3GAAA

The crystal structure of the protein with unknown function from thermoplasma acidophilum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
MIMVNKKASESQVMELEKRNYNNPVVLCGFAGSTPTGVLAASYIVETLGMHQVAHLISQHIPPVAVFVGGKLRHPFRIYANNSNTVLVAMCEVPISSAHIYEISNTLMNWIDQVGASEIVIMEGSPANGIPEERPVFAVAEKPKLDKFKKAGIQPADSAIIAGMGGGILNECLVRKITGLSFITPTSVDIPDPGAVLSIIEAINKAYNLKIKTDLLEEQVKALDEQIKKIEEQYKELQEKQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein Ta1441
publication title The crystal structure of the protein with unknown function from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
total genus 70
structure length 243
sequence length 243
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gaaA00
3GAAA 2P90A 4G4SP 3MNFA 3WZ2A 2WAMA 3E35A 3VR0A
chains in the Genus database with same CATH superfamily
4U1RA 2QN3A 4JVOA 1WUHS 1B41A 1YQUA 3QXJA 2VSXA 2JAPA 4H7HA 2WWIA 4IDQA 2DF8A 3PZBA 1O87A 3NDRA 1II9A 4NEQA 2JNWA 3S1LA 4DKJA 1KYZA 1NIJA 4MW5A 4NICA 5DTEA 3UUGA 3H75A 3NXSA 3I4CA 5I45A 3F9RA 1DG3A 3IUPA 4NOLA 3HHEA 2EERA 3W7BA 3D0KA 3LHDA 2WFLB 4G5OA 3RYHA 3SCZA 4P4SB 3N0WA 1K06A 1PDVA 4DV6B 4G63A 4LEIA 2P1RA 2VDJA 1DEHA 4M0LA 4B73A 2F3RA 4XIGS 1G1MA 5F1YA 4ZD6A 3OQBA 5SICE 1E59A 1G3IA 2H4XA 2A9RA 4L57A 3GMDA 1PGNA 3COZA 3IEUA 5AD1A 1VBNA 3FUXA 1R6BX 2I8LA 2I87A 4PZUA 3V1MA 3ZKAA 1FP1D 5LPNA 2ZJ1A 1ZDMA 4DLKA 1P0QA 3UJCA 5HBRA 2XH8A 5IDWA 2ZZNA 3C15C 4G0WA 1A9QA 3CLRC 4IICA 2LBPA 2WVAA 5C8VA 3BJRA 4MUFA 4AZ3B 3GC6A 1B15A 2N1MA 5IK2A 5TQ2B 3U7RA 4OLJA 4DV3B 1RI3A 2GYUA 1Z07A 4YWHA 1RWQA 3NHUA 2IZ0A 5KHAA 1OASA 3GFSA 3H4VA 4PV7A 4CCSA 4EHLA 3A3YA 5HILA 4BVEA 1JU3A 3EF3A 5F21A 3DEHA 4Z4IA 3R9WA 3MCAA 4J16A 3EVTA 1KAGA 1G8FA 2CDCA 4JA2A 2QAIA 1WB4A 4M7WA 2ONZA 3AK4A 3QBJA 3L7JA 5BRJA 3ZUGA 1ZXLA 3I6QA 4BWVA 4ZVMA 5TXGA 4COOA 1Q1BA 1MN6A 2FMHA 3AP2A 1DIBA 3LC1O 1BS9A 1CYDA 2V3VA 4WUTA 1KDYA 2W6PA 1FU4A 1KEPA 1V7PC 3VPXA 4ZYZA 1VGQA 2ZCVA 3S2EA 4RSMA 5J2TF 2GBIA 2O2YA 3AINA 3EXIA 1C30A 5HMMA 4ZWNA 1QBKC 1Z06A 1E2KA 3A2KA 1KZ4A 2O0KA 4FLEA 1SQSA 4MRSA 1H0HA 1VP3A 3PRHA 3UFXB 4LZWA 4L6IA 1YDFA 4M46A 3RT7A 5A4IS 4HFJA 1VJGA 2ISQA 1ZGBA 2PLNA 4HQLA 2VA8A 3KTAA 4KLNA 3H8SA 1KRWA 1JKJB 5J5VA 3CLHA 3L79A 4LDZA 4MH0R 3TLBA 1K6XA 4QBFA 5ADUS 1YRBA 3AZQA 2AN5A 1MTOA 2GNOA 5DTQA 3A6HA 3TWOA 3CLRD 1YU9A 3TRJA 3VPBA 3C48A 3KAPA 5CPBA 4C3VA 3TLYA 1W581 3TRKA 4ER5A 1XMXA 2C9DA 16PKA 2GJ8A 2HZBA 1HYEA 1C7EA 1E2HA 2GK7A 1WSDA 2QRHA 4N5NA 5EKUA 3S2ZA 3ENVA 3JYPA 1IZ0A 1VIAA 2IHKA 2YQ4A 3L46A 4NBVA 5L4NA 4WKBA 1NFRA 2VQ3A 3Q8KA 2DERA 5GVSA 2FN4A 2QUAA 4OI2A 1RHUA 1LX6A 3AVQA 1L8XA 3AOEA 3D0OA 4IGEA 2JH8A 3O6VA 4HYQA 4CUZA 3HFSA 1RPAA 5A5EA 1QG6A 1R66A 1IUOA 1PR9A 2Q4BA 2DRIA 2CEKA 1PZNA 3OU6A 1E9BA 1UP6A 1ZMRA 4TN1A 4ZC8A 3FMVA 4LOKA 5BVHB 2EIHA 5EJ2A 2YBDA 3N28A 5JQGB 3R7FA 4JI1B 4CKXA 1ZITA 1CEYA 4DIEA 1HLPA 4BZWA 2P40A 4JEMA 3BK7A 4KIJA 3IE0A 2WIBA 4FYMA 1E3WB 2QTBA 1OT5A 4IDHA 4R1MA 2H48A 1DAEA 3U9LA 1RQLA 5KSPA 1M2GA 1E3JA 3ELYA 3IAXA 3OWXA 3QE9Y 5ITSA 1RQPA 3QI7A 2ZLBA 1KQOA 4HGYA 1SUAA 3GT7A 3NYIA 2C97A 3IUSA 4Q1FA 5JJBA 4FYWA 3EVCA 4I55A 2JB9A 4G0NA 4LY0A 4M7OA 4DIUA 1C29B 3NASA 3QVJA 4Z9BA 1C0LA 2BZSA 2XZPA 4B9AA 4PLWA 3RVRA 4PNPA 3ACDA 1E66A 1LBIA 3BK2A 3ETGA 4XQGA 5KYGA 2YDYA 1CUAA 2VZ9A 1QKIA 3SFTA 3ZD9A 4DXDA 2BR5A 2WKWA 2YWHA 3AVWA 3FHJA 3SXPA 3ZU6A 3ZCVA 4H35A 3U3DA 3AVTA 2O2EA 3AY0A 1GVHA 2GPJA 2VJLA 3OPYA 3EDCA 5EHQA 1DCKA 2V3WA 3LX8A 3X0DA 2NVWA 2QU8A 3COVA 3T7JA 4G8CA 3FNIA 1H4SA 3IOCA 1LPNA 1Z4MA 4Q15A 2W6IA 3CYFA 2X0DA 2GVDC 3SZGA 4KI0A 4A26A 2CJWA 1DRKA 2YWGA 3CN9A 4L07A 2NT4A 1YA6A 2VDWA 1J09A 3WDKA 5DYIA 4L02A 3EEOA 3C8HA 3N07A 4Q4CA 2B4RO 2C9BA 3UM9A 5KU1A 5CDYA 1PFGA 3LKDA 2GFQA 1E9CA 4FNOA 4F3TA 3KJFA 3QEJA 1T5BA 5HW0A 3WGYA 1YFLA 1PKXA 2RH9B 2Q50A 1DC4A 1Q12A 3TOXA 4J8PA 5FLXA 4G97A 1N92A 3JAKA 3ZK8A 2P65A 2HXYA 2ILTA 2JJ2D 1MTZA 4EHIA 4R2JA 1GCAA 5I3ZA 4LTDA 4A16A 3M9LA 5EMMA 2ID9A 1RP1A 2ZR7A 3U56A 3Q6MA 2DQYA 2Y1LA 1H6BA 1T0HB 3B3GA 2FN8A 4NFHA 3I9V6 3QQ5A 1K4MA 3JU3A 1EQUA 4BMYA 1GTL1 4TXMA 3KKKA 1S2NA 3TZLA 5K99A 3BHMA 4MVJI 5EHZA 2IFTA 1SUDA 2J3JA 4RJ2A 1EFRD 1N1GA 1SCIA 1SMKA 1WB9A 2ZYSA 2FXIA 3FF1A 4MUMA 5DZSA 3BH0A 1UK6A 1Z4QA 1WP4A 1IBLB 2AZDA 4CKBB 2Z2JA 2A1IA 3OZUA 4BYMA 2ZRIA 2ODNA 4DCNA 2DY0A 4P83A 4QUGA 1TMKA 4Z9YA 4KKVA 1A4RA 3OIUA 5CVEA 5LB4A 3N0TA 3PIDA 4A6DA 4B46A 1X7GA 5J3JA 1TDJA 4XB1A 4KC0A 1FEZA 2DT8A 4F1JA 1S2LA 2HHLA 4PXAA 3O03A 4XUEA 2ODEA 3Q7QA 1KVRA 1E9FA 2R1ZA 2XLBA 3QUTA 4G25A 5AKGA 3BDIA 1YL7A 4D8XA 4NBNA 1WHTB 4JIMA 3VR3A 1D6MA 4Q6WA 3QKRB 4FFOA 5B3KA 4EG0A 1QAOA 4X8HA 1A9SA 3IBYA 5I47A 3K09C 4DCJA 4BNDA 2ZR0A 1I36A 5FWAA 2IYOA 4FIDA 2XMDA 3GGSA 4FZ3A 2ZI9A 5BT9A 4YMGA 2WMOB 3HU3A 4MA4A 5M29A 1A7AA 2GPBA 4AZWA 2JIOA 4FZRA 5BWMA 3ACBA 1JDZA 1F9EA 1EGMB 4ZQEA 3SSNA 3CNBA 4BWFB 3S5JA 2ZJ0A 5G1OA 4U2EA 5IAAA 4YMVA 5L3VA 3PLRA 4D42A 4R5HA 2AMYA 2ZQZA 3BGOS 1IFXA 4MPJA 4OP2A 5AJVB 4B7XA 4B6PA 5JNSA 2JAOA 3MGAA 3LRPA 3MG9A 4PO9A 4AJHA 2AN1A 1BHQ1 1UP7A 4K2HA 3R7BA 2GCOB 3RBVA 4UOEA 2JIDA 3EXG2 3V80A 3TDKA 2XUOA 3GY0A 3SHVA 3TNJA 4M55A 1O97C 2IY8A 1PNOA 1ECBA 4KVGA 2QRKA 4CPDA 4K0RA 3TTSA 2HD4A 3LSYA 4KO2S 5BW5A 4D4LA 4PG7A 5ABPA 4MS4B 4KRYA 1F0PA 5KYVA 5LDHA 1T9HA 4HQOA 3F4KA 3KPJA 2HF2A 4C76A 1E58A 1J8VA 2MSLA 3UXYA 1J39A 1RAGA 4IX9A 4IIVA 3A1SA 2H4FA 4QVGA 4TKUB 2QDKA 2XNDA 2Y2VA 2ZYAA 3H0KA 4N0MA 5ALYA 1JT2A 3P4XA 5A4AA 4KFUA 3BX1A 2I7CA 5LZ7A 3V7NA 1JAXA 1H8HA 3U81A 1NKTA 3I5AA 2V0GA 4MRVA 1EJ0A 1CF2O 2AMFA 3R44A 2W70A 2H5JA 2AXQA 2I6QA 1SA0A 4IWYA 5EVJA 3OETA 4RK6A 3LGAA 3U61B 5I9MA 1E5XA 4K88A 2ADFA 2X4LA 3NDJA 5IKEA 3DYIA 1JNYA 4B3MB 4ZTUB 3BWVA 1R9NA 4Y9DA 3PRJA 4BXOB 1MVOA 2YNMA 4IJUA 3HZOA 4YVFA 4DARA 1A5TA 5K4HA 1IBMB 1RI4A 3NVMB 4JR0A 5AK6A 4ZDWA 1LUAA 3ZHXA 2Y0PA 2DFVA 1UQTA 5SYAA 3G2QA 1B74A 3K4HA 3GNTA 3LIIA 5M7EA 5BMVB 2J9FB 3I23A 1JT9A 1O97D 4V02A 3NDIA 2WWRA 2IC5A 3DLHA 3E0QA 2NX2A 3L6DA 1OWNA 5CA1A 2VJYA 4CV2A 4IDNA 2VFAA 2QLLA 3A3OA 4P1ZA 1UMDA 2YHSA 3INYA 3EGEA 1E77A 2KMLA 4IWXA 4LJSA 4IXTA 2DHRA 2JAUA 3TI7A 3ZWQA 4RVFA 5JHGB 2I80A 5KPDA 2WMYA 3WMWA 1EFVB 4P53A 4RO0A 2O8BA 1Z2EA 1S0UA 1QRAA 2JIPA 2Q49A 2HJGA 3H9GA 3HJFA 1DJNA 1GTRA 3FE2A 3L0SA 4H60A 3RM3A 2I6XA 1VLJA 1YO6A 1PV1A 2DTEA 2GYVA 1F2TB 1E79A 2VNJA 4ATNA 2XMQA 4DKXA 1GG5A 3IUQA 5JO9A 1IATA 1VE9A 2E6KA 2IZ1A 3A36A 1TK3A 3NBAA 1N7HA 3RASA 2R6CA 3DBLA 1Q83A 1A88A 4MUNA 4BP8A 5THXA 1FMTA 2YHBA 1MOZA 3BHNA 4XIYA 3ZWVA 3KOWA 2EIXA 3AVPA 1YOBA 1AQJA 1TPZA 4GP7A 3OFND 1F2VA 3PUKA 1WQ1R 4G4IA 4M9QA 2AW3A 2LGJA 2Y76A 4R83A 3AV0B 1NUUA 4GX0A 4H7DA 4Q4JB 1MHTA 1OZFA 4OREX 3ZZNA 1M7HA 2EX1A 3AX6A 2DPXA 3H4TA 4Z49A 4O4IB 4EY5A 4NXNB 3T3OA 4X65B 3I61A 1XTVA 2ACVA 1U2SA 1W48A 3L1JA 3T1HB 2ASEA 5GAJA 4P0TA 1NUPA 2NLOA 3WLQA 1P77A 3A9SA 1HSZA 4FFWA 2BZGA 2P9GA 2GX6A 4TTTS 4JGBA 2G28A 3G13A 1QZUA 3N39C 4X97A 3RVKA 3UWMA 4X1KB 3GRYA 4ENRA 1FUKA 2WJZB 5D6OA 5KDLA 4HUJA 3RTEA 121PA 3NM6B 6GPBA 2IX3A 1KR2A 2I7DA 2WI8A 4MUJA 1K9SA 3EODA 1FJHA 4FGZA 4ND2A 3V4PB 4U7JA 2WV7A 5E6SA 1FU8A 1LVUA 1QE0A 2QJTA 3SLRA 4YJDA 3L0ZA 1CK4A 4V24A 5JPIA 3WGNA 4QG7A 1TZCA 1E7SA 4CODB 1E69A 2G3YA 2IDKA 4G5RA 2P3QA 4MRNA 4ZGGA 1YCFA 3B36A 2HW8A 4GUAA 5DBHX 3PX7A 1FLNA 1QF6A 1RIIA 5HUJA 1MA3A 2A1TR 4JB0A 2OFFA 4P58A 4PLPA 5T64A 4TV8A 1ZG3A 4P0QB 1IYZA 2K2QB 1UOQA 1C8BA 1JHXA 3GLKA 3PC6A 1LLQA 2RSLA 3NNDA 4RGVA 2I34A 2PK3A 1YNSA 1FP4A 1TO2E 1FCJA 3AM5A 3BM5A 3R0VA 4FX5A 1V45E 4QGFA 3WYDA 2WILA 1FFDA 1LRLA 3HYLA 3NHFA 4FHZA 4GLBA 4JSRA 2C7GA 2FJUA 3COYA 4P5EA 4OM7A 5IANA 3NNNA 4FHFA 2LNDA 2BGUA 5GP1A 1RQ2A 1PL6A 3VI3B 2DFLA 2EL7A 4HEHA 2PD3A 3DL2A 4DB2A 5ER9A 4IUCS 2VXBA 3QBTA 5EZSA 3N53A 3R6GA 3WKEA 2CKDA 3RREA 1C80A 2ABWA 1WUIS 5KTRA 3W3ZB 4BFWA 4O4LF 1LB1B 1NI5A 2XEDA 2OV2A 3W5UA 3GR6A 1GFZA 1YA4A 4G5HA 4A2WA 2X8BA 4L4YA 5HJ5A 2FPMA 5JIBA 5FIUA 3IEMA 4YJ3B 1JX6A 2IUYA 3PNMA 4Z3KA 2RK6A 4KPYA 2C84A 3MUNA 1K4YA 2LUOA 1ZMBA 4LX0A 5C52B 3OP1A 5KTTA 3GP8A 2ZRFA 1K0FA 4M2LA 4ESHA 1A82A 1AUXA 1EM8A 5HQ3A 2H6EA 5KINB 2CJFA 3OOSA 4FFNA 4X91A 3ESYA 4YBRA 4AK9A 1TZBA 3KS9A 1BXGA 1H69A 5BT8A 3T1TA 5CXUA 1F2DA 3W3AH 1XMSA 1BCRA 1HRKA 1IAQA 1K63A 1PZFA 3M89A 3PQ4A 4WY2A 5IM4F 3AJRA 1U8XX 5JYDA 3NBQA 1EDDA 2H51A 1EG7A 3R3SA 3KYIB 3M5DA 4Q9NA 1YRHA 4LXTA 1Y5NA 1AQUA 4L0DA 4OJYA 4Q93A 5JSFA 4FILA 1AY0A 2FZKA 4R41A 2BFWA 1MW8X 2R5FA 1DZIA 3WWCA 1MO2A 1RZ3A 2QY9A 3UJ9A 2WIAA 1FVFA 4QO7A 4QLOA 1QK5A 2BCEA 1ZKDA 2UV8A 1ZHHA 3H9QA 3O82A 4QVKA 4C0AC 1N77A 2Z6AA 3VR2A 4IKEA 5AKYA 5F35A 1M72A 5H4HA 3FKQA 1WUKS 4M87A 4NR0A 1H6CA 3E81A 2RKBA 1WQ3A 4DYDA 4UTVA 3IP6A 1QHNA 2R44A 3GJ5A 2IODA 4KNYA 1JFRA 1U9CA 2BJHA 2D3WA 4M1WA 4NFSA 5KQSA 5JS1A 4YUVA 3O91A 2QE6A 4UM8B 3E9DA 2RE8A 1IHUA 1JHUA 1SBIA 1Q1EA 4ROSA 2K2WA 4URXR 3DZIA 5FQNA 3GV0A 5BN1A 5DI3B 1R5OA 3DFKA 2VCYA 3ZS8A 1O6GA 3PD7A 1ZOOA 3DQPA 4C4ZA 3DHEA 4J0HA 4A15A 4LNUA 5GOTA 2C07A 1Q7TA 1N8TA 4F3CA 4V0RA 3BG5A 1YJQA 4B5LA 3BGDA 1G42A 1GRCA 3GCGA 5DCYA 4YRCA 5DM60 4UKDA 2R7AA 1ISPA 1X1AA 2XECA 4MWBA 2NO1A 3RKUA 2V1XA 1HH4A 2YWBA 3V8QA 4CIXA 4F84A 3AETB 3FZQA 2DSNA 2IV2X 3M9XA 4YJFB 2B0JA 2CLKB 3PEUA 1TB4A 2AW5A 3BMNB 3LUDA 2SECE 1QYDA 1ZC3A 3FWPA 4WWHA 3T5BA 2WD8A 1EUQA 3B8HA 1JR3D 2B37A 2QNRA 3AIMA 1V47A 1VL5A 4JT4A 3IQZA 2Z6QA 2DSTA 5C18A 1G291 5KNBH 2BFNA 2JLBA 3D3EA 5DHRA 2C7RA 1HUQA 2HNBA 4ZAZA 2QUHA 2W2VA 3G3EA 1MD9A 3PQ6A 3BMOA 1RWVA 4CDGA 4LGYA 4RGQA 5I7FA 6ADHA 4AP6A 1BD4A 1JHDA 1P3JA 1FMLA 3RHZA 3VDRA 3W6UA 4YAUA 2VP5A 3RAGA 1M3SA 3IAS6 5BSTA 2HWKA 3IQHX 4WXPA 2FEAA 2EKBA 1KY4A 3PHIA 2FW8A 5AW7A 3T6KA 3ROTA 3T3GA 4BNVA 4L2IA 5EQDA 3MBOA 1RLIA 2JZOA 1QGOA 3FXAA 5KHOC 3ON5A 4D9NA 2BFEA 4KAAA 1KY3A 3P9XA 1JU9A 3FUTA 2YCBA 4PCUA 4E46A 1GUZA 4Q9IA 4E2YA 1YDWA 3HM2A 2AFIA 4FGKA 1HO3A 2NXNA 1FXUA 1PAUA 2ZRBA 4Y9UA 1RBYA 1SUFA 3JV7A 1L4MA 4XYEA 1FNCA 1UKZA 5AW3A 3QSYA 3JQAA 3IGFA 1XPOA 4S2UA 1Z38A 3EFOA 3SDZA 3IRUA 3B9RA 5FWXB 4P7JA 1RRMA 1AKRA 4IVRA 3WB0A 1JDVA 3JQCA 2NO4A 3NBZC 3DV0B 2XZTA 4HWPA 4QJ5A 1XRNA 2ZR9A 3MCTA 3LPAA 1NW3A 1J1ZA 3OJWA 4N0PA 4OHOA 4QXRA 2ZIXB 1I2BA 1CVIA 1K86A 3MZ0A 3ZWNA 3L4BC 4B4VA 4BKMA 2Q3BA 4N7BA 1R00A 2WIKA 5CFRA 1LI7A 4J0DA 4MW6A 1UINA 4UAVA 1P61B 3NYWA 4B4KA 4C4SA 1EVLA 1JEYA 3TH5A 5CLFA 1TQ4A 1E61A 1Z8FA 2WKQA 2A8YA 2ZIUB 2XXJA 1DIAA 1GPMA 3L1VA 3NJRA 2EBFX 4JKIA 4AIIA 1IJBA 1YZLA 1Y4AE 2WNHA 3OZTA 5DEOA 4J2TA 1ADJA 4GOMD 4H77A 3QJYA 1CZNA 1CQJA 2ZYIA 4J0EA 1XL1A 2Z56A 1AGXA 4ILEA 4BJHB 1XIVA 1U11A 2JAXA 4MO2A 1O6ZA 2ERYA 1JJVA 3GUVA 3E9CA 3ESQA 3HUFA 1UOEA 1GJRA 3BRQA 4IFTA 2V03A 3K0KA 4AVYA 4Q24A 4R68A 1R8QA 1OILA 2WTMA 3D1VA 2CK3A 2M2IA 1OKKD 4ZTZB 2ZYHA 5KQPA 2QTRA 4QQ8A 4JOSA 3DFMA 3GZTB 2KX7A 3BCHA 2J6CA 4AKEA 1KOFA 2ZB2A 1I2MA 4ZZ1A 3K71B 2C0QA 5TMEA 4DCTA 1C2TA 3MHPA 1TNDA 3H6KA 2JCSA 1VYHA 2KM1A 3EQZA 2H85A 1B2LA 1Y5MA 4A9AA 4Z4CA 1HE4A 3I53A 3H11B 4WI1A 3PUWA 3P0JA 1FYVA 3DDOA 2BHSA 4KE8A 5AJXA 2CXXA 5KTYA 3LZDA 3QWBA 1ZD2P 1NF2A 3RCBA 5HS4A 5DP1A 4PC1A 2CNWD 4RNDB 3VU9A 5AW6A 2GN1A 4I5IA 2GCNA 4QQFA 1I1HA 1IDN1 3SMVA 1ONOA 1CUBA 1G4UR 1V6SA 1JHMA 5IJ0A 3S2GA 2D2FA 3M0EA 3RH0A 4UBMA 5DF1A 1P33A 3OM1A 2W9XA 3VU1A 3SC3A 1N6PA 4NZ9A 2I78A 1DINA 4KQKA 4DMKA 4I36A 2BT4A 5CA0A 2UU9B 4QWMA 1E6MA 4QU5A 1DC7A 1UZAA 1X7ZB 5CYOA 2ZIGA 1Y48E 3T1YB 4KH1A 3Q7IA 4HH1A 4J6EA 1U5BB 2VT7A 2WHPB 3PKZA 5G53C 1QDUA 1SKBA 4YJ2B 1KSGA 3TQOA 4B9EA 4DB4A 3P2KA 4EYKA 5I7RA 1VSBA 1NG1A 3REOA 3RWOA 4H2DA 4Y1GA 3RE1A 1HF3A 3WK9A 3VYTB 2E4VA 4B7UA 3MJFA 4MW1A 2PBFA 3LP6A 4UNQA 3ZK9A 1C9NA 5GTDA 2WNIA 4MA5A 5LYJA 2ZZKA 1TT7A 4QEDA 3KSAC 3R3VA 4EGAA 5TPZA 5KOHB 1JQEA 1KNQA 1ZGZA 4BE7B 4EY6A 2JHAA 3OTOB 2PS0A 1YVEI 10MHA 2IWHA 4ZI7A 2J08A 1LI4A 4JYAB 2C8LA 2IEDA 3BF7A 3KCNA 1S2DA 2V54A 4DR4B 3K6JA 4GIBA 2A92A 2FFHA 2AOUA 1I2AA 2ZBQA 4MQMA 3CEHA 2O5EA 1L7PA 1U8EA 2HLDD 1QFXA 3KKOA 4II2A 2CXNA 2XQJA 3I6BA 3QXXA 3KQMA 5F33A 1KEVA 2HMUA 2QI9C 2QTCA 1NULA 2BP7A 2DX7A 4W8HA 3PIIA 4TS3A 2ZAGA 3DAFA 3GOQA 4FMCF 1BMQA 2NUAB 2WSYB 3LUCA 1DEAA 2YYZA 1K2WA 2OTCA 4ARZA 3M3DA 2HCBA 3BWYA 4JITA 1JTEA 4YRLA 2WEKA 4ERXA 5BSHA 4Y0NA 4ARIA 4F3YA 2OKCA 1QF7A 2GZRA 2XCRB 2W6QA 4L9AA 4ZHSA 3OF5A 3AI7A 2Z4RA 3VPSA 1OA0A 4EJSB 3JD3A 2V59A 2JGLA 4KP7A 3GGDA 4II3A 3EXFB 4C6RA 3JQDA 2HWYA 5CTAA 4M1SA 4O2BB 3GXBA 2F43B 2B7CA 3IO3A 5UKDA 1OWOA 4DDWA 3H2IA 2D13A 3WMXA 3BWCA 1G6HA 3IKMB 1QG2A 2XGOA 4PYKA 5IEBA 3I62A 3KKNA 4JC0A 3D6JA 4ME6A 1V2HE 2QK4A 3ZV6A 2ZETA 3N8KA 3COPA 3D64A 4YQZA 2NAFA 4C7VA 2AE2A 3ICPA 4MWEA 1VL6A 4AMBA 2YFHA 4GE3A 2EP8A 1O95C 1L5KA 2BV3A 3LW7A 1HKUA 4NYMQ 3RFTA 4MWTA 2IOQA 3T4XA 2NZUG 2VNIA 5AW2A 1W4ZA 2XVMA 2Q4RA 3A14A 3AHDA 3ILYA 2DGDA 2XDAA 3TB4A 4IGAA 2VPYA 1QRTA 1S7GA 2P30A 3T3EA 4RK5A 3A4YA 5H5JA 3U17A 3VA7A 3ZY6A 1LSOA 1VE3A 1PG2A 2FEOA 4PS0A 2GEVA 4PX5A 4YPFA 4YMUA 4EI9A 1SIBE 5CDUA 2PZJA 7MHTA 1G41A 1HYQA 2QW0X 3LC7O 5FF9A 1Z0AA 1Z5OA 1RPNA 5H0IA 3RIMA 2QW8A 3TECE 1OFGA 4UVGA 1YDEA 2AJDA 3VR6D 3U7JA 3ZBTA 3TTXA 3AVUA 4RTLA 2HV8A 4MV1A 4PNZA 1WXEA 3WL7A 3IESA 1AMUA 5KVCA 4HY3A 3K7EA 2P27A 2NU7A 2FLVA 2O23A 3MWDA 1J5XA 3VPGA 2GR9A 5CT5A 1U7PA 1UM9A 4G89A 2H7YA 4MLCA 2OO5A 4R2MA 5TT0A 2O5CA 2ETXA 4JGIA 1ZC4A 1Q2UA 1QC5A 2A1TS 2APJA 3PV0A 4R9UC 4U6QA 2P3SA 4PQFA 5SZKB 1WMFA 1YDGA 2WG2A 1ZAKA 1ZK4A 4EENA 3PX2A 2YYSA 2F62A 3FYCA 3G1UA 1ZVVA 2O07A 2JHPA 3R7DA 4AJ9A 3M1IA 4CTKA 1DRJA 1HWYA 2H29A 3DUFB 4EMBA 4EG4A 5H1YA 5I01A 3PEEA 1AO0A 3KYDB 5HUHA 1N2CE 3AM1A 1L7BA 2O3JA 3TSAA 4OP3A 1E3LA 2C5LA 2D0DA 2ZTLA 4I66A 4MP6A 1GUDA 1XGKA 2OENG 3LHFA 1ETHA 4DMHA 2WG1A 4PZZA 3DYBA 4LYHA 4D79A 1O9HA 4DQVA 2R1TB 2GVZC 1DPFA 4QYIA 4XH9B 4A8JA 1VMAA 4M0UA 5KEIA 3G0CA 3H8JA 4CIAA 1OBVA 1OB5A 1EBUA 3RYFA 4ZIRA 4RNCA 4CKCA 2FVYA 4DY6A 3IMKA 1P7WA 4U7WA 2VOEA 4FYVA 4NEGA 1A50B 1M67A 3A2MA 4Q4AB 4D9EA 5JBIA 2PT5A 2H8KA 1K8ZB 1W87A 1YB2A 1Z3CA 3LY5A 3GQVA 1I1QB 2WFAA 3A4VA 2VOJA 1RWOA 5I7VA 4R3UC 3GLUA 2GHQA 3KHKA 4I50B 4EUFA 1NUAA 3GUCA 1JSRA 3E9QA 5E9WA 2IYYA 3CM0A 1Q1GA 4CLXA 1M8JA 1GAEO 4BVGA 3H9JA 4KQ2A 2FG6C 1OHHD 3L05A 1JMVA 4G9EA 2OUIA 1NVMB 1U0JA 2D1QA 3R5XA 5JCOA 2OYRA 4QFCA 1UT5A 3ZTTA 1H1LA 2NMVA 2XT0A 1U2DC 4BO9A 1D6JA 2LVBA 4MW0A 2ZJ7A 4JR2A 4DM4A 1QQTA 1SHZA 2PIDA 3VKHA 5L53A 1NAHA 4GX2A 2PFGA 4XGRA 1PVVA 1BHO1 1G21E 3K1YA 3WK6A 3SPXA 4MQLA 4O02B 4J76A 2IS4A 3ST7A 3HYRA 5G4KB 3EPLA 4TTRA 1QYWA 3GWGA 5DN6D 1S8AA 3O93A 2FWBA 3EWSA 3VDMA 1JFTA 1O6CA 4MVJD 4HAYA 3LJKA 1TT5B 3HH8A 4XWAA 1YR2A 5AOVA 1GDDA 1F5NA 2F1HA 4KIFA 2ZTSA 1SVSA 3VYRB 4I1YA 3KHTA 1YCHA 4NAHA 3RRYA 4JCCA 5LU9A 1HR0B 1WKVA 1ZI9A 3TOVA 1HEYA 2HGSA 4RSRA 4ZCRA 2V5VA 3OZVA 3KPVA 4PYMA 5G2OA 1NVBA 1E94E 2QLTA 3WYNA 1EAMA 4LY6A 3UC5A 2I54A 5CHEA 3T38A 1VHLA 1D5CA 2QRNA 3RTGA 4ZN6A 3VGPA 1ACJA 4JR1A 4NL4H 1KYVA 2DUWA 4BLWA 5C7LO 1JDTA 2J9RA 3GMTA 5AK5A 3AF4A 4M6WA 1NI4B 2UVDA 3TZBA 1AM4D 1K6EA 3P0IA 4YRRA 4YUAA 5J58A 1M2OB 4IO0A 5LD2B 4G56A 1OYYA 2PXHA 1N0IA 3IOEA 5AK4A 5LQCA 1NJ2A 2EQAA 2XIQA 4JJAA 5KYNA 4AUNA 1NVAA 2PMWB 3O7MA 1W5FA 3ZLVA 1P2FA 4RF4A 2HAEA 2P5UA 1TI7A 1AB5A 1GLGA 1ULUA 1BYIA 4HDCA 1FX0A 5IYZA 3QNUA 3MHTA 1OW3B 1GL3A 2IPOA 3DQZA 4IVNA 3ZVNA 1UBTS 1T2UA 2X2PA 1U0SY 1WW2A 3Q6NA 5MHTA 3RYCB 3OQHA 4LZNA 3JAMA 1KGSA 1J90A 4NCIA 5DNUA 5JCPA 4IFEA 4BO8A 2QRGA 3FGOA 1LTQA 4HI0E 1SY7A 2WW8A 2XTZA 3ASVA 2JGDB 1E6KA 3KAQA 3P8ZA 2BFBB 4O1HA 4ZT2A 1CF9A 4W5JA 4C0QC 3IMEA 3M82A 2C4TA 4RVCA 3C3JA 3E22A 1EFPB 1MU0A 2H0RA 2R48A 3HU1A 2DVMA 4HH4A 1W5EA 4K9MA 1RIFA 4LFAB 1SHJA 2GN9A 1G7RA 3D6VA 4RE6A 5JNRA 2C7PA 4QOSA 3H8VA 4P2BA 3GD7A 2HNKA 3ZV4A 4MHTA 5A02A 1JIJA 4CEIA 2MYTA 3HNOA 5DJ5A 1JWAB 2DY1A 4W7IA 1Z17A 3DTVB 3FMGA 3O4IA 1P8JA 5AI9A 5IC4A 3EIHA 2I66A 2P78A 1Y7TA 2BFFA 3G2OA 2PL3A 3HRHA 3JASA 3KVOA 1JIIA 3LKVA 3OIYA 4MS1B 4MROA 1GZ6A 2NP7A 2E5LB 1GGEA 1NDQA 4BYGA 3WP0A 3FCXA 3L4JA 3QVSA 1OWLA 3OCYA 4D8UA 1PUJA 1STOA 5J5CA 3FH0A 1Y33E 3N8HA 3SHQA 2RGEA 4U63A 1PGOA 1X13A 3KOOA 1QHEA 5AQEA 5IN5A 3JR7A 4J49A 4L6CA 3O3CA 4Z1MA 2R96A 1WZNA 3HDJA 3V2UA 4BMSA 2J67A 1KFKB 3WB9A 4PHFA 5K0SA 4J43A 4RV4A 1A4IA 3PFHA 3X1DA 3FI0A 3G85A 1NY6A 2B35A 5GPBA 4AO7A 4RD0A 4M0CA 2UUOA 2VYND 4GL4A 1XHLA 2QMYA 4R8RA 2XYVA 1BEEA 4M37A 4BQFA 1QZXA 1SVIA 4NZOA 1E96A 3KTOA 2PWZA 2AWNA 2QD4A 4QFBA 4KSCA 5CJJA 3ZHUA 4OKIA 3RQIA 3ZGYA 4XYLA 3LQQA 1UPCA 2VBCA 2Q9AA 2YC2C 4L85A 3OLWA 3NM4A 4H9GA 4J1TC 5F77A 2PNJA 3T3IA 2J5BA 2YJNA 3SVTA 1U28C 3IKLA 3DFIA 2PQMA 3SF8A 1S6YA 1L0BA 4YUXA 2GPAA 1NBWB 2FFAA 1POWA 3CCCA 1HC7A 1TYAE 3ZWBA 4RVOA 5AVQA 2QL6A 2FDXA 4RC9A 4RJLA 2R6ZA 4F96A 3JQ8A 3TR0A 3LXXA 2A9FA 2ISSD 3FTFA 5AKXA 2QW1A 1RYHA 1VE6A 4WXMA 4N18A 5B4TA 3DMPA 3Q2KA 1R8JA 2GZMA 1P81A 2NV0A 2P79A 4Q19A 3ZCRA 4QJIA 1FSGA 4LYDA 1CP2A 5LFAA 1DS6A 4RA6A 1WUYA 1GQOA 2GO1A 4ZT7A 4LTNA 4BVLA 3FX2A 2ZS7A 3LOQA 1O54A 3E4CA 1M6EX 1VIMA 4M9ZA 4MS3A 3B38A 1RJGA 1KE1A 1BFKA 5DCLA 1KQNA 2CVFA 3FNHA 3RFVA 2REQB 2JHFA 3PC8A 4H6PA 1V1MB 4WJKB 1SKQA 4XM0A 2Z2KA 1TZMA 1PEAA 5LNK1 2MCFA 3AL0C 2W8BA 3EUWA 3PC7A 4LSWA 4C0HA 4EO7A 2Z57A 3GEDA 4HTFA 2GK6A 2FFBA 4JVLA 5ALZA 1UBCA 1V3VA 1XZIA 3OSZA 5LDGA 1GUBA 4N0EA 5ELMA 1W2GA 2PRJA 3C3MA 1LLDA 3UBTA 2ZSAA 4B8ZA 4QBIA 3N9IA 3GRVA 1Z6QA 1LV8A 3PGA1 1XU9A 5BV7A 1VJRA 3QYAA 3I0NA 2JIZD 2O1SA 2XE4A 2YH2A 2UZ3A 5HM8A 2X5JO 4OLAA 1DBQA 3T1NA 1W0KA 3QYPA 4PYOA 3ODPA 4AUMA 1PI3A 1Z2NX 1HLGA 3G49A 4M7PA 2F1OA 3PF8A 3ZD8A 5A9SB 1J0EA 5ITWA 1VE1A 1GEGA 3KT8A 2OHVA 1GU0A 3DMNA 2REOA 3C1UA 3C3CA 4BE9A 3QFRA 2Q5EA 1SUIA 1R8XA 3KEGA 1QZ3A 2ZRLA 1E5QA 4OPMA 3ZDQA 4CF7A 3VC1A 1K5DA 2YMLA 2SCUB 3STTA 4ANFA 3ELUA 4NOMA 3MTJA 1B1CA 3U16A 3ZI0A 2D4HA 4EY4A 4JMPA 2C3OA 2NNLD 1R6AA 2XGGA 1ONPA 2D1SA 3GCWA 1UQRA 1X14A 3K92A 3WAKA 2CVQA 2W71A 1WEKA 1C8LA 4YRPA 1T34A 2FW0A 3SQMA 3WBBA 1LD3A 3DFZA 4Q3AA 4KFTA 3UAVA 1VP9A 3LLVA 4KQEA 5D51S 5J47A 2OZKA 5FPKA 4IIJF 2ORED 2WDZA 1L1EA 4NYMR 1JG3A 1W8DA 1XTIA 1RPJA 1MQ8B 2WAOA 4FFVA 2C96A 1OLUA 1EVJA 3C7KA 1PO7A 3JD0A 3NW9A 4ZANA 3ZGOA 1MC4A 3I01M 1R0SA 2Z1MA 2GPTA 4DIDA 5JS7A 1N9GB 4JP2A 1XALA 4A10A 2PA3A 4ZVKA 4ZCMA 3LK7A 4Q34A 3VV3A 4WNAB 3ZIAA 4DANA 3JY6A 1WXHA 1JYSA 3W5AA 4BY9E 1CY0A 3R9KA 1XLTC 2WF5A 5E3HA 2C1XA 3QPVA 1WZUA 4JODA 3M33A 4F6RA 2XE7A 3ZK7A 1PW5A 2MR6A 3DE3X 3ZV3A 4X41A 3ZDAA 1UJ6A 1JDUA 5I7SA 5HOEA 3CVXA 1WZIA 4O2AF 3WZLA 3QLEA 4PRKA 4CR8A 2FZWA 4TKVA 2OR3A 3L8DA 3PHLA 3PD0A 5E3IA 3MS2A 3T61A 3STXA 3UO8B 4F60A 4BNJA 2H1RA 1ZWLA 2YXEA 3QBVA 3K9WA 3DPUA 1YJ5A 2DU8A 2CB9A 4ZOLF 3DMDA 3GFVA 2FJ0A 3NDPA 2F2TA 2QMOA 3IDOA 5EKSA 5DTMA 4ZP1A 4TWZA 2KLBA 2IUTA 2NYAA 3O90A 1PFVA 4RFSA 1C9YA 1QX3A 1SNYA 1Z9BA 4R9NA 3RFXA 1OA1A 5FTWA 4XCXA 3MMNA 5K3FB 3LHKA 2AEFA 2PZ8A 1UT6A 4OG2A 2PSDA 1F38A 3B48A 3IPRA 1NL3A 3JQ7B 3ITEA 2E5FA 3FUWA 3FD8A 1G0NA 1PK7A 1Q92A 2ZXUA 3CINA 3GNSA 4Q6BA 3FYDA 4BQPA 1J42A 3PXCX 1RAIA 2C5SA 4HHEA 4TL6A 3LPNA 4XVUA 5LXTB 4EH1A 2GRAA 4DQLA 1ZX1A 2NXEA 3OLYA 2F67A 3IS3A 3LFHA 3KEOA 3WBJA 1F7UA 1KH2A 2F1RA 4LDPA 5MN4A 1E2IA 5TLSA 3KBOA 3TS1A 1T5OA 1D5WA 2IZ7A 3OM0A 2E1RA 5KJ1A 1JXAA 4S12A 4MR7A 5AO9A 3IP1A 5C7YA 2FPWA 1N2ZA 1FLVA 4KGXA 3PJEA 4FYIA 4ZDIA 5JU6A 5HIIA 3ZHTA 1N1DA 4W1QA 4CIYA 3CNLA 3QX7A 3RC9A 3TQIA 5JECA 1YBAA 3F2IA 2DBQA 1MC1A 3A6JA 4YREA 1NX9A 3LGXA 4OSPA 1MQAA 5IPFA 2RB4A 2OV1A 1XQ6A 3CEMA 3DEIA 1TJ4A 1MH9A 1DLJA 1TCUA 1XBTA 3MJ4A 4W99A 5CIWA 3R7WB 3C7TA 4BV9A 4V2IA 4DSAA 5BN5B 1JDNA 4EO4A 1HFJA 2VCHA 2PVPA 3VHQA 4FMBB 4Y0VA 4JXJA 1XD2B 1O3YA 2VXYA 4ND5A 3KPYA 3RC7A 4EB8A 2I2DA 5JMWA 2EHJA 3ECAA 4HN9A 1LBHA 4IZIA 4PX9A 5EQTA 3QEAZ 4YRQA 4L0CA 4D98A 5CDFE 3MTEA 4UBIA 4QX6A 1J8YF 2OK8A 3PHBE 3RSHA 3WQSB 3CEAA 4GBGA 4TQGA 4UUPA 1G59A 1TM3E 1L3IA 1OD6A 2B5OA 4CI0B 4INOA 2OGWA 3OC0A 3CJQA 2VJAA 2V7TA 4TMZA 4GU5A 4K5QA 2PO7A 4M0MA 4EFMA 5KKNB 3LDAA 4FGLA 2KPOA 3DZJA 5EN4A 4XQ9A 1N2GA 1W4CA 3KLNA 2BTQA 4L73A 1MX3A 1UUFA 4LHEA 4TL8A 5CTJA 4EJ0A 2EGUA 5TQ0B 4AN1A 2ZBRA 4BMZA 2A35A 4L4SA 3GGJA 5B64A 2A9KA 2OK7A 3GDFA 4FFRA 4V1CI 1Y5LA 4F56A 1NYLA 3HFGA 3IUYA 4EVRA 1E2DA 2GTIA 3C3BA 3N2KA 3N8IA 2G1AA 3D6FA 4R9VA 3LYLA 3AH8A 5HKAA 1Z73A 2ZAIA 3IDQA 3G9QA 1G3RA 4BEWA 2QTFA 3I4FA 3BDVA 2ZRKA 5EINA 1DO0A 4I7EA 4B4DA 4EVQA 5H70A 2FEXA 4L8LA 3MN1A 5AHXA 3K6KA 1BVYF 1L7AA 1SOWA 4TV9F 1ID1A 4D0NA 1BYUA 4DUGD 4F8EA 1ZRHA 3FOWA 5AVJA 4DGQA 2AS0A 2PTHA 2IYVA 5JRDS 1Q77A 4CKYA 3DZKA 3JVUA 1HMPA 1MUUA 1NSTA 3ESBA 2CXTA 4KSYA 5DIFA 1B6GA 1K98A 2QVLA 1JB1A 2WAMA 3L6BA 4D7AA 3ECSA 1E64A 4E6PA 3WWDA 3QLTA 4HDMB 4LF4B 4FBLA 3BKXA 4LGMA 1AGPA 1U0LA 1V9SA 4IEEA 4LWQA 5CFLA 3U80A 3V8PA 3IVAA 3EMKA 3MUEA 3E8MA 2J32A 2HFKA 2IHUA 5G3ZA 5C4IA 3A9RA 2GYYA 4U5QA 3HCNA 4QYTA 4XUGB 3TFQA 4TQUS 5F23A 3CNEA 4AB1A 5KS2A 4D6PA 4OBXA 5HIMA 4INJA 1YIDA 5SYNA 3TQRA 2FZ5A 3GFOA 1EB8A 4BAZA 3QNWA 4OP1A 1T2NA 4YAFA 2OO3A 4F4HA 2UUBB 1ZNXA 4QDTA 1MB2A 4Q3OA 3DDZX 2XR1A 2JS7A 3UHOA 4BNGA 1SVNA 4HX5A 3K0CC 1F4VA 4M1ZA 2UVQA 3ROFA 1FPMA 2J5KA 4AD8A 3EF0A 4J94A 3VOAA 1VJDA 4EF5A 4I3GA 5DYTA 1Q50A 2NZ8A 2PX3A 2UYOA 2WUFA 3I2GA 5AR1A 4IDFA 3RS0A 3EA4A 3RAFC 4FB4A 1J24A 3DF7A 3WHIA 1T8SA 1A8QA 3FYUC 4P38A 1THGA 2WQ7A 2VTBB 1JWLA 1IOLA 1IE3A 3UPTA 3MVEA 4MICA 3ZZ1A 3F5FA 3BD6A 1GPBA 1L4NA 2R7LA 3A3PA 3PC4A 4G67A 4NIMA 5JSKA 3GEGA 3D6TB 3L0CA 1TKRA 4MEJA 3TIGA 2R9VA 1ENYA 1GZHB 3E7FA 3IUMA 2VDQB 3PL1A 2XB2A 3FVTA 3L6UA 5LLTA 4CV3A 4D2IA 4B6RA 3U19A 1TL7C 1Z6TA 1YQGA 1KEEB 4JDUA 4QM6A 4Z51A 1RS0A 5FOTA 1CRZA 2WPDD 4HNVA 4DCUA 1BE8A 4H1HA 1J70A 1YWGO 4OO3A 4Q9KA 2BGWA 2RJNA 1Q11A 1YZUA 3QBDA 1EK5A 4R4JA 3IKVA 1FRVA 3JQBA 4QULA 4YP5A 5HFJA 1NE2A 3FHCB 3VDXA 1KXJA 5ADWA 3KELA 5I6DA 1YJAA 5KYWB 1Z7EA 2W4MA 5K4GA 4J7UA 4RTPA 5AW8A 2Z2XA 5GM2A 2R8OA 1A77A 2HMVA 5AVYA 4A0GA 5FOXA 3K1ZA 5M04A 4E11A 4KLZA 4DCGA 4D45A 1R37A 3L07A 4RY9A 3DSRA 5ERYA 2HCRA 4NJMB 1A4UA 4EUKA 1JBEA 7MDHA 2W93A 3GVXA 3V8NA 1T36B 1NW8A 5DWVA 4R2HA 2WHQA 5F7JA 4BO1A 1XTSA 3YASA 3QOXA 3C8UA 2O4CA 4FCVA 1CQIB 1CUGA 1UJ2A 4E5SA 3SF0A 1NRWA 4YCNA 1O96B 4P36A 3EAQA 3OQJA 2AJBA 4N8SA 2FLKA 3SKXA 3P52A 4DV1B 1FA9A 1X7WB 2VDVE 2KJQA 2Y77A 1VCHA 4H6XA 3DB1A 3ZZUA 4GSKA 1M2VA 2PX4A 3EBOA 2ZI7A 2J8ZA 4G1UC 3NPMA 3IB6A 1I6WA 2VKTA 4F45A 1AKYA 2VBIA 5EJ6A 3R7SA 4D26A 3C74A 2YWDA 3RC3A 4LVUA 4NPHA 1I8TA 4W9NA 4BVBA 4M83A 1H05A 2NTNA 3NTRA 2H5IA 3VC3A 3DW1X 2GJAA 2AB0A 5CM8B 1LBSA 4J0GA 3TQQA 4G0ZA 3S7TA 1XA0A 2ERCA 1SD1A 4CTMA 1XP8A 2VWHA 5BOSA 2QRLA 2RHOA 4Y18A 1NVFA 3DAYA 3LBAA 4XOUA 3VR4H 1YB5A 3DZHA 1LLFA 4WXRA 3ZDFA 4GXQA 5KC9A 5AESA 4G5XA 4NCXA 4BRSA 3IL2A 2W37A 1LLUA 1FS5A 1YZKA 4JSYA 3R6DA 3BD7A 2VUUA 3DM5A 3OCVA 3P0EA 2AL7A 5MF6A 1Z4OA 4G5YA 1UJNA 4K6CA 5A2QA 3CC8A 1MA0A 1OXVA 3L4SO 2OFOA 5FL7D 1Z2PX 4C4TA 3HACA 1O77A 2RHLA 3MQ4A 2GBLA 4N5LA 1VI5A 2F3UA 4R05A 3GHHA 1KO1A 2WF7A 4WFKA 4HWTA 4YP9A 2B8JA 2XMZA 5BSUA 2G4LA 1ZONA 5KNCH 1OIWA 3SEAA 2ZUUA 4MQEB 1OOEA 3FPCA 4LXXA 3AU9A 1IQUA 3R3WA 2PKXA 4FE7A 4GZ3A 3K1JA 4M76B 2XWBF 4YCMA 5KIAA 1N34B 4RF5A 2GAJA 4KRGA 1KDZA 2HTFA 1RC0A 1AUOA 1P1IA 2HRRA 3IILA 4LHVA 2FW7A 5CVVA 5EI5A 1ZCJA 5KQRA 2PDAA 3ISJA 4TT8A 3CJTA 4B7ZA 3WKAA 1KH3A 1OF1A 2VJPA 2VNHA 4EG1A 3EZXA 3NYQA 4Q1BA 1RBMA 5B6PA 4RA9B 5L6MB 1RRCA 4UEQA 1ECGA 2VQSA 3I9KA 1C8VB 4X8OA 2F48A 4DMFA 1AN9A 1FU7A 3HCCA 5AI8A 4S24A 5DNAA 1AUPA 3GLVA 4REOA 6CHYA 4FDMA 3K9HA 1WMBA 2AOTA 5HS6A 5ALDA 1IEXA 1MV8A 2VH1A 5IBQA 1KYYA 1PWZA 1BGVA 3VU3A 2I29A 3DOUA 2WWWA 1QG0A 2C8KA 1A2QA 2QTLA 4BQEA 1M9NA 3IP9A 4JJFA 2AG8A 4NY1A 1LDMA 3P96A 3EQ7A 4IS2A 3V8MA 1MX1A 3VJKA 5K7SA 2VTEA 4FLMA 3QEBZ 2R7NA 2NNWB 1NOKA 4GMFA 4L8VA 5DBEX 1ZD4A 1LH0A 1LK5A 1T0UA 3PEVA 3WLFA 2Y0CA 2CHQA 3SEZA 4B3RB 1MO5A 2C9CA 5HKOA 1NKVA 4KIWA 1MQSA 4MLZA 3G2HA 4JJKA 5DLYA 4GHWA 3C45A 1Z2CA 3QUQA 3F5SA 5K3SA 1Y3FE 3WGGA 1U3FA 3GEEA 4FI3F 4BLSA 3KBBA 2QRVB 1BDIA 2FSVA 3WE7A 5A04A 1Y6JA 4UE2A 4V38A 3DMTA 3S99A 2ZSEA 3U4HA 1TJPB 3RRJA 5TVGA 1GV0A 2WHRA 1V96A 3IDFA 3UATA 5IKMA 3O92A 2VP9A 1ULSA 3N6RA 2B61A 3TSCA 1I24A 3VVCA 1CRLA 1GFWA 1V8PA 3H2YA 3QW4B 2IIVA 2F1KA 2WUDA 3C14C 1X1TA 1SZCA 4REQA 4X63A 3X2FA 4GL2A 4NNJA 4JUIA 2JJMA 4IHKA 5ECGC 1DVRA 1WB5A 4WA7A 5FFMA 4AS2A 5KPJA 2ODTX 4I4TA 1RBZA 1XO1A 4OVKA 3CPEA 4YGXB 3NGXA 2GS9A 3QHQA 3ZBUA 1KEKA 1QRUA 1GZVA 3U40A 3MGBA 5JNUA 2RGNA 2OQ2A 4DGSA 4WOJA 3EVZA 3L92A 1HOTA 1UH5A 1IY1A 3USCS 4YJGB 3T5TA 2BH9A 4B0PA 2RDMA 3HXKA 3VZDA 3SYRA 4QSHA 1KL7A 4ETWA 5DNYB 3TSZA 2VT2A 1JZQA 5GZ1A 1PVDA 4FDUA 5DTJA 3VZPA 5EJIA 2UXBB 3GB9A 4AJJA 4EJ2A 3A58B 1JR6A 1M0TA 1NJGA 1ZM2A 5EUQB 4PG5A 4K28A 2FFRA 4C3UA 1UJ5A 2V1UA 2IBMA 1CS0B 1WZEA 4GX5A 4PS1A 4GZLA 1Z25A 4MV0A 5CX1B 2KBEA 3G8BA 2FP4B 3IFSA 4KDRA 4JZYA 3H0CA 4MIEA 4LRUA 3TTWA 1COWD 3KQSA 5ALHA 2GCGA 5EWLA 4D5GA 4DL9A 5HOQA 1PJ2A 2J9ZB 2VF4X 2YJ5A 3GDWA 1Z0KA 3HXTA 1GAWA 4RF2A 4C2BA 3S1SA 5CCEA 1U80A 1B73A 2CC2A 2E3JA 4RYLA 4CLRA 5JOQA 3PDJA 2O20A 2JD0A 4JBXA 4I1IA 2H4WA 1E0JA 1X7YB 2VG8A 3JAWA 4RY8A 1JHOA 1W93A 3EPPA 3UOGA 4RACA 1DBRA 1X19A 1LJUA 2I1WA 3GA0A 4PY2A 3K96A 2W2TA 4JLBA 1CUWA 3DVAA 4ZZ2A 2X3YA 2FDRA 1TQ8A 4EG7A 4UTRA 1AKEA 4FHGA 2FR1A 2FRDC 1ULZA 5HF5A 3OX4A 4RH1A 2IYWA 1ZH4A 2BKXA 3PSHA 5ALUA 1TYEB 2FEKA 1ESCA 3MINA 4IRXA 3LW8A 4O1MA 2XRYA 4JI8B 2P2LA 4DHEA 1XZHA 2OV4A 1FPQA 2CLSA 2L19A 2QXUA 4KO1S 3GJ3A 1AA6A 2Q1TA 3AESA 1GNQA 3NOXA 5KAMA 3PB3A 1NPDA 3SQLA 1PV4A 3CMMA 5KYUA 2OSVA 4L3VA 1KJYA 4RZSA 3JWEA 1GT91 2ZULA 2ZJBA 3D3NA 2Q6IA 2AN9A 1L7XA 2XUJA 1LK0A 3LHIA 1N6IA 4B74A 5A6SA 1FNSA 5DULA 4E1AA 5JISA 3USZA 5ENDA 2QWXA 2JIBA 3HRIA 5IARA 4G24A 5IKPA 1TZ2A 3VR5D 4GKBA 3DULA 4ZFNA 4H0FA 2YJ4A 5LP6A 3WQQA 4Y7DA 1NBMA 2CLMB 3KKPA 3LLSA 4DYHA 1NMQA 4N39A 3W04A 1ZL2A 2Q8NA 4KMOA 3ENZA 1XVLA 3RT1A 4O4JF 1JQAA 2OHHA 3L0BA 5ALQA 1PL8A 1U7UA 2PX2A 2H9AA 4Q7JB 4IXNA 4XWYA 5B6JA 4QOJA 4OH7A 2IPXA 3ICWA 4LQCA 5U1PA 3GLIB 5FAXA 1Y8RA 1XXHB 2IIPA 2J33A 4YWJA 1ONBA 2A30A 4G85A 2VH5R 1UXJA 4LBYA 1O5TA 4OQMA 5CURA 4CG0A 3G0IA 3EY9A 3VH1A 3O2QB 4EL5A 4ZI2A 1FJ2A 1L1QA 1XAGA 3D59A 5CYPA 4BZPA 2PM8A 2WLTA 4MUKA 2WU1A 4XIIA 2A88A 1GG9A 1Z0SA 2IF2A 1Z36A 3GZNA 2BEVA 3KZXA 1JA1A 3LQRA 4OQPA 4C0LA 2GBFA 4Q3DA 2PGXA 3CXRA 3HDQA 2NV2B 4IDBA 1C30B 3M4XA 3DMRA 1QCYA 1KJIA 5ED0A 1MXHA 4NBKA 2SNIE 3A0UA 3WLIA 1VECA 3UA3A 1R12A 1GUAA 5A5GA 3V2IA 1T9BA 3RJ9A 1OZGA 2WIGA 1EGHA 5LQMA 2ZIZA 2PV0A 4AX8A 2Q4TA 3HDVA 1MNQA 3I28A 2C3PA 1NR5A 2YOHA 4BTEA 5JY6A 5GADl 5BSRA 5I4IA 4WOPA 4G0YA 4EZBA 1WS6A 1DEOA 2XVXA 3N0VA 1Q21A 2DULA 1U8CB 1A9YA 1SIOA 2P77A 2QLJA 3MPOA 3Q12A 4J03A 3UHPA 3ZQKA 1KSFX 1CJMA 2OT3B 3GF4A 4LC9A 3G0OA 3LT0A 3HLYA 3QBEA 4PAQA 3AJDA 3WDLA 3UK7A 3ZOZA 3PG5A 2OBLA 4QUBA 3BT7A 1Y6QA 4LJ8A 4UARA 1MB3A 1HV8A 1P2SA 2JI6A 1AXEA 3GELA 5HKBA 3BH6A 2HREA 1ZIYA 4ZT4A 3S28A 1WSWA 1QUEA 3SKYA 4RD6A 3IAFA 4AULA 1FY2A 1X42A 4WXEA 2OP0A 5L3ZA 2FE1A 1NKSA 1FFXA 3CRZA 3CXUA 1DARA 5K3EA 4XGKA 3D7SA 2WP8J 1BIFA 3OF2A 3PNBA 2Y0DA 3AXSA 3D7LA 3VNVA 1RMTA 2HPAA 4L4UA 2ZSBA 4A2PA 3Q8LA 3ZIUA 5LWQA 4R3NA 1TJYA 3KE8A 4CKWB 4YAGA 3K9FC 2GEJA 1YT5A 3R74A 2PKCA 1RHQA 3JATB 5A0FA 3GAZA 2R6DA 4HWGA 4IF4A 4FBGA 5MN6A 3BWDD 4CMIA 3K70C 2YOFA 1N2CA 3JD2A 3TLKA 5C9ZA 3CVWA 5CU7A 3BIXA 3DH0A 3HB4X 1QFMA 2ZYTX 3P5BA 4LXGA 5TE9A 3ZCUA 1KBOA 2QTWB 1HQDA 1NHGA 1OU4A 2DP4E 2I99A 4G2NA 2B2CA 3EWAA 2ZSKA 1MGOA 4DBZA 3SVZA 1N0WA 4B2PA 1IK6A 2VLIA 3DP7A 4MW4A 2NP6A 3I9LA 2Q6KA 3FTEA 2R00A 3G2MA 1L9XA 3K0AB 5FA5A 2EJBA 1EXVA 3WOHA 1C0KA 4YRMA 2IOYA 2XWJI 3OPYB 3FPJA 3E7XA 3OAAA 3QA3E 3W4KA 4JLVA 2XBMA 5EYPA 1THTA 1Z5ZA 1P1JA 4HMQA 1ZJ5A 2H18A 2W8ZA 2OESA 3MAJA 3AGQA 2YY5A 3HWWA 5CBPA 3ZGVA 3TLEA 3G9ZA 4MJ3A 2GM5A 3OI7A 3T7CA 4FYKA 3U09A 2XUHA 3B6IA 1FUEA 2VDWB 3N7TA 3WWYA 2FUCA 1OI7A 2HQRA 3LT5A 4K0KB 4TYYA 1Z5NA 3DHYA 4CTJA 3AF5A 1XLUA 2VP6A 3KKMA 3M83A 4UPDA 4W5RA 4MR9A 2WKSA 3H1PA 3KHSA 3T15A 5BXYA 3PUYA 5EMNA 2FEMA 2YICA 2J41A 2EX0A 1C3LA 4JL5A 3K70D 4YMHA 1C3JA 3A11A 5THKA 3RIYA 4RVUA 1G21A 2CV0A 2C5AA 4C1BA 1JQBA 2CD7A 1YUBA 3GBSA 2VJMA 3RRNA 4HK4A 2RAFA 4B32A 1L5LA 2C7OA 2LW7A 9ATCA 1T24A 3EARA 3VNQA 3L8HA 1GDTA 3FY4A 3Q6IA 2XE6A 3L3BA 4DVGA 3LDGA 5EMHA 3RC1A 3W77A 1YU6A 2RGBA 3IUEA 3FW1A 4ES6A 5HYVA 1VI2A 4E5DA 3L4KA 2AVNA 1D4OA 1Y4UA 1TO6A 2QGNA 4RESA 4DA4A 1Q16A 3IBCA 3TO5A 1FRZA 2H00A 1UDCA 3AYXB 3BIOA 3BMXA 4N03A 1EFAA 4C29A 3K94A 2WTBA 4AF8A 2Y6UA 3JQFC 3WYFA 3MMSA 4GSYA 2WU8A 2V5AA 3DDSA 2P5SA 3RC2A 5JBNA 3U4QB 2VHYA 3UXEA 4EFLA 4L4ZA 1ZD1A 2G0AA 2ZXEA 2Z98A 1Z34A 4HGOA 2WMDA 1XPRA 5IUNC 4KYVA 3D8SA 4QPPA 2NO0A 1UFQA 2WFLA 1R6UA 4P4SA 4CE6A 1LC3A 2GRUA 5IUJC 2QD5A 3CR3C 1AZSC 2G9QA 5GJCA 1WNFA 3KLPX 3MELA 2M6KA 4YV7A 1Q74A 2LPMA 1P75A 1ZS9A 2CFCA 3INTA 3UWDA 5IASA 1PUXA 2BR4A 1KJ9A 1EX6A 2CDAA 3LPMA 2DEUA 5EE5B 5EXSA 3I5YA 1J8QA 4PVCA 2BMWA 3ESXA 3DLIA 3LPCA 1Y4ZA 3PHHA 1KNXA 1QIDA 1WB6A 2QLBA 3JYNA 3GAMA 4PLFA 3D4LA 4BX2A 4DLSA 4ZDJA 3AB8A 4RELA 3LP5A 4GM4A 4MW7A 3A1WA 3A9UA 3JARB 4X54A 5ER6A 1R10A 2BLNA 4EKNB 1A5ZA 1H65A 5CD1A 3I30X 2ZRDA 4IG9A 4YMIA 5F98A 4DAEA 2ID8A 3HEBA 1FJXA 4RTOA 2H1IA 3LBIA 3OVMA 1YB4A 4LFCB 3WL3A 4CMHA 3HB0A 1JR4A 5FLEX 4C01A 4NFLA 3BAZA 4X94A 2PT9A 2IU4A 4BPRA 2IH4A 3QWHA 3W7AA 5JXGA 4KVFA 4L4RA 3I9FA 5HMLA 1RQ7A 3AM4A 4TZKA 2B99A 4X1YB 3IIEA 1G3UA 2AG5A 3IAUA 1V5EA 1C3XA 1HEIA 3RLIA 3DG9A 4K2AA 1SB9A 4E51A 1J2JA 1N5MA 2NAPA 3KXKA 4JZKA 2FK8A 2VQFB 4OBWA 1NC1A 2WBLC 1J8MF 4XDYA 1TUBA 1L5NA 4AECA 4BATA 4E1BA 5EZYB 5ALSA 1AZTA 1HY3A 4J29A 4QDJA 5PGMA 4EZIA 2GPWA 2VF2A 5KOIA 5EJEA 1XRQA 1KZYC 1H9AA 1W0JA 2NTVA 1JKJA 1I5EA 4KWTA 4RENA 3LLCA 1A27A 3O5AA 2BGNA 3Q1KA 3ZHRA 1LV7A 2TMKA 1NQAO 4GLLA 1OYVA 3ETEA 4TXHA 4LVOA 4MQ4A 3EJWA 3HR8A 3HJBA 1RJ9A 1XPUA 2CJXA 3AONB 2ORYA 3T06B 4CQJA 2NQTA 2AR0A 1GGHA 4CF4A 1WXWA 5CJPA 3U7GA 4NQRA 2FHPA 3P0FA 1QVAA 4FYPA 4L8YA 3TVTA 4NU5A 4QAJA 2JPDA 3L8ZA 3ZJ5A 4KREA 5KVSA 1SA0B 2NZXA 3L01A 4G0XA 4E1VA 4L76A 2BHTA 1XTQA 2NO5A 1T0BA 1H85A 4OHCA 3O95A 1TQ2A 3MD9A 3QG5A 1Y9EA 4P3YA 5TR9A 3UMMA 5TS3A 1T8WA 2X2EA 1NZJA 2DJIA 2DR3A 2PKEA 2VUIB 4PYLA 4ZQGA 1OE0A 3SIPA 4B3GA 5JQGA 1F8FA 1IMOA 5FEMA 3Q3CA 4OMCA 4BIIA 4HB0A 1JL3A 1GKUB 3DR3A 1XKTA 5F4BA 1NMYA 4F8YA 3PQCA 4AM8A 5K8TA 1NQOA 4OHFA 3C4JA 2C3YA 5A06A 2KSQA 1Z5PA 5CA1B 5A9TA 1CKEA 2QYOA 4DSUA 3KAJA 1Y4SA 1ORWA 1CTQA 4WERA 2VBGA 1KJNA 3MFQA 4ZRDA 1NT4A 1WD7A 2PJUA 4OX9Y 5TX7A 3IULA 1YR8A 4J0JA 2CV1A 1N3YA 2PNFA 2W2QA 2X4DA 4O2LA 4QRIA 1WG8A 2IS1A 1KFBB 1U1EA 5K6TA 1JPUA 4GQBA 4MUEA 5BOVA 3TL2A 1YMQA 3M5PA 4F71A 1QYVA 2D5LA 5JLAA 2G25A 4JMLA 1PUIA 4ZALA 4LK2A 2Y92A 4JUCA 1K7SN 3Q0TA 1OFTA 4TXNA 3PR1A 5CH3A 5D86A 4W4TA 5TRTA 4TMYA 3JD1A 4OHXA 1OXSC 4EPTA 5C8YF 4Z2YA 4GPIB 4KN5A 4ENQA 4ER7A 3JZMA 4FB5A 2AF4C 3RF7A 3MJVA 2HMTA 3Q7TA 1GGFA 3G5LA 5JT1A 4IMRA 3T99A 1CZRA 7YASA 5K3OA 4IMIB 2FZ4A 3W79A 1M7GA 4J3JA 1D2NA 2XZOA 1T6ZA 3OCJA 1RI2A 3TGLA 3ZXSA 2RGXA 1IM8A 1PKEA 1UOPA 1Y7IA 3S44A 2UUAB 3CY6A 1QO0D 1TJ5A 4HXYA 4KUHA 1RAAA 3E9ZA 3CB2A 3Q5GA 4IHJF 3T35A 3F5DA 4MA0A 1UBKS 4M0PA 4JQOA 3EXHC 4Q7MB 4DA6A 1OI2A 2NADA 1G5RA 3ZHBA 1EP2B 1YCGA 2D62A 4IIDA 1JSLA 4RABA 4X8MA 4QA9A 5IDYA 4I3FA 1NDUA 1A1SA 4ZI5A 4S1NA 1JU4A 1RYDA 2B36A 4Q9AA 3NKFA 5AM4A 3LL7A 2O2JA 5AH0A 1W94A 2PKRA 2OEPA 2AXNA 2V8BA 3PGJA 3Q4GA 4OK3A 3ANYB 1ZZGA 3WK7A 2VZ0A 5E6SB 5AIBA 2DT5A 3BAFA 4HQ0A 3DXXA 2I3AA 3PFGA 2AGVA 4FMDF 4UUNA 3V46A 3FUUA 2FSIA 3WNBA 2LCFA 5JUWA 1H93A 1GU1A 3B6MA 4LZJA 4PONA 3EPHA 2O7SA 1V43A 1HLDA 1HT2E 2J5RA 2QYTA 3KUDA 4IYJA 4IM7A 4PC2A 3L04A 3QOYA 4TV8B 4AURA 1WOMA 2ETVA 2WR8A 4QWWA 2WWXA 5ES3A 5BYJA 3NMUF 1U8UA 4JVNA 3I58A 1BVHA 5EP2A 1PWEA 3E9YA 2D2VA 1CJSA 5BQOA 4CKBA 1UPTA 1PZEA 1SVMA 1DXHA 3AR7A 3PUHA 3O8QA 4GRDA 5ENZA 4BRZA 2HC9A 4OQEA 1G4AE 4Z54A 5CT8A 4W6QA 3SJUA 1Y9ZA 2GA9A 1PT8A 4C0BA 2EATA 4JEIA 4D4IA 1CNMA 4JJ7A 1NNUA 1HDRA 1GPUA 1PW7A 1RPTA 1UC4B 3E9NA 1M1NB 5TDHA 1C0EA 2YN0A 3EXAA 3KOYA 4GOJA 4PZAA 4LF5B 1I4DD 4CMCA 1A0OA 221PA 4BO0A 2W4IA 1A95A 1MV5A 2Y4NA 4FW9A 4MGIR 5D2CA 3TBFA 3U5TA 1WHTA 2C4NA 4A4DA 5ALKA 1ZM4A 3OZFA 1DL5A 3GRAA 4A7PA 2XHEA 2YQZA 4HYEA 1TM1E 4WFJA 3TE6A 3RYTC 3H99A 1YGYA 1US8A 2PIAA 4ZU6X 4E2ZA 2O4UX 2QAJA 3L7NA 3O0TA 4FMPA 3COJA 3GGCA 4P32A 3VISA 2RGDA 2ZBGA 3BRWA 5DB4A 3KJIA 3I52A 3VU0A 5J1SB 4L27A 1EWVA 3VHLB 1T3SA 5FDFA 1BXGB 4WD3A 3QU2A 1QIIA 2W48A 4YRTA 1VE7A 5E8JA 5EMLA 5B1EA 1X6VA 4NULA 3WLKX 2R8XA 2GARA 2QEQA 4FE3A 1Y8ZA 1BH2A 2PAFA 4BC0A 1YJ8A 2PH1A 3TPZA 7GPBA 2I4TA 4KKXB 2VJKA 4FK8A 1MIOB 2OILA 1F17A 2OV6A 2WT8A 2X9NA 3FHLA 3O75A 4JELA 2BGMA 2GCOA 1ICEA 2R5NA 1PX0A 2D5CA 1YI1A 4Y1FA 3TJMA 1O4WA 1QFYA 3HB1A 4ITRC 4AP5A 2G70A 4YMLA 3DHWC 2Q5LA 5KYXB 4E94A 1Y8QA 2YMQA 3AUUA 4UFNA 4KXWA 2NTJA 3I4LA 3DOEA 3TD2A 1KI4A 2C2MA 5MFPA 4MS4A 4IUYA 5FR1A 4HWRA 1JFSA 1WCIB 1L4FA 4MARA 1P7ZA 1U5AA 4BNIA 1GG2A 1PS0A 3WYGA 5EP4A 2VC2B 2PFKA 1J1IA 2YV5A 5CB4F 4MHOA 3U5ZB 3M4NA 3ESRA 1AK9A 1WM1A 1XTTA 2WJIA 3G2JA 1C3EA 2JC3A 4TKUA 4ZAGA 3PWKA 3TSWA 4EKIA 3TLZA 1S1MA 1JA9A 1W19A 5JDCC 2EFDB 4KU4A 4IVQA 3REGA 4EKEA 1XKXA 1ZD5A 2JA1A 3MWEB 2JGRA 2QQGA 1KS9A 1ZP6A 4BKRA 1U9JA 3F6PA 1AJEA 1JJBA 5BN4B 4BWYA 1G1AA 3DKPA 5REQB 1G5TA 1P44A 5F64A 3PNKA 1VTKA 4MP3A 5DHSA 1Y6ZA 5FULA 3FMPB 1KYQA 1W4BA 3AF3A 1E0SA 3KQUA 1N0HA 1W76A 3MCZA 1GA1A 4QO8A 4D80A 1LWOA 4LFBB 2AOVA 2IEYA 2LV8A 2X7XA 1M5RA 1SXJC 4JT9A 3GDGA 5CDFA 3T12A 3EA5A 4RORA 5GY7A 4UCWA 5IK2D 4QAQA 4C21A 5E6RA 3RW9A 2PUJA 3NQ41 4ZZ0A 4IV0A 1N5KA 3OPVA 2XZLA 3RSLA 3B52X 2CXPA 5L7YA 1UFVA 1N3LA 3HKCA 4BQQA 3TTVA 1OUMA 3AOEC 1PQPA 1T3LA 1CY8A 1NXXA 1UJBA 3OCUA 2ZE6A 1P2TA 2PA0A 4Q02A 4QHTA 5DCWA 3V9PA 3W5IA 4BCBA 5FTLA 1SU6A 4ZOLA 2QN1A 1EFVA 1QGUA 4JKOA 2X7JA 2OAQ1 4N8EA 3QFTA 3W5CA 4BFYA 2PU7A 5CGQB 1M7BA 1M8FA 3GJRA 2QX8A 1NPTO 3B1JA 4GOND 5KYTA 3K2IA 3HE3A 4FIZA 1WLSA 5LCXA 2BFEB 3RANA 4B87A 2O2HA 4RKRA 2Y1GA 4HT3B 4QHYA 4ESVA 2OXEA 2AFIB 2JH3A 2WA2A 3AB3A 3OPMA 4KQCA 4U3JB 1GGMA 5HG0A 2QLMA 2WYIA 2XW6A 1GL6A 1II0A 3EFOB 1RPZA 4J0CA 3QFCA 1V1RB 2FMUA 1GD1O 2EBUA 3KP1A 3DT8A 2GFIA 3PICA 4E21A 1NBIA 4NDAA 1K8YB 1I2CA 4ZJUA 2C20A 5DNWA 3WGUA 1E6UA 3ZX5A 4DEVA 3V1UA 1RM3A 1A3CA 4OGLA 4PLYA 3H5TA 1HL3A 2VDNB 4Q7EA 5FOUA 5JI3E 4O4IA 1ZK2A 5A5VA 3TUZC 1JEYB 3QVGA 4ZCLA 2IU3A 4DS3A 2X8AA 5KJFA 2QP3A 4Y98A 3ZWMA 3GJ8A 4DN6A 1BROA 3KWJA 4A2QA 2BY4A 4FDAA 2X1HA 2Q3DA 1BXZA 3AHFA 4OYRA 1M2FA 2C61A 3E58A 3R23A 2ZSJA 1H2YA 2GZ2A 4X85A 1ATZA 5L4SA 3IJ5A 1G60A 3HL0A 5AUQA 1KFCB 1A7UA 4R16A 2PYIA 2ZPTX 1MGPA 1QV9A 3HLTA 4WQMA 3UWKA 2WZQA 5AXCA 4EB0A 3DBRB 5BQXA 1LPPA 3RVSA 4IXDA 3OIGA 4MEAA 2P4EA 4OSOA 2QTTA 2BEUB 1QTNA 2Q9BA 3TRFA 3PI6A 2Q4DA 2H1LA 4NESA 3Q9LA 4ACBA 1U99A 3F6SA 3IV6A 3CUKA 3HI6A 2C78A 1SHTX 4OQDA 1C1XB 2RD2A 4PQYA 4C2UA 2A59A 4HCJA 2Z8XA 4M0EA 4M8NE 3OKFA 1ENZA 3RRBA 1QK3A 5JWRA 3OURA 2ZUWA 3P19A 5C5IA 1QYIA 3O8LA 5FI5A 5ULLA 4XOIA 2AYZA 2FHSA 3H3XA 1OXBB 2WZBA 3LUKA 4BWGA 2YJ6A 1DQRA 4FNAA 1JECA 3D02A 3ESDA 4CNBA 4H16A 4AUEA 2AOXA 1YRAA 2P9BA 2VJOA 3KSZO 1VDZA 3URKA 2WE8A 2ZS8A 3VU9B 1QB7A 3BXOA 4L5AA 4RH3A 5IJ0B 3D2CA 3QOFA 4E2FA 1ADBA 3NCTA 4HRVA 3X43A 2X13A 4L4XA 4ZJZA 1OIVA 1I7SB 4G8JA 4AJKA 4DREA 2IYPA 2ZDGA 3D43A 4FLFA 2W6ID 4JAVC 2YUIA 3TCNA 4BLVA 5CA0B 1YE8A 3L18A 5FWDA 3CRW1 4WOBA 1LSSA 1GZ7A 3A28A 1E1DA 4DMCA 2IYFA 5KNDD 2HRCA 3IMGA 1J00A 3ET4A 3QLVA 4RJIA 5ALFA 3RG8A 2DBYA 2NVUA 3OLXA 2P91A 2CLLB 2IYLD 4Y1RB 1GT6A 1R7RA 3QYJA 3KALA 4X8LA 5D00A 4FZVA 3QF7A 1OFUA 4N82A 3KL4A 2LCQA 1TMOA 2XCIA 4P4GA 4EUHA 5HIKA 5LYJB 1C3OA 3Q15C 3FRIA 5F76A 1PTJA 2JVIA 2GD6A 2BKAA 5IAGA 4V39A 4Z8XA 5B53A 1N6KA 1POXA 1T15A 3SVLA 2XAAA 4WTOA 4JC4A 2I4IA 4ZO9A 3WB1A 1P3Y1 3L6RA 3VSDA 4DZTA 4ZI7B 4LBVA 4KVAA 2OMEA 4M36A 4ODIA 2FA9A 1WXQA 4H18A 2CL0X 5F51A 4QGSA 2AOUB 1XFDA 1RT9A 3VSCA 1NY5A 2Q1SA 1Q7CA 1RYFA 1FTSA 4GBMA 4OCZA 3SQXA 3FTDA 3UOAB 4B33A 3NHBA 4G1EB 2E2WA 2I76A 1IJEA 1I4WA 2W6OA 3TXYA 2CNDA 5E9QA 1YKFA 1MENA 2WHXA 4X44A 1WZCA 4DR7B 4OL0A 5CDHA 3K9CA 5GV8A 4E2XA 2PGDA 5K6RA 1JG7A 3ETJA 4ZJPA 1MG5A 1FNNA 3V34A 1ZSYA 2I1QA 3HS3A 1E7QA 1GFSA 5J43A 3FNFA 3D7MA 2G71A 4BBZA 4RWZA 1ESDA 3AHCA 4GKVA 2R47A 3M6VA 5DI3A 1F6WA 5JAPA 2Q41A 4MYDA 3M70A 3NEYA 1SN7A 4IR7A 2GAFA 3A9CA 4PSAA 5BNFA 2JLCA 2DHDA 1IVYA 3I6IA 4HGRA 4N9WA 1V2GA 1W5BA 1CDOA 1J9EA 2DQSA 4DR1B 5T6MA 3VR3D 3L9WA 1GSAA 2B78A 4QDZA 1LTKA 1PZHA 3CPSA 4INAA 5BQ5A 2ZI6A 3MTAA 3ZQ4A 4YJFA 3GPBA 2Z83A 5KKCA 4DM3A 2ANBA 4ZMBA 2XXBA 2OCGA 2V7EA 2W6MA 1OAOA 2YXDA 1MB9A 1CZKA 1QZTA 5CAEB 1J23A 5CFQA 1JHZA 3NONA 3NOOA 3LNTA 1P5FA 2II6A 3D7RA 3GI1A 4XB6B 4DJDC 2BGLA 4KK3A 2LZ0A 3K9LA 2X0EA 3WRYA 1UP4A 4X20A 5JXWA 1CUDA 2JLSA 3NR2A 3RBXA 3NUZA 2PSFA 2XQIA 4YRBA 4IIUA 3W3AA 2COEA 1YTLA 1SEPA 5D3KA 4QBTA 1CB0A 1KWKA 3RV4A 4HLUA 2JD1A 3PXEA 1ZNZA 1RM4A 2IZOA 2G4CA 4Q48A 4M7RA 3EPKA 5JMPA 4DWWA 2J3IA 2I6UA 4F5WA 4DCSA 1YS9A 5F3DA 1CWUA 2E49A 2G06A 1ZBDA 4GT1A 3RO7A 4AY3A 2GKGA 2D2IA 4BFSA 4F04A 4YHHB 3G0DA 1NVGA 4DNFA 3T8YA 4N0DA 3KQTA 3WQBA 2RI6A 1NR1A 2OM6A 4GPZA 3RJ5A 1ISIA 2PSHA 3GIDA 1ZU5A 5FWXA 4ND8A 1SHKA 1UMCA 2XNDD 1XDBA 5BV0A 3DV0A 2D0OB 2NU7B 3BE5A 4D8YA 3OEEA 2JFFA 5DOVA 3JYLA 4KQMA 1VC2A 2ZIXA 3ONFA 4RIFA 4DG9A 5CG1A 1G8GA 1H8HD 1QC5B 2HXGA 1MB0A 4IDAA 4WNIA 5G0VA 3NHAA 3GVCA 2X3FA 3CRRA 4TLMB 5EZ5A 3PTAA 1ZOLA 2NIPA 4V3BA 5P21A 1V7ZA 3KZOA 2D00A 3RUIA 4Y2JA 2DR0A 2XYGA 1WMAA 1FFGA 4FD2A 1XF1A 2QI9F 3AL3A 3P9ZA 1XTPA 2DECA 3VYWA 4PZ9A 2XKKA 3VTKA 1KYIA 1E7WA 3ADKA 3JWIA 1U81A 1XQXA 2CZQA 1D4AA 2ECFA 3RUDA 3TCXB 2A84A 2HWUA 4FCCA 5D5HA 3RIHA 2VAPA 3PFFA 3VPHA 3T9DA 5FP0A 4BFVA 4KTTE 3UJAA 1NVXQ 6REQA 1U3VA 2X40A 3ZI7A 2A0KA 1J0XO 3IALA 3O4HA 3CWQA 5DVZA 1J2EA 2XUKA 1R0YA 3OG9A 5KNBA 1KK1A 1NJ1A 2IP4A 3IQWA 3K0FA 3Q5EA 4KN9S 1U7TA 3K8ZA 4ZPXA 3LXMA 4WCFA 2HYIC 1ODTC 4JBWA 2I5PO 1NRXA 4BGDA 3OTWA 2X42A 3GO4A 2ZATA 3EZ7A 4QNNA 2I4OA 3AF0A 3NCHA 4V0KA 4DIBA 3HN7A 4HZGA 5HRAA 1T4BA 5KTSA 5C7IO 2B1GA 1QOZA 3BXZA 2X76A 1E6LA 2PHZA 4YI5A 4G86A 2EJUA 1AOXA 1E79D 3DDHA 3V00A 2Q5IA 3DFFA 1FMJA 4BNKA 5FEUA 4DV4B 4Z4EA 1MAUA 4W5WA 1RXEA 2ZI4A 3E3AA 3CMCO 4XASA 4BTLA 4DJEC 1Q0PA 4WBNB 2PKQO 1H1LB 2LE0A 2P3OA 3GJ4A 3KQQA 4MX8A 5BUSA 1RXSA 2PTGA 2R86A 5KNLA 2NPOA 3U7FB 1IHPA 3E3NA 4Q9HA 1K5HA 2ZE7A 4FD3A 4JP1A 3ORRA 5IM4A 3RABA 3AEXA 1ODIA 3LPLA 5BWOA 4D0SA 2WM9B 1BRTA 3HJGA 2WJVA 1U3GA 1DAKA 3S2YA 1B8NA 4YV2A 5FNVF 2WIFA 2V6FA 2JBHA 1AHHA 3CH6A 3FJ1A 1EX9A 4WXYB 1X7ZA 4AICA 2JIMA 2ZBEA 4IMJB 1OWMA 2XUPA 1D6SA 2YXPX 1U5BA 2V4MA 4GC9A 5TEVA 4OU5A 3RS3A 2UYGA 3SM3A 5C46F 1R5JA 4D46A 2BCGY 3LKBA 5LLSA 4TKLA 4MKIA 1QHIA 1P8AA 1TU0A 4KZKA 2IUEA 4NFYA 5K8CA 2H0QA 3C5VA 4D25A 4QXMA 4UCFA 1ES9A 1H2BA 1JZTA 3C24A 3F3MA 2FCRA 4FHDA 4Y67A 5KOHA 2G7ZA 2O14A 3CB4A 3BILA 4NG4A 5B7PA 1G7SA 5JNLA 1C1YA 2RBGA 2Q0QA 1HDEA 2QN7A 1IAVA 2WAXA 1I01A 1U8TA 4IO1A 3HP1A 3Q3IA 5H59A 3VXKA 1JVSA 3RS4A 4EA8A 4EK9A 5D3MB 3QXGA 4M6WB 5K3BA 5LA6F 3BQMB 4PSCA 4UXHA 3WR5A 3EGWA 4DSTA 1Y7HA 5IFKA 3L6OO 4E3ZA 1RWPA 3HB5X 5A3QA 1FVHA 1RQNA 3HWRA 3PL5A 621PA 2EKZA 2P5TB 1N6RA 2H9IA 2Z0MA 2ZSFA 4NVRA 4UDYX 2ZCJA 2WJYA 3IVMA 1XDDA 1PFYA 1A8PA 3H7AA 1SQGA 4LZPA 3BBLA 4TRMA 3FCAA 4Q82A 3QZUA 4UNNA 521PA 3Q3EA 4ID3A 1UBSB 1DNPA 2P1DA 3CVJA 3IBSA 1FX0B 3IV7A 1RU3A 4HQFA 1J22A 1RYYA 1UXHA 2O48X 3ZEAA 5B58C 5DRYA 2K4MA 2R4TA 2VT6A 5GGYA 2NUAA 1C7FA 3ABSB 3DAPA 4TM8A 3VDQA 2V7PA 4MVJF 4EOGA 3OHMA 2LD4A 2L18A 1DX4A 3VFDA 2Q45A 2RGYA 1S89A 4LGVA 4LMPA 2G63A 1XJ5A 3FKSA 4EHBA 3PKIA 5AVWA 3U4IA 1VKRA 3PNOA 4AMYA 5FV7A 2BMJA 4DLRA 3GLIE 1KMIY 3F5MA 3MERA 2X77A 1K5PA 1XXHE 4E70A 2X6TA 5L3QB 4IG4A 3WB2A 4FYYA 2X5KO 3KB2A 2ZRAA 3OT1A 1N2BA 3PPWA 4OATA 1Z6AA 1OLSB 1ZN9A 3M6UA 2WKPA 4UQPA 3JX9A 3ZBPA 2JCBA 3DEZA 3UMGA 1NW5A 3OF3A 4FFMA 1FF9A 2RIPA 1JLKA 4NPAA 4F6LA 1JPVA 3RB8A 2PKYX 4R2KA 4R1LA 3TFOA 3FSGA 1AQIA 3CX4A 4E4YA 4CEIB 2HHJA 2WAAA 4NE9A 4JN6B 1N57A 3AEUA 1QMGA 1H3FA 4IVPA 1ZW1A 3WK5A 3L8CA 1Q14A 3JASB 3PCTA 1BN6A 6LDHA 1JYEA 3NHSA 3E61A 3W6OA 3AL2A 4D82A 1APBA 3E8SA 4Y2YA 3GUYA 2IYNA 4EI7A 4L28A 1GQ2A 1CCWA 1QE5A 1QONA 2ZWOA 3HBFA 5ARDA 721PA 4NBTA 3KU1A 1IXKA 1R0XA 5K1ZA 1WBJB 4GRAA 2ZUBA 2CMKA 4U0JA 1EXWA 1E99A 1W36B 4UHEA 2XKBA 3K0HA 4EW6A 5F1PA 4JUAA 4HL6A 4Y2UA 1HTTA 1QIKA 1HDCA 4MKFA 1J5PA 2FNAA 3SQDA 3AIIA 3GN2A 3JRXA 1Y63A 4Y6LA 1JDPA 1XTKA 5FUYA 1XA3A 2JFBA 3EA0A 5IZCA 4QYMA 3ER8A 1ISGA 1IN8A 2PY6A 1ORVA 1V11A 2Y05A 3VR2D 3HPQA 3WLJA 2SKEA 1I3KA 3BGSA 5I7EA 1B8VA 5HHTA 3CZ9A 2F7SA 5IBRA 2IXBA 3CS3A 2IY7A 3V2GA 4JLUA 4F3NA 1U4NA 4CM9A 2O05A 3KFVA 3PITA 2A4MA 4IH4A 4Q21A 1Z2DA 5EOVA 3SF8B 1MDFA 1Z63A 1I5OA 4XARA 3S3TA 5JS2A 3G79A 1A5SB 1WE2A 4R2LA 1FP6A 4R0VA 4BFCA 1D0VA 3OY7A 2XQVA 2BOVA 2ZYDA 1SKUA 1E7RA 1G6KA 1LSJA 1UAYA 1U0NA 1HMYA 1XRSB 4ZVTA 1JAYA 3L0PA 3RTAA 2R2GA 4MVJE 4F91B 1XAJA 2N0SA 3DUFA 1V4BA 4FNMA 4IIHA 2PGOA 4N9QA 1CP3A 2HADA 3M3HA 4QQRA 4TWRA 3WRXC 5A71A 3BFXA 3IAHA 3DE0X 4WDQA 2V9ZA 2O6LA 3GCXA 4ZT6A 2EG5A 2O7RA 4RPLA 5K8VA 4MS3B 4E7PA 3GLGB 4ZCSA 1QU2A 1M83A 2EKLA 2SBTA 4FSHA 4LDQA 2VQ6A 3Q40A 1T9CA 1WHSB 1R9GA 2GERA 4MI6A 2LTAA 4DJTA 3W2IA 1P1BA 1JJAA 4EQ6B 4P92A 3FNQA 4JLMA 5THQA 1I6LA 4HTFB 4ZA2A 2H2IA 4M86A 2YHUA 3O3OB 1R5BA 3O4GA 4LNAA 1X1DA 1RRKA 2B8WA 2PMKA 1T5DX 3PPIA 3FSJX 4M53A 3V48A 1VPLA 3MWLA 4E88A 2E87A 1JLLB 4Z0NA 4B47A 5J2TB 2OGZA 5LU8A