3UJPA

Structure of mntc protein at 2.7a
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
b'TEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNVKDVPSVVLTEGIEPIPIADGPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLEQVPANQRFLVSCEGAFSYLARDYGMEEIYMWPINAEQQFTPKQVQTVIEEVKTNNVPTIFCESTVSDKGQKQVAQATGARFGGNLYVDSLSTEEGPVPTFLDLLEYDARVITNGLLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Arginine 116 stabilizes the entrance to the metal ion-binding site of the MntC protein.
pubmed doi rcsb
molecule keywords Mn transporter subunit
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
total genus 77
structure length 274
sequence length 274
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3ujpA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3ujpA02
4WNAB 4WN9A 5CX1A 5HDQA 4INOA 4FILA 3AEUA 3AEQA 3BE5A 3MFQA 5KOHB 1N2CA 1QH1A 3MD9A 5KOJA 2XUZA 4PM4A 1MIOB 3BE6A 1M34A 1H1LA 3MINA 1QH8B 1KARA 3PDIA 2XDQB 2ETVA 4MX8A 3ZTTA 1XVLA 3ZKAA 3AEKA 3AETA 2O1EA 5BVHA 5GGYA 3AERB 2AFHA 4NNPA 3MWGA 4XPIB 2Q8QA 3GI1A 4TKVB 1QGUA 4OVKA 1ESZA 4UTPA 4MDYA 1M1YA 2PRSA 4HMQA 1M1NB 5KHLB 2XY4A 3U7QB 1FP4A 1G20A 1L5HA 2XV1A 5FLYA 3K1AB 5I4KA 4WESB 3ZK8A 2PS0A 5BVGA 2WHYA 4OXQA 4ND8A 4WZBA 3ZK7A 4UTOA 3TNYA 2X4LA 3LI2A 4OXRA 2Q8PA 1G21B 1PSZA 2WI8A 4FNAA 4WZAA 5M2QA 4TKUA 2AFIB 4GICA 3AESB 2MINA 5JG7A 4UDNA 4WNAA 4LS3A 2PS3A 5B58T 3HXPA 5CR9A 3R5SA 4NNOA 5GGXA 1MIOA 4IRMA 2OGWA 4INPA 1QH8A 5JJ5A 2XDQA 1EFDN 2OSVA 4FKMA 5M29A 3R5TA 4M7OA 3AERA 3CX3A 4MO9A 4WN9B 5CX1B 1K75A 4XPIA 5HX7A 3HH8A 4TKVA 2PHZA 2PS9A 1TOAA 2R79A 4DBLE 3NU1A 3AEUB 4N01A 2QI9F 3AEQB 2M6KA 1M1NA 1N2CB 2XH8A 5JPDA 1QH1B 4K3VA 2YNMC 3U7QA 5KOJB 3PSAA 3LHSA 3TEFA 1M34B 2OV1A 1H1LB 3K1AA 3MINB 4WESA 3PDIB 1KAEA 2OV3A 3AEKB 3AETB 1N2ZA 1PQ4A 5BVHB 5M3BA 3MWFA 4BBPA 1KAHA 2AFHB 4G07A 3EIWA 5KOHA 4H59A 1G21A 1N4DA 1QGUB 3PSHA 4FI3F 2M6LA 1K2VN 3ZK9A 4B8YA 1N4AA 3EIXA 1K7SN 1M1YB 3G9QA 4HMPA 4HMOA 5JOQA 1FP4B 1G20B 1L5HB 2AFIA 3AESA 2YNMD 4UDOA 5BVGB 4CL2A 3HJTA 4PAGA 4ND8B 2R7AA 2XQVA 4H0FA 4WZBB 3UJPA 5AFSA 5M34A 4LJSA 4HN9A 3TLKA 4MLZA 4G09A 4WZAB 1K0FA 4TKUB 2MINB 2RG7A
chains in the Genus database with same CATH superfamily
1N0IA 4FHDA 1QNLA 2BMJA 2ZETA 3DBRB 1SY7A 3FVWA 4RTRA 4RTSA 1JG7A 1QGOA 2GZSA 2BC9A 2IBMA 4H7JA 3QX3A 3MLBA 4X66B 1RWVA 4UCXA 5ER9A 3A4TA 3A9RA 4AXXA 5C2JB 7REQB 4TXMA 4OSOA 2Z4RA 1R5OA 1DQSA 4GOOD 5JAUA 1UPXA 2AE2A 2J4DA 4KIUA 4JI2B 1V37A 4F45A 2HA2A 2XDQB 1U6IA 4KQHA 4N3CA 3I5YA 1HI9A 3I9MA 1QQTA 3DAHA 4TRMA 5FWNA 1RXYA 2AJ8A 2ZJYA 4JP5A 4OMCA 1XU9A 1RXIA 4F06A 2EFCB 5CT8A 3OJCA 5DYWA 3VSAA 3ZTYA 3SQWA 2N3ZA 5B7PA 1ULBA 3ROXA 2X5KO 1CZHA 2EDCA 3T99A 1JU3A 1U0OC 2BFMA 2Z57A 3HE3A 3M33A 4WK4B 2P67A 3OU6A 1PG5A 1XAIA 1U7HA 1QLWA 2C2XA 5KTYA 1PJZA 2BFNA 4UE6A 2I4OA 3ZDZB 2QD4A 3ZCTA 4KAFA 3TNYA 1E20A 1N92A 4BFLA 5IANA 2YVLA 1GZSA 4NJEA 4X95A 4HJRA 4DA4A 3S0JA 3D4IA 3EUAA 4Z1OA 3D1JA 3DL0A 2Z9BA 3BRQA 3DC2A 3OD1A 4COOA 1XZNA 4U0JA 4XWYA 3IOBA 4D41A 1ZK3A 1AHHA 3LAWA 3AL2A 4TLLB 4QECA 1A9TA 1H2WA 2WF7A 4EJMA 5C1BA 3IVXA 3K6SA 1HYEA 1HRDA 2OBLA 1A2BA 3ESQA 1A9RA 1IFXA 4B6GA 2VNAA 1IQ0A 1BXGB 3E8MA 3Q1LA 5HK8A 3TQCA 1JFFA 2PX2A 2X7HA 2P1DA 2Y8EA 1MW8X 4IVQA 3FVVA 1FUEA 3S7TA 1SQSA 3LUJA 2E6KA 4IYRA 2VUUA 3QKWA 1JIJA 1KORA 2NVOA 3PZRA 4EEKA 1DIAA 2ZI5A 5B2EA 2W6JA 5CA1F 4DQUA 3QENA 1AUVA 1BVUA 3W6UA 1I1OA 3DEAA 1E4OA 3A2KA 3PSAA 3TD6A 3LSTA 1PV2A 3ZVNA 3LOPA 2FXVA 2JLSA 3OPVA 4LE1A 9ATCA 1DBPA 2HJRA 1TEXA 2Y0DA 3A6HA 3AJAA 1FFGA 4X1YB 1RWWA 3SFZA 1YKGA 1INLA 4BBPA 5CEJA 1TDJA 1UT6A 3RWOA 3EIWA 2Q2QA 2NU6A 1C9YA 3HB1A 1T5HX 2FMFA 1PT7A 3P45A 4GPBA 2OHJA 4IDHA 1W5BA 4X63A 3R7BA 4ZDIA 1DSSG 4Q37A 2QJFA 3U44B 3PFWO 4YRFA 3WDMA 4O4JF 5HIAA 2PWAA 2BKEA 2QT0A 3FOAA 4HAVA 4J0FA 1PTJA 3AH8A 3O1HB 4WVFA 4OJTA 3SYMA 4MMXB 1C9NA 4KFTA 3U16A 4R6XA 2C7PA 4BCCA 5AFSA 2HKIA 2FKNA 2R5FA 1JAZA 1T1GA 3LHFA 1GQYA 1XVIA 1PP4A 3L0SA 1U0FA 4GYKA 2YHSA 2P9GA 4LPKA 1X94A 2BE9A 2BHLA 3GDFA 3KQMA 3U13A 2RJOA 3INTA 1EUYA 2IUUA 2O0LA 3CCFA 3QTBA 5TLSA 2RIPA 3CF2A 3OTQA 3T94A 5EQFA 2PSFA 3IS3A 2IDJA 1FPMA 4LY3A 4LE2A 3QKTA 4IX1A 2GVZC 1PJRA 1GD1O 1YR3A 2V55B 3UHOA 4BMPB 6AT1A 2RMKA 2NTYC 2CYCA 1ODCA 5H9WA 3M6LA 3I64A 3X1XA 2F4VB 1BFUA 3PUKA 5EZYF 2ZI3A 3WB2A 4ND6A 2VBGA 2PH7A 5HSGA 1OH7A 1QYCA 2K4MA 3CMMA 3G0GA 4MCJA 4UBMA 3AETA 2N42A 3D64A 5DFAA 3ZKAA 4OQFA 4NOJA 1Y98A 4BVFA 2H00A 2HWUA 5I8WA 4QU5A 4BQPA 5HCUA 3DH0A 1V9LA 4QHSA 1W87A 1IZZA 1G41A 2CHFA 3ETGA 2ZYIA 2X42A 2W71A 2Q4TA 4H7EA 1Z5PA 2JEOA 1NPDA 2XWBF 3N3AC 4MGZR 3E3AA 1DKPA 2W4IA 3WNCA 1MB2A 2DH6A 4CN9A 3ZK8A 1JSZA 1G7RA 2GTPA 1PFQA 4B43A 5BW5A 1RHUA 3KHTA 4I4TB 2OLKA 1LPOA 4OXIA 3REQB 3AR7A 1VG0B 1SD2A 1XXHB 1Z3CA 5K05A 5JY6A 1K27A 3ELBA 1AQ6A 3D7KA 3AR6A 4NESA 2R68A 4HV4A 1QBKC 2PUBA 2FPMA 3G2PA 1JSCA 4LA4A 2C8KA 1E77A 1U7DA 2XNKA 2F00A 1EVIA 1I4TD 2PQ6A 2VDMB 4TTTS 4XXHA 3WO0A 1I24A 4PX3A 3IIJA 4AUNA 1N1GA 3WLTA 3L01A 4P81A 1JKFA 3UBMA 5JMTA 2O14A 1KC3A 3C87A 2FP3A 2DBQA 1P7CA 2PLAA 1R8XA 1WXIA 2ZWAA 4MS4A 1JYEA 4UUAA 1W1UA 2IS2A 5JJLA 1LPNA 4IG9A 4LYJA 4YDRA 4DCJA 2OOSA 3PXBA 1OBOA 1P4JA 3HR8A 4IMPA 1B6GA 2P78A 4LRSB 3JAMA 2GO7A 3K2EA 2ZS7A 4MGEA 2ZFUA 4WCDA 1BH2A 1C8KA 1DTWB 1Q20A 3QZUA 5EHQA 1GCIA 3PGA1 5H7XA 2CZGA 4DBLE 4ZGBA 4QYTA 4JLOA 3LMKA 2IXEA 3EUEA 1JG2A 4HPJB 2EZUA 3JVDA 2VCHA 3PDHA 2ZUSA 1YB1A 2BT4A 4HAIA 1TU4A 2B36A 5GONA 4EJSC 1A50B 1JXQA 4B2YA 4PSUA 3UAOA 1RD4A 3E4DA 4UNPA 4F97A 4YRZA 1U7TA 1OVMA 3P26A 4HTAA 3WY9A 1AG9A 1N2GA 1NQ5A 2YZMA 4DR7B 1Q92A 4V0ME 1XVTA 4ZC1A 1N7IA 2ZUDA 3C6KA 4MMYB 1OLSA 2ENUA 2ZSKA 2C9YA 2Q1TA 2ZRQA 1J9ZA 4WKCA 4GKKB 3RODA 4K9MA 4B5LA 1NHGA 1GLNA 3U61B 4A4DA 3OPNA 4MQEA 4B7AA 3S3TA 2D0PB 3I73A 2IYXA 3RU7A 2DLDA 3KAQA 1ZGGA 3WS7A 1NVDA 3PC3A 4MZDA 5ENVA 2XQJA 1KR5A 1CT9A 1JEOA 1CXZA 1J8MF 1UK6A 1XKXA 1ZMXA 2ZM6B 4F4IA 3KKOA 3CYFA 3VXKA 4KBGA 4CDGA 4LF4B 1J90A 2ZW9A 1L5KA 3WQRA 4L3VA 1K6XA 4MR7A 3DLAA 5HQTA 1Y7TA 3DM9B 3PXCX 3PQ5A 2A1TR 3MCTA 4HH3C 1O89A 4XE5A 3SIRA 5HQJA 4E13A 4JYPA 4Z7QB 3QE0A 2UKDA 1TVEA 3IEXA 1JAXA 2ZSDA 3N6VA 2YFQA 4WACA 4KWCA 4EO7A 3G0IA 2M32A 1P0IA 1GGMA 2HHAA 4EQ6A 2JA1A 4G0WA 1U8UA 1EQUA 1AB5A 4KITB 2VAMA 3FWKA 4ZFNA 3CNNA 1OX4B 1P1IA 3P9XA 1LB1B 2OKGA 3NS7A 1M2VA 3R44A 4ESHA 2HWKA 4MPTA 3G23A 4N7BA 1H8HD 4EY7A 3T9AA 5T67A 2R3SA 2VK1A 2YZ7A 3TOVA 5ADWA 4AWXA 3LKDA 5BPHA 1UBNA 1C0LA 2FZCA 5LQRA 2BMVA 2ZRAA 3UA3A 3URKA 4D0GA 2FPLA 4O4IF 2IOFK 3N8NA 3I8XA 2AB0A 2LRHA 3MGBA 1H0HA 4E5YA 1P9NA 3DLBA 1OZHA 4KGDA 3SNHA 3SHVA 4RLQA 3D2AA 1LRKA 1AKEA 5AKHA 5IT0A 1ZJYA 2AV6A 1P80A 4MVJI 1VGVA 4QTTB 4YPVA 4EPXA 4IXNA 3HI4A 5IN4A 3VR6A 4L0QA 3B82A 2PLNA 3F47A 3KVOA 2IPAB 3EEFA 4MV3A 2C4HA 1IN8A 1TECE 1DC7A 2Q3MA 4UHHA 1BA2A 4C06A 4B4VA 5FBWB 3F3YA 3MS4A 3INNA 2P9TA 2H06A 3AESB 1ZM2A 2X4GA 4I55A 2OO7A 1NY6A 3B3QA 3HVHA 3W05A 3TGPA 4MXDA 4DQKA 2ZYTX 4U9UA 4DMUB 4PGFA 2EU8A 4P4UA 4PVCA 1PFYA 2OP0A 2XEXA 4FZ5A 2QGNA 2XMGA 5EJ9A 1GSHA 2IEIA 1M2WA 1L2TA 4G6ZA 2AHOA 3OCVA 4J49A 1YJQA 1NFFA 3HQ4O 4ETIA 4KFRA 3AKZA 3ONWA 4NAUA 4ZCMA 3QU2A 4WOKA 1P0MA 3T3EA 4QDUA 3EEIA 1L8QA 4P3OA 2DUJA 3PUZA 1LEHA 1A98A 1FQOA 1T4CA 2VAWA 3DUFB 3LGAA 1J2TA 3MBKA 4RC9A 4XCXA 5ADVA 2IYWA 2GXSA 4MPPA 2OILA 4G5OA 1BE8A 1LDNA 5K4HA 3HYCA 2J3MA 3RADC 3G5TA 5H1YA 3AVTA 3BSFA 3QWIA 2AXNA 3BFVA 3DO6A 3HFSA 4G4GA 3ZW8A 4ZEVA 5JAHA 4B31A 1A95A 1N5LA 1JW9B 2WZCA 2FSFA 2O2JA 2QEQA 3GO4A 1OLXA 4QEKA 3R6LA 4V0MA 2EJBA 3HBJA 5CD1A 5LB4A 5KYYB 5JJCA 1NDUA 3AHHA 4KMSA 3AY0A 4U6NA 1E9VA 2AK3A 2P2ZA 1OGYA 4KXMA 3W2EA 2DBYA 4KV7A 4BX8A 2ZIVB 1KSJA 4Q18A 1AN0A 2VDWA 1Q0LA 5E7QA 4U3JB 1S0UA 2IYSA 2P30A 2D3WA 3D59A 4LZJA 3RUEA 1TPZA 4J07A 1T2EA 1EK0A 1Y6RA 2H48A 3S2SA 3FLBA 1EXDA 1NYQA 4HZIA 3IJPA 5KDLA 3SEZA 3HM2A 2C7RA 2V6MA 3OLYA 4HVTA 4NTZA 4C14A 1JEDA 3R77A 3ROGA 1RMTA 4KSYA 3TMAA 4KN9S 4BNZA 4KW7A 3Q6IA 3WA6A 1IN7A 2W83A 1X7HA 3BEDA 3CLVA 10MHA 2WR8A 2FCAA 2FZEA 2QL6A 1H4VB 1K0FA 3CURA 3JQQA 4WLFA 4DA6A 4PN7A 2H1LA 3N74A 4OBBA 5BYKA 2WQ6A 3RT1A 4BNMA 2JGIA 4N12A 2HIHA 3PWZA 1ADYA 2FPPA 4RK1A 3OPYA 1P5HA 2FZLA 1SCBA 4S24A 2KX7A 3LYLA 4IDDA 4DABA 1D2EA 5ADHA 2ZATA 1LF5A 1S7GA 3LCVB 4Q15A 4WK6A 1F0NA 2FN7A 4X41A 3TIFA 2XUZA 3G1TA 4CETA 2PJRA 1F4LA 2FKAA 2WWRA 3LY5A 2WSMA 4J16A 1MNQA 2ZYWX 1WA5A 2BCJQ 3SVTA 2MMGA 4AI6A 2OFXA 1MAVA 2HO4A 2VLIA 2M2IA 3NBAA 3UJBA 4XUEA 3DTVB 1LUAA 4LVUA 4OXXA 1YB4A 1OUMA 4ZQCB 4OLAA 1UFRA 2WJJA 3TUJC 4BZPA 2PA3A 1P72A 3VR5H 2DB3A 1FNMA 4OUDB 4ADSG 1IWOA 1RWXA 2GYYA 1K5DA 4RZXA 3VPGA 4OBWA 1N9GA 5EAIA 3C5CA 1ZAYA 1SXJB 2YJ3A 4UHEA 4C2BA 1MJGA 2XRMA 3JQRA 1RQGA 1QUEA 3FF4A 1RC0A 3LFUA 4CEJA 2I62A 1CRLA 1EE9A 4FFVA 4GSLA 4ONEA 3IKVA 4RZSA 2ZI4A 5EN4A 5FJJA 4CM9A 1R6DA 3D3KA 3FNHA 5I7EA 2XTJA 3T1HB 2BLLA 3NT2A 1V6CA 4PXYA 3W5DA 4GWKA 1YRQA 4ZARA 4IX9A 5KHOC 2XB8A 4ZXFA 4ZYWA 1FU4A 4RFSA 3VTZA 3IVRA 2JD0A 1ZH0A 1KDZA 4R1LA 4KXFB 4TN1A 3GXOA 1YMUA 3AX6A 2GRAA 2Z2KA 2DWOA 4HDOB 1EUCB 1W5TA 3KELA 2XYQA 3EWIA 2H6EA 3KOZA 1T36A 5U4XA 2FZWA 4DRYA 4DY4A 4EB8A 4DV6B 4ZYLA 1KPGA 1KYIA 2DMRA 2QUZA 2JLAA 2HZBA 3CG0A 2MT9A 3H0CA 4X1OA 1XQYA 5KAMA 3N8KA 5IWAB 1EK6A 1A0OA 2FP4B 3GNSA 4GMHA 1TQ8A 1GNRA 5CVJA 4H3HB 5BV0A 3DKKA 2C7GA 3IHKA 3EJ6A 3L9WA 4L8GA 4NV0A 5HTKA 3UUGA 1MKYA 2E48A 5F23A 3NTQA 5CB8A 2V7VA 2AOWA 1X14A 3FHLA 4YAKA 3TRJA 2CHQA 2V98A 3KJGA 4CQMB 1SUCA 1P3Y1 2VUSA 5U4QA 3BGDA 1ZH4A 3L8EA 2NYUA 4XYGA 4Y0NA 4YAJA 5BQFA 1NOIA 2Y1LA 1EAMA 5ULLA 3DMRA 1QZUA 2QU8A 3ESDA 1NE2A 4YCDA 5FI3A 2IW3A 1FFWA 2PMCA 4MINA 3H18A 2KLBA 1L5LA 3E81A 4C5CA 4AT1A 1PTKA 4RAOA 3GW8A 4KPGA 1Q1QA 1EI9A 2OE2A 4ZV9A 3W79A 3AM1A 4N8EA 3DAYA 3KQQA 5ESRA 2PGJA 2XE4A 3I9FA 2D3TA 3ZV7A 4TX1A 4Y30A 1LPAB 1GG2A 4ER6A 1SCIA 3H9CA 2CV1A 2WAAA 4M89A 2UUAB 3H9QA 4XX0B 1P17A 4DILA 5FOXA 2P2YA 1WHTA 2AWNA 1YASA 4KYUA 5I9IA 3GUZA 5B12A 3UT5B 2QVBA 1FZQA 1SHZA 2HU8A 3W06A 3BHJA 2Y76A 1JHQA 1TAQA 1PZXA 5EJFA 3KR9A 3L7OA 3LTEA 1IK6A 1UK7A 2R66A 3QYFA 1NXSA 2XB6A 3IP6A 1LSJA 1O87A 2A0FA 1UL1X 2C2GA 3GRUA 3PUYA 4NWIA 3UXYA 2ZRFA 3UK7A 2FFJA 3WIDA 1H05A 3DT8A 4TV8A 4QARA 3EOBI 2WF6A 2YNMA 1E7SA 5YASA 3TRIA 3LKZA 1K3FA 1Q95A 3QUSA 2W2NA 2IC5A 1B26A 4HEQA 3K2IA 4TQAA 4JI3B 1AKRA 1NW7A 1CF4A 1SN7A 1ZS9A 3DONA 3NR2A 1W94A 1JDNA 4KE8A 2O59A 3D7MA 4DQ0A 4FB5A 3GT0A 5EZ6B 3T9BA 4FE4A 1L5SA 2C0CA 2PT5A 2QRKA 2Q3CA 3RRJA 3DD1A 3NI2A 1Z8NA 2BI8A 1W1IA 5DTJA 4WL0A 8AT1A 1Y4SA 5B7GA 2ONJA 3TLZA 3OWXA 2PL3A 1EG7A 1C3XA 5FUMA 2OO5C 3OIVA 3P71T 2P9HA 1RHJA 3HR7A 1QHIA 1L5HA 3ZLUA 3ET4A 1KU6A 3Q2KA 1OXXK 4FW9A 3WGHA 4AF7A 4C03A 2I4RA 2RGDA 1ZCBA 4ND8A 4R7GA 3D3QA 3L5KA 1ZSNA 1LS6A 1XEWY 3H9UA 4G9GA 4PHTA 5IAKA 3DCYA 3W4KA 4ZA2A 2CLEB 5BMVA 3EF1A 3FOBA 4NE7A 4PR0A 4QAJA 4YMGA 2GN1A 2YWXA 3VH1A 2AA3A 2R00A 5DM4A 5F4ZA 1A4UA 1IPFA 1UBEA 1YRHA 4KHZA 5AO9A 5SZKB 3S8EA 1N5IA 1GTZA 1IPEA 1ODKA 5D6OA 3LWBA 1H8ED 5DYGA 2DG2A 2FWJA 2V4MA 3KPVA 2A9RA 3RVBA 3KQTA 3SGLA 4OB8A 3W6ZA 3JRXA 3X1JA 1W581 1E6UA 2HK9A 4EELA 3ME5A 1Z12A 2W6OA 3F6PA 4PLHA 4PO1A 4ZVMA 5FLEX 1SA0A 4LV5B 2FZGA 3VJMA 2AK2A 1Y1KE 1AHIA 1AKTA 2O0JA 3HKDA 1I2MA 5AI5A 4CF6A 3PCXA 4LWZA 5IFLA 5CX4A 2J8ZA 3A6GA 4IICA 2WIFA 1ZUD1 1TX4B 4OYLA 5EA2A 3AUAA 1R12A 2WYHA 1MQ8B 1OSNA 1YCFA 2C4WA 5FWYA 4NDNE 2PUEA 3OF2A 1NJSA 5FA6A 2CJYA 4XVCA 4HDMA 1PJQA 2A9FA 3OP4A 1TYAE 2BFEA 1PN3A 4MV9A 3V1TC 3OAAA 5KOIA 1EFTA 1SXGA 3QVUA 1JSRA 4LC0A 5F77A 5FR2A 3WYDA 3HCRA 1DNPA 3E03A 1M1XB 3A6EA 3SYLA 1FP2A 1ML3A 3OO1A 4Q4HB 3OPXA 3U3DA 3UW1A 4GE3A 4F60A 1ZKMA 2B8TA 2GCGA 2CWWA 3RJZA 2OAGA 4NFSA 4PPNA 1JNYA 5TRTA 5G3ZA 1F06A 2Z95A 3FMOB 4I5GA 4Q4AA 4PYLA 4CI9A 5ADUS 1QTRA 2HQSA 5NULA 2OORA 4L8WB 4FUTA 4K1XA 1YRBA 4TMWA 1IVYA 4G01B 3UGQA 1CNFA 3QFTA 4II2A 2QL9A 3HYSA 4FC7A 4WLEA 1RRPA 4U7JA 3V7YA 1LK0A 2I3ZA 5D5HA 1NW5A 4EGQA 2I7XA 2ZRCA 4FD2A 3G2KA 3ZOZA 5JDIC 4A1FA 2ICAA 4KDEA 5KNDD 5E6UB 1J9EA 4CDMA 2ZR7A 2V3CC 4LN1A 1C8BA 1FFBA 1Y8QB 3G59A 1SUDA 5FPYA 3WGVA 1PZFA 1IEWA 4R0MA 1R4NB 4WY8A 3WSTA 7MDHA 3PFGA 2OB2A 3DHYA 5JVDB 1O6CA 2EFDB 3RVNA 1GTL1 2IRWA 2XB2A 5TX7A 3IVMA 3JASB 4WQMA 1A1SA 2HPVA 2P9EA 4OK6A 4IDOA 2A0KA 4KQ6A 2PUFA 1NYRA 3L8CA 1SNYA 3QK7A 2Z9CA 5BWMA 1WB6A 3IO5A 4GPAA 3KTAA 3HJFA 2HSDA 3VVMA 3WMWA 4AWBA 3EVBA 2JFWA 1FYEA 3QWBA 4JYBA 1ZI8A 1HLGA 2ZIZA 3OC6A 2Q8QA 1II8B 3RS7A 2H4JA 4MKZA 4UNQA 3F90A 5U9CA 3IBCA 1HLFA 3ZLBA 3R3YA 1IIBA 1N2JA 2E1RA 4KN8A 1Z7BA 2BFOA 2RGEA 2VWGA 2DFTA 1PU2A 2NO1A 4K8OA 1HFWA 1O7JA 2JVJA 2O2IA 2C1EA 3OM8A 3LC0A 1Z36A 3QVGB 4IIDA 2WFAA 1BS1A 5BUSA 3QXJA 4M60A 2O5VA 3LCUA 1EVYA 4L4RA 5AKYA 5KNCA 4Y9SA 4FDLA 1PEKE 4ZOEA 5BRJA 1A5TA 2Y1CA 3LDHA 4ZT6A 1X87A 2HF8A 4MR8B 2DEUA 2CDCA 3O2SB 4NCHA 5JQGA 2C5FA 4OHFA 4QFMA 4KRFA 2XRFA 1S7CA 5IYZA 4X00A 1H85A 4XD7D 4JR0A 5MDHA 4NMWA 1VKRA 1W96A 4PXSA 3PKZA 4LGCA 3BORA 4WOCA 1E4EA 2BTEA 3OPQA 3LWDA 3A06A 4GOJA 2J9FB 1BMTA 3Q11A 1FB5A 2QZPA 2ZJ5A 4X8MA 3TUZC 3KOWA 2PDAA 3MXTA 3B5EA 4L0MA 4ZRDA 3L2OB 2VT2A 1O1YA 2QLTA 3I0NA 3QEMA 5DHTA 1FVFA 3NJ8A 4ZEXA 4YUVA 3WMXA 4BKRA 4BEJA 3VVBA 1ACMA 1MO4A 1T2DA 2HO5A 1XALA 4MUAA 1S2LA 1SK9A 4LHWA 4XPIA 3FB1A 5B4TA 5JHGB 2QG6A 1POXA 4BFWA 2ZAYA 1TOAA 7YASA 2L0XA 1JN0A 5HZHA 1H5NA 4DR4B 1GL6A 1W5FA 2C2MA 5HOEA 4CKYA 2YR0A 4B3XA 3I8OA 4QG7A 4H1TA 3TI9A 2EBHX 1TFUA 1YMQA 2OCBA 1TAGA 3HZHA 3IQWA 1G8FA 1QE5A 1WIWA 2FG7C 1A5AB 4HN2A 4HWRA 3WGZA 4BB5A 4HXFB 4RDIA 2WQ7A 1WCWA 2J09A 4V38A 2J9YB 1SPXA 1KAHA 2MDTA 4TPKA 3IIIA 4ZPJA 4F85A 2HRZA 3H42B 4E51A 5REQB 2YFYA 1DKRA 4NCBA 5A3SA 5TQVA 3PF8A 3VUEA 2BGGA 4KNVA 3KYJB 3RTDA 2WIGA 2Y9MB 1Q7GA 4HWGA 1I2CA 4HMPA 1ECJA 4A91A 3WK7A 3T1TA 5DXAA 5F9MA 4CMIB 4WXPA 3RTCA 2ZRKA 1VZ3A 3U4QB 3UICA 3T38A 1YJBA 1AHNA 3TCNA 1ZISA 3Q9UA 2IYYA 4IEIA 4OHVA 5HM6A 1CEEA 5K9ZA 3HJRA 3GGPA 3NTLA 4TROA 5H4HA 3M9WA 3I6MA 1V5EA 2W6QA 4JBXA 3KUCA 3MJVA 3PNVA 5D3MB 3LBHA 2Q6IA 4EG8A 1ONSA 1RI3A 1YR7A 4B3IA 4KB5A 5F5NA 1DC5A 3KQKA 1E7RA 2LW7A 3ORHA 4IL5A 3RS2A 4E08A 4YAWA 2ZYGA 2WHQA 2AOUB 1Y81A 3EDOA 1RBMA 4J7XA 4LOAA 5FXMA 3THSA 5CHEA 3V8QA 5EQTA 3RFUA 2GJAA 2CLOB 1PBTA 1WF6A 3HKCB 3FTPA 3IIMA 2JFHA 3H3FA 2R4UA 1Z18A 3UJNA 3G5UA 3RRMA 2BEWA 3VU8A 3C39A 4M0LA 5AW8A 1QO9A 3TKYA 1G55A 1T9GS 1QFYA 3EXAA 4M8IA 1UXHA 1T4GA 2MTBA 1P8JA 2UVPB 3T9CA 1V8ZA 4NCAA 1F1JA 1TFRA 2ZVJA 2EGGA 1UMBA 2G5GX 3UJ6A 4JVLA 4AJ9A 4DNXA 2AFHA 4U7GA 4DMGA 1YZFA 1UBOS 2GHQA 1NULA 1ECGA 5EKDA 2VTBB 1BVYF 5E8RA 5EP1A 3JRNA 3U9LA 1UF9A 2CCJA 1UODA 2PUJA 4DV1B 4A6EA 3UH0A 1CZKA 3AF3A 4PTLA 2RHGB 1JBEA 3O82A 2F1HA 1A7AA 1Z5UA 3QSGA 4S35A 4GPD1 3AVYA 2LKDA 1M0TA 3DUWA 4JGBA 5AOVA 1IH8A 5JXGA 1EM6A 1SBQA 1UDXA 1UJMA 4JROA 5T5QA 3RBXA 5CB6A 3EMKA 3F98A 5CYPA 4CLOA 3E82A 2JW5A 2BPOA 1SUEA 2LTAA 3K0FA 1Q22A 3I1JA 2OC9A 4LMBA 3A9TA 1Y5MA 3SEQA 4HH0A 4PNEA 4IDEA 1QG4A 3GJRA 4CLEA 1SUPA 2DHDA 3STTA 1OLOA 1RKUA 2YS7A 3NYWA 2BFCA 2UZ0A 5C5EA 1VKJA 2VUHB 3KFXA 1S4MA 3R0IA 2VJCA 3E5RA 4ZOLB 2NU8A 4F5WA 3T3OA 4D4IA 1Q0SA 1R4MB 1WCIA 1E7YA 2CD7A 3NIDB 5LA6A 1USGA 5D86A 1PLLA 1Z5NA 1DI0A 1FVXA 2PK3A 1EB9A 2XT6A 5DIZA 2CDNA 1Z2PX 1AUQA 4RLFA 1DKNA 1T6BY 4DVGA 2CNWA 2VK8A 2YIVX 5KTNA 1LDMA 4O2RA 3C1TA 1NT2A 5IXSA 5DPMA 1P0QA 4HI0E 1J56A 3GVHA 1EQAA 3UWSA 1SD1A 3V7NA 2WD7A 1T8YA 4OK3A 4DIMA 1X13A 2X13A 2VPPA 1OGIA 3A0UA 5AK6A 1PLJA 3C3XA 4Q3DA 3O74A 4R2KA 4NU5A 4MYDA 3O8QB 5B37A 3TX2A 1E6CA 3DOEA 2VDOB 4G5XA 4R31A 5HTOA 3T3NA 1DAEA 5HZMA 2AUNA 3A9CA 3MJCA 4HEA6 5JBIA 2FJ0A 4ER5A 1TM2A 3GAZA 3TFQA 3DCJA 3VAAA 2QUAA 4QE3A 1QH0A 1M66A 3P4UA 4FWIB 5TPWB 2VTDA 3FN4A 1CERA 3RU2A 2HMUA 4TV9A 3B70A 2Y4OA 5TT1A 5TVGA 4UZSA 1SB8A 2REBA 5E1BA 4HGQA 1K8QA 4LW8A 4H15A 2H31A 3KC2A 4LWQA 4ZYYA 5IVHA 3RK0A 1G2OA 1JT9A 4JI7B 1Z16A 2Z56A 4I3HA 821PA 4M1EA 3CLKA 2C2OA 1TKBA 3GJ6A 4PBRA 3S2IA 5KS2A 1NXOA 3H04A 3QF4A 5IDXA 3FFTA 3V4RA 4KXQA 1JLKA 4DCGA 1ZVVA 2XHZA 4Q5IA 3WE7A 8MHTA 2NNWB 3TDMA 4IWNA 5I7HA 1PNVA 3UCEA 1YZ3A 2Z5GA 5ENZA 1IRXA 1Q6YA 1JFVA 3HWX1 3TZ6A 3O31A 3VYRB 1J8QA 1MV8A 3ZGNA 5AKEA 1NW4A 5A9TA 1PL8A 3R6WA 1Y9JA 3AEUA 4M86A 5AP9A 1MRZA 2IUEA 3I1IA 4MKGA 3BQNB 4QQFA 5DBEX 3ESRA 3EDRA 4XJSA 5G40A 4ZCLA 2I4IA 1PIWA 4X3CA 4IZIA 4DYHA 3AR4A 4LRUA 3SBDA 3ZTTA 1JF8A 4Q9LA 3C43A 3CINA 1DT5A 2IH5A 4IP0A 3DXZA 3IERA 1TUBA 3DXXA 4EZEA 2LR0A 1TE2A 3EVFA 4F2WA 1XCJA 5KVSA 2RGXA 3IE2A 5A62A 1P8AA 4UZEA 2UYOA 3O3NB 1FSSA 4GZ6A 5FWDA 2J3QA 5E0OA 5KCZA 1L7RA 4ZWNA 2XNCA 2NP7A 1BGWA 1TYZA 4RELA 1YC5A 2CC2A 2AZMA 4PC7A 2DE0X 4QQNA 3I28A 4Z53A 3D5EA 5KX5B 4BQEA 2FR8A 5KSZA 1ZWLA 1TADA 4Z4HA 3ZK7A 2JIDA 2HC9A 2W6NA 4E3ZA 2A35A 1K5PA 1RQ7A 2PRIA 4GZ3A 2O4CA 1EVJA 1HNNA 4KCGA 3X1WA 2QROA 1C8VB 2QAGA 4C4ZA 3MT0A 3HA7A 4GYYA 3ZWCA 4ZI2A 4RM2A 1KF0A 1RW4A 2BFBA 1XG5A 3MSXA 4WH0A 2Y27A 4ZRNA 1N9ZA 3F5MA 3CVUA 1QYDA 5AVSA 4HGNA 3G9XA 4L7VA 4MW0A 4XCVA 3V8RA 2JHGA 3WMEA 1LVUA 3HWSA 1ECFA 5BN5B 1XF9A 2GWRA 3WGNA 4JENA 3WZMA 1AKVA 1LRLA 1MG5A 1PCXA 1NAIA 1Z5VA 1GYPA 2MU1A 2PZKA 1VKNA 2W0MA 3H2BA 4XGNA 5B30A 5KTPA 1XPUA 2Y1GA 1KZ1A 1MIOA 3K2BA 4H6XA 3OX3A 2BGIA 4W1PA 1AX9A 2H1VA 3PX7A 2N75A 4OQNA 2PQ0A 1HFEL 2CFCA 4MLCA 5LZ5A 3L3BA 2HPZA 4IFBA 3PGVA 4XDHA 3T7RA 5DK6A 2RHCA 2ID7A 4K9SA 2ZITA 2VP4A 4UXJA 3U1VA 1XELA 3CJQA 4OU5A 1PE0A 2PKXA 5AVUA 3R3XA 1UOPA 2IYVA 2X41A 3LP6A 5HKAA 3L1KA 3S2GA 4LF7B 1DQRA 1D03A 2WSLA 1XQ9A 2PVSA 2WDZA 2A4MA 4Q82A 1QMGA 3NPAA 3PFIA 4QO7A 4EZIA 5H59A 5BVHB 3EG9A 5K3CA 3BT7A 2E2WA 1KKLA 5B3LA 1YDMA 2OK7A 1G3RA 3PHJA 4IUCS 1E1CA 3OD5A 1LI5A 1WB9A 1FSPA 1UM9A 3D6NB 3QEKA 1DRVA 2JK0A 2V96A 5G4KA 1HBJA 2WJ3A 3OUZA 3IUEA 3GBPA 4Q7KA 1QANA 4PS1A 3HADA 3V33A 2GKOA 3VJRA 4BN5A 1TRHA 4O2BF 3UBTA 3DQZA 2VPTA 1M6HA 2AH5A 5J4VA 3FVQA 3M5CA 4ZIRB 2WPDA 2M6SA 2BLNA 3HABA 4DCPA 4IGFA 2BE7A 5FORA 3ZI0A 2DFVA 1EWRA 1EUDB 1NW3A 2HXSA 3NOOA 4DCNA 4IO1A 4MVWA 2IZ7A 1YDGA 2FNAA 3ASZA 1J00A 3BA1A 3RANA 3OM0A 4BIIA 5EYPB 1B6SA 2VXCA 3HKEB 1TB4A 2ECKA 2Z2ZA 3D0OA 1U3DA 4OKNA 2F48A 3ZV6A 4BIMA 1TF2A 2FRDC 2JGJA 1JHZA 2WM3A 4QUAA 3FPCA 1X9IA 1ESDA 1ZAKA 4B9AA 4EB3A 4G23A 1B0ZA 5EKUA 1U8CB 5B6IA 5HS6A 5J2UF 1C7JA 1OKKD 2M6RA 1TMYA 4IIYA 5TQJA 2ZIXA 5LYJB 1OH5A 5CT6A 4N9QA 5H83A 3D9QX 2UZ3A 3DKPA 3M1IA 5JYCA 3BMOA 1BN6A 1FRZA 1X77A 3FYUC 2A5YB 2W11A 1H66A 3R3SA 3NHSA 3QKSB 2DWCA 3VPSA 3HMKA 3HCWA 2P5UA 1NDQA 2GK6A 1C9EA 1J33A 1BJTA 2N9UA 2ZVQX 4JKYA 4YLEA 2Z2IA 1M0SA 5JATA 2C9OA 2BDUA 3RQSA 1DCKA 2I6SA 4FCVA 3C6YA 4M49A 1XQ6A 3WYGA 4O1MA 5HW0A 3VPXA 4ARIA 3PPVA 4DLXA 3TD2A 4YCNA 2TYSB 5BSVA 3ZVMA 3OLZA 3WAKA 3JZMA 4IZ6A 2GPYA 1OFTA 2HWXA 4XLTA 1BC5A 5ARBA 2OZLB 4FEEA 1XR3A 4LJ6A 3CKMA 2VO1A 2VEOA 5FIUA 3PEWA 1GRCA 5HIKA 3DOJA 1YOVA 4JODA 3E7WA 3R7LA 1FQJA 1RI1A 2P75A 1YIDA 2GEDA 3BWYA 4I46A 4UE2A 1NKTA 1OWLA 2UVDA 4LJ8A 5C3UA 1A1VA 1HDIA 2YMPA 3TAXA 2C1XA 3LCRA 3N70A 2OM6A 3EH1A 4FFRA 1QOZA 3EVAA 3ZU3A 3E7FA 4TS3A 3BJMA 4V0SA 3RROA 3PJEA 2PBRA 3E0QA 4PZUA 2YMMA 4GXNA 4Q3BA 1N2SA 3EULA 1XVVA 4HAXA 1ZX1A 3MB8A 2OR3A 2NWQA 2VSYA 5G2OA 4KGZA 4S04A 1V8FA 2W8BB 1PKEA 2H8KA 2OXCA 3GGOA 2ZU6A 2UUPA 5LLDA 4EK9A 3U62A 5BSKA 1T3GA 3O21A 5IF3A 2H54A 1UBMS 2I4NA 3MRTA 3TLBA 5JAMA 4HXYA 4P2GA 4YXWA 2WMYA 4I9NA 3LRPA 3IYLW 1C9DB 3P9SA 4WESA 1IOZA 3TPFA 4OHCA 3MJFA 1R50A 3NIGB 2DM6A 3U48A 3CRRA 4LOLA 2O8BB 3G2HA 5BN3A 4CLRA 4H7KA 5AVYA 3USES 2J1LA 4X54A 4I50F 3ZWMA 4JLUA 5KOHA 1AO0A 4JI8B 5KTOA 3NAMA 1DJPA 1G8KA 2ARKA 5BO5A 1VE6A 3UOAB 3MWKA 2QZ9A 2YZGA 4BMYA 4F6RA 2QPTA 1QTIA 1NP7A 4FFBA 4GLLA 3VOBA 3ZS9A 5TY0A 2Z1MA 1GSOA 1SCAA 2PS1A 4UHKA 5BVGB 4C4RA 4JLPA 2YYSA 4RZIA 2RGNC 3OZUA 4IH4A 1FDIA 4FHGA 4OIMA 4CKEA 1UAYA 3B3GA 3CH6A 3CISA 5LUAA 2ODAA 1I7QB 4RY2A 2PUVA 1Y1SA 1Y5RA 4IF4A 3AJRA 3MBOA 2GPAA 3PHLA 3WZ2A 2E5LB 2NYAA 3AOGA 4TVOA 2XUPA 3GEBA 3TRDA 5THXA 2WHPB 1J20A 3O83A 2GCEA 2YWHA 1XN4A 2F3SA 5ALLA 5B7QA 4EDFA 1Z7YA 2QQ0A 1F0PA 1XEXB 2BR4A 1ZOSA 3Q8XB 4HYYA 4RGVA 5CX1A 4EA9A 1VCOA 2EYUA 3P19A 1K7XB 4HDNA 4GAEA 3WLNA 4DYDA 3BMCA 2WWGA 2XB4A 4F2HA 1MJ5A 1VGRA 1PSWA 3E7PA 1T8PA 3CM0A 5JCOA 3VZBA 1DO0A 3ZY2A 2EEPA 5AK5A 3FOZA 3B6MA 1GPH1 1EHCA 2HPAA 2EZ8A 2R47A 4UPDA 4MX8A 5K0NA 1M1UA 3R41A 4NU0A 4B3DA 2IP4A 1RYNA 2O8EB 3G6WA 4O4HF 1N2CE 1XNJA 2FMUA 3G1WA 4NNPA 3RAGA 4DDUA 2X8JB 1GTRA 4FWBA 5LQCA 3ICQB 4D79A 2EW1A 4U5XA 5KUTA 5IJ0B 2A9JA 1LV8A 4RPKA 4Z9FA 4EUEA 1WVMA 4AUKA 3C7CB 3UATA 4AK9A 3CT4A 4OI1A 3H1GA 5T6MA 2OXEA 3I72A 3ONFA 1JECA 3RVLA 2GJ9A 1YI0A 5DXJA 3NM5A 4B17A 1VI6A 5C31A 4DB4A 2NZUG 2QD5A 5IULC 5AKIA 1HZJA 1G21B 3GZNA 1QHHA 4G5HA 5C18A 4LUCA 4RO0A 4WJZA 2RI1A 3GFSA 1W88A 2ZJZA 1O96A 1CUGA 1M8PA 3H5IA 2ATXA 4ZHQA 1K88A 1A27A 4DZTA 4JD5A 2QL7A 2G04A 1NE7A 4MMZB 4FQ7A 2Q5FA 3KTFA 4EYOA 3G0DA 3Q0TA 1RYBA 3VBCA 1KMMA 2G40A 4OHMA 2ZR0A 4Z86A 3OT1B 3H11B 3KYBA 4DXAA 5A6SB 1P61B 4WI1A 1ACJA 3HNRA 3IOYA 2PNJA 4C7OB 1FW8A 1E6KA 4KVFA 1IXKA 2OA0A 4DYVA 1RJWA 5IJ9B 1RPNA 4I4LA 3MTQA 1EWQA 2QMOA 4RDXA 4XB1A 3OTOB 5K0JA 3OFNA 3KKEA 4I5DA 3UWKA 1L3IA 2UV8A 3TMKA 1IBMB 3UAXA 2DTDA 4L15A 4UM7A 1GFZA 1R0WA 3JQCA 1JU4A 1LU9A 3PB3A 4JAVC 1RPAA 1ZYUA 2IOFA 1HURA 1BXKA 1R2QA 2XYVA 2B2XA 3OEED 5IG2A 4BO6A 5I9NA 4YONB 2F9MA 2PJZA 3REGA 2HMVA 1B0PA 1W8DA 2H1RA 2OV3A 3EIQA 3N2LA 4HY3A 2FGKA 4WY5A 3FTQA 3STVA 2CDAA 4YJ2B 4J2HA 3UMBA 3JYOA 1IZ7A 1NBAA 4RK7A 3D3NA 4K40A 4E46A 3R9XA 1PNQA 1GA1A 5J23A 2D2VA 3BSSA 1DHTA 4PRYA 5CLLA 3B2EA 4B3FX 2Y3IA 2IHVA 2YJGA 5AXCA 2JLYA 3PYLA 1X8JA 2WZQA 2AWOA 1PWHA 1BW9A 2E37A 2FE4A 4RS4A 4D9KA 1GPKA 4ZAZA 1EVQA 1TLLA 5E6SB 4HNVA 2XGJA 4MP3A 2XE8A 3QKRB 4IXTA 1C3JA 2FMXA 2XQVA 3KQVA 5AUOB 4B7CA 4DV3B 1E0AA 2O2ZA 3VHRA 1O94C 2PG3A 3UUWA 3ZDXB 4C76A 3HZZA 3PUIA 3O90A 2WFLA 3OG9A 1GIAA 2HBQA 1EXWA 3VPAA 3WWPA 4C6SA 5JO0A 1VP3A 4ZV4A 1ZNWA 3KFVA 1YZKA 2UZ1A 3OM1A 4D8WA 1V1JA 4HUQB 3S44A 2E85A 4LQDA 2GDJA 2Q3LA 3JALA 2ZUFA 5C8VA 3KRTA 4FBLA 4EJSA 3GLRA 3KQUA 1WOYA 1HNWB 2FPKA 1CIVA 2EJVA 2HADA 4EF4A 3S7ZA 1N2CA 1JA0A 2TMDA 2RHTA 3H7AA 4XSGA 1QCYA 2HIGA 5ALRA 3ZY5A 5K8VA 5LKAA 2NTJA 4RA9A 1L6IA 1MXHA 3LIPA 1FMLA 3SI7A 3ZKWA 1U9IC 3FPBA 3H87A 1NQOA 4YV2A 1GP2A 2D6FA 3R3HA 4QDXA 4CM3A 4M9QA 3G3EA 2B7CA 3PP8A 2GNOA 5IUKC 1GARA 1O3YA 5LUBA 3FIJA 1X74A 2A3RA 3JR7A 1E1YA 2BAGA 3BVPA 2UYGA 3U4IA 3ABRB 4MPDA 4XB2A 4WA7A 2QRLA 3UJ7A 1ZJJA 3RVPA 5CB0A 4JLMA 4B3HA 3GELA 5EGNA 3K9NA 5FPHA 4MULA 2VYVA 1AMNA 3GK3A 2HW8A 3NDIA 2O7SA 1LVHA 3HEAA 1GSIA 3MGGA 3RFFA 3TCXB 1NI4A 1LW7A 4R0VA 4EHKA 2VSXA 3ZXSA 1CZLA 2KS6A 2XDAA 3C24A 2ADFA 3FSRA 4NI5A 4ZT4A 3T1NA 5G0TA 1XQVA 1J8FA 1CR4A 4DDTA 1JR3D 4WNCA 1DQYA 5JG7A 1PZGA 2XHEA 1LDEA 1E7MA 1T6ZA 1Y48E 1YGYA 3HWRA 4RU1A 4DJTA 4WPGA 4TYWA 1EFUA 2VJKA 1IXYA 3U39A 2ZB4A 3QMVA 3TL6A 4YDHB 5CDYA 5DI3B 2W2KA 1NQWA 3UW3A 1KRHA 3MWDB 4F5YA 2W2XA 3RYHB 5HCNA 4WBNB 4H3VA 1L5MA 1Z6ZA 2G63A 4R71A 4R8LA 2IYNA 4FYPA 4DGQA 2DKFA 2QJRA 1N8KA 5TGDA 3FXAA 4PHCA 1WOMA 4YH1A 5IARA 3M4NA 5K3AA 4MK4A 2QX4A 3RSQA 3ZHVA 5JSUA 3LUAA 5KMGB 3OBBA 4HBGA 1DPFA 5B3AA 2RHJA 3JARA 1RQ2A 2X2OA 1DUSA 2OQIA 1JRLA 3ZWDA 2J3IA 3OLQA 1Z0DA 3OZ7A 1GKYA 5JJKA 1TVKA 3AR3A 4AULA 3B7WA 3H8JA 2RHRA 2WIKA 4OOFA 3OLWA 3ZE2B 5LQDA 1JG1A 4FOPA 1WMAA 4BVJA 1T0PA 5C4MA 4L0CA 1P6UA 3WL8A 1TCCA 2WILA 4BVKA 2GHIA 2QLNA 2LBPA 1YI1A 4YP1A 2VLBA 1B4DA 5DP2A 1B76A 2RGBA 3ABIA 3H99A 1V47A 1U2PA 1QUFA 2GK7A 4R6WA 1K3TA 3VM6A 3ZJYA 3V8VA 1EB8A 1ND6A 1NNUA 2O7NA 3SY8A 1LDBA 4M0KA 3ZZTA 4YIHA 2CXUA 3JQFA 4R5HA 5G0VA 1M8GA 3KJXA 2OESA 2E4XA 3MOSA 3ML1A 4CHGA 3UJPA 3FOFC 2PMDA 5LQAA 2JBWA 1P18A 3BDIA 1PR6A 3IUYA 4L9WA 4XWKA 2WVHA 5CA0A 3FFAA 4JK3A 2ZT7A 2N46A 1QHGA 1JVNA 1N2HA 3PVZA 4YGXB 4XRRA 5ALQA 5HYVA 2AGVA 1S1MA 3IP7A 1QMPA 2J5BA 4JJFA 5CCDA 2BJHA 2RHOA 4NHOA 2YZKA 3HL0A 3SYNA 3TSCA 2C9DA 2XGOA 4HNAB 1KNXA 1QFZA 4E6PA 4K88A 4L07A 3CNLA 3NGXA 4OH1A 2YV5A 4HK4A 1LWOA 4LGMA 4R9RA 3WNVA 4QBHA 5ALUA 4FYHA 1Y8ZA 1NRIA 4QPPA 1RXUA 5AKJA 2Q1UA 1BCSB 1KI9A 3KJEA 3ZUGA 5LP1A 1PR0A 1QIIA 3GLHE 2NUPB 4V0OA 5KNDA 3W2GA 1CNEA 2ONCA 4CPDA 3AXSA 1SHTX 3O0TA 3W9UA 1XT6A 2GX6A 1Q91A 3CUSA 1VJ1A 4K9NA 2CNLA 2NAPA 2I6GA 4RZ3A 4ZQEA 5DNWA 1QG6A 1NR7A 1G9TA 2YWCA 3FUUA 4JBWA 4DJ5X 1DTSA 4OQLA 4BO5A 1ZOLA 3FPKA 1TO1E 5AI4A 3U7QB 3NMUF 1Y8RA 3QP9A 5JSZA 3KQLA 1CR1A 1E9FA 3FYDA 1GRNA 1YI8A 2I1LA 2NV6A 3RPEA 2I7CA 1UM8A 3ASYA 3AY3A 2C99A 4HFMA 3BA6A 4J0JA 3ETHA 4NVRA 4BNDB 4BMCA 5C9ZA 1G6HA 1P2TA 1NJ5A 1R0RE 3OQ1A 1L4BA 2GLXA 2G8LA 3UAYA 4O1HA 1MENA 5IP5A 1PD0A 1YWGO 4MGKR 2V4ZA 4RZ2A 4Z49A 3EQ8A 3RS3A 4F8YA 4ND7A 1SXIA 3CRW1 5A5GA 4H0CA 2NUAB 2CL0X 4U7DA 3VO2A 2ANCA 4M8LA 3FDFA 5IK2D 3OICA 5IABA 3GRPA 2GJ8A 1F5NA 1ZH2A 1GZ6A 2J9ZB 2Q9CA 4PYMA 4OJQA 4BMXA 4KREA 5GTDA 1QWOA 4DIBA 5JZBA 3GJQA 1R8QA 3N2YA 4MI9A 4OB6A 5F3DA 3U37A 4E0BA 3QYAA 1KI4A 4IJ5A 1QK5A 3LT0A 2QW8A 3LA6A 1JPUA 4NENB 3CVJA 3BQMB 4EHBA 1THMA 1V7PC 1TIPA 5KVQA 1KBQA 2IP1A 3AERA 3L0OA 5A4KA 4S3MA 4XD7A 2VQDA 3GLIB 2IYEA 1Z0UA 3KEOA 1JKIA 3EIHA 1SKBA 4GM4A 4QLBA 3L07A 2HH9A 3W77A 3CW2A 3DPUA 1QCDA 3M5DA 3QHPA 1X6VA 3RH0A 3A1FA 4O0LA 5EY5B 5K6RA 4JT9A 3PA8A 4RULA 4QO8A 3Q5GA 1T9AA 3L1UA 1Q0TA 2P62A 1NMSA 4B6QA 1ZIYA 4P3YA 4TYMA 1JX6A 3C5EA 2Z2JA 3OPMA 4FR5A 5CDFE 3BIFA 4JGIA 3V2IA 2QS9A 1JVBA 4TLCA 1KJQA 2JH9A 3DNPA 4L22A 2X1MA 3ZDQA 1PRYA 4CR8A 1R6VA 4Q16A 2NP6A 1X1DA 3DZJA 1V16B 3RHZA 3FYCA 2B83A 4RTMA 3ABSB 1EBBA 1L4YA 1X38A 4NSNA 4Q9NA 1XTRA 4EUNA 2QQEA 1T43A 3VDQA 4NX2A 4E21A 2WIBA 5ALTA 1GKLA 1YR1A 1CR0A 3HA5A 3HEBA 3VNSA 2JGNA 5IW8A 3DLIA 1ONBA 5K0BA 1ZJWA 2F43A 1RWMA 1WB5A 5EGSA 3C0KA 1GR1A 2CMFA 3CZMA 4YN3A 4FT4A 1LJUA 1WZNA 2BM8A 3EGCA 3GLHA 5AT1A 5HP4A 2PSJA 2HAEA 1TLFA 2CLHB 1QHFA 4KMOA 4B4OA 4P3KA 3GMSA 3MA0A 4KPUB 5EWLA 3RSHA 4CG0A 3DMPA 1O94D 3E1GA 4GI7A 1MX3A 3MINA 3OTIA 4W8OA 3GLUA 5BY2A 5JEDA 1ZVJA 4HEJA 4DUPA 3AUJB 2F1JA 3PXXA 5EQJB 3QU4A 4DV5B 1SIWA 3NRJA 3NASA 4D9BA 2V8OA 4CMHA 3DXYA 4RLHA 2JNWA 3AUUA 3QI2A 4P4GA 3F6CA 4LBYA 5DOVA 4S2UA 1GZ3A 5BSGA 1L5YA 3HJNA 1JIIA 4RUKA 2O23A 3HKBA 3SX2A 2NSDA 4DSZA 2IYUA 4Z8YA 5ERXA 3RRFA 2X3UA 4RK0A 3I4CA 3RVKA 3WKCA 5A0TA 5A7HA 5FUYA 3IUBA 3BG5A 1L3CA 4HSEA 1R9MA 1ENPA 4H4CA 2JLBA 1YQEA 1X80A 5GOZA 1DL5A 3TLGB 3VRHA 1IC6A 4ZANA 3E61A 5B1HA 5B6PA 4NBVA 4ZHSA 2E18A 1F2UB 1P9WA 4YFVA 3T0GA 2F3PA 3QVTA 2RBEA 2XAUA 5IBRA 5LP6A 4AJ2A 2P4QA 5DCUA 1RRFA 3EIEA 2OCLA 1W49A 3C6ZA 2D2FA 1WXFA 1NATA 4NFLA 2W4MA 2HDNB 2HLPA 3BXZA 2NN3C 1P39A 1DPGA 2PZEA 1W46A 3OVMA 3B12A 1NPYA 1V5WA 4JUCA 4U2KA 2JI6A 3DLTA 5DASA 4I6JA 4UQOA 2DFLA 4GI3A 3RYCA 4PSDA 1YZQA 2AZXA 1CS0B 4DLPA 3PGMA 1ULHA 3IQXA 3DLCA 3N87A 2PKEA 2JKZA 4D25A 1HF3A 1GPAA 1E3LA 1PS0A 2WSYB 5AW9A 1QIKA 3O8OA 2YXEA 2FSSA 4QOJA 5JTUA 2B7BA 5BSHA 1FLVA 3BEOA 3NUGA 1UC4B 4WT7A 3ZE8A 3FLMA 4HQ6A 1M74A 1WU8A 3BE4A 3GLGA 2J48A 2DQZA 1ANKA 1AK2A 4BNIA 2AMVA 3UTDA 3ST7A 1MQAA 2QZSA 1M1NA 2ZAGA 5G0SA 4ARVA 1GV1A 2GEUA 5CJ2A 4IH9A 5DHPA 5CDFA 1TJYA 3THWB 4NBWA 4FFPA 4QOFA 2ZZNA 2QRVA 4X60A 1P19A 1W73A 1D6SA 3Q3GE 5IKPA 4DMRA 4ZAVA 2P9QA 3ZHZA 3UHJA 2RHHA 3N2GB 5KQGA 3LX5A 3L7BA 4CTJA 2EKBA 4XZ3A 1AKUA 1T2FA 3WK6A 2P6NA 2EOAA 4HNGA 5CVDA 4YRCA 1S02A 2A9PA 4HZUB 1JFLA 3IBSA 5HGJA 3THXB 4KOAA 1D7OA 3DZBA 2ESRA 4Q9HA 3KVNA 3BGSA 4RPCA 1XHLA 4F8EA 1NG9A 2I2AA 2W2VA 2C00A 1Z83A 4MW6A 3SP1A 3ZD8A 5JAIA 4RFLA 1T6XA 1NMYA 2C92A 4PBTA 4P7GA 5E4JA 4E30A 3PQ7A 2JJ8A 4YA6A 2HRBA 3GPCA 2RB4A 4BEBA 5JZ9A 3TAUA 2VHQA 5JCZA 1QDUA 2IOHA 1SVMA 2VRCD 1OZ0A 2XODA 2FFBA 2OBXA 3K72B 3BH7A 1W9MA 2OTCA 4XRGA 1RZUA 1Y4AE 1QBGA 1WD7A 3E9RA 1D04A 5BSRA 2UYHA 4RVHA 2MSEB 4KIWA 3WQQA 4HDSB 2JS7A 3CEPB 4TM8A 1V1RA 2D1FA 2VHJA 5CPBA 5IDYA 4WOBA 3WJ1A 3VO1A 4MPJA 1TCUA 4UNRA 1Z17A 3G5AA 1OLUB 1D6JA 4PLWA 4HDQB 1Z6TA 3HDHA 4LXIA 3V8BA 5KVVA 2F55A 4S1OA 4B79A 2EP7A 3I52A 5JNVA 5TMEA 2JL1A 3GH3A 4JYCA 1K5GA 2A5DA 1XWIA 2RC5A 3THOA 1SOAA 3OQVA 4BP9A 1YB2A 1E1KA 5DCYA 5C8YA 3THXA 4LJLA 3OY7A 4TZ0A 2RGWA 2HJGA 2BGNA 3O4IA 5JRZA 2HK7A 2OD7A 1MRSA 4P4SA 3TUIC 2IBTA 4M76B 3BMXA 2G0AA 3QUCA 5JDIA 2ZP1A 4GMFA 4GO1A 2N47A 2VQEB 5H16A 1TYDE 3LBAA 4R1QA 1B43A 3PLRA 4UTOA 3TNLA 3VSCA 4ENSA 3DD5A 5KU1A 4ZOCA 3H4TA 4OATA 2NTVA 4QPNA 4CT4B 2BELA 4JB0A 4L0DA 4N6GA 4HLCA 1W2WB 2W7TA 4Q93A 2GVNA 4GOKA 4E94A 1HKHA 4FYXA 1JWLA 2QW0X 1ZUHA 3TQQA 1HY3A 2CLDX 2VK4A 4Y7DA 2FDRA 5GQSA 4HFJA 3UAWA 2FUEA 1OHHD 3SXJA 4PGGA 3P8ZA 4MQLA 4C0LA 1ZNQO 1PFKA 4DLRA 1BDMA 1IZ8A 4R2JA 5D1HA 3JW8A 2C57A 4NDZA 3T5MA 2XPCA 1TM1E 3GEDA 3LUPA 4RSGA 3IUPA 4EVQA 6Q21A 5JH7A 1RE1A 2ASVA 3H8SA 5A5EA 4MO9A 2Q1WA 5KYKA 2ZROA 3RHFA 2PAFA 1QYVA 1EQ2A 1R18A 1XI2A 2R84A 4NPHA 4U7FA 5K0GA 2ZWVA 4HNTA 3TLCA 4ALKA 4BC1A 1B23P 1M67A 3PT5A 4LZAA 4A27A 2QMHA 3HY6A 1SB9A 1K7YA 2VNSA 2JI9A 3ZGXA 5CEEA 2DLCX 1PQPA 4U02A 1GNSA 1Q19A 3JR3A 4A5OA 5JMWA 4GZMA 3MMPA 2IHNA 4ARCA 2ZUUA 3BH6A 4IKEA 5AM1A 1HDEA 2XT0A 2P11A 2HMSA 3CN9A 4LK3A 3WQBA 4B3CA 1HMYA 2EERA 1N2ZA 1RI2A 2VXOA 3MFYA 1WSBA 4DLUA 3MM4A 1WVGA 4M3NA 2WTBA 3I9V1 4RF5A 2R4TA 1HDXA 3ORYA 4K2AA 4QSHA 2JI4A 4HVCA 4CL0A 3S68A 5DOZA 3LY7A 4PX2A 1TRKA 4WECA 3VYTB 2VNJA 3LOUA 2NX2A 3O2QB 1Y1RA 3FGOA 5GZ3A 1LW6E 1W0JD 4HOYA 3W34A 1GGFA 2JFFA 5CVCA 3AF6A 3DEJA 1SM4A 3DWEX 2HB6A 5EEHA 2CFSA 4JL5A 3GBSA 1GZDA 1ZP6A 3K15A 1FA9A 3CRNA 4DM4A 2VNHA 4ZYUA 3H5OA 3HS3A 1XTZA 1ONNA 3P2KA 1TF5A 3RSSA 2Q1YA 2EF0A 2XUIA 5AJVB 1WJGA 2I71A 2OZPA 5CXSA 4PSVA 4MQ4A 2JD1A 2CNNA 4CFZA 4YB8A 1USKA 2QGFA 2RGUA 3UANA 4G67A 4LQ4A 2VJMB 5TQ2B 1I7LA 4AYTA 4IQGA 4PCUA 4WRRA 5HDQA 2P9ZA 4UULA 3QG5A 4AICA 1LBQA 1IEQA 2BEVB 1P2SA 1MABB 2G4LA 1SBCA 4K6GA 3GWZA 3PRYA 5AVWA 1VHDA 1P3JA 5K0CA 3AEQA 2GN2A 3OTWA 3C98A 1KOLA 3T5CA 5SY6A 2C3MA 1L7QA 1ZVMA 2PKWA 3CX4A 2BGUA 3V8EA 3KZNA 3P5SA 1QH8B 2GF0A 4LXGA 3ZIDA 1C7RA 3VOSA 5F9FA 2BN4A 1WXEA 1OX5A 1PVVA 4UEOA 2C20A 3ELDA 4YCSA 2GCOA 3IHLA 5SYMA 8OHMA 4P3PA 1Z73A 1V9CA 2KHZA 2I2WA 3RC3A 5A06A 3C8DA 1UWLA 1LD3A 2XE7A 2ODWA 4UVHA 2YHIA 4UD2A 1XC7A 1Z4PX 3ABZA 3VC7A 3QEBZ 1UJBA 3OECA 1N32B 4MUMA 5E9WA 5TNXA 1E2DA 2GS9A 1IJFA 3P2OA 2PU5A 2QN2A 2EGHA 4WLNA 5DWDA 3TZKA 4DRXA 2J3DA 2HL6A 5K0FA 4DL9A 2X3FA 5KSPA 5TQ0A 3U4AA 3OT5A 1NL3A 2LIPA 3GEPA 4HAUA 4JC0A 5D00A 1U8EA 2WHEA 3DMGA 3PGLA 4DIKA 4EITA 1E1LA 4BY9E 2R1ZA 1E64A 3JAKB 4JX9A 4H27A 4LDAA 1LK7A 3JD3A 2F8TA 2TS1A 3CV3A 2LGJA 2DCUA 1C29B 3OZAA 4J1TC 5CJJA 2F8MA 1N2EA 1KO8A 5JXIA 2JAPA 3VU9B 1LJ8A 1XK6A 1RT9A 3SDSA 3GGGA 3QQPA 4J0QA 1QOQB 3VKGA 3ZJ5A 1LLDA 4ZJPA 4BB0A 4BKUA 4JH0A 1U0GA 1CJUC 2VPQA 4RD1A 1KHHA 2BHNA 2OV6A 4EJ2A 1JFSA 1JSLA 3PCTA 2XCQA 1ZM3A 3QELA 4IIFA 3ZJTA 5BT9A 3CRVA 2V9PA 1XTVA 3W78A 1FQKA 3TGLA 1KYQA 1XL1A 3BZUA 4KQJA 1MLDA 4B6FA 3BF7A 4XIGS 1HKUA 2ID8A 2E6UX 3JQ7A 1YL5A 4CKCA 2PH3A 2P4EA 4EG3A 4PFSA 3JU3A 2BM9A 4TKVA 5G0UA 4YAGA 2WG2A 3L4SO 1WSAA 5EEGA 1NBME 3OMXA 1F6DA 5FPTA 2O0MA 3AIOA 5HF5A 4AS3A 4TWRA 3V8PA 4E5KA 1QKIA 1QDEA 3W8RA 3OC0A 4ZZ3A 4UMVA 5HJEA 1M72A 4YY3B 2DHQA 3HCNA 4HYQA 4DSAA 1FDOA 3NNNA 4RH0A 3F73A 5GINE 3QBVA 1EFPB 5DEOA 1BJKA 3UAGA 3HWWA 2YRFA 4DUGD 1IQUA 1GWNA 2ZXFA 3NT4A 2CE2X 2E87A 2H4HA 4I1VA 4UU8A 3H19A 4GRDA 4ZT7A 1X7XA 1WPXA 2W6MA 3AY7A 2YYYA 3SX0A 1IZYA 4Y0VA 5J4YA 3GFFA 4M38A 1D3AA 2QVYX 4DLZA 1OJ7A 1JLLA 1A96A 1FNCA 4EUFA 1U5BB 1G9SA 4WXHA 2A0UA 2AVNA 4UJ3A 1W4CA 1W47A 4A2CA 1GRRA 3RT7A 2O8CB 3W90A 4GMGA 1RBQA 3LBNA 4UHBA 2OECA 1IDOA 4FFLA 2ADMA 1M2NA 3PQDA 1S5PA 4Y98A 1JKXA 1BD3A 1NU8A 1PYGA 2WA2A 3ES9A 3MT8A 2A2ZA 3AUFA 2ZG6A 4HDAA 3L0DA 5DBHX 1KYYA 2AL7A 4YRSA 2H9YA 4WNAB 2QVLA 1THTA 2AE1A 1HQDA 1O57A 1VG9B 4HTFB 5FBQB 5AIBA 2L19A 3PX2A 4JI4B 4GR4A 2JGLA 4J4TA 5AJWA 2PR2A 1L5QA 6ABPA 2SBTA 3BQ9A 2C2ZA 3UM9A 4IVRA 3HBFA 3CT6A 4IVPA 4M1WA 4XGRA 3SFTA 4BAZA 2HF2A 4BE9A 2FW6A 2PLFA 3E3LA 3CLRC 2W6PA 3GUVA 4UDYX 2WJ4A 4NHEA 5EG5A 1NMQA 4XPZA 3VBEA 3WRYC 1UQTA 3LQ1A 1I4LD 2PQ2A 3NRBA 1XHEA 3L9XA 3OEYA 5D8DA 3TVYA 2DERA 5TEVA 1U65A 2QV7A 3A3OA 2G5TA 4A0HA 5JUWA 1WKBA 2PO5A 1OXKB 1XNHA 5F76A 4EYEA 1U2ZA 4PVDA 4RL4A 5H5JA 3CWQA 3A25A 3NEAA 1BCRA 4IIEA 4DZZA 3ZYCA 3TNJA 1SVWA 4C4TA 2DUUA 3USCS 3MK31 3WMFA 4YT4A 2GBIA 4ZD6A 7GPBA 5J4KA 3T7AA 2HHLA 3DHEA 4QA9A 2YY5A 3ND7A 3TL2A 2G1PA 1NI3A 1XMSA 4OQQA 5JXHA 2O2YA 2PTGA 2PX3A 3VGJA 4E70A 3A28A 3VR2A 5JPIA 2HEGA 5LOVB 1FP7A 1J1IA 1KEVA 2XOEA 4L4YA 5AHKA 3EDCA 3J81A 1QP0A 1BMDA 1VJCA 1Z0AA 3V8MA 4Z8XA 1RLOA 5AVXA 4QYSA 2Q29A 2JATA 1E0DA 4LQLA 4D9JA 5A03A 5K8UA 3IRVA 1RM0A 1G7TA 2JAOA 2NVUB 2XMZA 3HXPA 3LOQA 4RF2A 4BJ5A 4BLTA 1G5HA 2WF5A 3LBFA 4ZKEA 5BUCA 5CNJA 1CRWG 1WUTA 3FUTA 2OEPA 2PANA 4G86A 1UBUS 2BDEA 2YHAA 4LE0A 2TMYA 3RR2A 4JLDA 3ONVA 4AKSA 3HRHA 5CIWA 1AOXA 7ADHA 1J5PA 1ZN9A 3UAZA 1LLUA 3VHXB 3HYLA 4ND1A 2HRDA 3KOUA 3RM3A 1A8IA 1NBMA 3OQNA 1CQIB 5C52B 5BNFA 1PJ4A 5JJBA 3PR2B 3IDFA 4YALA 2FWNA 2PV7A 1GL3A 1NW8A 1SXJC 3F7OA 3BYZA 1V1MB 4XX1A 2OWEA 1U5CA 2QNBA 1KFCB 1UJ4A 4XJXA 5ARCA 1I4EB 4YRLA 1DZIA 3I61A 4DMFA 5JZVA 3MBIA 3E7DA 4MB2A 3BIXA 2ZSAA 1I1QB 2QB5A 2DBZA 1XNGA 4EDHA 3WHIA 2WWTA 4LZWA 1ZNZA 2GYWA 2ODPA 4AY3A 1NA5A 2YWGA 5DTMA 1R6AA 2PUHA 2XRYA 2ID4A 4YMTA 1G1AA 3AK4A 3QEJA 5EUCA 3H4MA 1JIXA 4P08A 2GLUA 2JF0A 1MOZA 3HSSA 1GKKA 2A0YA 4K6MA 1C9JA 1KE2A 1OFVA 4YRGA 2BMEA 3CZ9A 4DA0A 2ZKIA 2DLNA 3DL2A 3TIIA 3PJGA 4CUKA 1E6LA 1E63A 1DT3A 4NS4A 1QGYA 4NABA 1QQ7A 3PDJA 1OFIA 4H35A 1TMGE 3PC8A 3C5HA 4M0DA 4C0BA 1Q17A 2HFJA 4R1OA 2GBLC 5B1DA 3L6OO 1RYFA 3EWAA 1GGVA 4LGYA 1Y3FE 2V7EA 4PZZA 3NDRA 1T3TA 2MYTA 1O2DA 4MVJF 4KIGA 4JQYA 2R60A 2ZDGA 4X20B 5EINA 5F52A 1NNEA 3UJHA 2XRZA 3DOOA 3R5FA 1LLFA 1C5KA 5C7IO 1UXJA 4JJGA 4E5DA 1K98A 1U2DC 2WG0A 2WHRA 2YWRA 4PHFA 2DQKA 4DEYA 2BRUA 1RWBA 3ZU6A 2P7IA 3ETDA 4N65A 1TW3A 4X71A 4EB6A 2J0UA 3NBXX 4OYHA 3RG2A 2DBVO 5JCJA 3FMVA 1JTFA 1JALA 1T5TA 2VQ3A 4O6VA 1U9JA 2XUFA 3Q2IA 5LZ4A 4HNQA 5F7OA 1GTSA 1V7ZA 1GQFA 1QLJA 1YSCA 2IUFA 1C30B 1ZXXA 4DWVA 1K4YA 4LZPA 3T3PB 3ZNPA 4A3SA 1OAOC 1U9CA 4HLNA 3SK0A 5JASA 5J40A 4GR9A 1FP4A 4HHEA 3GG2A 4HS4A 4O25A 5DHAA 4PCVA 2BUAA 2LIVA 5K0LA 1MH9A 5KPDA 1XDUA 4KSBA 3V4ZA 2I9KA 1N1DA 2OXFA 3P9PA 5K51A 4U63A 2WNHA 4ZCTA 1JB1A 3QRWA 2Z9DA 1DXOA 3OQHA 5GMOA 4WV3A 3TR5A 4IILA 1VE7A 2FRDA 2E3JA 2W70A 4OPMA 5DGDA 5KTRA 5JBQA 4KYTA 2H1FA 1W4ZA 4M6WB 2XUGA 1BFKA 1JEQB 2OZKA 3A26A 3JYHA 2WY2D 2V7QD 1RQXA 1X0VA 1OBCA 2JFYA 4ZDKA 1NF3A 1AQYA 3MCWA 4B32A 1FX1A 2CLMB 2G1AA 3QLVC 1BTOA 2H2IA 2OHOA 4GC9A 4R2WA 5AKZA 1EHYA 4PIMA 3FYUA 3WC4A 1JE0A 1RVDA 1NN5A 1ATIA 4ZCSA 5LDHA 2I6TA 2ZJBA 3R3VA 2YTZA 4BB6A 2B37A 2CD9A 3LLUA 3RIXA 4MUFA 2Z1NA 4C6RA 4ZGGA 4B87A 5CB4B 4ZEMA 4NF2A 2JD2A 2DECA 1KAOA 3GYGA 1JSXA 3EPPA 3K2QA 3PHGA 3GMDA 4HR7A 1DFGA 1UMKA 1YRWA 3C8HA 1GHTA 4AZ3A 5ABPA 3F78A 4URVR 1ISJA 5T4BA 3U5ZB 1Q16A 2R62A 4RHCA 4UUBA 1MU0A 4CV1A 2XDYA 2GXQA 4UAUA 4BJ6A 1PHRA 3JWGA 2Z2YA 3ZDDA 1XYVA 1EBUA 3IP9A 3RS8A 1ZINA 2H29A 4MQ6A 1CLEA 2FWIA 5KYUB 2ZLBA 2BKLA 4KWHA 3G8YA 3OY2A 4V1CA 2PZFA 1R9NA 3FRJA 1T6NA 3QVKA 2XGSA 4Q6BA 1LPBB 1N7HA 1XZIA 2C4UA 1P1FA 3CO0S 4D98A 2ERCA 2JBAA 1N4DA 3J81k 3FWHA 3CC8A 3M6XA 3TMYA 4Z0TA 4K9OA 4A0FA 5BNWA 1VL5A 1D4AA 2C29D 5CPFA 1Z28A 4TTVA 1VOTA 5MGBA 1XLTC 1KDPA 3N8HA 2I66A 4EFDA 5F3WB 2B5VA 3G9TA 3FF1A 3WWEA 3EQ7A 1Z37A 3SOZA 4BNJA 1IOVA 2J6CA 5E38A 3OX1A 3LUFA 2ZUCA 4NJEB 1MMFB 1SOUA 1KIFA 4ZAYA 1Z63A 1HEUA 2O8DA 3K4PA 1DBWA 1U1EA 3P2JA 4C6HA 4DPKA 4ALJA 3UK6A 1CJKC 1JEAA 2GAJA 4NU8X 4AMZA 1NF8A 2BL4A 5IEBA 5E4TA 1KEUA 4LTDA 1V26A 2IYFA 3D1VA 3QXGA 4NJOA 4R1PA 5JVDF 2LP4Y 2G0TA 1KYVA 3QUTA 4O4IB 2EKPA 2YN2A 3MNFA 4IIGA 1WKVA 4D8VA 5LQMA 3FUCA 1ODLA 3STXA 1JILA 1CUCA 4YJFA 3ZVKA 3ZN2A 2Q6VA 2V7GA 1UXIA 2R7MA 3LRTA 4WXRA 1JFFB 3QFHA 2Y6UA 3G9UA 1AD2A 1HFJA 3KPWA 4HWSA 1ZXLA 2ZJ7A 3QVMA 3A3YA 1Z15A 3LFHA 4REMA 3IR7A 2JIPA 1GKIA 2SKCA 1CY1A 3O3MB 3ONNA 3PL5A 3SC2A 4EH1A 1JXMA 2CCKA 3IHWA 3IVGA 3U7JA 2J0QA 5DNEA 4HADA 4MYCA 1ZVQA 1GCOA 4BQNA 4BGIA 4L6AA 4E5UA 4RW0A 2HSZA 1UKZA 2FF5A 4QPJC 1Y1TA 3ZH9B 3CZQA 3MF4A 3ZV3A 4OXQA 1T3SA 1VHJA 1N8SA 2GAIA 3OIFA 1LFAA 4OIFA 1GTJ1 3JZFA 2NU6B 1T1IA 3DHNA 4L02A 2QSJA 4ZYXA 5L53A 1OXMA 4E5MA 1TEVA 3HP7A 2Y66A 4FGUA 3W1WA 2AOTA 3B48A 2HYIC 2JCGA 4JJAA 3F8WA 4M22A 1B7GO 1BE0A 7ABPA 4FOLA 4OI0A 2CZQA 1NKVA 1NVGA 3PE3A 1UDCA 1QQBA 3JTEA 3KD3A 4L5IA 4KR9A 3DEYX 2AXPA 2PH5A 2BFAA 1IMJA 1Q1BA 3RTAA 1DLIA 1JZSA 3AC0A 5T57A 5L4SA 3EZLA 4MRAA 5IJXA 3Q10A 4NBLA 2PYIA 5DM1A 3GLFE 1H42A 5BSWA 1UKAA 5IK2A 1EG2A 4DQXA 4NQRA 5E2BA 5BV1A 1VA5A 5HGXA 5JSQA 1NP3A 4DIEA 4YAEA 2CN1A 2ATEA 4OXKA 4UM9B 4DR5B 1QHXA 1J7KA 3UB3A 2Q3JA 2ZCUA 2ON6A 1I5OA 2OD9A 3T3MB 5KNBD 3AKCA 2YQZA 3H8VA 3PPWA 3KG2A 3E2IA 1I3CA 1P5ZB 2YASA 3RC1A 4US0R 5A1JA 3LG2A 3SF0A 3DTVD 2W58A 1DLJA 3AETB 3K5IA 5J2TA 4XH9B 1GAQA 3WQHA 1XZHA 2NO6A 4RKQA 5J59A 1RHMA 4GT1A 3QXSA 1EVEA 2H4YA 1KYZA 2H18A 5CHYA 1HDRA 3PE6A 3ZV5A 1SXJD 2XI4A 2G36A 3PDCA 1QH9A 4A1OA 1ECLA 4HATA 4IHJA 2QTBA 1HR0B 3MLAA 3P0FA 5EJ4A 4NXMB 2VF5X 4BEVA 4ICIA 3A58B 2DUWA 3JVIA 3VMFA 1GAJA 4DTIA 4DDHA 4X8OA 3BMNA 4BKMA 3PEUA 1Q1AA 1XMJA 3KQYA 3O7MA 5EJAA 3V9PA 3M2PA 1K06A 4GLBA 1KEZA 5A04A 2ZUVA 1OZFA 3TLKA 1PHPA 4INAA 4XIJA 2VKQA 3GUUA 3BSWA 3C97A 2V54A 1R4ZA 1WHSA 3IPLA 4FSDA 2D62A 2HBZA 1MQ9A 1VLQA 2QRHA 3M49A 2K2QB 3UMGA 3W5HA 5FA5A 1RNLA 1PJBA 3DBVO 1M0EA 5EVCA 1E3EA 5ALZA 3KQSA 3I6BA 1Q2UA 1T9DA 1OH6A 2JLXA 5HCIA 1OBVA 1PWYE 4MYHA 3SSMA 4M9ZA 4MS4B 2XWPA 5F2KA 4QTYA 1SQFA 5FOVA 1OASA 3Q41A 3P27A 2CMKA 4QNNA 1Y4ZA 1HTTA 2DVMA 1AK9A 1UFVA 2VJYA 3KB6A 4G97A 2WP0A 2GEFA 3LYUA 4RD3A 1YZVA 3FTDA 4Z9XA 3WYAA 1IY9A 4CQMD 4F5ZA 2WUDA 3DCIA 3I01M 4MWDA 1ZD8A 4ZICA 3I09A 1YK1A 1QLHA 2AG5A 3COJA 2V0GA 1V5IA 3R9WA 1A9XA 1Y5LA 1XVAA 2C3OA 4XYBA 3LHKA 1O94A 5C8ZA 1XWWA 2JGEA 5GONB 4B4DA 1ZM7A 4OJMX 4BDSA 1XJQA 2FFAA 3DE3X 3IQFA 1YAHA 3OE7D 3PD0A 1EPUA 5H80A 2GPWA 4LHYA 4NZMA 4OF4A 2GMWA 2V4UA 1XU4A 3H2IA 1GG5A 3TDNA 1I14A 1HE8B 2FLKA 3AI7A 3DNMA 4J94A 5KTKA 4MAMA 1FTQA 1DVRA 4KP7A 1IOWA 2QUJA 4ZOLF 3DEHA 2X0IA 1Y63A 1OLSB 3CLSC 2WFZA 1BA3A 4GI1A 1X8XA 4CVNA 2WTMA 3PFBA 4ITRC 1YE3A 3G1UA 2V6BA 1M2KA 3ON5A 3ABQB 1W75A 4X94A 4OSPA 1UFKA 5EWMA 4BCBA 3P0JA 3H7IA 2ZYDA 3GLFA 1CLUA 4MQEB 4OHUA 4FNMA 1WEHA 3MAGA 2EYQA 2CXOA 1C0IA 7AT1A 2O2GA 5AW7A 2JC3A 4BFTA 2Q2VA 4I8DA 3RKUA 2O5RA 1CHDA 1OT5A 2PFKA 1XTTA 4TL9A 1S96A 3DOFA 4AF6A 2N1MA 2RKBA 4MVJD 4Q1EA 4ABTA 3C3WA 1K9VF 2FEOA 3E48A 1TNDA 1NFRA 5CIQA 1ECBA 2IODA 4MR7B 4Y6GB 4CKXA 2PZ8A 5BSMA 1F8GA 3RLIA 3NLLA 1AGPA 4GHWA 1S2GA 4PAMA 3UCFA 1AB6A 3AP2A 3OOEA 3I6QA 4UEWA 4XR4A 1J0DA 4EW6A 1M8FA 1NVEA 2P6MA 4RGBA 4R1UA 5DN9A 2HTEA 5JIBA 3TF5A 1TYEB 3LHIA 3NKLA 1E96A 4YGYA 1OI2A 2QRUA 5E7MA 4EQ6B 5J3JA 1DHRA 1E1NA 2CXHA 3STWA 4ENPA 1ZJZA 3NBZC 4FKZA 3LVRE 4XTRA 3TH5A 2BD0A 1Z2EA 4LOJA 3P9CA 4CEIA 1M2VB 2DQSA 1IY1A 1VKHA 3AYZB 2PX5A 4C4PA 2X58A 5IUNC 5T41A 2DPXA 4UNSA 4OMUA 3KE9A 5G0WA 1HLDA 1K7SN 4IFTA 1FK8A 1BX1A 3EVDA 4GMDA 5DB4A 5FUXA 4U5QA 1LNZA 5AK3A 2QMQA 3H2KA 3ZD9A 4PYJA 1WV0A 4TT3D 2DY0A 5EXEA 1LLQA 2B4YA 1YZUA 1A8UA 1R5BA 2I76A 5JHHB 3W8EA 3CZPA 5JZSA 3GEEA 4NV1A 1E2GA 3ZDEA 5AM3A 5KEIA 4YBRA 3DE7X 3TPCA 3U4GA 1NSYA 1OV4A 3NAQA 2G1KA 4OB7A 4N40A 3AINA 1BS2A 4D4JA 1Z2NX 2V7TA 4W1SA 5TR9A 4J9VA 3I58A 4I55B 1PG0A 1Z56C 1C81A 2C7VA 3CRQA 1Y6FA 1P0FA 1Y6JA 2JJ2D 3AUXA 4ZU6X 5F1KA 1DJMA 3U19A 5IMBA 1OR8A 1YFKA 5BV8A 4QVKA 1DMRA 3G88A 3ZX5A 4KLNA 2ZI9A 3SJUA 2BZ0A 5T3YA 3B89A 5GY7A 1BXRA 1ZMTA 3D8SA 5ECYA 3AI1A 4OFBA 1GQOA 3NVAA 4UW9A 1FUYB 2IOYA 3OOJA 1T4CB 1GGHA 1N2IA 2VRCA 4PIPA 5FUWA 4YWJA 4F3TA 4UTVA 3GI1A 1HT0A 2ZDHA 1SG0A 4ERXA 1KMQA 3KU4A 1SG9A 4OJKA 1XROA 3I76A 2JANA 1M5TA 3E3MA 1K3UB 3L92A 1C8LA 4YYZA 1B00A 1EMDA 4N5IX 5JS2A 3GZ4A 4ACAA 5KX5F 1QFSA 2HCFA 1T6YA 4BLUA 4XKJA 1VMAA 5T4EA 2AX3A 3KHUA 1IHXA 1MPXA 1OLXB 4I6EA 1FE8A 2C0PA 3NKFA 4K6OA 5AHXA 5EI5A 3SX4A 1U02A 1NZDA 2OHXA 2W2TA 1CUIA 1QCCA 1ST2A 3LZDA 2Z4SA 4X24A 3UMJA 3WP1B 3A1UA 1PO7A 4EAAA 1PVDA 2ILVA 5HIJA 3U4DA 3EVCA 4B8WA 4DA8A 2FSVC 1RWNA 3GT4A 3K4HA 1ZD5A 2VDWB 4LZOA 1G4UR 1XKTA 3WHLA 1W9HA 3IBTA 1EA7A 3WTBA 3CUUA 2X0JA 3B9BA 1UOQA 2HX1A 3CZRA 3GPBA 3TI7A 3ZNOA 4ETWA 1E89A 1GO2A 5A5VA 2XCSB 4R7TA 4GX0A 1JP7A 1CUZA 1UPCA 3L7JA 4NNJA 1FUKA 1CUXA 1H2HA 2VXBA 3GLGE 3ZZNA 1ZN2A 3WNZA 4CQJA 4XWOA 4I1UA 4IYJA 1SUSA 2JHPA 2O1WA 2OAQ1 3ANMA 2YUTA 4M37A 4PYQA 3VZDA 4FOTA 2Y0CA 3QPCA 2PL9A 4DUYB 2ZDQA 2FSHA 1ZA1A 2CMDA 2R8OA 4P82A 4PZPA 2Z3ZA 4LJAA 4Q9DA 2VA8A 5AJTA 1W4BA 3DDZX 1WW8A 1UEIA 1UR5A 3AFGA 2C58A 1PJCA 2FPPB 3KM0A 1KETA 5L4NA 2FJUA 1J4AA 3OMLA 4DR3B 4YR9A 3V7FA 2Y99A 1OHHA 3OM9A 3K9BA 2B2NA 5T64A 4ER0A 1CUJA 1VCNA 2I6UA 4XGQA 4F84A 4KVGA 1T2NA 2D8AA 2OCGA 2CYAA 2W2PA 421PA 2AR9A 3BAFA 1TM4E 3WKAA 1LV7A 3ESXA 4F6CA 3GCXA 3TNDA 2NV0A 4YRMA 1TW2A 4IXMA 4J43A 1RBZA 4YEDA 2EBUA 4HUTA 3CPJB 2YOHA 1SBTA 2ZUTA 4EGSA 1HYQA 3WBFA 4F11A 2IDKA 4E2XA 4NDAA 5JWRA 1E5TA 4LMRA 1SIOA 2XSZA 4YP0A 1OMOA 1M9NA 4PZ9A 1N9GB 3GPLA 2A0WA 2X15A 2NYRA 3U80A 2UZAA 3L06A 2IGTA 1W6UA 4PLTA 3I9JA 4R16A 4CEJB 1RM4A 1U0SY 4WTOA 1FRNA 2Z08A 5EUBA 1EDOA 1VLVA 4NPAA 1J06A 2I2BA 2BI7A 1S1CA 2PT9A 3E0XA 4PZLA 5DX0A 1KQPA 3T5BA 1TT5A 4XM0A 4JXXA 1RYYA 5BWNA 5JMOA 2G77B 4N18A 2RAPA 4B74A 2JI8A 1G5QA 1V0JA 2V65A 3AU9A 4XAQA 3CO5A 5G41A 4BX0A 5IX8A 4IR7A 1ZN8A 2GNAA 3CF4A 4BPRA 1RLJA 5FYQA 3U26A 1KK2A 3DPIA 5CXUA 1BRMA 1T36B 3VR3A 2IX3A 2RD2A 1D8TA 1E1QA 1ZA2A 4UTXA 3ZVLA 1I6LA 5HFAA 4BNVA 5LYJF 1UQRA 4NICA 1K6JA 5E3JA 3Q0IA 3VYSB