3GAAA

The crystal structure of the protein with unknown function from thermoplasma acidophilum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
MIMVNKKASESQVMELEKRNYNNPVVLCGFAGSTPTGVLAASYIVETLGMHQVAHLISQHIPPVAVFVGGKLRHPFRIYANNSNTVLVAMCEVPISSAHIYEISNTLMNWIDQVGASEIVIMEGSPANGIPEERPVFAVAEKPKLDKFKKAGIQPADSAIIAGMGGGILNECLVRKITGLSFITPTSVDIPDPGAVLSIIEAINKAYNLKIKTDLLEEQVKALDEQIKKIEEQYKELQEKQKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein Ta1441
publication title The crystal structure of the protein with unknown function from Thermoplasma acidophilum
rcsb
source organism Thermoplasma acidophilum
molecule tags Structural genomics, unknown function
total genus 70
structure length 243
sequence length 243
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gaaA00
3MNFA 3VR0A 4G4SP 2P90A 3GAAA 3WZ2A 3E35A 2WAMA
chains in the Genus database with same CATH superfamily
2AUMA 5I8ZA 4NV3A 3VSCA 3RWBA 1QQBA 3R0IA 4JI2B 1NMSA 3DKIA 2VRBA 5J1TB 3GEDA 1TU0A 1VLLA 1LF0A 2FZ5A 3E61A 4LMBA 1VI2A 3Q7IA 4AS1A 3O82A 2KMLA 1JSCA 4GX2A 4BUJA 3ILSA 1L5ZA 3NI2A 1YR3A 2DUUA 1NRJB 4EO4A 1QE0A 1NW9B 3EVFA 1U2PA 2NZWA 1DKLA 4RZ3A 4MS4A 4MVYA 1DXQA 4IDCA 5LXTF 2GZSA 4KODA 4JBYA 4QSMA 1BXZA 3BOSA 4DSNA 1UKVY 3TB6A 4PLWA 2F2TA 2GQ0A 3WYEA 2ZFUA 4QQFA 1K8RA 4O5AA 3MJVA 3VKWA 2Q3HA 3ONEA 2DUMA 3O4HA 4ODIA 4R5MA 2OXRA 1BG6A 5CT5A 2JAHA 1TCVA 3LY5A 2AC2A 3F8WA 4UNPA 1O5IA 1Y1QA 3ZKWB 4AYTA 3T0IA 4ECAA 4U9UA 1MAHA 4BMVA 1XA3A 3QKSA 3BICA 1SUIA 2GPSA 4DMRA 4WHMA 1X39A 2NZXA 1OTXA 1G98A 1ZH2A 4H7FA 3FSJX 4I14A 5EXTA 2ZCUA 3KV3O 4GQIA 5GM1A 4Z7OB 1DFIA 1XEXA 2FEMA 4GM1A 1ML4A 3TL6A 1NNEA 2R6ZA 4LFBB 1IFXA 4REQA 3QUTA 4JR2A 4KN6A 4L08A 4GC9A 5D3KA 1DCFA 5CNIA 3LW7A 3DE1X 1PHRA 3ROFA 4ONEA 4B75A 1UC4B 2B0CA 2JF0A 5LB2A 4CFSA 4RH1A 5DULA 4LYAA 5DF1A 4UM8B 3RE1A 3BCSA 4MRNA 5K8UA 1PR3A 1BXRA 1SUPA 3H13A 1SXJC 1ZG3A 4AUKA 4MI1A 4J0EA 4ILKA 1JPNA 1GNTA 2XUIA 4KV7A 2VSOA 4LY9A 1JDVA 1GZ3A 1U6IA 1TM4E 1NW3A 3SS9X 5TQ0B 4H6VA 1FLDA 3TLXA 4XQEA 1B1AA 1I7PA 2VUTA 3TCNA 1W4LA 4JR0A 3UC5A 3CONA 4BU1A 4XJSA 2ET6A 1OIWA 4MGKR 2OKGA 1MIOA 2WF9A 1MO4A 5FH9A 5LDHA 2JFBA 5IMBA 2JFUA 5EKUA 5DNUA 3NMUF 3SJZA 4F8JA 3S40A 3NUZA 1TPYA 2VUIB 3MYYA 4YI5A 3JQ7B 3P9XA 2GN9A 5HEKA 4K0KB 1GFSA 2YWBA 2GDZA 2H1WA 2WWGA 1B3RA 1UINA 1ZW6A 2R6HA 3CUTA 3ELYA 4GP6A 2AJ8A 1E79D 2W98A 3CNLA 5EP2A 5EWLA 3RRJA 1E2IA 1E6UA 1Y7LA 3H5NA 3VC3A 2VTDA 3RSHA 2DWPA 3S1SA 1MO3A 2OXEA 2AG1A 4NL4H 3FCOA 4X20B 3N8IA 2OGWA 1Z0KA 2PPLA 1NPDA 3PQ5A 4MTCA 5A05A 4FWTA 4NQZA 1Y81A 3RTBA 4Y1GA 4OBXA 2KSQA 2XBMA 2AK3A 1WDLA 2R8XA 1VP3A 3QG1A 1P5ZB 1R6TA 3ANNA 4TV8A 5A4AA 4BX3A 4CT5A 4CTOA 1KYVA 2WR8A 3GXBA 3TJMA 5JAIA 4G24A 3F8SA 1N8KA 1QO9A 2G3YA 3TZ6A 1JEYB 3U3MA 1BWPA 1WBDA 3N8KA 2C2MA 5AJUA 4AMVA 5LUAA 3MMNA 5KSZA 4D46A 5CFPA 3JQAD 1BH2A 2GEBA 1Q0SA 2JZCA 1H23A 3P32A 2W43A 1YZUA 2IPXA 2M2IA 2ZLBA 4GFDA 1XJWA 1K86A 3OQ1A 4LMPA 1XKLA 5LP6F 1KIMA 1QNLA 3E3LA 4NHEA 4REOA 5EC8A 5CM9C 4YMIA 4KNWA 4W5WA 1T91A 1XN1A 3OEED 2ZAMA 3EQ9A 2C4WA 3L8HA 2IIVA 2LIVA 3EN0A 2QU8A 3KB6A 4W9RA 1E7SA 3SQDA 4F72A 2CBGA 2IH4A 3H9CA 4RYLA 3BH6A 4DA4A 4N01A 5DM2A 1UAGA 3AU9A 1LZLA 3HO6A 1NYTA 2WMDA 1UDBA 3PWSA 4R3UC 4GRAA 4URYR 5BYJA 2YWXA 1QQ5A 4IIDA 1TYDE 4Y2XA 2XNCA 3RQSA 1G2QA 1IMJA 4D6XA 2B8EA 2VYVA 3HSSA 2WTMA 2BFPA 1E3JA 2XNHA 3T34A 4OI2A 2VJOA 3N70A 3H6HA 1G60A 3PF8A 4D92A 2PJRA 5F1YA 4JP3A 1G5RA 4OXIA 3HJUA 2B5WA 2E48A 1AG9A 1VYHA 2FLVA 2C96A 3UXEA 3WNCA 4CG0A 4L78A 5EMNA 4Y2UA 3QLJA 2A1TS 3FF4A 3LFHA 4JH0A 4RORA 4LUCA 1H93A 5CEFA 1H4TA 4MV6A 3KAQA 4ZK2A 2UYQA 4YI3A 1VJDA 2J85A 2OV2A 1ISIA 1YBMA 4DCCA 4QM6A 1ZVKA 1ZDMA 3PPVA 1MDFA 3EG9A 3IE2A 3K0EA 3VPHA 1G66A 1JR4A 2O2ZA 1CDEA 3ZY2A 1T3HA 3ADCA 1LJ8A 1GV1A 2R3SA 1BJRE 3FY4A 1JIIA 1NXVA 4FFBB 4KQEA 3TLYA 1ZNWA 4Y6SA 1B3BA 2FMUA 1NXSA 4MKGA 3IGFA 4QDXA 3UAVA 2O7VA 3R4VA 1PT9A 1E6CA 1ETHA 5EWMB 1RHRA 3E4CA 4CF3A 4DY6A 1EZ4A 4OUDB 3RCBA 3M3DA 3KJGA 1JLLA 2GN4A 2CUTA 3GRAA 4EG6A 1P0CA 4K6HA 2XE7A 2ZUEA 1QANA 2QMHA 4DM4A 1XLVA 1X0XA 5E6RA 3TX2A 2QTBA 1N57A 3IVXA 3SQLA 1AM4D 1CY2A 1RI4A 2I1WA 1PS9A 3GH3A 2WSLA 1F9AA 2B4YA 3F3MA 4XARA 2WIJA 4B5KA 2V7GA 4C7KA 3DCYA 1QDEA 2O4CA 3QVUA 1EBBA 1FP1D 1E7YA 4RX1A 2F3PA 3D8HA 4CKXA 3EEYA 1EFKA 2ZU6A 4JT2A 3IKLA 1J5EB 3JRNA 3MWJA 3W4JA 3KB1A 1LTQA 1AB5A 1VFNA 4X71A 4PC6A 4BNJA 1LTHR 3OD1A 5EJ6A 1Z0ZA 2Z4SA 1HKUA 3MIIA 5ECGC 4ZYLA 4DV6B 4RGBA 4JA2A 4QTXA 2FSHA 2YVUA 3HADA 3TXYA 3AR7A 3QK7A 4OSOA 3VDNB 1A8QA 3GJZA 4MGEA 1W6UA 4LHVA 4CJXA 1E0AA 3D6HA 1EJBA 4KACA 4A16A 3SEFA 4RV4A 2B2NA 4H15A 1FYWA 2PS0A 1NW7A 2ZRAA 4I5FA 4LISA 4R2KA 3O8OB 3U17A 5CFLA 2W22A 3S4YA 1NJSA 2Y93A 3V80A 1KJQA 3B3FA 1Q6YA 1K3UB 1MENA 1CVLA 2R1TB 3HGQA 3RFTA 3S1LA 2HMYB 1JH9A 2W5UA 1Q7EA 4LE0A 4EDFA 4CKZA 2X1MA 1JHRA 2NVUB 5AVUA 3N05A 4M9QA 3I1FA 3IUPA 5ESRA 1K0FA 5TE9A 4MKIA 1IHXA 2QHXA 4QOFA 4CEJB 5I7VA 1QIJA 2X41A 5B3LA 5LU8A 1FS5A 1W0KD 1GKYA 2WWVD 3VI4B 5ADVA 5AK0A 1Z5GA 2UZ1B 2EHJA 2FDRA 4JU8A 3KAKA 4J2OA 4NMHA 4WJKB 3KXKA 1BU8A 4FN5A 4NK4A 2RC5A 1TIPA 3BAFA 4RSHA 1Y1LA 3F3SA 2X0IA 2MCFA 2PQ2A 4BBPA 2P5SA 2NVWA 4F7DA 5MN4A 3I2KA 4K6GA 3H5VA 4FFSA 1ZVQA 2RI0A 3EXIB 4BNVA 2ZBFA 3DYBA 3Q7RA 2O8EB 4R9VA 1QIHA 3WK8A 3FCXA 4OOEA 1H3FA 4LRWA 4GVXA 1PTKA 1QTIA 4G63A 4OJYA 3GHYA 3QVWA 4XQ9A 3UKOA 2WIBA 3VPBA 1I6KA 1SBIA 3UMVA 1F8GA 4ZMSA 1A9SA 4S0ZA 1VGRA 5DI9A 1M6EX 4A0FA 1A5AB 1LTKA 1PJCA 4LC0A 4R1PA 4EA6A 4F12A 4HO1X 3M1AA 5ENVA 4DIUA 2GZAA 4XJXA 5DGDA 1PUXA 1CV2A 5BUZA 4A8HA 2JJ2D 1P5FA 4ZHQF 3EDYA 3ROEA 3ORRA 1TDJA 1YAHA 1MB9A 1YFLA 5HJEA 3VNQA 4MPRA 5BQXA 2FRDA 2R25B 2WJWA 3QV1A 1GLVA 3E70C 1SUFA 4MQUA 3HCFA 1E6KA 1E1LA 2YVKA 3R6LA 4MS1A 3M34A 4DV2B 1RWNA 2TECE 4OQLA 2VXOA 5IC5A 5JD3A 3THSA 3U6BA 2RGWA 2HNAA 1D0VA 3HKDB 1Y5MA 4J4BA 4AKIA 2JI4A 2AN4A 4JI6B 4B3GA 4LXTA 5FUBA 3ZZ0A 2FPSA 1TA9A 2LRHA 1H6BA 5BRAA 2H92A 2A2ZA 3BBPA 4KMOA 2QUZA 4XFKA 3UB2A 1KAOA 2Q0HA 4WZAA 1MAUA 3NWEA 3HM9A 2HD4A 2OA0A 1B2RA 4OG2A 2GZDA 4OI4A 1C8BA 2CF5A 3I6BA 3K09A 3IAEA 3WLNA 2XXBA 1YR2A 3G2PA 3U80A 1LS1A 1IMOA 3BMOA 2P40A 3SC2A 4I50F 1L6IA 3PRKE 3N5KA 1KO1A 2EJWA 4QPCA 4D98A 3I0MA 4WSOA 1CS0B 2IHJA 4R9RA 1KMCA 4PC1A 4AMUA 1XZCA 2HHCA 3BJEA 3GRCA 4TV9F 4OYYA 3IP1A 3C1UA 4IKOA 2I6TA 5T6BA 3EBOA 3EQZA 1KYZA 3OIVA 2X0JA 3VISA 1B2LA 2NAFA 3KWLA 4BMSA 1V11B 6Q21A 4YJ2B 2CDRA 2DU8A 4S3MA 1FFXB 3ED5A 3KYBA 2C9BA 3T95A 4S04A 4GWGA 1ONNA 1RWKA 4F4JA 4HAOA 3R9XB 1CR2A 1NURA 2VHXA 2MDTA 2ZUFA 1ACJA 5DP1A 2Y4OA 2WHEA 5FUVA 4JI4B 2H2GA 4JYBA 4YBRA 4D8XA 1TZ2A 4YAKA 1FJGB 4PTZA 4CMKA 3A10A 1L7DA 3EW9A 3M7IA 1PT8A 1JA9A 3BGOS 1ZU4A 3S2FA 2LVBA 3T5GA 2O3UA 1CQWA 4DDUA 5BV8A 2F43B 2N3ZA 1KC1A 2P4UA 2W0SA 1Z5OA 2EKZA 2HYIC 1SKBA 4NOLA 4XTCS 2QM8A 1DQYA 2OR3A 2V8OA 4HDSA 4E94A 1CB0A 2JLSA 4MRMA 4BN5A 3R0JA 4X66B 2YCBA 4JI1B 2FQQA 4QUHA 1ZM9A 4JVMA 2HWKA 3JQCA 3N0WA 2WILA 2X7HA 3BE5A 4PQGA 5CDGA 1CLUA 3TSOA 1CKEA 4DRXB 3AG6A 5EUCA 1M7HA 1XELA 5JE8A 1CZHA 3UKDA 1PR6A 2AL7A 1BW9A 1KERA 3FNFA 1DEHA 2XTZA 3EA4A 4ZU1X 4AN1A 1AA6A 4M54A 4J2HA 4XVQA 1EBFA 4U7FA 5FADA 3TYXA 2J3QA 2UUOA 1AUPA 1D6MA 1UC8A 5LYJA 1EFRD 3NGMA 3A1EA 4WZBA 3PA8A 4KE8A 3E7FA 3H9QA 3RYTC 4MVJF 1WMEA 2DUWA 5SZHB 3VZRA 3CX8A 2XUFA 2ZSJA 2VK2A 4Q16A 5TQJA 4DG5A 1QWSA 2J30A 2LR0A 4H7JA 3SR0A 3MB5A 1S9HA 4KVAA 5DSTA 2XUPA 3CLVA 4F2HA 3NBZC 3WYBA 1P2TA 5JZ9A 1OQAA 4H3HB 2NOAA 4A8JC 3GEPA 3SN6A 2E6KA 3ZU2A 1A9OA 1R9NA 3R8CA 5M04A 1XRQA 3WGVA 5EJ8A 4QVIA 4ABTA 3EQ8A 2NUPB 4GRIA 4MMXB 4EB6A 1GQRA 3I2FA 1H2EA 1CYDA 4KO2S 4M9ZA 1LJLA 1SCKA 3E15A 3KJQA 2NTVA 2XSZA 3CZAA 3L6CA 1ATZA 4AJKA 4BO1A 4Z4FA 1ND6A 4G8JA 1PGJA 2BKVA 1YZLA 4GLFA 3IRVA 2PD3A 5K0TA 1C41A 4J3FA 4TWZA 2GJSA 3F6SA 1E9RA 7YASA 2EGHA 4LAFA 1RLUA 4DMCA 1LBTA 1RYFA 1KY3A 1Y4DE 3IVGA 4LFCB 3KQOA 3HK2A 3LC1O 3NH9A 3P9PA 1YMVA 1QH0A 4XEUA 1A9XA 2CDBA 4EGAA 4KCGA 3E5NA 1PKEA 5H9WA 4Y7CA 5IRCD 3FDXA 2JRLA 2Z43A 1Z2OX 5IJ9A 1VXOA 1XVUA 4LMAA 4X3PA 5CIQA 2M98A 4J7AA 4WXHA 1TI7A 4IIHA 4PONA 4BCCA 4CR7A 1F2DA 5JROA 1WBJB 4ZYYA 1H8EA 2O23A 3JYOA 5IP5A 3HP1A 5MHTA 1SXJD 1Y80A 4F9FA 4Q48A 2JHGA 3T1TA 2DVMA 4IV5A 1FXUA 3E8MA 4OM7A 1DDIA 3ZDRA 5IANA 3RYCA 4TT3A 2AZTA 1WY5A 1QP7A 1M6WA 2Y0EA 2NUTB 5LQCA 1DIHA 3NALA 5C37A 2GCNA 4HNSA 1PR4A 3U7RA 2VUHB 3DL2A 4ZU6X 2PSDA 1H0RA 2H2HA 3DQZA 4QNNA 2PT9A 2V7BA 4RANA 4C1NA 3V1NA 4DSAA 4HJXA 4YCDA 3WL7A 2AEFA 3MUEA 4DIMA 3WMXA 4MUNA 4BWVA 2D5IA 1JIKA 2XQKA 5C8DA 1K5DA 1WHTA 2VHCA 3CEMA 3L0CA 3L1IA 1KOJA 3AEKB 3IURA 4BGDA 1B8VA 1NVBA 1U7TA 3KFXA 4KKVA 4RENA 1TB4A 1Y4UA 2HJGA 3BYZA 3IPXA 3USZA 1SUSA 2YHUA 2QR3A 5AOCA 2YFKA 1PU2A 3K2QA 4F56A 1ZCFA 2QUHA 1XWIA 4N54A 1N5KA 3GVXA 4NZPA 2WWIA 4BO2A 4CZ2A 3DUFB 4P1ZA 4YMVA 5KTTA 1JN0A 2RKWA 2IPOA 3SNHA 3THYA 2PHZA 1DADA 2BEUA 1XOIA 4ADSG 3U6KA 1DP4A 1ZGCA 4B8YA 4FMBB 2ZB2A 3HFRA 4A03A 3CUVA 3LY8A 2I4RA 5K0ZA 1PHPA 1NF3A 1ENOA 2Q41A 3EXHA 2CFSA 2RHMA 3MMZA 4UHKA 2I0FA 4V0KA 4TVOA 5CA0A 4R84A 4F2PA 3LBAA 4R9UC 1R4NB 5FCDA 2I1VB 5IKEA 3PNVA 4HDOB 2WLSA 3CLTC 1XD2A 2FOXA 1SXHA 1QPZA 3DFZA 5L40A 1D4ZA 3WK4A 4WKOA 2JK1A 4O3MA 1GRVA 2NW6A 3FOCA 4NIMA 4TS3A 4EY4A 4CN9A 1ECPA 3C6QA 2JANA 3MJEA 1J6UA 1J2JA 1F38A 1SFRA 2QTWB 3E9CA 5BMVF 3E2PA 4C14A 5GADl 3MCTA 1FP7A 5EMJA 1GL7A 1I30A 1QFMA 1DBPA 1DWPA 3U48A 3LT5A 2VDNB 4OOFA 4RJTA 1RNLA 2CD7A 5A9SA 2F3TA 1QHIA 5JVDA 2IQIA 4QASA 1CZOA 4U7GA 2WNIA 4OIMA 3C3XA 4TM7A 2Z9BA 3WBJA 5KYGA 4JC8A 4LOHA 1XYYA 4H4EA 3U0VA 1DTWA 2Q9CA 1NW4A 1J2YA 3F0TA 1YJ8A 3PWTA 4MMYB 2CLIB 4IKEA 1GZDA 3AK4A 1JHMA 1FDUA 4QEZA 3IOCA 4RNCA 2DB3A 2JG3A 3LXRA 2XRZA 5DTRA 3I39X 4ZOAA 5CA1B 1N77A 4C78A 3KQWA 1K7FB 4MRRA 3QVMA 2C3YA 1W85A 1OPRA 2W6NA 4G4GA 3DEYX 4IJUA 1E5DA 2ZWOA 2GN6A 2FTKE 2J0SA 2CL5A 1AN0A 1YDEA 3DPUA 3UH0A 2EBUA 2Q46A 3NUGA 3PFNA 3K0CA 5FWXB 4TS9A 2X6TA 2OZEA 1E2PA 4ZFNA 1E2KA 3P9QA 3VH1A 4YCAA 3N6RA 1Q7RA 4E22A 3U7FB 2HA7A 3RS2A 2PEZA 4FZ5A 1BCSA 5THXA 3RPEA 2C4VA 4GI5A 1GAWA 3PXUA 2ILVA 2HJ9A 1IPHA 3QI7A 4E07A 1L3CA 3AW9A 3GH1A 3ZD8A 1TA4A 3KEGA 2Q0QA 1LDYA 1LK7A 2ZZMA 2K87A 3GPDG 3ZTTA 1BHJA 3UT6A 2BFDB 2J32A 5K09A 2XPCA 4RIGA 1OFTA 4PFKA 5HKAA 4JOBA 1SXQA 1QGDA 5JXWA 1FNBA 5GWXA 5D7NA 3KLNA 5A0FA 4LJ9A 3HJFA 4FNGA 4M1WA 2I54A 3MJDA 3WDMA 4B71A 1M1XB 2F4NA 3R8FA 5E6SA 3X1MA 3OPYA 4XGRA 1Y5IA 2HGSA 2C03A 3LFUA 3ZU4A 4CKYA 5CXUA 5INTA 2LIPA 3HRIA 2EJVA 1NF2A 2WJ3A 2A1TR 1CUHA 3ISJA 3HKBA 4H0FA 2JEZA 4MA5A 4Q7JB 1RPNA 4URWR 1ZD5A 2QN6A 4O25A 2FPRA 2O19A 1BD4A 1GD1O 2NXJA 2DHDA 2R6AA 3I62A 1JYFA 2VG8A 1IBRA 5CJJA 3M83A 3AHGA 3CN9A 5AVJA 2GCEA 4MIOA 3MGCA 3WLSA 1NE2A 3B82A 4D4MA 1QX3A 2HF7A 5K1ZA 5FBVB 1SBZA 5AKLA 2V6FA 5KSWB 1ZD3A 3CV3A 2Y1FA 5GOTA 5HTOA 4ZT2A 3ND9A 4MI6A 4QJ5A 1NQUA 4PNPA 4X7RA 5M2QA 3ROTA 1MRNA 2XF8A 1U8FO 1A98A 1Z17A 3KKKA 1NQOA 1L4UA 2Y4NA 3LUBA 5KTSA 2OBBA 3QLUA 3NC4A 1WMAA 4TTPA 1VC2A 3TZEA 1UJBA 1WUTA 4S05A 4R8RA 1BHO1 2B4QA 1XRNA 2F6RA 4DT1B 3OURA 4AY5A 3FAZA 3P97A 5J2TB 3TQFA 5MGBA 6ADHA 3PTLA 4MVWA 4BTLA 1X7ZA 3JCZA 3VV2A 2XB4A 2YV5A 1NKSA 1ZGHA 2O8NA 1LEHA 4XASA 2YZNA 2QE6A 1WHSB 1E2QA 3IR7A 1KORA 3QFTA 9ATCA 2O5CA 5CBKA 1PEDA 4RD1A 3R7SA 1FZTA 1V5GA 4G0QA 4I4TA 5TVKA 3PIIA 3RI3A 4DCPA 4KI0A 2NPFA 4M37A 4LJAA 2HA0A 4IZIA 4ZREA 2FE1A 2QRNA 3A6GA 1JDPA 1ND5A 3C5WP 1KJZA 4JL6A 4P9NA 1VKRA 3AF2A 3VU1A 5LSAA 1KSGA 2J6CA 3JAWB 3CEJA 1AZWA 1IPEA 2V9PA 3VDMA 1RACA 4PZAA 4M0CA 1WOMA 2IP2A 3QX7A 1CRWG 3MT8A 2CVZA 2YW9A 4ZT7A 1U3GA 3I0ZA 4BO4A 4ETIA 3BQMB 3PGJA 3HCOA 3OLCX 1N3BA 3DMYA 2HU2A 5L4NA 3BDIA 1Q12A 4FDMA 5LPNA 1CEXA 1Z7EA 4P4LA 4KSCA 1H69A 4V39A 2Y99A 1J9ZA 3VSDA 4AG3A 4DEYA 2BLLA 4MCIA 3U37A 4HEA6 1X3LA 3SSNA 3B9QA 5ARCA 1T6BY 3D8UA 4QUDA 3A1SA 3BQ9A 3G9XA 3VR3A 5I7WA 3OE7D 3CGWA 5KWJA 4AJOA 1W5SA 2W2TA 4G89A 2GHRA 2J4DA 1PTJA 1YZTA 3PGLA 3H7IA 3LX6A 1V7PC 5B2ZA 5B4UA 5LD2B 3K9HA 5LWHA 1RHMA 3SNKA 4F3KA 5FL7D 1S4MA 4CCYB 4AIRA 3GGDA 2E85A 4IY1A 1GG9A 3ORQA 2R8YA 1KHTA 4XB1A 4BX9A 1CHDA 1Q0ZA 3PYLA 4IDQA 3DBOB 2ADMA 2VDQB 5LA6A 2V7VA 4I5GA 1KO7A 4RKEA 5E2IA 4YRDA 5FFFA 5LZ5A 1OLSB 3E48A 1JZQA 3RTDA 4OH1A 4UZSA 5KDOA 2P11A 3FZGA 5IJAA 5B30A 2PIDA 5JIBA 1VE6A 3V8VA 4UCFA 1KE1A 3L9WA 4FE4A 3UFBA 5JWOA 3H2IA 3GCDA 4Z3KA 4KRGA 1NNLA 1HRDA 1SPBS 4IGFA 4QEDA 1UAYA 3OZDA 3M8KA 3OPNA 3PCXA 4M60A 1F5NA 3MNFA 4C0LA 2GILA 3HABA 3AFIA 1OAKA 1Z0AA 4Z3OA 4LHEA 3G2QA 4R2LA 3R20A 1KRWA 3HB5X 4Z8YA 2QZPA 4HX2A 5EWJB 3WGLA 1EEHA 3UNXA 4DPKA 4B2LA 3P0JA 1WZNA 1QH8B 4PZ0A 1HLFA 1IEWA 4MW0A 1KFJB 1XCJA 2AQ8A 2IDJA 3GD7A 1AF7A 3MERA 3VXKA 3C74A 2YXDA 3ZU5A 4O8CA 5KYNA 4EB0A 1RC1A 1UOOA 2A0UA 2W6IA 4QVGA 1DHRA 3K31A 1TF5A 3LXUX 5DIFA 1T0JB 2AF4C 2OQVA 4UKDA 2RH4A 3X1JA 4HVCA 1U1IA 4P7KA 2PZKA 5AVRA 5H3LA 4MGYR 4G09A 2BM9A 4IIXA 1LFDB 5IKPA 1WNTA 1P3Y1 5UKDA 1P1KA 2D13A 3NWBA 2XTJA 1R66A 3E6AA 4YACA 5DNCA 2QTCA 1BROA 1QAOA 1O9GA 2NVBA 1GAJA 1V48A 2G17A 1UK9A 1JLRA 1OUMA 3JR3A 4HFMA 4MVJG 3ZWVA 1Z5UA 4JLBA 4R5HA 4BLVA 4C4XA 4AX4A 1OU0A 5KQMA 3IVMA 4US1R 2H4JA 1TRKA 1QHFA 2B1GA 2GS9A 3OFSA 5DIZA 3HFJA 1MNAA 4PG4A 1XWFA 1ESZA 2FX5A 2O7SA 3KVNA 3RSQA 5IJZA 3Q3HA 1NBHA 1R00A 1OMOA 4DNFA 3QBJA 2Z2KA 1UBFA 3COZA 4HH1A 4MIEA 3GBSA 5TGDA 4JEIA 1OWOA 2I76A 3TQTA 1SXJB 2WSMA 1TQHA 3NS7A 3IILA 1V1RB 2P30A 4Y2YA 1X77A 1RAHA 3F4LA 3U4HA 5JNRA 3C3DA 4IXMA 1NYQA 2C99A 2ZYSA 3AERB 4ZZ2A 3PUJA 2C9DA 3TI7A 2JA2A 1QGUA 2Y9PB 3LY7A 5EE5B 1SPXA 1WXHA 2HNBA 4MROA 2H52A 5HF8A 4QBFA 1JEOA 4MWSA 2Q8NA 2X7JA 1VKHA 1YXMA 5IVDA 2C0PA 4N41A 1QRRA 5CM2Z 4LJ8A 2O8VA 4LRUA 1NV9A 1ZXBA 4ZQEA 3WYNA 1DX9A 1OKKA 3JTMA 4LZAA 4CMHA 3PEFA 5JQGF 5AH0A 4IS3A 1A2BA 2FSIA 2B99A 1J56A 4HX5A 3FOFC 4EDHA 4L9WA 2FXVA 3A4LA 1NE7A 2CMGA 2GD2A 1IHYA 2XHEA 3QEMA 4DA7A 2WTUA 3AETB 4K9RA 3BSFA 1QYIA 2X0RA 4GYJA 4FFVA 1IOZA 1JBEA 2P1RA 2CJFA 3TMYA 4EZEA 5ALSA 3EHEA 2B1RA 3LUDA 5CDYA 3K5IA 4MIKA 2M32A 5EKTA 4EO7A 2PLWA 1ZH6A 4KFCA 1MRSA 1UXGA 1T24A 2CFIA 2C3PA 2IZ1A 4NFSA 4B3MB 4BO6A 2E4WA 5BQFA 2B2CA 3JQQA 2WVAA 4QYMA 3A26A 4ENRA 1T34A 3D4LA 3R5XA 4GKAA 2ZIGA 3BIJA 4AICA 1YA6A 1T4BA 2IGBA 2CSXA 1GNLA 1C3OA 4YCJA 1RLIA 4JI8B 4MYRA 3EIXA 3CF6R 3EB9A 1FRFS 1DKRA 1UBSB 3DWGA 4R2XA 4TXLA 4EAAA 2VA9A 3KVRA 4IFTA 5ELLA 3LUCA 4IJQA 3AVWA 1N4DA 3DKPA 3S3TA 2BTQB 1NFQA 4TTSA 1IM8A 4NARA 4Q4AA 3ZDYB 4AJNA 1QRSA 4KQHA 1X94A 1F8UA 3LGXA 2AFIA 2VP6A 4ZV7A 5F3RA 4UEJA 2W2XA 4RE5A 3WFJA 4GI2A 2VUSA 4R1TA 4UASA 1IL0A 4EUEA 1SC4A 2AKAB 4IJKA 3H5TA 4HRYA 2IZOA 2FEWB 1ZNQO 2WJ4A 1QQTA 3AFHA 3RR2A 4OMDA 3AY7A 1FBNA 1KZ7B 4KAFA 3D31A 3TKYA 1TA0A 2G09A 4IXWA 4W1SA 4NBTA 3X43A 3JATA 2HL6A 2IYZA 2Q4TA 4GBED 2YXPX 2PVSA 1A8UA 3IBTA 3G7SA 4PGMA 1RRFA 4QDZA 5CIWA 5GJVC 1H2YA 1SBYA 1W2GA 3D5QA 3FG9A 3HV2A 3IQZA 1Z0SA 3LHSA 3NYIA 1DELA 2R47A 1LBEA 1KP3A 1KEEB 2WK1A 3KQPA 3DDCA 4WINA 5J5CA 5TX7A 3RAGA 3RNOA 2DFLA 4B3IA 3HYRA 5DN6D 5I4BA 1EU1A 3A3NA 1X8LA 2MSDB 5BP7A 4G1FA 2PH7A 1SWVA 1PQPA 1EJ6A 2POCA 3OFVA 4FONA 5C31A 1CF2O 1ZPDA 1RXIA 4CQMD 1ZI9A 2MSLA 2EZ4A 2OQ2A 3ROQA 5HOEA 3RC8A 4IYJA 1CLEA 3F67A 3IT3A 3RODA 1USUA 3CUWA 3EOAI 3II6X 3LXXA 4C29A 2I4LA 1RFGE 1HXHA 3AUAA 3ORHA 3TVTA 1ACMA 3ESCA 2I22A 2QTLA 4I66A 3TX6A 3TUJC 1YBAA 2C1XA 4LF9B 4M1OA 2EJBA 2K4MA 3HCDA 1UR5A 3DD5A 3KEMA 2RSLA 1CUXA 1PZFA 1JJAA 4QTUB 4WNAB 2ZI4A 1IB6A 2DHCA 2R6DA 4EITA 1GO2A 2JIZA 3I9FA 1WF6A 5JSKA 4G4SO 1EXNA 4IMPA 5AKEA 5H3HA 4D9BA 2VDKB 3AUSA 3UA3A 1H65A 2OQRA 1J0CA 3KCNA 1NQTA 3BXOA 3H5AA 3AB8A 5TPWA 4BEVA 3S68A 1Q92A 5E4YA 4Y3UA 3JVEA 3K20A 1LPBB 3ZR4B 5JR3A 1SK9A 4AY3A 3AJ9A 3BRSA 3RIGA 4DWOA 2FG7C 3VH2A 3ZI0A 1JR6A 1C0EA 1FP4B 3CTPA 3IB6A 1I2MA 4YGXB 1GG5A 2DQ4A 5DEIA 4PZ9A 4JJAA 5DZSA 2I6FA 2FW7A 1FYEA 3CKMA 1H2BA 1WLSA 1WMFA 4WZBE 1CZNA 2WIFA 3HZOA 1G1MA 5EUMA 1FJXA 2KYRA 3SE7A 4RZIA 1U0TA 3DFFA 3NRJA 4K2HA 4MWOA 4ZZIA 4LIPD 2OE2A 1G21B 2YJTD 2YQZA 1RIIA 5ALMA 3H0EA 4IXTA 4N18A 3K0AA 4FJ0A 4DCJA 1J2RA 1EFUA 4X1YA 3MYRA 3ONVA 4B7XA 1LSSA 1Y8RB 1VPLA 2XUJA 1N1GA 1V37A 3OX1A 3QBVA 4HYEA 5EYPA 3TPFA 4K9DA 3UAXA 3ZX4A 4BQOA 5A3QA 3C6ZA 1VBFA 2VRCA 1X1BA 2D3TA 1Z2DA 5EKDA 2V6MA 1QQ6A 5F64A 2I65A 3TR5A 2MINB 3JASA 4P4GA 4EW2A 5E7IA 5EHXA 2D2XA 4OP2A 1HDEA 4YXWD 1ZN8A 2B61A 3NYWA 4ZOLA 4YK7A 1VI5A 4PNEA 3M4NA 1VOTA 3GLTA 1V1MB 2WABA 4MP3A 3IEUA 4DA0A 1PG2A 3H4IA 3RFCA 3RT7A 3WLQA 2DQSA 1SKAA 1GZSA 2F64A 5DTMA 4WK4B 4JVSB 4BY9E 2IHVA 3FLMA 4DZTA 4E1BA 1C2TA 5G53C 1U4NA 5B64A 1M83A 5DNEA 4EEZA 4JJ8A 1NPYA 1JRLA 1KDPA 3REGA 3HJCA 4TVSA 2R4TA 1PV4A 4ZAZA 5CLGA 1IUPA 2EKBA 2NXWA 5G2OA 2OV6A 1G5IA 1PK9A 1WZ2A 4B43A 2J9XB 4YRNA 1MX5A 1L6RA 4OBWA 1KH2A 2QN1A 4ZD6A 3R6TA 3GEHA 3NXSA 5J9FA 4DLYA 4A7PA 3CUEF 1NVDA 1U1GA 5C32A 2MU1A 1KPGA 3PFHA 5HZMA 3GLFB 2ZM6B 3WYFA 3EVAA 3V7UA 4Y18A 5J4KA 1GILA 4WKBA 1A4IA 5L3ZA 3NPMA 1G8MA 1PX2A 2XRFA 1EFCA 3HZHA 4IHJA 3UT0A 3OY2A 4IEFB 2WDPA 5EJ4A 1R4MA 2PBRA 1CQZA 3CUUA 3DVQX 3LCJA 4GT1A 4NBRA 4H3KB 5JU6A 5AKYA 5B37A 3GOHA 3EWNA 1DAIA 1CUWA 4NCJA 4NNPA 2NO5A 5ICFA 1Y9JA 2HNKA 2Q1UA 3H2BA 4K03A 2ZRKA 3E9EA 2IY7A 4KXXA 4PIPA 4GOLD 1GFZA 1UWLA 4HDRB 4WT7A 3ZWYA 4U1RA 3ZXSA 4PZUA 4E09A 1TAHA 4BEBA 4F60A 4KBFA 5EJ2A 3V2GA 4J3NA 3VRHA 3RT9A 2YY5A 3RV4A 1ZD1A 1WUKS 2IXDA 2QM0A 3F4KA 3EZ7A 3RSCA 4HQKA 1QZXA 2AN9A 2PZAA 3A9SA 1UZNA 1PR9A 1HDYA 2J48A 4DUPA 1QFJA 4QPNA 1A04A 5AI5A 5IYZA 4R6WA 2FRDC 2JHFA 3TGLA 1S2OA 1C7FA 1U81A 5BURA 3TOZA 2O4UX 4MQ6A 1CY8A 1MBZA 1AKMA 3W78A 4QVKA 4FSDA 1CE8B 1YZGA 2GYVA 3CPJB 3K9BA 1D7AA 3A1UA 1QBKC 1P1CA 4PG8A 1KSHA 1XTKA 4O5OA 1PNRA 2NADA 3OX3A 3LAWA 3M6MD 5JZSA 2CZGA 2PCJA 3SXJA 5LQNA 4PZLA 4RZQA 4P33A 1E1RD 5PGMA 2QGFA 4P4TA 1UBMS 3AM1A 2YHIA 1T4CB 5CYOA 1Q0TA 4RBNA 3R7FA 2BH9A 2LCIA 3TKLA 2ZOSA 5FJIA 4CETA 1RQXA 2H63A 3GT4A 1HC7A 2CLEB 3OECA 4FFDA 1S8AA 2F90A 2V7XA 1FSSA 3K8YA 3QZUA 3SC6A 3NOQA 4MYDA 3H2HA 4R8KA 5HE9A 5JH7B 1ILWA 4YPFA 3CH7A 4KLNA 2J41A 4ZCSA 3GCXA 2V3CC 1JIJA 2GEUA 4TVKA 3UA4A 4ZEXA 1KVRA 3E9MA 2BEWA 3LYHA 1JIVA 4KU4A 1SURA 5HIMA 3TZKA 5JMOA 1OHHA 3G0OA 4WVLA 3KWMA 1K89A 1P73A 2BP7B 3OKPA 2AE1A 1VKOA 1DAKA 1KY5A 3MPUA 4HLNA 4RC9A 3EEFA 1I6LA 1Q2XA 3E1KA 1UODA 4UMFA 1U0HC 1O6CA 2W4MA 3LY9A 2D2FA 3OPQA 3G49A 2DWUA 1CC1S 3R3ZA 1EJ0A 3IV7A 3JWIA 4RL4A 5CHYA 4EG7A 1Q1QA 3GAAA 2GWHA 4C5AA 3WB0A 1A4UA 1ENPA 1K2VN 2ZRPA 5DHFA 3RC1A 1N3YA 5FHRA 5A3SA 2UDPA 2FG5A 3NTQA 1C9DB 3KNZA 3LM8A 3PC4A 3QUAA 4WV3A 4FHCA 3X1YA 3BK7A 3EGOA 2HIGA 4P3XA 3IAM6 2HMUA 3VI3B 3H87A 1RXVA 5IN4A 4CMIB 4AFNA 1FA9A 4IKPA 2P9GA 4FFOA 3K94A 3TRJA 1G42A 5AXBA 2IEBA 4BQNA 2J3DA 3IEVA 1ZHFA 2G5PA 2YWHA 3MPOA 1QHGA 2DTEA 4HZGA 4PHFA 4CEIA 2JHCA 3EARA 3SIRA 3TRKA 3W5DA 1J49A 4RSMA 4I2NA 5EEGA 4DEVA 3IULA 4BZXA 4L75A 3QEAZ 4COKA 1YASA 2ZKLA 3IDSA 2CVQA 3I01A 1P4RA 4EJ6A 5FXMA 4YUVA 3COJA 3TF5A 4RY8A 3LO5A 3UK6A 1EP3B 1W1UA 2N0SA 3QLVC 4TV8F 2P90A 2QTHA 2QQFA 2HJSA 2OBFA 2RHWA 1GT6A 1Z37A 2JLCA 4MA4A 3I6MA 4A8JB 1I10A 3ANYB 4P08A 1OC4A 1KE2A 3V1KA 2YBEA 5I7UA 3U1VA 2G1JA 2QRGA 1L7OA 4ZGBA 3HVUA 1ZISA 3F6EX 4V0LA 4PG7A 4LDJA 5K3AA 4QYSA 1TZJA 5JDCA 5H83A 2PZEA 4E5MA 1E1QD 3KKLA 1F7UA 2CJPA 4ZQGA 4RVNA 1WU7A 2XB6A 3WLHA 3W5AA 3VJRA 5DSZA 3QPBA 4I3FA 2HRCA 1FU8A 3CT6A 3WLEA 4WBNB 5FBWB 3R7NA 4B7AA 1I2ZA 3TZCA 3ZCPA 4E4YA 2XCUA 4PHTA 5D5HA 4B3DA 1SCNE 4RVCA 2ZSHA 3TG8A 3W79A 4HWGA 1EVYA 1U8CB 3NM4A 4R41A 4ILEA 3ZQUA 4W9MC 2VDOB 3AY3A 4FYKA 2F8SA 5BNIA 1SCDA 3AG5A 1A76A 4WBSA 4Q3BA 1JQDA 3UJPA 2G0TA 1VL2A 4I55F 4U7DA 1KVQA 1FC0A 2E18A 4JVOA 3VMFA 2H85A 3EZ9A 3ELWA 5AOVA 4M99A 4EFKA 1PZNA 1D6JA 4P7BA 3UMRA 5D3MB 4A0RA 1TYAE 5DNDA 2UZ0A 1WTCA 4OP3A 4N7MA 5CVVA 3B85A 1KK3A 4N65A 1XJQA 5REQA 1Q1NA 1ZJ4A 1DBSA 4YJGB 5JISA 3GEBA 3FSGA 3FTCA 4RQAA 1IY1A 1FU4A 1W96A 2ZB3A 3CQ9A 1YK1A 3G1UA 4PPQA 1R0LA 1ZKMA 2HRRA 2Y1XA 1G63A 3CLRD 1EINA 4G26A 3EC7A 4LX8A 4R68A 4QX6A 4E7PA 5I47A 2IX9A 1U0OC 2X5OA 1T2CA 3LMKA 3PEWA 3OX4A 4MNTA 1NN1A 2DLDA 1KXZA 1APBA 1Y48E 3MQFA 4V1CI 1F0PA 1BWSA 1NIPA 4HD8A 4BFZA 1Q3KA 3NIWA 4CV3A 1Z18A 3M2PA 3W5VA 1I7LA 2D8MA 5BSGA 2NNLD 2Z1DA 5L9AA 4ZC8A 3SWWA 5EI5A 1N7JA 2DUNA 1OBCA 2EZ8A 3VPFA 1VP9A 5IK2A 4DCNA 1Z6ZA 1JGTA 3FTNA 4XUCA 1X80A 3E18A 4KWIA 3ZJVA 3ESQA 3GGSA 3IOEA 1QZZA 4JXJA 1L4NA 1X8JA 3L4KA 1OYWA 1ZH8A 1ONBA 2VTKA 3C39A 4TVBA 4QFMA 3PEVA 4U7WA 2G0NA 2P77A 3W6ZA 1RQPA 3B5IA 3Q7QA 4HVTA 4JGIA 3VU9B 4EQ6A 3NR2A 1CJKC 4D79A 5A3JA 1NUTA 1WRBA 3AFGA 1PS8A 1IDOA 3IEXA 2X2EA 3OUTA 3SJBA 4HB3A 5EJMA 1L4HA 5B55A 1HV8A 3G9ZA 3ER8A 5CB4A 2NXEA 2VHJA 3UATA 5LJIA 2DFKB 4BMCA 3FNHA 3FGPA 1IJFA 1NR1A 3WK7A 5A2QA 4OKIA 4AP9A 4AY2A 3BRWD 3GROA 5JJKA 1TVCA 3K9NA 1T5OA 1P31A 4PGGA 4R54A 4ZI7A 3CU5A 4H18A 4Q12A 3IESA 3N6XA 2AIRA 1TW2A 5BMOA 1PK7A 4JGGA 1G59A 5DXFA 4CQMB 2O5EA 1O97C 1E5QA 2V96A 3F98A 3GJSA 4MJXA 6REQB 2YQ5A 4O2BB 1II0A 4EFNA 1J0AA 2E4VA 3W1VA 3WGKA 4F4IA 2N1MA 3LHFA 3KZXA 4RNDB 1YC2A 4UBLA 4Z99A 2NPOA 3H3JA 4RABA 1SUAA 1CVRA 1U65A 4NKRA 2I1LA 3BN3A 3D5TA 5ECDA 5BXQC 4EATA 3WAKA 3LQQA 2JAQA 1J7KA 1MTOA 1WKVA 2QR2A 4UNIA 3WGTA 3ESBA 1M0SA 5GP1A 3IHKA 5BT9A 2IV7A 4BFXA 2ZSBA 3C48A 4F1WA 4YAIA 3AHDA 1JQ3A 3KZVA 2G70A 3P96A 5FTJA 1HDXA 1MFZA 4WEQA 3CWCA 1Z6XA 1EMDA 1SBQA 3TTSA 2ZGVA 4FW9A 4HBZA 5ULLA 2QGNA 2PMKA 5CT4A 2W6JD 1JIQA 1X13A 1SIWA 1Z0DA 2D59A 3GFRA 4RFSA 5K6AA 5KINB 4NU8X 4G0NA 4FTWA 1H2RS 3C3AA 1OPXA 1XEWY 1V35A 4QGSA 4KYIB 4BNFA 3B1KA 3F3YA 1OJLA 5F21A 5DT2A 3EPJA 2PUJA 4ZXPA 2V6IA 3LP5A 4U0KA 1JIUA 2UZ3A 3FR7A 2V54A 3VA7A 3EH2A 3ZJTA 1AS2A 2ZTHA 3L5KA 3L8GA 1II8B 5KU7A 4BNZA 1WG8A 4J7XA 4UQOA 1NNUA 1KU6A 5AM2A 1DKMA 2OAEA 4C9BA 4IXNA 1WF3A 1DTSA 2VJCA 1YOVB 4J7CA 3GPLA 3MUNA 4ER5A 1RTTA 3REQB 1NBMA 5BWBA 2PXXA 2FMIA 4E70A 1NDQA 1JFFB 4KMSA 1DC4A 4MKHA 2V7QD 4J43A 4FD3A 2HF2A 1OBVA 5FX2A 1TCUA 2DPGA 2YR0A 3B9PA 3EPPA 1H5NA 3HBMA 3HPQA 3OMXA 2P2GA 4D3YA 4UAGA 1NHGA 3A04A 2QAGB 2VPIA 5KDLA 1L7XA 4QUKA 1FMLA 1A2KC 1HFWA 1M2VB 3B6EA 1RWVA 3ND7A 1S6YA 2VDVE 3IAUA 3E4DA 1A69A 3K0CC 1ZN7A 3R23A 4R8MA 1YIAA 3W2TA 4F86A 3CE6A 3JQ8B 3G9QA 1UT6A 3AJDA 4MICA 4WLOA 3TD9A 4CM5A 1D1QA 2WYVA 3VO9A 4E5YA 3G0GA 4MKZA 1S2LA 4XJTA 2Q3DA 3RFUA 1Y4SA 3O8RA 4LW8A 4IJ5A 4XJVA 4KVZA 2FR8C 1JG1A 3DXXA 2GPAA 4JLPA 1XNRB 5T4EA 3LNCA 2Z6UA 5J3JA 4AXXA 1CUCA 1JMVA 2OGTA 4Q7EA 5EMHA 3SFZA 3V4SA 3VVLA 3WWOA 2QT1A 1DXOA 3C6XA 1UPCA 1CUZA 1VBKA 4L2IA 5JDIA 3I09A 3T4PA 4OK5A 2DFNA 3NBMA 5DMXA 3F5DA 5KREA 1UZUA 1OWMA 3OLYA 2JZNA 1U8XX 3KU1A 1QGED 1V4VA 4DQUA 2HDOA 1YVEI 5CAEA 1HQCA 1BX0A 3QU9A 4WA7A 1X38A 2XAUA 2Y1EA 2BHSA 5K3FA 3ZVKA 3ND5A 2J0QA 3DTTA 4XUEA 2WOJA 1TTHA 3AVTA 3BFVA 2NO7A 1PNOA 3TSWA 4N4AA 3KXPA 3V33A 2Y0DA 1CERA 5AVSA 1SBTA 2EC5A 2P3SA 1O96A 1L5LA 1RYYA 1K98A 4OXYA 2G88A 3K9CA 1H05A 2P4QA 3BUSA 3LSYA 4PYNA 3ELUA 1RRGA 3L82B 5E1MA 1XNQB 1OREA 3LGSA 3INTA 5DLQC 1GEGA 3K9FC 1TM7E 1ONSA 1JFSA 2Y1WA 1EB8A 3CO5A 1EVKA 1C9EA 4NZOA 2BV3A 2VQEB 3DFMA 4QLOA 4ZOEA 4U8HA 3ZE7A 4B9EA 4D3FA 5H4GA 1L3BA 1VYTA 4GR4A 5LBTA 4RIHA 2GSWA 3AFOA 3WOVA 2QL9A 1TQDA 1U1FA 2QVLA 4FHEA 2HSJA 2OORA 2EFDB 4INPA 1CQXA 5KNCH 3HPRA 1UIMA 1U0GA 4Z4EA 1NMQA 3KHKA 2VXCA 5FDFA 1LK5A 3FVTA 3F9RA 3QLUC 1CUYA 1J7JA 2OV1A 1L7MA 3DE4X 2ETXA 1DVRA 5DNAA 1FRNA 1ISPA 3A6HA 3N28A 5CX4A 1LSUA 3EVBA 4UNNA 5I9IA 2C5EA 1R0BA 2QVGA 3AFMA 1TFUA 3DL7A 1X1AA 2FWMX 3GDHA 1QZTA 2CFTA 3N8HA 2ZE5A 2Q6TA 4M87A 5FNVA 3E7XA 5JS7A 3FMPB 1P3JA 3NAQA 2X3FA 4PC2A 3KVVA 3GXOA 4CM4B 1I5EA 2PZBA 4CFZA 2NSHA 4DWVA 4G1UC 1JHXA 3EXG2 3WV4A 1C1YA 5AKHA 5LYJF 4BQFA 5JPCA 2PL5A 4J1QA 4D8VA 3HA5A 4LGMA 5IJ0B 3ZHYA 5KKNB 3FWYA 2BD0A 4XUGB 1EK0A 4BVBA 3NETA 3UWPA 2XWSA 4TLCA 1JBKA 4ME6A 1RAGA 1I0IA 1ZSNA 1ICEA 3KYCB 2AFIE 2YIVX 3K0HA 3D3NA 3TGWA 3PC3A 4CTNA 1DIRA 1F8YA 4G41A 2X3UA 3HGMA 2MOKA 4CM7A 1AK2A 1SA0A 3GJ7A 2Z5VA 3H84A 2W00A 4CM3A 3T1VA 4YMTA 2Q9AA 4MLZA 1GNRA 5GZ1A 4Z0HO 3CT4A 4DUZB 3GLGB 1WSWA 1Y6GA 2D74A 5D1HA 5HG0A 1OH7A 1TU4A 3QWHA 4NE9A 4DCUA 4MQMA 5TGZA 3RUIA 1M67A 1PQ4A 3ADKA 4KTTE 4MV9A 4G36A 4JP1A 2IPLA 2BFBB 8ADHA 4JT8A 4ZAFA 2XWJI 1UQRA 2QM3A 3GGJA 1RHKA 5DXAA 1R0WA 621PA 2Z2ZA 1P91A 3B3AA 2X0FA 4ZYZA 4L6CA 5BV2P 5DK4A 4FMCB 4FYJA 3Q7EA 3L93A 2JIRA 1XLTA 4NICA 3OQIB 1DBWA 1MABA 5B58T 2IY9A 2EYQA 2D0PB 3ROXA 4FMDF 4DLXA 2H07A 4GKJB 3KALA 2BZ0A 2P6RA 4UUQA 2VS1A 2A84A 1AB6A 1DWUA 4BWYA 2HWYA 5A5VA 4V0NA 1KAHA 1UQUA 3ZJ5A 1VHWA 3PLRA 1KK0A 1OGJA 3DYVA 2L18A 3B6JA 3DGFC 5H8WA 3A6DA 4LXUA 4QFBA 4HH3C 3AHJA 1JAIA 2ZQZA 4MEAA 3LQ4A 4UOZA 4YHHB 4TWJA 1IQRA 4BNWA 3E8SA 3GLHB 4KQGA 1YTLA 1ZU5A 2H4WA 5SZKB 4A3SA 4YJ3F 1D1SA 1W0JA 5KTPA 3E82A 2C58A 1NXWA 4X6XA 2ZR9A 4P4NA 2V74B 4QOIA 4N3CA 4EGCB 3H75A 1KAEA 4KDCA 4S1TA 1E4EB 1NG1A 4XB2A 4KSYA 3RWMB 8MHTA 1SKYE 2PK3A 4YH1A 4Q1BA 3LC0A 1A5TA 2PUWA 2E4YA 3IOMA 1CR4A 1YFJA 5CVCA 4U5QA 1U28A 4R1UA 3ZIDA 5C1DA 3OCVA 1QIEA 4JLWA 5T64A 3IJRA 2GTIA 2QV7A 3KO8A 4YCCA 1LF5A 4Z4IA 4AC9A 4L0QA 2Y92A 2REBA 5B4VA 5I9LA 1N5DA 3JARB 3DV9A 1CJTC 2WKQA 3CCFA 3EYAA 4G85A 2K5UA 1I2DA 3R3JA 1AA9A 4LGCA 4GICA 2DTDA 2VLBA 1JQKA 2H7XA 4KRXA 3BF7A 3FMVA 3U19A 2N47A 1RWMA 2X22A 1R12A 1LUAA 4HPWA 5GJWC 4RXMA 2A9RA 1DQZA 1DJQA 1FDIA 1YQWA 3AGPA 3EK2A 4DHEA 4V2UA 5AR1A 1CRQA 3V7WA 4JS0A 1UEJA 1XD8A 2G4CA 3TVYA 2W4IA 1KZ9A 1AJEA 1DXYA 3HLKA 1JSRA 1BFDA 3ZDEA 4G4IA 1MPTA 3ZBPA 2A0KA 4BZQA 3GARA 4YUXA 4UQPA 1PBNA 4ZQFA 1PJZA 1UJ2A 2JIBA 2QSJA 4PGAA 5TJHA 3UOGA 4URXR 5JAMA 2CNOA 1U3TA 4JYPA 5F78A 1N6HA 1XEXB 3RRXA 1XKQA 1HLDA 3CLHA 4GOOD 4Y9DA 1Y8CA 2P5YA 4BPBA 2PZJA 3QG5A 4IIJA 1BXGB 1TFRA 2JCSA 3R3XA 4DM3A 1E18A 2O14A 4BQIA 1EXVA 2B7CA 4FQ5A 4WDRA 5LR6A 2G7ZA 3I01M 4AQDA 4RQTA 1BXRB 3RABA 2R6R1 4L3VA 1NF9A 2CKDA 2IL1A 3ITEA 4HGRA 4LXYA 1MGOA 4NYJR 3MJRA 1RAEA 1K68A 4CEHB 3SX0A 4UAUA 4YUZA 3DZCA 1WWKA 3R9IA 2DE0X 4Q3LA 4C0JA 1PZGA 1VLVA 2WNHA 3EC1A 2LD4A 4MDFA 2AQKA 1XRMA 1Z25A 2VNAA 1U2RA 4FNAA 4ZARA 5C4GB 3H1GA 5HRAA 4V0ME 5G41A 4MS3A 1QCCA 2BMWA 3TS1A 3SDZA 4DC0A 4ZO9A 1DC5A 4TL8A 2JA1A 1ZCZA 5FO1A 1COWD 1JXMA 1XMIA 1OGYA 1OLXB 1U0NA 4J29A 4DCOA 4CF7A 2IYWA 2WYWA 4MPPA 4W5TA 1XZFA 3OF2A 1FL9A 1DS6A 1IXYA 2G4LA 1VMDA 5JYEA 2JFFA 1TUGA 3NOXA 5BO5A 4D7AA 2VFAA 3FFXA 3HUEA 3KHSA 3RUDA 3TQOA 1HDZA 5JECA 2IE0A 4PICA 3VZPA 2AZXA 4G1BA 3UCEA 2UYGA 1G6Q1 4NEGA 4F9GA 2VCEA 3OHMA 6ABPA 2OCIA 5ICGA 3B38A 1KWKA 3ZXYA 1OY1A 4HF7A 3IUQA 2GZ2A 1VCMA 2X8LA 1VHTA 4OHZA 1UBNA 3CBGA 3DCIA 4M0EA 4LGYA 4AK9A 4E12A 5IX8A 3KQUA 2OCDA 1T3SA 1QRDA 5B1YA 3TNDA 1EDBA 1YQXA 3WZ2A 2IW3A 2ZDGA 2FEKA 2PS1A 4G0ZA 5E7MA 5FLEX 5JMWA 1S3FA 2B69A 2LTAA 1GPWB 4HH0A 3I45A 1M6VA 2B4AA 4K6CA 3C8ZA 3H0CA 1IUOA 3LVRE 4QBIA 4A82A 4AZ3A 3BREA 1H8HD 3L49A 3EGXA 3PLNA 5CVTA 2W90A 1L7VC 3PE6A 3E3NA 2PX3A 3VHXB 4AIIA 1XRJA 1VG8A 1TL7C 1YRQA 5ALTA 3CUKA 4XPZA 5E9QA 2E89A 2ISQA 4MB6A 4QARA 2X0EA 1KETA 3M5WA 4B34A 5KU1A 3GP5A 3C16C 4MAFA 2ID9A 3AHHA 2CNBA 4O2AA 1ZUHA 4EARA 2X0NA 4DLAA 3JW8A 1RSZA 4B6RA 1JR3A 3HE3A 5G3YA 2GPJA 1MJGA 4HB2A 1DV2A 1MH1A 1V71A 3C6MA 3PC8A 1PKXA 2OHXA 3ONFA 3PL1A 5I9SA 4C06A 1U7UA 1ZR4A 1JQBA 1NP6A 1N2OA 1QDUA 2HLDD 3IAM1 2C42A 5EHGA 2YWFA 4HXEB 1P9LA 1OX4A 2NU6B 2ZT8A 4NBNA 4RF3A 5MDHA 5J2UA 2OAP1 3AXTA 3K6KA 3KB2A 3FWZA 4PCLA 3WJ2A 1L5RA 1KI2A 5A9TA 3V8NA 2H17A 3ES9A 4AKEA 3U7IA 2H1LA 1GRQA 4F93B 4EHBA 1EPUA 1RPJA 3WZMA 1B8PA 3FGOA 4KN5A 2OPBA 3EG9B 2QZ9A 2A86A 1Q21A 3IHTA 3O8QA 3DE0X 1E2UA 4MB0A 4NBLA 1E1NA 2VJAA 5DMHA 1T3ZA 4QM7A 3SQXA 2ANBA 3R5TA 4ECEA 5CD1A 2RD2A 5EIWA 3WAJA 2J33A 1YO6A 3RU9A 2KBEA 4G01B 5GMOA 1ULUA 1X70A 5DI3B 2P9FA 2VSFA 3ITNA 1YIOA 4IRXA 4QRDA 1HTBA 5BQPA 3TJZA 4F38A 1GQSA 1TYZA 5BN1A 1IOLA 2GVZC 4MAMA 1AMUA 1JLLB 1XX6A 2RONA 1B7GO 4X90A 5I3ZA 1GY8A 4Q9DA 4NENA 5JI3E 4QL3A 1CEEA 1EIZA 1X9IA 2UZ4A 3M5CA 4E2ZA 5E6RB 1UAAA 3I4LA 4E5NA 1N0HA 2RKOA 4DBZA 3K1YA 1EX7A 2ORED 3ZHSA 2EFCB 4Q4LA 2WC1A 2Z8YA 4KAAA 2H9AA 2O2JA 2ADFA 4XX0A 5H59A 3WVNA 2Z57A 4HOYA 3V55A 2ZR7A 1T2AA 2BEVA 3H4VA 4F91B 4Z51A 1VGVA 2XLBA 1C9MA 4DLKA 2XOKD 4G1EB 4AO6A 5CLLA 5L53A 4I4TF 4CYMA 1WXXA 2YXNA 4NCHA 3ICEA 2PRIA 2ZR8A 2EKDA 2QBYA 1D4OA 3B78A 3SXUA 2AOUA 3GLVA 4EP1A 4OQ4A 1QONA 2Y71A 2F7SA 2DWQA 2VATA 1OGIA 3EGIA 4WN9B 3I53A 3TR6A 4K87A 3DZHA 4WJZA 3OIFA 2YV4A 3MTBA 3NT5A 2EVWX 3AQIA 3K05A 3SZOA 4LQLA 4DLPA 1USGA 3Q85A 4HFJA 3ZWAA 3CTMA 1CJCA 3NTLA 1Q0QA 3GNLA 4Q66C 4OLAA 3FTDA 2VSXA 4H7PA 5HTKA 1OC2A 2OMEA 3GLKA 3T4EA 1XMOB 4I0WB 4EKNB 1ZMBA 4DC1A 2B92A 2GCOA 3VDRA 3SX4A 2JGDB 1MLDA 3P9ZA 4EUFA 2P2NA 2WMOB 2WAOA 4IUYA 1ZUWA 5K2MA 3PHIA 2H2WA 3FFAA 2VOEA 4MEBA 4JOSA 2AV6A 5CPFA 5EZYA 2OO5C 4CTKA 3AVOA 4UW9A 2CLDX 3DG9A 2Z6VA 4NQRA 3QF4A 2F3QA 4DDVA 2Z83A 2R11A 4D8TA 2LWIA 1EH5A 3PP8A 3URKA 3CXRA 4IDNA 4LDPA 2M6SA 3EZYA 3O90A 4LJ6A 4GYWA 2NX2A 5CH5A 2OK8A 2PUCA 4KFTA 1Y3IA 3LQKA 3IUMA 4UM7A 2N1BA 4CKWB 3BA6A 4ZYTA 2J7PA 4KYTA 1NW6A 3UGTA 1GNQA 3DULA 3M5PA 2Q7DA 4DB2A 1YR6A 2VTBA 3KEQA 5K8IA 1KO5A 1Z15A 1FVHA 3A36A 4M89A 5FLXA 1U5BB 2POQX 1VXRA 1VIVA 1WSAA 1F7VA 1FYFA 5KSOA 4RCVA 3CJTA 1BDHA 4TL7A 2PWYA 5CFRA 4A15A 4BTVA 3RYHB 2JFNA 2O57A 3A7EA 1Z2NX 2YWGA 4IH4A 4NBVA 5THQA 1BCRB 4RA9A 3DO6A 4QYTA 4WGGA 4MCHA 3ZIAD 3KDAA 4RSGA 5HYVA 3ZKWA 1P1HA 4GZLA 5BR8B 3IIEA 1MV5A 2B83A 2WLTA 4CLXA 4AY6A 3T9AA 2DBRA 2JCYA 1M5UA 3FOAA 4MVJD 2C9MA 2XMDA 1RC0A 4ROTA 2OKCA 4MIYA 3SM3A 3UAWA 1KYWA 3CKKA 5K7SA 1EUDA 4WZAB 2RGGA 5HRUA 1SHLA 1W9MA 1YWGO 7REQB 2Q3EA 4WAUA 2NZYA 3S8EA 2JGJA 4PLYA 5KNDD 5JXJA 1EYZA 1U7DA 2D8AA 2PTHA 2QX7A 5I7HA 4D4JA 1P0QA 2A5FA 2G28A 2PSEA 3PK0A 2F62A 2I80A 4JASB 4TLBA 1G3IA 2PX8A 3ASVA 3JD2A 4UUPA 3LLUA 1XZAA 2HEIA 4JY7A 4NRDA 2VZ0A 3FVVA 1OH5A 3VDQA 2AJBA 4R8SA 4DMUB 3VKGA 1R27A 4KZPA 5TQ0A 2J6HA 3R0VA 4AWBA 3IQEA 4L73A 2RG1A 5U4QA 1TO6A 1ULZA 1M0WA 4KLRA 2DKOA 3ANSA 4DCGA 3R44A 2WQ6A 3B7WA 4WADA 1D4AA 2XQFA 1EE9A 3A4MA 2BFFB 3PL5A 2ZI7A 4PR0A 3KB8A 3AF4A 1V2GA 3JQFC 3BDVA 4HMPA 3NEPX 3G0DA 2P3OA 1X9GA 3U4AA 5DB4A 3WGOA 4GPZA 4HYYA 1EGAA 1G1AA 2IUYA 3FDFA 1Y82A 1GGNA 3SX2A 2QPOA 2FFAA 3OOYA 4FPXA 2DFVA 2YN4A 1Z7WA 4X20A 3ZLBA 4NECA 5DCLA 5KYUA 3COVA 4B3HA 1QP8A 2IS1A 1SUBA 1GU1A 1GU0A 4E46A 1D6SA 3R5SA 4MRMB 4IZHA 3HACA 4FKMA 3VNUA 2CNLA 4MZXA 2YWRA 4PQYA 5D00A 2ZJ0A 3WGIA 3HB4X 1O95D 2REQB 4PQRA 1ZK2A 4L4SA 1JEYA 4XWTA 5JJLA 4TYWA 3QFCA 2XKAA 3L6DA 4L8VA 3ROGA 5JC1A 4K8OA 5D84A 4EB3A 1NBME 4Y6GB 4XVHA 3T3OA 3CMMA 2LDBA 4EG1A 4YP9A 5AM0A 2ATEA 2G07A 3BERA 3IDZA 1PRYA 2V7PA 1I7QB 4JI7B 5AVZA 3CRMA 3DFKA 3U61B 3E9YA 4QPZA 3O2JA 2BSAA 5E4TA 3FB1A 3VAAA 4F6RA 2WU0A 3ZYCA 1IY8A 1F60A 1MEEA 3WMFA 4LQCA 3D1VA 1NXTA 1EG2A 1Y5LA 4HN9A 3ZV3A 2BI4A 3AKCA 3V00A 5AJXA 4JI0B 3GNQA 3VBCA 3ZQKA 3V9PA 1XR3A 4G5RA 5E8RA 1CZLA 2RHGB 2AJLI 2RHCA 3OWOA 1B15A 4OFZA 3ROKA 4QUJA 3LPDA 1CUSA 2VZ8A 1AUQA 4OIFA 1T5IA 3OZSA 1IJBA 2WJYA 2A67A 1DI0A 2F1HA 1VL5A 3JWJA 4XA8A 2B98A 3M6IA 5E1DA 3S2UA 4DV0B 4KJXA 5KNBH 5H0IA 4B0PA 3RBVA 1GA4A 3DLCA 1N8NA 4LXIA 4KIFA 4EB6B 3DLPX 1S7CA 1C1DB 1P74A 3MCAA 4UHDA 1XHLA 3RC2A 3V1LA 2XTMA 1BDJA 5JV5A 3JQ9A 4FXOA 2J9FB 3DF7A 4PVDA 5B1IA 5JDCC 1KDYA 4PVCA 2PNJA 4BCDA 5M29A 1P17A 2PWPA 5JCJD 4MV4A 3PNOA 3AUJB 3PG5A 4KXFB 5FBLB 1F14A 4ZOCA 3VX4A 5D8DA 5ES3A 4EL0A 4M7OA 1R6BX 5AP9A 4FFBA 1T8RA 4YP6A 5KTYA 1DC3A 5JASA 2KJQA 3V1TC 3IHLA 1HYQA 1WQ1R 2EKQA 3OOEA 3Q9NA 3NYQA 5EWMA 5HA5A 1N2XA 3Q3IA 3KUUA 3SZUA 1G17A 3U09A 2PGIA 4OUDA 2QVCA 2YYZA 5F76A 2PCLA 4Q4DA 3NHLA 3WY9A 1V41E 2FFRA 2H29A 2QLTA 2XNSA 3V3KA 4F1JA 4WLNA 1PO7A 4M3NA 1IB0A 1SVUA 2BGKA 2DWCA 4P98A 4AB1A 4HDKB 2GPNA 1K5HA 1ZD4A 1J24A 1I1HA 1UCFA 3OD5A 3L1JA 4EGFA 1EDZA 4KV9A 2IXEA 1SCBA 4KR0A 3IT1A 2GKOA 3NH6A 2ZJ8A 3I6QA 3KR1A 1NI4A 1PT7A 3HZRA 3QHAA 4FUQA 3FI0A 4JJ6A 2Y1CA 5IU6A 3CNQS 2F3SA 1D4FA 2YOHA 4LHSA 2RHOA 2C77A 3MM4A 4IWNA 4XIGS 3ZVLA 4G84A 5FR2A 4KQWA 3USES 1DAMA 5GAJA 2E87A 5JAHA 1XZHA 3OP4A 1R0CA 4KXWA 5A0VA 1R0XA 1UMCA 3NIDB 1WNFA 1E6MA 2UUAB 1ZIXA 2YS6A 3MRVA 3K6RA 4YWHA 4DQLA 1CR0A 2OAQ1 1CCWA 1USKA 3E05A 2ZTSA 4J0DA 4KKXB 1L8AA 1IN1A 1WHTB 1G3RA 4S35A 5EQDA 1O2DA 3IMGA 1T35A 1HE8B 2VJLA 1QG0A 2A9VA 3O8OA 3Q2IA 4G0XA 1GTZA 3N6VA 4CIWA 4FT2A 4D1YA 1DLJA 5IDXA 2BL4A 3S6JA 4CG2A 2I8AA 1VI6A 4QKQA 3OZBA 3ZWBA 3I8OA 4JJFA 5HQ3B 3HVJA 3UY4A 2NVUA 3Q72A 4JL8A 1VIYA 2DT5A 3ICPA 1Z7BA 5IT0A 2X2OA 1GZ5A 1P7ZA 3QH4A 4IHAA 3THYB 2J3MA 4EI7A 3NFRA 1S4QA 1N75A 2ACKA 5TGTA 2CLKB 2I3ZA 3R7LA 2GRAA 2X15A 2H7YA 3H1FA 1C0PA 1VPDA 2UZ1A 2JCBA 1W88B 2NYVA 5ALQA 4F6CA 2YX1A 5T7BA 3MRXA 1ECBA 2R7LA 4F3TA 1VCIA 3M1IA 1Z45A 1NSYA 4WCFA 2OMKA 3DNMA 4IJVA 2BKLA 4LTNA 5C1BA 3VHLB 1XD2B 3C1OA 3PDHA 4DC9A 2C2OA 4U2GA 1GQ2A 2R44A 4HADA 2VYNA 1DJNA 2VCYA 1TAGA 2ID7A 3HXTA 3LS2A 1ADCA 4O1IA 4FWIB 1FYDA 1FYXA 3EXIA 4CL8A 1PR0A 4ZHQB 5A4KA 1W36C 2O8EA 2FWAA 3N1UA 1MEOA 2G8NA 5IN5A 3AVYA 4K9KA 4EKGA 1E3DA 3Q8LA 5TARA 4L4RA 4JBHA 4ZC1A 2ZXFA 3GW8A 5IJXA 3BWBA 4B7ZA 2OFPA 3K0BA 5L3SB 1B41A 6NULA 3TK1A 5LOVB 3QV2A 2G1KA 2CXNA 3A3YA 3NHUA 1OXXK 3HXLA 3KPVA 4GVPA 3RVOA 5JZBA 3ZE8A 1RYMA 3N0VA 5DYGA 1PFUA 4RK1A 4M9UA 1Q7BA 3PI7A 2UUCB 2B3TA 1U0SY 2CXRA 2CCGA 3CJQA 4MVCA 3DT9A 2BZGA 5LLTA 1KQFA 1L8QA 1QVAA 1UPBA 2D54A 2MSEB 2QUJA 3OCXA 4MWTA 4Q18A 3OT1B 2JJ1D 4IO0A 1YHZA 3ZEAA 3HKDA 3H0KA 2NQ8A 5LQUA 1OT5A 2BKAA 5K2OA 1DIGA 4PO3X 3B48A 3UJ3X 4D0NA 1W48A 2OUKA 1C4WA 1KAMA 1Y7PA 2Q9BA 3FF1A 4J4TA 4ND6A 3R24A 5CCEA 2H4FA 2LZ0A 3H5OA 5HR5A 1SOAA 4NF2A 3ZJYA 4B4VA 1U8UA 5G0VA 1AZSC 4E5KA 2WYHA 1V25A 4TKLA 2CF6A 4YLGA 2G40A 3FAKA 4KREA 4LDNA 2JKYA 3D7SA 1SKQA 1KTVA 3H8VA 2PE5A 1HSZA 2HHAA 1NBWB 2HLHA 1KDVA 4JELA 3URMA 3W6UA 4ER3A 1CS0A 3WWCA 3RJ5A 3OQOA 5IYZF 5TT0A 2UUBB 1M3SA 1L9XA 1CF9A 4PQFA 4IVRA 2H1FA 3IIMA 3M49A 4Q9JA 2ATCA 4ETMA 2ZRCA 2QE7A 4IOLA 4YALA 4D26A 1V11A 1X7XB 4O4JB 1Q74A 4IPTA 2N9UA 4OBBA 3T7TA 3NAZA 5A03A 1X1QA 3G0CA 5EP1A 5CT8A 3WI7A 3FPCA 4AS2A 4F6LA 1Y3HA 2O2DA 1WY7A 3EXG1 4HAXA 4YJKA 5E6SB 1XMVA 4JQZA 4II2A 1HNZB 3MD0A 3DCNA 4HTAA 1E62A 2XQGA 3CUYA 4JVLA 3C5HA 4JB2A 3C5EA 4BBZA 1I51A 2FUNB 1VDZA 4OGGA 1B0ZA 4LCJA 4X1OA 5JDIC 2PUTA 2EBFX 4RK5A 2HPZA 4IIEA 1KOFA 2F43A 2R68A 4CLHA 1HE5A 5LM3A 1MH9A 3ZGOA 3N3AC 1GAXA 3ER9A 2IZ5A 1GPBA 4LTMA 3AI2A 4HRXA 3L9XA 4H17A 2QMZA 1V3UA 3T9BA 2I87A 2PNFA 4QEKA 4F96A 4QYXA 1EGHA 1WW3A 4OU4A 4TLDA 2F8MA 5ALHA 3NOVA 3BXGA 1AKRA 4DDWA 2V6BA 3QKWA 2Z4TA 4DRXA 1TD9A 2C1EA 4AUEA 4QNMA 2NTEA 3HYLA 4NYMR 2INGX 4JXZA 2V1XA 2QS9A 1SMKA 4QWMA 3I4FA 2QB5A 2EWVA 2IKSA 2A14A 3HY3A 4RUKA 1LPOA 4GQAA 1DQNA 2GXQA 2XCOA 4TMWA 5HUJA 4EYOA 1GZVA 1K75A 1RI5A 3HKEB 3DC7A 2G5CA 1ABFA 5BUQA 4W5NA 4W6ZA 1X7ZB 3FNIA 4M1YA 1ZVVA 3R09A 5HHTA 3U3RA 1CQJA 2D1QA 3OAAD 4LOAA 3DAPA 4RCYA 2R79A 2O3SA 4CPDA 2HU7A 5ALZA 1S2IA 2OORC 4YRGA 3GVHA 2OHJA 2W93A 5K8TA 4DR7B 3PEYA 2GARA 3HU1A 3I2YX 4BQEA 1P5RA 5A5GA 5AFSA 3JQBA 3PJRA 2ZBRA 1B16A 1RJ9B 2J87A 2R4UA 4EEXA 1WDMA 4C6TB 2V8BA 4PNZA 5KO2A 4EZIA 2B7LA 2XMZA 4G1CA 3HN7A 2I2AA 3PJEA 1K66A 4MJ7A 4YR7A 5CITA 3HYTA 1XT6A 3F8TA 3EQ2A 5GM2A 5J58A 3W8NA 2J0UB 3ZOKA 7AT1A 2H31A 3FCSB 4DQVA 4OO3A 5TB5A 4M1EA 1UK6A 2BR3A 2ZIVB 1FDOA 2EP8A 3EIWA 4V24A 5B4TA 3THXB 3OTQA 1TJYA 1E79A 4K6KA 3HB7A 3ZUPA 4JHLA 4ZDWA 2NAPA 4DEXA 4DJFC 2G0AA 4F4UA 1RT9A 4CFYA 2BFEA 2HV9A 2HBRA 1QO0D 3T3HA 2PLNA 1FMCA 1A2QA 4DNQA 4X45A 3PFBA 2UYYA 4R01A 4HXYA 4EJ2A 1PSDA 4R8VA 2FUEA 3GDGA 4I19A 1GKIA 1TQ8A 2J4CA 1FTNA 5LCXA 4K2AA 1M5RA 1BOFA 1NX9A 3R3HA 1PJBA 1YUNA 4ZZ0A 3VU3A 5A0TA 1FSGA 4FI3F 3AM5A 3UH1A 4F45A 8AT1A 1H22A 4RULA 3F49S 4R1MA 5JNSA 2WM8A 3DCJA 1RYBA 5I7OA 3JQAA 1JLSA 3GJTA 2HRDA 1US8B 4DM7A 1JKMA 1XMQB 1VECA 1TZMA 1L4BA 3PXCX 2ZRIA 5I9MA 4C6SA 3DVLA 3G5MA 4HUQB 4L5YA 4P5DA 3V32A 5IULC 1MX9A 2FWNA 3LLMA 3UUWA 2EFGA 2JVJA 2RAUA 5JOQA 3OEEA 3AJAA 2M6LA 4EA9A 7GPBA 1PQUA 2DWOA 4M4SA 1RBYA 1M0EA 1X1CA 2O2EA 1DAEA 3A8TA 2Q3JA 1QLHA 1XLTC 2NUTA 1AQYA 3UUEA 2VQFB 1LVUA 2EATA 2I71A 1BE6A 3M70A 1GXSA 3M4ZA 5EOVA 3J7AC 5C5CA 1FSZA 2OSBA 5IEBA 1G291 2V58A 1S02A 2B5OA 1OAAA 2JI7A 3BD8A 3DMFA 4NPCA 3IP9A 4ZT3A 4DAEA 7ABPA 3IP8A 1YR8A 3BILA 1M8FA 2BGIA 4JMPA 4RFVA 4Q3EA 1UEXC 2Q5LA 3TW0A 3PX3A 3CNOA 1NR7A 1ESCA 4LKRA 1FU7A 4Q1CA 4ZT6A 2G82A 3FIUA 1P7CA 1F12A 4B48A 4QXQA 1IHUA 1ZMXA 1QU2A 2GAAA 1QF6A 1P4HA 2K7FA 3T06B 2JLVA 3KEOA 1K1EA 3LHKA 2AR9A 3P5SA 1EDOA 3TIXB 3MJTA 4D0LB 3I2IA 2X4GA 2DY0A 2B82A 3QUQA 1OHHD 2EBHX 1EFPB 1TE2A 2R00A 2ZPUA 3DMTC 1R8JA 2HADA 1L5HB 3DUFA 3GEIA 3IIIA 2P9TA 4H3VA 3X1KA 4II7A 2NP7A 4ND1A 3GBVA 3PUKA 1T0UA 4J0GA 4G5XA 2QUKA 3F9IA 1W8DA 5AKKA 1OXMA 3M89A 3H99A 2GT1A 1KFCB 5DO9A 5KX5B 5LP1A 2QW0X 2EDAA 2XDAA 5JBQA 2TYSB 3SSMA 1OWNA 5HRCA 1R4NA 3ILYA 4V03A 3GIDA 4BO0A 1KQNA 5ALRA 4PAQA 1O3YA 3L8EA 4BLOA 3L06A 1WB4A 1YCFA 1Q84A 3NM5A 4MWZA 2WFMA 4FLFA 1NXXA 3TNFA 3CUSA 3OESA 4YRTA 1DDGA 2FEAA 4GNKA 4D82A 1Q91A 3BA1A 1JHAA 2DYKA 3KVOA 3AEUA 3EGCA 3HEAA 2CWWA 5EXSA 2QD2A 3V6MA 2IFTA 3V8EA 3VTZA 2Q62A 2ZWPA 1UC9A 4WW0A 4YECA 2ONYA 1C14A 1Y9AA 1SUEA 3GELA 3I32A 3I6IA 2IK8A 3EFEA 2YJZA 2GA8A 2E82A 4FKBA 3QUCA 3LK6A 3TNYA 4BN0A 5LQMA 4CMBA 3M6XA 4K9MA 3MJSA 1HE2A 2BE9A 1TADA 2DBQA 2L69A 2H11A 5JWHA 4LF7B 2PWZA 4DXDA 1WIWA 4WLEA 2GBLC 4IDPA 1ABBA 4PAOA 3PX7A 4LHZA 2CY0A 4QGBA 3M2TA 4Y2JA 2XGMA 2Y67A 1EX9A 4MQEA 3PQ8A 1RQLA 1W76A 2WV9A 1UM8A 1JAXA 1J1UA 1F0YA 1G4AE 4PZCA 1ZW1A 2AMYA 5K3DA 5BV1A 5CA1A 5JCPA 5ALVA 2OTCA 5B7QA 2WF5A 2BISA 3AL2A 2AXPA 4MHSA 2FZCA 1LV8A 3OOWA 3CLSD 4RLFA 4YV7A 3S2GA 1YZKA 4ED9A 3B3JA 5LZ9A 2BZ1A 4W4TA 1PG5A 1S1CA 1S0UA 1ECFA 1IN5A 5AI9A 5FV7A 4Z4GA 3OPXA 4F4HA 3V7NA 1RXCA 3GCWA 4OJMX 2ZCJA 5G02A 2GLXA 1ODKA 4TSFD 1IZ0A 4P35A 1NQAO 2ZRGA 2RGAA 1T9BA 4KE9A 4TTAA 1J2TA 1V26A 5FYQA 2GJ4A 5KKCA 1HDCA 1W0KA 4QAJA 4X60A 2X0DA 3ILVA 2ZPTX 1X3SA 2OCBA 4G67A 4UVHA 5DV9A 5HZGA 2CB0A 2K7ZA 3FRJA 1QH1B 2VJKA 1CIPA 1IM5A 2HZ7A 1C3OB 1M6NA 2PO7A 3DEFA 4OLJA 3DVSX 4BQQA 1SB9A 3JVVA 1QCZA 4CUKA 3T9EA 2BFDA 3HBAA 2GERA 3TLGA 2WV7A 2Q1WA 4ALKA 3C4VA 5C2JB 3NJ8A 4HGYA 1EWKA 1HMPA 4IDEA 1W0CA 3P2EA 1ZM2A 3QPAA 1ILEA 2UYCA 4HWSA 2ZAYA 2QJOA 1V7QA 4HQLA 1OWLA 1X14A 3M6LA 1I2BA 5DYWA 2O8CB 4MQ5A 2FWRA 2C4NA 2FETA 2XE6A 3WMEA 4B8ZA 3GFPA 2A0WA 3V2IA 1IU9A 1LV7A 3BMQB 3AWDA 2ZUUA 2WWWA 3KU4A 2G1PA 2PX4A 3UPDA 4A2WA 2ODWA 4BGEA 2F3RA 2JJ2A 4GX0A 4B4UA 3JATB 2FSFA 2BYTA 3UK1A 1LNQA 1ORIA 3KUKA 3WWDA 1I2AA 3FGNA 3NX4A 5C8YA 2RG7A 2V7WA 3ODGA 4MV5A 2ZJZA 2WQ7A 3OE4A 4GBMA 2G9RA 5DHRA 1GQFA 1WOYA 3EW7A 2V4ZA 3R3SA 2QWXA 2O1XA 2WHPB 3C7KA 3D8TA 5DOZA 2AF3C 1Y89A 3KFLA 1I0LA 4OX9Y 3ASUA 1SULA 1LDGA 4D81A 2QDKA 3OZAA 4X91A 1SBHA 2XBLA 3PC8C 4QXAA 1KC3A 3ZDQA 1KEVA 3H2YA 3T7JA 1WO8A 2F9MA 4YAJA 3ZCSA 5HIAA 4XGKA 4IINA 2AMVA 1Y98A 2HT6A 2ACVA 5J2TA 3FD8A 1D2MA 2O8DB 1L5NA 3C1TA 1Q14A 4UUOA 4FIDA 2J0EA 4YASA 2Q4RA 2OC4A 1ZCJA 2FAXA 5KSPA 1VIAA 5IKOA 5AK3A 3C85A 1PNTA 3S2ZA 3GRKA 3SZGA 3U31A 4ALIA 4BLWA 1L1FA 1PQYA 3W06A 3WRVA 2QUAA 4MP6A 1Y6FA 4II3A 1W36D 4PZDA 3W8EA 4YJDA 4HR7A 2JJ8A 3W05A 1TD1A 3FJ1A 3JQPA 3HQ4O 3SYRA 5KZMB 3K8QA 3LF2A 3BE4A 4WKPA 1Z9BA 4CM1A 4UCQA 2VK8A 2X76A 4FS8A 4JHXA 4ZANA 4DR3B 1ZK0A 2YYYA 4N5LA 5DGCA 5F2KA 3K7EA 3WLLA 4JYAB 3PNKA 3JAWA 2GEDA 3E81A 1U3WA 1OZ0A 2DPLA 1HO3A 2GAFA 5FPSA 2XTNA 3G02A 1HYHA 3NM6B 3ZQJA 2CV0A 2W6MA 3DTYA 1CRPA 1VHJA 3EDOA 3HMQA 3LQ1A 4EBFA 4NOMA 4NZ9A 1ZR2A 2OOSA 2NG1A 1SD5A 1RHQA 1YU9A 2O2HA 1GUYA 4K40A 3TRFA 4PLCA 4LK3A 2YQ4A 4KAJA 4V02A 3R7AA 4JC4A 3Q6IA 4OJKA 1N0WA 4J7UA 4KR6A 3G82C 1TAUA 5GTDA 4ZEWA 2WW8A 1NMXA 1KNXA 1U7HA 2P2CA 3LK7A 3PV0A 4CM9D 4DABA 1XA4A 4H27A 4KH1A 1GTG1 3DZ8A 3MWDB 5KC9A 1SEPA 1UBTS 3PU6A 1TCAA 3O3MB 1O4WA 1H3EA 5JZMA 4M0UA 1M75A 5K01A 5BNZA 2IP1A 3IIJA 1UM9B 4UZEA 2GCGA 3TL2A 5CT6A 4I9HA 4O3FA 4BU0A 1C3JA 4CCYA 4M7RA 4RQUA 3IP7A 2P6OA 5DHTA 3PT9A 1W44A 1NIJA 3HXPA 1XV5A 1W87A 1STOA 2ZQYA 1K8YB 1PJ3A 3OBIA 1ZFNA 3ZHQA 4N39A 4IR7A 4DBLE 1HFEL 1DSSG 2PMBA 2ZIUB 2Z09A 3BL6A 4E4RA 4QU9A 1HSOA 1Y5NA 5FNZA 4B73A 2EKLA 4AI6A 4E3WA 1CB7A 2CL7X 1KMQA 1ADGA 2VWHA 4HJRA 1EFRA 4JYCA 1KK1A 3I8SA 3DOEA 2PD6A 2IOYA 3ERCA 1ESNA 1HLPA 1VLZA 2A4KA 2OC9A 2VPYA 3N59A 4H6PA 4UJ3A 4BC1A 2IU3A 4ARBA 1PLJA 1MAWA 3CF4A 4FE3A 4XD2A 3R40A 3HKCA 1MPXA 3DB2A 3OMLA 5FOQA 2KS6A 2VP2A 3UWOA 1VJGA 3VPCA 1QH8A 1XCLA 3LX4A 4L8GA 3LZCA 3LQ2A 4RU1A 4JXXA 1JG7A 1Q17A 1PWXA 4NAHA 1J1IA 1QXSA 4JP8A 2P2SA 4FEYA 4S1NA 1SVSA 1W47A 3KD3A 1CDOA 4WOKA 2Q6KA 1G41A 2I3BA 5J5VA 2O2CA 4ZV4A 5IEJA 2Q07A 2ZJ2A 1CJMA 2VC2B 4OXRA 2P7HA 1MR3F 3QVOA 1EE2A 3HI4A 1KI6B 1OA1A 1R4MB 2BIFA 1DLIA 3U13A 1I3KA 2G1AA 2G76A 1NG9A 1I3LA 1MJ5A 1VPVA 3W2EA 4NBUA 4RTRA 4A92A 3KAPA 1T3LA 2R2AA 3KPJA 1NDHA 2FSGA 3IR6A 4KC0A 4M8KA 4AZWA 2GD1O 3WRYC 2EL9A 1OH8A 1RKVA 2ZPAA 3L41A 3OIUA 1FJHA 4ZDIA 4GMDA 1E3LA 2AXEA 4RVDA 1Z5NA 4HUJA 1C7IA 1O5OA 4C3ZA 1F4PA 5IVPA 1XE3A 2ZSDA 4L27A 3BD6A 5C5IA 5K20A 4RD4A 2G83A 2WTAA 3EMBA 5ECYA 4ER0A 5CDTA 4ZYUA 2QXYA 3TXAA 1HNNA 3KUXA 3U40A 4EHFA 3S70A 2XYQA 2XQJA 4RM3A 4MW4A 2PPVA 1U9CA 3DZFA 3N2IA 1UK8A 1SXJA 5EE0A 3TGPA 3LBNA 4ZI2A 1V1RA 4F5EA 5ALYA 1YKSA 3D8SA 16PKA 3I5UA 5ER6A 3AERA 5HZHA 2GPTA 1FPQA 4FCTA 5JQGB 2OXIA 3DO8A 1ZJ5A 1X9HA 2CZCA 3QITA 1P2UA 2WSBA 1S7GA 1XK6A 3GUZA 3NASA 5K99A 1XJ0A 3GMTA 2EW8A 5E7JA 4C6HA 3Q6NA 1Y9ZA 2P6UA 1JEAA 2CL0X 4UTXA 4US0R 1ZUIA 2RHHA 3TDMA 1DRVA 1FMTA 2R6CA 1JF8A 1UBRS 3IPYA 2XF2A 2BSQA 5FLYA 4OB7A 121PA 3WLRA 1NRXA 4C7XA 4EMUA 1T9GR 2X4IA 2WZQA 3AIOA 4QODA 3GFBA 3A28A 3CR3C 3AETA 4EF6A 1J99A 3OEHA 4AJHA 1X8KA 1QB7A 1UP6A 2FZEA 2ZYIA 4U3JB 3OJLA 3FM9A 1EK5A 3GG2A 3W2IA 1DWQA