1XDWA

Nad+-dependent (r)-2-hydroxyglutarate dehydrogenase from acidaminococcus fermentans
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
331
structure length
331
Chain Sequence
MKVLCYGVRDVELPIFEACNKEFGYDIKCVPDYLNTKETAEMAAGFDAVILRGNCFANKQNLDIYKKLGVKYILTRTAGTDHIDKEYAKELGFPMAFVPRYSPNAIAELAVTQAMMLLRHTAYTTSRTAKKNFKVDAFMFSKEVRNCTVGVVGLGRIGRVAAQIFHGMGATVIGEDVFEIKGIEDYCTQVSLDEVLEKSDIITIHAPYIKENGAVVTRDFLKKMKDGAILVNCARGQLVDTEAVIEAVESGKLGGYGCDVLDGEASVFGKDLEGQKLENPLFEKLVDLYPRVLITPHLGSYTDEAVKNMVEVSYQNLKDLAETGDCPNKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD+-dependent (R)-2-Hydroxyglutarate Dehydrogenase
publication title Structural basis for stereo-specific catalysis in NAD(+)-dependent (R)-2-hydroxyglutarate dehydrogenase from Acidaminococcus fermentans.
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Oxidoreductase
total genus 120
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.-:
pdb deposition date 2004-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xdwA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xdwA01
1EUZA 5JBIA 4CV0A 2V6BA 2R00C 1P0CA 1E7SA 4BS9A 2HUNA 3VH4A 1NM5A 1QMGA 1U3TA 5JC1A 1P1KA 1U8XX 3F5QA 1Z7BA 2Z1NA 4CMEA 1SEVA 4IQGA 4Z9YA 4CJXA 3HFGA 2F1KA 3GN2A 4MIYA 1JU9A 1X7DA 3NUGA 3RUEA 4FFLA 4RQTA 2FZEA 3K2BA 3JYLA 1NHWA 3NJ8A 1H6CA 1KBZA 1BSVA 3PJFA 4XIYA 1EZ4A 5JCJD 3SJ7A 4TZKA 1PJ3A 1YS4A 2JJYA 1YDWA 4M8SA 1J5PA 4R1UA 4IIVA 1GAEO 1XA0A 2O3SA 3R6DA 3LVFO 2FR0A 3VVCA 3ZN2A 1PGQA 4PLGA 1ZVMA 1I30A 4U5QA 3NTQA 3K31A 4YA6A 2AW5A 4ND1A 3ZNPA 1G6KA 2B69A 4CMIB 4ALKA 1ZNQO 1UXKA 4CMAA 3QVSA 3DBLA 1T25A 1YBMA 2RIRA 2DT5A 2HMVA 5JYEA 4NU6A 3NTOA 1TT5A 3GGOA 2NV6A 3KEQA 4WUVA 3SEFA 2NACA 4L9RA 1YONA 3OIGA 2NVUB 4BNHA 3VHRA 3EZLA 4IJUA 3KSZO 4CQLA 1LLUA 2IXAA 2UYYA 3HB5X 1E1NA 1JTVA 1T2AA 4K9DA 4L73A 3F46A 4E6PA 1O6ZA 2VRBA 1EDZA 3WWZA 3KBOA 4BNVA 1GYRA 5F21A 4CLDA 1NPDA 3RASA 2PD4A 5T67A 5TGDA 3GC6A 2DBRA 4MVJI 1T4DA 3B1JA 1HT0A 3ANMA 1LQTA 2XOXA 4Y8VA 1JVSA 5COAA 3SLKA 5IXYA 2O48X 2P4HX 1WZEA 4HX5A 4OQZA 3D7LA 3RJ5A 1OZAA 5DBGA 1ENOA 3BMQB 4RLHA 4EDFA 4IBOA 3K9QO 1R6DA 1N7HA 2PV7A 3NDRA 4E33A 1ISIA 5L4SA 1ENPA 3DWFA 1XELA 4YRBA 3G1UA 1BRMA 2VYVD 4JCOA 5ILGA 1YVEI 2EP5A 3EYWA 5K6AC 1HRDA 4GQAA 5CEJA 1YL7A 4AVYA 2PWZA 1BXZA 4YRDA 1SNYA 4IIUA 4PVDA 4UULA 3KV3O 3G3EA 1FXSA 3N74A 3RUHA 1XEAA 3OM9A 2C54A 2WSBA 3R1IA 2J5KA 3ASUA 4BIIA 1F17A 2DTXA 4CM9D 3ITDA 2G0TA 2JFHA 2GZ2A 1SCUA 3ZV6A 2P68A 1SAYA 3D5QA 2DBVO 3BTUA 4W9NA 3ETDA 1V6AA 1Y9EA 3C7CB 4XJSA 3RC2A 1NYTA 4JJGA 1WPQA 4G5HA 4NK5A 2UV8A 1JKIA 4J1NA 4AJ4A 2DFVA 4HKTA 4Y9DA 3DC2A 3KVOA 1QSGA 4NR0A 1LLDA 1RM0A 3PP8A 3U09A 3KYDA 2HCTA 2NVWA 3WGYA 3WDSA 4RPKA 4YAJA 2JL1A 4R1SA 1ZZEA 1IPEA 2HMSA 1ENYA 1S6YA 2GLXA 2VUUA 2YY7A 1J6UA 2FPGA 5IJZA 3ZU4A 3M6IA 2FR8A 3JTMA 3JV7A 3HFSA 4ND5A 2I66A 1RJWA 1XYGA 3ETGA 3I9MA 3OIFA 1NAIA 4RCVA 1NNUA 2V7PA 5A9RA 4BNZA 1M67A 2ZB4A 3BMOB 4CQMD 3H9JA 4R51A 4S3MA 5JXWA 2D4AA 1O95A 3WLEA 4E3ZA 5KJ1A 2VZ8A 3OJFA 1QYWA 3QRWA 5JY1A 2EGGA 1H2BA 1GZ4A 3H5RA 4RQUA 3OH8A 3ZHZA 3NX4A 5IG2A 3TF5A 4NBTA 2B37A 1NFQA 3EY4A 5TRTA 3UOGA 2FSSA 2VWGA 4GVXA 4NFHA 1M6HA 1HWYA 2X0IA 4BB5A 4FFPA 4XGKA 1V35A 4BQPA 4WLNA 1DBVO 4CR7A 4GBJA 1M76A 3AUUA 2AXQA 1B7GO 3I83A 4TVOA 5CPFA 4FC6A 1JKJA 3R0IA 4XR4A 4FW8A 3WX0A 5IAAA 1Z6ZA 1KEUA 4XZ3A 5A03A 2HLPA 1F8FA 5MDHA 3OF2A 3VTFA 1MC5A 3S1LA 3PQDA 1LQUA 4MP3A 3UXYA 1IY8A 1BXGB 3PHGA 4BL5A 3KLMX 3D3EA 4YJFA 4YJDA 2X8LA 2RHCA 1E7QA 2PD6A 4BV9A 1LX6A 3FR8A 3OBBA 1H9BA 4AJOA 1A4IA 3QWHA 3QY9A 1HDYA 4PLHA 4PZEA 4ESOA 5MGBA 5G4KA 1NP3A 3NT4A 5CDSA 5ILOA 1ZJYA 5FFFA 3RROA 4CMHA 5DCYA 3ST7A 4XQEA 2F00A 3WYEA 4CR8A 1PQUA 2X0RA 1LSUA 5K6AA 2B5WA 2GD1O 4PN3A 2GF2A 1OOEA 2AG5A 3MWEB 1LA2A 3S55A 3S8MA 5JFOA 1AUPA 3U62A 4CM3A 4ZICA 2RAFA 5GZ1A 4R54A 4NZ9A 1M2WA 1YWGO 3OJLA 3FTPA 3GNQA 4YT5A 4JK3A 1B3BA 4R1TA 6ADHA 1PS9A 4U7WA 3WLFA 3W6ZA 5FWNA 5JAIA 1LTHR 3RUFA 3R3SA 1B15A 3K8ZA 3ITKA 2O7QA 3ZU5A 2ZKLA 1PSDA 3F1KA 3GHYA 1P9LA 1LRKA 4EW6A 4YQYA 4WOKA 2Y99A 2IDZA 2TMDA 1HE3A 3WR5A 3OP4A 3NEPX 4KUHA 2VRCD 1E7MA 1O0SA 1DRVA 1VI2A 3CE6A 1NPYA 1FDVA 1VJ0A 1PR9A 2GPTA 3C1OA 2I3GA 3AI3A 1CETA 4AL4A 1W6UA 4I5EA 2AE1A 4IJVA 2V65A 3TFOA 1PIWA 2OBYA 1XU7A 3EMKA 1EBFA 1WAMA 2DU8A 1U3WA 2Y1OA 2VHXA 4J7XA 1NWCA 3K96A 4RLSA 2DTDA 5T8KC 3GNSA 1ZSNA 3VTZA 3PFWO 4GX5A 1E1LA 2AQIA 3IDSA 3U3XA 4D7AA 4I08A 3W6UA 1P45A 2FPPA 3HG7A 2BFAA 4GSLA 5DULA 1F12A 3VH3A 3NTRA 1V3UA 4BGEA 4NQZA 3VC7A 1DIGA 3BTVA 1RKXA 3PYXA 5IXSA 2OO5A 4N18A 2X9NA 1YDEA 3H9UA 4UVHA 1XR3A 4RF4A 5L9AA 2IZ0A 5F5LA 3BAZA 3ZGYA 5EQDA 1E3LA 3DAFA 3GK3A 3AOEA 7MDHA 4MDHA 5BNTA 1GCOA 4HFJA 4MKRA 3H9EO 2EWMA 2YW9A 4TSKA 2UUOA 3R3JA 3G17A 3KM0A 5DF1A 2VNAA 1EVIA 4JP2A 5EN4A 5DT9A 2Y66A 5C37A 1HE2A 4DC1A 5JNLA 1LBEA 3RWBA 3TRIA 1ZEJA 2PY6A 4FFNA 1YB5A 3L6DA 4KDFA 4CUKA 3ZWCA 5CEEA 1GQYA 1R66A 3FD8A 4LN1A 4PG6A 2E6UX 2ZTUA 4AJNA 3ZWAA 2WYVA 1GCUA 3PYMA 4Z3KA 1YQDA 3OEWA 4MKXA 5F1OA 3VVBA 3A06A 4EUFA 4LCJA 3E48A 3OSUA 3D3WA 4XEHA 4GKVA 4LSWA 5IF3A 4M86A 1H6AA 2WD8A 4QUKA 1TXGA 2YFQA 4Q3CA 4YJGB 4ALLA 3EK2A 4WNCA 3WTBA 4BGVA 5DDIP 4M1QA 3EC7A 3HN7A 2D59A 4IDDA 2CDAA 4ROSA 1LUAA 2VTEA 1KYQA 2GN6A 1IHYA 3ROMA 3ZWOA 4KDEA 3F4BA 1BG6A 1F0YA 2X9GA 1YBVA 3E8XA 4E32A 3NDJA 4RDHA 2NM0A 3RUIA 3NGXA 2WE7A 3MJVA 4S1VA 3DBHB 4EJMA 4R3NA 2YYYA 1Y5MA 2GDZA 1TA4A 4MIEA 3CMMA 3O8QA 5COQA 5EPOA 2O3TA 1T24A 5EL0A 4CLOB 2B0JA 5JLAA 5T57A 5COBA 2G1UA 3HB4X 1Y5RA 3EVTA 2ZYGA 3AM3A 4J0FA 3UVEA 3ZWWA 4R68A 1PZGA 3PHJA 4D46A 5A5FA 1PZEA 5TF4A 1JAYA 1SZJG 3GR6A 1UXJA 3NKLA 4A0SA 1E3EA 3AI2A 3Q2KA 1I2ZA 1PZHA 3H3JA 1VSVA 4RORA 1Q7BA 3GVPA 3DBVO 4NBVA 3LLVA 1LLCA 1VKNA 2GRAA 3LT2A 2ZJ0A 4K6FA 1B3RA 4CM5A 1H94A 4BNLA 3PWKA 1OFGA 3JQ8A 5AXBA 1PQWA 5AXDA 2QRKA 3H8VA 5IZCC 3WNVA 1R15A 1CYDA 4MKZA 4BO2A 2R6JA 1C1DA 3S2FA 4YXFA 4J91A 3L4BA 1C0PA 2B36A 4O59O 3OQ6A 4WPGA 3H5NA 1ZIDA 5T8KA 2C7VA 1YL5A 4KZPA 3DZJA 2ZB3A 1HYEA 4FC7A 4CUZA 2NU7A 2NU8A 4B79A 4EZBA 5L51A 4Z9XA 4UREA 4YEDA 1AHIA 2G76A 3K92A 3IUSA 3HDJA 4J9UE 1IYZA 1D4FA 1GZ6A 3HJAA 3I1JA 4N54A 1FDSA 3INRA 4DA9A 3L6EA 4D3SA 1ZSVA 5JCJA 4XDYA 1QRRA 2PA3A 3JSAA 3ENKA 3OHSX 2C29D 2I9PA 3VPGA 1LSOA 1ZXBA 4W7HA 3OIDA 4ND3A 1VJTA 2O3RA 2OGUA 3MOIA 2EF1A 4LGVA 4JROA 1DIAA 1I0ZA 3BTOA 5KOIA 4WLEA 1ARZA 3V1YA 2Q2WA 3DBRA 1RM4A 2GGSA 2VQ3A 4ZQEA 4Z0PA 1U1IA 2AG8A 3EAGA 3MCVA 3OEYA 4PRLA 4RVHA 4K6CA 1TB4A 1UZNA 1KC3A 1PL8A 3PTZA 5B4UA 3GAZA 3FN4A 1E3WB 4DL9A 3BMNA 4TWRA 4WEQA 2O4CA 3PIIA 1GR0A 4OXKA 4YCAA 3MOGA 4NFSA 1D3AA 2QQ5A 1AE1A 3E9QA 3GVXA 2B5VA 3JD3A 3RUCA 3WJAA 1N1GA 4GWKA 2JD1A 2EW2A 2J5QA 2YJZA 3RU9A 3WQRA 2PKQO 1V8BA 3AUAA 2ZQZA 2B35A 5TJHA 2YDXA 4UEJA 5FYDA 5AYVA 3C85A 5JO0A 3STHA 1ML3A 1RM5A 2BKAA 3WBBA 2P91A 4RVDA 2GN8A 5JAQA 4MVJD 3KETA 2YQ4A 2P2SA 3BMCA 3QA9A 2YQ5A 5THQA 4D42A 3FPCA 8LDHA 5CDTA 2VYVA 5IDQA 4EGFA 3QVOA 7ADHA 4IJWA 4BKRA 4F6LA 4HNGA 5TS3A 1MC4A 3OETA 4AG3A 1A9ZA 3PWZA 2NTNA 2CVZA 1HDRA 5IDWA 4F45A 1SOVA 3I9KA 1T2DA 4DBVO 3IP1A 4BNFA 2GZ1A 3CXRA 5KVCA 1YO6A 4ID9A 4ZQGA 4R41A 4CM9A 3WGOA 3FNFA 4A03A 2AEMA 3ZWMA 1ZK1A 1YKFA 4NU5A 2HU2A 3NDIA 3RFXA 5I7SA 3CMCO 3GNTA 4IDBA 4DUPA 1GV0A 1O8CA 1VL0A 3RFVA 4CV2A 3A28A 4TRJA 1VL8A 3WQSB 1MA0A 3PWSA 3I5MA 3HE3A 2GZ3A 2VWQA 4DQUA 3V2HA 1SPXA 4JBIA 4OQYA 3JQ9C 4WCDA 4QO8A 4CUJA 4XWYA 5EESA 1JWBB 3JQBC 3TDKA 4BNGA 2HO5A 4CM8A 3L07A 3EZYA 2QHXA 1P44A 2ZTMA 3ZHXA 1A7KA 2FR1A 3VH1A 1LDBA 1RYDA 3GVIA 1B0AA 3ANNA 2GO1A 3BHIA 2O23A 1BDMA 4M54A 5EINA 1DRUA 1XCBA 1E6UA 5BSHA 3JQ7B 4GKBA 1Q7GA 5A3JA 1Y7TA 3T4EA 2IE0A 4IDAA 2POQX 4CQMA 4EJ0A 4YJHA 1O94A 1X13A 3O4RA 4C7KA 3WFJA 2HKIA 3M1LA 1R4NB 4PLZA 3VPFA 1CDOA 3GZ4A 1Y81A 1SO8A 3LU1A 1CEQA 2AA3A 1XHLA 1I32A 3MTGA 2C7GA 2NU9A 4QFCA 2FHSA 4WLUA 4IPTA 3JQEA 4CMKA 2PGLA 4XX0A 4TROA 3Q11A 4NBUA 1LRLA 2BGLA 2BFPA 2NNLD 3WMXA 4W9NC 4WEOA 2DVMA 1YGYA 4ALJA 2J3KA 4NH4A 5L95A 3NAQA 2WMDA 2VHVA 3LC1O 4HNHA 1E3SA 3JYNA 4WGGA 2A92A 1O5IA 4A26A 1DDOA 4D3FA 3F4LA 1Y8QA 3C24A 2EGHA 4KWIA 3LK7A 3UN1A 3ZWBA 3DO5A 1U7HA 3D4OA 5A06A 3CKYA 2DTEA 2X9VA 1MV8A 3GZNA 1A27A 4KOAA 3LDHA 3ZCXA 5GZ3A 1UR5A 1GDHA 2WD7B 4TMFA 3I4FA 3KOUA 2WM3A 4YB8A 2O4UX 4NJMA 3FNGA 3W1VA 1C1XA 1Z45A 3ZWXA 1DPGA 4EITA 4Z9FA 1WWKA 5J23A 3B1KA 3SBOA 1JLLA 2OOSA 1HYHA 2FSVA 2FPIA 4PFJA 3V1UA 1XKQA 3KYCA 5I9NA 5IDYA 5CDGA 5HM8A 1OAAA 4DYDA 2HMUA 2DKNA 5TX7A 1SBYA 2BFOA 1ONOA 4IINA 3DEYX 3ABIA 3L4SO 3EW7A 8ADHA 1U7TA 1NR7A 3NGLA 3CEAA 4YRAA 1PGOA 5I7FA 5AXCA 3D1LA 3MWDB 2GUGA 2GN4A 4NIMA 3DOJA 2NSDA 3WSVA 1HDGO 1LU9A 3UICA 4RVUA 3D0OA 5L45A 3RC1A 4BNNA 1L7EA 4R4JA 3WB9A 3D64A 4DQVA 2OP1A 2AEJA 1U5AA 1MX3A 1NVTA 1N9GB 3MJEA 4OXYA 5C5IA 4AJIA 3N7UA 1NPTO 4Z0TA 4ZJUA 3P2YA 3SC6A 2GERA 2X5JO 1DC5A 2VRCA 5DOVA 1KERA 1PJBA 3FHLA 1EVZA 3JQ9A 4YWJA 1OI7A 4WCFB 1OMOA 2J3HA 1ID1A 3JQBA 3H6KA 1X1EA 2Y0DA 3LC2O 4PGFA 4QX6A 4B4VA 4E5MA 2EERA 4Y6PA 3ONEA 4II3A 1DIHA 3SLGA 1UDAA 4AFNA 2CDCA 2YHIA 3H5AA 3ENNA 2CUKA 4LVCA 3E03A 2CNBA 3JYPA 2W2KB 3UHAA 3VAZA 1VJ1A 1JVBA 3PHLA 5B4TA 3EUWA 3G49A 3ZV5A 2BGKA 4XA8A 4B3IA 3KLPX 3L9XA 2GYYA 4M87A 1DEHA 1UZMA 1LNQA 2VTDA 3UF0A 3WFIA 2NQ8A 1B26A 2Z95A 3S2EA 3WICA 1K6IA 2X7HA 3ZH2A 4B7XA 4YT4A 4GVLA 4OSPA 3FWNA 3PGJA 3WG9A 1KVSA 3O9ZA 1PEDA 4Q3AA 1DFIA 1JWAB 3RFTA 3DZFA 4GLOA 2VT2A 4MVJE 3V8BA 3TNLA 4IDFA 1AN9A 1MXFA 3B6ZA 2H63A 3CH6A 1Y1PA 3GPIA 1FDTA 3LT4A 1NHGA 4FDAA 3WTCA 4BO7A 3UW3A 1JW9B 1A4UA 3JQAB 3PEFA 1PZFA 2CFCA 3AK4A 2Y1EA 4JN6B 4GX1A 1IE3A 3PDJA 4Z6KA 1E77A 1IZ9A 1HE4A 1DJNA 3JQGB 4IDGA 2B83A 4BHTA 3DZKA 5G0TA 5JMPA 2IZZA 4BO9A 3P5SA 1G1AA 3FRJA 4H16A 3SJUA 3TJRA 3A9WA 3IP3A 4ZA2A 4XB1A 3CIFA 3BYZA 4NNJA 4KUEA 4CLEA 1X0XA 2ZCUA 1GPJA 3O26A 3U4IA 5CPBA 3OJEA 4IJKA 1GADO 1GFSA 4WNIA 5EJ2A 4Y6RA 4L8VA 5FF9A 1K3TA 4BV8A 5HA5A 4PRKA 4B8ZA 2DUUA 1KOLA 1GD1O 4OOEA 4DVJA 4K26A 1EUCA 2I67A 5DCWA 4AICA 2O3JA 4IDCA 3T4XA 2PR2A 1UXGA 1A5ZA 4Q9NA 3RC9A 3PDUA 3DMYA 5GMOA 3UGKA 1Q2XA 3PZRA 2Q46A 3DZIA 1DFGA 3FCOA 3GDOA 2I76A 1WNTA 4FOSA 2YDYA 4UVEA 4BMSA 3AOEC 1GYPA 3L9WA 1EQ2A 1VM6A 5I8ZA 5FI5A 3RBZA 1QYVA 3TOZA 2VYND 1B16A 5IFLA 3E1KA 4XQCA 2HRBA 3AM4A 2CD9A 2XPCA 1YXMA 3ADPA 5CG1A 3I23A 2QYSA 4J1TA 4NJOA 1QKIA 1ADCA 4UEKA 4HBGA 3T7EA 4B3HA 5L7TA 4ZRMA 5BQFA 1P1IA 4CPDA 1PGPA 3ZNOA 4ZU3A 1HL3A 3PFFA 3GMSA 3A4VA 4GX2A 1I3LA 4P4GA 1DHRA 4WK6A 4DMLA 1I2CA 3WNQA 2AEFA 4TZTA 2Q3EA 5DCUA 2EHDA 4O1MA 1LDGA 4BO8A 1KEVA 3GN1A 3GGGA 4P4LA 3B20A 3H4VA 3KUXA 4A27A 2IEDA 4R5MA 3FBTA 3AFMA 5A4DA 2Y0EA 2RCYA 1VLLA 4FJ2A 1E6EA 4HWKA 3JYOA 3EVNA 5DBIA 4DXHA 1ISGA 5ITWA 5A9SB 3BIOA 2IXBA 1Y9AA 4FN4A 3MTJA 4GAEA 5G4LA 4NBWA 3RC7A 3C8MA 3DB2A 3ORFA 4KQXA 3INGA 1U8FO 4R9RA 5JAZA 5JYDA 1RPNA 3DMTA 2CF5A 2X5OA 1PJ2A 4YPOA 5U4QA 4E2XA 1QORA 3QWIA 1K6JA 5JAMA 2XXBA 3PRJA 4J43A 1ZSYA 3Q2IA 4JJFA 4CMIA 4XGNA 2Q2QA 4XRGA 1ONPA 4D45A 4ONEA 2J6IA 2J8ZA 3PZBA 4CM4B 2W4QA 3TWOA 1C0LA 3A14A 2NVUA 4L4RA 2VZ0A 2ZTLA 4TVBA 2B4RO 1HKUA 1BHSA 1VE9A 1BVRA 2PD3A 1ISMA 4J4BA 5AQ1A 1QLJA 4UUMA 3H7AA 4CL3A 2JFGA 4FOOA 2J5RA 5AVOA 1TLTA 1C0IA 1YOVB 4RDIA 3GA0A 4AJEA 2G5CA 3BHMA 1HETA 3FPLA 1WP4A 3COSA 2JD0A 3L4BC 2NU6A 2C5AA 3H2ZA 4X54A 4JBGA 4D3DA 3HZZA 1R0KA 3INTA 3PLRA 2BRUA 5KVQA 3TQHA 4CLHA 3BMQA 3GAFA 4PCVA 2EIHA 2ZB8A 1V3VA 4ZGWA 2Z1MA 4WLVA 5L7WA 2O7SA 4FJ1A 5EERA 3WGTA 3K30A 3F3SA 1MLDA 4BNKA 5A5EA 3I9NA 1E7WA 2NWQA 4MVJA 2HJRA 2B4QA 3QVTA 2GASA 4E5KA 3GHHA 4XCVA 4FSHA 2JCVA 2I3AA 3GEMA 1Z82A 1YQXA 4Q3NA 1QYXA 2HQ1A 4YBZA 3NRCA 2WTBA 3C1TA 4D79A 3IUPA 2AE2A 5KKCA 1YB1A 4ND4A 2D5CA 1DO8A 1X7GA 4JLWA 1P74A 2R2GA 4NBRA 1IB6A 3QLJA 1HSOA 4KUGA 1HLPA 4QXMA 4NDNE 2J3IA 1D8AA 1P1HA 3KYBA 2O2SA 3AY6A 3GH3A 2AQKA 2OZPA 4WASA 4G65A 1PJSA 3G1TA 5HWSA 4IMPA 2B4TO 5JW6A 1A9YA 1EK6A 4RF3A 4CLRB 5JMWA 1EK5A 2EKLA 4O5OA 3FNHA 4KTVE 1EFLA 2UUPA 4XRRA 3KEOA 1ZUD1 2JFFA 4OAQA 5I9LA 1BW9B 5DP2A 2YUTA 3HADA 3DHNA 3DONA 4M55A 5G0VA 1LEHA 2C2XA 1T2EA 2NTVA 3O38A 1C0KA 3ZWNA 4CV1A 2ZTVA 3ZU2A 5G0UA 3WXBA 4E5NA 3JQFC 2Q1UA 3AU9A 1ULSA 2DPHA 3ZWPA 4D0RA 1LLQA 2Y1GA 4PLYA 5GY7A 2BH9A 1ZXLA 2O3UA 2JHFA 4HUJA 3E18A 2NVBA 1E3JA 4IQ0A 3FTNA 4Z0HO 1NWHA 4BVAA 1TI7A 3TL3A 3AOGA 3LLSA 3Q3CA 4L74A 2OHXA 3C1AA 4CLXA 5B1YA 1Y8RB 2PKRA 2DLDA 3E5RA 1AXEA 4Y67A 1R0SA 1X1TA 4J2OA 4ZVVA 3I52A 3IIEA 4PVCA 1F8GA 3AUTA 3W8FA 1VL6A 4ALMA 3WYCA 2I6TA 2EW8A 4ILKA 4W7IA 3L6OO 3X2FA 4KQWA 1LDMA 2WWRA 1LC0A 2RH8A 3FSRA 3DHYA 1HDZA 4WLOA 2P9CA 2JD2A 3PVZA 2EXXA 3FWZA 4J3FA 4BGIA 4BNXA 1MB4A 1JQBA 4RF5A 3V2GA 2D8AA 2C2YA 2HK7A 1I01A 1R4MB 2UDPA 2ZYDA 1HEUA 5T6BA 1DAOA 3ZW8A 4F6CA 1ZH8A 4BMNA 4DREA 3GUCA 1IZ0A 1XGKA 4JBHA 4RPGA 3U4HA 4GWGA 2QZZA 2VHWA 3WIDA 1TEHA 2QG4A 4MVJP 4I5GA 4I9UA 3RUAA 3QIVA 4DLBA 1BXGA 2HK9A 2C07A 4XYLA 2O2YA 3WGHA 3PQFA 3CZRA 3ZWVA 3ZV4A 4J6FA 5F1PA 3MJ4A 2RBEA 4MVJG 5H81A 2CY0A 1N92A 1QXSA 3HHPA 4FR5A 4YAGA 1I3KA 1P31A 3K5PA 2BMAA 1UXIA 3DL2A 3Q9NA 4DLAA 4BO1A 3ASVA 2OBNA 3RI3A 1CQJA 1EUDA 1LC3A 4I5DA 1WDLA 1ZK4A 4NK4A 5A3VA 3OA0A 1AXGA 4PIVA 1FDUA 2TMGA 1GUYA 4NG5A 3C7AA 5A1TA 1DHTA 4BO5A 5A02A 1KETA 3P19A 1DOHA 5AOVA 3RJ9A 3IS3A 4QECA 5DNAA 1JKFA 5L53A 3VZPA 1JDJA 2W98A 3LQFA 1R12A 4XDZA 5THKA 2DBZA 1NVMB 1ZCJA 2FN7A 1FMCA 3BA1A 4RO0A 2VOEA 3UH1A 1Z7EA 1U28A 4YAKA 1HDXA 1ZJZA 3D4NA 3HSKA 1X14A 3F9IA 1QYCA 4FGWA 4IDEA 2DM6A 3I9JA 1DLIA 2CMDA 3RBVA 4EUHA 3JD0A 3DXFA 5HBRA 4B7CA 4CR6A 2NTJA 3DBLB 4UVDA 2FY8A 3O03A 4L4XA 3DZHA 4XIJA 3VDRA 1FDWA 1GUFA 3DHEA 3W4JA 1KVQA 1TT5B 1Z73A 4L75A 4DPLA 1IOLA 2W2LD 5DZSA 1MFZA 3DAGA 5I9MA 3RKUA 4E2WA 1BWSA 1GTMA 2ZATA 3A1NA 3GVCA 4IZHA 3F6YA 5G0SA 1L7DA 3QJ5A 4OSOA 1E5LA 1EQUA 4CM7A 4CQLB 2NADA 2DAPA 3WMWA 4XGIA 1K6XA 4E12A 4UUPA 1NBOA 3B1FA 4LW8A 2Q49A 4ITUA 4GLLA 1O9BA 2AMFA 3JQFA 4DGSA 1P3DA 1HYGA 4EJ6A 2G17A 4HFMA 4R01A 1U5CA 2HSDA 1B14A 5ENVA 1DC6A 2UAGA 4Y98A 1QP8A 4XQGA 4M49A 3LYLA 1R37A 5JDIC 4YACA 2YFHA 1I2BA 5L40A 1ZK3A 4WE3A 1HLDA 3IKVA 3S2GA 3VKVA 3AUSA 5JY6A 2ZJ1A 2C0CA 2P4QA 3WWYA 2HAEA 1U9JA 2EP7A 1ZK0A 3H9GA 1DC3A 3BZUA 4FGSA 2PZLA 4A10A 1ISHA 1H2HA 4FJ0A 1NAHA 3OFSA 1PL7A 1R0LA 1EDOA 1WLYA 3GOHA 2CZCA 1BDBA 1GV1A 1J4AA 1A71A 2PH3A 3IMFA 1GEEA 4IGFA 4JNKA 2I65A 2PTGA 4YAEA 1XU9A 1E7YA 1B2LA 1YL6A 4E0BA 2X23A 3DTYA 2Y1CA 4BO4A 1YQGA 5TT0A 1SC6A 2X0JA 4GI2A 3JYQA 4OOFA 5KWEA 3VH2A 4BO6A 3GRPA 5HS4A 2Y1DA 2QX7A 3ZNQA 4LRSB 4GSKA 1I10A 5U1PA 1ORRA 1W8DA 1KEPA 2NQTA 1PJTA 3KB6A 3KYDB 2D1YA 2HK8A 3V2UA 3OMLA 3S2IA 4BNUA 2IEBA 1WZIA 5ENDA 3OJ0A 3AWDA 1VC2A 3M2PA 3LSYA 2C82A 5HS6A 4YJGA 3K73O 1PX0A 4P8RA 2X58A 2W8ZA 1O89A 2VOJA 2Y93A 4R16A 4BNWA 3AY3A 5C3MA 4R3WA 3DFUA 3UKOA 2WJPA 3I9LA 4MOWA 1EVJA 3SC4A 3DR3A 1JN0A 3GG9A 1ULUA 1NQTA 1ZMTA 4I5FA 2X4GA 2X5KO 4LCEA 2WEKA 4E4YA 4YVFA 3DBHA 1K2WA 4L76A 3FI9A 3QHAA 1GUZA 3L0DA 4TKMA 5C7IO 3ZNNA 2SCUA 3W4IA 4J7CA 5CG2A 1ZW1A 2AHRA 3IJRA 3E6AA 4CLOA 2VYNA 2ZCVA 3G79A 4J90A 1XG5A 2A35A 4RGBA 2PZMA 1T2CA 4B4OA 4DYVA 3QWFA 1ADBA 1WW8A 3RU7A 1GY8A 4FFOA 2PH5A 1I33A 2AQHA 2BF7A 3KO8A 5K0ZA 3GFGA 5F5NA 2ZQYA 3KXDA 4U6SA 3TZCA 1D1SA 1LI4A 3WQQA 1SMKA 2VWPA 4XQ9A 2W90A 5LC1A 1WMAA 4EYEA 4OKNA 1P1FA 4P22A 4XD2A 1IULA 3M1AA 3NYWA 1X0VA 1RYEA 2EKQA 4AJHA 4YJFB 4XYBA 1FF9A 3CZMA 4GPD1 4RPJA 4YT8A 4GMFA 2V6GA 2Q99A 4O63O 3NT5A 1ONNA 4GGPA 4UEOA 3DZGA 4BMVA 5U9CA 3RVDA 5BNIA 1CWUA 1BXKA 1GQ2A 4BOYA 3SVTA 3TPCA 3GGPA 5G4KB 1WMBA 5DBFA 2H6EA 4TKLA 4UAGA 5JDIA 4YDRA 5TT1A 4PLVA 3TZKA 1QG6A 3MJCA 3PJGA 2X0NA 5KJFA 3OECA 5CHEA 1RWBA 1UXHA 2QRJA 2E4AA 3QQPA 5JDCA 4PLFA 1K89A 4QQRA 4XB2A 3WGQA 2ET6A 4BNJA 3Q9UA 4QO7A 3LF1A 4DTIA 1V9LA 4JJIA 3JCZA 4QSMA 1LDEA 4RZHA 2YV2A 4RV9A 5ADHA 1CRWG 4RVFA 3GY0A 4G81A 3H9QA 1LSJA 3OQ1A 3PPIA 2WDZA 3NJ4A 3TOXA 4IXWA 1E3WA 3FBGA 4J0EA 4ZHSA 1DIBA 1PJLA 2OUIA 3HDHA 2BHLA 3CPSA 3VDQA 1H93A 4E5PA 2EKPA 5IN5A 2GSDA 4BKQA 3PK0A 5L4LA 3LF2A 1LDNA 5H83A 1I36A 3ZW9A 4CM1A 1S7CA 3IL2A 1HTBA 1MG5A 3H65A 5AXAA 5B4VA 2OL4A 2D5AA 4R1NA 1BMDA 1N5DA 2IRWA 1IHXA 1UP7A 1YBAA 2EEZA 5TNXA 5G0WA 1EFKA 4LSMA 1ZEMA 2YZ7A 5B12A 3MJTA 5EQFA 2E37A 2JAPA 4XJTA 3ZDFA 1I24A 1HF3A 3BTSA 1E1KA 1ENZA 1Z74A 2Y67A 4LRTB 4PZCA 3F47A 2E49A 3GT0A 4Q3BA 3DMTC 3ON5A 4P38A 1IUKA 2RH4A 3FNEA 5KJEA 1MUUA 2Q50A 2XF8A 3TZHA 1NFFA 3WBFA 3AJRA 4JQCA 1HDCA 3NV9A 3T7CA 1T4BA 3VZSA 4ZQHA 5BSEA 1GL3A 1KVRA 4RPLA 5LDGA 1A72A 4TQGA 1FJHA 1IPFA 2GN9A 3UAGA 1ZBQA 3AM5A 3PYLA 4NPCA 3HDYA 4ZRNA 4KTTE 1KVUA 2O3QA 4GX0A 1EE2A 5KJ6A 1LDYA 4BKOA 2YHUA 4N5MA 5C7OO 2Z5LA 4DPKA 4IS3A 1K0UA 1B8PA 4BGUA 4CMJA 2BI8A 1CIVA 1VKOA 4N5LA 4OHUA 3VOSA 3PHHA 4Q3DA 4EEXA 4WCFC 3PHIA 1U2GA 1N7GA 1DRWA 1G0OA 3RKRA 5ICSA 3ETEA 1HE5A 2VCYA 5GZ6A 4EEZA 2X1HA 3D3WB 1U2DA 4MVJH 2ZIZA 3GUYA 4ALIA 2R00A 1CF2O 2DPGA 1P77A 4OJNA 5DN9A 3HWRA 3ULKA 4PG8A 5LDHA 4QTZA 2H9IA 1I8TA 3JQ7A 1SB9A 3QV1A 1M6WA 3I6QA 1WXDA 4Q3EA 5F1KA 5FEUA 4H7PA 1NFRA 4ZQFA 5CDUA 1E3IA 2QRLA 3DAPA 2J3JA 3X2EA 2C20A 3QW2A 4J4TA 3RD5A 1DFHA 1R4NA 1I3NA 1T1RA 5EMHA 4INAA 4BO0A 4WJZA 4CMGA 5IDXA 3KHUA 2WE8A 4RVGA 1W0CA 2PNFA 4DIFA 3U9LA 4XYEA 3FR7A 1N8KA 4LVUA 5TC4A 4L4SA 1PGJA 1Q0QA 2EV9A 2VT3A 4FQ8A 4HY3A 3G0OA 1NX6A 4U6QA 4OGWA 1CQIA 1E1MA 3O8QB 1M66A 1ZMOA 1PS8A 3PI7A 3UCFA 1I5RA 4I1IA 4KMSA 4UVIA 1MGOA 4A73A 1AHHA 4YT2A 3RUDA 3IJPA 3L77A 2ZB7A 5KCZA 5TIIA 1W4ZA 4M89A 5CP8A 2WD7A 3VPXA 2Q4EA 4R9SA 2CDBA 1A7AA 2VN8A 5A04A 3W8DA 1I3MA 1DLJA 3WYBA 4DRYA 3DQPA 4YQZA 3LT0A 4IQ8A 2P5UA 4DIOA 3JQ8B 1EEHA 3ZZNA 4BB6A 6LDHA 4OL9A 1PWXA 2QW8A 2X22A 3GPDG 1PQPA 4OYRA 5TJ9A 1C1DB 3Q0EA 3AU8A 2JCXA 3WSWA 3CINA 5BNFA 1B8VA 4RJTA 4YTEA 4U0JA 3DFZA 4ND2A 1MG0A 1Y6JA 1HXHA 1GZ3A 1X7HA 3UFXA 4BNMA 1KC1A 4MP6A 4GGOA 2ILTA 3ZI0A 5G2OA 3ZU3A 4E21A 4DC0A 4YR9A 1WVGA 3I3OA 4WKGA 2A94A 3GEGA 3TFQA 1DAPA 4J1QA 5ITVA 1H0KA 4E30A 3GRKA 4AJ1A 1Q0HA 4OH1A 4NMHA 1UJMA 3GQVA 4A5OA 1NXQA 2V6MA 1L1FA 4W99A 5ER6A 3CTMA 3IKTA 1PL6A 1E0DA 5CEFA 4PG5A 4ALNA 1E7RA 5KVSA 3MEQA 5B37A 2VUSA 3AFNA 3UCEA 4PZDA 4C4OA 2D0IA 3PIDA 4CMCA 3JQCA 4XYMA 4W6ZA 3U5TA 4RF2A 2Y68A 1N9GA 2FP4A 3DBRB 2DBQA 3IOYA 2VZ9A 3EHEA 1PJ4A 2VHYA 1Q7CA 4NI5A 3GLQA 2Q1TA 2HRZA 5K9ZA 4F3YA 4MO2A 2W2LA 1QYDA 1MXHA 2I99A 4YYZA 3BMNB 4WCFA 2Y1FA 1V0JA 1HDOA 4OM8A 4FFMA 1Z75A 4FS3A 3U49A 1U4OA 3HN2A 3W4KA 2UVDA 1CJCA 2D3TA 4NHEA 4BKUA 1LRJA 1KIFA 2PGDA 4N7RA 4WOJA 4D44A 5HRUA 2Q2VA 5IZ4A 4O0LA 5KNLA 3LT1A 4IS2A 3DZBA 3JQ6A 3ROKA 2VNSA 1YE3A 3RSHA 2W2KA 1QR6A 1YH3A 2Q45A 1GPDG 3GG2A 4HADA 3P7MA 3I4CA 1CERA 2CSUA 3QP9A 4IY1A 4OKIA 1PWZA 1J0XO 3ICCA 1YJQA 1EVYA 1PS0A 1VSUA 2GCGA 2O50A 4FPXA 4C7JA 1G0NA 1PR3A 3AY7A 2GR9A 1UH5A 2H5LA 1UP4A 4MIOA 3BMCB 4A7PA 4E5YA 3WGGA 2QYTA 2OORA 3TZ6A 1MP0A 1OBFO 1H9AA 4E2ZA 3EDMA 2PFGA 3V1TC 3OA2A 1D7OA 5C7LO 3VKUA 1M75A 1PJCA 5T5QA 4D43A 4J1SA 1NQ5A 4II2A 1E92A 3PJDA 3F1LA 4PLPA 2OXIA 3ZV3A 4AJJA 1YJ8A 5TLSA 4CODB 4WECA 4BO3A 3H3FA 1JA9A 4IUYA 1XSEA 1YRLA 3KZVA 1XIVA 4XYGA 3NT2A 3JQAA 4DQXA 2LDBA 2OP0A 5KIAA 2PKQP 1X15A 2Y05A 1PTJA 3BHJA 3JQGA 3ONDA 1HZJA 2HMTA 5HTOA 2BELA 2OMEA 1SOWA 1ZFNA 1EMDA 3KRTA 4GH5A 1K5HA 1T1SA 2IODA 3OJOA 4RVSA 4J2HA 4BNIA 1C14A 1P33A 3IC5A 4J9VA 2PZKA 3UUWA 1P0FA 3QVWA 3KTDA 1U3UA 4CM8B 3BMOA 1KY5A 4GMGA 4AJ2A 3P2OA 1NQAO 1UDBA 2DQ4A 5KJCA 4Y6SA 5LCXA 1QV7A 4DIBA 3RAJA 4HFNA 2FWMX 5JO9A 2PLAA 4DBZA 2BI7A 3VPSA 5CDYA 4IM7A 2NUAA 2ZYAA 3HNPA 2IZ1A 4IMRA 2JAHA 4TRMA 1XQ1A 4BNYA 4CQMB 4E2YA 4BNTA 4YJHB 3GDGA 1DSSG 2CVQA 3GEDA 3SXPA 4A2CA 5JCXA 4ZD6A 4PLCA 4TRRA 1TT7A 1NVGA 1UDCA 5I7VA 4K1LA 4J16A 3IAHA 1KEWA 1VRWA 3VPHA 3MZ0A 2EJVA 2VHZA 4LMPA 2Q1WA 1ISJA 2BGMA 3QWBA 4PG4A 1SEPA 1XLTA 4R5HA 4MVJF 4JIGA 4DLLA 3BXXA 1PJQA 3U0BA 2BLLA 4IGEA 2IYPA 5H82A 1Q1NA 4W4TA 3AI1A 5EIOA 4E31A 1C3VA 4UVGA 1Y8QB 2BFMA 3JQDA 1RM3A 5I8WA 3GZNB 1DB3A 1OC4A 3D5TA 4QEDA 2FOIA 3AW9A 4I9NA 2GNAA 5TSDA 4ZQBA 2Q4BA 4R69A 5DOZA 4OO3A 3SX2A 1T26A 1ADFA 3CSDA 5IN4A 4PLTA 1ZK2A 4NJMB 2AQ8A 2VWHA 4O6VA 1C1XB 5KKAA 2D2IA 3FF4A 3TN7A 4F46A 2VUTA 5A9SA 3HQ4O 2OFPA 1DC4A 3EGOA 3WIEA 5BSGA 5JC8A 1DXYA 1DJQA 3KYCB 2V6FA 3VZRA 4E13A 1SB8A 2WYUA 2YV3A 4UUOA 1GU7A 4JX8A 1LJ8A 1R16A 5BR7A 4L0QA 1YB4A 2YV1A 3E5MA 1KVTA 5JSFA 1U3VA 4Q39A 2WYWA 3H2SA 3B70A 3UCXA 2BD0A 4Z3DA 4CM4A 3F5SA 3KSUA 3IQDB 1D1TA 4FIZA 3K6JA 1J49A 4RPHA 3QWAA 3ZWYA 2FRDA 5L3ZA 2G82A 2EG9A 4EI2A 3N58A 1KS9A 3Q1LA 4J7UA 3ROPA 4DMMA 3RIHA 1B8UA 3U4CA 4J49A 1YOVA 1QLHA 4CV3A 5T64A 5KTKA 2FMUA 1F14A 1H6BA 3LZ6A 5I7EA 1E6WA 4MVJM 2A4KA 3I6IA 3QVXA 4OXNA 1E5QA 2LDXA 3V5NA 1UAYA 1NTOA 1Q0LA 1WDKA 4CL8A 1FK8A 1GEGA 2A9FA 1VPDA 4MP8A 4QT0A 1NASA 4W82A 4I9HA 1GYQA 4H3VA 5ICMA 4MPDA 4J4HA 1V3TA 4AJKA 4DWVA 2YHIB 2E48A 4GL4A 4CMEC 2CF6A 1HSZA 3MJSA 1BTOA 2JKVA 4FCCA 3GMDA 4MJLA 4QFDA 4U0KA 3WS7A 4B3JA 3ICPA 4TRNA 2NLOA 5JDCC 3W8EA 4B4UA 4UUNA 3PGXA 2C5EA 3OICA 1T2FA 3LC7O 2PGJA 3PJEA 4FFRA 4RZIA 5DP1A 2PK3A 4LISA 3WGZA 4BKPA 3DTTA 4H15A 4CMBA 4G2NA 4U8GA 1XDWA 3TSCA 1MFPA 2HDHA 4LK3A 1ZO8A 1N1EA 2PZJA 4HXYA 3I9OA 5CFZA 5A9TA 3DDNA 3DOCA 3E82A 3WGIA 2ZK7A 2EJWA 4IZIA 4IXTA 1BGVA 1WDMA 3JQAD 2XAAA 4PLWA 1UAGA 1LSSA 3PQEA 3RCBA 5BSFA 4DPMA 1UUFA 2DUWA 1H5QA 4BUCA 5FI3A 5L7YA 3ADOA 2Y0CA 3Q6IA 1OC2A 1PGNA 2QIOA 4CLRA 3C7DB 3U4DA 4JP3A 1EBUA 1NR1A 2C59A 5F3RA 4B4WA 3TZQA 1BW9A 1BVUA 4KWHA 4YAIA 4CM6A 4FB5A 5KVVA 3QSGA 1P1JA 2JHGA 3WOHA 4AJLA 4JXKA 3JD4A 4N5NA 4OMUA 1F06A 3VZQA 3QE3A 1ADGA 4I8XA 3JD2A 5IZCA 1XWFA 2QZ9A 1ZKMA 4LMRA 2X86A 1GQQA 9LDBA 2X6TA 1HZZA 2DFDA 4P4NA 3GFBA 2Q1SA 1NQOA 4OIMA 3HUDA 2JCYA 5ER9A 3ZHBA 3GF4A 1N2SA 5CAEA 2FZWA 5TQVA 3C3XA 1TVEA 1Y8RA 2HJSA 3E9MA 4JGBA 3TL2A 5JS6A 4MINA 2CVOA 4XKJA 3JD1A 4RL6A 4D0SA 3D4PA 4D41A 1U4SA 1XQ6A 2I5PO 4HP8A 2DC1A 1KY4A 4FD3A 4PG7A 4B8WA 3WJ7A 4AJPA 2H1SA 2P9EA 1UP6A 2HMWA 3M2TA 5BT9A 4EUEA 4XR9A 5JPIA 1DIRA 2IYOA 3ANLA 3RQSA 3KSDO 3GDFA 1LXCA 2P5YA 3GVHA 3ONFA 4B7UA 4EBFA 3HDQA 5ES3A 1R4MA 3RBXA 1QV6A 2E82A 4HV4A 2RHRA 1EE9A 3ZHYA 4KP7A 4BQRA 4HFRA 9LDTA 3PLNA 1W73A 1P1RA 1ISFA 3CUKA 3DOOA 1IL0A 1UZLA 3K2EA 3PXXA 2XXJA 4ZN6A 1PU2A 2P9GA 3E9NA 4URFA 4WLFA 1H6DA 4K28A 5A05A 1AGNA 1JAXA 4FBGA 4NFYA 5L4NA 3OQBA 5JE8A 3ROQA
chains in the Genus database with same CATH superfamily
1EUZA 3NANA 3ZQKA 3RWMB 4DLSA 1SVOA 1D2NA 2VXBA 1JH8A 1G5RA 4E1AA 4FX5A 2H48A 3SQNA 1E7SA 1FTSA 2DCMA 1NX9A 4MJ3A 3IR6A 1TKBA 2HUNA 4OJQA 1NM5A 4BS9A 4EF6A 1MNAA 2PEYA 4QLOA 2X8JB 3EULA 5JC1A 1A82A 1Z7BA 2UUBB 2FR8C 3HKEA 3H5VA 1ZGZA 3BH6A 1YTLA 5AOBA 3ZEIA 5ITZA 1NQWA 3GLGA 1XPOA 1NVEA 3PLAE 1IQRA 3CLUC 2AVDA 2CWWA 1U3CA 1JU9A 1XMIA 2PMBA 1EZZA 2TYSB 4MIYA 1LBSA 2A5YB 3C97A 3RUEA 4COOA 5DO9A 2FZKA 2FZEA 4RQTA 3JYLA 4PO1A 1J42A 3OZEA 3KVVA 4EL0A 1E0SA 4S04A 5GVSA 2F9MA 2QD2A 3NJ8A 2XOEA 3LRPA 4TZKA 2JJYA 4M8SA 2YIDA 2G6TA 4IIVA 4QBKA 4ZAFA 1U6KA 2O3SA 5BW5A 2RD2A 2YN4A 3PRHA 4S1TA 2W00A 3D7MA 3UUGA 3ZN2A 1YRYE 1ZVMA 3GZTB 3S2ZA 4DIKA 4HC4A 1XO1A 1TRKA 2FOXA 4ND1A 1G6KA 4GBMA 4CMIB 1ZNQO 2W6PA 4EI8A 5KYWB 3B9BA 4AN1A 1KQNA 3ZBTA 2D2FA 3UIEA 1XFDA 3E84A 2DSTA 4FYIA 2IA5A 4HRYA 4Y9SA 8MHTA 4AQYB 1UQTA 1CDDA 1JDBB 1YV9A 4NU6A 1CB7A 3MBKA 1TT5A 1RRVA 2NV6A 3SEFA 1ND6A 2NACA 2PR7A 3VQTA 4DLXA 4PTYA 4WBSA 4R8VA 4BNHA 2C7OA 3FY4A 2HBYA 5AVKA 1FFDA 2QJFA 4YCLA 5KYUA 3HJFA 1GT6A 5LB2A 2GYWA 1JTVA 1T2AA 4IGIA 3L7AA 3N3AC 1FTWA 4KSBA 5BSUA 2QUAA 4P82A 1EDZA 1RWOA 1A96A 2F64A 1TKCA 3I04A 3ISVA 3RT7A 2L82A 2E1RA 4MS1B 1UT8A 3B1XA 3BOSA 5SZKB 4B40A 1HT0A 3LVBA 1LQTA 3RF7A 1DU4A 2VK1A 3OLVA 4JLVA 4YI5A 3SLKA 1HR0B 2O48X 2RBGA 3TJMA 2GZDA 2UZAA 4OQZA 1GDTA 3GLTA 3BMQB 1W4RA 3R09A 1B0UA 2WUFA 2PV0A 3ND8A 3COWA 3RS5A 3WYFA 3BL6A 1EJ0A 3DDZX 4A0FA 4E33A 2ZSDA 1PWYE 5L4SA 1ENPA 1XJQA 1XELA 2ZXEA 4UAUA 3WNBA 5I9TA 4YRBA 3SZLA 1SC9A 5LMNB 4NESA 1FQKA 2M98A 4JCOA 4D8TA 5AM4A 4UEWA 2W6JA 1F8YA 2HIGA 4MW7A 5K6AC 3P45A 1H1LA 4ZP1A 2CJWA 4NE2A 3UWOA 1RQXA 1YL7A 4AVYA 2B6NA 2IEGA 5KCMA 3DTNA 3KV3O 3G3EA 1FXSA 2HBRA 3RUHA 1XEAA 2WSBA 2WLSA 2H00A 3R1IA 5F33A 1NDQA 4BQIA 1YKSA 1WZNA 2X6QA 1SHKA 3PGA1 5FRDA 2HQRA 5TGZA 5AIAA 2OGWA 2QLJA 2ZYSA 4RFSA 1JU4A 4YN3A 4CM9D 4YDQA 5LNK6 5LQUA 4NAHA 3MLBA 5KDDA 1IN7A 2NZVG 3ZV6A 1TK3A 3ZE8A 1SAYA 3D5QA 3EGDB 2DBVO 2OLKA 3K9CA 4W9NA 1QH8A 3ETDA 3GEEA 4QATA 3AHHA 3C7CB 3MHPA 3RC2A 3H75A 5EHIA 4B2PA 3NG1A 2X2OA 2ZLBA 3CX7A 4Q4AB 3C8ZA 1WPQA 3PUWA 5A4KA 4W5TA 1FPQA 2P7IA 2ADFA 4NK5A 4KGZA 1ECGA 5GINE 2DFVA 4F9FA 5CB6A 3U09A 3KYDA 2NVWA 5DW3A 1USIA 2GS9A 4WZAB 2JL1A 5F64A 4BC1A 4ERNA 1ZZEA 1IPEA 1OILA 1S6YA 2ECOA 4WNAA 3C8HA 2QU8A 3I2JA 1V8DA 1J70A 4EKYA 1J6UA 2FPGA 3BD7A 5IJZA 3OVMA 2C8JA 5JQGB 2XUHA 1WCIA 2X8WA 1RKVA 2YHSA 3FTQA 1MO2A 3GCDA 4HCJA 4ND5A 4ZI5A 4DR5B 5ALSA 1RJWA 1GIAA 2PGNA 2OT3B 3KLBA 4AP9A 3I9MA 1Q2UA 1P4GA 1NNUA 1IOZA 3MYRA 3OZIA 3KJNA 3PUKA 1RLTA 1QYIA 4Q34A 4BNZA 5A9RA 2O1SA 1R8XA 4OHXA 3A3NA 4R51A 2D4AA 1O95A 1KKUA 3WLEA 3BK7A 4ZGGA 5A4IS 1XQVA 1W52X 2NX2A 1Q22A 7REQB 5JI3E 1EP1B 1JPUA 3OJFA 1QYWA 2BMVA 2O8FA 2EGGA 4QREA 3TW0A 3H5RA 4LCBA 4MKGA 3IAM1 2BEWA 3OH8A 1ZGBA 4RWEA 4D0GA 1X6VA 5KS2A 2AD5A 3OD5A 1NIJA 3GI1A 5IP5A 2B37A 3GCGA 4LXIA 4G4JA 2FSSA 4DN6A 3PTLA 1NI5A 1N0IA 4GVXA 1Z13A 3F6RA 4MMYB 1M6HA 4NFHA 1HWYA 1WBJB 2BP7A 4RKEA 1GTJ1 1R6TA 2BVNA 1ORWA 4PQFA 4XGKA 4K2HA 4YS6A 4CEHB 4UEQA 5HK9A 2H54A 1G4AE 3GJ3A 1IBSA 3IBCA 4MVCA 3T7AA 3VJLA 1V2HE 4EAQA 1Z0IA 4JUIA 3NEYA 1KEKA 4LFBB 3UNXA 2G72A 1GLNA 1M76A 1WMSA 3OTWA 4GBJA 5KNCD 1B7GO 2FPWA 4QM7A 4GXTA 4ENQA 1N4AA 3QYAA 5CYOA 4LDPA 1T0PA 2ZYHA 5CPFA 5HDQA 1LK0A 2Q9UA 4HAXA 4XR4A 5FJIA 4LE2A 1KEUA 1YS2X 2HLPA 2ZYRA 4LBYA 2A5FA 3OFKA 4UQPA 4BNDB 3VTFA 3ASYA 3S1LA 2WSSA 3STYA 3WJ2A 1OJ7A 2GCEA 5IUKC 3UXYA 3KLMX 1UPUA 1X7ZB 1XVLA 3D3EA 5ED0A 1C9JA 5K8JB 2JLWA 4Y18A 4X6YA 2PD6A 4PHTA 3Q3HA 5EPUA 1H9BA 2ZQ5A 4RV5A 3ZKWA 2I4RA 4HDSB 1NA5A 3CNOA 3QWHA 2R5NA 3QY9A 5JMTA 4P34A 3DSRA 1GN8A 1T3ZA 4PLHA 1C5KA 4ESOA 4K5QA 3TG2A 5MGBA 1LF5A 5JMOA 5EUBA 1ZJYA 3RROA 1NRIA 4WACA 4UHDA 1LZLA 1AKYA 3V2IA 2QJRA 4ADSG 3ST7A 2PYIA 4FTWA 2BMFA 3BL8A 4D9MA 1G9TA 1E9CA 3CGGA 2JF0A 3FDXA 5FTKA 4OTZA 1YZTA 1GSOA 1DCMA 4E5DA 5K0LA 4L28A 4NWIA 1ZVVA 3T4UA 2GD1O 4E2FA 4D4IA 1FRNA 1OOEA 1VJDA 3MWEB 3S8MA 3SXJA 1OIXA 5JFOA 3M4JA 4U2GA 3MWGA 4OSEA 5LQRA 1WULS 1F2TB 1J39A 4L5CA 1L8QA 5KMGB 5IM4A 4B3MB 1M2WA 3OJLA 1NW5A 3LUAA 4R7GA 5CXSA 3ZE1B 1XEXA 2IGTA 4TMYA 4MR9A 6ADHA 2X77A 4U7WA 4HO1X 5B3KA 3JSXA 4IFEA 1I6KA 3V48A 4NP6A 1C50A 3BMXA 4YMSA 3ZU5A 4CKYA 3GHYA 1P9LA 4F92B 4QC2A 4YQYA 1CLEA 3I2HA 2P9HA 5HZMA 5KWJA 3QKTA 5B1EA 2IDZA 3T3NA 1SHLA 1HE3A 3ZY4A 1EHYA 3PI6A 1K97A 3NEPX 4M0CA 2A9KA 3SEZA 4TV9A 2IV3A 4LUCA 3ZE7A 5LP6F 2HMAA 4MV7A 1PLJA 1VI2A 1G6OA 3A9TA 3O1LA 2CMGA 4GUDA 1UL1X 4GNKA 3ABOB 2PHZA 3M6UA 2G06A 4MWDA 5FV4A 5FTJA 2E4YA 3W2GA 4C7BA 3I45A 2ZBGA 1A1SA 5JPDA 4FBLA 2F1JA 4BMYA 5IAJA 1NQXA 2C83A 3GUHA 4IJVA 1FP7A 2V65A 1BWQA 3EMKA 4ETIA 3WNCA 2ZJ8A 3ZGOA 3A1UA 4KX3A 1P4RA 2E7ZA 3R6WA 2D1TA 3DMPA 4GR4A 4TYWA 5C4MA 3A4YA 5DNVA 3HKBA 3GNSA 1ZSNA 4LXGA 1Z4JA 2AQIA 3U31A 1DOAA 1XXHB 3W6UA 1Q3TA 5IJ0A 1P45A 1XZPA 3AZPA 3HG7A 4DCCA 3K6SB 1K1EA 3VH3A 1L1EA 4DEXA 3AVWA 1J5EB 2XUFA 3OIUA 4NQZA 1I9CA 3EXG1 4MI6A 2R6CA 3BTVA 4KYIB 4HEJA 2IPMA 2OEPA 2OO5A 4N18A 2QTNA 1NSFA 1ONSA 2X9NA 2XYRA 1SKYB 3H9UA 2JZCA 4HEA6 4EVQA 4CG0A 5JASA 2VPIA 2HSGA 3G9ZA 3L8HA 1X92A 1Z12A 2GB4A 1XCPA 4GXRA 1E3LA 3DAFA 5I3ZA 4MDHA 1GCOA 1SOMA 4MKRA 5LMUB 4X7BA 2YW9A 1LWOA 1XLVA 1E2LA 1H2RS 2D2EA 1HQCA 2UUOA 3DWEX 4TSKA 3SQXA 5HJ5A 2A8YA 2VNAA 1WIWA 4QU9A 3ZHSA 1PUIA 2JASA 1IWBB 2Y66A 5DT9A 3TW4A 4RY2A 5C37A 3EA5A 2FK8A 4RFLA 5FDFA 1S02A 1ZUWA 3TRIA 3UV7A 4WN3A 1EEXB 4FFNA 3HCPA 1EFPB 2MYNA 1JZSA 1E2KA 3HYRA 3LH5A 1C1YA 4OGGA 4R9NA 1JIIA 1R66A 4K81B 4PG6A 3ZWCA 1ZOPA 4O2BF 2QBYA 2NO1A 4AJNA 1VQ1A 1D1QA 1XZMA 1A9SA 3K16A 4WZBB 1QQBA 3VVBA 2ZRDA 3E1GA 3H7IA 4ZKDA 4AYTA 1VLHA 4EUFA 1RC8A 5DBHX 1ZM3A 1Q12A 6Q21A 2J9XB 3M4ZA 1PW7A 4GKAA 4IV5A 1Z07A 4NYMR 3EEQA 3KHKA 2A86A 4Q3CA 5E2AA 1SZDA 3WY9A 4BGVA 4GM1A 1IAVA 3HACA 3HXTA 4H08A 5JYCA 3ICEA 1IQ0A 2QSUA 2JKYA 3N8IA 4Y2UA 4M1YA 4XSVA 3TPFA 1U9CA 3EMDA 1XTUA 5H68A 1XZHA 3R4VA 3FJ1A 2CDAA 2GT1A 2J9YB 3HRHA 4Y1FA 5CT9A 2XKBA 4UBKA 1EFAA 3V7FA 3G8YA 4ROSA 4AAYA 4EYSA 4PTLA 1U8ZA 2H0AA 3NKFA 4KDEA 1NBEA 2JLSA 3VV2A 4DXAA 4JFAA 3LQQA 3PX2A 4R7ZA 4YASA 3IEPA 5EWJB 3RUIA 1O2DA 2WE7A 5H0IA 3B3JA 1ZMRA 2Y71A 1L4YA 1PEKE 2PT9A 3F2VA 1OAOA 4KO4S 4S0ZA 5H7XA 4R3NA 2A1TR 4JDPA 1Y5MA 4JWKA 2ACWA 3CMMA 3O8QA 5EPOA 3MIIA 1YDMA 5EL0A 5DNCA 1UK9A 3V4FA 2JEYA 3OO0A 5COBA 4D0LB 1MT3A 2PXHA 5EQJB 4H17A 3HB4X 5KQLA 1VKJA 4RS4A 1OWNA 4RW0A 4RYLA 2V54A 2I2FA 3S28A 3KU4A 4OP2A 3U17A 4R68A 3V1MA 1UC8A 2QZPA 3FFAA 3SEQA 4V0RA 4LC0A 3LXRA 4O0MA 1JHXA 3NNDA 3NKLA 3S27A 4HNSA 4AMVA 3AI2A 3Q2KA 4DLVA 3H3JA 3EXFB 3L01A 4NNOA 1FTGA 1OV4A 2FGKA 3LLVA 5E9WA 5JVDB 5C3UA 1K2VN 2GRAA 3I09A 4K6FA 1N5OX 1B3RA 3PF8A 3QENA 3ADDA 1LCIA 1VP9A 4BNLA 2FWNA 3UHFA 5A4FS 4HL6A 4C30A 3WWPA 1RAFA 4EYQA 3IAFA 4PNPA 5AXDA 3TSAA 2QRKA 1QRAA 2PS1A 1KYXA 4H6XA 4C2AA 1VFPA 1SOUA 1NYQA 4BO2A 2IU3A 1XHFA 3FMIA 3H0EA 5J2UB 4EECA 2I4OA 2QUBA 2WVHA 3FDZB 4J91A 3WLNA 3GT4A 5LZ2A 4RA9A 2EBWA 3H5NA 4P92A 1XT6A 4O4HB 1YL5A 3ZIDA 3DZJA 3Q6MA 5LXTA 1N0UA 2CHVA 2FFJA 3VNBA 1TE2A 4QYIB 3HKEB 4KXQA 4Z9XA 2N42A 2EYQA 5ITZB 3FJYA 4YEDA 2G76A 1L4MA 3QUQA 3C3CA 3UHJA 1IYZA 1D4FA 1DX9A 1GZ6A 1PSZA 4UM8B 5F2KA 4F4CA 3INRA 2FQWA 3CVOA 2ZWVA 5JCJA 1UK8A 4RXUA 1LTQA 3ENKA 4NPHA 2QTVA 1QP4A 1VPEA 2C29D 3M3HA 5DFAA 3U60B 2Q5OA 3DUFB 1H85A 3DEIA 1DAEA 3OIDA 2XBUA 3TL6A 1VJTA 2OGUA 4LK2A 4PYIA 4INJA 1QK4A 4NCKA 4QFBA 5BN4A 2VI5A 5KC9A 2AJLI 4S0XA 5EJAA 2I9KA 5DGXA 5LZ9A 4MWZA 4KR2A 1CEYA 2XB6A 3LIPA 2NZXA 2Q2WA 1RM4A 1LLFA 2BUCA 3KQSA 3MCVA 2AG8A 3EAGA 3SZ3A 3W9YA 4PRLA 3KVYA 4IRMA 2VLBA 1LPOA 4L3WA 5EKUA 4BYGA 1TB4A 3LDAA 4LWQA 1UZNA 3D9QX 3OPVA 5B4UA 4P53A 3GAZA 3UAYA 2J32A 1R0CA 3AHDA 1ODSA 2GN2A 5LWQA 4I36A 3BMNA 3NHWA 3HYTA 4RLQA 3VSEA 3KB2A 4L8YA 1I7PA 1V8FA 3E70C 4OXKA 1N2CE 4YCAA 1QFYA 5HF6A 1P5ZB 1W2WB 2NXJA 4X20B 2R6ZA 4MR8A 4C6RA 4I0WB 4Q4DA 5EJMA 4XM0A 2JJMA 4RNCA 2XXAB 3E58A 1U0EA 1X2EA 1GKUB 2B5VA 3RUCA 1OWLA 1N1GA 5G40A 5MGNA 2HV8A 1F8XA 1AUQA 2PKWA 1EGAA 5BMVB 3CUUA 5AKIA 1V8BA 4R1QA 3WLLA 2FN3A 2ZUCA 3THYB 4F3KA 1JE1A 5IT0A 1MVOA 2PVCA 2ZQZA 5EY5B 5TJHA 5DU2A 4YRFA 2PWAA 4EPTA 1XRPA 3STHA 1QCYA 3ECSA 1DRKA 2OHFA 5CK4A 4ZVQA 2OBFA 3TQRA 1RM5A 1VCMA 2BKAA 1KPIA 3LX6A 2F4NA 1OVGA 3M5WA 4UNQA 2GN8A 4WFIA 4MVJD 5JAQA 4CYMA 1JB1A 1X3LA 3WGVA 2P2SA 1RPJA 2P67A 2YQ5A 3ODGA 3EQ2A 3HVHA 4D42A 4D9BA 1JFTA 2VYVA 3OPYB 3TLCA 1YHZA 3FUCA 1H2ZA 3EXHC 4F2PA 4LSZA 4B3DA 3QVOA 4GZ5A 2H11A 3THSA 1HG0A 4MAMA 4BKRA 4F6LA 7ADHA 3R7AA 4ZT7A 1TYEB 2VBGA 5BXYA 2LIPA 4EGAA 5B57C 2H16A 4C4XA 4YREA 3PWZA 2QX6A 3T9EA 2XR1A 4F45A 1N2ZA 1SOVA 3N39C 1T2DA 2GVNA 5DEOA 3IP1A 3Q10A 2GZ1A 4PZAA 2IP4A 1E0JA 3VX4A 1YO6A 4ID9A 3Q7EA 3NHFA 4ZQGA 5ECYA 3WGOA 1KL7A 2R8OA 3LPCA 3THWA 1T91A 4KFUA 1YKFA 3NDIA 3RFXA 2L42A 4EKEA 3WDLA 3TCNA 3G2LA 2C31A 1SBQA 1J23A 1O8CA 1ZU5A 2RBKA 3N5CA 2YY6A 2HDOA 1DKMA 5IARA 3C39A 4TLMB 5J63A 3RFVA 4ASUA 1GZ5A 2NUTB 3DV9A 3VR3D 4X8HA 1B74A 1J06A 2VPQA 5EMJA 3HZOA 3UAXA 4YUYA 2CB9A 4DQUA 2EATA 4X24A 1WV0A 2FW8A 1AF4A 2XUKA 5LBIA 1F2UB 2RGBA 2VF7A 1E9DA 1NOJA 1TYDE 4QO8A 5ELMA 2ZREA 1E1DA 2YVKA 3TD6A 4A91A 4CM8A 3L8DA 3L07A 3KT6A 2VJAA 4KLRA 5KSOA 4P83A 3ZHXA 4KRGA 2ONJA 5JNWA 2V5VA 2H1IA 1LDBA 4RENA 4BASA 3V4LA 1PHPA 1RCTE 2XKKA 2GO1A 2GX6A 4LE0A 1ZCBA 1BDMA 4EYGA 3UB3A 5I48A 1G5HA 1TJNA 3IILA 1XOIA 1E32A 1E6UA 3HBLA 3L8YA 5KTRA 2ODNA 3GRCA 4GKBA 2VTBB 2P6NA 3GDWA 4P5DA 2IE0A 2X7XA 2POQX 3MCTA 4IOJA 2ZE8A 2QUKA 3GRRA 4YJHA 2NUPB 3UM9A 4AMGA 5AKXA 1RIFA 3TEFA 4DF3A 3WFJA 2HKIA 2OECA 3D1JA 1ZL0A 3ZCUA 3INNA 4M76B 1V25A 4KR3A 1CDOA 3GZ4A 1Y81A 1FYEA 4H2DA 4QJBA 2JGAA 4C21A 3R0JA 1O9GA 1U7OA 2REBA 2HGZA 2XYPA 2ZUVA 1LBIA 3MC1A 4QFCA 1Y3IA 2VO1A 2DQYA 1N5IA 3JQEA 4CMKA 4XQ0A 2ZGVA 1KYZA 4YRIA 2CFSA 1IOVA 3IVXA 3TLBA 3G7NA 5FUYA 3U7FB 2NNLD 1WOMA 2DHEA 3WMXA 1YA4A 1ZR4A 4PYMA 5SZHB 2D5IA 2VAXA 2GYUA 3NV7A 4JYCA 1KDPA 1SC1A 4FLEA 3BA6A 4UCFA 3ZE0B 1Q5PA 3JVIA 3NAQA 2IH2A 3OQHA 3LC1O 1Z0JA 5FBWB 3EBPA 1O5IA 2IYUA 5C80A 3UPUA 4RELA 4FNAA 3O83A 1M2KA 5CYGA 2ZJ6A 4NHOA 2NYAA 3KOYA 4ZCIA 5BT8A 3P27A 3GZNA 3P2JA 4WSOA 4IWYA 3RRBA 4WBXC 4KOAA 4ZYTA 3CUTA 3LDHA 1KAOA 3D8HA 1UR5A 3ZQUA 2WD7B 4TMFA 5I7WA 3DTVA 5E7QA 2ESRA 3FNQA 5JJBA 1LFDB 1GO2A 2B4KA 4RC9A 2XUQA 4PX2A 4KPUB 2VKTA 4DUYB 1KJWA 2CK3D 4CT0A 3W1VA 1JIKA 2X15A 1E98A 3M6WA 2WQ7A 1YTUA 1YT5A 2R1TA 3H4IA 3I61A 1DPGA 1LW7A 4EITA 1VYUA 3MWYW 4I66A 1MIOB 3L7OA 5EIBD 4OA8A 1WLSA 4MZDA 1JLLA 4MVWA 4K3VA 4OHVA 3D6HA 1MO3A 4Y0AA 1KNXA 2HR1A 1GQSA 1MIHA 1NW4A 1A4XA 5IBCA 3PQ7A 1XKQA 3OOHA 3D6NB 3LQ1A 4U3JA 3VUEA 3KV1A 3QIAA 5IDYA 4Q6WA 4BFYA 5HM8A 4JLJA 3K2IA 1OAAA 1UFQA 2RGNA 2ID7A 1H2XA 4O33A 1UKBA 5DVZA 1KKMA 1IIRA 3ENZA 4DDWA 1PSWA 1U8CB 5I4IA 3H1FA 1PK9A 4V0ME 2PUHA 2YMPA 1GPNA 2OLEA 2Q3DA 4BLRA 2O19A 4KL8S 3ABIA 3W7BA 1QGDA 3EW7A 4R8SA 4ZAGA 4Q4HA 8ADHA 3QBTA 1NR7A 2D7DA 2JGDB 2RK3A 2C4NA 4NYIQ 4YRAA 3Q0IA 4U2FA 1JIQA 1PGOA 5KTYA 1WU8A 2JGRA 3HO1A 1WVMA 1HFJA 3HPQA 4JELA 4MW2A 3Q8KA 3QKIA 3U7RA 1Q6YA 3DOJA 5LL6P 1OLSB 2XWQA 2O14A 3WWCA 1YRAA 1CE8B 1FLDA 1ZQ1A 4EABA 4IIFA 2NZYA 4Q7KA 3H2BA 4B7ZA 2BGNA 4J75A 1CUDA 3FCSB 2BGGA 2OP1A 2AEJA 4J3NA 1TEXA 1Z5WA 4Q7JB 2BE7A 2O2IA 3IEKA 4AZ3A 3K3PA 4QUBA 3WHPA 4BATA 6GPBA 2ZRCA 4LG1A 1TZBA 1CJMA 2F6RA 3PNSA 5FNVF 5C5IA 4BU0A 2IHUA 4ZJZA 3SCZA 5BWBA 5HMMA 4Y6GB 2YCBA 5BMOA 2O8EA 4AN0A 3QPWA 2VRCA 4PHHA 5ESXA 3LY8A 5IH7A 1BQ4A 1KZ9A 3JQ9A 2XBLA 5J1SB 1OMOA 2DPLA 1RMYA 2J3HA 2D54A 4PFKA 2XZTA 4QYMA 2MSNA 3VBEA 3II6X 3GFOA 3B2EA 4Y6PA 3TTWA 3CF4G 4M0UA 1JDTA 4IKEA 5GWXA 2ZRQA 1MOPA 4AFNA 2QTCA 3EISA 4DJTA 1FQJA 2EDAA 2YHIA 5EJ4A 1FFHA 4G89A 5JHGB 1L5SA 5T4BA 1JP7A 1MH1A 5FA8A 4BBPA 1DBQA 3HU3A 2D6FA 1KIAA 3COPA 4GMDA 5TPWB 1QCCA 2LPMA 3BX1A 3E61A 3EUWA 3UUFA 5FBVB 3O4JA 1VLZA 3CLKA 2PUFA 1GGEA 2JEOA 1USKA 4LJ6A 1LPPA 2QN1A 1FL9A 1DEHA 5CYPA 1UZMA 3CR7A 4I1OA 1LNQA 2VTDA 3R9XA 3WFIA 4KRYA 1OX5A 1D2AA 4XPZA 1U2QA 4M53A 1B26A 4YAFA 2J87A 3WICA 3BCHA 3TI7A 2BKVA 4RX1A 2REQB 4IXMA 4P6VF 1Z2EA 4K9NA 4LSGA 4GVLA 4XD7A 3ZH2A 5IJ9B 4I8DA 1SKMA 3O9ZA 1DFIA 1IRIA 521PA 2RHBA 4OFXA 1TF5A 1CQWA 3GJXC 4MQEA 4UD6A 4HDRA 4IDFA 2QSJA 5B1SA 1MXFA 5ALEA 3B6ZA 1MENA 5SZJA 3KXLA 3NYQA 4RHEA 1FDTA 4MLPA 3LT4A 4KZKA 1U7DA 5B36A 1OXSC 3WTCA 3AR2A 1LI7A 1U7XA 1WPGA 2FQXA 3HV2A 3BWMA 3PNBA 3EVGA 4GPTA 3UW3A 2R7NA 1SCQA 2VS1A 1TD9A 2YN0A 1ZC4A 3ND7A 5IW8A 4MEAA 4F8YA 2CBXA 3JQAB 3ZY3A 3M6FA 4JN6B 1CVLA 2BR3A 2P90A 1W36B 3PDJA 3U48A 1E77A 1CVIA 4G5SA 1DJNA 3V97A 4BHTA 2MOKA 4EF5A 3DZKA 2PN1A 3PJRA 3PNPA 3P5SA 1G1AA 1ODLA 4JU8A 3GXBA 4RH0A 4MUGA 3IP3A 1UPCA 3AESB 1DAMA 3L8FA 2W42A 2C4TA 3IDQA 1ZOSA 4KUEA 4NNJA 1X0XA 4B75A 5CPBA 3U4IA 4EQZA 5BWOA 1RHUA 2QBYB 1LBTA 4WNIA 4G5YA 1CK4A 4BV8A 1P4AA 2VYCA 5BYJA 3CUSA 3KJHA 1XAJA 3PUXA 4KDRA 1NQVA 2NGRA 3V6LA 4F2DA 2P6PA 4K26A 1OXVA 1ULZA 4D3ZA 5J58A 3DQZA 2OAP1 4L4YA 5TB5A 3EDOA 5DCWA 4AICA 4HB4A 5B7GA 2M6SA 2R44A 1TM4E 3T4XA 3RSOA 2E5FA 3VAAA 3BJIC 3FDIA 4N3CA 1P1BA 2DJIA 1L7MA 3PDUA 3DMYA 4FMBB 1HV8A 1YDHA 4D6YA 3LQ4A 1GARA 2CJXA 3GDOA 2W6NA 2JAQA 4JEUA 2V03A 2O8DB 1EQ2A 5FI5A 5ETJA 3CNEA 4JVSB 4TN5A 1RPZA 4G25A 4RK4A 3RBZA 1CF9A 5BW4A 2CYAA 1IEVA 1RBQA 1ECPA 4AYXA 4KIJA 3FZGA 5FPPA 1OH5A 2Q4DA 3M9LA 3AM4A 3I01A 2XPCA 2BZ0A 3ZW7A 1FNBA 1XZNA 2C5LA 4K1XA 4DMGA 5AVWA 2F3RA 3H8SA 3I23A 2QYSA 4UEKA 1ADCA 4XGRA 4MA5A 1NXPA 2C4MA 3OPQA 5AM5A 1UDWA 2BEUB 1F0KA 2WLTA 3PNVA 4B3HA 4GC9A 4LRYA 1Z68A 5L3QA 3GYBA 5LQNA 4ZRMA 5BQFA 2R8ZA 3K0CA 5HIMA 3DTVD 3W6PA 3D3NA 3SZOA 4C88A 1P1IA 1PGPA 3MTIA 1B2RA 4XVQA 4QPZA 4ARCA 1HL3A 3IUQA 5DXAA 2B61A 1XZBA 4GOMD 1RAEA 4FCTA 4LF5B 3GMSA 4A23A 2WU3A 4GX2A 4FU0A 4J94A 4M1TA 3WO1A 3QV2A 4XWKA 1XRQA 1I2CA 2G1KA 2ZJ5A 3KUKA 3REGA 1YA8A 3STUA 3QSYA 3MB8A 1C9EA 1JBQA 3L7LA 1OFIA 4NE7A 5FBQB 1HH4A 1KMNA 4P4LA 5T3UA 3IAXA 4V0MA 3TQFA 3B20A 4LQCA 3H4VA 1YC5A 2QR2A 1RXYA 1JU3A 4R5MA 4MQUA 2VDQB 4Q02A 2ICAA 2R8BA 2OGSA 4IIJB 3TB6A 1XXLA 4JR0A 4G84A 1E6EA 1N3BA 3EVNA 1Q1ZA 1W85B 1YJAA 2QNIA 4O4IB 3AERB 4RM2A 4S1WA 4X8OA 2D1RA 5DISB 4FN4A 3NHJA 4F3NA 3FSGA 5G4LA 3RC7A 3A4MA 3C8MA 3ORFA 5EHNA 1U8FO 4XJVA 621PA 4PZ9A 3A2LA 2GZHA 1N5LA 2WUEA 2CF5A 3OQIB 5E0KB 2LNDA 1I6LA 4HATA 4HGQA 2VTVA 4YPOA 2AS0A 2JI4A 1NN0A 1V7QA 2ZVPX 1SOAA 3IVCA 4JUDX 3WIVA 3PRJA 3QYJA 1JSCA 2R86A 4DANA 5JALA 3LNTA 4JJFA 4J29A 1K7SN 4GI7A 4XGNA 1L7AA 4P80A 2WT8A 1ONPA 2X6RA 3W5VA 2BMJA 2Q3MA 1QQ6A 3R76A 4C1NA 2DPXA 3OCJA 1E64A 2W6OA 4DLUA 1F3OA 1HBJA 1YR7A 1O97C 5F35A 1QVZA 1XB2A 4M9RA 3WSTA 2JLXA 2W4QA 4FQ5A 3DEAA 3UJ3X 4ODIA 3A14A 3LWZA 3KT3A 2VSYA 5HXAA 3PPYA 2FWRA 2NVUA 3M49A 3CG0A 4KVZA 4D5GA 2QTBA 3JWJA 4L08A 5AQ1A 3CRQA 1P8JA 4QRHA 1QLJA 1HE8B 4MGYR 4AZ0B 1DTEA 2DJ5A 2AJBA 2JFGA 2J5RA 3Q9SA 2PSFA 4RMJA 5AOAA 4TXJA 1C0IA 4P31A 4YLYA 1M9NA 5KYXA 1H1TA 1OSNA 1DBPA 3U44A 4X3CA 4WFJA 3W79A 4ABTA 1HETA 2FUKA 4EG4A 5EIEA 2XNHA 1TAQA 3COSA 4Q47A 3L4BC 4YCDA 3FFBA 3H2ZA 2XVXA 3AJ9A 1C9KA 2AWNA 4X54A 1PRYA 3L0IB 4UHHA 4MR8B 4AUEA 5BYKA 2P2DA 3USZA 2BRUA 4P35A 1FMFA 2BHSA 2V98A 1RJFA 4DRXB 5KOJA 2TSYB 3PNOA 3BXFA 4NPAA 3BWEA 1SRRA 2WWTA 4IHQA 4ZGWA 3TIFA 2X4LA 1XTBA 2Z1MA 3V4ZA 4WLVA 1MAWA 4YIKA 4FGUA 4RTOA 2O7SA 1QH1B 4R6WA 4XD7D 2C7RA 1KZGB 1MLDA 4BFLA 2QVXX 2YWXA 5FFNA 2ZAOA 1IPHA 1JEYA 4E5KA 5HKAA 2HCBA 3OI7A 5F78A 1W4BA 1S9HA 4FSHA 5SYMA 3V8MA 2OCLA 3GEMA 1Z82A 1YQXA 3K4QA 3MMXA 4YBZA 2HQ1A 1VZ3A 3NRCA 1O58A 2I2BA 5AI9A 4DMKA 2CE2X 3I5YA 2WJWA 1Z35A 3CKLA 3N2KB 4G1EB 4M4SA 4DCSA 4G0NA 1T2UA 2VSFA 1CUCA 1CVRA 1X7GA 4JLWA 3LCJA 2WB2A 4JSYA 4M6WA 1IB6A 3DAHA 1HSOA 2QRMA 3VNQA 1E69A 2OZLB 3A31A 4HDKB 5FBKA 1XCGB 3PE6A 4FCWA 5JSHA 3AY6A 1JHAA 3F9CA 3H18A 3U6KA 2HSEA 4WASA 5KC8A 1BAPA 3G1TA 5HE8A 1A9YA 2RKOA 3W5JA 1EK6A 1A97A 1H3FA 2AJCA 3GJ0A 4YXWA 4CLRB 3MWJA 4W8GA 3MOSA 4O5OA 3IQEA 4OUKX 1W6RA 2WI8A 2HCFA 4KAAA 1QTQA 1X7YA 1DQZA 4OAQA 3R40A 4P1ZA 3CURA 2XRMA 4QASA 1GG8A 1U1GA 4HPWA 1YR6A 2C2XA 3E22A 1BA3A 1ZD5A 4N7JA 1C0KA 3T61A 4GZLA 3WYGA 2ZTVA 4UPDA 4CCYB 3HWSA 1BCRB 1E5DA 1T1EA 1QNLA 2DPHA 5K3FB 4D0RA 1SVWA 3SYMA 3LV8A 3G2JA 5LNK1 4PLYA 1ZKDA 3RU3A 3M4XA 1ZXLA 2O3UA 4KE8A 3BF8A 2ZR7A 3OF5A 2XYQA 5CT4A 1E2BA 1TU0A 3F7TA 1FOEB 1HUQA 3B3GA 4BVAA 4LHVA 2XUPA 1KK0A 5CAEB 1NN1A 3Q3CA 2OFWA 2OHXA 1QRUA 2DLDA 3OCZA 5KKNB 4J2OA 3Q12A 1LD3A 2I6SA 3I52A 5TF0A 3VKFA 1MHPA 5DYNA 4Z1MA 4AO8A 5I4BA 3ESAA 1RXEA 1TQ4A 2XWBF 4RD2A 3WYCA 2EW8A 2H4ZA 4PPNA 3SSNA 2PX0A 1LC0A 5IT4A 2WAAA 1MB3A 4B6PA 2EWVA 1NVDA 5A6VA 2YXEA 2JD2A 3PVZA 4MAAA 1JR6A 2EXXA 1ZI9A 5K8VA 1X1DA 4IFTA 2DWUA 4L8FA 1LVUA 1L6IA 4FI3C 4BGIA 4R71A 3L84A 1MB4A 1ZH0A 3A3PA 3CISA 3V2GA 5FBLB 4E1BA 5CLFA 4AKIA 5KWSA 4JFRA 1E6LA 1KP9A 5T6BA 2ZYDA 3QVLA 1HEUA 1Z4NA 2XKAA 2AMVA 5ADUS 3D0QA 3ZKAA 1JKXA 2FFHA 3BZWA 2Y1KA 2XMBA 2QL9A 3B6IA 3BJMA 3DE3X 3U4HA 1WZ2A 1TM7E 2UZIR 4RD6A 4FLFA 4Z9AA 3WIDA 1VIDA 4IP0A 2IOQA 3ZTTA 4RL4A 2GJAA 4MW1A 4I9UA 4O4LB 4MGEA 1G8SA 3FCEA 3QIVA 4DLBA 2HK9A 4R2HA 2B8JA 1D2MA 1ZWKA 2Y6VA 3WGHA 4XYLA 3N05A 4P7GA 3PQFA 3ZWVA 4ETWA 3ZV4A 3IURA 1QBGA 2WIFA 1LJUA 2G5GX 3ACDA 3B6MA 4A6XA 5CD1A 1DBIA 2HMYB 4OMDA 4QVGA 1PL0A 4LNHA 2AWOA 3ZLBA 4Q1CA 3IXMA 3WGLA 5HOEA 5KOHA 1Y7HA 3EH1A 3HHPA 3S4YA 5CA1A 4ZPXA 1QHEA 3FVRA 3QTBA 4YALA 2QTLA 3JZMA 3ZDDA 2W0MA 3V1KA 4BFVA 3Q9NA 3QVJA 1Y1SA 1KJNA 4BO1A 3K4PA 1LC3A 5KNDH 2C7PA 5P8WA 1W5AA 2FSGA 3OA0A 1EZ1A 1Z34A 1XJ5A 5A3VA 4CQNA 1O94C 2JJ2D 2Y1LA 3RH0A 4PIVA 2G7ZA 1QUEA 1AQ6A 1F5NA 1US8A 2VEOA 3NHLA 2J3EA 1P2BA 2HGSA 3E2MA 4ITVA 1Y82A 3AKDA 1KETA 3QUAA 5K51A 3P19A 5A02A 5CXQA 4LBWA 1DOHA 4JJAA 3P2MA 4DSZA 1C41A 2IXFA 1J90A 1JPVA 3ND6A 3DT8A 4OJTA 5AKEA 5L53A 1EUYA 4X60A 5L3SA 3X44A 1JDJA 2QTRA 5THKA 1DQYA 2DBZA 4HT3B 1WX1A 2FN7A 4RO0A 3PVSA 3EVDA 2BEVA 1REQB 1C7RA 1XTIA 4BUZA 1WW3A 2FZVA 1G8MA 3Q72A 4JYPA 1R88A 4KEAA 2UUAB 2A5JA 4FGWA 1FS6A 1ULHA 4IDEA 3UK0A 5HRAA 3O82A 2GJ8A 1DLIA 3E7XA 1C4OA 2C77A 1E2IA 1SKUA 3FVWA 3H04A 1AKMA 2FP3A 2P0YA 4L8GA 1K75A 5TQJA 3DXFA 1ZITA 2F8SA 4V2IA 3DBLB 5LP6B 5EXPA 4UVDA 3O03A 4JY7A 3U19A 1EU1A 4XIJA 4ENWA 5HKBA 3VDRA 3NNNA 1JHRA 1FDWA 5H59A 3RC9A 1JLSA 2CXNA 4GBGA 2QNRA 2HBZA 1D0VA 1Q1BA 3LUGA 4ZV7A 3HM9A 3CVYA 2VJYA 1XNGA 1MFZA 1D0IA 1U3FA 3DAGA 4EHIA 2VHQA 1QIJA 2F1RA 2IEIA 3C5CA 3NM6B 3F7NA 3O0DA 4B80A 4CM7A 4LIPD 2CJYA 1PEYA 3A6GA 3ETCA 2XTJA 1TVMA 2DAPA 3PKZA 2FSIA 1X9GA 1O54A 1MJHA 1PWHA 4OGLA 2FF7A 4M1EA 1FUIA 1P2UA 4XGIA 3UMFA 4N76A 3J7AC 1L7VC 3EQ8A 4C7OA 2FX2A 3D59A 3L7YA 1XHEA 4GLLA 1JQAA 3OESA 5BN4B 1RP7A 4C0HA 1QQTA 3IPAA 4ZI3A 3RAFC 3FOEC 4D8YA 1U5CA 5AHWA 3K0SA 4IHAA 4YCBA 1M8PA 1HC7A 1RJ9B 1T9ZA 4PZZA 2UAGA 5DI9A 4RSGA 5EXXA 3W5UA 3L6UA 4MJXA 4M49A 1UF9A 4CDMA 1GJRA 5CURA 2ZI4A 4KPGA 1FFCA 2PIAA 2H2DA 3X1DA 5C8ZA 1CUSA 5T6MA 5L40A 1ZK3A 4FGZA 3OZFA 4WE3A 2ZITA 3IKVA 5CCEA 3AUSA 4NLLA 2ZJ1A 1V1JA 2XDQB 4IF6A 3O9MA 2HAEA 4HLCA 1ORHA 1SZPA 1KOFA 1FJ2A 1ZK0A 2IIPA 2FNAA 3BZUA 2WUGA 3H9GA 2ZYUX 1A2QA 4JLOA 2AF3C 3EGWA 4QDXA 4UFOA 4CU2A 1QOQB 3JAKB 4FJ0A 1NAHA 1K68A 2O07A 2EZ8A 5FQOA 4P3KA 1WXIA 4RMIA 1GV1A 4X1IB 1J4AA 4L2IA 4YGXB 3W5SA 1ZQ9A 3WBFA 1QIMA 2I65A 2HLHA 2PTGA 1YL6A 3WA6A 1XRSB 4E08A 3I8SA 2ONYA 3KZCA 1EX6A 3H0KA 2BSQA 1CY6A 1OE0A 2YICA 5DMXA 4YQEA 4BYMA 4MQEB 4UTVA 3JYQA 1QHFA 2FZ4A 1TJYA 5DK6A 2X8AA 3GRPA 3I4LA 4KIFA 4US1R 1Q14A 5JSKA 6PFKA 1H42A 3T94A 3EGXA 3U61B 3HXLA 1Q0TA 4LRSB 4PC2A 1N2HA 1K4MA 4G1FA 1HNNA 4PFQA 3SFVA 4MRNA 3F6CA 3JZIA 4FFDA 3BT7A 3HLYA 1YA6A