SDBA 3STWA 4DNQA 3TZBA 3N0RA 1P6QA 5EEHA 4KFCA