3UJPA

Structure of mntc protein at 2.7a
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
274
Chain Sequence
TEEKKKVLTTFTVLADMVQNVAGDKLVVESITRIGAEIHGYEPTPSDIVKAQDADLILYNGMNLERWFEQFLGNVKDVPSVVLTEGIEPIPIADGPYTDKPNPHAWMSPRNALVYVENIRQAFVELDPDNAKYYNANAAVYSEQLKAIDRQLGADLEQVPANQRFLVSCEGAFSYLARDYGMEEIYMWPINAEQQFTPKQVQTVIEEVKTNNVPTIFCESTVSDKGQKQVAQATGARFGGNLYVDSLSTEEGPVPTFLDLLEYDARVITNGLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mn transporter subunit
publication title Arginine 116 stabilizes the entrance to the metal ion-binding site of the MntC protein.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803
molecule tags Metal binding protein
total genus 77
structure length 274
sequence length 274
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01297 ZnuA Zinc-uptake complex component A periplasmic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3ujpA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3ujpA02
2OSVA 2YNMD 4TKVB 5KOJB 3U7QB 3AESB 4MO9A 4XPIA 4TKVA 4MLZA 5KOJA 3AESA 5CR9A 5FLYA 4HMOA 1TOAA 2PHZA 2XY4A 4UDOA 3AEQA 4H0FA 1QH8B 4WZBB 1QH8A 4WZBA 4WESB 4HN9A 1PQ4A 4WESA 1M1NB 4INOA 4TKUA 3LHSA 1M1NA 3MWGA 4LJSA 3EIXA 1EFDN 1K75A 4G07A 2YNMC 5CX1B 4UDNA 1M34B 1QGUB 5CX1A 3UJPA 4PM4A 1M34A 1QGUA 2XDQB 2M6LA 1N4AA 2XDQA 2WI8A 5HDQA 2QI9F 2AFHA 1KAHA 4FNAA 3ZK9A 3GI1A 4WN9B 3BE6A 2PS9A 4WN9A 4OVKA 4XPIB 3AERB 4FI3F 5KHLB 2RG7A 3AERA 4OXQA 3MFQA 5M29A 3R5TA 3HJTA 4LS3A 3AEQB 2X4LA 4M7OA 4K3VA 5JJ5A 3EIWA 3TNYA 3AETB 4TKUB 3ZK7A 2Q8QA 4HMQA 3AETA 2R7AA 3HH8A 1XVLA 5M2QA 2ETVA 1M1YB 3MD9A 1M1YA 4WZAB 2R79A 4MDYA 4WZAA 2XV1A 3MINB 3TEFA 2PS0A 1ESZA 1KARA 3MINA 4BBPA 4UTPA 1H1LB 1K2VN 2AFHB 5JPDA 4DBLE 1H1LA 1MIOB 3MWFA 1K7SN 1MIOA 2MINB 4B8YA 2MINA 2PRSA 2XUZA 2WHYA 2M6KA 3HXPA 3PSHA 2O1EA 3TLKA 4NNPA 1N2CB 4IRMA 3AEKB 2Q8PA 2XQVA 1N2CA 2XH8A 3AEKA 4MX8A 1QH1B 2OGWA 3NU1A 1QH1A 5GGYA 1KAEA 2PS3A 5B58T 5JOQA 1FP4B 4PAGA 1FP4A 1PSZA 4G09A 5GGXA 3R5SA 3U7QA 3K1AB 3LI2A 3PDIB 3AEUB 3PSAA 4ND8B 3K1AA 3PDIA 3AEUA 4ND8A 5M3BA 4CL2A 4WNAB 3BE5A 3ZTTA 4OXRA 4H59A 5I4KA 4WNAA 4FKMA 5BVGB 5KOHB 5BVGA 5KOHA 2AFIB 4NNOA 4UTOA 4GICA 2AFIA 4HMPA 3CX3A 1G20B 3G9QA 1L5HB 4INPA 4N01A 1G20A 1L5HA 5M34A 2OV1A 4FILA 2OV3A 3ZKAA 1G21B 5BVHB 3ZK8A 1N2ZA 5AFSA 5JG7A 1G21A 1N4DA 5BVHA 5HX7A 1K0FA
chains in the Genus database with same CATH superfamily
4JVNA 3L02A 2QDKA 3QQPA 2BEVB 5KAMA 2WJ3A 1M2VB 2CXHA 4NP6A 2VK2A 3OMLA 1H6AA 1NR5A 4XXHA 2QPOA 4WD3A 5K0NA 3VTKA 2ZUBA 2JLVA 4DG5A 2B8NA 4DNXA 1E92A 3MT0A 2CXQA 3PCTA 4MWTA 4V3BA 5IEBA 2CNNA 2WEKA 3VDMA 1NW4A 1QZXA 2DLCX 1U4SA 4IS3A 3L7BA 2C2GA 4ZXPA 1E2HA 2JIZD 3RVPA 1KF0A 2QJRA 1T3LA 4PNPA 1VCMA 3GPDG 1CZHA 3NLLA 4FLEA 4L4SA 3QVMA 1WHTB 3GRRA 3GGPA 3T9BA 3WOHA 3LHDA 1QGUB 4LXXA 4C6SA 3DTNA 2EX1A 1HE4A 3H7AA 3AILA 4OYYA 4R8KA 3T61A 5BXQC 2WSYB 3R75A 4RDXA 1JWLA 2EL9A 4ARSA 4BB6A 4Y30A 3WVNA 2RHOA 3V4RA 5K3FA 1ISIA 1VJ5A 5TXGA 2W4QA 1QBGA 1QGAA 2BFWA 1FPMA 1WF6A 4WCFB 3QXJA 5IVKA 3PNQA 1DQSA 4AZ0A 3NJRA 5EP3A 3AY3A 4QUDA 2H65A 4JMPA 1E2IA 4LJ7A 2AJTA 1JVSA 3W8NA 1RQLA 5JJ5A 1J8DA 2DHCA 2O7QA 2XT9A 4HKTA 3K8YA 3I58A 3B9BA 4PZZA 1ONBA 5I7UA 1M2FA 3NNNA 4BNZA 1NVWQ 4KB5A 3SDZA 1L1RA 3ZDYB 1DT3A 4GI2A 1OTXA 4L5IA 4LSZA 3RM3A 4BFUA 5IM4F 2NLOA 3HN2A 1DXQA 2P4QA 4HUJA 1EWYA 2J0QA 3E23A 3B7WA 3I37X 3AOGA 3COWA 4J16C 4YMUA 3FUXA 3WLNA 1BA3A 4QKQA 4CKEB 3FFXA 1RJGA 1F3OA 3MT9A 1QH0A 5MN5A 3R5FA 5CFPA 4IIDA 2NO4A 2DUUA 5ENDA 5CHEA 3C8DA 1ZINA 4D99A 1G59A 5DGDA 3O90A 3C45A 5KEIA 1T1EA 3SX2A 1CUXA 2RHGB 4ZA2A 4KI0A 4E5NA 1KMIY 1OGJA 1PP4A 1NDQA 4MVJM 1E9SA 3MBOA 3CC8A 2CLIB 1LJ8A 5E38A 2PRIA 1L6IA 1Z0IA 1J2YA 1J09A 3PDCA 3L7IA 3OFSA 4FWTA 4REQB 1B6SA 5JC1A 5JJLA 5CTJA 4PSUA 3DGFC 4PSVA 4R84A 3U62A 1NN3A 1CULC 5L95A 1ZD2P 3HKCB 3HVJA 3UF0A 2FE1A 5EVJA 4MEJA 2H2IA 3VU9B 1K97A 1TKRA 2XPCA 1VCNA 2XOEA 3O4HA 2ID4A 4UE2A 4XGKA 1E89A 2P35A 5BXYA 2I9KA 3BERA 2OLEA 3TPZA 1ECFA 2FSUA 1WB4A 4ZOLB 2B25A 5B2ZA 5K0GA 4HGPA 2Q2VA 3OZSA 3URKA 4ZVKA 2WT9A 1ACMA 4PPGA 2B9VA 3AVUA 2NG1A 2D1SA 2Q4EA 3MQFA 1A97A 3W2GA 1PT5A 3OU6A 4H6PA 2DPLA 4EYSA 1JIIA 3AX6A 2CBZA 1XTRA 4YV1A 1MO2A 3OPVA 2AYYA 1THGA 2GYUA 2O2CA 2ERYA 3FDJA 3WDLA 2J0UB 5BR4A 1GP2A 3KOUA 2PDAA 5LQNA 2A59A 3OT1A 3JCZA 3C7CB 2XCTB 1QRAA 1W52X 1XTUA 3N76A 3ID6C 1EUDB 3G5MA 3VKHA 1E4OA 2VNIA 1TEXA 4IDQA 2G1JA 4DNQA 5CFOA 4QQFA 3SZMA 1KU6A 2H11A 2I0FA 1YBMA 4UPVA 1R4ZA 2VHUA 2ORYA 4UBNA 2W9XA 2JATA 4KXWA 3UENA 1GRVA 3DOIA 3L01A 4JLBA 3SR3A 1GGMA 2IYOA 1XX6A 1RFGE 2P5SA 3GEBA 3L8ZA 3KK0A 4HWKA 4KGXA 4WJKB 1A27A 1WUYA 1Q0RA 3QFHA 3VI3B 3MBKA 3W0LB 4BNMA 4P58A 3UB4A 2C82A 4RD1A 2QN2A 4OQZA 4EW3A 2EF0A 5JCXA 3ADDA 3B38A 3GN1A 3MJSA 1VMEA 3RCBA 1CBUA 1ORTA 4C0AC 2I67A 2H2DA 4MVJG 1LC3A 1TK2A 4JOSA 5ADWA 2IS1A 1J0XO 3GLGE 4HH1A 1PO7A 1Z6PA 4S2UA 4FDVA 1P39A 3QEBZ 2YBEA 3KUKA 5ALMA 4LVCA 4BHTA 5AI5A 1O5OA 6ADHA 1ATIA 1AGYA 3H8JA 3BMOB 2AFHB 4M0FA 3K1ZA 4GOLD 3WGVA 1BX0A 3QHQA 2ID9A 4OKSA 2P7HA 4Q4AA 4RHTA 4CDRA 1QZZA 1SVUA 2IUUA 3R2JA 3W6PA 3U5TA 1W88B 1JX6A 1MW8X 2Q3CA 1OFGA 4UQLA 4W6ZA 3OECA 2IE0A 3QXCA 3FMVA 2IYEA 1R4MB 4FSDA 4S35A 3VR5D 2WU1A 4ZCRA 3TZCA 5TRTA 2IZZA 4K9QA 1ULBA 5H68A 2AL7A 2ZTMA 1NOIA 2IK8A 4L2IA 3LWNA 1RHUA 1TQDA 3W6UA 3FPBA 5IJAA 3NHAA 4DSAA 4IFIA 1L1QA 1RWVA 3WIOA 3EC1A 4QOJA 2RH5A 3CUTA 1K63A 1XP8A 3OZGA 2CUKA 5G0SA 4JBNA 3DXFA 4UTNA 3BZBA 2H1LA 3STHA 4K46A 4B81A 5CB4A 2FWAA 1BZYA 3GY0A 2VH1A 4B34A 1CUSA 2J5KA 4KQ1A 4LF7B 3LQKA 2O7NA 1YS2X 3GT3A 2UXBB 4JQCA 3RFUA 2ZPUA 2OHXA 3UBTA 1OH6A 4HUQB 1GRNA 1R5BA 1OB2A 1C3OB 4NBWA 3A4NA 4KBYA 4NV3A 5EFOA 3BA6A 4KN9S 2GQ0A 5DXJA 2XZOA 1GA4A 3NG1A 4GVXA 4HQFA 4V3CA 3ESZA 3HJHA 4ZGBA 1G55A 4U6NA 1U1CA 5KAPA 3RVNA 3TUIC 5HOEA 2WYVA 2VQFB 2REXB 5TS2A 3DFUA 3WLOA 1UANA 1Z6YA 4TV8A 4U4AA 4UEKA 4F6RA 4OJYA 1G5PA 3HU5A 2V45A 2B4YA 1FIUA 4PLZA 1M9NA 1KTIA 1PFYA 1A5AB 4D42A 2RGYA 3EE6A 1XQXA 4RVCA 2W93A 1HFJA 2BFBB 5EESA 2GPNA 1HEYA 1ISMA 3IQZA 3EW7A 4UDOA 4QGGA 5CBPB 1I4TD 5EL0A 2W2LA 3C43A 4IUDS 4QPDA 4URWR 2E49A 3JZMA 3L0SA 5DF1A 4US0R 5F33A 4J4TA 1NM5A 2E21A 1I6WA 2QTAA 1QGDA 4QTYA 2ZBFA 5CVEA 2NU8B 2UZ4A 4BMXA 5SY4A 4F8YA 2DJ5A 1M33A 2OBYA 2WG2A 2WJWA 3E3AA 3ED5A 4Z99A 3G0DA 2R6CA 2IEZA 3OF2A 1E60A 3LZCA 3RUPA 4B48A 4LY9A 1VPVA 2BM8A 3WLQA 2XCOA 4UE3S 2XGSA 5AKHA 4BMSA 4EPXA 1B42A 3RJ5A 1UZMA 2XE6A 3TI9A 5AUPB 4YRAA 4BGEA 4U2DA 3MMXA 1XEAA 4LK3A 4G1MB 3SLRA 1JNXX 2FX2A 4EI7A 1CQIB 3SZUA 3BCRA 3ZU5A 5C4IA 4CM8A 2CDCA 2XCRB 2Z6QA 1OH5A 4R71A 5AJYA 5IZ4A 5ARCA 4E30A 4XX0A 5BQ3A 4CETA 4YRIA 3WNQA 4M0EA 1CJSA 1GU1A 3C6ZA 5E7IA 1Z74A 2A7QA 1Z7GA 4JN6B 3FM9A 2AG1A 4R2IA 4ZXFA 1O03A 3OKCA 4Z4EA 4HQRA 3PDUA 3SJCA 2AEFA 1IOWA 3HU1A 3JARB 2V3VA 4EL0A 5D3MA 3IXQA 4GI1A 4ARCA 2IHTA 2XQFA 1Q7CA 1U8ZA 1FW6A 4CTOA 1KP9A 4M9CA 1UOPA 3UMGA 4XWKA 4ZVTA 4W5QA 3WK6A 4H3VA 4U7TB 2W42A 2IL1A 2H00A 2OAQ1 3FYUB 3OUZA 3R8FA 3BWBA 3GCWA 1EEHA 1KEWA 3LM8A 3WADA 1CJBA 2QL9A 5FI5A 5K7SA 1VSVA 2QAIA 1Z4IA 2O2DA 4N48A 2GO1A 2JPDA 2Q3FA 5K0ZA 3FZQA 2Z6AA 1XZMA 2Y0DA 3IDFA 5EXEA 4B3GA 1PK8A 5LMNB 2QP9X 5F5XA 4D92A 5T41A 1W8DA 1T0IA 2ZB8A 4NBSA 5A5DA 4K6CA 4HADA 1U2DA 4IIBA 2Y0EA 2H9YA 1W34A 1QMGA 1XTZA 3Q41A 1JSLA 4ZCIA 3CSUA 2QRJA 1KA9H 4NJMA 4XB2A 4RXUA 1K3FA 3NVDA 4J8PA 4EGFA 4L74A 5JOQA 4OX9B 4ND7A 3ZWOA 4DWWA 1YRQA 3IVAA 1D6MA 2FF5A 4LTDA 1CETA 2C04A 1EXWA 1UDRA 4KFTA 2PUGA 4HTAA 4DWOA 2DLDA 1JLRA 2VUTA 3F3KA 1KAQA 1PL8A 2OY0A 2HFKA 3KS9A 1ZN7A 3WFIA 3MF4A 4WXPA 5JE8A 2QORA 2JJ2A 2ZR9A 3VR4H 1ATZA 1RADA 2D5BA 2O1SA 4GRIA 1V5IA 3DDUA 5GM1A 4I3HA 4AZVA 4WOKA 1E3QA 4ZT6A 3S44A 2DECA 2YRWA 2YWHA 2RI6A 1E6CA 3M6IA 3MQ2A 1L5GB 2ZFUA 4AKGA 4EY4A 2V7QD 1L3BA 3FI0A 1J07A 3E1KA 3G2PA 4QFMA 3TQIA 4WXYB 3UC5A 4B47A 1TYDE 3QPAA 4HDRB 2ZIWB 4HLUA 1X80A 4MJLA 3TQTA 3NC1C 2ZIGA 1DC5A 1JA0A 1V9CA 2VP4A 4DIKA 1JDBC 3GLIE 4RHXA 1C0IA 2D0PB 1OIWA 3R9KA 2WAOA 4JUAA 1MXHA 1VJDA 4QYIA 3V97A 5AW4A 5IXYA 2ZULA 4FFOA 1ZJYA 2OMKA 3BCSA 5KUTA 3A6PC 4E11A 1QYXA 3DMFA 1H0HA 5DLYA 4MRAA 4JK3A 5J3JA 3IE2A 2Q9UA 4AO6A 4K2HA 1JT2A 3DOJA 3LBFA 2VPPA 1D2NA 2VP2A 1Q17A 2HIAA 1PR9A 2YXDA 2Q8NA 1IBKB 2V1XA 4B09A 4LYJA 3I0MA 5SZKB 1Z63A 4I4CA 4K0RA 5EHNA 1SZJG 4CODB 3RYCA 1BVYF 1PTJC 1WB9A 4HWSA 3QUQA 1CNMA 5EFZA 3T4EA 3FFBA 5TPWA 1SHTX 3E9MA 3NTXA 3VRHA 5HQ3A 3HM9A 3WKBA 3QMVA 1TX4B 1QG6A 2QWXA 2R3SA 2PQ0A 1E0SA 2GAOA 2X8JA 1ABEA 5CVVA 3ETNA 5K3BA 2MTBA 1RC1A 2R6R1 1RI5A 4IOLA 3KT8A 3MJRA 3RIXA 3AEQB 5F21A 2G0TA 1T8RA 5EUMA 3M89A 5DGCA 4BMZA 1U8TA 1CUFA 3QXHA 5A5VA 1UBEA 2PUTA 2YNMA 3LT1A 3QJYA 3U4IA 2IZ1A 4H18A 3TJMA 1R9MA 5BQXA 2QVXX 3LK6A 1WA5A 1UOQA 5DHSA 3IV6A 3WO0A 3LYHA 3MB8A 4WGFA 5KOIA 2V0NA 3A1EA 3U0BA 2C7VA 1O89A 3I62A 1UXOA 2ORWA 3TB6A 1UC9A 2ZIEA 4FFSA 4R83A 5EE9A 2ZYWX 3E48A 1I0ZA 2C9OA 1H1LA 3AL3A 5AI8A 5KVSA 2PYIA 2Z8XA 4BBJA 3L0DA 3W05A 2O2ZA 3IUEA 2IUEA 1MOQA 2A1IA 2BKXA 1GZ6A 1JSZA 3AJ8A 1JFTA 3EPJA 4LY3A 1AMNA 4KO4S 3D4BA 1QQ6A 3HL4A 1L7OA 5DN6D 3PTLA 4POAA 2P9QA 3I2KA 4YMLA 3PSHA 1IY1A 4UAGA 5JCPA 1CZNA 1WUIS 3DDNA 3MWJA 1MKYA 3O3NB 3P32A 4CPDA 4DT1B 4RZHA 4YACA 2A4MA 2ZRAA 1SHUX 1P6XA 3CUVA 4MTCA 2EF1A 5JAIA 4YTEA 1N8TA 3FNIA 5C1IA 2FG7C 4B6GA 1JHQA 2YHBA 4N5MA 1ECJA 1TZCA 2GN6A 1TZJA 4ND1A 1HG0A 2AXNA 1T43A 4E3ZA 4FZ3A 2GBLC 1SKUA 4HLNA 5K3AA 3ETGA 1W87A 4ECEA 5L8VA 1Z2EA 5HK8A 1QLHA 1DIGA 2CVPA 2QTGA 3KSRA 4C4AA 5LP6A 3WAKA 2O20A 1XCMA 2O52A 2CDNA 4OHUA 5I9IA 2JS7A 4JXXA 4IHJA 1CR0A 1TCUA 1KP3A 1IQUA 1ZHFA 3VO9A 3P8ZA 1VECA 1UXJA 2RHCA 1EP2B 3CO5A 4N5LA 4PLYA 1H3FA 1M8GA 3G2MA 4X92A 4L4YA 2FLKA 4IMRA 1L7EA 1Q0HA 3IT2A 4NG4A 3LTNC 2ZUFA 2X13A 3H3FA 4DZTA 2J7PD 1H2HA 1EE2A 3B13B 4MVCA 2FH5B 2LDXA 1CZRA 4WT7A 1ENZA 1PLKA 4MOWA 3ZWQA 2JEOA 3HCOA 2I4NA 1G41A 1K89A 1EFLA 1GUZA 5IAJA 2JZCA 5T3YA 1B8PA 1C1YA 1XA4A 2ODQA 3IBYA 1CDZA 3L6RA 3THWA 2QE7A 1PKXA 1TK9A 1G8KA 3BFKA 3SX4A 3WGUA 1CYEA 4BMDA 4WZBA 1W93A 4EJFA 3NWBA 3B8EA 3G7UA 1CVLA 3B3GA 4LGVA 4PTLA 2V74B 3M6VA 4GRAA 4TL8A 4AKSA 4YFYA 5IH3A 4AY4A 3OY7A 4MCHA 2W6PA 1BEEA 4D45A 2ZUUA 3H11B 4DDKA 1AHIA 2FN4A 4EABA 4TTVA 4RVDA 3M83A 2N47A 5DCYA 1HYEA 2EBHX 1IM2A 1W6UA 1X9HA 1LB1B 2XE4A 3H5RA 1ZH4A 3MJ4A 4MRVA 2QN8A 1GJRA 3CISA 3HQ4O 4WI1A 1EFRD 4WW0A 2D3WA 3ZGXA 5CITA 5BUCA 1BHQ1 1I4LD 1FDWA 3HP1A 4MW5A 4XFJA 2I33A 1EBBA 3WA7A 3D8UA 4XOUA 2BJHA 5EE5B 4FFMA 1U3UA 1U8UA 1Z4JA 1Z45A 3K15A 4TYYA 3CBGA 2OECA 2K4MA 3NDPA 2R751 2F59A 2Q62A 3HY3A 2OO7A 3D8RA 4I3FA 1WXEA 1SD5A 3G2JA 2HQRA 2XNKA 4LC1A 2B5WA 3HPQA 3JZFA 4BL5A 3RS5A 2IQIA 4A92A 1NXVA 1BE8A 1JPUA 3RC2A 3MNFA 3J7AC 2FKAA 4GKVA 3PGVA 5F2KA 1DQYA 1X1CA 1XTPA 1JHOA 3O93A 3OT5A 3PR3A 5E3IA 1UXGA 2OV6A 2R8EA 4MUGA 1V5WA 4TZKA 2PKQP 4X7MA 2ZQZA 3Q11A 2FW1A 2BGNA 3BIWA 1SVNA 1OGIA 2A5JA 2QPTA 2RK6A 4KWIA 5B3JC 5KDDA 2KW5A 2C5LA 1CJMA 3S5UA 4YJ2A 2IJGX 3DAOA 4U8GA 3RTBA 2XNDD 1XVIA 4WKCA 5ALPA 1L1FA 4KREA 3BRWD 5LA6A 4D43A 1GDTA 4DWJA 2XVZA 3EJWA 4FCCA 2Q7DA 1C81A 3SYRA 2B34A 2OCGA 3D5EA 2H3HA 2O1EA 1YULA 2VJOA 3Q9LA 4RD6A 3IIKA 1NXSA 2PWZA 4G24A 3CJTA 1HF3A 2C1XA 1L5YA 5ESDA 2OQ2A 4EYEA 3UBMA 4KYUA 3ZWYA 3SIRA 3OFVA 4ND6A 3QLVC 4OBEA 1W9HA 4BIMA 1FYDA 1KAEA 5HEKA 5JQGA 1SCJA 3B6EA 4Q66C 2XGJA 1RWOA 2RHDA 1VC2A 2FRDC 3DBOB 1QHHA 1BN6A 4WHMA 4W1PA 1OZGA 1NV8A 3VPSA 1EP3B 3D6VA 4IZOA 4NBRA 3K1AB 1HOTA 4YCJA 5GPBA 3L0OA 2REQB 1XZHA 4NECA 3T7SA 1YUMA 5K3CA 3ZH2A 3WOVA 1E2BA 4RA6B 4ZYZA 3AR5A 3A1SA 2Y1LA 4CM3A 1I3KA 4L51A 3VAAA 4HGQA 1GZVA 1YZKA 2BM1A 4DABA 3GRPA 3C5EA 4NNOA 2G82A 3CNBA 4IWXA 5HIMA 3ZD7A 3UT0A 1DG3A 1JEOA 1H6CA 4XR4A 5YASA 1B00A 2BP7B 4B76A 4LZJA 4LBZA 4C4RA 4H60A 5D1NA 3R9XA 1XGKA 1JEYA 2HJGA 4Z2YA 1OKKD 1EBFA 3ZDDA 1Z73A 2BMAA 4ES6A 3JAWA 2P67A 3H05A 2WJHA 2J6HA 3QNUA 4B2YA 4IIJA 3NHRA 5K4AA 1LV8A 2YN4A 3LC1O 5FYDA 2F90A 1BWRA 2NOAA 2BM9A 5B7GA 4Q4JB 5C37A 1YCDA 1QIGA 1ZK3A 1S9HA 3A9TA 2IF2A 4OOEA 1B6GA 5BN3B 4BKUA 2ZWVA 4FUTA 5A9TA 2C96A 4NMHA 3ZDQA 1AS0A 5I51A 4F0JA 3ZXUB 2BT4A 1FP1D 4EG6A 4CMEC 2EVWX 1UOEA 3G8DA 3OG9A 4Y6LA 5CK4A 1P9NA 4QO8A 2YZ7A 3LZDA 1UWLA 3MTGA 5F9HA 1NW8A 4R2LA 5BYKA 2QLJA 4NCBA 3W7VA 2QEQA 3CPHA 2OV2A 3FDZA 1GPMA 4N5HX 5CW1A 3UNXA 1DLIA 3KJIA 1U0JA 1M5TA 1KNXA 3I2JA 5DX0A 3RFCA 5FD8A 5KYWB 4GR5A 5TT0A 1WL8A 2QX9A 4CMIA 5LNK1 1KQFA 4BV8A 5CLIA 4G8CA 5BRJA 1X2BA 2IH2A 2G77B 5DM0A 2ZSEA 3H4TA 4X61A 1RCTE 5HMLA 5JYBA 3L1KA 3ZJ4A 4CMAA 2B30A 1TLFA 5C1PA 3JW8A 1ZGBA 2AIRA 4FYWA 3GGOA 2YJZA 2E89A 1JXMA 3IR7A 3K5PA 1QFZA 5L4LA 4MV9A 3LQQA 4KLRA 2W48A 4LA4A 4WCFC 4KPEC 3WL3A 1Z5UA 1IOLA 1D5CA 1U8AA 1DLJA 3WQHA 1P80A 2IUYA 1W581 3KXIA 4BNKA 5JMOA 2QK4A 5FKJA 2MYUA 1E9FA 1N9ZA 1R8JA 1XWFA 1HFEL 2QNRA 2VRCA 4IF6A 1P2DA 4RSRA 4XD7D 1YR6A 3WC4A 4R4JA 2O0HA 3B52X 4WKNA 2OCAA 3VDQA 1CUYA 1GZ5A 3SS8A 4NYIR 2QUJA 2V03A 4AWXA 4DIBA 3R7FA 4DCUA 4O2AA 3R7NA 4DM4A 3ESRA 4OQEA 1RYNA 3PRYA 4MA4A 5AVSA 1E1CB 5AOBA 5FADA 1JAHA 1XF1A 2KPOA 3QEOA 5J5CA 3ROTA 1Z2DA 1GUFA 3OHPA 4QU5A 3K0FA 4QLBA 2I6GA 3L7MA 3DNPA 5B37A 3KOOA 3JD0A 1VG1A 3FETA 1CY2A 2CFCA 2VJCA 4UM7A 3H5LA 3P9NA 2J41A 4XIYA 2PL9A 1CS0B 4IDDA 3RSZA 4AW9A 3IUJA 2HHHB 3IEMA 4URYR 4PC6A 5HQTA 1Q44A 3FHJA 4ND5A 4L02A 3LU1A 4C6TA 5AVQA 4AYTA 4MW0A 5BQPA 2OZLB 5FOTA 4JJ4A 4E09A 3QHAA 1A8UA 5TQ2A 4FE3A 1MQSA 2PH5A 3M5CA 2D1RA 4PG8A 1ZOSA 1WHSB 3TMAA 1VSUA 2G9ZA 1FRNA 1H5UA 2J7KA 2C57A 3CUYA 3MCUA 5KNBA 3PENA 4N18A 1ZESA 4H3HB 4PYMA 4WAUA 3O31A 1Q1QA 1ZAKA 2DPHA 3KWMA 1P74A 4RW0A 3IP8A 4JZYA 4TYNA 1FTGA 2ZCJA 2YWEA 1K9VF 4ZAGA 4G5QA 5ALOA 1YZNA 3V48A 1E0DA 1LVHA 2TMYA 2AXPA 3BMCB 3RC8A 1EFHA 3H04A 4J43A 4FQ8A 3DFZA 4JMLA 1EZ1A 1ENYA 4OJTA 2X0FA 1V3UA 1UKYA 1VRWA 4EEKA 4EHJA 4LPSA 3T5DA 3BHMA 2QL6A 2NW6A 2P9FA 4DQUA 4EPWA 3PQ2A 1XT6A 5EE0A 4MI9A 3AH8A 2IWRA 1IN4A 1GZUA 4N47A 5FX2A 2GEFA 3IS3A 1F2UA 1IK4A 2O0LA 1JKIA 2D4AA 3AU8A 3K96A 4GECA 1T4CB 1GPDG 2OKCA 4KAJA 3WLJA 3OZIA 2IS4A 4QQ8A 4IILA 3GB9A 4FDTA 3IR6A 1EFUA 1E94E 4UXHA 3JR7A 4UATA 4YPVA 3LAWA 3EGIA 1G98A 9ATCA 1M1NB 1QUFA 1S5PA 1GKIA 4JH0A 4KBFA 1M6VB 2PKQO 3B2EA 3GX1A 1BE1A 4TXJA 4ZPJA 3HVKA 1PFUA 2QRPA 1JLSA 3O8BA 3R0ZA 2H16A 2ZRMA 3UN1A 4YY3B 1RRPA 4OP2A 5AOVA 2PUCA 3RTCA 1FVOA 3NW9A 3W5BA 2QD3A 4XCVA 1DWPA 1YB4A 5KYGA 5TLSA 1P60A 5BOSA 5L3SA 1P8JA 2JNWA 3AEYA 4LCEA 4DREA 2EFHB 2FZCA 3KQQA 2JJ8A 1S9DA 5G2OA 2C3UA 1QFJA 4MKRA 5L51A 1EXDA 1NWHA 2WG0A 2GK4A 1RP1A 3BXOA 1Q2UA 3JVVA 4FFPA 1G8AA 1QJCA 2GAJA 3N8NA 1BHO1 4UU8A 3DBLA 1A7AA 2HOQA 3D7LA 1IFXA 2IY8A 4HD8A 4RMIA 3KEOA 2YJGA 1II9A 1MO6A 1O8BA 4JCCA 4RBNA 4GEKA 3RUIA 2BGRA 1GGJA 2CXSA 4KP7A 4PZCA 3FAZA 3DQZA 4JB3A 2X7HA 3RYFA 2P6UA 2GERA 1CU1A 3IP3A 3S2ZA 2ICAA 3KJGA 2C61A 2FR0A 2FSVA 3M6UA 1I9CA 2X0EA 1LD3A 1G2QA 4PPFA 9LDTA 5GVRA 4NNJA 5JS8A 2ZT6A 1P1RA 4H7HA 1OZAA 3RIEA 4DLWA 2HXYA 2DHQA 3ZY2A 3TR6A 4XUCA 3K9QO 5HS4A 5JPDA 1KJNA 2AR0A 4K28A 1RBMA 3FR8A 4QPNA 5BN1A 2IOFK 3PL1A 5CGZA 1O6BA 3LUAA 2G76A 3SIWA 3QX9A 2MINA 1YMQA 5E9WA 3U81A 1IYZA 4YQZA 4D3DA 2QYTA 2O3RA 2BF7A 2OCDA 1KZ4A 1Z6XA 3NKVA 3H5AA 4IH4A 4AJ2A 2KBEA 2Y0PA 4ZCQA 1GNTA 1MC1A 2CYBA 5LWHA 3MT7A 1O08A 4MYTA 3WLLA 3IH5A 1G6OA 2RH9B 4KBGA 3KD2A 3ZDXB 2R97A 5DMXA 5GOZA 4HB0A 2J32A 2AW3A 4G0MA 4J91A 3ZE9A 2CHUA 3L0ZA 1G60A 1QH1A 1IL0A 3K0CA 3L43A 4EGQA 4V1CI 5K45A 3DW1X 1PZFA 1IZ8A 1F9EA 1MBZA 3NOVA 4ER6A 4F72A 2VYNA 2ZRCA 5ALLA 2FPMA 3NUQA 3QNMA 3L1UA 3RKUA 2XD4A 4C1BA 1XPOA 4YAKA 2P0YA 4IJKA 1PJ8A 1YVEI 3AHHA 1F38A 1TADA 4FHEA 1F2VA 1YA6A 3GELA 1S6YA 1PVDA 4WH0A 4EUKA 4OL0A 3OJ0A 3V1MA 2IU6A 3LRXA 3DVRX 3OEYA 3GFRA 4LOJA 4WNAA 5FBRB 3GZTB 2ESRA 1FXUA 4AF8A 5JY1A 4IVNA 3NNSA 3DEHA 3GFPA 4A27A 5A4FS 2ZTLA 4IGIA 2BFCA 5IKEA 1KKLA 3N2GA 1ADCA 2UUAB 1EESA 1IULA 1F1JA 1K7FB 1J20A 2NP6A 2P3OA 3GJZA 1ZH2A 4IQ0A 5AI0A 3UWDA 2W2TA 2GJSA 3EXHC 1ZVKA 3CWQA 5CA0A 2VK1A 3LF1A 5DM2A 3RWMB 3K0AA 2QRKA 1OAOC 2HIGA 2ZBGA 4PSDA 3GEPA 2Y4OA 4BO2A 4ENVA 5HZKA 4KVFA 4P6VF 3AESB 3MRTA 3MXOA 3CNNA 4LYGA 4MR9A 2EOAA 3GA0A 4MR8A 4PBSA 4C30A 4WK0B 1DJOA 4IR7A 4HX2A 2XBMA 4DY4A 2HO4A 4MV7A 3UWOA 2V5VA 5FO0A 5KJEA 1EDOA 1UBOS 4JB8A 2QV0A 3UTDA 3GFBA 1C8VB 2RGCA 3EODA 1T5LA 4YEDA 1FRVA 1HM5A 3GFQA 3H2HA 1N34B 3UMFA 4JT4A 1F6DA 5COAA 4LV6A 2FPXA 2B35A 2G9NA 4NONA 4L08A 1W4ZA 4JYPA 4DCSA 4NVRA 4YAGA 1A95A 2BGTA 2I7DA 3IQWA 4WIAA 4CFZA 4R41A 1P1FA 1W7AA 1PD1A 4O4JF 2FG5A 4CL3A 4K0KB 2ZU0C 4CU2A 2JGAA 4Q9NA 3G2QA 3H9BA 2RSLA 3K5IA 2R66A 3WK9A 4JOBA 1RZRD 3DE3X 1U3CA 3LPMA 1A4RA 1SXIA 3LDGA 1S8FA 4IDBA 4QUJA 5BWCA 3ONFA 4HQ0A 4YQYA 2W2KB 1UBCA 4P81A 5U1PA 4CLDA 3TF5A 3K92A 4ER3A 1XE3A 4TVBA 3A3KA 2NPFA 3WBFA 4BO0A 4DG9A 5IZCA 4LFCB 3WAGA 3HABA 1BGWA 2YTZA 1ISJA 5BRNA 1XEXA 4YP7A 1A7UA 5K0JA 1I7QB 1Z4LA 5DP1A 1QG2A 3K9LA 2RK3A 4DPMA 4F2HA 2OFWA 2QM0A 1UJNA 1YQQA 1T8SA 1Q3HA 3C5WP 3TZHA 2Q0XA 1L7PA 4PRKA 1UDBA 1PHPA 4NS4A 2ZSHA 2B8EA 2X5JO 1GTL1 4KC0A 4NQZA 4IJUA 2IEDA 2QNBA 1SY7A 1EWQA 2NAFA 4Z3DA 3GR6A 2AE2A 4Q3KA 5BMVB 1S3SA 2JANA 2QGZA 4RHFA 2ZAMA 1OVMA 1KR5A 1MX3A 1PBTA 3UC9A 3V7UA 1E7WA 4QPPA 2H92A 1FNMA 2GF2A 3IOMA 3X1WA 2BSQA 2BDEA 4DJTA 3FCEA 4RKWA 1X87A 2P3SA 1H6BA 4U3JB 1H4TA 2BTQB 3GO4A 2FDXA 3GG2A 4E5PA 3K6SA 2Y1CA 2TYSB 2ZIAA 1HK7A 3AEKB 4PWZA 1H22A 2XYHA 3JQ7A 1A2BA 2HTEA 3PHBE 3OP4A 5GONB 4C6RA 4CUJA 1GRQA 1LNSA 3WMEA 2DHDA 3BQ9A 2LCQA 1N5OX 4FCVA 4O0MA 4R1OA 4OH1A 3ZWAA 1QQBA 5F64A 4B7ZA 1SKBA 4ZVSA 1YU9A 4HOYA 3WIUA 3DXXA 4G09A 5DYWA 2NU9A 3C3XA 3U7QA 4AICA 3PDIB 3PSAA 4O4JB 4M8IA 3WIVA 1OYWA 3R3ZA 5ICMA 2NXJA 3VOSA 3EXIB 4HFRA 4WTOA 5FLXA 3CGGA 3ECSA 4KR2A 1N5IA 4F21A 1K8QA 1V7PC 2IYNA 3EASA 1U0NA 2HBZA 2PFGA 4OIFA 3WGHA 3GRUA 1Y8QA 4RS4A 1J21A 1IEWA 3MTQA 4CIXA 4AS1A 1KI6A 2H08A 3DG9A 3PCXA 2L69A 3HB1A 3IBCA 1WVIA 4BLOA 4D82A 1LSOA 2I7TA 4MV4A 3UTCA 5CB4F 4BMCA 5BWBA 2YL2A 3VR3A 3DEJA 2C03A 1BNCA 3PNBA 3KKNA 1BX1A 1NVEA 1HKUA 3OIWA 3OWOA 3RVMA 4JBHA 4XQGA 5CB0A 2O1XA 4YJKA 4DBVO 3HZHA 4TN5A 4DLPA 4XQ9A 1J5EB 2DXIA 1U80A 1GLGA 4DSZA 1LPMA 4XPIA 5ILOA 3ZWDA 3BL6A 1PEDA 4X6UA 1A8SA 2PUDA 5E2IA 3ZY3A 4FQ5A 2VPYA 3BTVA 1SCUB 4RD4A 4EGAA 3HU3A 5D6NA 1N36B 5FTMA 4R5MA 3BH7A 4RVHA 4PLFA 1BE0A 1A9PA 1GILA 1ZD5A 4TV8F 1FTQA 1QCYA 1SA0A 3DV9A 4B45A 1A1SA 3QXXA 4CUKA 2GCOA 2O7VA 2ZB7A 5AM4A 2VKQA 4MZDA 4FK8A 4HXFB 4FNGA 4OSPA 1BKSB 5GIOE 4O33A 3FWYA 2AEEA 1LDYA 2F9LA 5HIAA 2WF7A 1ZGGA 1P0FA 3KPJA 3WK4A 1XJ5A 2PWAA 1JR3A 3TYXA 5LMUB 1EIZA 1S01A 3GJ7A 4DMCA 4BNTA 4L8VA 5FL7D 4JL5A 2WUDA 3IHTA 4URHA 5FNVB 1J0EA 2D3TA 2ONZA 2X3YA 4Q00A 2DRIA 1G291 4Y1RA 3OQBA 1KMNA 4K3UA 1JFRA 1GPYA 3ZCTA 1GTSA 4N0EA 3HFGA 3KSMA 4TUYA 1VSTA 2OFFA 2RAVA 4D1YA 1ZCZA 2WAYA 4TLMB 1DVRA 4KQCA 3WQBA 1BCRA 1P0CA 2XA2A 5C4GB 3S2EA 3BA1A 1F2DA 5IASA 3MTAA 4ZK2A 4QU9A 4MUYA 2OYRA 1V1MA 1XAJA 3ESBA 1FL9A 1CHDA 2OXTA 3PXDA 3OLZA 4WLOA 5ESWA 3ZXIA 1YJ5A 3DOUA 3IODA 2LBPA 5FB3A 3B1JA 3PX7A 1K27A 5BUZA 7MDHA 2LWIA 4HGOA 1M2OB 4BN5A 5GMOA 1XQYA 2OOSA 2WU0A 5LD2B 3UJ7A 1Q0LA 2JJQA 3KTOA 5IABA 2M6RA 2DY0A 1CZUA 4XYLA 3KZKA 1NQTA 3DBIA 3PUZA 4RFSB 4DRZA 1HTWA 3VC7A 3Q9NA 4PO3X 3VVBA 3H2JA 4CM9D 1D2AA 2BKVA 2OFXA 4U2KA 1KYYA 1Q0PA 3AW8A 4P54A 5B3AA 4NULA 3WWPA 2R0QC 1HX7A 2CMHA 3PEEA 4RPGA 1I3LA 1N2CB 1OI3A 2Q6VA 3AJEA 4HWGA 3V2GA 2I76A 3WNBA 3WZ2A 3OESA 4DA8A 5ISMA 1TT7A 3GGGA 1H2BA 1BMDA 4OYRA 1PGPA 1AKUA 2MSLA 4QFCA 1F8YA 5LZ4A 3AEXA 3NU1A 4HLQB 4AK9A 3KDSE 4ME6A 5EZYA 6AT1A 3F6YA 2ZI5A 3GLQA 4CKZA 1QO0D 4RSGA 1ID8A 4J76A 2E6UX 2SECE 3RH0A 3U49A 4GZMA 5LXTA 4UUNA 3RVKA 2HK8A 2Q1YA 2X1VA 3Q10A 2IOQA 3DSRA 1XV5A 1ETHA 1OLSA 1KY3A 1LDBA 3KOXA 2ZVPX 4KVZA 3QKSB 1I32A 1P3Y1 4OXRA 3U7RA 2YYZA 4AIIA 4CLRB 3EA0A 3MHTA 3BMNA 3DC2A 4N0DA 4B7AA 2XXAB 3AY0A 2Q3JA 1NBIA 1PX2A 1T6YA 2ZRGA 2FEAA 3MJDA 3ROEA 3ZWNA 1E7SA 4JXZA 4Q01A 1GZSA 3U7IA 1IIRA 4ACBA 4I81A 1S4MA 1IQPA 1DKMA 3FWZA 4JELA 3J80A 13PKA 3U44A 4MRMB 4LOHA 5JC8A 1DC4A 5FUWA 5I4BA 1ZK1A 3ZCRA 3TKYA 2R8OA 5FBQB 4I36A 1U2EA 4MARA 3RSOA 3FXAA 3GQVA 2F2TA 2HK6A 3E0XA 1YR1A 1FFAA 3FB4A 4OO3A 3OIYA 1J99A 4J29A 4QUGA 4DANA 4X62B 1TOAA 1ZX1A 1BMFD 5B6PA 1VJ0A 2ZIXB 1FTNA 1UJBA 3IOEA 4RE6A 5HG0A 1XXLA 1RM4A 1HFWA 3BSYA 4W63A 4C04A 1JGTA 4U0JA 4TWRA 4FE7A 1YUBA 1Z3IX 2OLJA 3IPCA 3LRPA 3RAJA 1IONA 5GOTA 4PLCA 4KK3A 2HMAA 3AJ9A 4K1XA 4BNFA 3G85A 1ZOLA 1PV4A 3KAJA 5KCMA 4LVNA 2YS7A 2WIKA 2ZJ1A 3G68A 3HI4A 5DK4A 1DDIA 5LMCA 2JKZA 1ANKA 4P2GA 2WPDD 4PRYA 1PFQA 1KTVA 1MAWA 1RKBA 4EA7A 5K09A 1ZAYA 1E2FA 4KODA 4QGFA 4MO2A 1X39A 3EXFB 4GLJA 3NPAA 5KYYA 4L75A 2CY0A 3L8HA 3A26A 4AM8A 4C20A 3QMPA 3AR8A 2P9BA 2C8KA 3K09C 3UXHA 4E22A 1CZOA 3NQ41 4DQKA 4OHXA 1JIUA 3ANTA 1N25A 2P1RA 3AFIA 5JSQA 3B1ZA 4OHFA 5BSFA 4F93B 4X95A 3DLTA 2XTMA 3LOUA 4PZLA 2GRAA 4UVIA 1H2EA 2DZDA 5K20A 4OQFA 4HNAA 4EAQA 4KWHA 3E5RA 1PE0A 5LZ2A 5KTYA 2AOUB 1A5ZA 3Q1KA 4HAOA 5A4DA 3ESQA 5JSZA 5K8UA 2QX7A 4Y2RA 4WBNA 1NQ5A 1RYHA 2JAWA 1OW3B 4JDUA 6PFKA 1E0JA 1SHLA 2GKSA 2UDPA 3IAXA 4N12A 5P8WA 2X22A 5AK3A 1TK3A 5DGIA 1AZTA 2WABA 3N8DA 3WLEA 4XIFA 3RSGA 3QY0A 1ZJWA 3EQ6A 3HU2A 1RRFA 4GQBA 1NUSA 3BPSA 2WSMA 5BMOA 4NFYA 5C1BA 4L4XA 5FP0A 2VJNA 5DOZA 2OBXA 2ZUVA 1G8HA 5JJIA 2BGIA 1ONPA 3OA2A 1GCOA 4X3CA 4Z0NA 5LMZA 1JRLA 5KTRA 3VNQA 2CUNA 1X2EA 3H5IA 3QU9A 2ZIFA 1BWSA 1U90A 1U5AA 1CD5A 5FYQA 3KFVA 2YMPA 3L1JA 2FR8C 4IIFA 3LLSA 3UATA 1G8SA 4G1CA 4EVSA 3KQNA 3RD5A 2RE8A 2KLBA 4HNVA 8ATCA 3R7DA 4GNRA 1ZZEA 3FWPA 5JAQA 2O8BA 2AEJA 1E32A 1XKTA 5ILGA 1HE5A 5A3JA 1NULA 5EWJA 3PKZA 2HPVA 5DISB 4EJSB 2XHEA 4MXDA 2QKYA 2NMVA 1EDEA 2D2IA 5TF0A 1F60A 2H06A 1MB0A 3M82A 3NV9A 3VNRA 2G80A 2PFSA 4FEYA 5H5JA 2FUG6 3O2QB 1QIMA 1X7WB 2A9KA 1IHPA 3R5JA 2IKSA 5CRIA 3CKMA 5KO2A 4XIGS 5LP6F 4X54A 2PUHA 3K1JA 2VWQA 1DV2A 4P93A 4IHJF 4Y2SA 4RM3A 1YI1A 4TL9A 3DL7A 3F2IA 4MYRA 4PONA 3RFXA 2GBFA 1A69A 1RJ9A 3OCWA 4GG1A 1V0JA 3GP5A 4LYYA 1AS3A 1SBNE 1ADJA 2FRVA 3BUSA 3O03A 3UWKA 3WGQA 1NG1A 1BSVA 3WLPA 3X2SA 3TNLA 4DNPA 3WWZA 4CV3A 5AQEA 2ONCA 1AZSC 2LUOA 4ZARA 3VGJA 1V16B 4RLFA 1TAQA 1A4XA 1MAVA 2DQYA 2RJNA 3HDHA 4BQEA 4E2WA 1BW9B 4PHCA 2ET6A 4RESA 1I3MA 4NK4A 1F8GA 1W4AA 1R64A 2V98A 1JFVA 3KVYA 4RGYA 2N75A 2YWFA 3TGLA 1OX5A 4KQIA 3I2GA 2MDTA 1FZQA 3KCNA 3KYIB 3LL7A 5AW7A 2W2XA 1UFQA 2R86A 3SAJA 3V7YA 3VUEA 3ZKWA 3B20A 3B2QA 1IWBB 1E79A 1NL3A 3N8KA 1Z29A 3OO0A 4QTXA 1EA5A 1ZMBA 2ZATA 5KSPA 2X5KO 5HVNA 4K87A 5M04A 3WYCA 5HCNA 4RV5A 3F3YA 5H4HA 4G5GA 1U9IC 3L7LA 5CNIA 2D06A 3L5OA 1DKOA 4GSLA 1T9DA 1W0JA 2UZ1B 3ENZA 4C4PA 4DMMA 1VYVA 1B0ZA 5AVKA 1IB6A 2X9LA 2ZI7A 3PQ8A 1MZVA 3ADCA 4O0LA 2WQ7A 2DE0X 3L6OO 1GG5A 4XIJA 2QTRA 3LV8A 4G81A 4CT4B 3GUUA 4F2GA 4ZKEA 3UH1A 1NXQA 1U7OA 4CVNA 4IIXA 1CJCA 3A6GA 4E5YA 3NM5A 4ZJYA 1J2EA 4GVLA 4URXR 5HM6A 5IJ0A 2Q45A 3B48A 4TTTS 4DFDA 2LVBA 4GHWA 3AFMA 4JC4A 4XRRA 4IRXA 4KN6A 4KIUA 2OB2A 1W47A 2Q1UA 3IT3A 4Q1EA 4DR7B 5EEGA 1JU9A 3RU7A 5K8IA 2GXAA 4WNYA 1KQ3A 1VL0A 3UKDA 5LOVB 1QR6A 3C3BA 4KYVA 1PS9A 1FFXB 4XX1A 4YJ2F 2VEDA 1ZA2A 5EWMB 5JCOA 3VC1A 2VN8A 3T12A 1P1IA 2HV9A 1U0TA 5LA6F 1J25A 1LDMA 4IXDA 1SQ5A 3C8ZA 4RTOA 1LBSA 1N9KA 3P2IA 1CFJA 1NSTA 1N75A 2PZEA 3T34A 3VSAA 1HR0B 3ODGA 4BWVA 4RL4A 1H2WA 1HWYA 1R4NB 1OWNA 3KQWA 4TOIA 3AZOA 2OSBA 1E63A 4D9CA 1T5IA 5I9NA 4NQRA 4JT2A 2X5NA 4A10A 4E7PA 3SZLA 3DM9B 4HNUA 4KLNA 3U6KA 4BRSA 5JQGF 5JDIC 2H48A 2YHIB 3EA5A 1FQOA 3QW2A 4NCNA 3EMDA 2A78A 4WLFA 3QKUA 4CEIB 3KCQA 1Z62A 1GRRA 1U5BA 4OBWA 3RAFC 3JRXA 1ORHA 4PGMA 3RARA 2OV3A 1NRXA 4J7XA 3GJQA 5JD6A 2XEDA 1PJCA 2C2MA 5GM2A 3MLBA 3TBKA 1WM1A 3D8NA 3NO4A 3LKDA 2EG9A 4RL6A 2HB6A 1YS6A 1I6KA 4ZVMA 4GLFA 3HDGA 3DD5A 4RGVA 1UM9A 3H8VA 4Q3CA 4CEJA 4HMOA 4PG4A 2W0MA 2C42A 1LI5A 2PE5A 3QM1A 2ZSUA 4YJGB 1X7ZB 4U7DA 1EVIA 4Z9XA 4XDZA 1JTFA 1BA2A 5ALWA 3KRTA 3AU9A 1CY4A 2W6JD 3PLRA 4TWZA 3M6MD 4P35A 2CV1A 1VXOA 1P7YA 1XCLA 3CIOA 3CF4A 4TTJA 3VU3A 3JRWA 3NHZA 4LMRA 4V39A 3FH0A 4J07A 5G0UA 3Q2OA 4IIJF 4TZTA 2IDMA 3MOIA 1HTTA 1JP7A 3PC8C 4PE5B 2NNWB 1A50B 3UZUA 4AWBA 3OD5A 2ID7A 2OCXA 3A4TA 3ASUA 2Z09A 1OF1A 2CV0A 1SUSA 1TO6A 4MNTA 4F3YA 1HE3A 3BK1A 2IXAA 3I6IA 4L95C 1VLMA 1NBAA 4BKPA 2PS9A 3OO1A 1OMOA 1C3LA 4OHMA 3CZMA 1P4HA 2H1SA 3MUOA 3K8ZA 4IH1A 5F76A 1BIFA 4R0MA 3W5JA 1XQVA 3EMBA 4LS3A 1QHYA 1RLOA 4I50B 3E2IA 1AN0A 4W9NC 3ZU3A 4YXFA 3C7AA 1JVNA 2E48A 1I51A 1QTQA 4MWOA 5KKAA 2WDPA 4KPGA 4DDHA 3GK3A 4W4TA 4GQAA 2R7AA 2DUNA 2HLDD 1TIPA 2Q3HA 3BFVA 3ZV5A 2EW2A 4NBLA 4RYDA 3HWX1 4TMFA 2R1TB 3JQFC 3IMKA 1NBMD 5J2UA 2QBYB 1JG7A 2IEIA 3DZIA 3HY4A 3HN7A 4NMWA 3TKLA 2MSEB 3QU2A 4FX2A 1JN0A 3I1YA 4AXXA 3VVCA 3ICVA 3Q40A 5CVCA 4R2JA 4J2OA 2YFHA 3U26A 1PVOA 3JZIA 3MWFA 1TJPB 3T7JA 2C8LA 4GXRA 1I2AA 2VDNB 1QH9A 3SLGA 2X0DA 2EZTA 3MJEA 4QNNA 3P52A 4NYMR 4DR5B 5MGNA 1L7MA 2J5RA 1VE1A 1BKDR 2P2GA 2NU6A 2PBRA 2PBFA 3LVFO 5E6RA 1V3VA 3NH9A 2QG6A 4NOLA 2GRUA 4EARA 5B4VA 1SCBA 1LRKA 1FY2A 3TSCA 4ZC8A 4N3BA 1VIAA 2RAFA 2IYTA 1W4CA 4YO8A 3OLVA 3FOBA 4KH1A 4PTZA 4BWFB 1E4VA 2E1RA 2P5YA 3CH5A 2ADFA 4JXKA 4EFKA 4KMSA 1PWXA 1C1XB 2VDQB 4UNPA 1IIBA 4YUXA 3AM1A 1GTJ1 1NI4A 1OWPA 2JIQA 1GL6A 4AI6A 3NUZA 1X1TA 2EP5A 2W2PA 5CD1A 2XMBA 3NFRA 1EZZA 2Y0CA 1WMAA 4R16A 2BONA 2AXQA 4XWGA 4MLDA 3GLGA 3A6LA 1HZZC 1P33A 3QBVA 4M38A 3CRRA 5D2CA 4LF6B 5AHWA 4RMJA 1VIDA 4TV9B 3W9UA 1E2DA 4BGVA 1KH3A 1Z36A 2ZYIA 2HU7A 3PXEA 2WM3A 3TLZA 3D6MA 3EGCA 1ENPA 5A3VA 3NBAA 5HNKA 4I5DA 1KEEA 3QXSA 3TTTA 3WWOA 2ECFA 2H2GA 1CJTC 4K9PA 4M22A 1AXRA 1Y80A 1C3VA 5LU8A 4Y2HA 4I2NA 5LZ5A 3EUWA 4IDNA 5LR6A 3K6KA 3BSFA 2Y1FA 2RB4A 3K3PA 1B2LA 3RC1A 1RMTA 2H3EA 4BNDA 1R12A 1K8RA 2J9FA 3C6MA 4Z7JA 1C3JA 3AUYA 4TKVA 4LX0A 2FUNB 1QAQA 4X85A 4Y6SA 5G41A 2AE1A 5AVYA 2CVHA 5GADl 5AKIA 1Y1TA 4M1WA 5FOXA 2EDCA 1R0XA 2J3MA 3W2IA 4EDFA 3QVVA 1I10A 1KBQA 1EGVB 3M0EA 5B3KA 4C2TA 1IWOA 1JHMA 3I23A 5L4NA 1W4BA 4J1QA 1G1MA 1JALA 1DPFA 1FUEA 3MWYW 4GBJA 1K6IA 2VT7A 1I36A 1N3IA 4F96A 3I01A 4HAZA 1Z33A 3TBHA 4IKPA 1HLFA 3TS1A 3ICWA 3T1HB 2DX7A 2VPWA 1QP7A 3LP5A 1TW3A 1L8LA 3SQXA 2ZXFA 5BUSA 1IVNA 1RYBA 2O0MA 4AZWA 1DOZA 2F3QA 2AUMA 2WZDA 3PUXA 1JLLB 4FEGA 1Z25A 5FNZA 1QJ4A 3AERB 2MSDB 1Y8ZA 1ZJ6A 3DLIA 3Q3JB 4FNOA 2BKUA 3FPFA 1NVGA 1L5MA 4XLTA 3W9SA 4N4AA 4MJXA 4BAGA 1XZCA 1NTOA 4QUHA 1JR4A 1KOJA 5H3HA 5DW3A 1DX4A 5AXAA 2OD9A 1JL3A 1QRSA 2I6FA 2LIPA 3MMPA 5EJ5A 2AKEA 3B3QA 2VA9A 4DV1B 3FZGA 3JATB 4B74A 3HLTA 4RYLA 5BNFA 1VHTA 1DRJA 1XRSB 2NZVG 2GN2A 3CZPA 4F2DA 4JB0A 4XKJA 5KREA 2PR2A 2V1UA 4MTLA 3A4VA 4KV9A 1UJCA 3DYIA 3W6OA 4O4IA 1Y37A 1FFGA 1FJHA 5EI5A 4BBPA 4HNQA 3RBZA 1Y8RB 4YV2A 5HKOA 2X8LA 2OESA 4Y2JA 4O63O 2C2HA 2QRHA 2X6RA 4HPXB 1IJEA 5UKDA 4PFKA 4XVRA 4FN4A 5DK6A 5IWCA 3FPLA 4D41A 3JD2A 3U1BA 2PUVA 1EK5A 2Y6UA 4ERNA 2NT4A 3EC2A 3PRHA 3WRYA 4CG1A 2DERA 3SGLA 2EWVA 3TLKA 3RRBA 3SC2B 2WYOA 3REFA 3VOAA 3QEKA 4ASUA 1CS4C 2PCLA 1V43A 1FS4A 1XEWY 2NYUA 3G0BA 1PV1A 4AAYA 1YU6A 1GYPA 4IFBA 4G97A 4QOGA 2JHAA 5T6MA 5EC8A 3PEUA 3U4QA 2HBYA 2JAPA 3GZNB 3BULA 4QOIA 1KS9A 4IXNA 3CPEA 3EDMA 1C30A 3ZHXA 3DF9A 4MIKA 3RQSA 5HDBB 3FPJA 2IXFA 3FSGA 2PMFA 4EGJA 4M9RA 4MUFA 3MWLA 1N2OA 2HMVA 3HZOA 4Q6WA 3BXHA 3FPKA 3D8HA 2PZJA 4JKYA 3VPCA 4XFDA 5KTNA 4FGWA 4YROA 3UJNA 4EZEA 1I8TA 1R8XA 4L0CA 4MR7B 3C1TA 4YI5A 4FEAA 3LWZA 3QPVA 3V8PA 3NBKA 5C4MA 3DWGA 3RUAA 2IYLD 2W00A 2P0EA 1L0BA 2WVJA 3LT4A 1FVHA 3EEFA 3N2EA 4DDUA 3PD7A 4G86A 4QLOA 3THXB 3D64A 1BH2A 1FP7A 2BFFB 4ZDWA 3QYJA 3ENWA 4MQEA 1NW7A 3A2NA 4U7PB 1USGA 2C2WA 3O8NA 4RPKA 5IVDA 4J0CA 4CKXA 1OXVA 4KR3A 1KIFA 1XZBA 2Z08A 4LBYA 4REOA 3UK1A 5DV9A 3SYNA 4A4DA 1HLDA 2QG9A 3JQPA 3JWPA 4YJ3A 1M67A 1T10A 2FZ4A 3OQIB 5BV0A 2NT3A 1VHQA 1X1RA 5AM1A 4DLYA 5ITZA 3SP1A 2P2YA 3OTHA 1ZNQO 2O5CA 5BN5A 4I9FA 1QH8A 3N9IA 3V5NA 4ZEMA 1W36B 4QYSA 1Y9DA 4Z86A 4UNQA 1M76A 4C2BA 4C76A 2HSGA 2IV2X 5CA0F 1LK7A 1EX1A 3IBGA 4BCDA 5T4BA 3CONA 2PGAA 3OPXA 2O8DB 5ALXA 4WXEA 3C6XA 4TL6A 3IJ5A 2X1HA 3LX5A 3ZNOA 1M34B 3J7TA 2GXQA 4MS1A 2WSIA 4Q1BA 4DXAA 2HFJA 4AUMA 1PZHA 2W11A 2OO5A 1S8NA 2F4NA 4JLPA 2IBSA 3KJQA 1KO1A 1P1BA 2JDID 3LQRA 4QPCA 2Q4BA 1Z06A 2CSUA 1OLXA 3H2KA 3H84A 3T4UA 1I94B 2GDJA 3UHPA 1I7DA 1R27A 2YYAA 4X20A 1ML4A 3U3KA 1VJTA 4KOEC 4PO8A 3QX3A 1IY2A 2A5YB 2Q6LA 2IV7A 2DPYA 1C4XA 2GAAA 2F1JA 5JWRA 1XHFA 3LT2A 5CFZA 3TGPA 3UMMA 4KXMA 1X8LA 3R4CA 4TVOA 1HOXA 5KQRA 3RRXA 3UMSA 4DGQA 1DEXA 3MAAC 3HWWA 5TQ0B 3T9AA 1GARA 3TX6A 1N1EA 2TS1A 3GLVA 1S3FA 1QFMA 3S68A 3ZWVA 1G9SA 2EFJA 4UCWA 4G4GA 3G3EA 3R7WB 4ITRC 4UMEA 3TTWA 5B6JA 2PGOA 1O6CA 2CFSA 5FA5A 3R5KA 2G72A 3OC6A 4FR2A 4LJ9A 1ND5A 1XNGA 3G89A 3A6FA 3GMSA 5ERYA 4YDQA 3O8RA 1Y0BA 5IANA 2XUOA 4DQXA 3VKUA 2PPVA 2A2ZA 3G2LA 2A1UB 1X3SA 3IMFA 3AC0A 5JXWA 4RTRA 1CQJB 5LD2C 4R40A 4Y0AA 2Q49A 3BGWA 5JLAA 5C8YB 5IS2A 5AI4A 3C24A 2Y9MB 4U2CA 4JC5A 4K7JA 4N6NA 3VMFA 1W25A 2BAGA 1MV5A 3M3HA 3VNSA 2FXVA 4U5XA 2VYFA 1JMKC 4CMHA 2YH2A 5U9CA 3L8EA 3PD0A 1U5CA 4IL5A 4KQEA 5AI6A 4GSYA 4WA8A 4NHOA 2OZEA 4G5OA 3D7RA 3TW8B 2WB4A 4ND8B 5CGQB 1R37A 1Z4MA 2HA0A 2GM3A 2B1GA 2ZZNA 1MEOA 4PYLA 1FDSA 2NO1A 2YZ2A 3UANA 1ZGAA 4OX9Y 1UC5B 4D6YA 1RQNA 3A4YA 1B2RA 2C9MA 3QHPA 4OA5A 3VR4D 4QUKA 1NWCA 4QFBA 4RVGA 3X0DA 3LQ2A 1KAOA 4KJZA 3ZDEA 3R3SA 3WK5A 1KZ7B 2BEUA 1K6MA 2IHZA 3AP2A 3CZ9A 1U11A 3O4JA 4JWKA 4N7BA 3WGLA 2FJ0A 3X1ZA 4DHEA 1D5WA 1HL7A 3F7NA 2GJ9A 4L5JA 1BWPA 3THSA 4EHKA 2OZKA 2YCLA 4JLUA 2ZCUA 1PLLA 4WVLA 1DT5A 5LJIA 3UJCA 2PA0A 5B55A 3MTDA 4QUIA 3TLCA 2V55B 1PF7E 3ADKA 1E2LA 2HY7A 3E9YA 4S0XA 1K5GA 1I30A 1XWIA 2E5WA 4M1KA 1DCMA 1B1AA 1SUAA 3OEEA 4QYTA 5ERGB 1TVKB 2XCLA 3FGNA 3TIXB 3DOCA 3DCNA 3F97A 5EERA 1OTYA 3VZQA 1D8AA 1CP3A 5M7EA 3G9UA 1FNBA 4JP1A 4P7BA 1ZXLA 4G0NA 5CM9C 4ARZB 4M8NE 4BGIA 3CG4A 1ZXXA 2Z58A 3FW1A 3OTQA 3KJFA 2VSXA 3CEJA 3OIDA 1MQ9A 3PS9A 4KLAA 3H9JA 1ZU4A 3LNCA 5CVTA 4JYZA 1ZP6A 3IPXA 4FGUA 1XZNA 4HYYA 5KI6A 2PX6A 3H0EA 4NV1A 1YO6A 3BGSA 3DVSX 2OK8A 1M1XB 1EU1A 3NKFA 4IEFB 4EHHA 4D8UA 4QU8A 1UBUS 2OGSA 4MS4B 3LF2A 3MMNA 3T52A 3H6KA 3NC4A 1MEEA 2JIZA 4ZVOA 5HF9A 1Y3CE 4QBKA 1M2EA 4MS3A 2P7IA 5IMSA 3DMTA 3TSYA 4NRDA 1IOVA 1FSGA 1NONA 1Q1EA 4EYQA 4IFEA 1XP5A 1P4JA 1YDMA 4F11A 1NYTA 3SMQA 1TQ6A 1GUDA 2W22A 2D74A 4KKXB 2ZRHA 1SXJB 3GFOA 3D3WB 4OK6A 2PX4A 1RWKA 1Z2PX 4K26A 4EJ0A 4EPVA 2HMSA 1MP0A 2GVDC 2OL4A 3LXMA 5A7HA 2IX3A 5IT0A 3ZQUA 2RCNA 2IP2A 5A71A 1TJYA 5A9SA 3NRBA 1P8AA 1GHTA 4XW2A 4AMBA 1PU2A 4I9UA 2GDZA 3A7DA 3FMPB 3LX6A 4X66B 3JS5A 3ROGA 1NW9B 2PS0A 3AUAA 3OQVA 4HTFB 3BN3A 2FFJA 4N6GA 4A6DA 3LUFA 2I3GA 3K8QA 2O0JA 3BB1A 1FDOA 2NZUG 1JFSA 2ZUWA 3LECA 4GYYA 4QHYA 1NPYA 1RM5A 3X3HA 4B44A 1MN6A 4BNNA 2W6OA 5DW0A 4PXAA 3ADOA 1VLVA 1ZNZA 3DV0A 2OXCA 5CLQA 1V96A 3RS7A 4QSMA 4E4TA 2HI0A 1M0SA 1VE5A 3LX4A 4CCWA 1GEGA 4EBBA 5CA1A 1ZL2A 4M49A 1FDIA 2XA1A 4M6WB 1VJRA 2A8YA 1PV2A 3K73O 5CDSA 4M2LA 3N0XA 1E20A 3A28A 4QJ4A 5ALSA 4F38A 3AGQA 4B84A 4MV0A 3FIUA 2JIRA 1QK3A 1T3ZA 1QIKA 1E1LA 1XVAA 1YKSA 4BRWA 2Q41A 4JR0A 1XTJA 3WA6A 4IS2A 1C7FA 1RS0A 4DNOA 4HLUC 4R9RA 3GEIA 4ALKA 5AOAA 2I80A 3Q0TA 3ZZNA 4B33A 1AKNA 1JQKA 4TQGA 1G16A 3AEUA 3KR0A 2RKOA 4LDPA 5D6OA 2YHAA 5KTSA 4Q4CA 1BFKA 3RB8A 4KSCA 4U63A 1GSIA 1GR0A 2G06A 3U56A 2J4DA 3IUSA 4P34A 3AF0A 4E5UA 1GAXA 3FZNA 3K9NA 5CT4A 1ZW6A 5EZYF 1C3XA 2UVPB 2IOFA 3A9SA 3H0CA 1UT8A 2JD2A 5F5LA 3OY2A 1SRRA 4MIEA 3ZZTA 1NVFA 2FQWA 1L4HA 3T3DA 4ZEVA 5LXTF 1H5NA 2LZ0A 2XODA 3ETLA 4AKIA 4WMLA 3PGLA 4HXGA 1MPTA 2FEPA 5FI1B 2D1TA 3AO0B 2K2WA 2E2WA 4FGKA 4UDXX 3RT1A 3SYKA 4EJSC 2ATEA 4F86A 5KJFA 1CUGA 4JD5A 3QNWA 3SZ3A 2H7YA 1CR1A 1KJQA 3GN2A 4HQ6A 1L4EA 2KHZA 1ONNA 3M9LA 4U1RA 4L5AA 2WHXA 4L5CA 4FIZA 4E5SA 5KMGA 4Q93A 2G83A 1DEHA 3NHBA 1S7CA 1FRQA 3OKAA 4JYCA 3LA6A 3SHTA 1NBME 1QRUA 3NIWA 2X5OA 6REQB 5BWNA 5AKXA 3NORA 3CVXA 4TPKA 2ZKIA 4WKBA 2P3LA 4XM0A 2J45A 4UFOA 3VR0A 2YNMC 4GWKA 3OVMA 4J7CA 3RFVA 3CZ5A 4FFNA 4ARBA 5FTJA 4WZ6A 1E77A 1IG0A 1V25A 4KE8A 5AT1A 2IHUA 2DFNA 4DMFA 1NLMA 2ODPA 3S8MA 4PTYA 2C8VA 1OFTA 3IVMA 1NVVQ 1WSWA 1WUJS 2OV4A 2VDOB 3K6JA 4FB5A 5MFPA 3GFSA 3DEKA 1ESDA 1UWKA 4J7AA 1LBHA 2OXRA 4M7OA 1UQUA 2FE4A 3MJHA 3ZHCA 4IKEA 5MFZA 2AMYA 5JJKA 4BIIA 1QHSA 2IXTA 2B1IA 3BC1A 3M4JA 5FUBA 5G1PA 3RG2A 1P62B 3A9VA 1YHYA 4J16A 2OWEA 5FIUA 3Q5GA 3DPSA 1QIDA 3H1BA 5LJLA 2ZXEA 5FPSA 1PYOA 1ZW1A 2EGHA 2YCBA 3LDFA 1YS4A 3IHLA 4HQNA 5AKYA 2O8EA 3A6DA 5FBKA 2AWOA 4DUGA 4PF1A 1JEEA 3KUCA 3ZEIA 4CHGA 1X1BA 2B61A 5AKEA 3ZLTA 4DKXA 5BYAA 1SVSA 3EZXA 1I0IA 3K5HA 3M81A 1H0KA 3HA3A 3VVLA 4EFNA 1PR6A 4PNEA 3EW9A 3UJDA 3KTDA 1NJSA 2FN8A 3F1LA 1LPBB 1LH0A 1CQPA 1G9TA 1QFYA 1SFRA 4FHZA 4G1BA 4TS3A 3N1UA 3P94A 1P5JA 2O3UA 1EXVA 3IULA 2JKVA 2P9HA 4ZT3A 2IA5A 5KNCA 1L3IA 4MINA 2VP0A 1Z34A 3UFXA 1E1DA 5JXIA 2XH8A 4R1TA 2E87A 4TLCA 5H1YA 1LCIA 4MV5A 3RS0A 3WS7A 3KLMX 1WPQA 2BSXA 2VDKB 3IURA 1V8ZA 5ILQA 5GGYA 2V5UA 3R23A 4EW2A 1MA0A 2RIRA 1B6RA 3BBPA 3I5MA 2CXXA 3I53A 1A76A 2QD4A 4L8WB 4U2BA 1D03A 2WA2A 3CX7A 2WD7B 3I2FA 3D3JA 2BGLA 2BUCA 3GC6A 2Y6VA 4PLWA 4R0VA 3AJDA 4D9IA 1QVZA 4XWYA 1NZFA 3ZY5A 3FZYA 4IVRA 2I99A 3KUUA 1FSPA 1F6BA 2SNIE 2BOVA 2JAXA 2WTAA 2WY2D 1WCWA 3WTCA 4BECA 2O7SA 4B3FX 3FNBA 5I45A 2QU8A 3PFNA 3UVEA 1Y8AA 3FX2A 3LGSA 3VYVA 4N49A 4CN8A 4DMHA 3G49A 3UXMA 5I7AA 3QPWA 1TQ4A 2PYZA 3JY6A 2I2AA 1YB1A 3D4IA 3ORSA 1R6VA 2JFFA 4WY2A 4IJ5A 3TECE 1KPGA 2E18A 3EVTA 4MB0A 3VR6H 4GDFA 1OLUB 3H19A 4NAVA 4OXNA 1PUJA 2EKQA 1PSDA 1AK1A 2NSYA 2QTWB 2VDUE 4QA9A 5DWDA 3ANNA 2UU9B 1XA0A 4ZVVA 2YNMD 3V46A 4RD3A 1DC8A 1SUPA 2I6UA 3KOWA 4FUQA 2W83A 3EPHA 2EP8A 4A36A 3UWSA 3KEQA 1T25A 1VB5A 1XZAA 2HF7A 3QEJA 5ICEA 3LMKA 2RAPA 1VPTA 2JAQA 2P79A 3PFKA 5EXTA 1NMXA 2MSCB 4MPJA 1DEOA 1NE2A 2JIBA 3SHWA 3HHEA 1TT5B 1YCHA 4LMAA 3ZCPA 1XD9A 3IQFA 1XMOB 3SC6A 2FQQA 1O54A 1XFAA 5SZHB 4EL5A 4R2MA 3N0WA 5LL6P 1N4AA 4Z4GA 4PFQA 5H70A 4FNAA 4YT2A 2XWPA 4CKWB 1DCFA 4C07A 1S3IA 5DDIP 3F2VA 2VOJA 1HKHA 3MWDA 3VH3A 3IR5A 5K9ZA 3QP9A 1I6MA 1X3LA 3BHNA 3CZQA 3EUEA 4OGKA 4M1YA 3KKKA 2Z0MA 4OKIA 3Q7RA 4H1TA 4PXSA 5SY9A 3ANYB 1RC8A 2V9CA 5LLSA 2GEJA 1T1RA 2PA3A 1QCZA 3O3CA 5KTTA 2ISCA 1K4KA 3NH6A 1FC0A 1QO9A 3FTNA 1D2MA 3O47A 2N0SA 4UNNA 3T7CA 3TG2A 2WTXA 1S2NA 2X8BA 1HV8A 3UICA 4TYPA 4MVXA 4FC7A 5G1OA 3SF8B 1OUMA 4MV8A 4M53A 2J3DA 1CKEA 3OFND 1F51E 4TTIA 1QHIA 3RR2A 1G3QA 5DM60 4J1NA 5JVDB 3TRJA 2VDPB 1FCJA 4MKFA 5EE3A 3FHLA 2F62A 3A10A 3D5TA 2YVQA 4IJ6A 3TFOA 2HWUA 2HO5A 1J00A 2FN7A 3CTMA 2VTBB 4JYAB 1WO8A 2Q5HA 2QU7A 2ZE7A 3PPWA 4HAIA 3ZV4A 1TTQB 2B0JA 4EP1A 3IPLA 2OORC 3BTUA 4H1UA 4S1WA 4X91A 2RH4A 5GY7A 3CVVA 1AH2A 4H6VA 4Y9RA 3D6UA 2VIIA 4BCCA 4F3KA 3B3AA 1V3QE 4J0DA 1YSCA 3B2NA 3I73A 3B1KA 3DE6X 4J03A 5A9RA 1USIA 3JALA 4JLNA 2P9GA 4PG7A 3DHNA 2Q7OE 4PZPA 5A4JA 3M6WA 5A4KA 5KX5B 1L5RA 2NO5A 2QE7D 4NOKA 4R81A 2X2PA 2NN3C 3TD6A 5C52B 3E9CA 4O2LA 1JQEA 3CLTD 4FDMA 2OZPA 4KRXA 2CMFA 1OX4A 4M3NA 5KU1A 4LJLA 3BD9A 1BXRA 3CLSC 2IIPA 1Z47A 1V6SA 2RGAA 3CF6R 3ZHZA 1FTYA 2R47A 1Y6ZA 5BYJA 3E4DA 5F73A 1FFEA 1DC3A 1DHRA 4IIYA 3VDRA 3K0KA 3N53A 4MAAA 4EB0A 4F4FA 2P91A 1MRSA 2YJ4A 1AKYA 4EA9A 2H8KA 4UVDA 2RC5A 1XD2A 1H65A 3DZKA 3TH5A 4KQ2A 1CJUC 1TRHA 4N8EA 2WHPB 1H85A 3S27A 1I6LA 3EGXB 5EWLB 5HA5A 3ZJYA 4HO1X 3D4PA 3CLUC 4Z9FA 4Q3LA 4Z7NB 2NYVA 4B1FA 3V3KA 1UCFA 4ZAYA 1JE0A 5EIXA 1CDOA 1Z0JA 3IIIA 4HWTA 2V7QA 1BQ4A 1L4GA 2XWJI 2ZUSA 3DE1X 4X8HA 1KSJA 3FGPA 3NB0A 2CC2A 3UK7A 3ZGNA 4KO8A 4V1CA 3FVQA 2DJIA 3Q3VA 1P9RA 1J97A 1KK1A 2D1YA 2G8LA 4KX5A 1LFDB 4QDKA 3U3ZA 2WZQA 5K0BA 3VPHA 3CVUA 3LK7A 1NGSA 3CEMA 3USES 5C34B 1ADYA 1CCWA 2VNAA 2GZ2A 3O92A 4EHBA 5FV7A 1HZJA 1OWLA 1X19A 1XU9A 2AGVA 2FV8A 4OHCA 4UOZA 2GS9A 4DLUA 4RGBA 1RXCA 4HJXA 1OVGA 3FVTA 2R8BA 2I4MA 1AQIA 5E1MA 4WXRA 3BF8A 2O8VA 3L8DA 1JSRA 5E0KB 4EHLA 4IDAA 2GLUA 3L84A 3SKVA 3VJRA 3Q87B 2B3TA 5ALGA 1Q7GA 3QE9Y 3M49A 5KHLB 4IOJA 3H3XA 3O9MA 5JRJA 2F8MA 3ZV3A 4M1SA 3E5MA 3HXLA 1N2HA 2AN1A 2VP9A 3RUHA 5IFKA 1A8IA 3WLHA 1QPBA 3BZUA 4OFZA 2IE8A 4ZK6A 4FP9A 3OTWA 2F4VB 5G1NA 2DM6A 2E4ZA 2Y99A 5IJZA 1H1DA 5J63A 1RPZA 4DL9A 2B37A 2YWJA 3CB2A 1H0SA 4ENSA 1MU0A 3P27A 4N5NA 5HBGA 4BV9A 3ANSA 4G5YA 5L7TA 1NBWB 1SVWA 1QYWA 2BDTA 3QFFA 3KVRA 4G41A 5BNZA 4GC9A 1Z0KA 4JVLA 1EUQA 4R0NA 4A9AA 2BEWA 4LQCA 4C0BA 1NXOA 4AKEA 4A6XA 4LE1A 3ZXYA 1K06A 1UZNA 1R6DA 2RARA 2ZDGA 3LLCA 4LUCA 3A70A 1GXSB 3ASVA 3U39A 4RJTA 2B2NA 2XAUA 1VP3A 1I7PA 5AJHA 2M6KA 3HCAA 2FP4A 3LUKA 3IQIX 4ND2A 2QD5A 3AQ4A 4D4HA 5J2UF 2I7VA 3CLSD 3PR2B 3EGVA 1D2CA 1PK9A 4Y0VA 3OX4A 4AY5A 1JAIA 4GMKA 1E58A 5DN6A 3VYSB 5KJCA 3L8GA 1UP6A 1T6ZA 1TCCA 2PSFA 3WLKX 5CH8A 5HGXA 1MF7A 2QG4A 4MP8A 3OOEA 2PCJA 3WMFA 3JQAB 2B7LA 4XEHA 5EJGA 2J67A 2CHEA 1SXPA 4XR9A 5FFMA 4F3TA 1VPLA 1ZI8A 4FYJA 3JAKA 2GK3A 3CLUD 2A84A 4EITA 5DZSA 3ZQ6A 4GM0A 2IS2A 2NUPA 1O1YA 4DA6A 1DTWB 4JI8B 3HLYA 3ZVRA 4ZI2A 5KOHA 3DVAB 3NHKA 5C18A 5DOVA 3D3NA 6NULA 3ORYA 2X1MA 3C3YA 4BPBA 1SBYA 2C4VA 1V1RA 3TIVA 2PMBA 2Q3DA 5KBYA 4KUHA 2HHJA 1JQJC 3U7EB 5A5FA 2DKNA 5KS2A 4L9SA 1DQZA 5CH5A 2HA5A 3QPBA 5JASA 2UXDB 2OCBA 3QVGB 1AGRA 1CUEA 1T2VA 4BFCA 5F1OA 3SKXA 3WB2A 2O6HA 2JBWA 1DFGA 2ZI6A 3S2YA 1JJIA 2OSVA 4BP9A 3QUAA 1AKWA 5EMJA 4EY3A 1S2IA 5JHGB 4CMKA 5JY6A 4N1AA 1T5BA 4NZOA 4X7BA 1GAQA 3WL7A 4C6HA 5BR1A 2WUFA 2QT0A 4XGIA 2EQAA 2J7PA 3O2SB 1ADFA 3UOWA 2D2EA 5B3LA 3L6UA 3KEFA 3C8MA 5TGDA 4I9GA 3OC0A 1SO8A 1PIWA 2R8RA 2HDHA 1QP4A 1N7JA 1VLZA 3DUFB 3ZXSA 4IXMA 3VYUB 4CG3A 3A2KA 3PQ5A 1W85A 2NUAA 2G1AA 4FSXA 3UIEA 4YA6A 3H5OA 4D8VA 4HBGA 5JSKA 4BEWA 5ES4B 4UBMA 2OBBA 3UJ3X 5L4SA 2PQ2A 4PYRA 3VUFA 4FNMA 1M8JA 1W36C 2CWWA 2EYQA 2WTUA 4F45A 1U8CB 4F4UA 5LP1A 2FA9A 2IBMA 3IE1A 1UK8A 3FYTA 1LZKA 3KSUA 2SHKA 2A94A 5SYNA 1VGQA 4RA9B 2MMGA 1NIJA 3NNDA 5I7SA 4JP8A 4KDCA 3R0IA 2XLBA 1KI4A 3DM5A 2RI1A 1NYLA 3KC2A 4ERXA 3OMXA 4UHHA 3SPXA 2WK1A 1QKJA 4ICIA 4Q4HB 2VAVA 1EFRA 1W48A 1UDWA 2VQ6A 3CF2A 5CLFA 4MA0A 3CEHA 3EIWA 1YFLA 3ZG6A 1WF3A 5LM3A 4FMDB 2F3SA 2CFRA 3RDPA 2AN9A 4O1IA 3FCSB 1Z68A 2Z4RA 1FMJA 4LTNA 1D09A 3NEAA 1VMAA 1JDUA 4PYIA 4LGMA 4OA8A 3HY6A 2GEBA 3HGTA 4WZAA 2SKCA 4O3FA 1XL1A 3EZ2A 4HAVA 1NMQA 1DRWA 4INAA 2O8FB 1CQWA 3A1NA 3JD1A 4LWQA 1DKRA 1N3LA 3M1IA 1SCNE 2BFEB 3BIOA 2BZ1A 5T3UA 3KM0A 1ZLYA 3NWEA 5JAMA 4E2ZA 4YV0A 4DEYA 4YP5A 4PU0A 3DT9A 1YQGA 3RYIA 3UQYS 2CLFB 1L5NA 1S7GA 3HUDA 1N2BA 2G5TA 3S1AB 1JFFA 1XBTA 4X1IA 4AJNA 2RG1A 2EC5A 3H9EO 3JV7A 3VHXA 1V8DA 3W1WA 3BHIA 3UFBA 2JLXA 3O9ZA 1UFVA 3P96A 4MQ5A 3ZCVA 4O4IF 3HVRA 2QRMA 5IBRA 3N2LA 4PBRA 2D13A 1ULAA 1XHEA 1QG0A 4PWYA 4MGHA 3QQ5A 1L4NA 4TS1A 1Y33E 3MJCA 3O5AA 3HS3A 4LHYA 3SBEA 5AW9A 2O5VA 1JA1A 2GBLA 4ZIRB 4X1KB 3ONVA 1UEXC 1TKAA 2C78A 1OB5A 4CQLA 4DTCA 2FAXA 2R2AA 3GIDA 1ZIOA 2QSYA 1QIHA 1PSZA 3EEQA 3QG5A 1RXYA 1SBQA 4KHZA 2WWVD 4D3ZA 3GA7A 3T3NA 1BOFA 4PZEA 4RGQA 3RNLA 3SS9X 3O1LA 3ZE6A 1UDXA 2I65A 3H16A 3QFTA 1Z12A 4F84A 2OHJA 4RVFA 3F7MA 2NACA 5IYZA 5JEEA 1FFWA 2QOEA 3FYSA 3QLUC 2QLNA 4L4UA 3MTBA 4X1YA 1J8MF 1WR8A 2MU1A 1W44A 1DELA 1Z38A 4C2AA 1KBZA 3R44A 3CSDA 2ODTX 3CZRA 4R51A 3OTIA 2HLPA 3KYCB 3PBKA 1XAGA 5C8VA 2CMDA 1RXWA 1XUOA 2J08A 3GJ5A 4QXQA 3VPBA 4H6WA 3L9WA 1L8XA 2JVKA 1K0FA 1K1EA 2WJJA 3O1JC 1UXKA 4S0ZA 3ANMA 4D8WA 1CV2A 1XZ8A 4F12A 2SCUA 4Q1FA 1TKBA 2QW8A 4CJXA 2ZQ5A 2J6BA 1L4BA 1ND6A 1W36D 2ARKA 4M37A 2CMGA 1OKKA 3UMRA 1FNDA 4YJFA 3QSGA 1PYDA 2QR3A 4PHHA 5IARA 4KG7A 3W77A 3ZNNA 2QSZA 4KMRA 4D56A 2H5IA 3NVKI 2XE7A 3ABIA 2Z2YA 3BE8A 3WLFA 2J07A 1YJAA 3M6AA 4H7JA 4DZZA 1EFTA 1XRQA 2P27A 3LHKA 5JV5A 4P84A 2Z4SA 1WP9A 1Y81A 4CM5A 1A9SA 3TE7A 1E9EA 3F8SA 3IDZA 2C7RA 1KK3A 2QS9A 3E5HA 3I32A 1B6TA 1Q74A 3MN1A 3NDIA 1XLVA 1SCKA 2J9RA 2TMKA 3OQ6A 4GE3A 4YJ3F 3IEXA 3R6TA 5FLEX 3H87A 2CLSA 4D0SA 1E6WA 4NSNA 2AQ8A 4HRVA 4Q1AA 1SKYB 5E7MA 1VPWA 2XDQA 3HACA 1SEPA 1PR0A 1YVRA 4NEHB 3PXCX 4TTQA 4WN3A 1BXGB 4URVR 3NIDB 3INYA 2DETA 5LYJB 1AUOA 1H8HD 3O73A 4QXOA 1D2GA 3Q3CA 1SVKA 2ISQA 1GUYA 2W6MA 1WKBA 3ZHYA 2QRGA 3DBRB 1FU8A 1TM3E 2JBAB 3REGA 4BTLA 1LFAA 2X4LA 4ZPXA 4TVSA 1ODJA 4PQYA 1AUPA 3JASB 3ICEA 4B2IA 2VUSA 1YNSA 2IODA 3N3AC 4FFVA 2ZWPA 3KIPA 1PJ3A 1N92A 4ZI7B 5BPFA 1W2GA 4YMGA 4OFWA 1YGPA 3SJUA 1M1YB 2YV3A 1DBWA 1Q15A 2FZLA 3A06A 3LUPA 5B3JA 4HN2A 1JLMA 5TS3A 4UU1A 1PDOA 5EHGA 5HF8A 1VZ3A 4L8YA 3H99A 2WWIA 2ZSJA 1EPUA 3LQYA 3SD7A 4KI7A 3VISA 1CY6A 1MTZA 2NSJA 1U9YA 4ZU1X 1EE9A 3REQA 3ROQA 4BX0A 2P40A 4I1IA 2IHJA 4RIEA 2D8AA 4CW7A 4RDCA 2DYKA 1H8EA 1UBMS 2GJAA 2P2SA 4QGBA 4EY5A 3W5SA 1EWRA 1V5FA 4YCLA 2BHTA 2FKNA 2OAEA 3LFTA 4Q3EA 3B9RA 2H4ZA 1SG6A 1RAGA 3NTQA 3ORHA 4IDCA 4MPDA 4MW1A 3T7EA 4WK6A 3P4YA 2VO1A 3W04A 3QLVA 1SCQA 4C3UA 1Y5LA 3GP8A 3FTEA 4ESVA 2C00A 1KI2A 1IHXA 1XXHA 2FRDA 4A0RA 1L5SA 1GT6A 2FK8A 2L19A 3EWSA 4X24A 1EFVA 4U9HS 5ELLA 1KO7A 1ECCA 2QRVA 1T2NA 3CCFA 1KBOA 3DJFA 3A3PA 4JLVA 4BEVA 4PCUA 4DCNA 5D7NA 1MOSA 3S99A 3V55A 4GM4A 4YC7A 1YASA 3N7TA 5HRAA 1MLDA 3HA5A 1PJRA 1VHLA 5KVQA 5KPJA 1M8PA 3B12A 3OOJA 3GVXA 5FPPA 1KZHA 4BNLA 1GKLA 1H2FA 1G6KA 1KEVA 4WKPA 1Z35A 3A1TA 3VBEA 5ALFA 2CVZA 2HJSA 3PKIA 5EYPA 5AUQA 3G7NA 3VYRB 5BVGA 5ALTA 1TUBA 1QB7A 2QYOA 1GEEA 4J0QA 3V8VA 2QIOA 1K8YB 3LY9A 3E3OA 4PC1A 2O2SA 2ZTHA 1Y3BE 2OPHA 4E5DA 1L5HB 4INPA 2H54A 4CXMA 1BTOA 1K8XB 3TR0A 4PYJA 4X41A 4LY0A 4DLRA 4G0QA 3DYBA 1PI3A 2FWBA 1B3BA 3CIFA 5B7NA 5HM8A 2O2JA 3WV5A 1LGYA 4FHGA 2CHFA 3E7FA 4C4SA 4LXUA 4JZKA 3R76A 1R0CA 2QMQA 3SJBA 4EW6A 5JANA 1KRHA 3DKVA 1TTPB 2MWMA 2WNIA 2QP3A 1XVTA 4DCJA 4PX9A 4EJ2A 4Y8VA 2R8PA 4HCJA 1X7YB 2X15A 4BO8A 2YY7A 3FTCA 3OZXA 5BSMA 1M2VA 4RVNA 1AHNA 4CMEA 3GEGA 3IAS1 1A3CA 5C1OA 2DTEA 1P0QA 1SIUA 1PWHA 1EG7A 3H2IA 3HCWA 4U7HA 3ZBTA 3MM4A 3KVVA 4OLJA 1Z22A 4XD2A 3H5VA 4EELA 4YYZA 3KX2A 3FD8A 2IUFA 3BG5A 3ZH9B 1AD2A