1XDWA

Nad+-dependent (r)-2-hydroxyglutarate dehydrogenase from acidaminococcus fermentans
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
331
structure length
331
Chain Sequence
MKVLCYGVRDVELPIFEACNKEFGYDIKCVPDYLNTKETAEMAAGFDAVILRGNCFANKQNLDIYKKLGVKYILTRTAGTDHIDKEYAKELGFPMAFVPRYSPNAIAELAVTQAMMLLRHTAYTTSRTAKKNFKVDAFMFSKEVRNCTVGVVGLGRIGRVAAQIFHGMGATVIGEDVFEIKGIEDYCTQVSLDEVLEKSDIITIHAPYIKENGAVVTRDFLKKMKDGAILVNCARGQLVDTEAVIEAVESGKLGGYGCDVLDGEASVFGKDLEGQKLENPLFEKLVDLYPRVLITPHLGSYTDEAVKNMVEVSYQNLKDLAETGDCPNKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for stereo-specific catalysis in NAD(+)-dependent (R)-2-hydroxyglutarate dehydrogenase from Acidaminococcus fermentans.
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Oxidoreductase
molecule keywords NAD+-dependent (R)-2-Hydroxyglutarate Dehydrogenase
total genus 120
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.-:
pdb deposition date 2004-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xdwA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xdwA01
1YB5A 2VNSA 2HSDA 2YHIB 4DC0A 1VI2A 3MCVA 2X0IA 3R3JA 4Q3AA 3NT4A 3BAZA 5KVSA 1DHTA 1ENYA 5EINA 3TDKA 1EFKA 1ARZA 5KCZA 2X8LA 1Y1PA 3NDRA 5U4QA 1AGNA 5EJ2A 3TZ6A 1W4ZA 4BNUA 3C7CB 1FMCA 4MVJH 4DQXA 4PLFA 2Q1UA 2ZJ0A 2DUWA 2OUIA 2PTGA 1T25A 1HDXA 4RPKA 4IGFA 2UAGA 5JNLA 1JKIA 5B12A 3MZ0A 1ADFA 2AHRA 3E8XA 1RJWA 1NFFA 1PL6A 1LTHR 2Q1SA 2Y99A 2Q2QA 4NQZA 3RFXA 4FFRA 5L45A 3PJFA 2JD0A 1JA9A 4UAGA 2IZ0A 4II2A 9LDTA 3I4CA 4CLHA 3WJAA 3DFUA 3H3JA 2V6FA 1KC3A 4MP3A 1EE9A 3DXFA 5C37A 1FDSA 2Y93A 1IOLA 4WUVA 3TZQA 5B1YA 1HWYA 4RDIA 3VZPA 3ZV5A 1RWBA 3HN7A 1R37A 1H2BA 1WZIA 2DBRA 2J3KA 2BMAA 4JJFA 4XKJA 4BS9A 2H9IA 2HRZA 1F0YA 5LCXA 4RVDA 2TMGA 3BHIA 4TSKA 2Y1DA 4EJMA 5AXAA 5BSGA 1P1FA 2DQ4A 2OGUA 2B35A 4YRBA 1XLTA 1E1MA 1L7DA 1MC4A 3FR7A 4IM7A 5B4VA 3HN2A 3ICPA 4R54A 4L76A 4I08A 5EMHA 1S7CA 3QVTA 4DGSA 1PZHA 4ND4A 3K73O 4WLUA 4RVGA 4RO0A 1E7YA 4UEKA 4E32A 4MVJI 3LVFO 4XGIA 1PZEA 3WGOA 2BGKA 4J7UA 1T26A 1TI7A 3ZDFA 3D0OA 3QWHA 1UP7A 4JROA 3KSUA 3VVBA 2VYND 1JN0A 5KJEA 3FHLA 5DZSA 1YB1A 3E1KA 3MTJA 5HA5A 3DMYA 1Y8QA 3IP3A 3VPSA 2GZ1A 4JNKA 3DHNA 4IIUA 4M55A 3OECA 4L4XA 1HDYA 3NKLA 3OETA 3GDGA 1IPEA 3HNPA 3RUIA 3T7CA 4CMKA 2IODA 1Z7BA 4XIYA 3W4KA 4OH1A 4DBZA 1NR1A 4R5MA 4CM8B 3RBZA 1K6JA 3ZU2A 1LC0A 3HB4X 3CZMA 1I01A 3PRJA 3PQEA 4D0RA 3CMMA 1DLJA 4KUGA 1E3WA 3ZWOA 1E3EA 4EBFA 1J49A 4GVLA 2BFMA 1T2EA 4INAA 3DMTA 3ABIA 3NGLA 4BO1A 5I9NA 3ETDA 3KOUA 2I9PA 2QRLA 3K92A 4TVOA 4XB2A 1K0UA 4IXTA 3ZHXA 5A5EA 2X22A 2G5CA 2LDBA 3E9MA 4OOEA 3FNFA 2I76A 3M1LA 4TRJA 2EEZA 1A5ZA 1R4MB 3Q3CA 4XD2A 3VVCA 3HE3A 1QYXA 3HADA 5EERA 1EMDA 1VM6A 3BHJA 4OQYA 2VWGA 3K8ZA 4J2HA 3NTOA 2Q1WA 3U4HA 4R1UA 3PQDA 2O3JA 3JCZA 5ENVA 2NVWA 1KETA 3VPGA 4J4HA 1CETA 1HLPA 3EUWA 4O59O 4JBHA 3FNHA 4OMUA 1C0PA 5ES3A 3AI2A 5JW6A 1U2DA 2ZK7A 3V2GA 4Z3DA 2UDPA 5BR7A 3DONA 3ENKA 5B37A 1SPXA 2EKPA 2RHRA 3JQAB 2FN7A 4U5QA 1FF9A 3E18A 2VT3A 4U6SA 5TS3A 4OAQA 3O9ZA 4P22A 1VJTA 1YDWA 4HNGA 4S3MA 3GGPA 1LSJA 3M6IA 1C14A 4BNIA 1UDBA 4E30A 2P91A 5KWEA 3W8EA 1FJHA 4WOKA 4B3HA 4IS2A 2YQ4A 4LVUA 4D0SA 1YH3A 4DMMA 4LVCA 2JFGA 2WMDA 3O8QB 1B3BA 1M76A 4YT4A 3S1LA 1Q0LA 4CQMD 2F1KA 3Q1LA 3GNQA 1NP3A 5GY7A 3GZNA 1CIVA 2G0TA 4KTTE 4NFYA 4R16A 4RF4A 4RF5A 5DBIA 2EW8A 4I1IA 3BMQB 2ZTLA 4H15A 4I9NA 2HUNA 5DP2A 3PHJA 2FY8A 1NPYA 1R0LA 2NTNA 4R9RA 2GYYA 2D4AA 4E2XA 4Q3EA 3VH4A 4MINA 2E37A 1XU7A 3I9NA 4GGOA 4PG4A 3DDNA 1CRWG 2E4AA 3VTFA 3WSWA 1NPDA 1NQAO 1AXGA 1IUKA 1U3UA 2EV9A 2GN9A 5JCXA 2NADA 2ZYGA 4M1QA 2ILTA 4AJPA 1GEEA 1I10A 4IDAA 4IGEA 4OM8A 1GYRA 1O6ZA 5FF9A 1BSVA 3QVOA 3GT0A 1RKXA 2DLDA 1LU9A 4CM4B 4HNHA 5L4SA 3TZCA 1ISGA 3OJLA 3P7MA 4TVBA 3K6JA 5EL0A 2AQHA 3GEGA 4HX5A 4ND1A 4ZQHA 1ISFA 5G2OA 4Q3CA 5K6AA 1XIVA 3HDQA 3RFTA 4DWVA 4XR4A 4JX8A 4L75A 2I67A 4CLXA 3PWZA 3N74A 3DTYA 4NFHA 3TJRA 2W98A 1MG5A 4H16A 4URFA 5CG2A 4LSWA 4FD3A 3LLVA 1G6KA 2YUTA 1J4AA 1F8FA 1HDZA 2DTDA 1SZJG 3BTVA 3PXXA 1YRLA 1C0IA 5FI3A 5TGDA 1V9LA 5F1KA 1FDVA 4ZQFA 3H8VA 5HWSA 4FJ1A 1NVTA 1YB4A 4ZRNA 3V2HA 1T2FA 1DJQA 1J0XO 1PR9A 4QXMA 5COAA 1PQWA 5K9ZA 3L9WA 1N2SA 1U8FO 1YL7A 3M1AA 2HK9A 4GLLA 1U1IA 3GPIA 3AFNA 1IE3A 2ZB7A 1UJMA 5DF1A 1ADCA 3DZFA 3A14A 1V8BA 3F47A 2RCYA 4WASA 1TXGA 1PJBA 4EYEA 4PVCA 1UZMA 2XXBA 4BIIA 2O2SA 5CDUA 3W8FA 5K6AC 4W4TA 4R69A 3OMLA 3WFIA 4AJLA 3VH1A 2PLAA 4B4VA 3WGHA 4OJNA 4CV2A 1U4SA 3IKTA 2NWQA 3DZIA 5MGBA 2V6MA 4BNGA 1EVZA 1LDGA 2IZ1A 2VNAA 4XGKA 1P45A 1C1DA 3ASUA 3EY4A 1EUZA 1GCUA 1UP4A 2HK8A 1NPTO 3ASVA 2EG9A 1OI7A 4AJJA 3VDQA 4Z0TA 1E3WB 2GN8A 1PR3A 3TZHA 4GX2A 1TLTA 3SJUA 3VH3A 1BGVA 5BSFA 4M8SA 1QSGA 4H3VA 4R41A 1I3KA 4ZRMA 4MVJM 4F46A 5A3VA 2AE2A 1K89A 3Q11A 4IDBA 3W6ZA 3AW9A 3HSKA 2QW8A 1Q7BA 4XA8A 2NQ8A 2FOIA 2WM3A 2BGMA 2IYOA 3OEYA 2J5KA 3ROKA 1T1SA 4D45A 4FQ8A 1DBVO 1A27A 5BNIA 1UXKA 3E6AA 4BNNA 2D3TA 3F3SA 3GNSA 3Q0EA 3LDHA 1WWKA 2NTVA 4M89A 4MVJG 3H2ZA 2O3UA 1XHLA 1O5IA 2PV7A 3H6KA 3IOYA 2EJVA 2I3AA 3GN1A 3KV3O 2ZB8A 3WIEA 1HF3A 3JD1A 4GKBA 2PZLA 2D5AA 1ML3A 4J3FA 5F21A 4JLWA 5TT1A 4B7UA 3V1UA 2OBYA 3ZV6A 1SO8A 3OJOA 2PKQO 5JYEA 4MKXA 4CMEC 3RC2A 4WLVA 1ZEJA 3JQAA 2G82A 4RL6A 3QVSA 4LMPA 3B1KA 1MV8A 1U3TA 5F5NA 5DN9A 1VSVA 3GVHA 4HBGA 4WECA 4J9UE 2P5YA 3AUTA 1U28A 2HMUA 2EERA 3FI9A 3PJGA 5A04A 2HMTA 4R1TA 1OMOA 3OQ1A 1HYGA 1NAHA 1YXMA 3F46A 4B8ZA 4BO4A 4JP2A 5L4LA 3ITKA 3ANLA 1QMGA 4IPTA 3RU9A 3K5PA 2OXIA 3RUHA 3IMFA 4YTEA 3FPCA 2I6TA 4RVUA 5I7EA 1V3TA 2GRAA 4BO9A 3L6DA 3L4SO 1SMKA 1RPNA 1DDOA 1EQUA 5T8KA 2C5EA 4YR9A 4L9RA 4ALLA 4MIYA 5L95A 4XIJA 1KVRA 2H5LA 3FTNA 1PTJA 1LSUA 1LDMA 1NX6A 2FR0A 2X5KO 4CLOA 5I9LA 4OKNA 5T8KC 4JJGA 2BF7A 1VC2A 1FK8A 1OAAA 1KC1A 2C54A 3OP4A 5LDGA 4EITA 4BGEA 1YVEI 5DCWA 4BL5A 5ICMA 2YJZA 3WB9A 3OA0A 1HYEA 3G1UA 3PHIA 4DRYA 5AXDA 3KVOA 4PLGA 5COBA 2O50A 4OQZA 5IZ4A 4CM5A 1HE3A 3HB5X 1EEHA 2O4CA 3I9JA 4J49A 3ZWAA 4EW6A 4AJ4A 2B5WA 4W82A 4MOWA 3DQPA 3FCOA 5KKCA 2JKVA 3PHGA 2NVBA 4R51A 3B6ZA 4W7IA 3K31A 4L74A 1LRJA 1BDBA 3ANNA 1JWAB 3K9QO 5IN5A 5ENDA 1QLHA 3ZWYA 4B3IA 1XG5A 2NNLD 2C2XA 3G79A 2AE1A 4CLRA 4MDHA 4J2OA 4NBTA 5A9SB 4UUMA 3WG9A 1IPFA 1I30A 4EJ0A 2W4QA 5JFOA 1R16A 4PN3A 2VWPA 4CM6A 1IY8A 4JP3A 2ZCVA 3GMSA 5MDHA 2Q49A 1GEGA 4K26A 1LRLA 2EKQA 4E2YA 1KVUA 1XA0A 3ANMA 1CDOA 3T4EA 4G2NA 3EHEA 5A03A 2ZIZA 1E3IA 2JD1A 1E1LA 3E9QA 2PA3A 1MXHA 2PH5A 2CDCA 3GZ4A 3DHYA 5G0UA 3JQGB 4OGWA 3RC7A 1K5HA 5JPIA 4PVDA 4UULA 3EDMA 2ZTVA 5TF4A 1KYQA 4BNKA 4BNWA 4D41A 3IAHA 3WS7A 3HUDA 1XSEA 1NVMB 1DEHA 1H93A 1MGOA 1DC4A 2PY6A 3DAPA 3GVIA 5CDSA 1YJ8A 5ITWA 2FPGA 3IQDB 1Y5RA 4NR0A 4NPCA 1U7HA 2OO5A 4GKVA 3I52A 4BB6A 4N5MA 3BYZA 4Z6KA 3I9MA 4CMHA 4BKPA 3UICA 5ILOA 2C20A 2CUKA 1C1DB 4I5EA 3RU7A 4QEDA 1QYVA 1O9BA 4E5MA 4E5KA 1LDYA 1D3AA 4DLBA 5JCJA 4YJGB 1X15A 2V7PA 5TQVA 4AICA 1W6UA 1GZ3A 1A9ZA 4FW8A 5A5FA 4AJIA 4Q9NA 3SJ7A 4KQXA 4PFJA 1IZ0A 3U9LA 2W2LA 3PDUA 3OICA 4U7WA 3GMDA 2DKNA 4K28A 2QRKA 3QHAA 3FWZA 2QIOA 1QORA 3CSDA 5T6BA 1YO6A 2JCVA 2VYVA 4CV3A 2O3RA 3U4DA 1FXSA 2FSVA 2VOEA 4IIVA 1EK6A 4WNCA 4WCDA 1QYCA 1OFGA 2P68A 2I5PO 3PIDA 2P5UA 1I2BA 1G0OA 2Y0CA 2ZQZA 3DZHA 4YWJA 1M2WA 1E7MA 3JQDA 4R3NA 2O7QA 4N7RA 4HKTA 3B1FA 1WP4A 4GX1A 3RAJA 1KY5A 1PQUA 1YQGA 3WLFA 4BKOA 4R4JA 3KEQA 1PQPA 4J43A 2OZPA 4R5HA 1BXGA 3K2EA 5CDGA 3FD8A 1E5QA 1F8GA 2VN8A 3PEFA 3UGKA 5U1PA 2DC1A 1E92A 3RUCA 4HFRA 3U0BA 3D3WA 5C7IO 4PG8A 4MP6A 5IZCC 3PYLA 3GG2A 4W9NA 5EIOA 1UZNA 2AG5A 4PLPA 3V2UA 2GASA 4MVJF 5GMOA 4YAKA 4IS3A 1U9JA 3NT2A 2I3GA 1UXGA 3I1JA 5JAMA 1DIAA 1NHWA 2DBZA 3LQFA 3ZHBA 1CERA 1H6DA 3GG9A 1I5RA 4GX5A 4OL9A 5IJZA 1PJCA 4XX0A 4PRLA 1DIHA 1P1RA 4XEHA 1LQUA 1QRRA 4WPGA 2PD6A 1TT5A 4PIVA 1X13A 4MVJD 3PK0A 4QSMA 4HFMA 1SEPA 3BMOA 5G0VA 1EVIA 4KWIA 5G4KA 4CUZA 1UZLA 4B4OA 1ZJZA 3ZU5A 2O4UX 4RLSA 3ZV3A 1JVSA 3JD3A 4O1MA 3GHYA 3NGXA 5HS6A 3W8DA 3GUCA 2HAEA 3G17A 5CEJA 4GPD1 1ONNA 4GAEA 2WSBA 1O0SA 3VPHA 1H9BA 4XYBA 1A7AA 2WWRA 3LC1O 2J5QA 4KZPA 4J0EA 3B1JA 4AG3A 2X58A 1DPGA 3KLMX 3RWBA 5T57A 3IJPA 1LLDA 1N9GA 4ALJA 2BHLA 2Q50A 4ONEA 1N92A 3WX0A 4UUOA 1Q0HA 2O3TA 2NU8A 4BNHA 4DL9A 3WYEA 4BB5A 4O5OA 2P4QA 4EZBA 3JD4A 1NAIA 5DOZA 3D7LA 3WFJA 1PWXA 2VOJA 2A35A 2FPPA 3DC2A 3LU1A 3KYDB 5DP1A 3ZWNA 2CVOA 3GVPA 4U0KA 1HT0A 1A72A 2OL4A 2VCYA 3EGOA 4G65A 4NJMA 1HXHA 3OJ0A 5AXBA 5JDIC 1MP0A 3BXXA 1NFQA 4JGBA 4E21A 3DEYX 1ISHA 2YW9A 1MG0A 4TQGA 2VHZA 2P4HX 2OHXA 5HRUA 1HETA 3UCEA 1QP8A 4I8XA 4AJOA 1PZFA 4U6QA 4CQMB 3LK7A 3ONDA 1IYZA 3T4XA 3ZWBA 5DNAA 1P1IA 1X14A 4RV9A 3RQSA 1AUPA 3DBLA 2O2YA 4J1SA 1BVRA 4QECA 2GF2A 1VPDA 3GEMA 4ZHSA 3BIOA 2D1YA 4NBVA 2WTBA 4IQ0A 3GRKA 4ID9A 1EE2A 3Q9UA 4GL4A 2EXXA 2EIHA 5THQA 1H9AA 4ZD6A 3ZNQA 4K6FA 2OP1A 3ZCXA 3I9KA 3MJEA 3IKVA 3KHUA 2OBNA 4YAGA 1T4BA 1Y81A 4FDAA 4O0LA 2C82A 3DHEA 3KZVA 3DBRB 1HE2A 3KSZO 2ZYAA 3GY0A 1V3UA 3VZRA 4Q39A 4LCJA 1A7KA 4WEQA 4TMFA 4ZVVA 4RPLA 3H3FA 4RDHA 4CMBA 1SB9A 1NXQA 3AUSA 3GF4A 2E49A 2QZ9A 4M86A 4DIBA 5JY6A 3ZNOA 1NQ5A 1B8PA 2WYWA 2Y1CA 4RCVA 3P2YA 1DIRA 4H7PA 5TJHA 4PCVA 2Z1MA 1O89A 4CMJA 2PFGA 1R15A 1KERA 2X5OA 2Z95A 3WBBA 5TT0A 4X54A 4AVYA 1IHXA 1I8TA 1Z75A 2JD2A 4RGBA 1DIGA 4R1SA 5TC4A 4BNFA 1GZ6A 2PH3A 3JQGA 8LDHA 1A4IA 4ALIA 3RKUA 1VRWA 3O38A 2PZJA 1Y5MA 4XWYA 1UXIA 3B20A 1A9YA 1FDWA 4YJHB 4CMIA 3I3OA 1X7GA 1W0CA 4ZJUA 2FR1A 1LDBA 1V3VA 1ZK1A 2X9GA 3DAGA 5FI5A 3JV7A 5JYDA 4PG7A 3ROQA 4JXKA 2HRBA 3EC7A 4BGUA 1ISMA 2CVQA 1LLQA 3PLNA 4RPHA 3GGOA 4Z9YA 5TX7A 3OF2A 4YJFB 5JDCA 4FSHA 1MC5A 1XEAA 2HDHA 4PLVA 1CQIA 4Y9DA 5IDXA 3ONEA 3ZU3A 3GFGA 5DCYA 4M49A 1BW9B 1XWFA 3JQ7A 1PJTA 2VUTA 1P0FA 2E48A 4FFPA 1RYDA 4ZU3A 3ZWVA 3JSAA 3FBGA 3GH3A 5G0TA 1YQDA 4A7PA 3OA2A 1BHSA 3GN2A 4UVGA 5F1PA 2NU7A 2PD4A 4XGNA 1YWGO 2WE7A 4WJZA 4YQZA 1YQXA 4IINA 4ND5A 4TROA 3OJFA 3TFQA 3AY3A 4Y6RA 4KOAA 3H5NA 4LK3A 3F6YA 3K2BA 4UREA 2WYVA 3IL2A 2HMWA 4E5YA 1T1RA 2Q46A 3C3XA 3TOZA 2GR9A 4J0FA 5ER9A 5KIAA 4NNJA 2HCTA 4B79A 1LC3A 3O03A 2G76A 4YYZA 1JW9B 1N8KA 3DBHA 3PIIA 3TQHA 4YRAA 2QQ5A 3E9NA 3MEQA 3COSA 5EQFA 3KB6A 5KJCA 4IZHA 1U2GA 1YGYA 2O7SA 1H5QA 3CTMA 1X0VA 4QFDA 3KEOA 1DLIA 5CFZA 1P1KA 1PGJA 2PNFA 4FBGA 3OFSA 3CXRA 4YACA 4F6LA 4GWGA 9LDBA 3PWSA 4D3SA 2IZZA 3X2EA 4CL8A 2ZB4A 4FJ0A 1W73A 3CKYA 4MKRA 4NI5A 5L51A 4XJTA 2BKAA 4J7XA 1B26A 2B4RO 3KYDA 1GU7A 5A9TA 1DRVA 2YQ5A 1PX0A 4GI2A 1BRMA 1ONOA 1KVQA 2Z1NA 3DB2A 1GY8A 4CM8A 2FZWA 1MLDA 4PG6A 3GVCA 3ZNNA 3S55A 2GD1O 2IRWA 2YV3A 2WEKA 3A06A 3ETEA 4G5HA 4LRTB 4BOYA 1EFLA 4QT0A 3I6IA 4CQLB 3LT0A 3L9XA 4EUHA 4A03A 3EVTA 1Q1NA 2EWMA 1YJQA 3AI3A 3C85A 3GDFA 4EEXA 3I9LA 3LC2O 3I83A 4J91A 5GZ1A 5JO9A 1YOVA 1ZEMA 3NDJA 1LUAA 4DIFA 3UAGA 4OHUA 1P9LA 3INTA 3RUAA 4CLEA 5IDQA 4B4WA 1V35A 1K3TA 4D3FA 2B5VA 4E2ZA 3HZZA 2FMUA 2VYVD 1ZXBA 2AEMA 4AJNA 3FWNA 4BHTA 4E5NA 3SXPA 1DO8A 2DBQA 1HKUA 3SX2A 3E82A 1F12A 3BZUA 3KBOA 2UVDA 4J4BA 2O3QA 2R00C 4WOJA 1UXHA 2ZYDA 2DFVA 2V6BA 4BV9A 3GAZA 1B15A 1O8CA 2AQIA 3ULKA 2VWQA 4I5DA 2Q3EA 3NTQA 1WMAA 2QHXA 4FOSA 1W8DA 3WQRA 3Q2IA 5HTOA 5G0WA 2X4GA 3U49A 4EDFA 2CVZA 2CMDA 1DIBA 1R12A 4CMCA 4IQGA 2GN6A 3RI3A 1HYHA 4N5LA 3NAQA 1D7OA 5JS6A 4ALNA 1J6UA 1F17A 4RVHA 3W1VA 1Z6ZA 2RAFA 3X2FA 1HTBA 4YAJA 3GLQA 3CIFA 3ITDA 1LNQA 1LDEA 3QA9A 1WDMA 1YBVA 5AVOA 4NK4A 4YXFA 4CR8A 1SC6A 2GSDA 2J3HA 1MFPA 4IMRA 3VPXA 3NT5A 1X1TA 3JQCA 4GGPA 1KS9A 4QO7A 2JCXA 4FFMA 3RBVA 4NBRA 3VKUA 4DIOA 3AK4A 5G4LA 3ZWXA 3DOCA 4JIGA 5F5LA 1UUFA 2P9CA 2DU8A 2Q4EA 4HY3A 4KP7A 1E7WA 5DBFA 5F3RA 4HV4A 4HXYA 4YJHA 4CMIB 2GZ3A 3FR8A 3EW7A 3RJ5A 4WCFC 5C7LO 3KRTA 1B14A 2FRDA 3BMQA 4WLEA 2B83A 3L6EA 4PGFA 1LBEA 3HG7A 3GAFA 2O23A 1E3JA 2OMEA 2CDAA 2OFPA 2PGJA 2VUSA 4FGWA 4IJVA 3JYOA 2BLLA 4PLHA 4ALMA 5CEFA 3GQVA 1WNTA 1Y8RA 2NSDA 3I23A 3WGGA 1JAXA 1B16A 1I2ZA 1I24A 1N7GA 2POQX 4TZKA 1KBZA 4FOOA 1U3WA 4XJSA 3D4OA 1MUUA 3ICCA 3LZ6A 1V6AA 2AXQA 1EQ2A 2FWMX 3IJRA 3ADPA 4J1QA 3PYMA 2VHVA 1NWHA 1ISJA 3JQAD 4OXNA 1YE3A 3FNGA 4NIMA 4ZQEA 2DTXA 4XQCA 4A73A 2SCUA 3DOOA 3DBRA 5H83A 1YBAA 5I7VA 2EP5A 4D43A 5BT9A 4DYDA 2BFPA 1I3NA 2WD7A 4FJ2A 3H9EO 3HDJA 4P8RA 2ZCUA 2BH9A 3E03A 3L77A 3LF1A 4KWHA 3IDSA 3A28A 5I7FA 3Q2KA 3ROPA 1N7HA 2C59A 3QY9A 4YPOA 2R00A 3DBHB 3PGXA 3BHMA 3RCBA 3LT1A 3RD5A 2TMDA 2X0RA 3SLGA 1O95A 2W90A 4BGVA 3LYLA 3S2EA 4BNJA 3JQFA 3JYLA 5JSFA 5JC1A 2GNAA 4BNYA 3VDRA 8ADHA 1ORRA 5B4UA 2DPGA 5DDIP 3U5TA 1X7HA 2VQ3A 5F1OA 5IDWA 3G49A 2IXBA 3TL2A 3GUYA 4BKQA 4FIZA 5BSHA 5JLAA 3E5MA 2P2SA 1P74A 4YCAA 1C1XA 4HFJA 1PS0A 3HWRA 3STHA 3PTZA 1GDHA 1I33A 3L4BC 1AHIA 3ZZNA 4I5GA 2D2IA 4IDCA 1EBUA 1H6AA 4Z0HO 3DZJA 2D0IA 3ZH2A 4ROSA 1XGKA 2J6IA 4ZN6A 3C1OA 4F3YA 1GPDG 3JQBA 4FPXA 4IZIA 1YONA 3PYXA 4D46A 3QVWA 5G0SA 5JCJD 5BNFA 1DHRA 1BW9A 4IY1A 4ITUA 5CAEA 3OQBA 3DAFA 5C3MA 2VUUA 4J9VA 4XB1A 4B7CA 1EVJA 1R0KA 5IG2A 3RC9A 3V8BA 3WIDA 2DBVO 2DUUA 3PLRA 5ADHA 1YOVB 1CJCA 2Q99A 3JYNA 4A2CA 1FDTA 3R1IA 5LC1A 2Y1OA 3VPFA 5HBRA 4F45A 1IL0A 3R0IA 2YYYA 1SB8A 1LLUA 3QWIA 2ZKLA 3PVZA 4NDNE 3WYBA 4BUCA 3O26A 1NQTA 3SVTA 1GFSA 3WTCA 4I9UA 4DUPA 4YAIA 4EUEA 1H94A 2W2KB 1DRUA 1GAEO 2GN4A 1PSDA 4E5PA 3KYCA 4HADA 4UEOA 3S2IA 1RYEA 1VJ1A 4WCFA 3F5SA 3VOSA 4AJ2A 1KY4A 3D5QA 4DPKA 2JJYA 3LF2A 3UHAA 5ICSA 3EMKA 3W6UA 1ZK4A 3VKVA 4RQTA 3WXBA 1NR7A 4E2WA 4GH5A 1U8XX 3F4LA 1VSUA 4BV8A 1VLLA 2W8ZA 3RBXA 4CLRB 3G1TA 3INRA 3WGIA 3C24A 3D4NA 3OM9A 1JKJA 4DLAA 3HFSA 3W4JA 3L07A 4ZICA 1SEVA 3QLJA 2ZTMA 4BMSA 1Q7CA 3FF4A 4MIEA 2BFOA 1EK5A 2FZEA 1P1HA 4KTVE 4OSOA 4CUJA 1BXZA 3MWDB 3D64A 4KDEA 4RF3A 5JO0A 1KIFA 4AJ1A 2PZKA 1Y9EA 3FTPA 1UXJA 3CPSA 4CLDA 1E0DA 1PEDA 3DBVO 3V1TC 3KLPX 4KUHA 1EBFA 1PL8A 3WWZA 4RF2A 1GQQA 3QIVA 4E13A 3EVNA 1ID1A 2WDZA 4ZQBA 1TVEA 3MJCA 1IZ9A 2QG4A 4OXKA 3RFVA 5IF3A 3WGTA 1M67A 2YZ7A 4C4OA 4LSMA 2AA3A 2P9EA 4BGIA 4XYEA 4BMNA 2IEDA 3DR3A 1HDGO 3AJRA 4CLOB 1Y8RB 5JAZA 3BMCA 1H6BA 3A4VA 4IDGA 1LX6A 5TNXA 3C7AA 4CMGA 4LMRA 3EZLA 2VYNA 4LW8A 3OHSX 5C7OO 5ITVA 1E7SA 2FSSA 3DZKA 2NV6A 1ZUD1 2XXJA 2HQ1A 4Q3NA 4O63O 5TLSA 1E3SA 3MJSA 3AU8A 4PZEA 1GV1A 4TWRA 4K6CA 1KEWA 3QVXA 2VRCA 4CM9D 1TEHA 2Y1EA 3D1LA 3QSGA 1T2CA 4IDDA 4BVAA 3H5RA 1YBMA 1SNYA 5LDHA 1DAOA 4A0SA 1ADGA 2BI8A 4D79A 3RC1A 3R3SA 4CM9A 2VRCD 1DXYA 4MJLA 3PWKA 5KJFA 4PLTA 4DMLA 1JVBA 1ZK2A 2EJWA 4E6PA 3P5SA 4J1TA 1NASA 3RROA 2O48X 2WD7B 3U4CA 4P38A 2DT5A 2X5JO 3IC5A 1UDCA 3ZW9A 3C8MA 3IUPA 3KO8A 1R4NA 2EHDA 3GVXA 4YA6A 1KEVA 5JDCC 5L9AA 2C0CA 1BDMA 3HJAA 1J5PA 4CR6A 1PGNA 1ZMTA 2WD8A 4GSKA 5AXCA 5FFFA 4DLLA 1XYGA 2UUPA 1NWCA 1JU9A 3HQ4O 3OIGA 2NVUB 1BXGB 2R6JA 3ZN2A 3KSDO 3VH2A 2NLOA 1AN9A 4D42A 1R0SA 1E6UA 4J4TA 1JTVA 1QV6A 2YHIA 3JQ9C 3QWAA 4QQRA 3KETA 1Y8QB 2JCYA 5JAIA 3DZBA 3H7AA 3AY7A 1R66A 1GL3A 2V6GA 3ON5A 5L3ZA 4WKGA 3LT4A 3NRCA 3ZWMA 4BQRA 1QXSA 3B70A 5KVCA 1I2CA 1Q7GA 1DFGA 2Y0DA 2DPHA 4DC1A 4WLOA 5IXYA 3S8MA 2ZTUA 3TOXA 4BO0A 3PGJA 1PGOA 3H4VA 1E5LA 4Z3KA 2AMFA 6ADHA 3WNQA 5FYDA 3O4RA 5DBGA 1EUCA 3DTTA 5KNLA 1ZZEA 3E5RA 4W7HA 4OXYA 2BRUA 4B3JA 1Z7EA 5TRTA 5T64A 1P77A 2RHCA 3QWFA 4YAEA 3ZHYA 2Y05A 3ZI0A 1KEPA 1CQJA 4RPGA 2PD3A 1GQYA 3VC7A 3PDJA 4UVEA 1ENZA 3BMOB 2WE8A 5KVQA 2EGGA 2FR8A 3BTOA 4CM3A 1HLDA 5CP8A 1MXFA 2D5CA 5I8ZA 1DJNA 3G0OA 3SC4A 2HLPA 3UVEA 4CM7A 3MOIA 2Y66A 4QX6A 3CE6A 3JQFC 3AOEC 2X9VA 3KTDA 4EUFA 2XAAA 3H65A 7ADHA 3WGQA 3NYWA 3UW3A 1NFRA 1K6XA 2W2KA 2RBEA 3IUSA 1Z73A 1IHYA 4YQYA 5KKAA 5IXSA 4Y6PA 4RQUA 4IJWA 2Q2WA 3VHRA 4CM1A 2QZZA 2HKIA 5CG1A 2A92A 3P19A 1XKQA 3D4PA 4IUYA 1JQBA 2EKLA 3RUEA 1N9GB 1JWBB 2Y67A 3NDIA 3OQ6A 3ZU4A 4DPMA 4WE3A 3GNTA 4XDZA 3ST7A 1DC3A 2PKRA 3NV9A 4E0BA 3UFXA 2R2GA 3A1NA 3BTSA 2X6TA 4WNIA 2VHXA 4HP8A 1OBFO 5CHEA 1OC4A 2JHGA 2FPIA 4CJXA 1P0CA 1YL5A 3OIDA 2A4KA 1M66A 1LEHA 1B7GO 2Q4BA 3F1KA 5AOVA 3WYCA 4GMFA 4L73A 1T2DA 1HRDA 3KXDA 1EUDA 2BELA 3PHHA 1C1XB 4XYLA 2XF8A 1QV7A 2EP7A 3GGGA 1NBOA 1WMBA 1DC5A 4GQAA 3AI1A 1ZMOA 2ET6A 1ZSYA 2O3SA 5GZ3A 4II3A 4NU6A 3AU9A 2Q2VA 4PZCA 3EK2A 4GWKA 4CQMA 1SAYA 3C1AA 5L7YA 1KVSA 1QLJA 2GDZA 4N54A 4OIMA 4C7JA 1L7EA 1AHHA 1GUYA 3ETGA 4BO7A 4ESOA 2NM0A 1ZK3A 2JFFA 1WPQA 4BO6A 1ZW1A 4DBVO 4DXHA 3BMCB 3JYQA 3RSHA 5G4KB 5A4DA 4P4GA 1I0ZA 1T2AA 3H5AA 5TSDA 3GA0A 4XZ3A 4UVHA 2IYPA 4M54A 2X0JA 4CR7A 3GFBA 1Z82A 4PLYA 1B3RA 1P33A 4CMAA 4DYVA 4U0JA 4LN1A 3UF0A 3TL3A 2XPCA 2AEJA 2ZATA 2ZJ1A 4CM4A 3JQ9A 5I7SA 3NTRA 1Y7TA 2A94A 2YDXA 3G3EA 5L7TA 1MA0A 4C7KA 4CPDA 4Y6SA 4HUJA 1ZVMA 3JD0A 4YEDA 4P4LA 7MDHA 5U9CA 1GD1O 1QKIA 4RZIA 3I6QA 1V0JA 1G1AA 1VKNA 1PJSA 2VHWA 3KUXA 3FSRA 4OYRA 1H2HA 1PIWA 2CF6A 4R01A 1ULUA 1GUZA 1RM5A 2J8ZA 1UAGA 1YS4A 4DREA 4EEZA 2IXAA 2Y68A 3CZRA 4JQCA 4UEJA 5BNTA 4LCEA 4TZTA 3BMNB 3D3EA 1MFZA 4YT5A 1HE4A 1LRKA 4DQVA 1KVTA 1CEQA 4OOFA 4YVFA 5TJ9A 4J6FA 4NJMB 2NVUA 3C1TA 3O8QA 3PZRA 2QYSA 1K6IA 2DAPA 2VT2A 2FHSA 4YT8A 3TFOA 1JDJA 4I5FA 1X1EA 2X0NA 4Z0PA 3U09A 3EAGA 5L53A 4LRSB 1PJ2A 1T24A 2I66A 1UP6A 2QX7A 1N5DA 3VTZA 3PFFA 3WLEA 4E12A 2Z5LA 1WDLA 2JHFA 4FC7A 4MVJE 3WOHA 4XYGA 5KTKA 1Z45A 5IDYA 3PI7A 1P31A 1LXCA 3LLSA 3ZWWA 1UAYA 3BA1A 5JBIA 2V65A 2B69A 2UUOA 3DBLB 1I3LA 1M6HA 1LSOA 2X7HA 4YJFA 4ZA2A 5I9MA 3T7EA 5A9RA 4OKIA 2JL1A 3UN1A 4BQPA 1DAPA 2H63A 2F00A 3I5MA 4PZDA 3OIFA 3JQ7B 4BNVA 3NJ4A 1HZJA 3NJ8A 3JQEA 5IAAA 3WTBA 1IB6A 4WLFA 5ER6A 3F1LA 3ROMA 3SBOA 3E48A 2VZ9A 4DA9A 1HE5A 4WK6A 5AYVA 2GERA 3GK3A 4TRRA 1EDOA 2AQKA 5J23A 2CDBA 3RIHA 2C7GA 1ENPA 1E3LA 1PS9A 2X23A 3S2GA 4ALKA 2B0JA 4XYMA 1N1EA 4A10A 1ZBQA 3ADOA 5EN4A 4BKUA 1PS8A 3HDHA 4RZHA 4BNMA 4FB5A 1HDRA 4ZGWA 2PZMA 4KMSA 3CMCO 1SCUA 2IE0A 4A5OA 3INGA 4CODB 4BNZA 1QYDA 2JFHA 2NU6A 4BNTA 1DRWA 1R4NB 4HFNA 3JD2A 4PG5A 2CY0A 1LSSA 4L4SA 4NHEA 5FWNA 4MVJA 4XCVA 4FN4A 4E4YA 4ILKA 1C3VA 4AFNA 4R1NA 1NYTA 1E1NA 1S6YA 1LQTA 3H9UA 3GRPA 1OOEA 3R6DA 1B0AA 3FN4A 4FFOA 1ONPA 3AUUA 3HDYA 4W6ZA 4FFLA 2CF5A 1PL7A 1ZJYA 1LI4A 5B4TA 4JBIA 1Q2XA 1PJLA 4Z9FA 3AFMA 4RORA 4E3ZA 2EW2A 3UUWA 1GTMA 1GZ4A 3FBTA 4Z9XA 1L1FA 3JQ8A 2CZCA 2YDYA 4U8GA 5CPBA 4WGGA 4WEOA 4UUPA 4FR5A 3RJ9A 1PWZA 3Q9NA 1OC2A 4ND2A 3CINA 4IQ8A 3MJ4A 2VTEA 3WGYA 2HJSA 3RUFA 1ZK0A 2J3JA 2AG8A 2P9GA 1M75A 2PKQP 4MP8A 4ZQGA 2GPTA 1MX3A 1GQ2A 3GEDA 3MTGA 3VAZA 4CQLA 2HO5A 2BGLA 2VHYA 3WICA 3PHLA 3QW2A 2VWHA 2WJPA 3NUGA 3TSCA 1ZNQO 2DFDA 3FRJA 2D59A 2NACA 4IJKA 3QWBA 1CWUA 3FPLA 4BNXA 1ZIDA 5EESA 3VZSA 3HFGA 2YFHA 4JN6B 1QYWA 1MB4A 4DQUA 4KDFA 4NBWA 3MWEB 2C7VA 1QG6A 3UOGA 1A71A 2NQTA 4UVIA 4EI2A 1T4DA 5A3JA 1EDZA 2GGSA 4MIOA 4BMVA 1DFIA 4F6CA 4IXWA 1PJ3A 3Q6IA 3AY6A 2DVMA 2J5RA 5DULA 3UCXA 2X86A 2AQ8A 3H2SA 3PJEA 4BKRA 2QRJA 1GUFA 1DB3A 1LDNA 3MOGA 4HWKA 4ND3A 3VZQA 3MJTA 1X7DA 1E6EA 4JK3A 4EJ6A 4MO2A 5JMPA 3AM4A 4AL4A 4IJUA 1WZEA 4GX0A 3C7DB 4PLZA 4K9DA 5A9SA 3DWFA 1WXDA 1ZH8A 2OP0A 2RH4A 3ZWCA 5H81A 5L40A 1PJQA 1WDKA 4J90A 4UVDA 1CYDA 3WBFA 4QUKA 3BMNA 1XQ1A 1HL3A 1YKFA 4R68A 1H6CA 3PQFA 1Z74A 3JYPA 1BMDA 1CF2O 2Y1FA 5EQDA 5A1TA 2BI7A 4GSLA 4W99A 1HDCA 3SLKA 1D1TA 4Y67A 2NUAA 4E33A 4NBUA 3TZKA 3PP8A 3CUKA 2C2YA 3U62A 5AQ1A 1ZFNA 5IN4A 4OSPA 3S2FA 4AJKA 4B8WA 1N1GA 2DTEA 2Y1GA 2HMSA 1VKOA 4NK5A 2YFQA 2RIRA 1B8UA 5BSEA 1GYPA 1KOLA 2X1HA 3QRWA 1A4UA 2QYTA 3DZGA 1B8VA 5T5QA 5CDYA 2JAHA 4FFNA 4TKMA 4DPLA 3AOGA 2H1SA 1EZ4A 1F06A 1SOVA 3HHPA 4XRRA 3AM5A 2UV8A 5A02A 1ULSA 5JAQA 5IZCA 3LC7O 2PK3A 1HSOA 1XCBA 1HEUA 1QR6A 3TWOA 5TIIA 4YT2A 2GUGA 4YJGA 1GADO 4P4NA 4NU5A 4YB8A 5I8WA 1LA2A 1F14A 1LLCA 2IDZA 3TRIA 5GZ6A 3ZW8A 4BO5A 1GCOA 5JDIA 2I65A 2PR2A 5KJ1A 2I99A 3WSVA 4CV0A 5T67A 3TPCA 2NTJA 3V5NA 4TRMA 2OOSA 3DOJA 3IIEA 4XR9A 5FEUA 3WDSA 4D7AA 4K1LA 1HSZA 1U3VA 1ISIA 4N18A 2CNBA 5IFLA 1PGPA 4JCOA 4NG5A 3L6OO 3OEWA 2G17A 3FNEA 1PJ4A 4Y98A 2C5AA 1BG6A 4UUNA 3NX4A 1GR0A 1P44A 1SBYA 2CFCA 1JAYA 5A05A 3OBBA 5JC8A 4O6VA 3AWDA 5C5IA 2XOXA 1G0NA 4XQGA 4D44A 2E6UX 1YL6A 1D4FA 1RM3A 3UCFA 2HK7A 3ZNPA 2W2LD 4MPDA 4BNLA 1AE1A 1I32A 1TB4A 3GR6A 3TN7A 4QFCA 2YY7A 4GMGA 3UXYA 4J16A 5DT9A 3UH1A 1RM0A 1Y9AA 4B4UA 2VRBA 3JQ6A 2Q45A 1E1KA 2BFAA 2VTDA 1VL0A 4G81A 1NM5A 1DC6A 1NNUA 1UH5A 3ENNA 1XELA 4FCCA 4NJOA 3WR5A 4M87A 3K30A 2GCGA 3P2OA 3ZWPA 1LJ8A 1SOWA 2FP4A 3D3WB 1GV0A 5L7WA 1I36A 4B7XA 1VE9A 2CD9A 1KEUA 3GPDG 3IP1A 1AXEA 2EF1A 3KM0A 2YV2A 3UKOA 1PZGA 3F9IA 4BO8A 2X9NA 3ORFA 2G1UA 4DVJA 3A9WA 4FC6A 5KJ6A 1NQOA 3V1YA 3U3XA 6LDHA 1ENOA 1D1SA 1GYQA 4Q3BA 2IEBA 4YDRA 4Q3DA 4TRNA 3OJEA 2A9FA 2HMVA 4N5NA 3RASA 4RPJA 4A27A 1XDWA 3OH8A 1B2LA 5JY1A 4TKLA 1XU9A 5K0ZA 3M2PA 5L4NA 3JTMA 1H0KA 3WJ7A 3F5QA 5CEEA 5JXWA 5COQA 4BO2A 3RUDA 3WNVA 4NH4A 1VJ0A 3CEAA 3ZV4A 1DOHA 3EZYA 3GHHA 3QQPA 4R3WA 1FDUA 3DO5A 4RVFA 4D3DA 3PZBA 1K2WA 1X0XA 4L0QA 4JJIA 4AJEA 3AUAA 3N7UA 4NZ9A 2DM6A 1PGQA 1I3MA 4EGFA 2RH8A 4A26A 4YJDA 3ONFA 4LISA 1ZCJA 4IDEA 5KOIA 3QE3A 1RM4A 4PRKA 1Q0QA 4MKZA 1UR5A 1R6DA 4XRGA 4NFSA 2LDXA 1WW8A 1JLLA 4FGSA 4KQWA 1WLYA 4WCFB 1C0LA 1ZSVA 2PWZA 1P1JA 4IBOA 4PLWA 4L4RA 5DCUA 5DOVA 1O94A 3H9GA 1Y6JA 4GVXA 3I4FA 4DTIA 1P3DA 4CV1A 3JQBC 1XQ6A 4FS3A 3LT2A 1WVGA 2HU2A 3DL2A 4MVJP 5CPFA 5EPOA 3DFZA 4OO3A 1BTOA 3ZHZA 2PGLA 3H9JA 4XQ9A 3JQ8B 3GC6A 4XDYA 3DMTC 1DFHA 3U4IA 3LSYA 2VZ0A 3TF5A 2NU9A 3WQQA 4NMHA 1ZSNA 3MJVA 4GLOA 3IS3A 4PLCA 5ILGA 4IMPA 4WLNA 2CSUA 1HZZA 4BO3A 2BD0A 3KYBA 4L8VA 3GZNB 5JE8A 3WGZA 2ZB3A 3WMXA 1ZKMA 4RVSA 2UYYA 4LGVA 2B36A 3RVDA 4CMEA 1C0KA 2B4QA 1VL6A 2PGDA 1OZAA 1M6WA 4JBGA 4QO8A 5A06A 1TT5B 2Q1TA 1U5CA 1UDAA 2HJRA 2VZ8A 4J1NA 4RLHA 3TNLA 2GZ2A 3WWYA 4CUKA 1E7QA 2J3IA 4E31A 1E77A 1R4MA 2AW5A 2H6EA 3N58A 2JAPA 4QTZA 2B4TO 3RKRA 4Y8VA 2OORA 3QV1A 1JKFA 4YBZA 1TA4A 3GDOA 3M2TA 2C07A 1GPJA 2B37A 1U5AA 5KVVA 4W9NC 1WAMA 3QP9A 1U4OA 3KYCB 4S1VA 1D8AA 1U7TA 2YV1A 4RJTA 3ZGYA 3SEFA 1BXKA 4CL3A 3L0DA 3OSUA 1E7RA 2WYUA 1EVYA 4YRDA 5CDTA 5BQFA 2EGHA 3I9OA 5JMWA 1BWSA 4I9HA 5HM8A 4GBJA 3PJDA 3WQSB 2GLXA 1E6WA 2D8AA 2YHUA 3AOEA 1ADBA 1IULA 2E82A 3GOHA 4J7CA 3F4BA 1HDOA 5H82A 4R9SA 5THKA 3BTUA 3PPIA 3SC6A 4IDFA 1NVGA 1PU2A 3W4IA 3QJ5A 1XR3A 3CH6A 3H9QA 3AM3A 1BVUA 3NEPX 1ZXLA 3L4BA 1NTOA 1VL8A 4AJHA 1YDEA 3D5TA 1DSSG 3EYWA 2C29D 2AEFA 2GO1A 3K96A 4XQEA 1NHGA 1ZO8A 1TT7A 4KUEA 2ZQYA 3PFWO 5HS4A 2Y0EA 3WMWA
chains in the Genus database with same CATH superfamily
1YB5A 4NFLA 1NI4B 2HSDA 5JZSA 5TQJA 1RHQA 3MCVA 2ZPAA 5CGQB 2QNRA 1N6HA 2HNBA 4UJ3A 4LI3X 1I1QB 2QENA 3AEZA 2FP4B 5DYWA 5FULA 1M2KA 4ER6A 5KVSA 1ENYA 1NZJA 2BR3A 3TDKA 4MCHA 1N4DA 3NDRA 4PQRA 1AGNA 5FTNA 1EFUA 4CU5A 2HA2A 3C7CB 4QJ4A 1G3UA 5GJWC 3W9YA 1RC8A 2ZJ0A 1A8UA 1NU8A 2XMRA 1T25A 2FHPA 3IPLA 4TLLB 3UMBA 5ADWA 3ZIAD 5SY9A 3QVVA 4WESB 5B12A 3HA2A 4ROTA 1B6SA 1FUYB 2X1VA 4W9RA 3MZ0A 3FSJX 3BD8A 3M4ZA 3SVLA 2V5AA 4HQOA 4OJYA 1PX2A 1JJAA 5JZVA 4PINA 1PL6A 1BIFA 2H2GA 3VBEA 3HJFA 1Q2UA 4J0DA 1M7BA 1NMEA 2VF8A 5CX1B 5CX4A 4FFRA 3LL7A 3PJFA 1U7ZA 2QRMA 4EENA 4WN9A 4UOEA 5CLFA 3ZXSA 5FTKA 4OB6A 3WKAA 3FSGA 4L07A 4UQLA 2V9CA 3DFUA 2RHLA 1JPJA 2AG0A 3H3JA 1W6RA 2VBCA 3JVEA 3O92A 3Q3EA 2Y4OA 3JRWA 1GKKA 5DYYA 3V4FA 1EE9A 5IVIA 3WIVA 2VL7A 5EFOA 2WDPA 5C37A 1FUUA 1FDSA 3BK1A 3ZBUA 3ZK9A 1S7GA 1Z2PX 2CFTA 3BWCA 3JARA 1LNZA 4QU9A 4WUVA 4RDIA 3TK1A 2A5JA 3VZPA 3ZV5A 4Q0MA 4HDKA 3S27A 1RWBA 4B6PA 1R37A 4NE2A 3UATA 2J3KA 2GAIA 4BS9A 4RVDA 5BSGA 2Y1DA 3CVWA 3R76A 2OV2A 1Y1RA 3O91A 3OSZA 1P1FA 2HC9A 2OGUA 1HNZB 1FNCA 3GFFA 3WV4A 3VNRA 1CE8B 4YRBA 3E3AA 1RCFA 1N33B 3GP3A 1SXGA 1UK6A 1VG0B 2BEVA 4HDNB 5KYYB 4ERXA 3MMSA 2BMJA 4JHLA 1MC4A 2RK6A 4LWPA 4TTSA 5SZKB 3QG1A 5E9QA 1H1LA 1O97D 1MAUA 3HN2A 4QFBA 3U0VA 2ZI6A 4ZI3A 1S7CA 3QVTA 1PZHA 1L2TA 1OA1A 1Z4MA 2CEKA 1TVCA 3H9BA 3K73O 4ND4A 3NYRA 4OBEA 2BP7B 4RO0A 4DCMA 3GT4A 1BCSA 1E7YA 1HNXB 5I48A 3PS9A 1SBZA 4RKFA 3IGFA 5GIOE 3M34A 4GOND 3TKLA 1GL6A 3DSRA 4XGIA 3NG1A 3TMYA 2JCSA 3S70A 2C1XA 2BGKA 4J7UA 2HA4A 3QWHA 4GZLA 4X9XA 3KSUA 2VYND 1ACLA 1HMPA 1JEAA 1DARA 3E7FA 2BRUC 2HT1A 2X4DA 3FHLA 1YB1A 3ES9A 5KMGB 2QRPA 3IP3A 1EE1A 3UMGA 2IZ6A 2J31A 1XRMA 3OECA 5BRJA 3WHLA 3HP1A 1GR1A 1MTZA 4Q15A 5DI3A 5BSWA 3JZDA 5K0SA 3TLKA 4O4LA 3T7CA 1OLUB 1Z7BA 2IODA 4CMKA 1TVMA 4DBZA 4ARBA 1XTKA 2ZUCA 4CG2A 5AIAA 1MZPA 4ZOQI 4G01B 1PV1A 2W9XA 5EPUA 4FSXA 2NP7A 2OD7A 4A82A 5K0JA 3FOBA 3KJHA 3AP2A 1I01A 1CQXA 3ZCVA 3OQMA 3GT3A 4HAIA 2WLTA 1JG7A 1OXTA 3QU4A 4GNRA 1BU8A 3UAWA 3ZWOA 4D0RA 1J49A 3O84A 4GVLA 4HRYA 1A7JA 1OPXA 1QB7A 4Q1DA 1V39A 3RLFA 3DMTA 3QFRA 5HE9A 3ETDA 3K92A 2BIFA 3SWWA 3MWJA 2FN3A 3M6AA 2ZZMA 5A5EA 1WIWA 1X1BA 5BT8A 3SGLA 4BNDB 1RLJA 1JHXA 4MCIA 4ZXFA 4CFYA 2GZDA 2I76A 1FFWA 5EVCA 1A5ZA 2JGLA 5C18A 1X3LA 2AJCA 3G9XA 4JP5A 2Y6UA 2FOLA 3HE3A 4P08A 2WFLB 2ZRCA 3N2NA 2FWJA 1EMDA 3Q8KA 5C1DA 2AUNA 3STWA 2H7VA 4OQYA 2VWGA 1E3DA 4J2HA 3N6XA 1EWRA 5EC8A 3EVAA 4IEFB 3U4HA 3WJ1A 4MWOA 4RK7A 2RHGB 4AZ3A 1V8ZA 2WD9A 3FYCA 4DSAA 2O3JA 3C6QA 2FUG6 4QOSA 3NHYA 2OO3A 3WL5A 3QUSA 2CLKB 4AS3A 1HLPA 4O59O 1KBQA 1M34B 1D5CA 4JBHA 1H2AS 2C9ZA 4MROA 3X44A 5LIPA 4NYJQ 3RT7A 3KJXA 4KWTA 5JW6A 1QTNA 1U2DA 3EASA 3V2GA 4LWZA 4YJKA 4ER5A 4ER0A 3SP1A 5HE8A 3TSZA 4PX9A 3DONA 3RGGA 4LWQA 2JHCA 4R2JA 4JLVA 4JKOA 3WK4A 1RLTA 3ESQA 4LJ8A 4TVKA 4A1OA 2VDVE 4OAQA 3VHXA 3QU5A 4P22A 1VJTA 2HT6A 1GITA 4XAQA 1EDDA 4YMTA 1WUTA 1XALA 2FX2A 4KR0A 3M6IA 1IB0A 1C14A 4RSGA 4BNIA 1YS1X 4WRRA 1XROA 2FRVA 3CIOA 3F74A 3GRAA 1OBVA 4LSZA 2GBLA 1AD2A 3PFIA 4B3CA 4ZHQA 4IS2A 2QL7A 2YQ4A 4D0SA 2B8JA 5JNUA 1YH3A 2YZGA 1TA0A 2JGFA 3PX2A 4KE6A 5JRJA 2HF7A 4ZO4A 2ISCA 2MT9A 1NVBA 3EFOA 4HQRA 2JKYA 1TPYA 3WRXC 4CQMD 4G24A 2ZBPA 1D1PA 1KMHB 5FPSA 2F1KA 2D2EA 2O1WA 2BMVA 3LTNC 2G71A 4HB3A 4EKGA 1Z4PX 1ZMRA 4CYMA 5B2FA 2BVNA 5JAPA 2XJ9A 2O1XA 2G0TA 4B83A 1ZH2A 1XLUA 3EFHA 3LQQA 1FNBA 1V3QE 4RF4A 2XMPA 5D7BA 5E3JA 1MMFB 4BE9A 2EW8A 1JDPA 4ENVA 3MTAA 1RQLA 3FZEA 2PS1A 1U1GA 1VKZA 4HEA1 2HUNA 1ICEA 2H1CA 5KB3A 1NPYA 2FSUA 2IXTA 2RARA 4Z99A 1IHDA 2GEDA 3HRKA 4M9QA 3OWHA 4DNPA 3QKRA 4US2R 2II6A 1IM8A 4IIEA 4C0XA 3KEFA 1T8SA 3BRWA 4I14A 3ASZA 1E2PA 3VTFA 3WSWA 1NXVA 4JQSA 2FKAA 4TKZA 1NQAO 2O9JA 3GRUA 2GN9A 3H1GA 5E7JA 3TQFA 3TXYA 1HFWA 4EPXA 4M1QA 4Q1VA 3MAJA 4BCCA 4Z54A 1NVWQ 1Z68A 3PD1A 1YJBA 2WB4A 4Q7EA 4AJPA 2WU4A 4WAUA 2FQWA 3GU3A 4IDAA 4OM8A 1RMTA 4QUDA 5GJCA 1L5YA 4E1VA 5LVAA 1F20A 3A6KA 1OI4A 2CL6X 2SKCA 3LV8A 5ALXA 2DLDA 3RS2A 2X1LA 1IY9A 1KPIA 1MVNA 3EC2A 3JQRA 4YP1A 3U4QA 1TZ2A 1B0ZA 3N8GA 5LXTB 4D8VA 1ISGA 3OJLA 1EM6A 1YKSA 4CXMA 3GX1A 4P84A 1DTSA 2HLHA 2VJLA 4QEKA 4BVEA 3CLHA 4LBZA 13PKA 5EWLB 5G2OA 3RFTA 3FYUB 2XRYA 3GH1A 1LS6A 4E5SA 2I1VB 2CWWA 2AIRA 2VLBA 4L75A 2IBMA 4CLXA 4DT1B 3PWZA 3N74A 3DTYA 4PZ9A 2WU0A 3QE9Y 4HRVA 1MG5A 3H6GA 1B6TA 4H16A 2B2CA 5CG2A 3CCCA 3WK6A 3PNPA 1G6KA 3LXMA 4JDPA 4Z1MA 5TGTA 1HDZA 5HZMA 2R7NA 3D4LA 2AJLI 3KKNA 4URYR 2CJWB 1BCRA 1FDVA 4KFUA 2VYCA 4WFIA 4FJ1A 1NZDA 4UDYX 4DEVA 4ZRNA 3V2HA 3R8FA 5HVNA 1DJQA 5COAA 2ZCJA 1PQWA 1T43A 4RD4A 2PT9A 2Z08A 4RTLA 3AKYA 4EHIA 1JQ3A 2BFFB 2RHOA 3HP7A 1UJMA 4ME6A 4WXPA 1GTZA 4TV9B 1L6IA 3M9LA 3UAYA 4ASUD 3ZGLA 3CNEA 2GCNA 5H3CA 1DAMA 2E9SA 2UZ1A 3CZPA 3PE4A 1HFKA 4TKVB 3UV7A 2EJCA 5LQRA 5EXPA 2E4UA 4KNWA 4W4TA 3RRNA 3OMLA 1U0SY 3WFIA 2H8GA 2YRWA 2PLAA 3N75A 1ZM3A 3EGEA 4X1OA 2JJ2A 2LV8A 1U4SA 5B2EA 4N6GA 4XCQA 1JG6A 3DZIA 4DMGA 3PNKA 2V6MA 3K70B 3KJIA 4MQLA 3N0TA 4XGRA 1V8DA 2IZ1A 2IY7A 3B53X 3NIWA 3T8YA 5BN3A 4V1CI 4C6RA 1A1SA 1GU0A 1AKNA 1NVXQ 1L5FA 1VBFA 1W93A 2VF7A 3Q9SA 2IS2A 1KTVA 3CRRA 2Y76A 3ASUA 3G7SA 5E6RA 4D97A 2VG8A 2X42A 1QE3A 1C4WA 1UP4A 2GF9A 1NPTO 2V7TA 3BQ9A 3EY4A 1NW6A 3JPYA 4P33A 4FKBA 4Z0TA 3VDQA 3WA6A 4CDMA 2YX1A 4DC9A 2XMGA 2NSYA 1FSFA 4TVSA 4GX2A 4KQHA 2Z3WA 5CX1A 3SJUA 3SD7A 3VH3A 2IUFA 1BGVA 4QDOA 5IBCA 1QH1A 2GN1A 2ATEA 2OHHA 4W5NA 1I3KA 3UK2A 4MVJM 1GNSA 3RADC 2G1PA 1UAAA 3HRHA 3R09A 1U8CB 5B36A 4C2BA 1CG6A 3D3NA 3Q11A 4CKWA 4IDBA 2OBBA 4EGJA 3PUIA 1Y0BA 1IY0A 3AW9A 2QW8A 4TN1A 3T61A 4RTJA 4FR0A 2I7CA 2FPKA 4EJSA 2HWYA 4X97A 3EWIA 5CLIA 3E70C 1OXUA 1YA8A 1L7PA 3OKAA 4ARZA 4CNQA 2J5KA 2NGRA 4ZP1A 2JLQA 4FQ8A 2P2LA 4P35A 4RZ2A 3OD5A 1EFPB 1UXKA 2I4TA 5KPDA 4CEHB 4ZC1A 4ZDJA 4BZQA 3C41J 3GNSA 2PX8A 1NQWA 1WMEA 2FMIA 2GARA 4FWIB 2NTVA 4M89A 1KGSA 1QIMA 3PKZA 3ZUGA 3ZCTA 1G5TA 2ZE7A 3PQ2A 1O5IA 3IOYA 3WVNA 3TM4A 3ZWQA 2I3AA 8GPBA 2BEVB 3N6VA 3OMXA 1FYXA 2PZLA 1QO0A 1ML3A 2D5AA 2ZIEA 4J3FA 4Q00A 4XDHA 5J59A 4B71A 1ZITA 4WL0A 4AZSA 2PKQO 2ZRJA 3H2HA 1KY2A 2YWCA 3PV0A 4CMEC 3G8AA 3OZEA 4WLVA 4F7WA 1Z13A 1CUIA 1ZEJA 4EA6A 3LUBA 4NRDA 4QLOA 1AUOA 2IHNA 4Q4DA 1IEXA 2WWHA 3TLYA 4XW2A 3J7TA 4INZA 1JKJB 2HPZA 2VPWA 1KHHA 1KKLA 2C9MA 1CUHA 2Y3IA 2Z5GA 2A1IA 2ZVQX 3G6KA 3OLZA 1KEEB 3BAFA 2VK8A 1VSVA 4R8LA 5DN9A 5E0OA 1JL3A 1G6Q1 4HBGA 1Z6XA 3OOYA 3L0SA 2P5YA 2AKAB 1U28A 2EERA 1TJPB 2QTAA 3FI9A 5A04A 4YRFA 3K0EA 4G5QA 4FYPA 3V46A 4ZCRA 1KA9H 2XDYA 3BXFA 2WHQA 3CUWA 4HJXA 4EYGA 1JALA 1HYGA 2YJ4A 1SOAA 4IW3B 2CHVA 1GNTA 1OBCA 3T0IA 1YVRA 2H4ZA 4AKTA 4S05A 2O06A 4BO4A 1USGA 2CLCX 5LQUA 1A9TA 4IPTA 3W8NA 2GJKA 4QJ5A 2NUPA 3FDIA 3RUHA 3ZBTA 3A37A 3TPFA 1T9CA 2EBUA 2GRAA 3L6DA 3ZEAA 1YI1A 1SMKA 2H4WA 1YI8A 4RIGA 3W2IA 2C5EA 5HKOA 4L9RA 5CCBA 1IU9A 2F3SA 3EXHA 3GLHA 5CB4B 3HKCA 1PL0A 5BMVA 1CRZA 2W8BA 1VCMA 2AJTA 2GT1A 2ORYA 3PQ4A 2FZVA 1LDMA 3GFOA 2HSGA 1SKYE 2X5KO 5DWDA 3S2YA 3R7BA 3RSOA 1VMKA 3ILHA 4X3OA 1VC2A 1YBFA 2HU8A 3W2HA 5IJXA 3COJA 2XWQA 2C54A 3H1TA 3EMBA 4GEKA 4BGEA 5JI3E 3UAZA 1Z2NX 3GAAA 4NVRA 1U0TA 2FK7A 2YBEA 3MM4A 4CIWA 3IQWA 4KEAA 4JH0A 2QJFA 1T0BA 1HYEA 3A9RA 2WJGA 1PT7A 5AXDA 1J9EA 1G8SA 5FWAA 5IZ4A 1ZGZA 2ODPA 1VLQA 4J49A 1LVHA 3AYZB 3I30X 1HTWA 1XDGA 3A6JA 2O2ZA 3ANSA 4GPBA 4W82A 2A9PA 2FDRA 1UFKA 1AY0A 2FR8C 1VG8A 3UNXA 5SYNA 3V97A 3M83A 3HBLA 2HU5A 4F06A 1CRPA 2WV9A 2NVBA 4L6AA 1Q15A 1Z4IA 2B5OA 4IIFA 5TS2A 1SKAA 4W7IA 2G5TA 2HDWA 3BWXA 3K31A 1SC3A 2EG5A 4L74A 4MHSA 3ETNA 4OQXA 3PJRA 3ANNA 4YCDA 1JWAB 4D02A 5IN5A 5ENDA 1QLHA 3ZWYA 4ZI7F 1C81A 4B3SB 2A0XA 5LLDA 1XG5A 2NNLD 3VAAA 1NF3A 1ZD2P 3FDFA 5KSYA 4IVNA 4NBTA 4NTZA 5A9SB 1I7SB 1JPUA 1I30A 2PLWA 3QQ5A 2MOKA 3FCEA 5AM0A 4EJ0A 2VWPA 5MFPA 5CHYA 1Q1ZA 2ZCVA 4HXEB 2Y0PA 4NDAA 5LB2A 3JVVA 2Q49A 1B8NA 1FFDA 4OI4A 4ZC8A 1CZKA 2NOAA 1C4KA 1QTRA 4IIBA 3WNZA 5HUHA 1KVUA 1XA0A 3Q98A 2OA0A 5A4IS 1CDOA 1USIA 3T4EA 4UTPA 3U1BA 4LXQA 3IVRA 1NGSA 3HVKA 2NO0A 4C0LA 3EXG2 3PFBA 3WRYA 2QRUA 4FX5A 3GZ4A 3DHYA 2RI0A 3P97A 3IELA 4FDMA 3KLOA 5IJAA 3WP0A 1P80A 4C2AA 5JG7A 1GA6A 2GJ9A 3V1NA 3X1DA 2LVBA 5TF4A 1KYQA 4GRAA 3AR9A 1KK1A 4JJZA 3L6CA 2OAEA 4WD3A 1T5BA 1XSEA 1EHIA 1DEHA 3AQIA 5AKHA 2VDLB 2ZS7A 3B8HA 1JEEA 1I3CA 1LPBB 2PY6A 3IPYA 4KVFA 3HXOA 2UUBB 4B3RB 4WZ6A 2ZUFA 1H8EA 1TPZA 4NR0A 5ALKA 2IH2A 3IUBA 4KVAA 1Z0DA 3BYZA 4Z6KA 4X3PA 3MVEA 3ONVA 3KR0A 2ZSAA 4ZQIA 2B3DA 1Y3HA 2CUKA 3N5CA 3LAWA 2HA7A 2XE6A 3R74A 4O5AA 3RU7A 3Q8LA 4IICA 2HTEA 1QYVA 2XGGA 1HZZC 3R7WA 1K8QA 1N2EA 3PEYA 5AM3A 1F8XA 3GFTA 5HP4A 5EEGA 1TADA 3Q6NA 1QVVA 1D2AA 1GZ3A 3IQZA 4V0OA 3GRCA 5A5FA 1JT9A 5A7GA 2L42A 1JSZA 4D4IA 1LTKA 4EK9A 3WWOA 3IT3A 4WW0A 4BMZA 1IZ0A 1JJ7A 2RD2A 3BRCA 3H87A 2DZDA 2FZGA 4MITA 1VSQA 3QHAA 1P4SA 4C4RA 1NIPA 2IHZA 3F8WA 1EQAA 1QORA 2NXWA 3CSDA 3K3PA 4HGPA 4LNAA 4R83A 4JJ8A 5TQ0A 3RIXA 1YO6A 1RMYA 3RYTC 1YZNA 2OV6A 2VYVA 5KQGA 3DL7A 3SQWA 3B12A 1T0PA 5MHTA 2J48A 4LE0A 1YJCA 1HQYE 4P7GA 3UC5A 4FONA 3NTUA 3GPBA 4NC9A 5K03A 2JFNA 1STOA 1IONA 1CUBA 1LPSA 1OFGA 2PXXA 1IAVA 2I5PO 5B1IA 3V42A 3Q15C 1T8TA 2ON6A 1SBNE 3RDPA 2ZUWA 4WXRA 4GRIA 4YWJA 4CCSA 3PEEA 3JQDA 3RVLA 2XVZA 3O4JA 2ID4A 4IFIA 1FQKA 1BCRB 3QEKA 4HKTA 3RAJA 3WLFA 1QBGA 3MLAA 4RHTA 4R8SA 2EW1A 2GHRA 3N0RA 4R4JA 3IBCA 4QG3A 3KEQA 2W0SA 2P69A 2GETA 3STXA 5D7NA 2AZTA 3FHOA 3IPCA 5BW4A 2Q5EA 4RTNA 1MO3A 2RJOA 1WR8A 1F8GA 5DM4A 4CEIB 1ZOLA 4WFJA 3UGKA 5U1PA 2Z83A 4IQFA 4LY0A 4TT3A 1P5HA 2O0LA 3H05A 4I4IA 4L9AA 3VR3A 2O5RA 1SELA 4EPVA 2QNBA 3TI7A 4X7RA 5DM60 1V9CA 2VXOA 3EGDA 1FP1D 1XZJA 4WZBB 5E1MA 3H4IA 3PYLA 1E18A 4RZ3A 4RA9A 2P65A 2EQAA 3KUCA 1KJJA 3VR3D 3HI4A 4P5EA 3ZW7A 4ZYVA 5KWIA 1L1RA 2B8EA 1H8HD 1B23P 3GLGE 1UXGA 3OKCA 2HWWA 2M6KA 5AVZA 1NHWA 2DBZA 1SWVA 3BS4A 3OEHD 1OVGA 2XNDA 4OG2A 2A2ZA 4EFMA 4JZKA 1KH1A 2AMLA 3LA8A 4NPAA 3REFA 3VKFA 3HJTA 3HLKA 4A8JC 5BWMA 4GX5A 4OL9A 1M72A 4DXAA 4M8NE 1BDJA 4XX0A 2WZDA 1K8XB 3BJIC 3SXUB 1LQUA 3SHTA 3SZMA 3UK1A 4U8HA 1CQJB 1MH9A 2QY6A 4MVJD 3PK0A 4WVLA 5FUYA 3ANTA 3OQHA 1SEPA 1PT5A 3MGCA 1BC5A 4M0UA 3U7QB 1KJ8A 3VR5H 4BN0A 3NHRA 4QBHA 4X1IB 4QGBA 2KSQA 2MDTA 4BQFA 2E89A 4BC1A 1J2RA 1G6OA 3JD3A 2QX4A 4QTTB 3FUXA 1U99A 1MA3A 1SZPA 3MOSA 3NGXA 4WXYB 4NKRA 3PRYA 3T0GA 4UM9B 1A9XA 1VCIA 3G17A 2O2JA 3I45A 4EY7A 1TOAA 2LD4A 1FVOA 3LY5A 2G0NA 3GDHA 2HOQA 3B13B 4G0OA 1ADYA 4GR9A 1JIJA 4IKPA 1TIBA 2CHQA 4KR9A 1WU7A 3U4AA 4ZVQA 4PYMA 3UEOA 1JILA 2WM8A 3IFSA 4J0EA 4KZPA 1GP2A 4R40A 3B1JA 3RC3A 3RU3A 1M2OA 3KLMX 1SXJA 1Y89A 1KDYA 4GE0A 3TQSA 4D6XA 3GRYA 3D6NB 3CUUA 3T1QA 3ACBA 1DOZA 3EZXA 3F67A 3EQ2A 4ALJA 4FZVA 2BHLA 2Q50A 1N92A 2F3RA 1C4OA 4QPNA 2O1EA 2PN1A 3A4TA 3H6HA 4BVGA 5DTIA 5K8VA 1ISRA 5A4MS 4EG0A 2DULA 4DJ5X 2OXCA 3R7SA 1JGTA 1NAIA 5HKAA 3NWEA 4XOIA 3D7LA 3KZKA 4R8VA 1OYVA 1J09A 1M6EX 4HH4A 5E9AA 3G8CA 1JE0A 1B43A 3EZ9A 3L82B 5IKOA 3ZY6A 3RAEC 5AVQA 1L7XA 3SKYA 3LL4A 5DP1A 1Z18A 3H1EA 5FPTA 3TXXA 3VR5D 5IABA 4Q19A 1T3ZA 1M54A 2G0AA 2OL4A 2VCYA 3EGOA 3FDXA 1DBQA 1HXHA 3OJ0A 3PDCA 5AXBA 5KPJA 2NG1A 5KX5A 4Q34A 3RS7A 2YRFA 3ZHOA 4E21A 5BMVF 1SQSA 1XCMA 2VHZA 2QSZA 2EGUA 1R10A 2CXSA 2P4HX 2ST1A 2Z5VA 1NVUQ 4U9HS 4Y6QA 4NICA 3RYFB 5BPFA 4AJOA 1N34B 3VVCA 3TYXA 1MQ8B 2FQ1A 3ONDA 4M9SA 1YGPA 3TRJA 3VKWA 3VC3A 5DNAA 3BA6A 3AVWA 1X14A 5JZ9A 3OE7D 4L0MA 3PHCA 1ZZGA 3HB7A 3QEMA 4J1SA 4Y2TA 2PQ6A 5C5CA 4OLFA 1I2DA 3HJNA 1VPDA 4RVCA 4ZHSA 2IE8A 2D1YA 1EESA 5BUCA 4JXJA 3I09A 2R6CA 3SSAA 4O4HA 1PYGA 1UBLS 7REQA 2WTBA 3MT7A 1DUVG 2J46A 2L17A 4X8LA 1WW3A 1RTTA 3GUHA 3Q9UA 1IN4A 4GL4A 4HWOA 4A91A 1BU5A 4B74A 4C6HA 2EIHA 1NG9A 1TK3A 2EFDB 4HNQA 3B36A 4K6OA 5E1BA 3B51X 1EHCA 1RQNA 1TCBA 3PVCA 2ZE6A 1JIUA 4FFVA 3S6JA 5IKXA 2GEBA 2CBGA 3CONA 4YAGA 1FLDA 3NUZA 1QH9A 1SG6A 2HEGA 1CUCA 3VR4D 2XOKD 4FDAA 4CI0B 3T1HB 3FJYA 1P9OA 2C82A 3KOWA 2DWOA 1BO6A 2GCOB 2MSWA 1P72A 1GOTA 3VZRA 4Q39A 4LCJA 3WLLA 1JHZA 4EY8A 5ALPA 4UTOA 4WEQA 4ASUA 3DL4A 3OF3A 4LJYA 4FS8A 4RDHA 1SB9A 2H18A 4ID3A 5G3YA 3GBPA 3QXGA 5AW2A 1NXQA 4J8PA 3TNDA 1JEQA 2J59A 2IT1A 3CPHA 4M9CA 4MHTA 3B3FA 3IUYA 4F7DA 1OH7A 1RAHA 1X7WA 1YRWA 4M86A 1RLUA 4UBNA 4TMKA 5ALVA 1N0IA 5FWYA 4W5TA 4YLYA 4WKCA 3N07A 1UK9A 4ZCSA 1TFRA 5FCDA 3FCAA 5TJHA 3SICE 3T3IA 3PNYA 2OUKA 1RWNA 3BEDA 3QA3E 4OBWA 4G0WA 2Z95A 2VI5A 4PM4A 3WLHA 2PTHA 3ENVA 3WBBA 4LFBB 2PNJA 5K4HA 3C97A 1MNQA 2Q41A 1KARA 4X54A 5KS2A 4B2YA 4S0ZA 5A4KA 4AVYA 1VJCA 1O96A 1I8TA 1KQFA 1KO5A 3EGWA 4OGGA 4BNFA 1GZ6A 2KX7A 2PH3A 3OPXA 2BM0A 4JJ4A 2PM8A 1MJNA 2C9YA 4NATA 2XADA 3O38A 2ZR8A 2PZJA 4FHGA 1MN6A 5K6TA 1Y5MA 2J9GA 2CVFA 1XKLA 3L40A 1A9YA 3FYTA 4CMIA 4YV2A 1VHTA 2FEWB 4OYLA 1RU3A 1U8TA 4UBMA 1EIZA 3RSFA 3RFCA 1M2VA 1EFTA 2C2ZA 2FR1A 4OJKA 1MRZA 2X9GA 1GRQA 5FI5A 2HF9A 2ZDQA 5JYDA 1Q1GA 1WUYA 3VRHA 5LP1A 2NTYC 3LDAA 1Z37A 3SZUA 2GKSA 2F8MA 3W34A 1ODJA 2GVDC 1ISMA 4MS3A 4OMFG 4Z9YA 3HJRA 3OF2A 4LVOA 3HUFA 2WG2A 4OXXA 3SBEA 1SU4A 1L1QA 3LUGA 3T7AA 4QG7A 1EU1A 4JOSA 4MW7A 5DCYA 3JQ7A 2XCQA 2G67A 1INLA 1NW8A 2VUTA 2GF0A 1L7BA 1RYDA 5IC5A 3SU8A 1QRAA 1Z5GA 3FBGA 3JSAA 1WEHA 5TDHA 4NG4A 1ZJ4A 4EAAA 2NU7A 2PD4A 3BXOA 4AG6A 2QLFA 1NM5C 4MI6A 4MQ5A 3C45A 3ZD8A 4WJZA 4EKNB 3ISTA 4J0GA 1YQXA 1PF7E 2XMDA 4DYHA 2DGDA 1Z6GA 2MWMA 3FVQA 4KMMA 1OXMA 2BFNA 2PQ0A 4L2IA 3ZXXA 4B2IA 3BL5A 2F8LA 2PUJA 2R5FA 3F6YA 2BFWA 2A30A 2Z0MA 2Q46A 3K2BA 4TWAA 5D3KA 4UXHA 3KCNA 5JD3A 4BVHA 2GR9A 2QT9A 1HT3A 5KIAA 1ZIOA 4GXRA 2YVAA 1TTQB 5CLQA 4MDYA 5HIIA 3IVGA 4X6XA 4B79A 1Z08A 3OM1A 2MSDB 3AR7A 4I6JA 3F5DA 2CNDA 4Y9SA 4PPQA 2QQGA 3VV3A 1FU4A 4DIKA 1N8KA 1DQNA 2DH5A 3TQHA 3UWSA 4E6EA 3MEQA 4CKEB 3UPUA 3MFYA 2X3FA 2JVKA 3A9VA 3EEQA 2BR4A 1KEZA 2WZQA 1JHRA 2R7MA 4IX1A 1U0OC 2Q5IA 1WD5A 1L5HB 1DTWB 1QGOA 1X0VA 2BDEA 2WJHA 3BGWA 3F6RA 2F3QA 4OHWA 4Q12A 5CFZA 3QEBZ 1T3LA 1P1KA 2XYQA 4KJXA 2QLNA 2P35A 3ME5A 4KRXA 1V8PA 4NL4H 1GPAA 4BJ5A 3OZUA 2OCDA 2JGRA 4KXMA 4D3SA 3X2EA 5DBHX 3KOZA 3HYTA 4XJXA 4QKQA 4MUKA 1NF2A 1KP3A 1W73A 4NI5A 3TIXB 2AFHE 2OYCA 1L7MA 4XIGS 1UKBA 4NJEB 2WHPA 4DB4A 1EVLA 3GJ6A 3NFRA 4GI3A 4IHKA 1CUGA 3KYDA 1QLWA 3HCDA 4H18A 2FW6A 1DRVA 1J2TA 1OV6A 1PX0A 5A9TA 4EHJA 1P2TA 2R65A 4RZXA 3H5TA 2BI4A 4UU1A 3U3DA 1X94A 4EB8A 1BA3A 4OFZA 5KQPA 4P2GA 5IFKA 2ODTX 3GRFA 1U02A 1XAGA 5CA1B 3AL0C 3GVCA 3ZNNA 3CE9A 4PHGA 5CT6A 5AKKA 5EJIA 5FFNA 3S55A 1CP2A 2JGDA 3KE9A 1R3UA 1Z5OA 2JIRA 3H16A 3KL4A 4AC9A 4HGOA 4ZO8A 2VP6A 1HYBA 1BQ4A 2UXBB 1FS5A 4K6MA 3ETEA 1V11A 3HCCA 3QGMA 2BZGA 5DTJA 3RSCA 4C0QC 4E08A 2P2GA 2YZMA 4CIXA 1GTL1 2V97A 1ZRNA 4WJLA 2JZCA 4A03A 3EVTA 4QHSA 4EUHA 5IARA 5C8DA 3GFRA 1TNDA 3FRHA 3LC2O 4OF4A 3VOAA 2YYSA 3SEZA 4PC2A 3L4KA 1HRKA 2VDPB 1CDDA 2R6ZA 3KQVA 1LUAA 2V4ZA 2GESA 2BE9A 3A25A 5DMXA 4DIFA 4OHUA 4JWTA 3INTA 4HWTA 3ADCA 3QLVC 5EMKA 5IULC 5L3RA 4B4WA 2Z8XA 1K3TA 3BDVA 4D3FA 2B5VA 3K4QA 2J09A 3RRXA 2PYIA 3SYMA 4PRYA 2L19A 1A9XB 4DNQA 3K71B 1HKUA 1GKYA 1TTHA 1NI5A 4JL8A 5HGJA 4B47A 3KBOA 1KKMA 3A1DA 1KDZA 3N70A 1JG3A 1UXHA 1ILEA 3G5UA 3IP7A 4DDUA 2WAXA 3P9QA 3GAZA 4C29A 1PBTA 4FYYA 3FRIA 2MSKA 3OIWA 2OFOA 2Q3EA 5FBWB 1JXAA 1M2OB 3NTQA 1TLLA 1RJ9A 2XD9A 1EVEA 1M8FA 3A04A 3GA7A 3H2JA 3FWPA 3Q2IA 4BWGA 5G0WA 1JXQA 3P0EA 1YU6A 4N7BA 4NF2A 1PD0A 1DIBA 3DM5A 4UTZA 5F4BA 4CMCA 1ZXXA 1HYHA 1U0HC 1V4VA 5E6UA 4X71A 3TUJC 2G9ZA 3JVIA 2WJ4A 1SZCA 1V47A 4ALNA 2VJYA 3W1VA 1Z6ZA 5SY4A 3X2FA 1F3LA 5FEMA 1RKUA 3ZX4A 4Y30A 1YBVA 4QTYA 4NK4A 3SOZA 5DNYB 3L93A 3VPXA 3NT5A 1BJTA 1QKKA 1YDHA 3W5AA 3AVQA 1KS9A 3ESDA 4QO7A 4CKZA 2HHCA 4FFMA 4KKXB 1WBJB 4C43A 1J9ZA 3TGPA 3QUQA 1OHHD 4QICA 5HK8A 4ENQA 3HEBA 2QD1A 1TK9A 4KKVA 4JEHA 1O6GA 5DN6A 3UO8B 1E7WA 4HXYA 2VPYA 1QAOA 1JR3A 1RI1A 1G6HA 3FR8A 1ZY2A 1G5HA 1V7PC 4YRIA 5DGCA 1R88A 2G9QA 2VR1A 1QOZA 3V55A 3S8YA 2PCJA 2GZAA 5LYJA 2WF5A 5AVJA 3K0HA 3SEAA 1SVOA 1LBEA 3U7FB 3E7DA 1MIOB 1QIIA 1Y3DE 4N3GA 1EWKA 2CDAA 1O54A 3R6TA 2QTRA 4FZJA 4PLHA 1ZHFA 2BLLA 2HPHA 3GELA 1WNTA 3PT9A 2FMFA 5CA0B 3WKEA 1B16A 4AMYA 5DGHA 5GTDA 2QQEA 4NS4A 2GX6A 3ZDEA 4AMGA 1U3WA 1NLMA 2V4MA 2SBTA 1WSWA 4K2AA 2NT3A 4KH1A 3KD3A 1AMNA 5IMBA 2XGOA 3VU8A 1C7JA 1PBNA 1V6AA 3A26A 1UODA 3ADPA 3IE2A 5BUQA 3AJ9A 4FEAA 3EAQA 1V43A 4AIRA 3JQAD 4L7QA 3AFGA 5ERGB 3U3RA 2CNKA 1CQPA 1G2OA 1XKTA 3OJCA 1QE5A 4NIMA 1QHHB 2RKBA 4OLBA 4ZQEA 5C4MA 2DTXA 5FR2A 4J75A 3EF0A 3LPLA 4CW7A 3DBRA 1FNNA 4UAVA 5DB4A 2X7XA 3K05A 4JOQA 1XDBA 5H83A 4OSEA 2WKWA 3UA4A 4MYCA 1J2JA 1KZ6A 4YAFA 1E1QD 5BT9A 4DYDA 3CT6A 5TQ2B 3HDJA 1MV5A 1OF1A 1QDEA 4AYWA 1CEXA 3F2VA 1MIHA 5DX0A 1RHUA 1FB5A 3W5UA 4KWHA 4EVIA 6REQA 3TCKA 6ABPA 5DHTA 3OCWA 2QWXA 5DMHA 2Z2YA 3SLRA 1GCGA 1R64A 1K8RA 3R7FA 3TW6A 2WVAA 3MMXA 3DBHB 1JU4A 3BIFA 3SF0A 1E2UA 1FTQA 4YMGA 1YF3A 3LT1A 2TMDA 5AK3A 2X0RA 2C5BA 1F3OA 1V1JA 3KVRA 3BBPA 3NANA 1WUHS 4EW2A 2Z56A 4KR3A 1H3EA 2RHMA 1WU8A 3RGWS 2ZWAA 3KPWA 3O8CA 3ZD6A 3LVQE 4BNJA 5JC1A 5FWDA 1KAMA 3VDRA 4B81A 1ORRA 1U31A 2H0QA 8ADHA 5AHRA 5JV5A 5DDIP 3U5TA 1FRFS 4FNAA 1O5OA 1UT6A 2IXBA 4NENB 3GUYA 5ALMA 4CT0A 1BHJA 1XQXA 2PL5A 3WISA 4EM6A 3EARA 2Z8YM 5BSHA 3WL6A 2Z98A 1XAJA 4NBLA 2LBPA 1E2MA 2WG1A 3ZJUA 1P7VA 4EJ2A 1SBHA 3ZQKA 2NP6A 1I33A 4CN9A 3I5XA 2X2OA 3ZZNA 4ZGGA 2YMMA 3LA6A 1H6AA 5GPBA 4HH3C 4NBKA 1OB5A 2D0IA 5K3BA 3ZH2A 2HBYA 3Q9LA 2J0QA 2WHEA 4WBXC 2C0QA 4ZN6A 4DLXA 3OU7A 1BE8A 1GPDG 2Q8PA 5C0OE 4TXNA 4EA7A 1YONA 3PYXA 4HUQB 4QGAA 2H1LA 3QVWA 4FZ3A 5K8CA 3UGJA 3ZU4A 1HNWB 1DHRA 1BW9A 2ZBUA 4IQ4A 1I14A 1R0WA 3FTQA 4PGAA 4WADA 5EQJB 3I8OA 4A8HA 2YIVX 2YWXA 4E5UA 3HM2A 1S2NA 5FXMA 1YZYA 5EIFA 4KGDA 4L85A 3T5AA 3OU6A 2TS1A 2W71A 2WW8A 3T9DA 3L4JA 1D5WA 1U8AA 3EF3A 2NV0A 1OAOC 3UMVA 4F3NA 2VDOB 3VOTA 5DYTA 5HKKD 4AQ7A 4YRZA 2Q99A 3C7TA 3R9WA 5LNK1 4UTXA 5KEIA 3KSBC 3R1IA 2YHAA 1CZUA 5ALZA 1OSNA 3FXAA 4G0UA 5F2OA 4N3AA 1P4RA 2G7ZA 3VPFA 5HBRA 4F45A 3EPJA 2WJAA 5M04A 4MYHA 2YYYA 2PRJA 4KIUA 4PZAA 3GRRA 3PVZA 3R6WA 1EBBA 3HCOA 2RGEA 2GA9A 2EKDA 2V8OA 1GFSA 2ERXA 3WTCA 4E14A 2HXYA 3BGSA 4YAIA 3CVXA 3KPYA 4EUEA 1YR2A 4LZWA 1COWD 1OROA 2QOEA 2ZSIA 4PFSA 1H94A 1DRUA 1GAEO 2H2FA 1GPUA 1L3BA 2QU8A 5IC4A 4UEOA 1H0SA 3M33A 2HQBA 3S2IA 3NHJA 1RYEA 3TIIA 2V55B 3VOSA 4AJ2A 1IXKA 1H23A 5C5EA 3D5QA 1AGRA 2J08A 5CR9A 5HJEA 3LF2A 2WPNA 4N49A 5ILQA 1ZD8A 3DT8A 2JAUA 1JAZA 5IM4A 3EMKA 2RAUA 1T36A 4JQZA 5TXGA 5HOQA 2QZPA 1ZK4A 3L7NA 1HKHA 3VKVA 4C3OB 4E2WA 2BZSA 4B8YA 1RVDA 2XNKA 7YASA 4JXZA 2FWIA 2GBIA 3H1FA 4PNZA 5D3MB 4E7PA 4IV5A 1FX0A 1FC0A 1OY1A 3RBXA 3F5FA 1K3FA 4LHWA 4CLRB 5J4VA 2G80A 3G8YA 4O2AB 3HFSA 3LWZA 2PZAA 3L07A 1FP4B 1R0YA 3CGWA 4P4TA 3ZLUA 4GC5A 4ZICA 4ZJUA 3AF6A 3AVXA 2A4MA 3FF4A 4TTIA 4V03A 5A0VA 1AB6A 4CUJA 5AI8A 1U1DA 3D64A 5B6JA 3LX4A 4F38A 4KDEA 5DO9A 4ZOEA 1X1RA 3FTPA 4RW0A 4AP6A 3EA0A 3CPSA 1DADA 3V4SA 3MS4A 4I4LA 5LZ2A 2IOYA 4FHFA 4OA5A 2GAJA 3IDQA 5ANRB 1JQLB 1JR3E 1PR1A 3WSTA 1EBFA 1PL8A 4Y2VA 3WWZA 2QBYA 3K35A 1KDOA 2VZLA 2QTMA 4C4TA 2WDZA 1N0VC 3IQXA 3WLPA 2QAGB 2OT3B 1HFJA 1WX1A 1A8PA 3LCJA 3OT1A 3RFVA 4PC1A 5IF3A 1JJFA 5DLPA 4D98A 4YRGA 3WGTA 2I8CA 1DC8A 4D96A 5JSUA 3LI2A 1C3OA 2AA3A 1K4MA 2J67A 2VTKA 1G7RA 3OCVA 3VO2A 2PMDA 4BMNA 1Z33A 2IEDA 2IPNA 3EDYA 2ZBVA 2CLHB 5DX8A 2VDRB 5JSKA 4C4AA 2FTKE 4EG3A 1W35A 3RIMA 1RSZA 1Y8RB 2K6GA 4B73A 1H6BA 3BWDD 2HQRA 3AG5A 4J94A 3STVA 2B61A 2YW2A 1T29A 3A27A 4KVGA 2XXJA 4YRRA 3BL8A 2XB9A 4O63O 2HWKA 2P3OA 1ZD4A 2OLKA 1ODTC 4IRXA 4A8PA 1GV1A 4I99A 2D2XA 2H54A 2VRCA 1P7WA 4HN4B 1G8AA 2GZHA 4XD7D 2OO5C 1Z0SA 3RUPA