3UJPA

Structure of mntc protein at 2.7a
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
b'TEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNVKDVPSVVLTEGIEPIPIADGPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLEQVPANQRFLVSCEGAFSYLARDYGMEEIYMWPINAEQQFTPKQVQTVIEEVKTNNVPTIFCESTVSDKGQKQVAQATGARFGGNLYVDSLSTEEGPVPTFLDLLEYDARVITNGLLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mn transporter subunit
molecule tags Metal binding protein
source organism Synechocystis sp. pcc 6803
publication title Arginine 116 stabilizes the entrance to the metal ion-binding site of the MntC protein.
pubmed doi rcsb
total genus 77
structure length 274
sequence length 274
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3ujpA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3ujpA02
5JPDA 1QH8B 1K2VN 1QGUA 2PRSA 3MINB 4INPA 4WESA 1M1NB 1M34B 1N4DA 5GGXA 1K75A 4INOA 4LS3A 3GI1A 1N2CA 3PDIA 4ND8B 2O1EA 3BE5A 3AEUB 2PHZA 2XY4A 2PS9A 1N4AA 3PDIB 3ZKAA 4TKUA 1M1YB 4HMOA 5I4KA 1TOAA 3LHSA 4UDOA 4MO9A 3AETA 3K1AB 4WN9A 4NNPA 3MFQA 1H1LA 1PSZA 3AEUA 4NNOA 3K1AA 3PSAA 4WN9B 4WNAB 1FP4A 2XV1A 2PS0A 2AFHA 4IRMA 5BVHB 4PM4A 4TKUB 1L5HA 3MD9A 1QH1A 3R5SA 1G20A 3AETB 1M1NA 1M34A 2X4LA 3ZK7A 5KOHB 3G9QA 4FI3F 5JJ5A 5BVGB 3AEKA 3AEQA 2MINA 3TNYA 3AERA 2Q8PA 4G09A 1KARA 1G21A 2WHYA 5BVGA 4PAGA 3EIWA 4XPIB 2R79A 2WI8A 1KAHA 2AFIA 3AESA 3TEFA 2Q8QA 4FILA 2XH8A 1K7SN 2OGWA 4FKMA 2MINB 2YNMD 3HJTA 3UJPA 3HXPA 3PSHA 1G20B 1K0FA 4WNAA 1G21B 4G07A 3MWFA 4XPIA 1EFDN 4HMQA 2M6KA 4CL2A 5KOJA 2XDQB 4HMPA 1H1LB 2PS3A 2M6LA 3U7QB 4BBPA 3AESB 2ETVA 4WZAB 4WZBA 5CX1B 3MWGA 5CR9A 5AFSA 5JG7A 1FP4B 4OXRA 2R7AA 5FLYA 5KOHA 5CX1A 2RG7A 1L5HB 5KOJB 5B58T 3AEKB 1QH1B 3AEQB 1PQ4A 3EIXA 4H59A 3U7QA 3LI2A 5JOQA 3HH8A 1M1YA 1QH8A 3BE6A 4HN9A 3ZK8A 4K3VA 2OV1A 1MIOA 2AFIB 1XVLA 4UTPA 1ESZA 4B8YA 4TKVA 1MIOB 5M3BA 3ZTTA 5M34A 4TKVB 3NU1A 3R5TA 5HX7A 4LJSA 4N01A 2YNMC 1KAEA 1N2CB 4MDYA 4WZBB 4WZAA 3ZK9A 4OXQA 2OSVA 4M7OA 5HDQA 2XUZA 4DBLE 2XDQA 4FNAA 5M29A 3AERB 4UDNA 4GICA 3TLKA 2OV3A 4WESB 4MLZA 4H0FA 3MINA 5KHLB 2QI9F 5GGYA 5BVHA 3CX3A 5M2QA 4UTOA 4OVKA 4MX8A 1QGUB 2XQVA 2AFHB 4ND8A 1N2ZA
chains in the Genus database with same CATH superfamily
1SR8A 1EFVA 2JDIA 4V1CB 2CV0A 4LEIA 4F7DA 2PRSA 1HM5A 3OKCA 4GO1A 2AMYA 1YH3A 1I3KA 4B3IA 3RQSA 5B4TA 5KPDA 3DV0A 1JR3D 2YZ2A 5EJEA 3EPPA 3ZGVA 4A91A 5JMTA 4Q48A 3PF8A 5AJVB 4CNBA 4NZYA 3BWCA 3JAKB 1HKHA 1YIAA 3A6JA 3ICWA 3LIIA 4HVTA 1Q11A 5AO9A 3V42A 2DG2A 4KFCA 1ICEA 1EUCA 3IQXA 4KLRA 2V6MA 1PQPA 2PIAA 2X8LA 3UWPA 4GI7A 2PN1A 3ESBA 1UIRA 3A7EA 3IVAA 5H5JA 1NGSA 2R44A 4PYMA 3RUFA 4AG6A 3HGMA 2RIRA 3WOVA 2F7SA 1DINA 1PFUA 1AY0A 2ZVJA 1E2KA 1EDDA 3AUXA 2RKWA 3DR3A 2H2FA 1CUFA 4GSYA 4JP2A 1DXYA 5LQCA 1PZEA 1YMVA 2OKCA 3BD7A 4GHWA 5KQLA 2WHXA 1LDBA 1QZ3A 2G6BA 4WL0A 4YH1A 4MQ6A 1E5XA 2RARA 4N5DA 4RJKA 4CG3A 1SCJA 2OSBA 1E6LA 4OUDB 5NLLA 3RRNA 2X4LA 2GH1A 1T8TA 3T1HB 1NAIA 1KJWA 2NU9B 2VS1A 1JHZA 4FWIB 4YAJA 4TPKA 1O6ZA 3I53A 2RCYA 3C6MA 3FCEA 1VB5A 2BFDA 1PEAA 3DFZA 5TLSA 4NP6A 4OA8A 2IZ7A 3D3EA 3ER6A 1A8QA 4UXHA 4F96A 3DBRB 5IMSA 5FTWA 3RBXA 3OJXA 4YXWD 1NJ6A 4MQMA 2V58A 1PS0A 3QOXA 3TKAA 1KQFA 2JCBA 5EE9A 4Z51A 1QE3A 5ELLA 3AILA 4GBJA 5SZKB 3BGSA 4BB5A 3WB2A 4NRDA 4EJSC 4OJKA 4LZJA 3RPEA 2QUIA 4EFMA 1P8JA 4EF6A 4XRRA 4A8TA 2EZUA 2J3EA 2ZSUA 2A9FA 5DNAA 4BP3A 2WAAA 4O5OA 4E5DA 3UT0A 2WM3A 1SXHA 4TWZA 2OHHA 5HQ3B 4NV0A 2AYYA 3WKCA 2OC4A 3MJRA 3NIDB 4Q02A 1C7IA 3IAHA 3G1UA 3L5KA 3Q2OA 1OI4A 3ZHYA 4PW0A 1VCNA 1JYSA 5C1IA 3HBMA 2OV1A 1RRKA 4DCUA 5JCZA 2XDWA 2Y0DA 1AH2A 3UJ7A 1TK9A 4EECA 3DFMA 5L9AA 3VNSA 3BOSA 1MO6A 4G4SO 2R5WA 4ETNA 1CVIA 4HB2A 4QQNA 4TV8B 4Y1FA 4Q1FA 3EVBA 3P9QA 5D3MB 1Q16A 4REOA 4ZAZA 2CLMB 3AY0A 1P2DA 3SHVA 1SCAA 4K9DA 2O2GA 1CZHA 2CV2A 5K4GA 4WNIA 4MS1B 4GYYA 1NDUA 2LIPA 4FWTA 1V7PC 2PUTA 4RFSA 1MDBA 5LUAA 1RAIA 3MILA 4OXQA 1LNQA 5DNWA 3ZD8A 4DBVO 2LDBA 5BR1A 1VXOA 3I8XA 5BRAA 2HYIC 5M2QA 2JLYA 2DJ5A 2VSQA 1XKLA 1ZUNB 4X71A 3GFBA 1V35A 3AM3A 4M1EA 3UC9A 3RI3A 4ZIRB 5DGIA 4X8OA 4KQ9A 2IPOA 3BEOA 4Y6LA 1CVLA 3RIMA 1GITA 2OK7A 1U8XX 2XTJA 1E2FA 3OFVA 3IQGX 4KFSA 4DIKA 4J16C 3I4FA 4R1PA 1WZUA 4B40A 1CHNA 2PVCA 3GPIA 1B74A 2V7UA 4RYLA 5BPFA 2OM6A 4BCDA 3VPBA 1IQUA 3B9PA 3A6HA 3H17A 4EUEA 3AB7A 1G55A 3AUAA 2BAGA 1GL6A 1Q44A 2A9KA 3JWJA 4ZOLB 4IQGA 4G37A 3ICEA 1Z38A 3IKTA 1U2DC 2QRHA 5DEIA 5MDHA 4CW7A 1ZSVA 3BULA 5HZKA 1HDCA 1I4TD 1EKXA 3LUHA 4QUEA 3D7MA 3N2KB 4G9EA 4E2XA 3D7RA 5JAOA 1Z4PX 1L7EA 2QAGB 3BSFA 2NO6A 3TW4A 3WWZA 3K1YA 1HEUA 2JH3A 2ZJ2A 4R0MA 2FEAA 3TSYA 4NV1A 2XRYA 3WGZA 4B0OA 4E5KA 1GUBA 3U31A 1CLEA 3A6FA 2BH9A 4ZPXA 5EJGA 1IZ8A 3T1YB 5HFNA 3CXUA 3HJNA 3KXDA 3HBLA 2ZRAA 3I30X 4FTWA 4RA6A 5EZQA 5F5XA 2OPHA 3DXZA 2I5PO 3DDWA 5E2BA 2BTQB 3AKYA 3DZKA 4G4SP 5ILQA 1G21A 2QLLA 2XTNA 1A88A 1RS0A 1JEAA 2OT3B 3RTCA 1XP5A 2O59A 2HCRA 2HCTA 1KI6A 1KVTA 1SY7A 2JHAA 2Y4NA 1JSCA 2ZDQA 1F6DA 2FK8A 3ELUA 2JNWA 3L3BA 2LGJA 2ZB3A 1IRIA 3ESRA 2PYZA 4MUFA 5C4GB 3Q1KA 4BNMA 2E37A 5J2UF 4H7PA 4F3TA 4JNKA 1MBZA 4P5EA 3VTFA 1YNOA 3KSUA 1UXOA 3ZPXA 3TG2A 1OHHA 4R9NA 2H11A 1N7HA 3PF9A 4KLZA 4BNXA 3Q7IA 7MDHA 1AUQA 3UGQA 2IH5A 2QSYA 4G9GA 1QHEA 1IRXA 1VLMA 2PANA 1PL8A 1M5TA 2EU8A 1UKAA 4XA8A 1OXUA 1F6BA 1NJGA 2QENA 4H0CA 4J0KA 1IM2A 1GO2A 2AF3C 3FCXA 3QKRB 4CNQA 3OTOB 4IVNA 3DV0B 1K88A 1DWQA 2ZULA 1VTKA 3K4HA 2ZE5A 3JD2A 1PN3A 2XAUA 4DWOA 1QQ6A 4AQDA 1X3SA 1L4NA 4M9XA 2J3MA 1JG4A 2O5RA 1M1ZA 2OV4A 4O3FA 4DDUA 1AZWA 1X80B 1EUCB 3LQYA 2PGJA 4KO8A 1V3UA 3VKVA 1U0HC 2BUAA 4QTZA 1IBLB 1J39A 2GKGA 5AI6A 5AM3A 2R8PA 3T5TA 1QRSA 2HWWA 4W9MC 4KI7A 1O95A 2AK3A 1Q0LA 2QUZA 3IULA 1NJ8A 2Z1DA 1W5BA 2O8NA 3BICA 5AOBA 1MVNA 1ORHA 4D9HA 3BSSA 1XK7A 5AJHA 2F17A 3KU4A 3NP7A 4D57A 1E4YA 1WSWA 2B1JA 4YACA 5ILGA 2H4FA 4CIXA 4HN4B 2AB0A 5CNJA 4NXNB 1CY4A 4LDAA 3ZYZA 4MX8A 3VHXA 4CIAA 4DR4B 1KYWA 3B9BA 2AVNA 4LXYA 1S02A 2ZJFA 2BR3A 4KO3S 3Q3VA 1DGQA 2YC4C 5DYWA 1EP9A 3WMEA 3NBMA 5CP8A 3WRYA 1TJ5A 5C5CA 2VG8A 3FIUA 2OCGA 3WWCA 2YWRA 2M2IA 2WTUA 3G3EA 4CR8A 3B3AA 1UEIA 3T4UA 2ERYA 2ZBFA 2RGYA 4TKZA 4LMBA 1Z0IA 4Z6KA 2E7ZA 2H4XA 2H2AA 3FYCA 4M7RA 3ETLA 1EK1A 2ZUFA 1JU3A 2WBLC 1ZY2A 3RSFA 1V2HE 2UUAB 3OFSA 1FBNA 2JIQA 3A10A 4GM0A 4H7DA 3HCNA 4QLAA 5ALMA 3GJ3A 1JLHA 3TPZA 2VNKA 2H9IA 4JJKA 3O2NA 1AF7A 1AK9A 1FTNA 1Q0SA 1CS0A 4AKTA 5L3QA 4QOIA 1SU7A 4J4TA 3RVBA 1B2LA 2PX0A 2XE8A 3QKWA 4DA8A 2WKRA 2X13A 4WKCA 4DJ5X 1T5BA 5J4YA 4F8YA 1W5SA 5MFZA 1RMTA 1IZ9A 3LUBA 2JVKA 3GAMA 5KQGA 4M1YA 1TD9A 1IZZA 2WAMA 4D45A 1VSVA 5EE5B 4HQFA 1SO8A 4NAUA 1LDMA 1GU7A 4D9KA 4DC9A 1Z7BA 4QLOA 4RVCA 5C1DA 4PYQA 4UFPA 2D2XA 4EY6A 2FK7A 1LPSA 4G09A 3R76A 1NFQA 3D31A 3L6CA 2IEAA 3FETA 4IDGA 3V9AA 3Q41A 3NJRA 1T9BA 3INYA 1ZAKA 5DM2A 3QM1A 5CU7A 4EGAA 1ORVA 4LVCA 1PV4A 2WIAA 4FILA 4KIGA 2YHSA 4TT8A 3I2GA 4EI8A 5G41A 4Q4JA 1TYZA 3O38A 1T2VA 5BN4B 1X9GA 2JD1A 3TCNA 5FUQA 2OB2A 1NYRA 5JROA 1QK4A 4JKYA 5BSFA 4PS0A 3E22B 5KTPA 2HTFA 3FF1A 4B4WA 2GPJA 1FX0B 4N5NA 1JJAA 2I2XB 4NPCA 4P82A 3W3AH 1L7RA 2REQB 4TM7A 4H27A 5C1OA 5A4DA 3I2YX 2H3HA 3EW9A 2DHCA 1WHSA 1W2GA 4R1NA 3N2IA 3QZUA 4WY5A 3D5QA 5F2NA 1EWKA 1V3VA 1OC4A 3H9UA 1HYEA 1QYVA 3SBDA 5REQB 1MO5A 4X61A 5F4ZA 2VF7A 5FWDA 4HH0A 1YZHA 1ODSA 4F38A 4M89A 2Z5LA 3A05A 2I4NA 1V1MA 2IZ1A 4Y2UA 4CR7A 1DQSA 4URHA 2GN4A 4X1YB 2ZAYA 1TMKA 3IELA 1MT3A 3M5CA 1U7HA 2A94A 2QB5A 3JASA 3OMXA 4OK6A 4QL3A 4R4JA 3AHDA 3UA4A 1XEXB 4NAVA 4C4RA 1MAHA 4DV2B 2P41A 1OAOC 3DL2A 3JARB 5KYYA 1ONOA 2O3UA 4BNDB 3EC1A 1JG3A 4DANA 3F6PA 3R6LA 5HCIA 3U61B 1ZC4A 4LYFA 2ZTUA 1A27A 2EFDB 2VATA 4RS3A 2VJYA 5EAIA 4AJ9A 1J0BA 3LKZA 4RWEA 2E1PA 3X3HA 5KHOC 1RQLA 1XRPA 4F1KA 4RJ2A 3FYTA 4BLPA 3UXYA 1CQIA 4EZBA 3D6MA 1D0SA 1JDJA 3KYDB 4IRUB 1YKSA 3H13A 1ZOLA 4F3RA 3K15A 1CX9B 4DWWA 2P9ZA 4GICA 3LCCA 4LMRA 3UAOA 3AR6A 1JZTA 1LPBB 1XRLA 2R6AA 1O03A 1QG2A 1D5WA 4Z99A 5B37A 4F3NA 4GBMA 3SZUA 2XT6A 4AJNA 5JNRA 2C97A 2O7VA 5LWQA 2HWXA 10MHA 2N46A 5DISB 1R0WA 1CQZA 2WV7A 5EJ5A 1R4NB 5KOYA 3RC9A 3OD5A 4PCAA 2E5FA 1BFKA 1UWCA 3IJPA 4DLSA 2FTKE 1U9ZA 3BB3A 2VSNA 4GPBA 4PS1A 4IH9A 2R1VB 3N28A 1UZUA 3W8RA 3ZY5A 2I33A 4TYNA 4YROA 4AS2A 3HO8A 2B6HA 1QC5A 3RYHB 4D8TA 3OT1B 1QPGA 2ZCVA 5JMWA 1RD4A 1OBHA 3BC1A 3PG5A 3FPBA 4QYTA 1MA0A 1TJ3A 2XX3A 1BXGB 3AEYA 4N5HX 3ZY4A 1R0KA 5HG0A 3WJAA 4PICA 5G0WA 1Z8NA 3E3LA 1U0TA 3GCZA 4B3MB 2DY1A 2XGOA 3H5WA 4NBTA 3EQ9A 3DB2A 1ZOOA 1K98A 3VDRA 4IKEA 3N59A 2UUPA 4BX8A 3BJRA 3G5MA 3ZD7A 4LNHA 2H1HA 4C06A 2XBMA 5TGDA 3QI7A 2JFPA 3PRHA 3BD8A 4ROSA 3GJTA 4EF5A 2JLUA 2AS0A 1NBAA 2GETA 4MKGA 4HWPA 5HIIA 4KNWA 1EPUA 4PLPA 3AUJB 2X0KA 3JALA 3LUFA 2XLBA 2QQEA 4R8SA 4F5ZA 3TLZA 4UBIA 1X7YB 2ZOSA 2UVQA 1Z5UA 3BMOA 1QG6A 2NYRA 4HFRA 4RY9A 4YT4A 4IEEA 2H6EA 1H9BA 1JIVA 4JWKA 2XKAA 4INZA 1NLZA 2PL5A 5I9MA 2JW5A 5JAPA 2JLSA 3EBLA 3EXG2 5BSEA 1HOXA 1I4WA 16PKA 5D1HA 4NSNA 2NUAB 2JL1A 4HWGA 1J06A 5LZ4A 2C83A 3OH8A 4Q66C 2AFRA 1UT5A 1VXRA 1ZD3A 3JVVA 1PZMA 4YCLA 1REQA 2FWNA 1KAQA 1E18A 1N6HA 2JGKA 1DC4A 3VDMA 1U2EA 2Q5HA 1TF5A 3TMYA 4AZTA 2HNBA 2ZPAA 3SHOA 2LD4A 4I66A 4IS3A 1D9XA 3SF8A 2P0EA 5JSUA 1ZHHA 4Y9RA 5GINE 2EBWA 3Q3CA 3WK4A 2HYDA 2C5FA 4F4JA 1KTIA 1T9KA 1HTBA 2HU8A 3LW7A 3P9KA 2GRJA 2W2XA 3LDHA 1Y82A 5CB8A 2GDJA 4JP5A 2GF9A 1B43A 2VZ8A 4X60A 2QUJA 1S3GA 3WIBA 3L0YA 4G01B 2BFBA 3UMSA 4RV9A 1P5HA 3AB8A 3OZGA 1H3NA 1FS4A 3E0XA 2VLBA 4Q3OA 2QZ4A 3KKLA 5IDVA 3UXMA 3G1WA 1YZQA 1A2QA 2YNMC 4CE6A 3OEWA 3PEUA 4A8HA 5JD5A 2CLIB 3D2AA 5F77A 4PX3A 5ARCA 4HDKA 5EYPB 4CQNA 1P31A 2ZAMA 2RHRA 4PRLA 2YZNA 4CCYA 4DSNA 5AVYA 3WV5A 5JALA 1R8JA 2W4MA 3WRXA 4E5PA 4U39A 4Y30A 2JC3A 3QXHA 5ES3A 3R1IA 4PG4A 4S12A 3U17A 3EC7A 2RB5A 3GP5A 3H4VA 5JH7B 3DE4X 3G2PA 1AMNA 2OBMA 5BR7A 3DAOA 3GUUA 1Z25A 3ZCTA 1BJTA 5A0TA 3W4JA 4HX5A 3KUCA 3GCXA 5FBLB 3I8OA 4ZHQF 2UXDB 1T2DA 4AIIA 2ZLBA 3EVNA 1I2MA 1UKZA 3QMPA 4NULA 1G8JA 3PR2B 4TVOA 2O20A 5JANA 1DX9A 1PZFA 1QV7A 2GK4A 2HAEA 1P0QA 5IEBA 4BV9A 2QNBA 4Y6GB 3QMMA 4YJHA 1L3IA 4U1RA 5CM9C 2ZQ5A 3HKEA 5DBGA 4XIJA 1ZRNA 2ICAA 2PR7A 1SC4A 3BE5A 1TE2A 3EOBI 3OQVA 2ISQA 3QX8A 4NH0A 1JEQA 4XQEA 5CUQA 5ARBA 1JRLA 4WHMA 2ZJ6A 1JSXA 1M33A 2AW3A 4PIPA 1TD1A 1XLWA 3B36A 5SZHB 3UY4A 4BNUA 2Z9BA 3GEEA 1B0AA 4UUMA 5EPEA 2X22A 3K1AB 5HMLA 4B8ZA 5I8PA 1MGOA 2AFVA 2GXSA 1HNXB 1H0SA 2DVMA 5HUHA 1F06A 1W44A 3UK6A 4D8UA 4I08A 3E18A 4PCVA 1Z45A 4HDOB 4KX5A 1R66A 3DWGA 2G0TA 4P34A 4AJLA 1T8RA 1J0CA 3QPDA 4H4EA 1E6WA 4Y1GA 2O2XA 4BE9A 3X1DA 1P80A 5LU8A 1AMOA 5A4MS 1SKYE 1LCIA 3IUNA 5AXDA 3RYFB 2P9EA 1RXVA 3T1TA 1P61B 3DYVA 4CMHA 3K1TA 1Q74A 1HE1C 3FOBA 4N3NA 3WHIA 1O94C 1K4KA 4KIWA 2W0SA 1Z8HA 1TECE 2B9EA 4M54A 1IWOA 2HC9A 1RZRD 3HFRA 3MG9A 1XMIA 1M8GA 4K05A 1T91A 1X1RA 2FGJA 3N1UA 1NUAA 3E48A 3KQTA 5FWXA 4ZCPA 4QDKA 2IHBA 3SNHA 5D6NA 2Y67A 4J1SA 2YY6A 2B7CA 2VZLA 3OZUA 4GI2A 3U6KA 4KV7A 1NDQA 2ZRLA 4OJQA 4YBZA 4MO2A 4E1VA 4HQNA 1CF4A 1JQBA 2DUJA 1X8KA 4L5AA 2JIDA 3PPYA 4OQZA 1QTNA 1N1MA 4G07A 4UBMA 4ZVKA 4YMVA 3ZU4A 5KCMA 3CTMA 2VDLB 3I5AA 4TTTS 4RD2A 3AR5A 1K08A 4ABYA 3IIKA 5CX1B 4GGPA 3MCUA 1SHTX 4Y7CA 1OXTA 3JVEA 4JJZA 5JG7A 3CH7A 3JQPA 3ZQJA 4RKYA 4AMZA 5AW6A 1E2QA 4FI3C 1VL0A 3Q7TA 1U6IA 2B30A 2P90A 2Q1XA 3AJRA 4RVDA 4JOBA 4YAWA 3GUVA 5F9MA 3KT0A 1XTUA 3CNBA 3PL5A 5FV4A 1SPBS 5EY5B 3F4KA 5HYVA 1JILA 4K3VA 4EENA 3MHPA 1YDHA 5I7HA 4MAAA 5JWOA 1FYVA 4LNUA 2AZTA 1TAHA 4OFBA 4YAOA 1FL9A 3REGA 5CA1A 2ANCA 5D3KA 2YCBA 3ND8A 4B6EA 1NOIA 4RPKA 3KR2A 5D7NA 4QTYA 3NWBA 1USKA 3LSYA 5D51S 2FZGA 1PNRA 2DPYA 3PNLA 1YQDA 4N54A 2ZATA 4CBVA 2FMTA 2ILVA 4MVJF 1GFWA 4DM3A 1DWPA 1EP2B 1NMQA 1W88B 3C7CB 2QWXA 5LQJA 1WV1A 1DB3A 3L18A 1VLJA 5J23A 4BVJA 3T7EA 1A9OA 1S1CA 3L1HA 4FFMA 4RIEA 4BVBA 5IG2A 3RIHA 1DT3A 3IPAA 1VJGA 3IQHX 5JAZA 1YV9A 4M0UA 3IB3A 4IOLA 4D56A 1TUIA 3U4IA 3TECE 4F0JA 4V1CI 2NNWB 3AVPA 1E3IA 2OV8A 3KKMA 5JWHA 1BJKA 1H9CA 4X85A 5L53A 5FORA 3PS9A 1RQPA 9ABPA 1UKVY 3EXFA 4AP6A 4BN0A 3V8VA 4HDQB 1SC6A 3O4JA 3LCUA 2FLWA 2JEZA 3USCS 2VQ6A 5TARA 4J0CA 3WGKA 3JSXA 3P45A 1C4XA 1XHFA 2XY4A 1W88A 1PQYA 2V9CA 4IDBA 5G3ZA 4DRXA 3NATA 1VPTA 1X7GA 1ZLXA 1E0JA 5LLSA 2BF4A 2G9NA 3RWOA 1EUQA 2ZJAA 1XELA 3RK1A 4PLVA 1WBDA 1YVEI 1W85A 3LQ4A 2OMEA 4U6NA 1NBMA 3OY7A 6GPBA 3VU9A 2GKOA 2C3UA 4YIKA 2OQVA 2R8XA 1GNVA 2LPMA 3KJEA 1R0ZA 3ROZA 3VPHA 2SKCA 4X9XA 4B74A 4FFDA 2B8TA 3R7DA 4JJFA 3WOHA 3HJUA 3EVFA 4EELA 1QOQB 1M1NA 1M34A 1QTIA 4R1OA 2OYCA 3HB4X 1T6BY 1YB5A 1IXZA 3DMTA 4W63A 2RK6A 1SU4A 4NOKA 4OYLA 5FCDA 1B3BA 1WKVA 2QR5A 2QT0A 1A76A 1JKJA 4QDOA 4TRRA 4J4HA 2H2HA 3UICA 3NIGB 2NWQA 2QDXA 2XVMA 5JFTA 4RDCA 1LLDA 1SOMA 2QGNA 1KGDA 4FOLA 1QBKC 1ZW6A 4O25A 3WA7A 5F5NA 2H4ZA 1QCDA 4ZA2A 2R2GA 3S1LA 1GRVA 5DNUA 2LRHA 1W85B 1NJFA 3HJTA 3S7ZA 4EHLA 4WZZA 3UQZA 1A72A 2XCTB 2O2DA 5EZYF 5KVSA 3RV4A 3IP3A 3A4LA 2VOEA 3GV0A 1ST3A 4MMYB 3DOIA 3H7AA 5BV1A 1XCGB 1RYBA 4X1IA 2PR2A 3EXHA 4MYSA 1Z7WA 1GSOA 3BQNB 4RTLA 1JWAB 3TJMA 1W7AA 1E2DA 2Q0SA 2A2ZA 1ADFA 1BO6A 3A70A 2OZPA 2G5TA 2A1TS 2J31A 2J7PD 1Z63A 2IZOA 2C9YA 3VTKA 1N7IA 4UUBA 2W2OA 2WSSD 4UBNA 1QGDA 4X1YA 4RNDB 5BT9A 1X42A 2AR9A 1XDZA 2CL7X 2K2WA 4Y1EA 1GY8A 3U4DA 4HWSA 5JBNA 4D9BA 4D9MA 4DLYA 1NL3A 3L8GA 1X7ZA 2Z2KA 4GR4A 2PA3A 2XXAA 3KTFA 2HR1A 1X7XB 4UQPA 2C9DA 1FDWA 3A1VA 3V80A 2LZ0A 2F1HA 1AS2A 2M1XA 5LP6F 2WPNA 4URVR 4W1QA 3PUJA 1YZKA 5J9FA 3O0DA 2FSSA 4B79A 1XRMA 3ADCA 4B3FX 4N01A 4HEQA 4F21A 1GM5A 4S35A 1WQ1R 3QITA 4QJ5A 1N2CB 3LDFA 4QEZA 1DKMA 5IKPA 1J8DA 1PF7E 2XUQA 4C2TA 1MX9A 3EIUA 3UJNA 4KIUA 4ZANA 4KACA 2O3JA 1BDBA 2LDXA 4UDNA 1WQ3A 3CF2A 3KTAA 1LU9A 2X4IA 4P1ZA 1QO9A 4GX0A 4ZT6A 1VE5A 5AW8A 1U9CA 5AXBA 1YMQA 3EDOA 1BN7A 3V5NA 1CEYA 1R4NA 4HDSB 3KZCA 2ZU6A 4I2VA 4IM7A 3DDOA 3D3QA 3DT8A 4QRIA 5NULA 4P3XA 3ZDEA 4JENA 1XAJA 4MKFA 4Q9JA 5DB4A 5JS1A 4U6SA 2X23A 2DH5A 3IV7A 4QU5A 1ZYUA 5HFJA 3CUKA 3ZWBA 2WZDA 1O96A 1U0RA 1GARA 1V26A 2OHOA 4A8JB 2CNLA 4IYRA 4OUKX 3ZVKA 4U5XA 4INOA 2PUBA 3LCJA 3QU7A 1UWKA 3OT1A 3PKJA 5EWJA 2JAOA 1C1DA 1A9PA 1YB6A 2YWHA 4FN5A 4JLJA 3I73A 4RHTA 4IVRA 4PHGA 1N2CA 1I0ZA 4EMBA 5K0LA 3QVGA 3MTBA 3FDXA 2C57A 1FQOA 2H4HA 2OHXA 3OAAA 3GLFE 1FQWA 4QUBA 5JHHB 3A2KA 5BSUA 4O4JF 2O6HA 3S2YA 1V7QA 3RBAA 1W36C 3DQQA 1C3EA 1OLUB 2GJKA 1H8EA 4R2LA 4BGEA 3H65A 3DZGA 4UOQA 2MMCA 4EY4A 1P44A 5I4BA 4Q1AA 1P6QA 1E94E 4HQ6A 4L50A 3VOSA 2Q7OE 3JD0A 4IP0A 3U26A 1D2HA 1RAEA 5CJPA 2O3TA 1UJMA 1HV8A 4K0RA 1QOZA 1V25A 3H3FA 3SI7A 2O07A 4MS4B 5JZMA 1VG1A 1WVMA 5CVEA 1JHXA 3O2QB 4GWGA 1A8PA 5KNDD 4O2LA 1U2QA 3Q8MA 5ALOA 2MT9A 2GBLA 3ZVLA 4ZOLF 4ATNA 1HY3A 1XZMA 4JBHA 3RYCA 4IIEA 1H93A 1C1DB 4IYJA 1VJRA 3Q8KA 1IIRA 4TYPA 1E32A 4MUGA 3O91A 4X6XA 3DDNA 3UFBA 3WSVA 3R74A 3ZZNA 3DDHA 1WR8A 3KAPA 1AV7A 4N39A 1MA3A 1BXZA 3TKYA 5EHXA 2WTNA 4ZALA 4L4UA 5J2UA 5DF1A 4Z1MD 2WIJA 3DYIA 5JE8A 5TPWB 3H42B 1T3GA 1K7SN 3P26A 4NR0A 3RS9A 4B6FA 3HXPA 4LTMA 2XUPA 2QN3A 4W82A 2QPLA 4CV3A 3PQ6A 1IBSA 1THMA 1WPXA 1VGQA 3GGJA 4QDZA 4JMLA 1BH2A 5CXSA 3BS4A 4DV3B 4BJHB 3FOZA 1KYZA 3HVJA 2HKIA 5MGNA 1XN1A 3LFUA 2J45A 5JQGA 4PX2A 1OX5A 1RHJA 2II6A 5DCYA 2PWAA 4DNQA 2OYRA 1F20A 1SVSA 3W6ZA 1KQPA 3MWDB 4MCIA 5M5BA 1NP6A 2OCKA 2VT7A 3GLRA 1ODCA 2HMSA 4Y9UA 4A92A 1K7FB 2GF0A 4C3UA 3A9RA 1Z82A 2HK6A 4XWKA 3NCTA 1DPGA 4ZVUA 4BAUA 3IIEA 1I3CA 3LI2A 4ZK6A 3B85A 5ERYA 3BXXA 2WD7B 4FN4A 3WP1B 5HQTA 1G63A 5A7HA 2O2CA 2XEDA 3UTCA 2HLPA 5C3MA 3RB8A 1DC3A 1A7AA 3GVCA 1MD9A 1NOKA 3FVVA 2XRMA 3E82A 2Q41A 3QXGA 2NP7A 1BMDA 2PL1A 3LFTA 3DE5X 3ZGXA 1D6NA 1M2JA 3DFKA 4ZK2A 5GTDA 5E4TA 4L5BA 3V1TC 4OQQA 4DRXB 2VUUA 4GL2A 4R83A 2G4LA 4MWBA 1DNPA 4PC7A 2DQSA 1D3AA 1J0AA 5IT5A 5JQGB 1QIEA 3FN4A 4WVFA 3V7NA 3JQ9C 3T9EA 3IBFA 1G5IA 2G17A 3MS2A 5IULC 2DBVO 1LSSA 1X13A 4CCSA 2OBXA 4ND7A 2PFSA 4OQ4A 1SXPA 2JKZA 1EVLA 3KXLA 2P69A 3WRXC 1Z36A 4QWMA 1N3LA 3WL7A 1TKRA 1KVUA 2HZBA 2X7XA 3PPVA 3UK7A 5IAJA 1WZEA 4J7XA 3SD7A 3WXBA 1QX3A 1BVRA 5BN5B 1WMBA 3DKIA 4LZLA 3IERA 5A5EA 1Y37A 1L5LA 5HP4A 4JDPA 2ZBUA 4ER5A 3GAFA 1OWLA 1A9ZA 2HA0A 3VH1A 4UAVA 5HZMA 3G7NA 2ZG6A 3ZDYB 3IUPA 1E5LA 5BWBA 5T5QA 3RU7A 3SR0A 1U9YA 1KI7A 3STYA 1FYEA 2DUUA 1PQWA 5IFLA 2P9BA 3C3XA 5FWAA 1IB6A 2ZVQX 1F8XA 5FFNA 1SPXA 1TJPB 5F7OA 4FEEA 1NHGA 3A7DA 3W6NA 4GIBA 3CUYA 3X1JA 1LRLA 4A0GA 1YR3A 4OA5A 4JBGA 1O08A 3AETA 1ENOA 3FUUA 1HQKA 1PFKA 4S2UA 2P0AA 1YZYA 4PO3X 3SFVA 3SQDA 4BMNA 5IM4A 4YP1A 2OK8A 3EB9A 3EIHA 2BD0A 4P3OA 5DYYA 1BQ3A 3CX8A 4DDTA 1CRQA 1WDKA 4LV8B 4NCJA 2BHRA 2GQ0A 2I6GA 4DUZB 2B4QA 4PLZA 5IX8A 3VOAA 1L5ZA 2W2TA 3SJUA 3NHSA 5BNIA 3E9EA 2JCVA 3LD9A 1BS1A 4G6ZA 5AM2A 2C1EA 5JJIA 1ZMBA 2GWHA 1WB6A 1GVNB 3OOSA 3ZV6A 1GFIA 1W2WB 5DVZA 3QW4B 3IT1A 3PZBA 2UZ0A 3LDGA 2QJWA 1MB0A 2X2FA 4DYHA 1F0YA 5ADVA 5EIBD 1V5WA 4JI1B 2Q8QA 3RAGA 4IIJF 1I10A 4R98A 3GJQA 4HDNA 3M34A 3PL1A 3KVNA 3MJVA 3C8DA 4HEJA 1PKEA 1CY7A 2HMUA 3KB6A 4ICIA 1VM6A 2PLFA 1LGYA 3U0VA 4EMUA 1FMFA 2BGIA 2DPGA 3PYMA 3ZNQA 3RK0A 2QM8A 3W6OA 1JJFA 3RS4A 1N3YA 1CKEA 4DA6A 4ZI3A 5KINB 1ODJA 1JTVA 1F0NA 2C9CA 1N6NA 2AEFA 3PFBA 3DNMA 4KSBA 4DM4A 2R47A 1X87A 4AL4A 3ZJ5A 3LE8A 3JYHA 4FYYA 4OMFG 4DPMA 3I1YA 5JZOA 3TOZA 4G1UC 5KNDH 2AN3A 4X66B 5EKSA 4ZDWA 5BR4A 2PZAA 4R9RA 1HDIA 1JFRA 3DF7A 2CMDA 4TWRA 3T1NA 1L5SA 3QPCA 1BRMA 4LSGA 1PWEA 1NIJA 1A0OA 4MVJG 4TS1A 4TS3A 3F8TA 1ONPA 3ZYCA 4DWJA 4UJ3A 5E3HA 4BFWA 1M2OA 3WHKA 4MUKA 3UAYA 3GLGA 3PVZA 2B1RA 3BWDD 3O3NB 4IHJF 4HLCA 5DHFA 4ZRDA 5D01A 2XB4A 3IV6A 2MHCA 3SHFA 1KAEA 3AINA 2QZ9A 4ZYWA 1JEDA 1NNSA 4BKOA 5KTTA 5GJWC 3ERCA 4YV1A 2IY8A 2CXPA 1ZGCA 4A9AA 1D1QA 4I6EA 2P0YA 4UCQA 3TTUA 3WGLA 2WTEA 3BA6A 3LCRA 2KLBA 5DGTA 1E1KA 1IDOA 1M2HA 2B0CA 4QICA 2JLVA 5HS6A 2E82A 3H3XA 3ND9A 4JEIA 1VIMA 1P4JA 4QODA 3NOVA 1RZ3A 1V5EA 4KQIA 4F2HA 3BFXA 4P7BA 1ZQ9A 1POWA 1SB8A 5BOSB 2Z9CA 4H17A 1CJBA 3EQ8A 1XVUA 3QTTA 1OU0A 2N47A 3KL2A 3ZU5A 2ZRIA 4PN7A 5B55A 2DKNA 1EVZA 3EVGA 3E3MA 4NYMQ 3HN2A 4R8LA 3M4ZA 4BO2A 5JSZB 1H2RS 3X0DA 2BGWA 3RVSA 1DBQA 2FPRA 3BEDA 3D3JA 3EQ7A 3J7AC 3H0KA 3TPCA 5JECA 5B1HA 5G4LA 2ORED 3QLVA 3FUVA 4HAOA 2HU5A 2C2KA 1KAMA 4TLLB 4IHJA 2P68A 4D0RA 4OHBA 1OT3A 4DCNA 5DK4A 4EFKA 4H1TA 1W94A 4BFSA 5DTIA 3VR2A 5K0JA 2Y1EA 2LBPA 1IY8A 1U1FA 4OSPA 2DR0A 4P6VF 3TJZA 4HTFA 3V2IA 1ATZA 3T7JA 4UPEA 3IOCA 3BIFA 2AOTA 2CLFB 1BD3A 2AFHA 2C3PA 3BKWA 3C3KA 3O4IA 4QHSA 4QOJA 4LBZA 1EHYA 1Z4QA 1YF3A 2FOLA 3ID6C 4NU0A 4OQYA 4MZDA 1YBVA 4W9NC 2XKKA 1PV2A 1W25A 3HDQA 3WMFA 2CLKB 4JZKA 4A0RA 3WMWA 1ZJJA 4BQPA 5JRZA 3KELA 3B1ZA 4HDAA 1HI9A 4OGFA 3EMKA 5H82A 1LDEA 4J9VA 4ZJPA 3BSYA 2FN9A 3DYBA 4RK6A 4FHEA 1JE0A 3LIPA 3K6KA 5DDIP 3WL8A 1MOSA 5B7PA 4I81A 1N5RA 1NVTA 1OAAA 1WEKA 3WGGA 4EITA 2WM2A 3F2IA 4X1OA 1LLUA 2CYBA 2PH5A 3VPAA 2JATA 3WRVA 4G1CA 1PKXA 4OK5A 1IJEA 3U3JA 1QH9A 3L01A 4WCVA 3UJPA 4Y6RA 1Z17A 3SJZA 5IT0A 2VPZA 2PAFA 4TN1A 1NQWA 5JNLA 4LHXA 1G42A 4AZ0A 2W2PA 3DNPA 1GQSA 1QUFA 1SHKA 2YCLA 3UA3A 4D96A 1MV5A 1M6YA 4X92A 4AXXA 3F49S 3WAJA 3IR5A 4XUCA 3A6KA 1Y8ZA 1X74A 3DHVA 1DKQA 4JMPA 3UWMA 4C0JA 2BJWA 2G0NA 4AMBA 2WNSA 4DBZA 4RTNA 1VSUA 4ARBA 4PG8A 3E9RA 1HQYE 4PLYA 3NJ4A 2R751 3JQFA 4Q1BA 3UJBA 3I72A 2IUSA 3KNZA 2BFBB 3DEIA 3T34A 2O8EB 4MV3A 1CUEA 1YD7A 1GPKA 3HKBB 2IWHA 5JBQA 4J1QA 1IY9A 1ZIYA 3CH4B 1OD6A 1RMQA 1U04A 2WYVA 3D8UA 3HEMA 4QFMA 2OCYC 3NANA 3QOFA 5T67A 1KVRA 2DCUA 4KDCA 3G13A 5K8UA 1GKYA 1FTQA 1ZZGA 1MG0A 3BFVA 1E0AA 1L9XA 2WT9A 1EH5A 3UO8B 4OU5A 5C7LO 3FPHA 1E2LA 4BZWA 1QVRA 1SU8A 3FPAA 1ACMA 3ETJA 1GADO 3MLBA 3R3XA 1MC1A 4IFBA 3ZTYA 4BJ5A 3HUUA 2AZ4A 3T1QA 3DFUA 2VUSA 4BFVA 5EIHA 2GNPA 3VYWA 2Z98A 3HXKA 2VZEA 1E2MA 1WUHS 2BJVA 4AK9A 4QREA 3QKSA 5TEWA 3COJA 1XZFA 3PUIA 1YGPA 3ZWXA 1LTKA 2A6PA 1M2FA 3T4XA 1O8BA 4ZMRA 4IJ5A 1YL6A 3CJQA 5AI4A 5KYTA 2DUMA 3FNIA 3IAS6 2FMIA 4HWOA 5AJYA 1NN5A 1CJMA 3K9HA 5KC9A 2HHJA 1QP8A 4B7UA 3OG9A 1U0LA 3MINB 4LJ8A 5FBHA 3AV3A 3SEZA 1MO4A 3VVMA 4HV4A 5JDIC 3EPKA 4OP1A 4CF7A 1K75A 1KY5A 1P9LA 1U8UA 4IJUA 3PT5A 5FXMA 1UBUS 5KNBA 4CMEC 1YDMA 4KVAA 2GZRA 1FDUA 1N2HA 1R0CA 4AC9A 4BLSA 1D1PA 2PRIA 1YVUA 2ZANA 1EFRD 4QPCA 5DK6A 1HE2A 4WXPA 4AMUA 1E89A 3SJ7A 5FF9A 3OZCA 1BE6A 3O03A 3FOEC 2N42A 1QAQA 1SIBE 4P3KA 1V45E 5CVUA 1Z5NA 3E8MA 1WXWA 4QT4A 1SG6A 3P2OA 5CT6A 3FB4A 4MKIA 1JVNA 4K9NA 3CUUA 4MW9A 1M10A 1OVGA 1IN8A 2JI9A 2GZDA 1Z15A 1USVA 1WB4A 2QPOA 4L0QA 5AKXA 2FPPB 4QU0A 2FZ5A 3QG1A 2YWGA 2GERA 4JQOA 5DTEA 4BWFB 4NE7A 5JJ5A 2PSSA 4GLJA 4ZJUA 4FU0A 3QUSA 1WSDA 2GUGA 4IGKA 1J0XO 5HGXA 4KQJA 1RCFA 4BU0A 3AG6A 4CIDA 2OZKA 1L5KA 3L1IA 1SXIA 1IVSA 1EG2A 1YS4A 1JSZA 3A1DA 3ONNA 4PAGA 4Y2HA 3W5VA 1AKRA 3N5CA 5ALLA 4ARAA 1JKMA 1T9GS 4NEQA 3W04A 2REBA 2HWYA 4GW3A 3R7NA 3SHWA 1OT5A 4ACBA 5LL6P 1YFLA 3AM1A 4OAQA 4PF1A 2VPXA 4L73A 3NVAA 2VTEA 2OVFA 1VKNA 3K92A 4TN5A 1TZMA 3ANXA 1R3UA 3FJOA 1MAAA 1C4OA 2DLNA 2GPYA 3U7QB 3U40A 2P6RA 1D4AA 2LKDA 4OM7A 1V3QE 2BEWB 5LQUA 2G7ZA 1I1NA 1O97C 3IBGA 3H1PA 3HMQA 3OECA 1V3TA 4O0MA 2AG0A 4JBYA 2B7LA 4PSVA 2Z3WA 3IO3A 4G85A 9ATCA 4TRJA 1S9DA 2E5WA 3DBLB 2CFSA 2QD5A 3PFGA 2EBHX 4GUAA 4NH4A 4PYOA 2DETA 2F62A 1NVBA 1KI1A 2SECE 4IIXA 3QVJA 1TTPB 4L1KA 1XOIA 4QUGA 5KUTA 2A0FA 2OFPA 1NM5C 2QMZA 2A9OA 1PEYA 2H54A 1JEJA 1E1QA 4Q1CA 1GKKA 4GPD1 4ZO4A 4BZQA 4NQRA 1KAOA 3C14C 1O4VA 1Q1AA 2XMZA 3ZDCA 3GDFA 5BORA 3NHRA 2G67A 5KDOA 1I2DA 1A50B 2VJKA 4Y6QA 4O02B 3GT7A 5KQSA 4DA4A 4WZ6A 1F7VA 1X1AA 2GD2A 1SUAA 4KEAA 2BEWA 3AP2A 1SBHA 4C21A 5C53B 1VCIA 1RM4A 2JS7A 2CDCA 4FKZA 2ASEA 1JTFA 4LY9A 2L69A 3ASUA 4RA9A 4OHZA 4A82A 1ZJWA 1AXEA 1V7CA 4P7KA 2WICA 4ZVLA 3MJCA 5GV8A 4JNCA 3R40A 4BHTA 2IVFA 1UKEA 4UHDA 2DPLA 3ABOB 3RSHA 3PCRB 2HF2A 2XQVA 5T8KC 3NTLA 4IILA 2FQYA 1JL3A 4LY3A 4CMCA 2OO5A 3ZJTA 4S1NA 3G8CA 1HYBA 3O8LA 1MQ8B 4NMWA 4PCLA 4U63A 3NNDA 3F9CA 1PT7A 4OIMA 4FMCF 5BRNA 5DI9A 5DHSA 2X2EA 4ZOCA 2BZGA 5F3WB 3CX6A 1NG9A 3KWFA 4ZTZB 3CONA 1U94A 4V0RA 1SBNE 3DL0A 4I50A 4TYWA 3VU9B 2Q0HA 4IWXA 2PMKA 4CMGA 1CQPA 2BZSA 3U16A 5ADWA 4L78A 3ONWA 3OA2A 2QQ0A 4ON9A 3P0HA 3FMVA 5CLFA 1SQ0A 1JALA 5FL7A 1RADA 1KRWA 1J1IA 2N1BA 3D8TA 1HG0A 1IU9A 1M7HA 3QYFA 4MQFA 1UXJA 4OYYA 2P3LA 4DCJA 2GYYA 3HZRA 3UENA 2SCUB 3DVRX 1OYYA 3R9XA 4RABA 4H7HA 2J7PA 4EFNA 1GGHA 3QU4A 4KXUA 4PFKA 2NZ2A 4TUYA 1HO3A 1PK9A 1E8DA 3FYUB 4GX1A 4HDSA 5EEGA 5BYJA 3WDLA 3K5PA 1RXCA 3MTEA 3DEJA 3WLHA 4C76A 5C7IO 2AXEA 4M3NA 5L3VA 2HN9A 1OX6A 3E2PA 4RTQA 1R0BA 1XKTA 2EZ4A 4K7JA 1C0IA 1F9AA 5AVQA 1WBJB 3RK4A 4L5JA 3TR5A 4LTDA 3ZHOA 4CKWA 4YWHA 5TF4A 2Y1XA 3EA0A 1L1RA 4X6LA 3S2FA 1EK0A 3BILA 2F43A 3JQ8A 3CW8X 2AYXA 4D92A 4EG6A 4RD3A 1H05A 1TMOA 2QJRA 5L51A 3I9FA 4UDYX 3ZI7A 1T35A 1HNWB 1H94A 2BUBA 1O77A 2YMLA 3WV4A 1XJQA 3MYYA 3K1ZA 4MPRA 3TOVA 3ELBA 5IJAA 1Q7RA 1UAAA 2ZR9A 3D1JA 5B3KA 1YI0A 1WNTA 2H52A 3G02A 3QRWA 5TSDA 1AOXA 4AICA 1N5MA 3R9WA 3PC8A 2AC2A 4LG1A 4CDMA 1TB4A 3HCOA 1VMKA 3GB9A 3GRKA 1RMYA 3D4LA 2GYVA 2BFNA 4G2NA 2XUJA 1QHFA 2PRZA 2MU1A 4MULA 5A7GA 4ZCRA 4IDHA 1B1CA 3HACA 3AB3A 1K7XB 2NU8B 4LSMA 2FU5C 3AG5A 3HCFA 1YZFA 3DLBA 2VQSA 4LBWA 2Z04A 4FT2A 4LCBA 4FMDB 1THZA 5KQRA 1JFTA 4YRPA 5IABA 2V0GA 2XTAA 3DE0X 1UF9A 1SBZA 2HLDD 2WUWE 3ETCA 3PDHA 3PXAA 5AHKA 3ZDQA 3I45A 3DMRA 5EJ2A 1CFJA 3I6BA 4QLBA 1VGRA 2PVPA 2HSJA 2RKOA 2WTAA 3AFOA 3P97A 2F64A 4EK9A 4LJ5A 1HYQA 4O5AA 4Z7JA 4TKLA 3M6XA 3ED1A 4LYJA 4G24A 2FH5B 1ISHA 2FZEA 3HCPA 4H6VA 4PX9A 1LBHA 3CV3A 3JQAB 5IT4A 2AUTA 1N2EA 1X0XA 2J0UA 2F9LA 5JTUA 3TVYA 4Y6SA 5KVAA 5CT5A 3T5BA 1HKUA 1PJBA 1TYEB 3DBHA 1GD1O 3GL9A 2QL5A 1FS5A 3H5IA 5G53C 2NU8A 1CLUA 1WX1A 3ACCA 4BZPA 5HS4A 2NQTA 4OSEA 1GTSA 2F59A 1UK8A 1FW6A 1ZVVA 2DF8A 3KJHA 3V4VB 3AWDA 2RC6A 3H5LA 1Z28A 2H4YA 4JSRA 4NU8X 3NPMA 3SXUB 4ITRC 3DAHA 4J0EA 3L8CA 4QYXA 4R8RA 1F6WA 2Q5JA 1T24A 3F8WA 4K26A 4HNVA 4RKRA 3VR3A 1G5QA 2F4NA 4R16A 1QNLA 3G9UA 1RJ9B 1BE0A 1QB7A 5ALUA 4ZEMA 5L3QB 5EE3A 1M0TA 3NBYC 4PHTA 4BNLA 2O5EA 2SHKA 4QVIA 3DO6A 4HSGA 3PEYA 1ORTA 3VC7A 4HGNA 4WNYA 2AJLI 2UYOA 4XQ9A 2BR4A 1Q0HA 2CHGA 3AP1A 4BNKA 3UXEA 2C2YA 2RGEA 4QYMA 3HDTA 2FZCA 3CB4A 1TPZA 2EBFX 3FDFA 3T1VA 2D7DA 3R7FA 2D5LA 2HH9A 2NTVA 2IHTA 1P77A 3BTUA 4TL7A 5L7TA 3UJAA 3W90A 3IO5A 1ICIA 4EB0A 1YWGO 3Q85A 2JAPA 3TDMA 1QF6A 1H1DA 1WXXA 1WMSA 3NC1C 4XWGA 3CZ5A 1NVUQ 3BD6A 3RNOA 3X2FA 3JD3A 3BIOA 5EP4A 4HRYA 5D3MA 5JLAA 3C4JA 3V1NA 3CG0A 1HFJA 3WLMA 4WXHA 3WS7A 1B23P 4D9IA 3U1TA 4DSUA 1I1HA 1DCKA 1PWHA 3SHQA 5B58C 3MGKA 3DUFA 2XZDA 2IDJA 4WJLA 1Q7CA 4RFSB 4ZEOA 3OWHA 5KYKA 3I1IA 2JKVA 3LYHA 9LDBA 1XA3A 3T5GA 1E5VA 1SD2A 3DKPA 4FGSA 3TI7A 2C54A 2OBYA 3LC2O 5JDIA 3WWPA 1TU3A 1C0LA 3EIEA 4PPFA 2WDZA 4LWQA 3O82A 4LDRA 4EGCB 3G8YA 3JYNA 1XQWA 4H18A 4KXQA 3OBBA 2ZRKA 2BFMA 1ZM9A 2F48A 4JELA 3ZE1B 1S4MA 1GPLA 3PFNA 4DS3A 3IQFA 2GEVA 2JJ2D 3E53A 3V8BA 1YA8A 2J9FA 4IJQA 3VV2A 1ZNQO 3S44A 3UZUA 1RPAA 5HM6A 3ZWAA 1J4AA 3G9XA 2F8SA 5LQDA 3K16A 3C8ZA 1PJSA 3OVMA 2H31A 2B1IA 5HCNA 5K8CA 4OIFA 1NTRA 4RPIA 1ADBA 1Q0PA 5EE0A 2Y1CA 1RC8A 3ZTTA 1KFJB 4GPEA 3S28A 5AUQA 3QW2A 1MHTA 4NABA 2REOA 4HBGA 2QN9A 3EVEA 2QD1A 4JJ8A 2OHFA 3P8ZA 4JR2A 2HDNB 2H1WA 3EWSA 3OTIA 1MU0A 4EVQA 3L8DA 3NYRA 4WFJA 4WZBB 3H5RA 4MIOA 3LTNC 1ADCA 4URXR 2JI4A 2ZPUA 1SZPA 4I1SA 3WX0A 3DPSA 2Q6TA 1PTJC 3H18A 1BDMA 3K2QA 1VPDA 3KR0A 2ZRFA 2QV7A 1B7GO 2WIKA 2XCQA 1PR6A 1I9GA 1V7ZA 4RMHA 3UV3A 4CG2A 3AHHA 5DM1A 1V16B 3M81A 3SX4A 4CN8A 3AI1A 3OQIA 4I46A 4OKNA 4RLSA 4UEOA 1O87A 3KSRA 2DR3A 3FNGA 3HBNA 2R60A 1ZN8A 3DZDA 3T12A 3QMWA 4B71A 2O23A 5CNMA 3GGCA 3FI9A 1QNFA 4AD8A 3ROPA 1U9IC 3EASA 3FIJA 3WICA 2QVGA 2HB6A 1VYTA 5LJIA 1Z5OA 4GYKA 5H3HA 2JA1A 3HFSA 5KJ1A 1K3UB 4ONEA 2XJ9A 3OZRA 2DSTA 4R6WA 1C9NA 3HYTA 4B4OA 3C4QA 2FPIA 1URPA 5AYVA 2CNDA 1QGOA 1L0BA 1U99A 1WHSB 1ZONA 1GZ6A 2WR8A 3D7LA 4Z7QB 5DMHA 5KNLA 1NBWB 1U3GA 1FDVA 2RSLA 5A6VA 5A9SB 4WK0B 2QQGA 4UQOA 1DLIA 1UJ5A 4D81A 1U7PA 1NYQA 1H23A 2QVBA 2ZJ1A 4HXGA 1SUBA 3KT8A 3DMHA 1Y4DE 1E9AA 3HYNA 4FJ2A 3SZGA 4EB3A 1IJFA 1Q57A 5IC6A 1L7NA 1Y1PA 3S2EA 1RABA 1KR5A 3A04A 4I4NA 2WY2D 3BQ9A 1O6GA 3OF2A 1N1EA 4JLVA 3TXXA 2X0JA 3UHPA 4EAAA 1SKAA 4OCZA 1GL3A 1T1GA 3T7KA 2ZEJA 4LJ4A 1GZHB 5T6MA 2DHEA 3GLGB 1RBQA 3QNWA 3S2SA 3WLKX 4ZRNA 1O2DA 4GYJA 4E5VA 1ABFA 1RI4A 1NI4A 1XUOA 2R4UA 4I9UA 4IO0A 2VDKB 3ABQB 4BO8A 3DEAA 1KK2A 5BV0A 1ISFA 1QZZA 2R5NA 4XDGA 3W5CA 3C7KA 4CDNA 5E3IA 5FIUA 2YXEA 2OZEA 1DO0A 1TQ6A 2Q45A 4GXTA 1TK2A 3Q8LA 2V03A 5GONA 3RSLA 4L72A 5KX5F 3MLEA 1I3OA 2ZRGA 3VZRA 3ZHCA 5LUBA 5IH3A 3M6AA 4HJRA 3BXEA 3R41A 3ZWNA 2W8BA 3MJ4A 4EDFA 1T0JB 2YIJA 4AMYA 3F74A 4MQ5A 4YRLA 5EJ6A 1OJLA 2JFZA 2EW8A 1HURA 1OI2A 2DJIA 2IGTA 3B52X 4JB2A 821PA 2O7RA 1YRBA 1E2PA 1SZCA 2QRMA 3FOCA 2A4MA 4FVTA 4V3BA 1RI2A 5D5QA 4GQBA 5J2TF 3RJTA 4HUTA 4EEXA 4C7XA 1XU7A 2VTBA 2PKQO 1WDMA 4XAQA 3VAAA 4NPAA 3MT8A 3RC3A 3K0AA 4GNKA 4BKRA 4RL6A 2ZIFA 3MPOA 5KSWB 1PEKE 4EOGA 4QKQA 2ZJYA 2W6JA 4L4XA 5EUMA 2XQKA 3DBHB 4P92A 1ETHA 2RAVA 3AU9A 1CJSA 3W2IA 5JOQA 1GAJA 4TZ0A 3TRFA 2AJDA 4IIJB 1KJYA 2CFIA 2QTCA 2XCSB 5ED0A 3LZDA 1UEXC 4RYDA 4N7JA 5DNDA 4M8KA 1I7LA 2QTVA 5TPWA 3UWDA 1UM9A 1QAOA 2IYSA 4L9WA 1OXVA 1RQ7A 1MEOA 3EEYA 3QJGA 3TL2A 1JT2A 4PTLA 3TQRA 4F4FA 5FHQA 4AI6A 3NEPX 2JIBA 2V4MA 2HJHA 3WYAA 2WKWA 3R20A 1Z33A 2Q3MA 4TSRA 1CR6A 4ASUD 5K3OA 1KEVA 2HHCA 3DTYA 3OKPA 5FWYA 2VTBB 5F7JA 2CXRA 4LVUA 4BMOB 3V7WA 3C48A 1ADJA 4G86A 5IH7A 2JA2A 4F06A 4QOEA 5BSHA 2IHVA 3JZAA 3QXSA 2G8LA 3RQIA 4CHGA 2X0FA 3O8NA 1BRTA 1A8SA 3NOXA 5CIWA 4BFZA 2AE2A 5CFLA 1YUNA 3UYLA 2OB1A 3HKCB 2B92A 3TINA 1KH1A 1CDEA 1XXLA 4WFKA 3UG7A 1F9EA 4D42A 3IAFA 2JLBA 2D3TA 1EESA 4IHJB 4W8OA 3A1FA 1E4OA 1FXSA 4YJHB 3LYUA 5FFMA 1DO2A 2GXUA 2P75A 1XJ5A 2UVPB 2YJ4A 2R84A 4I8DA 1M3SA 4MAMA 4AKEA 3GJ6A 4I3GA 1AKTA 2GCIA 3G17A 4V3CA 3IRUA 5AWFC 4XUEA 3TNFA 3DVQX 3SKYA 3QUAA 2WWIA 1ND6A 3WLLA 1QYDA 3K0SA 3JWPA 2GK3A 3A58B 4QXQA 1GUAA 1MXHA 1DG1G 4B48A 3T0GA 2FGKA 1DPFA 2XSZD 3VSDA 1Z83A 1N5OX 1RKVA 4BGIA 3CGWA 2FG5A 5EN4A 4IXNA 4CETA 2Q5EA 3PSAA 5C35A 4K03A 3FNEA 2DKOA 4L2IB 4KUEA 2VCHA 4L9AA 3IEKA 1F2DA 1F2TB 3RS2A 3WNBA 3OLQA 4RELA 4GPIB 2LVBA 4XWTA 5JAHA 3ZCSA 1ZL0A 3KPJA 1RRMA 3N0WA 4LDPA 5GOZA 3FHOA 2HBZA 5EGSA 4YV7A 1GUFA 4D02A 2UU9B 1XTZA 4OHUA 4YLGA 1NV9A 4DDVA 5MGBA 2B99A 1YRHA 1Y8AA 1KZ6A 2PXCA 3E0QA 1XDDA 2PTHA 5C80A 1JMKC 1KOLA 2IXGA 3R0ZA 4FS8A 1X1QA 4RU1A 4FSXA 1L4BA 1PYDA 3PDJA 1FDOA 1DHRA 3VU1A 4CKBB 1BHJA 3MCTA 3QU9A 4J6FA 3SKVA 1QFYA 2OBNA 3P0JA 3ACBA 4HGRA 5F2OA 2PT9A 1R50A 3OZFA 4P4UA 3BIXA 1UDCA 1IFXA 1E64A 5CGZA 4F11A 2EHJA 3MN1A 3OZAA 1XZQA 3EZNA 4YJGA 4PQGA 4FOOA 3P94A 2IV3A 2HJGA 1G4UR 4IO1A 1X6VA 3GNQA 5JAUA 5E3JA 5CA0B 3QEBZ 5KOJB 2I4RA 3WL4A 2ZWOA 3AJEA 5EMLA 5K03A 4J1TA 4DREA 4ZT4A 1OXSC 4IQ8A 3WIEA 3GVHA 3ZX4A 2H9YA 3R8XA 2VRWA 2A67A 5DLDA 2IYQA 1MH9A 3JY6A 5ALQA 5JRJA 1WEHA 2Q8NA 2IXFA 3JWIA 2HLHA 3UMCA 3GCGA 1GTJ1 1L2TA 1NU6A 4J2OA 3RC7A 3UJDA 3C0KA 4HH1A 3FHCB 2PKRA 2OAEA 2OWDA 3UKJA 1T10A 1B26A 1U4SA 2PM8A 1D03A 1R9JA 1UL1X 2F6RA 2Z6VA 3NIWA 3QK7A 3GEMA 4BFYA 2HEGA 4BC0A 5KJCA 4I9NA 1WCV1 2GAIA 1GLGA 1K27A 3CSUA 3U7HB 4MR8B 1JQLB 1AKWA 3EEQA 4TMYA 3PXGA 1IATA 4FUQA 3U3RA 1TCUA 1IWPB 1GHTA 2FSIA 4I4TB 4YAKA 2AZXA 1E1RD 1L6RA 2YW9A 3F9RA 5DBFA 5JJKA 4HS4A 5KYXB 1D09A 1Z2DA 1YQQA 4AJOA 2EWMA 3EGXA 2FMUA 4ZAGA 2KMLA 5DNEA 2OFFA 4WCFB 5IW8A 4KZPA 4ZU1X 4DCGA 4LF7B 1UT6A 5THKA 1S8AA 1WM1A 2YL2A 3Q8XB 4X90A 2XWJI 3REOA 1V1RB 2HPZA 3L4EA 3PE6A 1IUNA 2C31A 4N5IX 2TMGA 4X93A 2CN1A 2GOYA 1GT6A 1RU3A 5CJJA 5FUXA 3CBGA 4WXMA 2AKEA 2ZYWX 3O1JC 4FPXA 4DV7B 2I80A 4Q4HA 3LKDA 5D7BA 2XA9A 4MR7A 4LDQA 4MHOA 1NP3A 1U6KA 3S29A 4DDHA 4GF5A 3TIIA 2Q1TA 3L92A 3GEPA 3QELB 4RMIA 4EHIA 1K6MA 3H9QA 2GDZA 5BNFA 2PX6A 2QRKA 5C32A 1UZLA 1YC5A 3NFYA 5A5DA 3AY6A 1E7SA 3P9YA 1VRWA 4JXZA 1RQNA 1HTTA 2EGHA 3O1HB 5CVJA 3EGEA 2A78A 3NTQA 4BB6A 3LO8A 5I5EA 1FSZA 2DBRA 5HWSA 4G5GA 1IXSB 4ZC8A 2HF8A 1ULTA 2I67A 4ER0A 4HXYA 4K6KA 1PUXA 3UPDA 5JZVA 1XJWA 2OFWA 3K7EA 5TX7A 1JHMA 2AG1A 2EFEB 1KGSA 2P77A 2PKWA 2YWBA 2BLNA 3LP6A 4G97A 4R41A 2P4QA 2V7WA 4XWYA 3M2TA 3E5NA 3N07A 3E84A 4A8PA 3GLIB 1KO1A 3LTEA 1NE7A 1DZ3A 4I8IA 4MV9A 1EZ1A 4X84A 2EQ5A 3UQYS 1XROA 3K5HA 4U9UA 2RHJA 3CRZA 2FR8C 2XVYA 1KJ8A 4Q7MB 3EAGA 5CDFA 1ZQ1A 5JCXA 4KZKA 4J43A 5HILA 4PGFA 2WIGA 1KORA 5F4BA 4ZYLA 4KMSA 5JUWA 2CKMA 4DMMA 2BTEA 3AZOA 1NE2A 3EXHB 2X5NA 1JG1A 5MN6A 1FFXA 1CUGA 1YFKA 2JJYA 2LCFA 3AR8A 3TIXB 1C1XB 3SZ3A 1N57A 2XCIA 1E6EA 3FMIA 3OUUA 4M1OA 4WZAB 4DF3A 1FY2A 3H9JA 1QIGA 3ZU2A 4C7OA 3KKPA 3Q72A 3DDUA 3ZS8A 3MIIA 2XIJA 2X6RA 4XD2A 5FEUA 3IOBA 3OT5A 4YRMA 2E5LB 1RPZA 5D00A 3FYUA 2HLDA 2H2IA 2FRDA 2GD6A 2QE7D 2VUHB 3F8SA 4I5GA 1KMNA 3K70D 5BXYA 1QHSA 1EA5A 2WYWA 4D97A 4F6RA 3ELDA 3ZHUA 2QMUA 3NM6B 3VUFA 5LP1A 3M33A 1A8IA 1ML4A 2V9ZA 3CLVA 5AW2A 1YTLA 1D4ZA 1W34A 2R00C 1BFUA 3OQNA 1XL0A 2HMAA 3IDSA 1G6KA 2XEXA 1ADYA 4NBUA 5DGHA 5FOUA 2XYGA 4NZZA 4B31A 3VX4A 5ITSA 5KB3A 3PQ7A 1SELA 4KAXA 1XC7A 4LOHA 4CCWA 2R48A 3JQ6A 4HFMA 3TNJA 4XX0B 3GEBA 2DH6A 2J8ZA 4KIJA 1E2NA 1RWBA 2GZMA 4PZUA 4WY8A 3L1JA 1E98A 4HYYA 1QQ5A 2Z1MA 4HLQB 4OYHA 1N2XA 3MOGA 2W4QA 2A57A 4WACA 1G64A 3HWSA 1H3FA 4DCOA 1MVOA 5SYMA 2QMEA 1W0KD 1M6NA 5GOTA 4DR6B 4CR6A 1C4WA 1YR2A 1JF8A 5B7GA 5JS7A 2UUCB 4FGZA 3P0FA 4EA7A 4KK4A 3VPXA 4E2ZA 4B3RB 1VC2A 3F7NA 4PC3A 1L8LA 1TI7A 5HIMA 5E9JA 3HUDA 5FWYB 3BIWA 2I34A 3V97A 3W77A 3L0OA 1O97D 4H6PA 3C3JA 3EGDA 3HRIA 4MRSA 5B7NA 5I51A 2HO4A 1RJWA 4TTJA 4CI9A 1S4QA 2P2ZA 5FQOA 1TT7A 2JAHA 4MV7A 3KQUA 3NT2A 1KPGA 2CNWD 4G5HA 4IRXA 1YJBA 1RKXA 2PS9A 3SE0A 4ZFNA 1Z3IX 3E3OA 2SCUA 5B4VA 5F2EA 3L2OB 4RCVA 1VG8A 2LR0A 1KBOA 4JGBA 4S1PA 2BCJQ 5CNKA 4ED9A 5HGJA 4PXYA 2EEPA 1OFIA 1QMPA 1X7ZB 3AIKA 2XXAB 3RJ5A 1EM8A 3WHPA 1O6CA 3IXQA 2OXTA 1IY2A 3CVOA 3FVTA 3H75A 3PEEA 2ZTMA 3MAGA 3ZGOA 1Z3CA 4QBFA 2QV0A 3W3AA 3SLKA 3EAFA 2BM9A 4D79A 1P18A 4LOKA 4K9RA 2HL6A 3DJYA 4RXUA 4ZEXA 2JAWA 2EV9A 1GVHA 3SVZA 2PUDA 1FFEA 5TMBA 5JJBA 1RAFA 1ZNWA 4QHYA 1KO8A 4Z9XA 3T4EA 3NNSA 2DT5A 4ETMA 1R6BX 3UATA 2W6ZA 3PNYA 3V2UA 1H5QA 1YB1A 1UODA 1V5IA 2P2CA 3DW3X 2EATA 3I64A 3VJKA 4YCCA 2HSWA 5FPHA 1CR2A 4MINA 4TQUS 2R79A 2ATEA 2VXYA 4BP9A 4YCAA 3E7DA 4H3SA 4KLNA 4CQLA 4U2FA 4DQXA 1L5YA 3KZVA 2XB8A 4G8CA 4U7FA 3ZXUB 5AQ1A 3D4BA 3ICCA 1Z35A 4X24A 1QTQA 4ZARA 3BDIA 1EHIA 3QYAA 2I3GA 1BYUA 5EHNA 5F52A 3S81A 1R0XA 1DBIA 4ZCTA 1K9SA 3FVQA 3NBXX 1TGYA 1RXYA 4YXFA 3LOPA 2VAVA 3N2LA 4HB3A 4M1MA 3RVLA 3W0LB 2GZ2A 4F5WA 4W1PA 1GGNA 3L7CA 4IDNA 5H9WA 5LR6A 5JSYA 5JMOA 1TRHA 3K0FA 1DLJA 3FFBA 5LN1A 4A73A 1IHDA 2Z08A 3JWGA 1JXOA 1Z2CA 2VP2A 4P5DA 3HDJA 3R3VA 1V95A 3BXGA 5ALPA 1HLFA 4A10A 2QTVB 5BYAA 2VJPA 3E8SA 5L7WA 2C0CA 2MSWA 4EJ2A 1E96A 1QDEA 2GVNA 3TG8A 4IZHA 4ZXPA 4DIBA 5IBCA 1QLWA 2RMKA 2UZ1B 3VBCA 1SNYA 4O1HA 4O4LA 4E0BA 4Q4AA 4U9HS 2BFOA 2ZS9A 3MERA 3QELA 4JLUA 3UCXA 4QTXA 1K86A 1TTQB 1CUXA 1ISIA 2VDQB 5E7IA 1ZRMA 5HDBB 4D8WA 1V8PA 4YA6A 5G1PA 3THXA 3UMRA 4L0MA 1WUJS 4TS4A 4OOEA 3M7IA 3WBBA 3M6IA 4LNAA 1QIKA 2TMYA 1T9CA 3FCUB 4R71A 3TAUA 3ESYA 2OD7A 2ESRA 1J70A 1MC5A 3AM5A 2QTRA 2O9JA 4IL5A 1QHNA 4EMSA 4RTRA 2PSJA 4GMXA 4IF4A 4KE8A 5DW0A 1IEQA 4M22A 4M83A 3I01A 1A7KA 3TQOA 2Z95A 2R97A 3ILHA 4LGVA 4OQPA 1UP7A 4H4DA 4Q7LA 1W47A 1ENPA 2NO9A 2QJOA 2VXOA 2YZKA 3KOXA 4GI5A 3UHAA 1ABEA 4GGOA 5AW7A 3ZD6A 3PENA 3DE2X 3RREA 4POAA 2GFHA 4O3MA 3SC3A 4KKVA 2BLLA 1D04A 4PYRA 1LLCA 3HEBA 2SBTA 6REQB 3ENNA 2ENUA 3TQIA 3LPLA 1G8PA 5IWCA 1A9QA 1JKXA 1O94A 1U5CA 3GYBA 3JQBA 1E62A 1P9NA 1R9NA 3KPYA 5FBWB 1IAVA 3IB6A 2WFZA 3IJRA 1EJ2A 5CT4A 4UTZA 3TK1A 1HMPA 2CFTA 1U2GC 5JLJA 4HMOA 3FCCA 1USUA 4PSCA 2YMQA 1PUIA 3G2IA 1J1ZA 3GG2A 1LPPA 3M9WA 4HWTA 2I3BA 2CLOB 4RJIA 4C22A 1WULS 2BM0A 2RI1A 3QA3E 3EK2A 3KHUA 4NK5A 1EEXB 5EUBA 2RAFA 4LFCB 1YUBA 2CZCA 4JLKA 3AOGA 4NV3A 5ENZA 2Z1NA 2C96A 3N6XA 1FRZA 3G8BA 4PXSA 1BXRA 2IU6A 2C92A 4LI0A 3EZXA 2RKBA 5F1PA 1BH6A 4PZAA 4BMPB 2AX3A 2Y0CA 4O4HB 1IBKB 1Z0KA 4ZWNA 1IEVA 3E1KA 1L7QA 3P5BA 3PGJA 4XCVA 1DKLA 2MSNA 3A0UA 1JG2A 3T3EA 4ZCSA 4ZVNA 3U37A 4DR5B 1OJ7A 1MTOA 2X5OA 3CXRA 1KDYA 2Y0EA 5C1BA 2WI8A 3GLHA 4CKBA 4DCSA 4N82A 4WKBA 1AT1A 2PL9A 5JNWA 2JDID 2IX9A 4XM0A 1XMVA 1A82A 4N7MA 5HBRA 4C29A 2MINB 4KPGA 1E0DA 2A92A 2G04A 3GLQA 4MLDA 4R5MA 3D54D 3PFCA 4AJ2A 4QJ4A 5ALRA 4LY6A 2X3YA 2XBUA 4NDZA 2AL7A 4L51A 3CZPA 1Z88A 1NI5A 1U4OA 2CGEA 4ZMBA 2WU8A 3OLWA 1J49A 3AVTA 4DEXA 1AQLA 1P45A 4W7IA 4BC1A 3DEKA 1FUYB 1N2SA 3FCAA 4EGSA 3U4MA 1KH3A 3RJMA 5LMCA 3COPA 3PV0A 4M1TA 4CG0A 1NVWQ 1E3LA 4EPRA 2HQSA 5DYNA 4C1NA 5J1TB 3KOWA 3TOXA 1R12A 4PLTA 4LFAB 2FG6C 4BYMA 2C7BA 1S01A 2C94A 1T43A 1C5KA 1GQ2A 1OA0A 1QR6A 3AF1A 1E4VA 1KI6B 1MEJA 1O94D 3KCQA 4L4ZA 1OH7A 4A6PA 3FCYA 1PL6A 4C5CA 2GEJA 5KYUB 4UDXX 3OJFA 1NR1A 2PGLA 4LJSA 3WWEA 3OTGA 4KYTA 3V4LA 3KJZA 1M34E 2HDWA 5A3VA 3BGVA 4JJ6A 1K66A 1DAMA 1K4MA 1A5ZA 3GIDA 3ZK9A 1BG6A 1ORRA 4HQOA 1O89A 2YUTA 1Q3KA 3L8HA 1UBEA 2CCJA 1H4SA 4NARA 2IYUA 3HVIA 3DXXA 1IOLA 2AOVA 3WNDA 3ZW7A 4MB6A 1YCFA 5IFKA 4RTOA 3AL2A 3M1AA 4RK4A 1BCRA 4B8WA 1C7ZA 3ZHTA 2A7QA 2G08A 3QF4A 3LPNA 4NTZA 1CP3A 3EARA 1V9LA 1Q1GA 2ONJA 4TQGA 1JDBB 3V1KA 2JGFA 3GU3A 1FRNA 3A14A 3ECAA 5A4FS 3AF3A 2EYQA 3OKAA 1NW7A 1FDRA 2NVBA 4BLTA 4R3NA 5AI8A 1HK7A 1PR3A 2ZBRA 3B7PA 4BO9A 2JCSA 5JTTA 1HYHA 1H2AS 1RZVA 3MTJA 1WLSA 2OGUA 1SQ5A 1KZYC 3EH1A 2V6IA 2QD3A 1BKDR 1HYGA 1ULHA 3ZKAA 4UEJA 2DX7A 1S1MA 4JKIA 1E92A 1CUBA 1CJKC 2JIMA 1K7CA 2QAJA 4CQMD 3FMFA 1YFZA 3TSAA 2AN9A 4M38A 1E7MA 1AXGA 1W581 1KIMA 3HI6A 1P0MA 1PNOA 2F8LA 1XRNA 1V41E 4P53A 3W05A 4EW1A 1OVMA 2J3QA 3HBAA 1I1OA 2Y99A 3AQIA 4IICA 2O2ZA 4XOUA 3EUAA 3DVAA 3UIEA 1OBCA 4GVLA 1JAYA 4KFRA 1I3LA 2XA2A 4K87A 1J42A 5E6RB 3G1TA 4ZVQA 1T0PA 5PGMA 4HT3B 4FFLA 3OIUA 5AVUA 2JLRA 2QR3A 3OPVA 2P5TB 3DO5A 3NJ8A 5T4EA 1T6NA 3ASZA 3PNQA 1VLLA 1YACA 1FIUA 5AI0A 4TS9A 4X65B 4LJYA 2G07A 3KWLA 4XLTA 2XDAA 4DY6A 3GEDA 2WHYA 4MH0R 4ZV7A 2BI8A 3OEEA 3AONB 1UMBB 4MS3A 1G9XA 2PX3A 4Q9DA 5FPYA 1IOVA 4GX2A 4X1KA 4CF5A 3FWKA 1G7CA 1H6CA 2BKLA 1F2UA 2GVZC 3MWDA 3H2YA 4RAOA 1GZSA 5T64A 1O9BA 4YJFA 2D5BA 1Y1SA 3I9NA 1M2WA 1Q6ZA 2NTJA 4U2CA 2AJCA 3OOWA 4K81B 4DA9A 2H2GA 1UJNA 1OLSA 2B1GA 2NVOA 5DM0A 2WUDA 3GX1A 4JCOA 1RJFA 1QS0B 4FFWA 4B3BA 2VDMB 2EZ9A 5SICE 2VUTA 4AQYB 2RHOA 2VNJA 4K1LA 1PAUA 4UOZA 3MOIA 1KZ4A 2ROQA 5B2EA 1U3FA 3S27A 2X1LA 4PBSA 3EF1A 1KTVA 3L4BC 4KTVE 4QPNA 1U65A 2UZIR 5KREA 4AXBA 5D6OA 4R1MA 5EXSA 3E7WA 1P3DA 1WF3A 2A9VA 2Y9MB 5D87A 3SOZA 2A7XA 2JVJA 1AN0A 1TZJA 1GGFA 1VIAA 3CLRC 4P2GA 1X1DA 4FXPA 1B76A 4EG1A 5IKMA 4NCBA 3OZDA 3DOFA 4PRYA 3RRFA 2VCYA 4MVJD 1RCUA 5ICMA 2B21A 3BK1A 4AG3A 2DWQA 1KEEA 3QXJA 5TY0A 5BN4A 4DJDC 5I4IA 1QF9A 5AKLA 1BIFA 4H6XA 1VYVA 2ZWIA 3PLAE 1ECBA 4B3TB 3K2EA 1WUTA 2KM1A 2X0NA 2ZTVA 3FTNA 3IFSA 2OENG 4FP9A 4N9WA 4GSKA 4MR9A 5JI3E 5FV7A 2HQRA 1PYGA 4I14A 3ZHSA 1RHUA 2AA3A 3DZFA 5BP7A 5FOQA 1LRJA 1Q91A 1NQXA 1NJSA 2ZSIA 3BCUA 1RJDA 3HE3A 3ITNA 3PUVA 4YY3B 3HCRA 4ARVA 5EQTA 2R9VA 3G59A 1ECLA 5EUCA 2UDPA 3F3YA 5B3AA 4KPYA 2YYAA 3QKTA 4LJ7A 4D0GA 1T9AA 4LF8B 5DOZA 1D6JA 2OXCA 3RUCA 1SG9A 3A4VA 1RWNA 3PQ3A 3D4PA 1P2SA 3U80A 3WQBA 4XJSA 1L5OA 1MABB 2DKFA 4REMA 3ZXIA 1EWQA 2B6NA 3CSSA 1E3DA 3C6KA 3EQ6A 3GAZA 1GPUA 1OQAA 2IXAA 3EF0A 1NX9A 3HP4A 3SIRA 3T9BA 3ZKWB 5EKTA 1G17A 4OKIA 2BGUA 1GYQA 1VL2A 3M9LA 1QH0A 4OREX 3H1TA 3KB8A 1Q7TA 3WIVA 4PRZA 1OZAA 3KSAC 2QZZA 1YHYA 1J20A 4BLRA 1Y4SA 1V96A 1XQ1A 2NZYA 4ZP1A 4MO9A 2EL7A 2IX3A 4V0LA 5JD4A 5F78A 1YS9A 4TL9A 1X15A 5H9VA 2XT0A 1NXQA 3K8ZA 3MQ2A 3QVXA 4IG4A 4B9EA 3IUQA 1FC0A 2OZLA 3FFAA 1RM5A 3K9LA 2IBMA 4QPZA 3ABRB 3MJTA 3OI7A 4ZO9A 2FG7C 4G1VA 4KMRA 2DGDA 2MYUA 3OJCA 3ZHXA 5KWEA 3Q2IA 4Q5IA 3CU5A 4XE5A 1QO7A 4IDOA 3RVNA 1EX1A 1QIHA 4C2BA 1DAIA 2G3YA 4EM6A 3UT5B 1U1DA 4LXQA 4RW0A 1BDIA 1T2EA 5E2AA 5CG2A 4RADA 4ZCMA 2P9GA 4FWBA 1H69A 1N0HA 1OXXK 3EZYA 4LAFA 4U2GA 3MUFA 3K09C 1X7YA 3SAJA 2O50A 4CCAA 1CE8A 4W5RA 3TAXA 2F3TA 2MYPA 1B0UA 2AFIA 3IQEA 1T1RA 3R4VA 2PGIA 4OL0A 1AKQA 3UV7A 3UW1A 3NV9A 5HA5A 3GLGE 3PK0A 4ZI7F 3G0BA 4E15A 3ZE0B 4MARA 4RULA 4OBBA 2NUAA 3T15A 4F85A 1VYUA 3WNCA 2GA9A 1OFTA 5DLEA 4Z4IA 3N76A 1Z6TA 4BMSA 1A77A 1PBTA 2P6MA 3ZIAD 4PGGA 1E1RA 3B6IA 1UPBA 1Q50A 1DEAA 2BMFA 2TS1A 1JYEA 3HB5X 2PGAA 3K9QO 5DGCA 5ALJA 5FLYA 4EIWA 3SVLA 1EGAA 2Q27A 4XRGA 1FFYA 1UPCA 4DQKA 2I9KA 5KJFA 1AZLA 4NMXB 3REQA 5TS3A 2XTMA 4JJGA 1QH8A 2GARA 3CN9A 3L7BA 3MGBA 1CE8B 4RZQA 2H1CA 5CCEA 1LSOA 1VSBA 4IJMA 3I09A 2CSXA 1MIOA 4HGQA 1DU4A 4R2XA 2AFIB 2X5XA 3RUPA 2ZP1A 3SQXA 3I04A 2K6GA 4OLFA 1GN9A 3MD0A 2PBZA 2BCGY 2QEQA 5CGQB 5KNBH 1ZM3A 1S7CA 4EDHA 4B4UA 4FD2A 4JVLA 1Z06A 3IEPA 1BMTA 2JGLA 3LOQA 1TRKA 4ZYVA 2QJTA 3MZ0A 4QFDA 4GKKB 2O1XA 4UCFA 3F6BX 4JD5A 1Y63A 1AZTA 3WJ2A 2Z6UA 3SEQA 4WCFA 3ZWYA 4Z9FA 1MJNA 3EFHA 3ZU3A 5IZCA 3PFIA 4YAIA 1Z6PA 4DDWA 1NXVA 1ZH4A 1OIVA 1CV2A 1YR1A 2WUVA 3IXMA 5FAXA 4JYMA 4EARA 5K51A 1PFWA 3O7MA 4OHPA 2Q3DA 2PX8A 3ZS9A 2FUG6 4JK3A 4PAWA 3O4VA 3CY6A 5J43A 1JDPA 4J0HA 4M9ZA 3EX7C 2O54A 4QC2A 4DJAA 3I62A 1E9DA 2B36A 1UKBA 2D1RA 2QN6A 3KOMA 3KKZA 2QX9A 4I6JA 3L0DA 2E9SA 3JQ9A 3IVRA 2Q3JA 3PX2A 2HHHB 1VBMA 1EYZA 1GAWA 4HTFB 2O0LA 1JR3E 1QQTA 2JRCA 4AIRA 3DBOB 1U28A 2GCOB 3CEHA 1UP4A 1QIDA 2HA2A 4X7BA 4XD7D 5G2OA 4B5LA 3QPUA 1MX5A 4O2BA 4AJEA 2VA9A 2P6PA 2WAOA 2HMWA 4NZ9A 3V6LA 3OPYI 3U13A 1RWWA 2YFQA 2YFYA 3ZDFA 4BATA 1Y80A 2XUAA 1AQJA 4YAUA 1FF9A 5ALWA 3HKCA 1HTWA 2WP0A 1CPYA 3GPDG 1EINA 2ECPA 1FJHA 3K1AA 4AJIA 2ZAOA 3WE7A 3CPJB 4JP3A 1A4XA 1Q3TA 2BI4A 4XZ3A 1N9GA 2NXNA 4LDNA 4DZZA 3WK5A 4H3VA 1ODKA 3NONA 3KQPA 5KOHB 1IDN1 2XVXA 4Q3DA 4ZOBA 4AO8A 4CLXA 1YIDA 3RYFA 1II0A 1YIOA 2DE0X 3PIIA 4W5JA 4BVEA 4LF4B 5J4KA 3F6RA 4Q18A 2OECA 4TXLA 5ICGA 2GM5A 5TPZA 1EFRA 3AJ8A 3CZ9A 5GZ3A 3VO8A 2ECKA 4X62B 2GXAA 4NNJA 1EWTA 3GEIA 1TZKA 3TLEA 1NQUA 2ZCJA 3SX0A 2VJAA 2XUKA 2ZJOA 2WMOB 3IVCA 3PNSA 3O8BA 1QP4A 1M67A 1ZMOA 2XMSA 3Q87B 4J29A 4OMUA 5IK2A 3NUGA 3U3OA 3K5WA 1LFDB 3PKZA 4Q39A 1RT9A 1EUDA 3D0RA 3NWPA 1UMCA 3N3BC 4P58A 5FTJA 1L7PA 3VU3A 3ZWWA 1NUQA 2YQ4A 3JWEA 1KC1A 3K9CA 4EUSA 1YMUA 1Z39A 5FOSA 3S70A 1IN1A 4H7KA 5G40A 4ZI2A 2GPAA 1IN5A 4OI2A 4NBKA 3HU2A 4TXJA 1P5JA 3QEAZ 3AVYA 2NW6A 4HXEB 4NFSA 4QQRA 4YX9A 1HQCA 4XXHA 1P60A 3R09A 1G8YA 3RUEA 1ML3A 1X19A 2VTDA 3SDBA 4BWGA 4Z4HA 2QYTA 4FX5A 4I1OA 2ID8A 4JWTA 1D9ZA 5GIOE 4R6XA 1J0EA 5LKRA 5CLGA 5FQNA 1P1CA 1ZDMA 4GG1A 3VH4A 1TC2A 4EGJA 1YA6A 2OLKA 5BN3B 1UKCA 2C2ZA 1LC3A 2KYRA 4ZOLA 5LQNA 1R5OA 2VCEA 5GM1A 2AJBA 2CF6A 3HRKA 3JQBC 4H7JA 4JB0A 5CCDA 4JDUA 1T15A 5LQAA 1IQ0A 4EVSA 3PTAA 5HE9A 2VP5A 3TTVA 2QMHA 3ZWQA 3EVZA 1SRQA 2PSEA 3OP1A 5DGXA 4G0OA 2H51A 5BW6B 2TRSB 1QZUA 2QP3A 1N6IA 4FYJA 1L8QA 4FYWA 5CB4B 2CW5A 3FGOA 1XDWA 1UDBA 1EDZA 1KY3A 3RF6A 3CEMA 2X9VA 4TQ9A 221PA 3LWDA 1CETA 2L17A 2N3ZA 3ESXA 4ZOAA 1IB0A 3RHZA 3QLEA 3ZXSA 4M1ZA 5ALKA 3UH0A 3R3WA 5FJIA 2JD2A 2YJTD 5KOIA 4OX9B 4H7FA 4PG5A 5FWNA 4M6WA 1SBTA 3DBRA 3N53A 4OPMA 1EFPB 4LKOA 4DJEC 3PDIA 1YJCA 1D8AA 2XMCA 1TMGE 4JX8A 4EVIA 4CM1A 1SIOA 2D0DA 3UW3A 1J0DA 1K8ZB 4Q3CA 1KJ9A 1K5HA 3AR4A 4PO9A 2D06A 3QFSA 2ZSHA 2WF8A 3U3DA 4MRPA 5KYXA 3Q9SA 4UQLA 1G59A 4RS4A 2JJQA 2H48A 2GBIA 3U56A 4X3OA 1L5HA 3WNVA 2QG6A 2PD6A 3MTDA 1NXTA 2F1OA 5ALNA 1DJLA 2N1MA 621PA 1VLHA 2VXCA 3E7XA 4MVJA 1CY0A 1UBOS 3GLVA 1MV8A 1M6VA 4QG3A 1LK7A 3WGQA 4CUZA 4LC9A 2W42A 4DV1B 1NLFA 2OOKA 3WLAA 4MS4A 3PC6A 1OV4A 4B82A 2PE5A 3FF4A 3TS1A 6REQA 1OZHA 1GQFA 2B4TO 2CEKA 3E9CA 3GT3A <