1XDWA

Nad+-dependent (r)-2-hydroxyglutarate dehydrogenase from acidaminococcus fermentans
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
331
structure length
331
Chain Sequence
MKVLCYGVRDVELPIFEACNKEFGYDIKCVPDYLNTKETAEMAAGFDAVILRGNCFANKQNLDIYKKLGVKYILTRTAGTDHIDKEYAKELGFPMAFVPRYSPNAIAELAVTQAMMLLRHTAYTTSRTAKKNFKVDAFMFSKEVRNCTVGVVGLGRIGRVAAQIFHGMGATVIGEDVFEIKGIEDYCTQVSLDEVLEKSDIITIHAPYIKENGAVVTRDFLKKMKDGAILVNCARGQLVDTEAVIEAVESGKLGGYGCDVLDGEASVFGKDLEGQKLENPLFEKLVDLYPRVLITPHLGSYTDEAVKNMVEVSYQNLKDLAETGDCPNKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NAD+-dependent (R)-2-Hydroxyglutarate Dehydrogenase
publication title Structural basis for stereo-specific catalysis in NAD(+)-dependent (R)-2-hydroxyglutarate dehydrogenase from Acidaminococcus fermentans.
pubmed doi rcsb
source organism Acidaminococcus fermentans
total genus 120
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.-:
pdb deposition date 2004-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xdwA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xdwA01
3AY6A 2X22A 3LYLA 3DMTC 3GVCA 4CLRA 4R51A 4IJWA 1RM3A 3EK2A 3VDQA 3NJ4A 5I7FA 1N1GA 1HDZA 1V0JA 2EP7A 3DMYA 4JLWA 2ZJ1A 1HDXA 1A7KA 2X5JO 2FPIA 3CINA 3KM0A 4NR0A 1ZNQO 4OH1A 2ZTMA 2E82A 3L4BA 3KYDB 4PG6A 5DZSA 4R4JA 1N5DA 4DBVO 4MINA 2O48X 4CV1A 4LMPA 4BGIA 4GMGA 3ZU3A 5GZ6A 3PJFA 1ORRA 1VPDA 3IP3A 3PK0A 4MP6A 5B37A 3GNTA 3S2GA 3IP1A 3V2GA 1HT0A 4UVEA 2DFDA 3WNVA 3T4XA 3I9MA 3PYLA 3LT1A 5A4DA 3QVXA 1RKXA 2HJSA 3UVEA 4FDAA 1J0XO 4II3A 3TZKA 1I2ZA 3KOUA 3GLQA 3CUKA 4IINA 1MGOA 5TF4A 4EDFA 3V1TC 4J7CA 2C7VA 2GZ2A 2HMWA 3EVTA 1I32A 2EXXA 5KJCA 2AEJA 3JD1A 3FRJA 4PLGA 3M2PA 2E48A 4HFMA 1JAYA 4BHTA 3AI2A 3JTMA 2V6FA 4GLLA 3D4OA 1QMGA 2AHRA 1ISFA 3KLMX 3L6EA 3T7CA 3FPCA 4D3SA 5C7IO 3DZHA 2PFGA 4GQAA 2GN6A 1P74A 1PR9A 1OMOA 1P44A 5KJEA 1I10A 3OEYA 1PGNA 3GEMA 3WX0A 1A4UA 1ZSYA 3AU8A 3Q2IA 4OXNA 3SXPA 4A73A 4E31A 1PZGA 1PJ2A 1YBMA 3JQDA 3JQCA 5KKCA 2QZZA 5AXAA 1Y8QA 1XLTA 4XR9A 4RF5A 3PIDA 3VZSA 1E3SA 4IZHA 1GUYA 4IJUA 1EBUA 1PL8A 2GN9A 3WQSB 3F1LA 4BNMA 1E1NA 1TB4A 3JQ7B 3ZV5A 2EKPA 3EC7A 1E77A 4QX6A 1NVMB 3DC2A 3JQGB 4Q39A 1MG0A 1R0LA 1NPDA 1U1IA 4XDZA 2E4AA 4WLUA 3GVXA 3WG9A 1QSGA 4ALJA 3HDYA 1IL0A 1Q1NA 1HF3A 3ZWXA 1EEHA 2BGLA 4W99A 3RWBA 2VWGA 2BGKA 4D0SA 2PV7A 4L76A 3LT2A 4PG7A 3JQAA 2NTJA 2G1UA 1H6BA 1DLJA 1ZCJA 4ND1A 2X8LA 3GY0A 1K3TA 2D59A 4NNJA 5H82A 4O6VA 5G0UA 4MVJM 3AOEA 5EN4A 4YT4A 2P5UA 1KETA 1GPDG 1ID1A 1T2CA 4QFCA 4ZHSA 4PZCA 4L0QA 5JY6A 2IODA 1Q0LA 4URFA 1HE3A 4PN3A 4ZQGA 3ITKA 3NT5A 1HDYA 1UXJA 4L4XA 4JK3A 5ENDA 4BB6A 3DBRA 3DOOA 3K2EA 3EZLA 5DBFA 1PS8A 4NJMB 3ROKA 1YL7A 5IZCC 4XWYA 4PLHA 3H6KA 1YB4A 1PQPA 3NX4A 1AUPA 2VYND 3RUHA 2CDCA 1T4BA 1P0FA 1CERA 4J7UA 1WMBA 3UFXA 1IZ9A 1TT7A 3MOGA 1C14A 7ADHA 4NIMA 2BH9A 4YT8A 1N2SA 2IZZA 1E3JA 1U3WA 4E5PA 4IJVA 1ZEJA 4FOOA 1ZIDA 3NDIA 2GD1O 4D7AA 3I9LA 3MZ0A 1ADFA 1GTMA 4L74A 4N7RA 1EMDA 3NYWA 3Q6IA 1VE9A 1GYPA 2PTGA 1YB1A 4BNVA 3S2EA 4G5HA 1NAIA 4J4HA 3UCEA 4KUGA 3QWIA 5T67A 2POQX 2VOJA 2XF8A 4KZPA 4U7WA 3LF2A 1XQ6A 4CMIB 1EE9A 3TQHA 5JCXA 1GEGA 4IM7A 1U9JA 5A06A 1MFPA 1DPGA 3ORFA 4QEDA 3IS3A 4QSMA 2UV8A 1E6EA 2QX7A 1N7GA 3DTTA 1PTJA 4ALLA 4AVYA 3JYQA 4NH4A 4RZHA 2Z5LA 3E9QA 1YB5A 3Q2KA 2Z95A 2RH4A 4U6QA 5ILGA 4DA9A 4GLOA 5F5NA 4CL8A 7MDHA 3PFFA 4RLSA 2Q46A 2VT3A 5GMOA 1AHHA 4R3WA 1IY8A 4DLLA 1MXHA 4M8SA 2TMDA 2Q49A 4QUKA 1B0AA 4ALIA 5T57A 2V6MA 2J5RA 2O3JA 5ILOA 3HHPA 2C54A 1JN0A 1DSSG 3OMLA 4XYLA 4NBWA 5G4LA 3QE3A 8ADHA 4B8WA 2VUSA 2ZQZA 3NUGA 4FFNA 1BVRA 1DXYA 2B4RO 2O4CA 2I66A 1PU2A 2Y1GA 1BXKA 2Q1TA 4B7CA 3E03A 4XCVA 3ITDA 5K6AA 2X6TA 4BKRA 1NVGA 1ULUA 5A9TA 3WIEA 2JAHA 3IOYA 4L4RA 3GPDG 3B6ZA 3H4VA 2FR8A 2E49A 2DT5A 1KIFA 2O3TA 3GHYA 3U62A 3E8XA 5CP8A 1SC6A 3FNEA 1LU9A 1H0KA 4NQZA 5AOVA 4I5EA 3RFVA 3H5RA 1EDZA 2OGUA 1DDOA 4MVJF 2OP0A 4ZU3A 1UDCA 2C5AA 4JJFA 2UDPA 3E9NA 2EIHA 2R00A 3AY7A 3JYLA 4RCVA 4EYEA 3VVBA 3JQ8B 1KEVA 2O2SA 3DOJA 4RZIA 4PLWA 1UJMA 4IY1A 1I24A 2NADA 4FJ0A 4IIVA 4QFDA 1HEUA 3TJRA 2EW8A 5L3ZA 3UF0A 1KEUA 2HU2A 4AJKA 6LDHA 1EUCA 3F3SA 1H6AA 1T1SA 1K6IA 1JQBA 4LCJA 1GUZA 4N5MA 1U3UA 1XR3A 4E0BA 3KEOA 3O4RA 2BLLA 4GL4A 1D1SA 4ESOA 1NR1A 2OUIA 4O1MA 6ADHA 5G0TA 3K5PA 5TT1A 2C07A 3VKVA 3AFNA 1ISHA 2I3GA 1HLDA 4Z0PA 5A3JA 1GL3A 5A5FA 5J23A 1EVYA 1GUFA 3DWFA 1Z74A 1R15A 2B35A 1EZ4A 1B3BA 3KETA 2B83A 1LLDA 2DTDA 1R0KA 3LVFO 3PLRA 1TI7A 1IYZA 2PZLA 3R0IA 3ENKA 1U7HA 4N18A 3UKOA 4Y67A 3RC1A 3ADPA 3ANLA 3H65A 1BDBA 3W4JA 2H63A 3GRPA 4YEDA 5EINA 2VCYA 1Y9AA 1CRWG 5IN5A 3GNSA 1DAOA 4BNGA 3N58A 2DUUA 3PYMA 1OC2A 3OH8A 2PD4A 1YQGA 3IUSA 1T1RA 3B1JA 4PG5A 4ALNA 3Q1LA 4NG5A 1F8GA 3OBBA 3ZHBA 1N9GA 1PGOA 1KERA 2JFHA 3AUAA 2NU6A 3GN1A 3JSAA 2W2KB 3NGXA 3I5MA 2JFGA 2PKQO 3DZFA 4J7XA 3SJ7A 1Y81A 5THQA 4Q3EA 1CQJA 5DOVA 3IIEA 4PLFA 4K28A 5ICSA 4WCFA 1BW9A 1GEEA 2VHYA 1C1XA 4N5LA 1MV8A 2HMUA 3WSVA 4XX0A 3TPCA 3WGIA 1DC5A 4M87A 1ADCA 2NQ8A 3GG9A 4JJGA 2IEBA 4CODB 2QZ9A 4AJ4A 1PJTA 3ROMA 4IMRA 4XGIA 5JSFA 5JFOA 3ON5A 3QIVA 4G81A 1BWSA 5H83A 1ZXLA 1B8VA 4FR5A 2PR2A 1R0SA 2OP1A 3BMQB 1QLHA 1M76A 3S8MA 3GPIA 3DFUA 3KVOA 4CM4A 5ER9A 4J43A 3HWRA 2EERA 1NX6A 1GD1O 1DOHA 1A9YA 4HWKA 5L53A 5I8ZA 3PTZA 1TT5A 4Q3DA 3TZCA 3GMSA 1NQOA 3C1TA 2QHXA 2BMAA 3DBLA 1M75A 3QLJA 1WMAA 4A26A 4CMJA 4H3VA 4YJFA 5JAMA 2Y93A 2C5EA 4XYGA 4D44A 3ZU5A 2PZMA 1IULA 5ITWA 2ZQYA 2AEMA 4RPHA 3QY9A 1ZK1A 3AM5A 2D0IA 1WXDA 2DTEA 1H2BA 5A05A 1DJQA 1SAYA 4EI2A 3F6YA 1FK8A 1SPXA 3E5RA 3BTOA 5L45A 1SBYA 1WW8A 3HQ4O 4WLNA 3E82A 2PY6A 2VTEA 4M49A 1B16A 1YXMA 3RKUA 1SB8A 1UR5A 3JQ9C 3RUEA 5JAIA 1FJHA 4J4BA 1NFRA 4HFRA 3CMMA 2W2LA 4GVLA 3DQPA 4ZGWA 4BQPA 4J9UE 4XJTA 1YE3A 1NP3A 1KVSA 1LLCA 1WZEA 4NFHA 2BI8A 4CQMB 3LC7O 4YRBA 1P9LA 4WLVA 4YR9A 3R3SA 1DAPA 4E5KA 5FEUA 4O0LA 4XQCA 1ADBA 4KQWA 4UAGA 2EV9A 3DL2A 1E1MA 4A10A 4U0KA 3KYCB 3ZI0A 2BF7A 3QQPA 3JD3A 4YCAA 4E30A 4YT5A 1UUFA 3PZRA 3OIDA 1GV0A 1ISJA 1YWGO 1VM6A 3FNHA 3TOXA 1H9AA 1YQDA 1MA0A 1DC3A 3W8EA 4D41A 5DF1A 4KOAA 2RCYA 4ID9A 1DO8A 3OETA 3GK3A 1DEHA 2BRUA 2ZATA 2PNFA 5ER6A 3PWKA 2W98A 2FSVA 1U2GA 3RKRA 2X58A 2B69A 1XYGA 5U1PA 4GAEA 4Y9DA 4NJOA 1UH5A 3NDRA 3RU9A 3PDUA 3TDKA 4J0EA 3G0OA 2NTNA 4J91A 2B5WA 2YFHA 4IIUA 3KB6A 4DUPA 1ULSA 4LRSB 3VPFA 1EFKA 3RFTA 4MKZA 2DU8A 4EEXA 2DBRA 4YJHA 2NVUB 1WDLA 4FOSA 1JVSA 3PZBA 1H6DA 1E7SA 2V6GA 3OHSX 5HBRA 4DYVA 1BSVA 3QV1A 3JQFA 3H9JA 1BXGB 5BNFA 2VWPA 3OIFA 5KVCA 2NM0A 3WICA 2VUTA 2FN7A 3WR5A 4ZRNA 3E18A 4QECA 4YDRA 3ZNNA 5IDYA 5JDIA 3T7EA 4PLYA 3KHUA 5JC8A 1JU9A 2PD3A 1EVZA 1Y5RA 3GGPA 1YKFA 1P0CA 2G76A 3PIIA 1P31A 3GAFA 4IZIA 4LCEA 4W6ZA 3RUAA 2WEKA 4F6CA 4Q3CA 4LMRA 1LJ8A 1LRJA 3G1UA 4AJ2A 5A3VA 5AXDA 2AG5A 5BSFA 1RWBA 3GVIA 1UZLA 1PS0A 2Y0DA 2IE0A 3OICA 4TROA 1Q2XA 5L7YA 3HZZA 4E33A 4CLOB 3RCBA 4MPDA 3WMWA 1E3WA 3MTGA 4GX0A 5IXYA 1N92A 1YDWA 1R4MA 4TRNA 1U5AA 5EESA 1PL7A 2A9FA 2NSDA 3K30A 3HSKA 3PWSA 4WLOA 3QRWA 4PLVA 1MC4A 5THKA 3JD4A 1AXGA 4RVHA 1ENYA 4Q9NA 5HS4A 4UUOA 3ZV6A 3L4BC 4PLPA 2GRAA 4RJTA 2B0JA 5TNXA 1ZEMA 4MVJA 3QVSA 1ZBQA 4YXFA 2I99A 1MXFA 4M86A 4DYDA 5LDHA 3PYXA 1P1JA 1E92A 1D7OA 3FD8A 3SVTA 3ETGA 1ZSNA 1PS9A 1VJ0A 4UREA 2HMTA 2J3JA 3ZV3A 1QV7A 1JVBA 2X0RA 2WYUA 4XZ3A 3U49A 2WYVA 2GYYA 1KS9A 3EMKA 2AA3A 4AICA 2PGLA 2PGDA 2SCUA 3F4BA 4WLEA 4INAA 2ZIZA 4YJGB 4D3DA 3HNPA 3OFSA 4XIJA 4CMGA 1DIHA 2ZB4A 2DM6A 4PVCA 4CV2A 1Q0HA 2PWZA 4BO6A 3TNLA 3RD5A 2Y1OA 1FDUA 4L8VA 1J4AA 2D2IA 4DIOA 1JW9B 4YAJA 3KXDA 2I5PO 3ST7A 1R12A 4WKGA 2O50A 4BO9A 3TF5A 4HBGA 2X1HA 1NPTO 4QXMA 4GH5A 1M67A 5JW6A 1E7WA 4H16A 3AFMA 3WGGA 4CM6A 4PGFA 3F9IA 3AI1A 1UXGA 3WGOA 3PJEA 4CLDA 1NXQA 1B2LA 3C7CB 1E6UA 1X1TA 3RVDA 1WAMA 1EUZA 1MLDA 3PHGA 2VNSA 5KVVA 4WOJA 1MB4A 2EGHA 1KC3A 4OAQA 3WOHA 3ZWMA 3IC5A 2FY8A 4BUCA 2VHXA 4CQMD 2VRCA 4EZBA 5ADHA 1BXZA 1IUKA 2O3UA 3A9WA 3DOCA 2EP5A 1PGJA 1VKOA 4EJ0A 4N54A 3NAQA 4JCOA 1WLYA 4XYMA 1I30A 1RPNA 1N8KA 4JP2A 8LDHA 1C0KA 1KEWA 4II2A 3OM9A 4KQXA 1B8UA 1YO6A 3VC7A 3H5NA 4OXYA 5DCWA 3VZQA 3RROA 4TSKA 2YHIB 5FYDA 1E1KA 4RLHA 3A28A 1VC2A 5T8KA 3BTSA 1QV6A 3QP9A 1P1KA 2OFPA 1CJCA 2FWMX 2IRWA 3AOEC 4YACA 3ZW9A 3INTA 4ZN6A 2OORA 4BNHA 2CY0A 1DBVO 3ZV4A 3HB5X 4CM8A 3AM3A 4F46A 3SC4A 3LC2O 2NLOA 5KJFA 4DPKA 1NFFA 1ZMTA 4R54A 1KC1A 4O63O 3L0DA 3INGA 5KJ1A 1IHYA 4WGGA 2YJZA 3QJ5A 1YDEA 3OA0A 4J2HA 5I9MA 4BVAA 4LVUA 1NR7A 3EHEA 4NU6A 1SEVA 2X0IA 2B4QA 4RDIA 4RORA 4D42A 2Z1NA 1Z7EA 2UUOA 3WFIA 1E7YA 2AG8A 4I9UA 3O8QB 5COBA 3ZU4A 1A27A 5G0SA 4C7KA 4J6FA 4DGSA 1PGQA 2A4KA 2I65A 4IS2A 4A2CA 3A4VA 1V3UA 4FB5A 5L7TA 1NNUA 2DVMA 1LSJA 2WYWA 4UUPA 2EJWA 1X0VA 2XXJA 4Z6KA 5ITVA 3GEDA 3JV7A 2FSSA 4K9DA 4E2XA 4M55A 1SNYA 3QW2A 5B1YA 1EBFA 3WFJA 3ZCXA 4B4WA 4WJZA 1CQIA 1ISIA 4MVJH 3UH1A 5JBIA 4BNKA 1YBVA 3ETDA 1M2WA 3K9QO 4BL5A 3RFXA 4WPGA 3FNGA 1P45A 3B20A 3HDJA 4FC6A 3BMNA 5A9SA 3ABIA 5KWEA 1T26A 4BO3A 3PXXA 1DIBA 2Y67A 4EJMA 2VHVA 3GFGA 1UXIA 3IMFA 4PLZA 3X2FA 4XR4A 2OOSA 3CEAA 2JL1A 3U5TA 1E3LA 3AU9A 3JYPA 1PJ3A 3VH3A 3WWYA 1A71A 3C85A 1LDMA 4LVCA 5L4LA 3U4HA 2HRZA 3LT4A 4RF4A 4OOEA 3ZWPA 1BXGA 3P19A 3Q0EA 3KTDA 3WJAA 1J49A 4D43A 1RM5A 3WTCA 4JP3A 1AE1A 4E5MA 5K6AC 3DXFA 3RBVA 3FR7A 2Q2QA 4XQ9A 1G6KA 1OBFO 4DC0A 1ZUD1 2Y05A 3FWZA 3DAFA 4FFPA 1YQXA 1FDTA 1J6UA 3KUXA 3DHNA 4LSWA 1V9LA 5L9AA 2GSDA 2GUGA 3GN2A 4DQVA 2FR0A 3ZHXA 4HADA 5JNLA 3DDNA 3KBOA 1TVEA 4GWKA 4YVFA 3ADOA 1LDGA 3RC2A 1Q0QA 3EUWA 5EIOA 3PI7A 3RUFA 2PK3A 1Z75A 4DREA 3RUCA 1NVTA 3RUDA 1ONOA 1Y5MA 2R00C 5I7VA 3GFBA 2DKNA 1O8CA 3KO8A 4IS3A 2UUPA 4J1QA 5CDGA 5CAEA 1ZK0A 2FZWA 1DHTA 4J49A 3ZWCA 3RSHA 3HDQA 3WQQA 4ND2A 1GQYA 3U0BA 3WYBA 4LW8A 4L4SA 1HWYA 3GOHA 5COAA 3WTBA 1G1AA 1HE2A 3AUUA 4ND3A 4HY3A 1F12A 5GY7A 3GNQA 3BMCA 4PG8A 4IDCA 1KBZA 1ARZA 5KKAA 2YDYA 2GF2A 5FI3A 3BMOA 1LTHR 4RV9A 3N7UA 4ZJUA 5FFFA 1B3RA 4RO0A 1D3AA 3JD2A 5EERA 3KSUA 1BHSA 4IGFA 2NACA 2IDZA 2Q2WA 4OXKA 5DOZA 3WJ7A 4BO0A 3H9UA 2RAFA 2RHCA 4NBUA 1J5PA 2O3RA 2BKAA 3VTFA 2P9CA 4MVJE 1VL6A 4RPKA 4BMVA 2ZB8A 5U9CA 2P4HX 2X23A 2YHUA 4YQYA 3WWZA 3DONA 4CQLA 2E6UX 1WWKA 1L7EA 1UZNA 1Y8RB 3E48A 3LC1O 4CL3A 2BGMA 2GLXA 3MOIA 3ZWBA 2HK7A 4CM3A 5L40A 2AW5A 2PZJA 1P33A 5IDXA 1X1EA 2VRBA 4BMSA 4BGUA 3UUWA 2GZ3A 1LQTA 3NT2A 4CM9D 4RQUA 1PJSA 3I6QA 4GPD1 1WDMA 2AE1A 2NV6A 3TZHA 4PVDA 3P5SA 1BRMA 2VYNA 1YJQA 2YQ5A 3LLSA 2UAGA 2C2XA 4I5GA 1WVGA 3U9LA 1MX3A 5TJHA 4QTZA 1R4NA 1XU7A 1NPYA 2ET6A 3CPSA 4XKJA 3BXXA 1T24A 4DWVA 5DULA 5JCJD 4WCFC 3DB2A 3NDJA 1DRVA 3IQDB 5FF9A 1D4FA 4U0JA 2Y1FA 3WBFA 4AJ1A 4U6SA 4IDAA 2Q4EA 5JDCA 2FP4A 3W8DA 1HYHA 2OO5A 3IKVA 2BFAA 1SZJG 1FDSA 1HKUA 1D1TA 3EY4A 1BMDA 3GZNA 4DIFA 3P2OA 1C1DB 4D45A 4NHEA 2ZJ0A 1YRLA 4DPMA 5CFZA 2VN8A 5JYEA 3GR6A 3JQ6A 2EF1A 3R1IA 3S2FA 4FJ2A 2F00A 4YWJA 2D1YA 2IXBA 3GEGA 4CUZA 5T64A 1IPEA 2PH3A 4LRTB 3VTZA 1B7GO 2FPPA 3ANMA 1XSEA 2P9EA 2PKQP 4NBRA 4BNZA 2O3QA 4R1SA 2CNBA 2VZ0A 4OL9A 3LF1A 3AW9A 5G4KB 5EMHA 3SLGA 4WASA 3OJOA 3CSDA 3KV3O 3LZ6A 3E5MA 3KYDA 3TRIA 1IHXA 3QSGA 4UVHA 5BNTA 1ENPA 2AMFA 5TGDA 1LXCA 4CMEC 3WBBA 4W9NA 3GDGA 3UXYA 4UVIA 5H81A 3RASA 4BO2A 4GX2A 1I0ZA 1DIRA 3DBHB 3L4SO 2AE2A 2WD7B 3NTQA 3V8BA 2QRJA 3VPSA 4Z9YA 4YPOA 1PQWA 4QO8A 4BNLA 3SEFA 3DZIA 2I76A 1HDCA 4UEOA 2WTBA 4HX5A 3E9MA 3F46A 1H2HA 3GDFA 3G49A 1GCOA 4IBOA 1XWFA 1A4IA 1MFZA 5KIAA 4FS3A 4B3HA 3CIFA 2DPHA 2H1SA 2Q45A 2H6EA 4FFOA 4G65A 3ENNA 3KLPX 3KRTA 3ROQA 5TT0A 3VDRA 1PGPA 4ZQHA 3SLKA 1XG5A 1ZK2A 3VZPA 2NWQA 2ZK7A 2HJRA 4EUEA 5U4QA 5B4VA 1GQQA 1QYVA 1X7DA 2DC1A 3OP4A 5ICMA 4IDDA 2NU8A 3HJAA 4FQ8A 1H5QA 5L7WA 2DPGA 2NU7A 5MGBA 3JQBA 3F5SA 4AJIA 1LSOA 1NYTA 3RIHA 1V3TA 4J16A 3BAZA 1GQ2A 1C0PA 4JN6B 3VH1A 5TLSA 5BNIA 4OSOA 1QORA 4TQGA 1IOLA 5C37A 1R16A 2D4AA 2ZB3A 3JQ7A 4RF3A 3S55A 4CV3A 1HRDA 2QYTA 1E7MA 4N5NA 1YOVB 1EUDA 4OOFA 1GADO 3QWHA 4Q3BA 2VZ8A 3JQGA 2AQ8A 3K31A 3NKLA 1U3VA 2GNAA 2Y0EA 2D3TA 3D3WB 3PVZA 1I33A 3R3JA 4BKQA 5TRTA 1E3EA 4AJPA 1QYWA 4NZ9A 5K0ZA 1GZ3A 4JBHA 2Y1EA 3MJTA 3ONFA 4LSMA 3QWAA 5IG2A 2P9GA 2YV1A 3JQFC 2PD6A 1KVTA 3UAGA 1LDBA 4GVXA 1ZH8A 4UEJA 4AFNA 5KNLA 1P1RA 1UDAA 2EKQA 2QW8A 4I1IA 4WLFA 3CH6A 1E5QA 4ZQEA 5JDIC 2FZEA 5DT9A 2JD0A 3BZUA 2VT2A 5F21A 2VYVD 4BKPA 3UHAA 5C7LO 3I4CA 3INRA 1O9BA 4ILKA 3C7DB 4KWIA 3ONEA 4I5FA 4MKRA 4PRKA 2FPGA 3PRJA 3ROPA 3R6DA 2Q4BA 4CMHA 2VHWA 1JAXA 1GFSA 2BHLA 3IKTA 4Y98A 2QQ5A 1E3IA 4NJMA 1OZAA 2ZYAA 2PLAA 4NK5A 1LSUA 1HE5A 1O5IA 2DBZA 3PHLA 4UVGA 2CD9A 2DQ4A 5LC1A 5B4TA 4XQGA 3OJFA 1CF2O 2V65A 4XGNA 3B1KA 3WNQA 1EFLA 3UN1A 4CMCA 4CLEA 3WS7A 2BFOA 4XGKA 5JMWA 1NQTA 5F3RA 3OQBA 5AYVA 4O5OA 1U8FO 3PGJA 4WE3A 4ZICA 1LRKA 3ZWVA 5TJ9A 4CR8A 2EGGA 1QR6A 4QO7A 3W6ZA 2HO5A 5B4UA 4RPLA 3CZRA 2WJPA 4BV8A 1Z7BA 4E21A 4KDEA 3SC6A 4CMIA 3VKUA 3PQDA 2RIRA 4Z9FA 3C3XA 4DIBA 3F5QA 2JCYA 4J3FA 3TZ6A 1ZW1A 5KVQA 2QIOA 4EBFA 3D3EA 3KSDO 3AOGA 3TFQA 1P1FA 3QWFA 3V1UA 2FOIA 2A35A 2EKLA 4P4NA 3W4IA 4NBVA 1EVJA 1ISMA 1W73A 1OI7A 3U09A 3DAGA 4RL6A 1IE3A 4UUNA 4D3FA 2CVQA 4NDNE 3U4DA 5AXCA 1GV1A 1KEPA 1GR0A 1Y8QB 4RVSA 1AXEA 3GF4A 3BHMA 5JO9A 2HQ1A 1ENZA 1CEQA 4RVDA 2Y99A 3H2SA 4IXTA 1V8BA 3PQEA 4PG4A 2OZPA 1Z82A 3IUPA 1X0XA 4XA8A 1YBAA 3MJVA 5ES3A 3ZWNA 1NFQA 1V35A 1RJWA 1ZK4A 3HN2A 1C3VA 2IYOA 4BO1A 4FJ1A 2JJYA 3SX2A 5C7OO 3OSUA 2EWMA 3WGTA 1VKNA 3CTMA 4ONEA 3DZGA 5L95A 4YBZA 3C7AA 4DMMA 3FCOA 3I83A 1R6DA 4OHUA 4EW6A 5IF3A 3H9QA 2OBYA 3VZRA 1PX0A 3JQAB 1CIVA 4CR6A 3D1LA 4EUHA 4DQUA 4OKIA 4DRYA 4E13A 2ZTLA 4K1LA 4KP7A 2LDBA 3TZQA 1S7CA 3ZU2A 4W82A 3G3EA 5C3MA 1ZO8A 3QVTA 2D8AA 3DZBA 1A72A 2CSUA 1P3DA 4UEKA 3OJ0A 4IPTA 3LK7A 3CMCO 3VH2A 5L51A 3CKYA 1ISGA 3FSRA 2B37A 3O26A 5I7SA 1JKJA 1VL0A 4YJDA 4EITA 1QYCA 2GCGA 3JQ8A 2EEZA 2P2SA 3C1OA 3PHIA 4TWRA 3RBZA 4CPDA 1E7QA 2HDHA 2I6TA 3FF4A 4WEOA 4J9VA 3DBRB 3RU7A 2PGJA 3GQVA 3PFWO 4K26A 3FPLA 5T8KC 3WQRA 4BNFA 2IZ1A 4OYRA 4GSLA 3A1NA 1BVUA 4H15A 1Q7BA 4A0SA 2FHSA 1F14A 4JQCA 1DB3A 3GAZA 1K6JA 3FTPA 3HDHA 4GKVA 3STHA 2DLDA 3ZDFA 4E3ZA 3O03A 2CDAA 2X9NA 1SCUA 4WUVA 2X9GA 2XOXA 3C24A 5HRUA 2DFVA 1B14A 4R1UA 2C0CA 3KSZO 2WM3A 4GGPA 3WLFA 3RAJA 2HRBA 3HFGA 4P4LA 1X15A 2NUAA 4O59O 2TMGA 2JFFA 1GDHA 4YRDA 1ZKMA 1GAEO 1P1IA 4FGSA 5EPOA 4IJKA 4XEHA 2I3AA 3DO5A 5CHEA 3AUTA 4WCDA 1FF9A 5EQFA 1LX6A 2YV3A 3ZGYA 3MTJA 4IXWA 1ENOA 4BNJA 2NTVA 3NV9A 5F1PA 3DAPA 5TQVA 3L6OO 3PQFA 5BSGA 4DL9A 3EVNA 4XYEA 2W4QA 3OEWA 3F47A 2Z1MA 3RC9A 1Z73A 1K89A 5A5EA 4QQRA 4TKLA 4BO5A 3GUCA 3OECA 3D4NA 5IAAA 4K6CA 3BYZA 5CPBA 5AXBA 1LDYA 4JJIA 1NHWA 1KY5A 1LUAA 2A94A 5G2OA 2XPCA 1IPFA 1L7DA 2W2KA 2FMUA 3GGGA 2F1KA 3M2TA 4P4GA 4PZDA 4RGBA 4TMFA 1PQUA 2ZKLA 3UW3A 4GMFA 2HKIA 1XU9A 2YW9A 4I5DA 4BV9A 3K73O 4Q3NA 4QT0A 1I3LA 1C0IA 5EL0A 2Y68A 1DFGA 4Z0TA 4GSKA 4PRLA 1DFIA 3EGOA 4Z3KA 5CG1A 4FW8A 1EVIA 1PEDA 1Y7TA 2J3KA 4CM1A 3F4LA 1VJ1A 1ZMOA 4BKUA 4CMBA 3O38A 2BFMA 2Q1UA 2C59A 2YQ4A 1R66A 3X2EA 5CEFA 1PSDA 1JKIA 2RH8A 4BNTA 2DAPA 2P4QA 4ZVVA 5IJZA 1LDNA 3RQSA 3CE6A 3K2BA 1VLLA 2WWRA 3I1JA 1U8XX 4OJNA 3H5AA 2ZB7A 3EAGA 3BMQA 3S1LA 1G0OA 5KOIA 5TS3A 1E0DA 3JD0A 4YB8A 2Y1DA 2GZ1A 2A92A 1LNQA 3GGOA 4LISA 4JGBA 2X86A 3WGHA 4YAIA 4GX5A 3OJLA 1JKFA 5CDSA 3TSCA 2AEFA 1DLIA 3BHJA 1XGKA 3SJUA 4OSPA 5HM8A 5G0WA 4XDYA 1HE4A 1KVUA 4IMPA 1S6YA 4MIOA 1HYGA 1BDMA 2ZYGA 3FBGA 1YL6A 2I9PA 1PZFA 5BQFA 5I9NA 4B8ZA 4NFYA 4BNNA 1GU7A 3I52A 3K6JA 3ZWOA 1P1HA 1I8TA 2JD1A 4LN1A 3H2ZA 4HNGA 4B3JA 1T2EA 4R1TA 1IZ0A 1Q7CA 3AUSA 1A5ZA 4GGOA 5JYDA 1I3MA 3L6DA 5JE8A 2Q1WA 5IZ4A 4CMKA 2CUKA 4EUFA 3OA2A 3NTOA 1UDBA 4MJLA 3WDSA 1K6XA 3COSA 2DUWA 1AHIA 4JNKA 4HXYA 1X13A 4MDHA 4MIYA 3JQAD 4R9SA 4I8XA 4CQMA 1PWZA 2VHZA 2WSBA 4D0RA 5I7EA 1B8PA 5MDHA 5BR7A 1TLTA 3BIOA 1YL5A 3LDHA 4ROSA 4I9NA 1JWBB 2OBNA 3ZNOA 4J1TA 1FMCA 2LDXA 3KYCA 4CV0A 4BNIA 2BI7A 1A7AA 4YYZA 3NJ8A 3MJCA 3A06A 4TRMA 2VWQA 1R37A 4ZQFA 2VUUA 3VPHA 1PJ4A 1ZFNA 3RBXA 4AJNA 5JS6A 3M1AA 2RHRA 1T2FA 3K92A 2VTDA 3BA1A 5KJ6A 4XRRA 2G5CA 4MOWA 4DLAA 3VHRA 2HSDA 3T4EA 2JKVA 5A9RA 1EDOA 1RYDA 1E7RA 1KY4A 3D7LA 2Y0CA 5CG2A 4F6LA 2RBEA 1N9GB 4E2ZA 5I9LA 5KTKA 4W7IA 3WXBA 2VZ9A 1LQUA 1VSUA 4B4OA 1VRWA 2CVZA 4F45A 3FN4A 4B4UA 1UAGA 3ZN2A 3AJRA 3U4IA 5DBIA 1ZVMA 2C2YA 2GO1A 2Q2VA 1BW9B 3GHHA 3PHHA 4IQ8A 4WCFB 1C1XB 2Q1SA 4C7JA 2NVUA 4FD3A 1YJ8A 3K8ZA 3V1YA 2WDZA 3LLVA 1KYQA 2CDBA 2EHDA 4KUEA 4MVJI 3V2UA 1I3NA 1EK6A 1RYEA 4PCVA 4W4TA 2O2YA 3Q9NA 3WB9A 1Y6JA 4EGFA 1DRWA 5A1TA 5DP2A 4R69A 2ILTA 3PPIA 3FWNA 2JHGA 1GZ4A 1U4OA 2J5KA 3DMTA 2O4UX 3I4FA 3MWDB 3GUYA 3BTVA 4CM4B 5GZ1A 2O7SA 3FHLA 5JDCC 1O95A 5JMPA 1TT5B 3EW7A 4TZKA 4Y6RA 2NU9A 3TL2A 4OGWA 1XHLA 4BQRA 3RUIA 1EE2A 2Q99A 3DBLB 1HXHA 1HDRA 2X7HA 3WIDA 4R9RA 3H3FA 3KYBA 3TL3A 2E37A 1UZMA 3GVHA 1LSSA 1T4DA 2O3SA 4YJFB 5C5IA 4R1NA 3DTYA 3LQFA 4CLOA 3IL2A 2P91A 2Q3EA 1B15A 2D5CA 4HFJA 4ZQBA 1G0NA 3V2HA 3FBTA 2AQKA 4ZD6A 1NTOA 1SO8A 3RI3A 2D5AA 3GA0A 2Y66A 4WEQA 2YZ7A 3NEPX 3ZNQA 1U5CA 2V7PA 1JTVA 3H7AA 4B7XA 2BD0A 4IGEA 4NBTA 2H9IA 1HSOA 4DVJA 4Z9XA 4Y6SA 5L4NA 1W8DA 4D79A 2ZCUA 3QVOA 4W9NC 4A7PA 5IDQA 3PJGA 3CZMA 5IXSA 2J6IA 4UVDA 3IAHA 3DEYX 1ZSVA 3GZ4A 1JLLA 5TSDA 2PA3A 4MO2A 4JXKA 4XYBA 2OHXA 1ZJZA 2ZTVA 1CWUA 3VOSA 4AJHA 5F5LA 3QVWA 1M6WA 3DHYA 4E5NA 3GT0A 1ZXBA 4A03A 3L9WA 1U7TA 4FFLA 4FSHA 2W8ZA 1I5RA 1HTBA 2JHFA 2X5KO 3MCVA 2YDXA 3PJDA 4YJGA 3K96A 2X0NA 5TX7A 3VPGA 4HFNA 1O89A 3ZZNA 5TC4A 4FBGA 1TEHA 3PLNA 1I2CA 5HS6A 4DQXA 2G0TA 3VH4A 4OQZA 4MKXA 3HADA 3EZYA 2WE7A 1VI2A 3OF2A 1RM4A 4DLBA 1DJNA 2DTXA 2H5LA 4XB2A 4CR7A 2J5QA 1WNTA 4U8GA 4YAEA 3GC6A 1UXHA 4P22A 3JQBC 1O6ZA 2OMEA 3I9KA 4C4OA 3PEFA 3H8VA 2HLPA 4BNXA 4I9HA 4Q3AA 5CEEA 4YJHB 4RDHA 3M6IA 4JROA 3W1VA 5A02A 5IN4A 4J90A 3UICA 5BSHA 3NT4A 4FN4A 4GX1A 9LDTA 3H9GA 1HDGO 2J3HA 4K6FA 4Z3DA 5JLAA 2GN8A 3JYOA 3TFOA 4WECA 1W6UA 1UP7A 3DHEA 2EJVA 3ZWYA 4FPXA 3W6UA 4ALMA 3E1KA 9LDBA 3GG2A 1V3VA 4KTTE 1XDWA 4GBJA 4MP8A 4OQYA 3G79A 2IYPA 2NVWA 4IQ0A 4R5MA 4AJLA 3HFSA 1DC6A 1PJCA 1U3TA 1X7GA 1LC0A 5JAZA 3I3OA 1YVEI 1HETA 2C20A 3HB4X 4MVJP 1Q7GA 4YTEA 2CFCA 2YHIA 4CM5A 4AJEA 5IZCA 3A14A 4J0FA 3PWZA 3D64A 5HTOA 2J3IA 1NWCA 4LK3A 1QG6A 1HZJA 1E3WB 3NTRA 1AGNA 4XIYA 3AM4A 1JWAB 1R4MB 4IDFA 1HYEA 1VSVA 2QYSA 3C1AA 4DPLA 5HWSA 1C0LA 4CUKA 2WMDA 2CF6A 1XEAA 1CYDA 1XELA 4B79A 4CMAA 3FNFA 1NWHA 2VWHA 4R68A 4CM9A 3WYEA 2JCVA 4IQGA 3S2IA 1MUUA 1OOEA 3G17A 4BNYA 4OM8A 2C29D 5EJ2A 5T6BA 4J1NA 1HSZA 1UP4A 1L1FA 2YV2A 1LRLA 3PGXA 4XB1A 1ML3A 1LLUA 1I3KA 1LDEA 1BTOA 3WSWA 4ND4A 4NFSA 4MP3A 4B7UA 1FDVA 2FR1A 3P7MA 5JCJA 2HUNA 2HMVA 5ENVA 1XCBA 3KZVA 3O8QA 4RPGA 3ULKA 4R01A 4DMLA 1HLPA 2GR9A 4BOYA 3HUDA 1GYRA 2HAEA 4TVBA 3UOGA 2X9VA 2J8ZA 3C8MA 2HCTA 4KMSA 4S1VA 4ZA2A 4BIIA 5JC1A 4PZEA 3L07A 3RC7A 3D0OA 4HKTA 1PR3A 1GY8A 4M89A 3P2YA 3IJPA 1PIWA 4AJOA 2QRLA 4J1SA 4BGVA 2CVOA 4MVJG 1GPJA 5CEJA 5CPFA 3GRKA 4DXHA 1PJLA 3FR8A 4HUJA 3G1TA 2BFPA 3HN7A 1AN9A 2V6BA 2EW2A 4Z0HO 5LDGA 1Y9EA 3D5QA 3MJEA 3O9ZA 4JIGA 4I08A 1FDWA 4E12A 4RVFA 1JA9A 2ZTUA 1N1EA 3JQEA 3DFZA 1HL3A 3I9JA 4WK6A 2PKRA 4TRRA 2W2LD 1LBEA 4TZTA 4FFRA 3QHAA 1OC4A 1SOWA 2GPTA 4BNWA 1T2AA 1SOVA 1YH3A 5A04A 4F3YA 4UULA 3WGQA 3L77A 2GERA 1X7HA 1QLJA 5DP1A 1D8AA 1F06A 2G17A 2R2GA 1LEHA 3ZWAA 4AL4A 3AK4A 1NAHA 1UXKA 4E2WA 1EQUA 2O7QA 1HZZA 5CDYA 5DBGA 3L9XA 2YUTA 5EQDA 4GKBA 4FFMA 4U5QA 2VQ3A 4YA6A 4FIZA 4CLRB 1E6WA 5IDWA 5DN9A 1M66A 1W0CA 1DC4A 1DIGA 1E1LA 1QYDA 5DNAA 2PZKA 1QXSA 3B70A 3GH3A 2P5YA 3UGKA 4BS9A 5I8WA 4XD2A 4IUYA 2B36A 3GVPA 4R16A 2ZYDA 3QWBA 5JO0A 1NHGA 4IDEA 1MP0A 1WPQA 1KOLA 1ONNA 3I9NA 4GI2A 1XA0A 1DHRA 1I01A 4GWGA 4KWHA 5AVOA 4BKOA 1H9BA 5JXWA 1ZJYA 1VL8A 1LI4A 1UP6A 4NMHA 2OL4A 1NBOA 4CMEA 3ASVA 5DDIP 4CM8B 2NVBA 4HNHA 1NM5A 1V6AA 1Z45A 1M6HA 4PLCA 3EDMA 4IDGA 2B5VA 4PLTA 2XXBA 4TKMA 5T5QA 5FI5A 4ND5A 1E5LA 1O94A 2AXQA 3ZHZA 1YONA 4JBGA 3MWEB 4L9RA 4YQZA 4CM7A 3ZH2A 3F1KA 1BGVA 4KDFA 2DBQA 3ICPA 1NQAO 5K9ZA 1EK5A 3SBOA 1ZK3A 1U4SA 5GZ3A 4CLHA 3ANNA 1GZ6A 2VOEA 3DR3A 3RJ9A 4WOKA 1GYQA 4D46A 1KVRA 3TOZA 3ETEA 4R3NA 4XQEA 2C7GA 4RVUA 5JPIA 2HK9A 3NRCA 4P38A 5TIIA 2X0JA 2YYYA 3U3XA 2Q50A 1Y8RA 3TN7A 5JY1A 1HDOA 4TRJA 3VAZA 1LA2A 2VYVA 4NU5A 3ONDA 1H93A 3ASUA 3UCFA 1SEPA 5CDUA 2Y1CA 4JBIA 4KUHA 4RF2A 4DTIA 2XAAA 1JDJA 4CJXA 3B1FA 3BMNB 5A9SB 1QRRA 1N7HA 1SMKA 1K0UA 2GASA 4FCCA 4DBZA 3M1LA 2AQHA 1GCUA 2BELA 2P68A 2QG4A 1VJTA 1PZEA 4PFJA 4MVJD 4WNCA 3H9EO 1TXGA 4ITUA 4ZRMA 1PL6A 4G2NA 5F1OA 1DIAA 1B26A 3VVCA 1H94A 3ICCA 4XJSA 5F1KA 3W4KA 1QKIA 4P8RA 1O0SA 3HE3A 4FC7A 2IZ0A 4CLXA 1CDOA 3IDSA 4EJ6A 4H7PA 3RJ5A 3DZJA 4RPJA 1OAAA 2YFQA 4E5YA 3MJSA 3U4CA 1PWXA 4S3MA 4OIMA 1F0YA 4B4VA 4PIVA 4XRGA 1PJBA 3MEQA 4BO4A 2R6JA 3H3JA 3OQ6A 2EG9A 5JAQA 3GMDA 4BB5A 2VNAA 4KTVE 1C1DA 3D5TA 1XQ1A 2AQIA 1UAYA 3HG7A 4YAGA 3OJEA 4YAKA 2JD2A 3GDOA 5BSEA 2O23A 2DBVO 2G82A 1A9ZA 2ZCVA 4NPCA 4OO3A 2W90A 3QA9A 1NASA 3I6IA 2PH5A 1P77A 2CF5A 1CETA 3I9OA 3BHIA 1DFHA 4NK4A 1IB6A 4OKNA 3LT0A 3Q3CA 2JAPA 1FXSA 2FRDA 1MC5A 3NGLA 4BO8A 1EQ2A 4E2YA 5G4KA 5HA5A 4YT2A 4YRAA 4J4TA 4AJJA 1F8FA 1LLQA 1NQ5A 2NNLD 3PP8A 2X5OA 4BGEA 2UVDA 3JQ9A 1DRUA 4X54A 4LGVA 3ZW8A 5FWNA 1W4ZA 3I23A 4W7HA 1T2DA 4BNUA 1TA4A 4JX8A 4CUJA 4Y8VA 3AI3A 3DBHA 4E4YA 2WD7A 2QRKA 3IJRA 1WZIA 4HV4A 2VRCD 1XIVA 5BT9A 2HMSA 4TVOA 5DCUA 1WP4A 1OFGA 5DCYA 4J2OA 3BMCB 3WMXA 4IDBA 3BMOB 2GN4A 4MIEA 1SB9A 1YGYA 3CXRA 1ZZEA 1BG6A 4M54A 2X4GA 4NI5A 4A27A 4R5HA 2IXAA 4HP8A 4OMUA 2GDZA 1K2WA 1QYXA 4BO7A 1KVQA 1X14A 4RQTA 3WYCA 4E32A 4WNIA 4R41A 3W8FA 2YY7A 4RVGA 3EYWA 3JCZA 4UUMA 4CQLB 1U2DA 1H6CA 1XKQA 3N74A 4L73A 5G0VA 3ZWWA 1WDKA 3KEQA 3VPXA 2I67A 3FTNA 3JYNA 4A5OA 4Y6PA 5IFLA 1U28A 3AWDA 3UCXA 3AY3A 4DC1A 2CMDA 2IEDA 1Z6ZA 5LCXA 1T25A 1Y1PA 4FGWA 3V5NA 4E6PA 2HK8A 5AQ1A 3E6AA 1PJQA 1RM0A 3TWOA 1LC3A 4EEZA 5COQA 2OXIA 1YOVA 4B3IA 3ZHYA 4BMNA 3D4PA 5KVSA 2JCXA 1I36A 1PZHA 3DBVO 4M1QA 5CDTA 3D3WA 3WGZA 5B12A 5L4SA 2B4TO 2CZCA 1R4NB 3Q9UA 1MG5A 1F17A 3PHJA 3WGYA 2C82A 3WLEA 1K5HA 5KCZA 3Q11A 2NQTA 3MJ4A 2WE8A 3ZNPA 4L75A 1YS4A 2WD8A 3DZKA 3PDJA 5A03A 1ONPA 3LU1A 2GGSA 1QP8A 2UYYA 4AG3A 3FI9A 3OQ1A 1I2BA 3LSYA 1ADGA 3GZNB 3OIGA 3BTUA 4ALKA
chains in the Genus database with same CATH superfamily
5I9TA 1RKVA 3AY6A 3LNTA 2X22A 5F2OA 3AEQB 3VU9B 3LYLA 1E2HA 1QHGA 4DCGA 4WL0A 2ZYUX 1TLLA 1RM3A 3TR0A 3VDQA 3K0CC 1NV9A 2Q6VA 3GBPA 5BW4A 1PN3A 4IR7A 1N1GA 1QPGA 3BILA 4EX6A 1SURA 1GR1A 2H4FA 2VBFA 4ZPXA 1D5CA 3W77A 4HX2A 4B74A 4BRUA 2G36A 4A8PA 1Z0IA 4WGFA 1P2DA 1J70A 1VMIA 2YCLA 1T5IA 4NR0A 4X6YA 1ZNQO 2GBFA 3FWPA 5EWMB 3SJAA 1HNWB 3R9XA 1ABEA 1AH2A 3KYDB 4PX3A 4URWR 5BUQA 1EX7A 1LWOA 1ZNWA 4QNRA 1N5DA 3NLLA 1SCQA 5FT9A 2PVCA 4DBVO 4TTVA 1C30B 1WPGA 4P0QB 3C5WP 1K4MA 2JFUA 2ZJ8A 4UHFA 3PJFA 1ORRA 1VPDA 4P08A 5MN5A 1F7VA 1P4HA 1Z0JA 4EKIA 4TMTA 2B6NA 3KQNA 3WNVA 4AYWA 2P6PA 2CMHA 3I9MA 4R2JA 1S2NA 1G3UA 3QVXA 4H1VA 1PUJA 4X62B 3I61A 4B3SB 2JC3A 3HWSA 1I2ZA 4PEVA 2QD1A 4YRSA 2DCMA 2P8JA 5EMJA 1TQ2A 4O25A 4IINA 5DLEA 1T8YA 1US8B 1XX6A 2PS1A 2VH1A 3V1TC 3IT2A 4HDKA 2BI4A 3NTUA 4TMZA 5GAJA 3VO1A 5AKKA 2P2GA 2XWSA 3TQOA 2HDNB 4PLGA 3M2PA 2E48A 3DP7A 2HYDA 2ZBVA 3Q15C 4HFMA 3MGBA 3AI2A 2D0PB 4PHGA 5FOWA 3JTMA 4BHTA 4MHTA 1BD3A 1Y4ZA 2MMCA 2QMQA 4DMGA 1ISFA 2WJYA 3KLMX 3TD2A 2W6PA 4MW7A 3T7CA 5ADWA 3FPCA 4D3SA 1P4GA 2IY7A 1T36A 4D9FA 5C7IO 3IKLA 1QV9A 3WLNA 4Q1CA 3U0VA 5LN1A 3P9YA 1MENA 1NMZA 1K8XB 4GQAA 1E96A 5CW2A 5A0VA 2WWIA 2G5TA 5E1MA 1P44A 4X5OA 1KEZA 2O2EA 5KJEA 1HFKA 3A05A 1RDFA 2R66A 3A1CA 3OO1A 5ERXA 4A16A 3W34A 4Z49A 4PNHA 3TR5A 1F2UA 1LK5A 4LXQA 1ZCZA 3AU8A 3LCVB 4E31A 4A73A 5ECDA 5DE3A 3PFIA 1MAAA 3JQCA 1Z37A 3VPDA 1P75A 2QZZA 1Y8QA 3GA7A 5AXAA 1NX9A 1CXZA 3VZSA 3F67A 2PUEA 4XX0B 3DKIA 3WQSB 5AM0A 1VI5A 3F1LA 3BWXA 1E1NA 3AKCA 2LCFA 4IG9A 5CM9C 3DLBA 1Z8FA 3C3JA 4Y9UA 1E98A 2R11A 1J0DA 1KDTA 1NVMB 5KDDA 4DS3A 1QHHB 3JQGB 3SFVA 4Q39A 1LBTA 3SS8A 1YAHA 4GC5A 1NPDA 4TT8A 2J46A 5ALYA 5B1DA 5PGMA 2QJRA 4J0GA 1GFZA 2E4AA 2VDPB 4IIJB 5IARA 1J0AA 2ST1A 3KCNA 3EFEA 4JMLA 5D5PA 5LQAA 1BO6A 1HF3A 3A1FA 3NOVA 1ZISA 3BSFA 3S0JA 1W5SA 3C15C 4S05A 3HI4A 5K0NA 1YZHA 3ACCA 4YCSA 4D0SA 3CT4A 1SUDA 2X4LA 3G82C 3JQAA 5LP6A 3OE7D 2PSJA 2NO5A 2RAPA 1H6BA 3DDSA 2AG6A 3QOXA 4QXQA 3L6UA 4KIUA 2IVZA 2RGNC 3AF2A 5KHAA 2X8LA 4K9NA 4DUGA 3EEIA 3TMAA 1CR0A 3DEKA 1UXOA 1RLMA 4U9UA 4UU1A 4HNRA 4RULA 1QZZA 5H82A 4O6VA 1V1RA 3FKQA 4MVJM 1E2UA 1V7PC 4R2WA 3T7JA 2IEIA 3B1YA 5EN4A 1B0PA 5EMMA 1IVSA 3Q7RA 1KETA 3TKLA 1VHJA 1BH2A 3DE0X 3OZWA 4QFCA 1CNMA 5BMVF 2YKGA 1UCFA 4N3GA 1PWYE 2F3PA 4B0OA 3D8TA 2FPGB 3QKUA 5JY6A 4N0DA 3WRWA 5B1EA 4IL5A 1RJ9A 4EA7A 1HE3A 5C2JB 4N0QA 4G36A 4RKEA 3UMJA 4L4XA 3P4UA 2HEIA 4DV5B 2WA1A 3DBRA 4NJMB 3FPJA 3HU1A 4XWYA 3MINB 2A9QA 3VSBA 1HNZB 4I9GA 4KQ1A 3ICQB 4N7BA 3KALA 2Q3MA 2Q21A 1KI7A 4HNAB 4PYMA 4B3RB 1P0FA 1Q84A 1QVVA 1CERA 2NSHA 1Q1QA 4PE5B 3CYFA 1T9ZA 3UFXA 1T1GA 3MOGA 3ZCUA 1SHUX 2I6SA 4NIMA 4MRVA 4PINA 1T3GA 3F9CA 1Z5ZA 4PX2A 1VA4A 2IZZA 2JJ8A 1MEJA 5FQOA 3NBYC 4EG7A 4E5PA 4M1EA 3OM1A 2C2KA 5G53C 3T9BA 3LZCA 3I9LA 2YYSA 3MRXA 5E6RA 1WP9A 2G77B 3L7DA 3N6RA 4MSUA 1U3FA 2ORVA 4HLDA 1XA3A 3HKCB 1OBCA 4QBFA 3WO1A 4ZFNA 1LBSA 1IOZA 4UW9A 1SKBA 4P34A 4ZT3A 3Q6IA 2J30A 2ODWA 2CDRA 3E5NA 1YB1A 1Z6TA 2C5SA 3ZXIA 5CVTA 3IA7A 4U2EA 3HA2A 1LZKA 2ACEA 4NBSA 1FVOA 5CA0A 1WCIA 4GUAA 4H1UA 1RE0A 4ZHQF 1NAIA 5KWIA 3UCEA 4DR5B 1PW7A 4EZIA 1KSGA 1IEXA 4MUFA 5TPZD 3ZZUA 4CMIB 1OAOA 3TQHA 4IM7A 3I32A 4LMBA 5J4KA 3RYHB 1YB2A 2XOKD 1DX9A 3QKTA 1XZ8A 3IS3A 4GM1A 4NPAA 3LBHA 2HDOA 2UV8A 1PTJA 3HDTA 4NCJA 2FG7C 1Z0UA 3W2IA 2Z5LA 4O2LA 3RO7A 5LQMA 2IX9A 5ALLA 4QATA 1SVMA 4JOCA 1ZH2A 5ALTA 1N2BA 5F5NA 3VSDA 1G20A 4D99A 3F6BX 4DHEA 2VA8A 4EG5A 1CULC 4RSMA 1E66A 4RLSA 2OBBA 4M9UA 4MUMA 4YNBA 5C51B 3C98A 4R3WA 3BL8A 3I8SA 1MXHA 4M8SA 3T34A 1LPAB 2Q49A 4ALIA 3VMFA 4YRMA 4Z7OB 2Z2YA 1OR8A 4TV9B 4GEGA 2FQ1A 2V6MA 4ZGGA 5ILOA 3HHPA 2VVTA 2C54A 2OHHA 4XQ0A 1DSSG 2O1SA 3OMLA 4PN7A 1JJIA 4NBWA 2E0IA 8ADHA 1O4WA 3WHPA 3I1FA 2BFFA 1J1IA 1A9TA 1P1CA 4P9NA 1M74A 2C4VA 2O4CA 4BQSA 1VIAA 3OPYA 3A04A 3G5MA 3N2GA 4CKYA 3AEKB 3KIPA 4C7OB 2I4TA 5IYZB 1NRWA 2QDXA 4HK4A 5ELMA 4OLAA 4FI3C 1QIMA 4MCHA 1L6IA 3ZE8A 4BKRA 1NVGA 1ULUA 4X7BA 1U9ZA 4FEEA 1Y7LA 2F1JA 3TE7A 1DQYA 1NR5A 1QE5A 3F7TA 2CXRA 3AT1A 2OCLA 2XW6A 4TLLB 4A0HA 1WBBA 4WA7A 4Y2SA 3WDMA 5C5CA 2PZGA 1OLUB 3R7FA 3U62A 2O54A 1TF5A 3E8XA 3B2EA 1UT6A 3DGFC 1U8TA 3QTLA 3LP5A 4NQZA 1UWVA 2PZEA 4DVGA 1W4LA 4C2UA 4MVJF 4YLGA 1T6NA 2WM2A 1E1QA 4PC7A 3LS2A 1YHNA 5HVNA 5DNEA 2H1VA 2ILVA 3WMGA 3S81A 1L7BA 1CY6A 1PHPA 4JJFA 2EIHA 2C9BA 3F49S 4RCVA 4Y0VA 3TLKA 4EYEA 1VGQA 3LBAA 4AG6A 1TW2A 3BHNA 5BP7A 4N9QA 1Y82A 2GD6A 2C94A 3LE8A 3QBJA 4MGZR 5AHWA 3RWMB 2BSXA 1OJ7A 4WVLA 1V5EA 2RHTA 2XVYA 4PLWA 3T3EA 2BP7B 3UTDA 1NG9A 1LJUA 4QFDA 1O8BA 4LTMA 4UBLA 1T9DA 3RKSA 4L8GA 4C3OB 3SQWA 1WB9A 1E4OA 1KEUA 2OFOA 4K9RA 5A1JA 5IM4F 1AIPA 3F3SA 4QU8A 4UZSA 1W44A 4S1PA 1HORA 1K6IA 3AB8A 3L05A 1JQBA 1MTZA 3FI0A 3QVMA 2CKDA 1II8A 2HBQA 3ASZA 1TD1A 3W5CA 1UINA 4N5MA 1XR3A 1NM5C 2VZLA 3KEOA 3O4RA 5CTAA 2F9MA 4Y0NA 3KKLA 2OUIA 1WW2A 5H1YA 4HSGA 4B2IA 3FB4A 1UBGA 3QELB 2C07A 2X40A 3AFNA 3HKBA 2VDLB 1HLDA 3QE2A 4TYPA 5EE1A 4Z0PA 3V6MA 1EVYA 3DWFA 3MTEA 3QBDA 3WLMA 1ZL0A 4B6FA 5A5FA 2YC2C 3EVBA 2B35A 3EBLA 1GPYA 4HEA1 4QVKA 4ZARA 4X24A 2FDXA 1EZ4A 4RVCA 1M1ZA 3U3RA 3UB3A 5HQTA 1RMQA 2B83A 3BZWA 3O0TA 4LKRA 1LPSA 4ZDJA 3ZJ4A 1P80A 5HMMA 3BL5A 5JJLA 1KAQA 3PLRA 2AFVA 1S2LA 3DO8A 3FTCA 4Q21A 1TI7A 4Z7JA 1B00A 3ENKA 4N18A 4QGAA 5ECYA 1U9IA 3ADPA 4EA9A 1ZMXA 2R8EA 1X8LA 3PLAE 3W4JA 5EINA 2C95A 1NJGA 3ESBA 3FDZB 5F4BA 4OP2A 5IN5A 4KI0A 2TYSB 1PFGA 3N58A 4JLAA 1ZRMA 3BIXA 3CPEA 5HKLA 4G09A 4JI3B 1T1RA 3B1JA 4QDTA 3NHAA 3QUTA 1JDBC 3KLBA 4IWYA 2JFHA 3VR3D 4YRTA 4L85A 3ZHBA 1EFTA 4L57A 4E14A 3JSAA 1XCOA 1JI3A 5C4MA 4CEJB 1DARA 1E1YA 3F4KA 1V11A 3L1KA 3ND5A 4Z7QB 4YBRA 4E6EA 2PKQO 4J7XA 5HK8A 3SJ7A 3WOVA 1X7ZA 2JCBA 2BEUB 3FPHA 2QE7A 3OX3A 2XQJA 3BB4A 2D5IA 3BXFA 1CW2B 2XNCA 1N8NA 4DDVA 4B6SA 1G17A 1PFYA 1GEEA 4LGYA 2I7DA 1SD5A 1TO2E 2HMUA 3ZIUA 1L7MA 3AXSA 4B2PA 4XX0A 3EWSA 3BDIA 3T9EA 4JJGA 5JRJA 2IEBA 3D43A 2QZ9A 1CY2A 3GGJA 1DZ3A 4KXVA 5CXXA 4AJ4A 3SX4A 3N28A 4IMRA 1QHHA 1UBUS 3AF5A 3F5MA 3H2BA 3ON5A 2HJWA 3TQCA 4GZMA 5BRJA 3QIVA 3P0EA 1Z12A 1SCIA 3PPXA 1FC0A 1NE7A 1X1CA 1X39A 3GYGA 4U9HS 1B8VA 4FR5A 2M6SA 1IAVA 1NW7A 3OCCA 1QLHA 2GN1A 1Z15A 1D6MA 2X13A 2ZJ5A 3DFUA 1KZYC 3DFFA 3EJWA 3W2EA 4CM4A 3RVPA 1C4KA 5TEWA 1M0WA 3OKPA 4KEAA 4QOJA 1OVMA 1GD1O 4OQEA 3FUCA 3PTZA 5JPDA 1D2EA 3SU8A 3GMSA 3E7WA 1NQOA 2XOEA 3C1TA 1EX6A 2BMAA 3ILXA 3MVEA 5DM1A 2DB3A 1FLAA 3GXBA 1XPUA 3SYRA 2HN9A 5J47A 3P97A 1ND6A 4A26A 4YJFA 3C70A 3RNLA 1AGXA 2C5EA 4XLTA 4V0LA 1XRSB 2VSQA 1M73E 4RY9A 3K9WA 2ZQYA 5FORA 4RPHA 1KZ1A 2OECA 1U2EA 3B7PA 1XTIA 1E4EA 4QELA 3WQBA 1QU3A 2ZRHA 4EI2A 1H05A 1RFLA 3H97A 5K3OA 1FYVA 3ZJYA 1C7QA 1CJTC 4XI9A 5T6MA 1KK3A 3U3OA 3VNBA 2GZAA 1ZCAA 1SU7A 2VDKB 1HV8A 3PNLA 3FCEA 4JJ8A 5JQWA 3E82A 3TQTA 3PNYA 5K4HA 2LTAA 3TCKA 3D4LA 5EJEA 5TE9A 3RKUA 3MW8A 3P4XA 1YR8A 2QAJA 1FJHA 3R7DA 1QQ7A 4TTTS 1PVOA 3ESXA 2D4HA 4YAWA 1D2NA 1A7JA 5AT1A 3CMMA 1NL3A 2IDMA 4WK2B 4JC4A 4BQPA 3FYCA 4XJTA 2AMLA 2GVDC 1YE3A 4JSTA 3GUVA 2FNAA 1YR7A 2WJ4A 1LLCA 4QLAA 1YVPA 2H2FA 4YRBA 4DABA 2D8MA 3G9XA 1NBAA 1P9OA 2X0DA 3R3SA 1ORHA 4YR9A 3C8ZA 5FPSA 5E4TA 1TA9A 2PMDA 3T1OA 5AW0A 2GZHA 1L8AA 4KFTA 4KBYA 1J99A 4JEIA 4WIAA 3R3VA 1JAIA 4BRZA 3NWJA 3ZLBA 1VLQA 4E30A 1JBQA 3K71B 2B1QA 2AS0A 3AG5A 2VJKA 1F4PA 3PZRA 4Y6QA 3PPVA 1N6KA 1POXA 1VM6A 5C32A 4J94A 2C3MA 4ISCA 1MA0A 2WUWE 2G4VA 5JSZA 2V4ZA 2ZOSA 1DO8A 3V7FA 3DLCA 4O2AB 1DEHA 1CZLA 5KHLB 3MYYA 5BSMA 4MWOA 1S0UA 4AWBA 3TG2A 1CRPA 5ER6A 1HO3A 2JBAA 5I45A 1RE1A 1U2DC 1Y48E 4R3UC 2X58A 2ATCA 5CDHA 2B69A 4Q7QA 3CPHA 4H7KA 4DEXA 4NJOA 1VPVA 4ZO7A 3UWMA 3NDRA 2YZGA 2OHFA 2R7KA 1X6VA 2NTNA 4G5SA 4J91A 2B5WA 2QX4A 3U13A 1J97A 3KB6A 4LRSB 4XLLA 3TS1A 5AKEA 5EKTA 4E5UA 3RFTA 1AKUA 1QVZA 4Z54A 3UXMA 4EEXA 1MU0A 3CIOA 3THXA 4YJHA 1DT3A 2ZE8A 2NVUB 2H3HA 4FOSA 3AZQA 1JVSA 1ELOA 1H6DA 1SG0A 1W1IA 1E7SA 1SXHA 2BAGA 2QP4A 2YVUA 1L4NA 3C3YA 4DQ0A 5HBRA 1OKKD 3OHSX 4DYVA 1BSVA 4GMKA 4MQ4A 3JQFA 2FUCA 3KVVA 3V00A 1BXGB 1Z62A 4WBSA 4P4UA 5BNFA 6CHYA 3QE9Y 2WFLB 3BK7A 1TAUA 3EEOA 3AEKA 3IURA 5EWLA 2IV2X 3TLZA 4P3PA 3WICA 2VUTA 3K09A 1GQSA 4MDFA 3OZDA 1INLA 4YDRA 1RPTA 4HDOB 5JDIA 1P0MA 3AH8A 5IUKC 3T7EA 5JC8A 1CRZA 3DNPA 1GA1A 2XSZD 4JSYA 5FJIA 2GK6A 4DANA 2PPVA 2AFIB 1D2RA 1Y5RA 2R6AA 3GGPA 4LCEA 2ZRCA 2P77A 3GAFA 5HHTA 3ZS8A 2OK8A 2XE8A 2I4RA 2Z4SA 1LRJA 2CL0X 2PRJA 3CEMA 4DMUB 1R5BA 3RGGA 1QIDA 4GF5A 1BOFA 4ZPJA 4ECEA 4OHXA 2P90A 1GNVA 1EX1A 3ESYA 3ET4A 4WA8A 1FMTA 1HMPA 2D5LA 3K0FB 4PXAA 1DRKA 2Z9BA 3TW8B 4KX5A 3I9V6 4TROA 1KI4A 2ZRNA 3HZZA 4A0FA 3B3AA 4CLOB 3NHZA 4EHFA 1OIWA 2PSDA 3WMWA 1I2MA 3MTGA 3N8NA 4GX0A 1N92A 2JI7A 3BCUA 4TRNA 5GV7A 3S70A 3SZOA 2JLVA 4MKHA 1RRGA 1PL7A 2LBPA 2NZWA 2O1WA 2ZE5A 3D3JA 1ZINA 1KDYA 2WKPA 2JCSA 3HVIA 3CRNA 4PLVA 4P36A 3DVRX 3CLSD 2QIPA 5THKA 3JD4A 4HSEA 1ENYA 4Q9NA 5HS4A 4UUOA 3DJFA 3ZV6A 2IQ5A 1GL9B 1D4OA 3L4BC 4LBYA 1ZM3A 4W8OA 3I2IA 1Y8ZA 3OZCA 2JJ1A 2B0JA 2XD4A 4UXHA 1T0HB 3U48A 5FTJA 1QGZA 2PZ8A 1V1JA 2JGFA 4UOEA 1IOVA 3DD1A 1RZUA 3A27A 1YIAA 4NPHA 1E92A 1KQOA 2Q6TA 5DTIA 2CMFA 3QF7A 1JPVA 3JWPA 3ETGA 3FFWA 5EZYF 5CB4A 1SWWA 5J5VA 3OTQA 3TXXA 2PSEA 4G89A 3UWSA 2J3JA 3ZV3A 2C3PA 5LD2C 2AYZA 1O9HA 2IHUA 2MIIA 2QU7A 2V6JA 2X0RA 2NT4A 2ZTHA 4YUVA 3U49A 1KS9A 4XM1A 5C52B 1XZEA 2VQSA 3D6FA 3NBQA 4AICA 4C4TA 4YCLA 2JFZA 1FL9A 3QKRA 1U0HC 1ZWLA 4P3NA 3PX2A 4XTCS 3U3JA 5FR2A 5LKAA 1FNNA 4Z4EA 2CHVA 2O07A 4MDYA 1HH4A 4GL2A 2FLVA 1V8ZA 3VKFA 1G8HA 3TZBA 3I2GA 3C39A 1Q0HA 3D8NA 3QVKA 4W9MC 3KAKA 1AV7A 1R3UA 3LPDA 4BO6A 3TNLA 1RWVA 2R6HA 3NM6B 3C48A 4P6VF 5F77A 5IRCD 3D54D 3KLNA 4L8VA 3WGNA 3ZYCA 3IP8A 3RUPA 1JB9A 2DJIA 2D2IA 4UOQA 2PJDA 4EHLA 3ZE6A 5EJ5A 1I1QB 3TF5A 2GXAA 1NPTO 1G6HA 1TE2A 1DKOA 2FVYA 4GH5A 3BD6A 4H0NA 4X1OA 1W93A 4MAMA 1K8QA 3MBIA 5CH3A 1PX2A 4RZ3A 4ZV7A 1T2UA 1OH6A 1IQPA 2G25A 1NXVA 2PWYA 2WVAA 3C5VA 1QNLA 3F9IA 4W5HA 4EY3A 1QCCA 1QVRA 3FSGA 1NXQA 1AKWA 1GKUB 4JUAA 1Z22A 4B3DA 2QRZA 2XIQA 4FYXA 1MLDA 2D7JA 3BZBA 1L7RA 3RRJA 3ZWMA 4EMUA 1GXSA 2FY8A 4KXLA 2A3NA 1MCZA 2FZCA 3GCXA 3JWEA 4OUKX 5CXSA 3USZA 1BXZA 2O3UA 1BHJA 2QTAA 3I2KA 3Q2OA 5HJ2A 2VQ6A 3HYLA 3RRZA 2E6KA 3WK6A 3RF7A 1ECLA 2ZIXA 2IPLA 3NAQA 2XNJA 1OX6A 4JCOA 5DPMA 4DSTA 5H9WA 2WK1A 3NC4A 2VH5R 4K05A 3RIYA 1I30A 1KJ9A 4GLFA 1N8KA 4HB3A 5L3QB 5GIPE 2D7DA 2KW5A 5BW5A 4EQ6B 4C87A 2B6HA 1O57A 2UZ1B 3GA5A 1KAOA 2ETVA 2XMGA 3HB1A 5F5XA 4C3ZA 1YO6A 3VC7A 3H5NA 4IDOA 4BCDA 4MQEA 1YI8A 5BSWA 3N6VA 5DCWA 3VZQA 4HQOA 4MI9A 3RROA 1UBRS 5IKMA 2JIZD 2ZRIA 4PFSA 3HUEA 1V2GA 4L15A 4U6NA 3A28A 4EHHA 3VR4D 2Y71A 3WRXC 6ABPA 1I6KA 1RQ7A 1FVFA 1QV6A 2ZLBA 3QP9A 2FWMX 4K2AA 1P8JA 2JH3A 3TLYA 1XRRA 1JHQA 2CY0A 3DB1A 2VHCA 3NS7A 3DTVB 4YCDA 4KRGA 4DRZA 5AVJA 3CO0S 3NFYA 5JS7A 4AYXA 3NANA 4OHCA 2RE8A 4Y0AA 4FCTA 1XP5A 2FKNA 1X7WB 2N9UA 3AUJB 4DPKA 4XPIA 2VEOA 3BBLA 1OYVA 5DHAA 4R54A 1J0EA 5HZMA 4LF5B 4MICA 4O63O 1NUSA 5LNK1 1ZI8A 3GFPA 4I8IA 3MWEA 1L4FA 1IHYA 2PUTA 4U2CA 4DSOA 4QOIA 3O2NA 2YJZA 3T3IA 3QJ5A 1YDEA 2FW7A 2WU4A 3AYZB 1T6XA 1CUSA 3VOBA 1L5YA 4YGXB 1NR7A 1PJZA 3R4CA 4HXGA 4OQQA 1KYIA 5ALGA 4NU6A 2J45A 1SEVA 2ISQA 2B4QA 3K0AB 3UK7A 3A1DA 4A36A 2PQ2A 3HPQA 4ANFA 4L5YA 1JPJA 3LX8A 5JNWA 4HZUB 3EX7C 2AG8A 1RAGA 3PF9A 3A3OA 1M2VA 5AO9A 9ABPA 3TDMA 2HGZA 4DLTA 4M99A 4ETNA 4S24A 1PGQA 4CE6A 4CDGA 1X1BA 1D6NA 3D7KA 4PSUA 1BC5A 3A4VA 3P0FA 2PCLA 2CCGA 1NNUA 4DR1B 3NNNA 5AI4A 4EVQA 2WYWA 3OMXA 4PAGA 2BISA 1QAMA 2EJWA 1NYRA 4Z6KA 2Q5CA 3LTNC 2W7TA 4MW5A 3TQIA 3GEDA 3O95A 5ITVA 1W4AA 2W2MA 3B52X 3L79A 1D0IA 3DFKA 1SNYA 3E0QA 4IIJF 1GSOA 2FG6C 5B58T 3ZCXA 1GG2A 2GRJA 3Q7SA 1QS0A 1ISIA 4MGEA 4EKYA 3SYNA 3UH1A 2W2QA 5BY2A 5JBIA 3PD1A 4JYBA 1YBVA 5CHYA 5D01A 1PQ4A 3HCBA 3FOBA 2ERYA 1P17A 3KEGA 4WWHA 3RJZA 3ICVA 3R9WA 3P32A 3KVYA 4TL8A 1YZNA 2WUEA 5A9SA 3DKRA 3SX0A 1UJBA 3CVOA 3GJRA 1T26A 1ZM4A 4CEIA 1JR3A 1ST2A 2WTNA 3AHDA 3H5VA 4HT3B 1WMFA 2A7XA 3GFGA 2Q5JA 3T95A 1QB8A 1W9HA 1UXIA 2OOSA 4ER3A 1KMQA 4N49A 1JV2B 1E3LA 2ZRLA 3B53X 3KTAB 2W6NA 1KZHA 2O57A 4WXRA 2Q0XA 4OGLA 4RTPA 4V0SA 4MW1A 3H0KA 3S8YA 3OQMA 3BGOS 3C85A 3DUFA 3IEKA 3ILHA 2QLJA 4A6PA 4KQ6A 4Q1VA 3HN6A 3FM9A 3QH4A 4LVCA 2A0WA 3U4HA 3TTSA 5CLLA 1EFHA 2H2WA 3LT4A 3ZQKA 4KHZA 3SOPA 3WADA 1ZONA 3O6VA 4IDHA 2P8SA 3ZWPA 1BXGA 1KY3A 1Z13A 3P19A 3B89A 3KTDA 1J49A 3WJAA 3I5YA 1KIMA 3RJMA 1L4YA 4XQ9A 2AV6A 4KRFA 4J6EA 1M33A 2IDJA 4DJDC 3TGPA 1WM1A 1R0ZA 2G40A 3FWZA 3GOQA 4FFPA 4IFTA 4L6CA 1FDTA 4GWLA 3G9TA 3KUXA 4ZQCB 4QJ3A 1NF3A 4B2YA 1SZCA 1FX0A 1ZC4A 2GUGA 3BH6A 3GLIE 5FBVB 2FR8C 3UTCA 4F60A 4LJYA 3FLAA 5MGNA 3B82A 2ZRQA 3PXCX 3P96A 5IKXA 1O1YA 2BJWA 4PBSA 4YJ3B 1EA5A 4I3GA 4B1FA 3KVRA 1ZXXA 3N2NA 1X8JA 4CCWA 4BDSA 4EKNB 1LDGA 3RC2A 2LV8A 1G8YA 3LH5A 4MAFA 5EIOA 3PI7A 1QQ6A 2NZVG 2C4KA 2PK3A 3TW8A 1VLMA 4C4XA 1Z75A 4D92A 1DAEA 3DLHA 1WUHS 1NVTA 5B53A 1ONOA 2R00C 3OAAD 4M7WA 1QRTA 2GXSA 4N5IX 4GXQA 2PT9A 3FYUA 1K3UB 4P3XA 5CAEA 1M1YA 1KSFX 2OHIA 3E7PA 4GOLD 2DQZA 4WBNB 1ZOPA 3R23A 3QG1A 1H1DA 4HYQA 2HWKA 3RSHA 3MQFA 3TDNA 3IT3A 4NU8X 5HKKD 2WP0A 3M5WA 1JYSA 4O4HA 3MSCA 3WYBA 3O8OA 4L4SA 3H0EA 3ZI7A 3IQHX 3ITNA 3AUUA 5LZ7A 2Q1XA 4HY3A 3D1VA 3ZE7A 1P7WA 4DDTA 5L3VA 4A4DA 3GD7A 1XLVA 2WRZA 3OCWA 5KKAA 3BK1A 1DBQA 1NNEA 2QEQA 4MMYB 2PX0A 4RV9A 1UJ5A 2NAFA 2Q4OA 3EOZA 1ODFA 2J3QA 3VZBA 3WBKA 3KLOA 2EHJA 3NWEA 3P45A 4Q00A 4TV9F 3MD0A 1WHSB 2GTHA 2P7IA 3CO5A 2VJMB 1JFFA 3IUJA 3KSUA 4P3YA 5AHKA 4BLPA 2NACA 1GHTA 2IDZA 3EXHA 1M1NB 4Q3OA 2L17A 3EGCA 3LPMA 3U60B 4S1WA 1CJUC 1A5TA 1VL6A 4RHFA 4BMVA 4NZOA 4DCSA 1JDBB 4JC8A 2YHUA 4YQYA 3C8DA 3D6NB 3L7KA 3DONA 3QYJA 2E6UX 2ZWPA 3IT0A 4JL8A 5CH5A 4K9OA 5AP9A 1E6CA 3GT4A 1Y8RB 3E48A 1YMVA 1P8AA 4TLMB 3RE1A 3RVRA 4CL3A 2GLXA 2WYIA 5ICEA 3MK31 3ZWBA 3Q7QA 2OBXA 3VC1A 2HK7A 1MH1A 3H1GA 4KK3A 1T1IA 4DLYA 5A5GA 2AW5A 5EJ4A 2A5DA 1P33A 1MOSA 2H06A 2UVPB 2EDCA 1X1EA 2VRBA 5I7RA 2Q9AA 4BGUA 4NZNA 1C9JA 4JH0A 4F3NA 1XVLA 4D5GA 3NT2A 3I1YA 4RQUA 1PJSA 4QUEA 3V34A 1AHPA 3T3OA 1XHFA 2YWDA 2QPAA 4AMUA 1BQEA 1C2YA 4BMDA 2K4MA 1A5BB 1CLUA 3GPBA 3VHQA 2A78A 4MLDA 4PTLA 1BRMA 2VYNA 5GWXA 1P2FA 4TT3A 1YOBA 3CFYA 2CB9A 4FSDA 2JLBA 4QUBA 5J3JA 1UMBA 4FONA 1O08A 3A4TA 5K8UA 4I5GA 1WVGA 1WOYA 1BH6A 4XKJA 1NPYA 2ET6A 4R1PA 3M6XA 4C89A 4DWVA 3HVHA 3KBBA 1SC9A 1XVTA 4H0CA 2VAVA 1TUBB 4HWSA 4JSRA 4WCFC 4E94A 3H2JA 1C7ZA 2X8JB 3L92A 1D4FA 3NP9A 4EATA 1WA5A 3WBFA 4Z4CA 1TTTA 2I87A 4CTOA 4ZI7A 2OBLA 1QFYA 2FP4A 4BQFA 5HW0A 5LOVA 1JJFA 3QFSA 2OO5A 2H2HA 2VK4A 4WVFA 1IBMB 3OFJA 4H1TA 1OH8A 3Q4GA 4Q34A 1HKUA 4QTUB 1QH8B 3GZNA 4CIBA 1C1HA 2ZJ0A 1TEZA 3R6WA 1E2JA 1BS1A 1HURA 1I14A 1LB1B 2HA6A 2P62A 2MHCA 2VN8A 3BERA 3EXFA 3S2FA 1YSCA 1FNBA 1B1CA 2IXBA 4FW9A 4GLBA 3L8GA 4JA0A 2GF0A 5LMNB 5T64A 2R7AA 4LJ7A 1R0YA 1HPLA 3NHFA 3OPVA 3V9AA 4LRTB 3VTZA 4I99A 4KNWA 3ANMA 5JD6A 3H1TA 1QU2A 2CLSA 2DPYA 3FA2A 4BNZA 3LO8A 3R7WA 2HCJB 3GLVA 1GGEA 4KSYA 5CBPA 3AGQA 3RAFC 3PQ7A 4ILEA 4CKEA 4D8TA 4NJEB 5FFMA 5G4KB 4JJ4A 4F9FA 3A2NA 4I0WB 1UM9B 3KV3O 3LZ6A 1OTXA 5BNTA 2WWYA 3QSGA 4JYCA 1ENPA 4MHSA 4CMEC 1GCGA 1P7ZA 4PO1A 3DTVA 2IYZA 2W93A 5H81A 4JFAA 3ISVA 4GX2A 3S7TA 3DBHB 4KPGA 5KTMA 1D9ZA 2EFHB 5KYXB 1QC5B 5DYYA 4YPOA 3SDZA 4QO8A 5I5GA 5LZ5A 4ZV4A 3SEFA 1UJ6A 3WIUA 5DI3B 2C2OA 2C1ZA 3OJCA 1DXHA 1HDCA 2I76A 4DY4A 4MMZB 2D0OB 2WTBA 5ALEA 4FLFA 3F46A 4H08A 2D06A 5F4ZA 3G49A 2VDNB 4IBOA 2C03A 4P98A 3HKDB 4GYKA 5JEEA 3HTXA 3NKFA 5JISA 3L3BA 5I9BA 1Z7GA 3CIFA 3HH8A 1PLKA 2WKSA 4EF5A 4M1ZA 4HZUA 3VU0A 1H5UA 1ABFA 1XMSA 2VLBA 4LE0A 5TT0A 2HTEA 4E88A 1JJ7A 2L2QA 2GPNA 2PUHA 1PGPA 2BFWA 2H1IA 4QYMA 3UAYA 3H8WA 3PBKA 4JLSA 2P4SA 1GQRA 3OLCX 1C3OA 3S2ZA 5A0FA 1T4CB 1OLXA 2ZK7A 5FPPA 5HJ5A 1ZMBA 3O82A 3C6XA 5U4QA 1ZOIA 3RTBA 3SXUA 1YK0A 3IJ5A 4POOA 1NNLA 2NU8A 1T5LA 2P5TB 4PIPA 4FQ8A 2BMEA 2F48A 1DXOA 1H5QA 3DHWC 4OUDB 4O4IB 1T5SA 2DPGA 2F4NA 3KZ1E 5HFJA 3V8RA 2AOUB 1YVDA 1LSOA 3UJ6A 3BD8A 2F6RA 3WIBA 2ZRAA 1V3TA 3O1HB 2CVFA 4P92A 2QRNA 8ABPA 5IWCA 3CUSA 5JMOA 2D2VA 3EIFA 3ZDRA 5CM8B 1XRJA 4TQGA 3D0KA 4C3VA 5M34A 4PCUA 1KPGA 2ZB3A 4MJXA 5MFZA 3LW8A 1HRDA 1ZOLA 3MXTA 1JMYA 1E7MA 4N01A 2ZIUB 2R0QC 3D31A 3CUWA 2H1OA 3AEZA 4C06A 4WESB 3LA8A 1A2KC 1JYFA 3DEFA 2HT1A 2Y0EA 1P7PA 4FR0A 5TRTA 1YC5A 3DXZA 2BEJA 4HLNA 5FHQA 1QYWA 1QIFA 4RANA 4BQIA 5ITZA 1JALA 1GZ3A 4MWZA 2DE0X 2Y1EA 1IPHA 3ONFA 5CX1A 1GPNA 1HM5A 2Q5HA 4MB0A 4X63A 2P9GA 1T1EA 2PBZA 1P18A 3CKKA 4QQNA 1ZVQA 1TFRA 4ZDKA 1BHQ1 1ZH8A 4Z7NB 4EAQA 3LBNA 3OZEA 3WMEA 2UXBB 1I6LA 2EKQA 5DJ5A 1HOXA 4IX9A 3VHLB 2IZOA 3WNDA 5K6TA 2VATA 3RHTA 2JD0A 5KOYA 4N03A 4QL3A 3L7JA 3UHAA 3CVYA 4E51A 4WACA 3VAYA 1XF9A 3LYUA 1S4QA 3FCXA 3ONEA 2C78A 2FHPA 4MS1B 5IVDA 1EVLA 4CMHA 1T3HA 3W6OA 1GFSA 2I1LA 4FKZA 3H2KA 4G0VA 3KQWA 3F3KA 1DAFA 2ZJAA 4YJ3A 1OZAA 4MA0A 4R8VA 5EJAA 5JS1A 2IK8A 3LUAA 4MQ5A 4RETA 4PS1A 1I5OA 3ABOB 2WYHA 4BV3A 3HB7A 3PHLA 4MGKR 1SFRA 5AI9A 3CNNA 3ZVKA 1T0BA 2ODBA 4BJ1A 4UNPA 2SICE 5LYJB 1MC8A 1EFDN 4N3CA 3B1KA 3K3PA 3KKNA 2R8YA 3KU4A 4CLEA 4NABA 3JYHA 4BE4A 2ZWMA 5KQGA 2J48A 5DHSA 4XGKA 3JARB 5LD2B 1Z2DA 3D6JA 4O2AF 1DCTA 1WUYA 2G80A 4LY3A 4PQEA 3LV8A 3OQBA 4ZREA 4LOKA 3EOAI 2I4OA 4Y6LA 3TSOA 2Q62A 4KVZA 1U8FO 3PGJA 1RTTA 2NO0A 4ZICA 1G21B 2OXFA 4HJRA 1BXRB 4F5WA 5HM8A 2CJWB 4KNVA 3MT0A 4RM3A 4RLFA 4OGGA 1MIOB 2PXHA 1Z7BA 4PC2A 1AB5A 5LA6F 4MIKA 4UCQA 3K9GA 4KDEA 3VJMA 3I1IA 4ODIA 3VR6A 3ZKAA 4ME6A 3I72A 4F4FA 3TZ6A 2JCYA 2VHUA 1PUXA 2QIOA 4KREA 2H0AA 2MR6A 3ABSB 3KSDO 2ODTX 5TQ2A 1IB0A 1ZOSA 1KO8A 2FOIA 5KX5B 2FSFA 1PP4A 1BN6A 3FGNA 1Z5VA 2EKLA 1F6WA 2YV5A 3OOYA 3M0EA 2JS7A 1P2BA 4KQCA 1EVJA 4NBVA 2ZI3A 2QXUA 2YVQA 4WDQA 1W73A 3T5TA 1OFTA 3D6UA 1GRQA 2REQA 3M4ZA 1BWQA 2Q4TA 5HCNA 4DCTA 2JATA 5FPHA 2IHBA 4WOPA 1JDUA 4KAJA 1RBYA 1TGYA 2CVQA 3FHJA 3U4DA 2B7CA 2IZ5A 4RVSA 3OHMA 4GI1A 1CG6A 2NYVA 1OZHA 2ESRA 3C87A 5BWOA 5EJ6A 3BHMA 5JO9A 4KO4S 5EUQB 5C8DA 2EFDB 5CVJA 4KYUA 4RVDA 2Y99A 3H2SA 4IXTA 4IWNA 3L01A 2I6UA 4XE5A 4ZV9A 1BROA 1P4SA 2XCTB 1X0XA 5ES3A 2WVHA 3OJWA 3GCWA 4INJA 2QSJA 4JJAA 4WZBB 1DQZA 2VSFA 3PDIB 4LXUA 1EAYA 2IYRA 1CY4A 4PTYA 4QODA 3RSSA 2H9YA 1NURA 4DGQA 3OSUA 1RZRD 3CTMA 1H0HA 2W8BA 2WOJA 5ALJA 5C31A 5L95A 2J33A 3I83A 1JTFA 3K16A 3GLHE 3S29A 3T38A 3H9QA 4ZCIA 2OBYA 3HHEA 4IVPA 2X8JA 3O7MA 1CIVA 4QFBA 5FTKA 4EUHA 4DA6A 2O7NA 4OKIA 3TBHA 1IQUA 4HTAA 4PHHA 4K1LA 4DTCA 2LDBA 3TZQA 2KI5A 5J1SB 5ITSA 3O7WA 3THYB 1YA4A 1ZMRA 3SJZA 4N48A 3I8XA 2CSUA 4UEKA 2B61A 3MAAC 3OJ0A 3C97A 2RK4A 1XNGA 3CMCO 3NHLA 4OJTA 3VH2A 3FSRA 3NAMA 3F0TA 3DPUA 3RYCB 3ZU6A 1VL0A 4LYHA 6AT1A 1U7ZA 3AKEA 3E81A 4P5PA 1YDGA 4H4CA 2P2SA 4UQPA 2VJBA 4WY2A 3RBZA 5CCXA 1W4BA 1E7QA 2HDHA 2KSQA 5M5BA 1TYAE 1T5TA 4J9VA 4YO7A 5FUYA 2CXOA 4K26A 3GQVA 3RU2A 4BNFA 4H15A 3A1NA 3WWOA 2Z8ZA 4A0SA 2FHSA 4M8NE 4JQCA 2J0QA 1G3IA 3ETCA 1K6JA 4TYYA 4NJEA 3N2IA 4D8UA 4Y7DA 1U99A 3DZ8A 4MRAA 1ISPA 1M83A 1ND5A 2DLDA 1DQRA 4M8IA 1ZA2A 3PQ8A 1RZ3A 2X9NA 4L4YA 1NN0A 1LS6A 3OKAA 3F8TA 4PAMA 4E5DA 1MRSA 3AEUB 2XOXA 4OD0A 3ZY3A 3F7NA 4ZYYA 2DFVA 5ED4A 5DWDA 1B14A 5JV5A 1FTQA 1PK7A 3BREA 2ZAYA 3KPVA 5E8RA 4UTPA 1A8IA 1QO0D 1UJCA 3IXQA 2JFFA 4JS0A 2GZMA 1TTQB 1ZKMA 2C2BA 1P1IA 3K72B 4FGSA 3ZCVA 1OXXK 1SPBS 4BX9A 1MVLA 3M82A 1KYWA 2GTPA 2V8OA 3FX2A 5KWVA 3LI2A 1XD8A 4B33A 3AUTA 4JVMA 4YUZA 2IWRA 3ZGYA 1JPUA 5BV2P 1DWPA 4IXWA 5JALA 4BXOA 2IXEA 4PGHA 4XJVA 3NFRA 2NTVA 3H99A 5EVJA 5SY9A 4EUKA 1NJ2A 3O75A 3PQFA 3EW9A