3GAAA

The crystal structure of the protein with unknown function from thermoplasma acidophilum
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
243
structure length
243
Chain Sequence
b'MIMVNKKASESQVMELEKRNYNNPVVLCGFAGSTPTGVLAASYIVETLGMHQVAHLISQHIPPVAVFVGGKLRHPFRIYANNSNTVLVAMCEVPISSAHIYEISNTLMNWIDQVGASEIVIMEGSPANGIPEERPVFAVAEKPKLDKFKKAGIQPADSAIIAGMGGGILNECLVRKITGLSFITPTSVDIPDPGAVLSIIEAINKAYNLKIKTDLLEEQVKALDEQIKKIEEQYKELQEKQKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein Ta1441
molecule tags Structural genomics, unknown function
source organism Thermoplasma acidophilum
publication title The crystal structure of the protein with unknown function from Thermoplasma acidophilum
rcsb
total genus 70
structure length 243
sequence length 243
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09754 PAC2 PAC2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3gaaA00
3WZ2A 2WAMA 3E35A 3GAAA 2P90A 3MNFA 3VR0A 4G4SP
chains in the Genus database with same CATH superfamily
2TRSB 3MWYW 5IDQA 2PRYA 3K32A 2BMFA 2O7SA 2HHCA 1BA2A 4XUCA 2IDMA 2XE4A 2OO5A 2Q4OA 2Z98A 2DBVO 3F49S 1ZJZA 4OQFA 1A2BA 1PX2A 3G5TA 2FZCA 3WLPA 5LZ8A 5I4IA 1UKBA 2JFGA 2Q1TA 1K6XA 2ZWOA 4OP2A 2VOEA 1Y42X 3DP9A 3QX9A 4KMRA 1SUAA 4OL0A 1FXSA 1WA5A 3JD3A 4R8LA 1WXHA 2GYYA 4AKTA 4LX0A 3SJZA 4BV9A 2QE6A 4HT3B 4I9GA 3IEVA 1QC5B 3V9PA 2VZ8A 3I8XA 3NDIA 2IXGA 1AUVA 3G68A 4UPVA 4EZBA 5KYTA 3DE0X 1M6VA 3QUSA 1WP9A 1ZO8A 3R3UA 1I94B 3R5JA 4I9UA 5A0VA 5JZOA 5IC5A 3TAXA 5ABPA 1ZIYA 2IRWA 2E6UX 2YICA 3KB1A 4NESA 4YMGA 4GKJB 1NNUA 4PINA 3GJRA 4H6VA 1YSCA 1M7HA 4EB6A 2E21A 2JGNA 2DBQA 3TE6A 1EGVB 3UENA 3IBGA 4YNBA 3KZ1E 1I0IA 5FBVB 1N2SA 4AMUA 4P82A 2R8RA 2I2AA 5F7ZA 4EOGA 4BX2A 3OM0A 1P9WA 2O57A 3GXOA 4WGFA 5ITZB 3QBEA 1RYNA 2YDYA 2AVDA 5ULLA 2BTQB 4HN2A 3EXG1 4C4TA 4DE5A 1WO8A 4A91A 2IS1A 2Q46A 4HTFA 2BTQA 1JG1A 2ZANA 3IOYA 4RKQA 4CF5A 2O50A 421PA 2BGNA 3PJDA 4HDAA 1YTLA 3T4XA 4Y67A 5D8DA 1T6YA 4WVFA 1A4IA 5HMLA 5AIBA 4LI0A 3TZQA 4GBED 2DPXA 4M99A 3DQPA 3DEIA 3IMGA 1QXSA 3G0GA 1I7LA 3KJEA 5KMGB 4M9RA 1YA6A 4TSFD 3FLEA 1Y3BE 3KUDA 3N2KB 3ET4A 1MMFB 2PNFA 3R3HA 4KQEA 1GLVA 2IGTA 4GM4A 2PRZA 4LG1A 1KZHA 2QQEA 1T36B 1ORDA 1TC1A 2DMRA 3E22B 3FYSA 2YL2A 5HQ3B 1ZCZA 4GR9A 3ZY6A 5F9FA 1JBKA 3GFRA 5SZKB 3DE7X 4U63A 1CF4A 2E5FA 1NWHA 4X20B 2QR5A 2RK3A 3JYQA 1ZJ6A 2ILTA 2CNDA 4EG8A 1MB3A 2D74A 3HP7A 5JO0A 1EIZA 2IOHA 2J3LA 1X80A 2ZE8A 3AVQA 4XRRA 3PC7A 4NONA 3PP8A 3SVTA 4LJKA 3M5WA 4L8FA 4NBSA 1CJCA 1DKNA 1MKYA 1NJGA 2P0EA 3U9SA 4AJEA 5LBUA 5C8YA 1EQUA 3P26A 3TPFA 4E88A 1R4MB 4TMYA 5JYBA 3SQOA 4E3WA 3DV0B 3X2FA 2FKAA 1KORA 1L5RA 2P6MA 1XR3A 1FA9A 2FOIA 2BW0A 3I09A 1UWCA 2NO7A 1YE8A 1XZ8A 4HR7A 4MQFA 4TWRA 4DQXA 2VA8A 1Y33E 1WOYA 4EKNB 4QASA 1IXZA 1JHMA 4F38A 2V7TA 1YI0A 3HRHA 3OQ1A 4JVNA 4NZMA 2BM8A 1KBQA 4WX2B 3RUDA 1QYWA 4Q4JA 4ZQFA 3PTZA 3CS3A 3U49A 4M1KA 3W4IA 3W2FA 1E1QD 2XUHA 5THXA 5HWSA 1NYQA 2WTMA 5FUYA 4JI6B 2VUUA 2XRYA 1SNYA 2R48A 2ZB7A 6LDHA 4ZVLA 1D2EA 1JEEA 1FMFA 1G1AA 2E48A 4GVXA 2WSSA 2VP2A 3AGQA 5DE3A 1ZFNA 4YQEA 1RPNA 3IIMA 1YJXA 4L5BA 1E1MA 1R10A 3NP7A 5JNWA 1W36B 1JG2A 1JA0A 3BHIA 3H2GA 3K5IA 4LJ5A 1NXSA 4UVHA 5GP1A 5BN3B 4YQFA 3D64A 2CB0A 1I6WA 3ETDA 3I9FA 3GUCA 4PC1A 3ND5A 3INRA 4ZAGA 3M34A 4EKYA 3ZDDA 5D00A 4CM7A 3RYCA 3RC2A 3MTGA 3ROPA 4QU9A 4BVLA 3EGDB 4YDHB 2G9NA 2YTZA 2BDTA 3BIJA 1WHSB 3PQDA 3UKOA 3LC2O 1JECA 2YHSA 4I50A 1E1KA 1Z0IA 1ENYA 2XBUA 3IVCA 3K1JA 4FNAA 4JYCA 4O8CA 4TKLA 5CA0A 2X0EA 1K6EA 3GV0A 3OKAA 3OOYA 1CRQA 1SIWA 5FBLB 4YRKA 2QZJA 4RKRA 4MGHA 1YHYA 3A9TA 4HATA 4TXHA 3I83A 3L3BA 3VAZA 5IHXA 2JIMA 3T3HA 4RZHA 5F2EA 1I2CA 3MMPA 3BKXA 1GTZA 3WMWA 2OUIA 3FHOA 3GBSA 2B69A 1W34A 3EIEA 2YX1A 1KDYA 1F4VA 1GG5A 2JFHA 1U6IA 3NJ8A 3BXZA 4RY8A 3UUEA 3WNDA 3NEYA 4KX3A 1NMEA 1R0CA 3OZXA 5BYAA 4M98A 1CLUA 1UF9A 5BPHA 5G1PA 3KQSA 4HZUB 1UOOA 2IVFA 3E5HA 2VCEA 1OI2A 3HFSA 3HKCA 2JC3A 1G1MA 1GZ3A 2BF4A 3PK0A 4AS3A 1E2JA 4F84A 4JUFA 3WWZA 3DOUA 5BN1A 2BGWA 2C4HA 1X86B 1VA5A 1NVTA 1YBFA 2OAQ1 3GZNB 4DUZB 5C32A 5JMOA 4GX1A 3OU7A 3LF1A 1A5ZA 1V5GA 3CHYA 5JCOA 5AVRA 2OZPA 5FPQA 1YBMA 3CVOA 1X1QA 5EIBD 3K0KA 1XRPA 2E18A 2IE0A 2KBEA 3AHIA 5IH7A 2VZLA 5B7QA 3SEAA 5DWVA 3T3DA 4OX9B 3CCFA 3NDJA 2HLPA 4X1IA 4ND5A 4GRDA 4UC0A 1UJ2A 5E1BA 4ZVTA 4E1AA 4P38A 1M74A 3VR2D 3STXA 3VSEA 3GIDA 5IJWA 2ZIXA 1B0AA 3DMNA 3KOWA 4TWJA 2FVXA 1RPZA 1JPVA 5D1NA 1JDSA 4X7BA 1OV6A 2WW8A 1FLDA 5EIOA 221PA 1IVNA 1TVCA 4LJ9A 5PNTA 5TVKA 2GB4A 3L1JA 5JALA 5K4GA 3KTAB 1CRZA 2KX7A 2QMZA 3S2ZA 4BVKA 2JAQA 5KQGA 1Z6ZA 5E7MA 2Y1LA 2BFEA 3CWQA 1L7VC 2XADA 2GEFA 1FDTA 3PXEA 1J0EA 1D1PA 1HBJA 4TSFA 1YCGA 2CEKA 4U2DA 4YO8A 3DOCA 4QPPA 1ZA2A 3VUEA 1YL5A 5TDHA 4UDNA 2OBMA 1ODJA 1DHTA 3FOBA 4G01B 1Z2DA 5E9JA 1GUFA 2HSZA 3IS3A 4RE5A 3L4SO 4DYDA 4N18A 4DZTA 4PAOA 1PGJA 4BLWA 1YRWA 3GDWA 3ILHA 1MGPA 3VU9A 4DV0B 4IX9A 4LXUA 1SC1A 1JIVA 2OV6A 3FSEA 3N3BC 4G1FA 4LHZA 1NI4B 2GSWA 1P4HA 2QRMA 1BD3A 4FZ5A 1ZRNA 2IXBA 1EUCB 1V2GA 1IAQA 1YS9A 2JIRA 2JA2A 3L2OB 4IOJA 4Z1MD 1PR6A 5SICE 4A9AA 3ANNA 1EWYA 2G8NA 1CZHA 1DEXA 1H69A 1PX0A 2QJRA 2VDJA 2YHBA 3HVIA 3O5AA 1EE1A 3Q7QA 4XQGA 5IT5A 4YJFB 3U5ZB 5B2ZA 1XKLA 5FR1A 2C4NA 4IS3A 3L82B 2EQ5A 3K9GA 5H8WA 5ALMA 4G26A 4W9RA 4URWR 2R8YA 3N2GB 1B4DA 3VPHA 4RTJA 4JHXA 4NOKA 2QN8A 2VP3A 2WJGA 2C31A 2XQVA 3VOAA 5CBPB 1EHIA 1GZ6A 3VNVA 1T0JB 4M8LA 2KI5A 3JQ9A 4MW6A 2WSYB 1GGVA 2OR3A 1NV9A 1SELA 2W93A 1QCZA 3D0KA 1XRNA 2VLBA 4QXQA 1K66A 5EMJA 3RBAA 3DZBA 2K7ZA 2A9PA 2BR3A 3QXHA 4QDOA 3ZHQA 2GI4A 3HA2A 2XYQA 3PJEA 4RPJA 5KWEA 1YZGA 3WA7A 3QY9A 5JJIA 5AJHA 1GYRA 4BQPA 4EMUA 3V4PB 4FHZA 2CYBA 5DLPA 3VC3A 3TGPA 1L5ZA 1OOEA 2FCRA 3EE6A 1DKUA 1SZCA 4E5MA 2XWSA 2A84A 1JBEA 1FNSA 2BFEB 3H2IA 3QSYA 1HC7A 2WJHA 1PO7A 1M0EA 1VL5A 4AFNA 4EA6A 3I2YX 2V0GA 2Q3FA 4N39A 5KYKA 3DLTA 2PSFA 3R0VA 4P3XA 2NZJA 2YQ4A 3L1HA 4FDUA 4G5XA 4F85A 1Z47A 5LL6P 4D82A 4JVMA 1CKEA 4XVHA 3IB6A 4M9SA 3DD5A 1SZPA 1RZRD 4KQFA 2OKCA 1LQUA 1VDMA 4B4UA 1RM0A 1ISHA 1HNXB 3D31A 5KNDD 3KB6A 2VYVD 1N2EA 4ZVKA 4DILA 5JSHA 1VYTA 4OYRA 4OI0A 2ZJAA 5I7AA 5L3VA 1W4BA 2X2OA 2G72A 1SQSA 2W2QA 3ZI7A 5IWAB 4JLBA 4IILA 1NDQA 1YJAA 2ZIZA 2NUTA 4FMPA 4BHTA 2I4IA 5J2TF 1T36A 3E22A 3W8DA 2HREA 1V5FA 2R7NA 1SG0A 2YY7A 5B6JA 1KOGA 1FMCA 1GLGA 1O95D 1PUIA 2C5EA 2QUIA 2Y6UA 4CQLB 5BWMA 2CJWB 4FFSA 3VGPA 1USKA 5MN4A 4RAQA 3C8UA 4KREA 3OWXA 4XWAA 3MT8A 5D3KA 5D7BA 3VPBA 3DUFB 4NVRA 2R4QA 4KQCA 3QBTA 5HOQA 3UHPA 3CO5A 2ONJA 4S2EA 3T99A 1H4TA 1MHPA 3AFIA 4UNQA 2ANBA 2VK1A 3LLMA 3DV2A 1O08A 3M4YA 1ZQ1A 3UAVA 4ZYWA 3FTDA 3GZ4A 1FP1D 4RDIA 2GTPA 4MV6A 2GDZA 4MVYA 4V2IA 1GRVA 3EOBI 3NHYA 1KI2A 2WHPA 3VR5A 4BGUA 1IE3A 5K0FA 2PA0A 4TV8A 4YASA 4FM9A 2RK6A 3JZAA 2MSEB 5MN5A 1WIWA 2ILVA 2FMKA 2PKQP 3PWZA 1BN7A 2ZULA 3B1WA 1N2CA 2O3TA 2GAIA 3LSTA 3I62A 2BCGY 5FAXA 2V6GA 4Q1BA 1MOSA 4FJ2A 2GCPA 2GCOB 2VPIA 4UE3S 4OAQA 2ZJ5A 1ZGGA 1K27A 1C30B 3B6MA 2R7AA 1KOJA 4AKSA 4B3BA 1YMQA 1PIWA 3ONEA 5ALGA 3W79A 1AMOA 4Z4QA 1G7RA 2GN9A 2J5XA 5DHPA 3AI3A 1SCNE 2Q0QA 3AB7A 3G7UA 2EQBA 1U0EA 2X13A 1WDKA 3PR3A 4E2FA 3L7NA 3TQQA 1HUQA 1TEVA 2RG7A 4EBFA 2O5VA 4DCNA 1J5PA 1WUKS 4NE7A 2BEUA 1RVV1 2PR2A 3KZVA 1QGAA 2BBTA 3GA5A 4OHBA 4A2WA 4RIHA 4F1WA 1AQNA 1S2LA 1A9SA 3UK7A 1L3IA 1SBIA 5DHAA 1F38A 3ZEAA 4RKEA 4A8PA 3RRJA 1L5LA 4ZXPA 4BFWA 5LOVF 1Z2EA 3ZCQA 1W19A 1JJ7A 2EKPA 3ZGYA 1GPUA 1BNCA 2LKCA 2P1DA 3H1BA 3N2GA 4NZOA 1JE0A 2RAVA 2VXYA 2P2SA 2H8KA 3B2QA 2EFDB 4IXWA 1QK4A 2G17A 4A6XA 4E5KA 4CQMB 3MXTA 4DSOA 3R6DA 4NYJQ 4RK1A 4Y0VA 1YUNA 4HO1X 4FYJA 4C7VA 4MWSA 1RBQA 1WXGA 3JQCA 3QHQA 2NLOA 2QG4A 4YBRA 1TM2A 2QXUA 1Z8NA 3I76A 1NN5A 3QEJA 4I3FA 1OROA 2I8LA 5HFJA 2MSDB 4DR1B 1LVHA 1RPJA 2FE4A 4UBKA 3COYA 1G5QA 1GILA 2X0NA 3TNYA 5DCUA 2IDZA 3ZK8A 2XBMA 4H3VA 1TA0A 4KFTA 2IXTA 4Q37A 3FE2A 3JQRA 4HRXA 2X0RA 2NW6A 4JAVC 5KYWB 4NHEA 3EWSA 4FT4A 1NNSA 3D8HA 3STVA 1LJ8A 2ZBPA 4FCCA 3OD1A 1W36C 5K8TA 3H5VA 4KXVA 4PZPA 2WZCA 3LD9A 3GT4A 4I9NA 1FNCA 3X0DA 3GA0A 1CIVA 3JVUA 4RDHA 4R01A 3WLKX 2YRFA 4MB2A 5BMVB 3QE4A 4NL4H 3DBVO 4NCXA 4OQ4A 3CM0A 5JIBA 3LA6A 1VBKA 2J67A 4MARA 1XMQB 2DEUA 4XVCA 1N0VC 1ES9A 1XZMA 3LBHA 4P9NA 5BSHA 1NW3A 5TMEA 4E4TA 4LRSB 3PC8A 3IPLA 1QH1A 3S7TA 4LOLA 1XOIA 4YP0A 5I6DA 3F6PA 1U28A 2CCJA 3O8QB 1N3IA 1PL6A 3JQ7B 4PGGA 3SXJA 5I4KA 4E15A 1OKKD 1Y8QB 1RHMA 1NBMA 1E2KA 5HZHA 1WUHS 4QJIA 5G4KB 1T4BA 4LNUA 1O97D 5LQSA 1OXTA 2PIDA 3NTVA 1LSUA 3OQIA 4MPJA 3BWBA 3TTTA 1QGOA 2RB5A 3FYUA 5BQ3A 1RR6A 4U7JA 1FX0A 2CUKA 2H59A 4I1YA 3PGMA 3OZCA 1D4OA 4L4RA 3ADOA 4IGKA 5D2CA 1KK2A 1OWLA 5J4YA 1ONNA 2I4RA 3TNJA 1OFGA 4U3JB 4N03A 5CITA 5EVJA 3AI2A 2QF7A 4EUHA 1C8BA 2HA2A 5JDIC 1O6BA 4ENQA 1MX5A 4EHIA 2WJWA 4TS9A 4F71A 5IVPA 3GT0A 4FNOA 5LQDA 1BOOA 1J1IA 2O0KA 3A6LA 2CF6A 4EL0A 3FTCA 1GDTA 1GR0A 4NOJA 3TL3A 3T9FA 4V0OA 3QOFA 1EXVA 3RNOA 4QGBA 3TLGA 1MJ5A 2OECA 4FB4A 4UNPA 5IBQA 2JLUA 5GPBA 2OGWA 4QWWA 3UJNA 4JZYA 2W42A 3FYDA 4OKIA 1UPTA 1CFZA 1EBUA 1M1XB 1R37A 3JQFC 5C3UA 2PZ8A 2XNJA 4M1YA 1FFBA 4EG7A 2JGAA 1WKVA 2QTCA 2YBEA 1DAMA 3ENZA 4DR6B 3B1FA 4PONA 4EB6B 3LCCA 5BQOA 2BMAA 3C6QA 2VHWA 1U7OA 3BE6A 4R9VA 5EIHA 1NY5A 1L8XA 3WDLA 3RVSA 2P75A 3TLXA 5JZSA 1CR0A 1J8MF 3AERA 3IDOA 3Q7TA 3V1LA 3DEZA 2EEPA 3E5RA 4L9WA 4CKWB 2D8MA 5BN3A 4HFMA 3PV0A 1GUYA 2LVBA 4XJVA 3MTQA 4HGQA 5KCZA 1NATA 1R0SA 3FDFA 1CF2O 1XD9A 2FRDA 4KTTE 5CA1F 4NYIQ 1QYRA 1AF7A 2R5NA 1KAQA 1G21A 2ZJ3A 3OZGA 5DT2A 3RASA 3IQDB 3KD2A 3ELBA 1GXSA 3JYOA 4LXGA 5DV9A 1OT3A 4OG2A 3MD9A 2CMFA 2XPCA 1E1YA 2WKPA 1MW9X 1J0DA 1O97C 2AWNA 2BM9A 4QLOA 3ZS8A 4JITA 4C4AA 4MO2A 4D96A 3K8OE 1X1TA 4UNSA 5GOTA 5JANA 1ID8A 2F1OA 2VJOA 2MSKA 4G2TA 5FBQB 3EVFA 5B1HA 1KY4A 3TPCA 3WI7A 4FXOA 1U2DC 5EI5A 3TOZA 1HG0A 4I1SA 4MS1A 1N3LA 4IVNA 4HF7A 2CJXA 2EDAA 1I14A 1GCIA 3H11B 3PRYA 1H2HA 1NJ2A 3RR2A 3V8VA 1LC0A 4NU6A 2DP4E 4BMCA 4Q3DA 5LBTA 6AT1A 3P9YA 5LN1A 3BS4A 4YP7A 3GN2A 3M1LA 1EB9A 1O9GA 3TEFA 4C08A 4RF5A 2RGCA 1G0NA 1ZH8A 2PQMA 4PBSA 3DOOA 1WEHA 1J21A 3BRWA 3IPCA 4JENA 4R69A 2E3JA 2VSQA 4Y6SA 3QK7A 1MLDA 5U4QA 3SF8B 2FN7A 1CF9A 1PUXA 2J1LA 3WSVA 3VKFA 5IAAA 2Q6TA 5BSTA 3OEWA 2RHRA 2IY8A 2OQ2A 3KL4A 3AXTA 4FDAA 3U3DA 5HJ5A 2GKSA 3V1NA 2C2BA 1VPTA 2PTHA 1QNFA 4EJSB 4ZI7B 4Q4HB 1JMKC 4E7OA 4QBIA 3MTBA 3AY6A 1N33B 5DIFA 1LWNA 1QHHB 3DPSA 4FD2A 1NQOA 1R15A 3OT1A 3VSCA 1Q6YA 5EZYB 2V7QD 2VTEA 4MWCA 5KUTA 1V1JA 4YMUA 1KIAA 1YAJA 3NH6A 4E3ZA 4G8JA 2ISQA 5LMZA 2O2CA 3V46A 4IIUA 2GWHA 3AL0C 3B9BA 4RGQA 2OO7A 1HX7A 1N8NA 2WPDA 4TMKA 5IM5A 2B2NA 4LK3A 3UMSA 3DOHA 2HTEA 1YRLA 3B2EA 3OJCA 1GTRA 3BSSA 5LMUB 2WLTA 4S3MA 3EISA 4MSUA 1YXMA 1VMKA 2A9JA 3EWAA 2CXXA 2QN9A 3EEQA 4XD7D 4OLBA 3AVWA 4JC4A 5BNTA 4L95C 3FHCB 2WHEA 3ECCA 5FX2A 3PUYA 3KWMA 5E8RA 1YMUA 4BN5A 2RARA 3D8RA 4MLCA 2YJ6A 2R6DA 4W5TA 1SIBE 2GCIA 1TAGA 4M9QA 5DM4A 4FN4A 1L4YA 1YU9A 4JSYA 3BPSA 2SKDA 3R0JA 3T54A 1GNLA 1WW3A 3N5KA 4PSUA 3IUEA 3TLCA 4TZTA 1Q0PA 1WXWA 4MULA 1ZN2A 3WIVA 1IAVA 5TEVA 4R1MA 4BN4A 1M54A 3OLVA 4B71A 1BX0A 1BHJA 1C0KA 3HV2A 4R83A 2B3TA 3QTLA 3UVEA 4KZPA 4F9EA 5BQXA 2C20A 4QDJA 2O8BA 1XX6A 1B26A 4PLPA 2EC5A 4GIBA 4UU0A 1DZIA 3K70C 4C0AC 1KO4A 1ENOA 3WWDA 1Z5VA 3AEZA 3RIHA 1E79D 3NYWA 1A9XB 4ZRNA 3DMYA 3NOOA 4CU2A 1FTNA 2ZRCA 5JXIA 1PLKA 2ZYGA 1X87A 3F4LA 3D6AA 4LVUA 4HSGA 3VR4A 4PYJA 4EMBA 5KWSA 4IQGA 5KJ6A 1CS0A 1OZAA 1DDGA 3G89A 3UFXA 4EKDA 3KSDO 4KPEC 5TXGA 3P9KA 1GKUB 3DNPA 2MU1A 5KSOA 1CCWA 4LVCA 4O4LB 1MOZA 2PZFA 1L4EA 3D0OA 1H2ZA 2COEA 2D4HA 2FPSA 3T0GA 4D6PA 1ICEA 4BQOA 1ZUIA 3I9NA 3UA3A 2PMEA 3VKVA 2C9ZA 3HYLA 1JWAB 3J80A 4LXHA 5FNVF 2XMQA 4X1KA 1VHDA 2W6JD 4KB5A 1JDJA 3TZKA 5KVCA 2IKSA 3IH5A 1GRRA 5BRAA 3FCYA 5EIEA 1G42A 2D06A 2GN4A 1RHRA 1TC2A 2I99A 3H5OA 3H2JA 3M9LA 4E46A 4NWIA 2CBXA 3HBFA 4HNSA 3DW3X 4N5DA 2HNAA 3GUVA 3VH2A 1K06A 4B43A 2ZETA 1VZ3A 1OX4B 3FHLA 2OZLB 2POCA 1EG7A 1SVSA 2C3MA 1C4KA 4LRUA 2O3UA 2O2JA 1DTSA 1SAYA 3LYHA 4OKNA 3GGDA 3L6UA 4DIMA 4M1QA 2XD4A 4B8WA 4BFSA 2D5AA 2ZJZA 2XX3A 2YOGA 3KZCA 4XJSA 1SOAA 1NXWA 4ARAA 4AYXA 5ICGA 5FLKA 4X6XA 2E4XA 4FGWA 2GEVA 1RKQA 1PR9A 4ZQIA 4NENA 4JC5A 1E0JA 2O7VA 3DWEX 2XB4A 1KAOA 1RSZA 4HDNB 3KXIA 5CIWA 2DETA 1T9KA 2YCLA 1X39A 3QPVA 3SBOA 2XKKA 4I55F 1A7JA 1JVBA 2BF7A 2EGGA 4M4SA 1ISRA 4ZDJA 2DBRA 1RP1A 2CE2X 2P2GA 2A4MA 3DDSA 4LYAA 3A9VA 4JY7A 5C31A 1TECE 2AFVA 2PWAA 4O2AF 3DT9A 4MHSA 4D5EA 5LNK1 2V55B 1LI7A 2B1JA 3CCCA 4ZTZB 1QP7A 5KSPA 4MVJF 4Y0AA 2DAPA 1UKZA 5F2NA 1L9KA 4CT4B 5JVDA 5CB0A 2P2ZA 3TF5A 2D5BA 3BDAA 1M2WA 2PUTA 5JG7A 4A3SA 4CV2A 1HT3A 5JVDF 1UIRA 3HZOA 1YRHA 1GTL1 4Q3BA 2JFXA 2PEZA 3E4CA 5H0IA 4XYEA 3RFTA 4BNTA 3PEWA 2JL1A 1JALA 2PYIA 3K1YA 2GHTA 1UBCA 1OTHA 1YULA 2V7WA 5CLGA 3WX0A 1KQPA 1MUUA 1S4QA 1WCYA 2C9YA 1P1JA 2ZBGA 2VSYA 2NZVG 2VHJA 2PT6A 1YZQA 3HCFA 4FZRA 4Z9FA 4MYRA 1VRVA 3SAJA 6PFKA 2GEDA 3EAGA 1ZLYA 3KT6A 3E84A 1S2MA 2VJDA 3OZUA 4KQ2A 1KNXA 3C70A 3IIIA 2NAPA 3TXAA 1PJCA 4LTMA 2FLKA 4INAA 2P27A 2AHRA 1FS5A 3NI2A 2YC4C 4JI2B 1ACJA 4X71A 1ZGAA 4W5QA 3CNNA 4I55B 2VOJA 3KX2A 3ULKA 4LPSA 2A5JA 5CU7A 4LSGA 1FJXA 4KXUA 1ZMTA 5EC8A 1NLYA 2A1TR 3MWDA 4NG5A 4JVSB 3OZAA 3AERB 3DF9A 5DM0A 2D1SA 1XLTA 1TUEA 1YO6A 1Z0DA 2CL0X 3HO8A 1E3DA 4MEBA 5BOVA 3T94A 4ACAA 1JAHA 4R1UA 3AK4A 3ZQUA 3ZNNA 4MTCA 4INJA 3F3KA 2J5QA 2ZREA 3RABA 1OBFO 4AKGA 2VZEA 1UOQA 1HFKA 4YJ3F 3GH3A 1Q2XA 1LX6A 4XEUA 1EIWA 3EB9A 2HU8A 3K6SB 1MB4A 4UMVA 3WHIA 4Q9LA 1RAGA 4X1YB 1HURA 3QE3A 4R1SA 3CEHA 1A4UA 3ZWOA 2N1BA 4Z8XA 5BR1A 1NAIA 4ZVVA 1Z45A 1Y7TA 4N5LA 1II0A 4Q3NA 3HCCA 2P3QA 3LAWA 3PT9A 4YPOA 1J1ZA 4O4LF 4H6XA 3TFOA 4DBVO 2BELA 1U2GA 1YFLA 2X5JO 1LDEA 4C7OA 4F4JA 3ZI4A 2ASVA 1P4SA 5EIBC 3E8MA 1XZCA 2LE0A 1Q7GA 3NRBA 4RY9A 3EVTA 4DLBA 4EY8A 4RETA 3TZ6A 1XD2A 4KW7A 2MYTA 1NOKA 2PYDA 2FWAA 4D56A 2Q5QA 3TUJC 4IDBA 5FNVB 5HYVA 4DIUA 5IMBA 2WDPA 2FWMX 4PNEA 5CFPA 3SVLA 3ZHOA 3Q5DA 2FPWA 3UHJA 1NVVR 4ZPXA 2AJBA 1TCVA 3ZNQA 2NYAA 4G4SO 4LSWA 2IV7A 1L5OA 2Z6UA 1E4YA 1S2IA 5KQRA 3F6EX 3C1OA 4G85A 1P1HA 3GLFB 1OVGA 4YQYA 4WXPA 2C4VA 4EAQA 1OZFA 5ISMA 1KP9A 4CLRB 2ZBEA 3VA7A 4MVJD 2HYDA 2WHPB 3BDIA 3NXKA 4U7FA 2RJOA 2W6JA 3DOEA 4Y2YA 3Q9UA 4B33A 2J59A 1DO2A 3WYEA 4ITVA 4Q1DA 2ZYWX 3JPYA 3KV3O 4D8YA 1F51E 1N8KA 1TJ5A 1PLJA 3SCZA 4BZXA 1YCFA 4YMSA 4WY8A 4AMYA 4DSUA 4BOYA 2P30A 5KNBD 2O2ZA 1QOPB 4J29A 4JBGA 3EPLA 1OI7A 2X1MA 1ESEA 2FMHA 2B7CA 3OCJA 4JFAA 4N0DA 1GN8A 4U7GA 4YJFA 4EVQA 3R24A 3L8YA 3HWRA 5CB6A 2XOKA 4FFLA 3A25A 4FD3A 1U3GA 1XCJA 2F6RA 3PUIA 1GA4A 3IHWA 3QVJA 1NQ5A 1AC5A 2CLDX 1OB2A 1O1YA 1TA4A 2FG7C 2QS9A 4FFOA 4X91A 4RTLA 6Q21A 4LHEA 5EA2A 3B6ZA 1PNOA 3RAPR 1YZTA 3ZZMA 2YS7A 1ZPDA 2A1UA 2CVPA 3T8YA 1FTQA 2G80A 2FZKA 1TOAA 1Q7CA 3EH2A 4JA0A 1SUEA 4MMZB 1O95C 4KO2S 6ADHA 2ZVDA 3PJFA 1G291 4Q05A 3KFLA 4R16A 1GAQA 2NUAA 3AB8A 4YCBA 1QRDA 3IEIA 4FDTA 1VLMA 4GOKA 1DP4A 2WKSA 4GQAA 1A2OA 2G1JA 3UB2A 4HWOA 1SEPA 2DTXA 3I2HA 3PI6A 3AUFA 3GRRA 4GM0A 5HA5A 2BAGA 4JBWA 1I4TD 1PSDA 1QDUA 3QIAA 3NUZA 5AKEA 5G41A 3ZK9A 4EVRA 3R5TA 1V39A 4MUXA 1ZJYA 4HAUA 4IL5A 4DSTA 5CEJA 1M1NB 2UZ0A 5ERYA 4KUGA 3ZGLA 1Z74A 3BMQA 2NP7A 2OB1A 4CKCB 5J2UA 1LDBA 1X19A 2HXGA 1HGXA 3CVUA 5GY7A 4YRMA 3ABOB 4BO8A 2VRCD 2VSFA 1E32A 1K7XB 4O1HA 4U2EA 3LFHA 3DHVA 2BONA 3BB4A 1E96A 3LCVB 5GQSA 1R7RA 1XTTA 2BDEA 1KYWA 4BLUA 4ZYTA 3A6JA 4LDQA 1RM5A 3KT8A 1ZNZA 1KC3A 4DV5B 3CNLA 1NM5A 2E4YA 3PDCA 1NTOA 1WSBA 2ZR0A 2JGIA 2REOA 3B1KA 4IPTA 2W6ZA 3ZDCA 3DL7A 1ZESA 1E1RD 1DAPA 3UJBA 3W8EA 4PRZA 4QOIA 5FA8A 4UUAA 2VHXA 1PEDA 2G0AA 2G77B 1G63A 2OSVA 3G9TA 3BD8A 2FFRA 1ZD1A 2Q1YA 5HQJA 5CAEA 4TQ9A 4D0GA 1EEHA 2WK1A 1JBQA 4K9RA 3VR6H 4JXXA 3T34A 5ELXA 3CVWA 1UOPA 1VGQA 1A8IA 2YV2A 4WBNF 4P4TA 1A9PA 4BV8A 3DPIA 3PFGA 1TADA 4BBZA 4TLMB 3DZ8A 3KKOA 1A71A 4N9QA 3TW4A 3O9VA 3FNHA 3TBHA 5AD1A 2AV6A 1MRZA 2BLNA 1LY1A 4BDSA 3GT3A 5FNZA 4DNXA 2X0FA 4MH0R 2NTJA 5KJ1A 3HYNA 3RF7A 4MQMA 3OQ6A 3ST7A 1VE9A 4K1XA 3AUAA 1CD5A 1J56A 2I65A 4N3AA 4EG6A 4GYJA 3MJVA 1YIDA 3NBZC 4YRPA 5EG5A 5C4IA 1GPYA 5D84A 4HGYA 4KWEA 3ORHA 2A67A 3NV9A 3ZJUA 1PP4A 5AI9A 3TW8A 4HXFB 4L5IA 5FEMA 5KYVA 5EMLA 1NUPA 3QKTA 1ZISA 3EZGA 4YAIA 2EZ4A 2AQ8A 4PFKA 5F21A 1JHDA 3F90A 4MRNA 5TEWA 2VDOB 3GYGA 3PKZA 4ZOLF 3VNUA 3PX7A 3MCVA 3U3XA 1E18A 1AKNA 1PL0A 2O7RA 5CLJA 3BK1A 5IYZB 3AESA 3KE9A 3DO5A 2IHVA 4RYLA 2AYXA 3PTLA 4X97A 1RYBA 4M38A 3WL3A 1HE5A 3DJYA 3UUFA 2VT7A 2D2IA 4CV3A 4HAOA 1OGIA 1OC4A 1PJ3A 3HP1A 3BCUA 3F67A 4PG6A 4WUTA 1XU4A 4P81A 1H93A 2HZ7A 2FG6C 1UODA 1G8GA 2KMLA 4BP3A 2BE9A 4GU5A 1E6CA 4LK2A 3PLNA 3BTOA 4JBHA 5D3QA 2F1JA 3KOYA 1H2YA 4LJLA 4XZ3A 5FFMA 1XMXA 4Q4JB 2AR7A 3PFBA 4DKXA 4WRRA 5DW0A 1KAEA 2HA0A 4UQPA 3IAM1 5CVJA 4DV6B 1KFCB 4JSTA 2HLNA 1UM9B 2VP9A 4H1WA 1DXHA 3V4LA 3LL4A 2H5JA 2ZSHA 2WWWA 1RJ9A 3NNSA 1HOTA 3C5HA 4LS3A 2FQ1A 4PC6A 3TW0A 3R5KA 2FPKA 3OZVA 4QREA 2HCFA 3HBAA 1U9ZA 1C7FA 1AKWA 3PNPA 1F5SA 3GEEA 3KAKA 2HRDA 3PVSA 4QQKA 4OI2A 4RK0A 5AW2A 3B8EA 3SHOA 4D9EA 3LRPA 1G98A 5BR4A 1E3SA 1IN5A 1B93A 1UDBA 3HP4A 1CP3A 3N5CA 4NSNA 5HS6A 3BE4A 4RTQA 3PGKA 4UPDA 1RKUA 1JZSA 4IHAA 4RK7A 4QEZA 4X66B 2YQZA 1KYTA 3HJBA 3CV3A 3HB1A 5AXCA 4ER6A 4R1NA 1X7XA 5A7GA 2ID7A 2C77A 1NJ5A 1ZVKA 1SURA 1LNQA 2XJ9A 3IIKA 5F2KA 3TNDA 2AB0A 4XVRA 3HBLA 1AGRA 1Q7EA 1VBMA 2YMLA 1QVWA 1XWIA 3AFOA 1TLLA 2CHVA 2HX1A 3KM0A 3LRXA 3VH1A 3GZJA 3SQWA 2G1AA 3LUPA 5D3MB 1P4AA 1MG5A 1GDHA 2RGBA 3EX7C 3BGVA 1E59A 3WIEA 3G2KA 1ORHA 2H2AA 2H1FA 2AOUB 2O1SA 2OFWA 2UYGA 4WERA 1G3UA 3CT4A 1T5DX 3UGJA 4YC7A 1Y8CA 1NVGA 2PMCA 1EFHA 3K70D 3HU5A 2F64A 1JIIA 1J9GA 2HWKA 3WRYC 1N0WA 3WRVA 3QVWA 1ZEJA 1Y8RA 3W5CA 1GP2A 4JP8A 4RA6B 2OM2A 1Q44A 4QEDA 2RI6A 4W9NC 5KPJA 4Y18A 2H7VA 2R8ZA 4HMQA 5DYGA 1P8AA 2RHHA 4KGVA 4MI3A 1WBBA 2PX0A 4LBVA 4KGXA 3V00A 2XMRA 3UT0A 1HM5A 5A03A 2FW6A 4Q9DA 4KR9A 5JYCA 3LFUA 4HDMA 1NBMD 2DUJA 1DC7A 4L4XA 1O94A 2P0YA 1FNDA 3J7TA 5A9SB 4OK6A 2OGUA 1OAOC 5KVSA 1BJTA 4YRFA 4MQEB 1E4EB 3ORRA 4IJVA 5F7JA 1QE0A 3UOGA 5EKXA 1XV5A 3FF1A 4X45A 2C4WA 4GOXA 5HXAA 4HV4A 1S89A 1LLCA 4ZDIA 1L7QA 1L8QA 4MMXB 3W6OA 1GARA 3DQQA 1XD8A 3CE6A 1FUYB 3LSYA 2ZSUA 3K8QA 1DSSG 3PR1A 4XIJA 1ML3A 4JBLA 5CVVA 5ELLA 5GWXA 5JOQA 5IKMA 2AN1A 5ESDA 3SHQA 4HAXA 3F9IA 4LHXA 1L9XA 2ADFA 1G7SA 1G20A 1KEWA 1OZGA 1S7CA 2QL9A 3DBHA 1O5TA 2DGDA 4G36A 4TGLA 2O8CA 4TWBA 4OQPA 2V6MA 5T7BA 4P3NA 1SHUX 3O8OB 5DHQA 2ET6A 5IBCA 1XELA 2HPHA 1IOZA 1O77A 1DAEA 1XTKA 2RG1A 2YS6A 3DDOA 1J5EB 2IHYA 3FUCA 1SCQA 5CVUA 1IU9A 5KB3A 1OE0A 1N5KA 1VYHA 2ZYHA 3GDOA 4IIJB 4OTZA 2GFQA 4YRDA 1F8XA 1UADA 2VT2A 1V7QA 3HVJA 5IT0A 2ZUDA 3RYHA 5EIXA 3NYQA 1RYEA 4MGIR 4TS3A 3KPWA 2JIBA 2Y76A 3I5AA 1UXKA 3N2IA 3UGTA 5L6MB 3P9RA 5MFPA 3I5UA 1SC3A 1JJBA 2GM9A 4KI7A 1UKAA 1V4BA 4NK5A 5AKHA 4HKTA 3GLIB 1BXGB 2OP1A 3VZBA 3FYTA 3NVKI 3OO0A 4Q3LA 5AJTA 5EZYA 5C53B 2O1EA 1BMDA 2XIQA 3GP5A 3O4JA 4GXQA 2UXDB 1BXGA 5BV0A 2A1IA 1BD4A 2XMPA 4ZALA 1D4FA 3DDZX 2YVUA 1O87A 16PKA 1EX7A 4IHJF 5HFAA 5J2TB 1JH9A 4M9XA 4YR9A 1RI5A 3B5IA 4R2LA 5LDGA 4DLYA 1GPKA 2NXEA 4O2RA 1TYAE 621PA 5AJVB 2EYQA 5E9WA 1NNLA 3PQEA 5T4BA 3Q1KA 1VL0A 2FMIA 1KO7A 4WN3A 3NC1C 3KYBA 2Z2ZA 2ZI7A 1TF2A 2HSJA 1L7RA 4G25A 3UO8B 1FDUA 5IS2A 1V6SA 5EXTA 5IFKA 3I53A 1USWA 1CDZA 1VJRA 4IGEA 3TTXA 2BE7A 4D3DA 4Q93A 3HXOA 4MV4A 1YRYE 3H0KA 4XYLA 2H18A 4IIBA 4CF7A 1V7ZA 4RVNA 1BO6A 3UHAA 5T67A 4RJ2A 4G5RA 4NCBA 1CULC 3U9TA 4HDCA 5CBKA 3KZNA 2VEOA 2XTMA 4FILA 1SVUA 2BSXA 4MVJG 1KYYA 3ZJTA 1Q21A 3CBQA 1RJWA 3WL8A 1B76A 4IQ4A 4GEKA 3AFNA 1NUSA 2R87A 3C16C 7YASA 5U4XA 1P74A 2R6GA 5AI8A 3NT2A 3DZFA 3VOTA 2YIVX 2SCUB 2BBWA 4IGFA 2RHJA 4CIXA 3OOHA 2Q3DA 1DIAA 4ZOAA 1OWPA 3NHJA 3MRXA 4HB4A 4D3ZA 2QRNA 5B4VA 3IJRA 4H7EA 4OBWA 4TYPA 1EFPA 3U6BA 2XZOA 2Y1DA 1QB8A 2Q3LA 3E8XA 3T95A 2G0TA 4AJ2A 3GAMA 7ADHA 4FDVA 3QM1A 3PEEA 4WFJA 3RFUA 5CM8B 1UDXA 1KDRA 4IZ6A 1PS8A 1FQJA 4XDZA 4YJ3B 5LOVA 5B2EA 3H2SA 3IDQA 5EJGA 4DQVA 5SYMA 2VJCA 4N6GA 3T38A 2P78A 1N78A 1I2AA 2BL4A 3Q3VA 3FETA 3F78A 4FKBA 2Z56A 3DE2X 5DASA 5L7YA 3PDIB 3I8SA 1I2MA 2BFBA 1GXSB 3GLHB 5CW2A 2W83A 1LFDB 3LKZA 5DH9A 1HMPA 4KXXA 4N5NA 5DGXA 2D0PB 2R8EA 3PF8A 1CETA 4IDQA 1NBME 3CX3A 1T26A 3RTAA 1UC8A 3YASA 1GR1A 3OPQA 5FTJA 2IYAA 2KHZA 2WTUA 3LC1O 5BQ5A 3T5PA 3S0JA 4U3JA 1GPMA 3FPKA 3Q41A 2P9FA 3EDYA 4OQQA 5B4UA 1JEAA 3F73A 3THXA 1MAAA 1E5XA 1G16A 1J70A 4PX2A 5ESXA 2FRXA 5HTKA 4B7UA 4RF3A 3PNOA 1JAIA 1SZJG 1TLFA 2P40A 3HY4A 1QO0A 1G3IA 2GVZC 2QN2A 2B25A 1YACA 2MSCB 4I4NA 3BMCA 3EFBA 5AW1A 4RTNA 3KQNA 4NV0A 2VF5X 2DU8A 4GKKB 4K6OA 2XGOA 1QTRA 4DLXA 1UC4B 1P6XA 2VF2A 3JVIA 3LWNA 4GP7A 5K4HA 4QOFA 4L8VA 3G82C 1KO8A 3FCUB 3CKKA 3QQ5A 3QVUA 4I4CA 4NDAA 2GPBA 4F2PA 1NR5A 1S3SA 2JDID 2WQ6A 4JOQA 2PH5A 1FTGA 1N4DA 4YRNA 1NASA 3CH7A 1K2VN 4M0LA 3QLEA 10MHA 4E13A 5FDFA 2V6JA 1LLUA 1T6NA 1TZ2A 3FZQA 4D9GA 5E4YA 1YVPA 3IP7A 1ID1A 4YXFA 1VPEA 1XFDA 1ADGA 2D5IA 3NOVA 4KXLA 3V4FA 1LK0A 2JVKA 3HN7A 2ZJYA 2FI1A 3QEKA 3UCEA 4CG3A 4W5NA 4XCXA 2WD7B 1L5GB 5L8VA 4RHYA 3LPLA 1SPXA 4CTNA 2Z6VA 3CY6A 3V8RA 1JKMA 1FDRA 4PBTA 2AEEA 4C0WA 2Z95A 3EGVA 2UZIR 1FFXA 1U90A 1DAGA 4RTKA 4MW1A 2QNIA 4CCWA 3NETA 2YYAA 1T8UA 5HFNA 3TS1A 1K08A 4AICA 3IHLA 3OOWA 2Z09A 4UJ5A 2B37A 3TLMA 1XTZA 2PHZA 2WQ7A 1VGVA 3V8QA 2CLSA 2WOOA 3WGNA 3EVZA 2C8LA 4PX3A 2P9ZA 3KLOA 4G1UC 4K46A 3HCNA 1F20A 1ND6A 2D1QA 3CF6R 1LJLA 3Q7RA 4CKBB 1KQ3A 1S1CA 4F5DA 1E1QA 3BJIC 1F2TA 2DT5A 2WMYA 5FIUA 2QTNA 3ZWAA 4HN9A 2WYVA 3ONWA 4GBJA 1KIFA 4NPAA 5E3HA 3CFYA 3DP7A 4PPNA 3DGFC 3GEMA 1LU9A 3AINA 1NW7A 3K6RA 2F17A 4JLVA 2CLCX 2XY4A 3W3AA 4WOBA 4X8MA 2Z8YM 2QPOA 1LRLA 1QUFA 3FAKA 1WU7A 2QVLA 3LRTA 3ILXA 4YROA 2JAPA 4RQBA 5IDVA 3OQOA 2NG1A 2O14A 4CKWA 3CC8A 5DNUA 1N6PA 1Y1TA 3SS9X 3CNQS 3RV4A 1KJJA 1IBMB 3PTAA 3PEVA 3SC2A 1WUTA 1RLMA 2RGNA 4BBAA 4LZAA 1SCDA 2OZKA 3VO9A 4EUKA 1P9LA 2G28A 4J4HA 3ZDEA 4ATNA 4MQUA 5K9ZA 4PPFA 3NJ4A 5JO9A 2B3DA 3ZE1B 4CPDA 1C7RA 4DA4A 3KSRA 1P4GA 3AGPA 3DDUA 2AJTA 1CT9A 2I7XA 2RGEA 3SIPA 5HJEA 2QPAA 5DCYA 4BFUA 3EY4A 1OI3A 3OZIA 4KBYA 1OXXK 3TLJA 3WJ7A 5CH8A 2BGRA 3BWVA 4F5WA 2VATA 2XMCA 3PQ6A 1F6BA 3A3PA 1TYZA 1YB5A 1MQSA 2JCSA 3MFYA 3O4HA 1X9HA 1XDDA 1Y89A 2EKBA 3D6JA 3K0AA 3QVKA 4MWGA 5AKGA 3QE9Y 4Q9NA 4EG3A 3GJ3A 2K87A 1G8FA 1GNQA 1M67A 5AK6A 1AN0A 2ZIFA 4M1ZA 3U37A 4DLVA 1YIAA 1Z56C 2B8NA 5TARA 5IULC 2LPMA 3WDSA 3B1YA 3K2IA 4KN9S 5EMNA 2Z58A 4AWBA 2FE1A 4LVOA 3BL5A 3AJEA 1JLHA 2OFPA 1TLTA 5HM6A 1GNRA 1VPVA 2DECA 3SFZA 2E5LB 4NEHB 1K7FB 1GCAA 2IGBA 2IZ6A 2JLXA 4UREA 1QLHA 2QXTA 4QNMA 4RJKA 2QDXA 2IX3A 1E7MA 3L4BC 1EJ0A 2WWYA 4WK6A 3L7AA 4IDNA 1T2DA 2G5GX 2WYIA 5A62A 4XASA 3PHCA 4OJKA 1BDJA 1IN6A 3AQIA 2V7EA 3ELDA 4XB1A 5HUQA 1H2FA 1KQGA 3BTSA 1HTWA 4OFZA 2BFCA 5JH7B 4FWTA 1IIBA 1TJ4A 2XA9A 4FCTA 4LYYA 4XARA 4ER7A 3X44A 2R5FA 5IBRA 3N2EA 4UCXA 3J81A 4LBZA 3KCQA 1J0XO 4M88A 4CYMA 3IP8A 4ETMA 4ZZ3A 2J3EA 4UBMA 2H31A 1U9JA 4F6CA 1FQKA 4GMFA 1TJ3A 4E22A 2P2DA 1E6MA 1LBHA 2KM1A 3C15C 4LVNA 3RREA 4WOKA 1QO0D 2JI4A 3O3OB 4H7FA 3D59A 1ADYA 5EZYF 4B0PA 4ZGWA 2D54A 1FS4A 3FZEA 1PJ4A 4M53A 2O59A 2R00C 1B1CA 3IPYA 2V0NA 4UVDA 3U80A 1IM5A 1P0FA 2X9VA 1TIPA 4IIHA 1GQSA 1C8KA 1IXRC 3I34X 4W4TA 3T3OA 5AK3A 4ZA2A 3LIPA 3JQPA 3VPCA 2CXQA 4G4IA 4MB6A 4OP1A 4R2IA 4AL4A 4DHEA 5BORA 1KPIA 4MA5A 1N2ZA 2MIIA 4IYJA 1G55A 2C5LA 4RH3A 3OP1A 1ULBA 2CJWA 4INOA 3W5JA 1YOBA 4IV8A 4KYTA 1XZEA 5HF8A 2PV0A 2RH8A 1EZ1A 4B0OA 1O03A 1B42A 2REQB 2OEPA 3SJ7A 3ANXA 3F96A 4JBNA 1CUAA 1TTHA 4UXHA 1OX6A 5CXQA 3ENNA 1W9MA 9MHTA 3SEQA 1XHEA 1XTIA 4C4YA 5HBGA 4CMBA 1Q50A 5F5LA 4Z1MA 4E5DA 5D01A 5AM0A 4M1TA 3E9RA 3ZTYA 3H9EO 1ZOLA 3HBNA 3OU2A 3TLYA 2Q6LA 2RCNA 4GWLA 3E81A 4JB3A 4V02A 1S6YA 1U2DA 1XEXA 1GA1A 1OJ7A 1YFZA 3CINA 1XLUA 3EQ9A 4TMXA 5LP1A 3CVVA 5SZJA 1QYDA 1P0MA 2Q4EA 1GKKA 2JIZA 2XSZA 3JYNA 4WZBE 1PNRA 2GAFA 1D6JA 4DCVA 3RROA 4NBLA 3IVAA 2VHCA 5AKXA 3S4YA 3RVBA 4BX8A 1OLXB 4HAYA 5H3HA 2P5YA 1VI5A 4PNHA 1XTBA 3L43A 1Z2CA 1R16A 2VK2A 2PR7A 1XJCA 3KXKA 2C88A 5T6MA 1KDVA 1U0JA 3CX8A 4RD4A 4A0GA 1CE8B 1IULA 1E89A 2JH9A 3PYMA 3L4BA 2JHAA 1BN6A 3FDXA 1E0DA 3MBKA 4JR0A 1Z3CA 2TECE 1ZGHA 2ZBRA 4CL0A 3E0QA 1KHTA 3E05A 2ZJ0A 1NVMB 4NE9A 1JHUA 1L6RA 3PUHA 3JSXA 3B5JA 3R40A 4M8SA 3WV5A 2YINC 1Q91A 2GARA 5C7OO 5TSDA 2GZ2A 4OJYA 4EATA 4E5SA 4W9MC 1W4CA 2HH9A 1LPPA 2C2YA 4XSGA 4ZHQF 5IM4A 4ILEA 4JUDX 3KETA 3QP9A 4IHQA 1KFJB 1BU8A 2IBSA 2NU7B 3TTYA 2BGJA 1L4BA 3VNRA 4FPXA 1C14A 3LVRE 4HPJB 1YR6A 1IZ7A 1FXUA 3EEYA 5BQPA 3VKWA 4DWVA 3AVTA 1V1MA 3PQ5A 4ZCIA 3EMKA 1VE1A 1E2EA 4M6WA 4BV2A 4HNTA 4R5HA 3BCHA 3T5GA 5B57C 3VTKA 4E12A 2VHVA 4MV5A 2O6LA 2GASA 3IQXA 3NM6B 4R54A 3D0QA 1AXEA 4I5EA 5HG0A 1N2IA 4D43A 4DF3A 3ZJ5A 4MUKA 4RSMA 5JCPA 2PANA 3CSSA 1Z5GA 1FRZA 2ZRGA 4OB7A 5CLQA 4QOJA 4QELA 1AQJA 2D62A 2VH2A 3BXGA 3TTVA 1J00A 1U8YA 4A0RA 3FNIA 1PTJC 3E23A 3ZCSA 1E5QA 2FFJA 1XJWA 3EGEA 1YHNA 3JW8A 4GSLA 4IDEA 1EVIA 4I6GA 4QDUA 3IAHA 4TOIA 2JGEA 2C8KA 1JDVA 1SHZA 4JQZA 4O1MA 1PFWA 4MPPA 4RM2A 2PUCA 2M6KA 1LUAA 1VP3A 3RUEA 2CZGA 1D5CA 5C9ZA 1PNQA 1BG6A 2V8BA 5H4GA 2ARKA 5CUQA 3RU3A 3H1EA 2WIGA 1DBSA 4M8IA 3UCFA 3SVZA 1D4ZA 4JB8A 3OKCA 4CFYA 1BVHA 4OB6A 1LFAA 3FKJA 3P2OA 1I1QB 5AT1A 4GEGA 2Y93A 3BHMA 1O57A 1EZZA 3UC5A 4W1RA 3EUWA 1TTPB 2EERA 4RLQA 3JAMA 1DUSA 1NLMA 1PV2A 2EWWA 3CN9A 1TJNA 4KQKA 4D74A 2KW5A 1II8A 1X7DA 4YT8A 3M3HA 3ZHSA 3RUHA 3RWOA 3VFDA 1T4CA 4PZ9A 4BLVA 2UUAB 3OX3A 3R3VA 2W2VA 1XMVA 2BHSA 3HY6A 3LU1A 1KVRA 4PFJA 5KQMA 4TYNA 3HUEA 1FMTA 2FZGA 4FX5A 4RVCA 3W90A 3AL2A 3MJRA 2BYTA 5JSFA 2AD1A 3CJQA 1T34A 5CT4A 4BYGA 2YR0A 5BMVF 4B7XA 1CDEA 2C9BA 4NE2A 1W0JA 2C96A 3TQHA 4NBTA 2P7HA 1U4OA 4UZSA 5JJ5A 1G9SA 2XUZA 4YDQA 1VBFA 2CFIA 3OZEA 4B7ZA 1KYXA 1E7SA 1O8BA 1ONPA 2WA2A 3VSDA 3ZDXB 2IHUA 3U3MA 5BXQC 3AR8A 4R7TA 1WVMA 1YUMA 1E2MA 1YAHA 2NVBA 4RCYA 4C22A 4NMHA 5A4MS 4QU8A 4L9RA 5ERGB 4DOMA 3JCZA 5DNEA 1T8PA 3JQQA 2QOEA 1GPLA 4DQUA 3GK3A 2G09A 5JQGB 2OQRA 4PZZA 3BL8A 4BFYA 1JLMA 3MPOA 4YV1A 1SG6A 1ZNQO 3JWIA 5BN4B 2G40A 5F35A 3BRQA 3UANA 3QUCA 4KIFA 4TSKA 4ZVQA 2MINA 3B12A 4XOIA 5C1DA 4ENWA 3NRCA 2XB6A 3SX0A 4X1YA 4Z2AA 5ALRA 1TCCA 3K9WA 5AM4A 1EWTA 2WUDA 1K9SA 3QG5A 5AOVA 4DMMA 5ITSA 2HMSA 4MINA 4R6XA 1DFGA 5C5EA 1VKHA 1Z2PX 1H2RS 3CUYA 3GOHA 4KQXA 4RZ3A 5HCUA 4H7KA 3ZNOA 3IUPA 2F3TA 4PGFA 5TC4A 1VG8A 2WU8A 3WLNA 4ECEA 2BD0A 1CUEA 4I66A 4L4SA 1LI4A 1QM5A 2ZUWA 4ARBA 2VF7A 3B48A 3RVOA 1UXHA 2HMWA 3DGEC 2ETXA 2XTNA 3BFVA 4JCOA 4CG1A 5JI2E 1OFVA 2RHGB 2JGKA 2OCYC 4YPFA 4D8TA 1ZXBA 2NIPA 2DFVA 4C87A 4TRMA 3RT1A 3GUZA 2R96A 4AY4A 1EAYA 3TZBA 3ROGA 1IN8A 2NZWA 5F1YA 5FLXA 2DSTA 4NZ9A 1N5DA 2IEZA 3HFRA 3NHWA 4AN1A 4UHCA 2RAFA 3UJDA 1I33A 1VM6A 3H8WA 3L41A 3TVTA 3C3YA 1PS9A 1U2EA 5LQAA 4HX2A 3KVNA 1FRNA 1T24A 2EW2A 3IHTA 1YHZA 4LGCA 4RD2A 4RMHA 1JQDA 1L7NA 1T5OA 4CLOB 4LNAA 3DM9B 2H1CA 3G0DA 4UM8B 2PUVA 4J0IA 1EVEA 3P2EA 5BVGA 4OHCA 4EMTA 2CV2A 3NBKA 3CX4A 2QAGA 3HJGA 1FSZA 4S2UA 2I2WA 5G1OA 3OIUA 4RLHA 3FCSB 4AUMA 5JZ9A 2BI7A 4MQ4A 4CM8A 1D09A 2PV7A 4JHLA 3EVBA 3ZVLA 5CB4A 4AI6A 4E4YA 4F2WA 4JEIA 3QTTA 2FPGB 5TT1A 2QX4A 4AIIA 1XZKA 2OAP1 5I7SA 1EBBA 5T3UA 4BNYA 1BYIA 2BH9A 4J76A 3TG8A 1ZWLA 5DTJA 1PV4A 1GQRA 2AEJA 2Y66A 4IMJB 4P0PB 3F5MA 2CNLA 2HGZA 3AJRA 4MP8A 4TTIA 3UWMA 4Y6PA 1C0LA 2HDWA 4QHSA 3H1FA 1D04A 4G86A 1YS1X 2OGTA 3MXOA 4JX9A 2YY6A 4PCVA 1RDFA 1XUOA 2IQ5A 2JAXA 2WSSD 4KTVE 2F43A 3BJEA 1DWUA 3DLAA 4HLCA 4O0LA 2XQGA 4QYTA 3TLKA 4ODIA 1SCJA 2XGSA 4PYRA 3ZGZA 2O07A 1VZ2A 4I2VA 4LZZA 1IONA 1Y9DA 1IYZA 2NVOA 4LCEA 3S68A 1KMQA 4EEKA 1G6HA 3GFVA 2WM8A 4BNVA 3TKLA 3KK0A 4AMVA 4F3RA 2YYYA 1T1GA 4Y2RA 2G88A 3D6FA 3ROKA 4EX7A 5LQJA 4KWTA 1W8DA 4DC1A 4ND3A 4B45A 3R0ZA 2OCDA 3LVQE 2OHHA 2WSBA 3HKBB 4FGZA 3UMMA 3H3XA 1X7ZB 3MVEA 1G4AE 3PI7A 2B35A 1CJVC 6CHYA 1PT5A 4RPGA 3BMXA 2EP8A 1A95A 1T1SA 2UXCB 3DO8A 3V2HA 4FC7A 2F2TA 2G36A 3MS7A 5AOCA 2P8JA 1E92A 4AX4A 3NBAA 4DIOA 3CVXA 4IXTA 2H08A 4WJKB 2V9ZA 4RF2A 3LPNA 2HADA 3OF5A 1EGMB 2OYRA 1E2QA 1F6WA 2RFLA 3B7GA 1Q3HA 3CJTA 1NONA 3JZIA 1DNPA 3RD5A 4BUJA 1R6DA 3CZRA 4IEIA 5DKFA 8ABPA 4F93B 1FW6A 2P9YA 4RH1A 4R68A 3I52A 2WAMA 1XRJA 2WNIA 3PVCA 3S2EA 4MYTA 1QP4A 4ND1A 4JNKA 1SCBA 1HR0B 1NT4A 3LOQA 2HTFA 4II3A 1ULSA 1NKTA 4AYTA 2YXPX 3IBFA 3GHHA 4FOSA 4KXWA 1L3BA 3Q40A 2QL6A 2IXAA 4V39A 3ZQ6A 4CMHA 2PU7A 1W6UA 2HD4A 3AF4A 3G02A 4H3SA 4LDAA 4PO8A 5A9SA 3SNKA 4E5PA 1NKSA 1L1EA 1ZMXA 4YJGA 1G9XA 1L7MA 3OBBA 3ZG6A 1MAVA 1ULHA 3KZMA 3LHFA 4KQ6A 3JQ8A 5TQ2B 5A05A 4JYMA 4J94A 3GELA 3IQIX 4LRXA 5DBGA 3UTCA 1F4PA 4DHWA 3U5TA 3P4YA 3BFXA 2P2CA 2XMDA 1BVYF 3DXXA 3F5DA 3OBIA 2ZRFA 1Y9EA 3H75A 3N7AA 1JR4A 4UJ3A 2X5XA 2C2MA 3EMVA 4M1EA 2ZDHA 4GYYA 4I3HA 1KEUA 1SA0B 1PZHA 1SKBA 4I5GA 2UAGA 4QUJA 3GIWA 3FGOA 2FY8A 3I28A 4HWKA 3VH3A 3KSZO 5M29A 4BU1A 3RRXA 3CZ5A 3O8OA 1UP6A 3F3MA 3T5TA 1XJ0A 3UATA 2FW8A 3UJPA 3IKTA 4O5OA 2XB8A 4JBYA 1G8SA 3KR9A 4KDEA 5LQRA 4CGZA 1IQRA 2AMFA 1JJFA 2CVQA 4PFQA 3LQ1A 1VDZA 3T1QA 3ZU4A 3TLEA 1RRMA 2ZIUB 3AX6A 3DSRA 3V7YA 1AZTA 3AYXB 4AJ4A 3PQ4A 2J87A 4XFKA 2WZBA 1TZMA 1C8LA 5BP7A 4ZZ2A 4JYAB 1XRRA 2NUBA 5JSYA 5IZ4A 1E3TA 2ES4A 4G5HA 1KEKA 4OREX 2W4MA 3GVPA 5E3JA 3OE4A 4C43A 1RQNA 2QPTA 4PPQA 1E2DA 1OHHD 1PJ8A 3UOAB 1W49A 1A76A 1ZM7A 1LNZA 1TQ4A 2XT6A 1H2XA 4ALKA 1HORA 2I4NA 3B3GA 3SZ3A 3D5QA 1VB3A 4ZHSA 2PBRA 3I04M 3GLRA 1SUDA 3T4EA 4TSRA 1DRVA 2H9AA 5A9TA 2B82A 2HLHA 3PE4A 1OF1A 3IVXA 2IP1A 5JFTA 1XVIA 4OAPA 4G41A 2GZ3A 2IYFA 2ZFUA 2ZTLA 5M04A 1Y7PA 3NBQA 4X20A 1GGMA 2R751 2VHUA 2WC1A 3EASA 1GVHA 3GVIA 5EHZA 4N5MA 4U7TB 5KJEA 3HK2A 4P4SB 3V1UA 1I7SB 2D3TA 4ND4A 4IDFA 2FN8A 2G07A 4LN1A 4KR0A 2I6TA 1JTEA 3E9YA 3ZJ4A 4CLDA 3WK6A 2ZUEA 3V6MA 1AA9A 2ZI4A 5A7HA 3MUNA 3ZJVA 2AQIA 3O91A 5KZMB 5JRJA 4U7WA 4YI5A 3FHTA 1NXOA 2G1UA 3P9CA 1PYOA 2EX0A 2PL1A 1N9ZA 4WLNA 2CLHB 5LUAA 4E5YA 1YQEA 2XCIA 1YMVA 2HDHA 4AB1A 4TS1A 4UPEA 2YRWA 3ICPA 2I4LA 2YV4A 4F8JA 2MSNA 4JT4A 5KC9A 3R9IA 4YY3B 1C7IA 3D54D 1HFEL 4GBGA 4K9SA 3UWPA 4E14A 2C8JA 2EZ8A 2HM7A 2ZQZA 1XMSA 5B58C 2F7SA 4B6SA 2XOKD 3SDBA 4LY3A 1AIPA 1IHOA 2A9RA 1QPZA 1AZSC 4DCCA 3OEYA 4C29A 3O4IA 5EJ5A 1KSGA 3FFWA 1TVKB 2ZROA 2LIPA 3LPDA 4NAVA 4EI8A 4M0KA 1G20B 2E85A 3VM6A 4JKYA 4GX2A 2AUTA 3D3WB 3F8WA 3W2HA 2AS0A 1NVKA 2VUTA 3PSHA 2WWVD 3SSOA 1SVLA 5AW9A 4BUZA 3WGKA 1G20E 4IIJF 1KH1A 1TL7C 4QA9A 1OUMA 3ESRA 5EJEA 4F3TA 2B4KA 1IUNA 1Z17A 2C82A 2ZU6A 2FN9A 3GGJA 3H84A 3MWJA 3Q8WA 4LNUB 5D5PA 1QHNA 2JLQA 1XBTA 2G25A 2ZS8A 1NIPA 2QX9A 1AUXA 2YWEA 1DKMA 3MWKA 1EFPB 2WIDA 4HDMB 3MCZA 1C81A 3MYYA 1EK1A 5DGTA 2FPPB 4YJ2F 3FUWA 2ZRKA 5DNAA 2IPXA 3S2UA 3I2IA 3P0RA 5H81A 4WA8A 1PEKE 4J0KA 4RK6A 3OCVA 3V7NA 4EM6A 4WAUA 2NSLA 4MW9A 5FOSA 2X42A 3FVRA 3OFNA 2Q99A 4O59O 2GA8A 2MSWA 2UVQA 3ANMA 5A5DA 1KZ4A 2JHPA 3CEPB 3HJRA 1Q57A 1OA1A 2WSMA 5EESA 3GBVA 3ZW8A 3UGKA 5AYVA 5BPFA 4YT2A 3HCDA 4Y1RB 4E5NA 1JG3A 4ZT6A 4IJ5A 2RE8A 4DWJA 1ZVVA 1UFKA 1EH5A 2HL6A 4FB5A 3ETEA 4L07A 2AW3A 2ACWA 2HHAA 3DLCA 3EIHA 3RS9A 3S2FA 3UY4A 1P4RA 3C41J 4ABYA 1OMOA 4XE5A 3H18A 3QA3E 4CU5A 4Q9AA 4ZI5A 3L46A 1OLSA 4WT7A 1U3VA 1UBHS 4ZVPA 3TDKA 3TCNA 5GJVC 5E95A 1EWRA 3N76A 4EPVA 5FI3A 2J5BA 3LTEA 3TQIA 2WYWA 1Q7TA 3ZR4B 1XRLA 1KQFA 1UJCA 5COAA 5DWQA 1B8VA 3EH1A 4C7BA 4Y9UA 1TD9A 3T5CA 4KYIB 3NNNA 4F3KA 3P0JA 5LZ7A 5EY5B 2IODA 3UK2A 4AO7A 5EYPB 1KDTA 1FFEA 5K0BA 4POAA 1XNHA 1A69A 1WG8A 1EXNA 2QUKA 1OXSC 1Q2UA 5FAKA 1Q92A 1WUYA 4QAJA 4V0ME 2HMAA 4MZDA 2X9QA 4KSYA 2OCKA 2C5GA 4XR4A 2EIHA 2XQFA 4AJOA 4MTLA 3AO0B 4R0MA 1QIEA 1ZCAA 4RGYA 1IDOA 4JUCA 4UM5A 4XA8A 4QFMA 3KU1A 4YFYA 5K51A 3KXLA 5TVGA 4MUMA 2PUHA 4OBXA 4E2XA 2P3SA 1Z7BA 3WLFA 2OV2A 1YT5A 4IHKA 1CS4C 2WHRA 4HDRA 4BLRA 3BD9A 4YJKA 3JWHA 2WF7A 4BNJA 4KOEC 1DOHA 4F86A 3OU6A 3BIXA 3GD5A 4IRUB 2XT9A 1ADFA 1WNTA 2B8EA 4LXXA 3SE0A 3D9QX 1Z63A 2AUNA 1V8BA 4UU8A 4KRYA 2ZUTA 5GVSA 2NUTB 4QUGA 3BWXA 4E07A 1E1DA 3KUCA 1K6IA 4RV4A 1R3DA 2EJBA 4EELA 2IS4A 4Y2PA 2GEJA 3D1LA 4KN8A 3OQIB 3R20A 3FZGA 1L4HA 4JOBA 3BVPA 3KOUA 3LUKA 4WD3A 1HWYA 3BK2A 4AXBA 1VG1A 1VIYA 4WXMA 3ZWPA 2QEQA 1WMAA 3VZSA 2BIFA 5L53A 4C6SA 4W5OA 1JE1A 1JDTA 2XVMA 3Q3EA 3MK31 4G3XA 4WN9A 3ZCUA 3LHIA 1NLZA 2D7CA 4JLSA 1MTOA 4EH1A 1U5CA 4XUGB 4DRZA 1PLLA 4CUZA 4B2LA 2R1ZA 1NSFA 4DSAA 3O3NB 1QGED 1P91A 5TE9A 2NTYC 1S0UA 5TF0A 4GLOA 2X4DA 4FEAA 4KVGA 2CDRA 1ISSA 1CDOA 2GT1A 4RA9A 4QTYA 2ZI5A 3AEUB 4GZMA 4V2UA 2VTVA 2QORA 2LIVA 3R4CA 4BB0A 1JFLA 3EPKA 1A8SA 2DKNA 4F45A 2YMMA 2ONZA 3KYCA 5LDHA 3GMSA 1D1SA 2VK8A 4BFVA 4AURA 1RJFA 3IAXA 3CEAA 3JYPA 4R6WA 2XYVA 4M86A 3RANA 3LHDA 4M7OA 2WHXA 3ZCRA 3C7TA 1SEVA 2V9PA 3O38A 5DBEX 5B4TA 4ONEA 2BY4A 1B00A 1MZVA 1CYEA 4G5YA 1B7GO 3QLUC 4U39A 3M4NA 3TIXB 1JVSA 4ESEA 1F8FA 1I3OA 1Z06A 3BWEA 1EJBA 2X9NA 1MJNA 1YH3A 3IGFA 2PO7A 3NHUA 2HUPA 4GPTA 3SPXA 2OXTA 5E1DA 4B83A 5L7WA 4B3JA 4YUAA 3GOQA 2JIPA 2NPFA 4J1TC 4G56A 5KTYA 2OZEA 2JRLA 4WK2B 4LY9A 4JLMA 1Y3FE 1RXSA 1SCIA 1PQYA 4Y1FA 4OMCA 2O8EB 1GDDA 1GGFA 3V34A 2UZ4A 5GZ3A 2P6RA 5F51A 3A06A 4OQMA 2F62A 3HGQA 5DK6A 1CVLA 2AXEA 1Z0UA 5EFOA 3SXPA 3SHTA 2C9OA 4H6PA 1CUFA 2ORIA 1QHFA 4IKOA 3Q8KA 1QRTA 4L51A 4ZK6A 2QD4A 4WFKA 3FIUA 4GOJA 4YMLA 1AKEA 3STWA 1EU1A 1MA0A 4C4XA 3D4OA 2DPLA 3HSYA 1MO3A 1RRKA 1UPBA 1TGYA 3AL3A 3VR4H 3EZ6A 3D4BA 4B3DA 2C1ZA 1JNXX 1Y3IA 1TNDA 4ZZIA 1FUIA 3WWOA 1KEVA 1XXHA 4RCVA 1O94D 4EO9A 2ZXEA 3O21A 3GCXA 4UAGA 5BR8B 3BMOB 1RRGA 3LW7A 3O4FA 3T5DA 2A58A 4FJ1A 3UMFA 2V3CC 5B6IA 1DAFA 1O9HA 1QAQA 1UBUS 2X5NA 3TZEA 2OXFA 3K09A 3S40A 3OCWA 4QPZA 3ADPA 4AM8A 2OHJA 2MHCA 3P4UA 4UATA 3ZU3A 5IC6A 2RJ3A 3N75A 4MRVA 1Y8ZA 3EYWA 1CEEA 1UCFA 1P7WA 4DQKA 1AOXA 1UFOA 4K3UA 3RAJA 4E30A 1Z35A 1EPUA 2W0MA 3MCWA 4G9BA 3QI2A 5L3SB 2WAXA 4ND6A 1WWKA 3GJ4A 4FK8A 3NAGA 1NXVA 3EEBA 2J0VA 2V1XA 1JR3A 5FP0A 2DUMA 2R7KA 3KPJA 1GGNA 3I42A 1OKKA 1B6GA 2G5PA 1VL6A 2J3MA 2VXCA 4FHGA 1T8WA 2NU9B 1LXCA 1U8TA 1L5FA 1F48A 1PR3A 3CT6A 2C9MA 3WDMA 4M6WB 4A92A 4QGSA 4ENTA 3GF4A 3OC6A 3R6TA 2JASA 3R4VA 1VCOA 5KS2A 4HLQB 4C0HA 3LT4A 1VIAA 1P62B 3HFGA 1N2HA 3E5NA 2P1RA 2BN4A 1Q0SA 1R0WA 2TMGA 5EUBA 5M2QA 2J4DA 3D8UA 1YB2A 5AHWA 1YR3A 4D97A 4H17A 1JIJA 3VO2A 3ETHA 3O82A 5FTNA 4V1CB 2LCIA 2D1FA 2NO4A 3ESCA 4N5IX 2X4GA 1P61B 1JHVA 5GJWC 3M4JA 3U31A 2P35A 1SVOA 3R09A 3RH0A 3D81A 2Z6QA 3D6TB 1G5HA 1ZG3A 4IX1A 5LA6B 2XUGA 3BGIA 4G2NA 4UDYX 5H16A 5KHAA 2PMWB 4R2WA 2XDYA 2KE5A 2XRFA 2GTHA 5LA6A 3VKHA 1QS0A 3ORYA 3B85A 1JXOA 1IOWA 1ZCJA 1RJGA 2ZUSA 4ZO8A 3H1TA 4TT3D 3HSKA 4F0JA 4GHWA 3KUUA 2I2CA 3CMMA 3ILSA 2C58A 3KT0A 1QU2A 3CUTA 4AZ3B 2IUYA 1LS6A 3BGDA 2Q45A 1RBYA 3WRXC 4CMJA 1M83A 5K8LA 4I19A 2PQ2A 2C4KA 4FI3C 1I32A 1PG0A 5JSKA 4AZTA 1W8IA 2FEOA 3L6CA 3NFYA 4UZEA 4G1CA 3TSOA 1YNOA 1DXYA 2CBZA 1ETUA 5JZVA 1D9XA 2NU9A 3FRIA 5LWHA 3FHJA 1FK8A 3TIGA 4TXLA 3ZQJA 3U62A 4WDQA 2Y0PA 4FDLA 1RQXA 3V42A 1ZD8A 3R6LA 5A02A 2HUNA 2O6HA 3DMHA 4JLUA 3BREA 3ZD8A 3A37A 3KC2A 1Y3DE 3FXAA 2G7MC 2O2SA 2H3HA 2W8BB 1TGVA 2GXQA 4BECA 3B2NA 4E5VA 1KH3A 2VO1A 3BILA 3LK6A 1VKNA 2VJYA 4WVLA 1JTFA 2EJVA 2P2YA 3NAQA 3MFQA 2ZBQA 3I1JA 3KQTA 4IFIA 5GTDA 5JT1A 2VHQA 3M82A 4GW3A 3JARB 5EUMA 5F33A 5FF9A 1M2FA 4KMOA 3TNFA 4AX8A 3BE8A 1CUZA 1Z6XA 3GXBA 1NRXA 3SP1A 5K8CA 2YOFA 3C3PA 3FCOA 3PQ3A 4DEXA 3GAAA 1B16A 2FFAA 2FEKA 2Z43A 3K9HA 3R8CA 1XKXA 3RO7A 3TKYA 3RSCA 1Z5PA 2IKQA 4ZVMA 3WGGA 3QUAA 4L1KA 3NJRA 2M6LA 1YRBA 4ZIRB 3GLHE 1JPNA 1GPJA 4BNXA 3E48A 4V0KA 1FYXA 5F76A 1VHJA 2G83A 3L1KA 4HGPA 2DLDA 2QY6A 4IOKA 1TAQA 4NAUA 1SXQA 3KDPA 5ICCA 4EW1A 2O5RA 4EO4A 3VDRA 4TX1A 4J49A 2HMTA 4F9TA 2W6MA 2GN0A 4I36A 4XIIA 5C5IA 1W6RA 1M2OA 1XP8A 3LDUA 2X2EA 2H52A 1OGJA 3OJ0A 4PCUA 2LBPA 4B3GA 1K8RA 1SCUB 3DZIA 4GI2A 4NYJR 4QPDA 4UE2A 3VNSA 3NHLA 4KRFA 2A9VA 3DONA 4CKZA 2PK3A 4DZZA 5CFNA 5CH3A 5AKKA 1PHRA 3CTMA 3ZV3A 5KYYA 1E98A 3FG9A 4OI1A 4AG6A 3EGXA 3UFBA 1E1CB 1XZQA 4H1HA 5H9VA 5E6UB 3UJ3X 5KTNA 3K0SA 1PTKA 4PCAA 4BB6A 1VL1A 1YDEA 2QTHA 3IQGX 2PKRA 5FYQA 2JGMA 2I3BA 3EXFB 3H6GA 3ZBPA 4L5JA 3ABSB 4A73A 4AZ0B 1T6XA 1KI4A 1JHXA 3G2LA 1UEJA 1FCJA 1ZD3A 3JD4A 5IK2A 4C89A 1J2EA 4F3NA 3ETLA 2I1QA 4HH4A 3VUFA 3BULA 1NMZA 2NWQA 2GPJA 1D2HA 2DFKB 3HMKA 2BSAA 1PJ2A 2NXJA 2IPLA 1K63A 1W47A 1V4VA 3C74A 3T7JA 3ZU5A 4EW6A 3OIYA 3X1XA 3U1BA 1YR8A 5DNDA 1E9EA 3C7DB 3W8RA 1MJGM 3M9WA 4Y1GA 1XMIA 3VPFA 1JB1A 2DLNA 4ZN6A 2XUPA 2A78A 1IRIA 2X8BA 1YZ3A 3WBJA 1WUIS 3KYIB 4DEVA 3LLUA 1RI1A 2VRBA 4MVXA 4OLJA 1AO3A 3B52X 3HZHA 3EODA 4P53A 1YR1A 2Q28A 5TPWB 1PL8A 3M6MD 3ZLTA 3TSWA 5JYDA 5IJ0B 1EB8A 2XVZA 4RFLA 2F8MA 3UMJA 2J7PD 4DAOA 1SXPA 3WGYA 3PEUA 4G4SP 4GL4A 4FKZA 4HG2A 4Q34A 4ETIA 3ZLUA 2J48A 1UZUA 4DB2A 1RYDA 3QXXA 3SHVA 2P8SA 1I3CA 4PLYA 5FUVA 5J5AA 3G17A 4HDRB 2BHLA 3GGOA 1NR7A 1O3YA 1QC5A 1ZSYA 5HK8A 1BEZA 1E2GA 2C42A 2Y92A 1VKZA 4Z4CA 1TF7A 1PFQA 3EC7A 4RIEA 2IBMA 5FYDA 3SC4A 5CK4A 1K0UA 3Q10A 4G67A 2O5EA 3RRYA 1Z75A 1KAHA 1R9MA 2W11A 2HBZA 4DCPA 3R76A 1MDBA 4TWIA 3W4JA 4D1YA 3I6ZA 1LSSA 3HCBA 1WKBA 3RVPA 1A5SB 1A8PA 1NURA 1JQ3A 1DU4A 2P4UA 2QMQA 1BJKA 2YRXA 3G1WA 4Y9DA 5G40A 3UAXA 4NYMR 1XDBA 1SKUA 1V8FA 2NGRA 5CA0B 4NCIA 2VPPA 3T1TA 3OMLA 1BW9B 5EHXA 3EPHA 3PC8C 1YRAA 3G7NA 1JU3A 4TTAA 1M76A 3SQMA 4ETWA 1E4OA 4NPHA 4X95A 4PQYA 1FRQA 4XTRA 5AUOB 3DDNA 4R9RA 4JEMA 4WIAA 1PUJA 4M37A 2AVNA 3FTPA 5AKYA 5DTEA 1DWPA 1HZJA 3WBFA 3UBTA 1K88A 3FWZA 1RLJA 4RSHA 4UEQA 5LU9A 2C8VA 4TWAA 3AR7A 4HP8A 2AJLI 3LI2A 1QO9A 1JXAA 2IPMA 2Q6VA 4UXIA 2HJ9A 2QAGC 1HE8B 2BHNA 4R9SA 4HQFA 3A6ZA 1OWOA 4K9KA 4PHHA 2WNSA 2Y1XA 4UDOA 5AKZA 5ER6A 2QPLA 5HCNA 5H80A 4URVR 5AVTA 1NQUA 4YXWD 3UAYA 3ED5A 4FFWA 2RMKA 4D0RA 4BFXA 4JQYA 2OAEA 4PAGA 4EWLA 1MBZA 3ABIA 1KFEB 5LLDA 1USUA 3OLQA 4LOJA 4MVJH 2QVZX 4H3HB 4I7EA 4NNJA 1JYSA 3QFSA 1ZW6A 5CT6A 2DHQA 5DYIA 1D03A 1IEXA 3KKLA 3ZN2A 2VT6A 3M8KA 4NOLA 2VDMB 4XOUA 2O7QA 3ZHXA 5FD8A 5JYEA 2MT9A 1DGQA 3I2GA 2YFKA 3SLKA 4BB5A 1UZLA 3ZU2A 4DBLE 1NDUA 1JP7A 1QX3A 5JARA 3P71T 4JLNA 3G8BA 5AI5A 3I45A 5JHGB 3A4NA 4MGYR 3WFJA 2CFSA 1U8EA 1GFZA 4FQ5A 4M9ZA 3OFJA 4L78A 3OX4A 3GFSA 3T4UA 4A8HA 1P6QA 4MR9A 3IRUA 5HMMA 3RB8A 1IBLB 2QRUA 3U60B 3QWFA 4UBLA 4BBJA 4TMVA 2JI9A 5ALEA 4P2GA 2G70A 2FP4B 4M22A 1Z15A 3ZWBA 2PU5A 5BSUA 2B61A 2JHGA 2O8CB 4A10A 1PJQA 2AXPA 1D0SA 3TB6A 3C5EA 5LMCA 1VXRA 3F0TA 4B85A 1VHLA 1T2FA 3HM9A 5EZ5A 2EOAA 4L7QA 4W5RA 3KFVA 2RBKA 5E3IA 2JCYA 1KTVA 1RXUA 5AOBA 3HC7A 4NBKA 2AI2A 1LK5A 1GRQA 4JLAA 1DTEA 2C59A 1U2GC 3ITEA 2H57A 3GJ5A 1UMDA 4BMDA 1Y63A 1E9AA 3L0CA 4TL8A 3OQPA 1WF3A 3NVAA 4LJ6A 4RNDB 4E4RA 3HBJA 3TSYA 1F60A 2XAUA 2AX3A 1FSPA 1BGXT 1ITZA 2AG8A 2C9DA 2ZITA 4JASB 5GM2A 2C99A 1IBKB 1PEYA 1QRUA 3JQ8B 3N9IA 4IF4A 4X1KB 2QN3A 3RVMA 3WQQA 3PEYA 2IH2A 1QYVA 5K6RA 2P41A 1DL5A 5LLSA 3TLZA 2G6TA 2ERCA 3RI3A 1XL1A 4GLJA 4RLFA 5IT4A 3TINA 2ZB4A 3Q3HA 1WETA 1HRDA 2Q21A 3HBMA 2XSZD 3PE3A 4BC1A 1BFDA 3ID6C 3GNQA 4KIGA 2P67A 1M9NA 2QYSA 4OHFA 2BGIA 3OIWA 5ALLA 3UQZA 1ZAKA 1LBIA 2FX3A 2O05A 4GLLA 2BKEA 2YWBA 4LYDA 2LR0A 2BR5A 2XCLA 4IMRA 3OMXA 1FSGA 2BEJA 3PGA1 3TRKA 4E2WA 1BGWA 4HNHA 4TKUA 2QLTA 3I32A 3MELA 1TUBB 3A6HA 4EJ6A 2GO7A 1RYZA 4NFHA 4OJNA 1QR6A 2VHEA 4DMRA 1ECBA 5H3LA 4JD5A 1U1EA 4S35A 1C1XB 1NVUQ 1OAKA 2ZTSA 1KZ9A 3AEQA 1T1EA 3IIEA 3BRWD 3LX6A 4YUZA 3KELA 4DCMA 4KR3A 4Z4IA 2ODTX 1X7XB 2JD1A 4LPKA 1V7CA 3RUFA 2FA9A 1KR2A 5L4SA 1LDGA 2C83A 2FHSA 4JLKA 1M2GA 1ZD5A 1IMOA 2I80A 3F4BA 2CZCA 1J09A 3P5BA 5LP6A 5GZ6A 2FUKA 1GU0A 3SK0A 3VZQA 1DFIA 2WZDA 3PQCA 3GFFA 4U1RA 1EXDA 1EE2A 5D3ZA 4N12A 3RS3A 5T3YA 3KSAC 4QG3A 1PSZA 1WMBA 3DKRA 2VDWA 1G8MA 2CXHA 4KVFA 4TL7A 4X92A 5AI6A 5I45A 3RUCA 2ZBUA 5DHTA 2PUGA 2J4FA 4HQOA 2CXOA 4PLTA 1H94A 4HTFB 2M6SA 1K6MA 1UBFA 4UOEA 1FFCA 1G59A 1G64A 4BMOB 4XX0B 2FJ0A 5HBRA 4ZVUA 3BA1A 3AM3A 3ED1A 3RYFB 4REQA 3EQZA 3FMOB 1DV2A 3Q6MA 5A5EA 1MB0A 2FUNB 1ZIDA 2UVPA 3SJCA 4DC0A 2JFOA 4EPXA 5LJIA 4ZU6X 5GIPE 3S99A 4B4KA 4BMSA 4CEHA 3AM4A 3D3NA 3URMA 3MRSA 2AFIA 3QWHA 4XTCS 1ELOA 3GN1A 4I4TA 4AZ0A 2YJGA 1HE2A 4LRWA 1H8HA 1CR2A 1Y5NA 3H6HA 4RFSB 3AOEC 1SVIA 1PSWA 2JD2A 3TD6A 4UEOA 3TRJA 1CUWA 4AJ9A 5IMSA 5IJAA 4GI1A 1TCAA 3O2SB 3HWWA 3LO5A 3OURA 1RJ9B 1KNQA 2HJVA 1HH4A 2GAAA 2W2OA 3X3HA 1RZVA 2BKUA 5GV8A 2Z04A 2X7HA 3D6NB 2XI4A 1MIOB 4OY3A 4Q7JB 4D3XA 2R84A 1XEWY 4MI6A 4AY2A 1M0WA 4L5CA 4G5QA 4J16A 3I01A 5FA5A 5B1YA 3QI7A 1XPJA 3P5SA 2JI7A 5DU2A 3MUFA 3FUVA 4K2HA 3OESA 2AC4A 1I4WA 1E6LA 1NX6A 4HDSA 1IOLA 4AIRA 4ISCA 1BH6A 3FUTA 3M6AA 4URUR 1XZFA 2K7FA 1D7OA 4RZUA 4V0MA 3CYFA 3FBWA 4N8DA 3GEIA 2OL4A 3I39X 1O9BA 2VPZA 1H3FA 1Z18A 2HBQA 3QE0A 3ECSA 3PD7A 3RIGA 4CN8A 1IMJA 5CDSA 2PGDA 2GEKA 3DZDA 3OFND 3C6XA 2VYNA 3DWGA 1Q0RA 1TZBA 1CHDA 2Q6IA 3U3ZA 1C1HA 3ER9A 3WVNA 3SHFA 3CVYA 3ZZTA 1Y3CE 2ROQA 4OHPA 1OLUA 3MG9A 2ID9A 3T52A 2H2HA 3ND6A 1QDEA 4IG4A 4JWKA 1H22A 3REQA 1VL8A 3PHIA 4W7SA 5JAMA 1QK3A 1R4ZA 5TGZA 5EMMA 1QRSA 1AUQA 5DX8A 1J8QA 4B5KA 4ZAYA 3P2IA 3DF7A 3A1DA 4ZQHA 5IPFA 3HCEA 5GVRA 3AKYA 2CL7X 3B9RA 4UNNA 1RLIA 1QQ7A 4ZCTA 4YRBA 4DUPA 5DTQA 1RD4A 4LZWA 3RRMA 5HE8A 1TUIA 2OWDA 1U63A 2C3OA 1R18A 5EMHA 2NPOA 2V5UA 4OGWA 5F64A 1V5IA 6GPBA 3DR5A 4GNRA 4CMGA 1UBOS 4FLMA 4UD2A 1W7AA 3IT3A 2OCAA 3M6IA 4KOAA 3JQ9C 2W4IA 4DMGA 1G5TA 3KEOA 1LBTA 2QTGA 2R44A 3ITKA 3PFHA 4S1VA 5CFMA 1E9RA 4L8GA 5KQSA 2QTAA 3L01A 1NZDA 2JA1A 4ZRDA 3SMQA 4JDUA 2UVDA 4GRAA 2HRBA 4Q9KA 4BEJA 5FH9A 1U9IC 4Y6GB 4IDAA 4P7GA 2B4RO 2F1IA 4FEGA 4JR1A 1KF0A 2Y77A 4OP3A 3FMPB 5E7IA 3EOAI 1FRVA 2J32A 2A0YA 3TOXA 4EI2A 5TGDA 1G3RA 2IYEA 2CFTA 3KFXA 4JUBA 3A6KA 3PXUA 1NRJB 4V0QA 5IYZF 4WNAB 4PXYA 4WZ6A 3C3AA 3G9XA 3M6VA 3IT0A 1HNZB 1FLVA 3V1KA 5COQA