1XDWA

Nad+-dependent (r)-2-hydroxyglutarate dehydrogenase from acidaminococcus fermentans
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
331
structure length
331
Chain Sequence
MKVLCYGVRDVELPIFEACNKEFGYDIKCVPDYLNTKETAEMAAGFDAVILRGNCFANKQNLDIYKKLGVKYILTRTAGTDHIDKEYAKELGFPMAFVPRYSPNAIAELAVTQAMMLLRHTAYTTSRTAKKNFKVDAFMFSKEVRNCTVGVVGLGRIGRVAAQIFHGMGATVIGEDVFEIKGIEDYCTQVSLDEVLEKSDIITIHAPYIKENGAVVTRDFLKKMKDGAILVNCARGQLVDTEAVIEAVESGKLGGYGCDVLDGEASVFGKDLEGQKLENPLFEKLVDLYPRVLITPHLGSYTDEAVKNMVEVSYQNLKDLAETGDCPNKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD+-dependent (R)-2-Hydroxyglutarate Dehydrogenase
publication title Structural basis for stereo-specific catalysis in NAD(+)-dependent (R)-2-hydroxyglutarate dehydrogenase from Acidaminococcus fermentans.
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Oxidoreductase
total genus 120
structure length 331
sequence length 331
ec nomenclature ec 1.1.1.-:
pdb deposition date 2004-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xdwA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1xdwA01
1KC3A 4ZRNA 4OO3A 3HNPA 4GSKA 2G1UA 3L6OO 1DDOA 4WGGA 2BFAA 4AJOA 1LLDA 4E2YA 3MZ0A 4CM1A 1PL8A 3PFWO 3RUEA 4E6PA 3NJ4A 4MVJD 3WIEA 1U8FO 1WNTA 2Q4EA 4RCVA 3JYQA 2EXXA 3SBOA 1H6CA 4UAGA 4WOJA 1HL3A 2BMAA 4XCVA 4CMHA 3NJ8A 3GK3A 3NDIA 1YB4A 1PTJA 2X9NA 1WMAA 2YV2A 5CDYA 4E5MA 1BW9A 1DRWA 3LC1O 3OEWA 4FD3A 4EBFA 2RH8A 4XGIA 1EK6A 1I2CA 1A7KA 3CMMA 4YYZA 4GKBA 1B0AA 1ISIA 2YQ4A 3VKUA 1Y9AA 1X15A 2RHCA 2WTBA 4XD2A 1FMCA 3STHA 1EMDA 4AJJA 1XR3A 3U62A 5JW6A 2EERA 1LDMA 3Q9NA 4N7RA 1HZZA 1MFPA 4FC7A 4O59O 3H65A 2PH3A 2Y1OA 1D1TA 2ZB8A 3FR8A 1X7DA 3PP8A 1IOLA 4IDCA 5ER6A 2XXBA 1OI7A 3D1LA 3LLVA 1FK8A 1M6HA 5AXCA 5KJ6A 2W2KB 3NGLA 4IGFA 4DA9A 1HDRA 3LVFO 3SVTA 1TXGA 1HETA 4XRRA 1N1GA 1YE3A 3L6EA 2FRDA 3AI1A 1AHHA 2OXIA 4BKRA 4AG3A 1BSVA 1Y1PA 1PJ2A 2A9FA 2HJSA 4LCEA 3ZWXA 3RUHA 5L4SA 3OECA 4X54A 3OBBA 1LQUA 4PG7A 3PWKA 3B1FA 2Q99A 4J91A 3TZHA 3K30A 4B4UA 4J4BA 2AA3A 2BGLA 4JN6B 3E18A 2P9EA 2EV9A 1U2GA 4CM3A 1CIVA 1XELA 5I7VA 3QSGA 3TN7A 4AJPA 4HBGA 3AUAA 3QWAA 1HKUA 1P9LA 1GYPA 4YQYA 3JCZA 1B8UA 1CYDA 4K28A 1HYEA 4MPDA 3S2FA 4DRYA 1QYVA 4QXMA 3RUAA 4BO2A 1YB5A 3VH2A 3ADOA 3QV1A 3HWRA 2QQ5A 1SOWA 3KYDA 1O95A 3H8VA 5L95A 2AQHA 5JCJA 2O7SA 2VQ3A 1TLTA 2IXBA 1DRUA 4J3FA 1H2BA 1DC4A 3JSAA 3V2HA 1GFSA 4O6VA 3QVTA 1C1XA 3O4RA 4L4RA 3S55A 4BS9A 2NTJA 3W1VA 3VZSA 3ZDFA 5BSHA 4D41A 3WTBA 3RUDA 1O5IA 5DCUA 1LSJA 3LDHA 2UDPA 3GUCA 5F1PA 3RC9A 3HG7A 4INAA 4BKPA 4TROA 1QSGA 5BR7A 2JD0A 2JCYA 2EG9A 2VHVA 1CERA 4IJVA 2HU2A 4HWKA 3OEYA 1R4MA 3IP1A 1BHSA 3TFQA 4E2ZA 5ER9A 1E3WB 1WMBA 3JQFC 5DCWA 4E5YA 2VZ8A 2ZIZA 2RHRA 1UZNA 3INRA 1E3EA 2DTDA 3ANMA 4TMFA 4A03A 4W9NC 3B1KA 2H1SA 1X0XA 4ZQBA 3WGHA 2SCUA 1JDJA 5KVVA 3IS3A 4LK3A 4DWVA 4TRJA 3UGKA 3FN4A 3GN1A 4W7HA 2O3RA 5T5QA 4O0LA 5C5IA 3HDJA 3UH1A 3DQPA 2C2YA 3H9JA 4YB8A 4Q3AA 3KYBA 1BGVA 1GL3A 5JDCC 3VZPA 3KHUA 4OSPA 3ZU2A 2YUTA 1DLJA 3KO8A 4OAQA 3M1LA 1NVMB 3WNQA 1BWSA 4CMEC 1A7AA 1FDUA 3VVBA 3K2BA 3H2SA 4U7WA 2D4AA 1ONNA 5KVSA 5ICMA 4G65A 3OICA 4D0RA 5TIIA 1M2WA 1W0CA 4PG6A 3MOGA 4A10A 3IKTA 3GHYA 1RM5A 3O9ZA 3Q3CA 1GDHA 3JQAD 4RVFA 3WGOA 4MVJI 3PI7A 4A27A 4PLGA 9LDBA 2WYUA 3GEGA 2A4KA 3OJLA 4IDBA 3VPXA 4DYVA 3IP3A 4QTZA 4JP2A 3PLRA 3KSZO 4E21A 1PJQA 5KJ1A 2IEDA 3WWZA 2X7HA 4PLFA 4I08A 3GN2A 1KEVA 4IGEA 4UVIA 5B37A 3R3SA 4ZA2A 3JYNA 5IDYA 4QEDA 2CVQA 1D3AA 1R15A 5G0VA 1GUZA 1TT5B 3H4VA 5L4LA 2LDBA 3GAFA 2HKIA 1Q0LA 4XZ3A 1NWCA 2Q45A 1M67A 5F5LA 1NP3A 2YHUA 1BDMA 2V6FA 4MVJH 3Q11A 5L53A 1U9JA 2WD8A 4D44A 1OC4A 4GLOA 1T25A 4EUEA 4FPXA 3NRCA 4CL8A 1OC2A 1E3SA 2Y1DA 3AM3A 3HDHA 3KV3O 3ONEA 3WGYA 1M75A 3TNLA 5HTOA 3RC1A 4W82A 2DBVO 4CQMA 3C1TA 6LDHA 2PA3A 1EBFA 1UXKA 4ZJUA 1MG5A 3BTVA 1HT0A 3ORFA 4UEJA 4XIJA 3FHLA 3C3XA 4W6ZA 3GAZA 5L7TA 4CM8A 1NAHA 3ONDA 1MV8A 3TFOA 2UAGA 3HADA 4CV2A 3KYCA 3CIFA 1N9GB 4EZBA 5TC4A 3LSYA 4F3YA 3RKUA 2Y67A 2NVUB 1U1IA 5A3JA 5AXAA 2QRLA 3TL2A 3MJ4A 3QWBA 4H16A 2HCTA 3ZNQA 4H7PA 3OJEA 3KVOA 4YT8A 5A04A 1ENOA 1VLLA 1SZJG 1QYXA 1S7CA 3ZWVA 4ALKA 3EDMA 1D4FA 4D3SA 1LU9A 2EKPA 4D46A 4PZDA 2IYOA 3U09A 3LK7A 1EDOA 3BMCA 1QKIA 3DBRB 4G5HA 5A4DA 5B4VA 3AUSA 4IXWA 1U2DA 3DOJA 2X22A 3RD5A 3E5RA 2E49A 5EQDA 1PJTA 3MWEB 3OQ1A 4Z6KA 1Y8QB 4FOSA 4XKJA 4B3JA 4E5KA 4R41A 3LLSA 4DGSA 1JA9A 4M55A 2GSDA 2ZB4A 2A92A 1E6WA 4YJFA 1W4ZA 5CPFA 2HMSA 4BO9A 4A26A 4DQXA 3FPCA 4J1SA 1AXGA 4E3ZA 1LDEA 1EFLA 1WLYA 4BMNA 2CVZA 3QQPA 3OH8A 2P9CA 3AI3A 4II2A 2XF8A 2X8LA 3KBOA 4QO8A 3EZYA 4EJ0A 5DULA 5KNLA 1VSVA 3ZH2A 4OXYA 1Y8RB 1NBOA 3B20A 2VTEA 2VNSA 1P1IA 3AY3A 4CLOA 4FDAA 4DIBA 5FI3A 2CD9A 1JLLA 1KVRA 3JD4A 3V1YA 2YJZA 4KQWA 1NFQA 2ZB7A 4NBWA 2VRCA 1E3LA 3MTJA 4ND5A 4HFJA 1PJ4A 3ZHYA 3ZU4A 4RV9A 3E9MA 4RZHA 1C0LA 1QYCA 2NACA 3RBZA 4BOYA 4QX6A 5A03A 1GY8A 2A94A 2WYVA 2ZB3A 2EJVA 3IJPA 3PEFA 3K31A 2EEZA 3K96A 4MVJA 4Y8VA 4HKTA 5C7LO 1AUPA 4WLVA 3SLGA 4CM5A 5KKCA 1BW9B 4E30A 1NVGA 3WFIA 1ZH8A 4WLFA 1Z7EA 1VE9A 2HK9A 2X0JA 3EW7A 3RUCA 1GADO 5C3MA 4NFYA 3VTZA 3M1AA 2VWQA 3JQ7B 5EL0A 1P1HA 1MXFA 3UW3A 1U3UA 1UH5A 1DO8A 3PDUA 1LC0A 1XDWA 3ZWOA 2HK7A 2J3IA 1I3LA 1HZJA 1SB9A 3N58A 1NPYA 3VOSA 1C14A 4DPLA 3FNHA 4F45A 5AVOA 3R0IA 2PK3A 1NQ5A 4RZIA 1GZ4A 2ZTLA 2DT5A 4RPHA 4YACA 4DIOA 4R51A 4CM9A 1LRLA 5TF4A 1H5QA 2FHSA 2EKLA 2YFHA 4MVJF 1U5CA 3VPFA 4ZHSA 1HSOA 5GZ3A 5JFOA 4E0BA 3G79A 4DLLA 3E5MA 1L7DA 3JQ6A 2G82A 3FTNA 4K6FA 1GQQA 3AK4A 5EN4A 3GNTA 5JCJD 4F6CA 4L4SA 3TOXA 1NQOA 2ZYDA 2BGKA 4GGPA 4J49A 1OAAA 4E12A 2Z1NA 3A4VA 4WEOA 4NIMA 5JAMA 5BQFA 4OM8A 1O0SA 2DU8A 1YL7A 4JIGA 3FR7A 3PYLA 1B7GO 1N92A 1J4AA 1FDWA 1YONA 3CPSA 2HSDA 3I4CA 5F1OA 4GMFA 1JAXA 2X0RA 4B79A 1XQ1A 2VHZA 5F21A 5DP1A 1HE5A 5TGDA 4B4OA 4RL6A 2P91A 4RQUA 1E77A 2ZQZA 2AQ8A 4DL9A 3AY6A 3MCVA 1U28A 2E37A 1XCBA 4PLVA 2QZ9A 1XIVA 1UDAA 3WLEA 1PZHA 2G0TA 5T64A 4D7AA 4GQAA 3OJOA 3H3JA 1C1XB 5KJEA 4RF4A 5TSDA 5T6BA 5LDGA 5TJ9A 2XPCA 1O8CA 4CMKA 4Q3CA 3HDYA 1YOVA 3CTMA 4EITA 1AN9A 3H9EO 1BMDA 2X6TA 1BRMA 4GGOA 2JFFA 2AW5A 3KUXA 4FBGA 3U4IA 5TRTA 2DUWA 2ZQYA 3PWSA 1R4MB 4N5LA 1UJMA 2FN7A 3TZQA 3DB2A 3EZLA 3I9NA 1JQBA 3E9NA 3LF1A 3WICA 1WP4A 4PG4A 1DXYA 3ZCXA 1C0KA 1XEAA 1TB4A 1CQIA 2NVWA 1WZEA 2BI8A 3ZGYA 1NFRA 3PZBA 1R4NA 1GQ2A 2NVBA 1M76A 4RF5A 1H9BA 1YH3A 1UXIA 1J0XO 1ZJYA 3B6ZA 1PZEA 3MJVA 1NQAO 3IIEA 3HUDA 2DBQA 3AOEA 5GY7A 1X7HA 4BVAA 2DC1A 4BGUA 1PQPA 2B4RO 2BH9A 1A71A 2IYPA 2NTNA 3G17A 4RGBA 1HE3A 2CDCA 3MJTA 1Y9EA 4Z0TA 4OQZA 1UAYA 2I6TA 3QVSA 4BGVA 5ICSA 4CUKA 3OJFA 1LRJA 1LDBA 1YDWA 4XR4A 3TQHA 2C59A 4PG8A 5LDHA 1F12A 2RH4A 1LDYA 4TVBA 1MG0A 3TJRA 1EVJA 1W8DA 3S2EA 1AGNA 3GEMA 4RDIA 2YZ7A 2NV6A 5GZ1A 1HWYA 1K0UA 1NR1A 4TKMA 1N7HA 3G3EA 3V1TC 4GPD1 3DMTA 4BO8A 2X0NA 4XQ9A 3JQAA 3WDSA 2PTGA 1NQTA 1EK5A 2D1YA 2PKQO 3P5SA 2WWRA 2ZCVA 4AJEA 3K6JA 1GEEA 3OQBA 3QJ5A 1T2DA 1VKNA 4LN1A 2WDZA 4RO0A 4XYGA 4CQMD 4EDFA 2AG8A 3TZCA 3ZV3A 2Y1CA 4WCFC 1ZSYA 4LGVA 1MLDA 2YHIA 3DBVO 1EFKA 4WK6A 4FB5A 1W6UA 1F17A 2Y05A 4LRSB 3MTGA 1V35A 5IDWA 4EJ6A 3PJGA 2XXJA 5EESA 1HTBA 1XU9A 4I5DA 4NH4A 1PWZA 3PHIA 3CEAA 4WLOA 5JE8A 2GZ2A 2FPGA 5ENVA 2PY6A 3WJ7A 4B4VA 3DR3A 3F9IA 3G49A 4HV4A 1YBMA 3F1LA 4R1SA 2OMEA 4TZTA 1H93A 1P0CA 3O8QB 2NUAA 3A06A 2GASA 5K6AC 4P4NA 2JHFA 4U8GA 2O4UX 1QYDA 1Z82A 3PGXA 2TMGA 1H6AA 4MP3A 4EUHA 2D5AA 1NHWA 3QVWA 3QW2A 3ZHXA 4GSLA 3DEYX 3I23A 3IKVA 4EEXA 1PR9A 1C1DA 3W8FA 2ZYGA 1E92A 2VZ0A 3ZWPA 1HDGO 4BNJA 3FCOA 1R0KA 3NAQA 1NPDA 3V8BA 1LSOA 1Y6JA 4KWIA 4DPKA 5I9LA 1D1SA 4JX8A 3ASVA 4M8SA 4WE3A 3BXXA 3A14A 4Y6RA 5GMOA 1KY5A 5CFZA 1KVUA 3AU8A 2W8ZA 3LYLA 3NV9A 4PLYA 3WXBA 3HSKA 4BB5A 1GQYA 4UEKA 2BGMA 2RCYA 4IQ0A 4HXYA 3E48A 3GZ4A 1ZVMA 2Q49A 1VJ0A 2DTXA 2DQ4A 4P4GA 2CDAA 4H3VA 5TT0A 3HN7A 3KEOA 4M89A 4R1NA 1JKIA 1IYZA 4KUEA 2EF1A 4YJFB 1R12A 1T4DA 3AM4A 4XWYA 2VOEA 3OIDA 4CV0A 5IZCC 1HSZA 1MFZA 4U0JA 3GF4A 4BQRA 4RPGA 3LC2O 3UKOA 1A4UA 2Y68A 2PD4A 3O38A 4Y6PA 3HJAA 3GLQA 2NQTA 4IZIA 1P0FA 1KVQA 5BNFA 2X5KO 3B1JA 3GZNA 3L6DA 1LX6A 2CDBA 3I9OA 1X14A 2FR1A 1SEVA 2HMVA 3AM5A 1NVTA 4OQYA 3CUKA 4IDDA 3EAGA 3ZNOA 3AWDA 3NX4A 1P45A 5I7SA 5KJCA 3RROA 4URFA 3DAPA 3C85A 2UV8A 1KC1A 5FFFA 4M49A 4ND2A 1I30A 4R3NA 1R37A 1T4BA 1ZFNA 4DXHA 4GVLA 3U9LA 3E8XA 3P2YA 4BNTA 3B70A 2GZ1A 3JQ9A 3GR6A 2YW9A 1WDLA 3DBHA 4II3A 2YDXA 3MJEA 5DOZA 2BFOA 4DQVA 4U6SA 4PLHA 4BKOA 2I99A 5BNTA 3AFNA 2HRBA 5CEFA 3S1LA 1ZK3A 2PR2A 4CM9D 2Y66A 4I9HA 2V65A 4BL5A 4UREA 2BELA 4WOKA 1LLUA 2Q3EA 5IDQA 4J0EA 4OOFA 4DTIA 1CETA 4HY3A 1BXKA 4Y67A 3Q2KA 3NT4A 3TWOA 5EPOA 4NHEA 2OUIA 1H9AA 1ADCA 2G17A 3NGXA 3BA1A 1WW8A 3NTRA 4N5MA 4YJDA 2W98A 4R68A 4RVGA 2EJWA 3ZNNA 2QIOA 2HUNA 1O9BA 1QRRA 3JQCA 3PHJA 4CMAA 1YWGO 1YQDA 2Q2WA 4ITUA 1GCUA 1NNUA 3KB6A 3QP9A 1M6WA 2PKQP 1BXZA 4A2CA 1IL0A 2Q2VA 4GWKA 4NK5A 2I9PA 1ONPA 2HLPA 2O3SA 1E7RA 2PD3A 4YRAA 5IXYA 3GVXA 2IEBA 4LSMA 2GZ3A 4RF3A 3H5AA 4JROA 1D8AA 4GX5A 2FOIA 3D4PA 4BO0A 1I0ZA 5A05A 1I2ZA 2X9GA 4FIZA 4IXTA 3WGGA 4ND3A 4MIOA 4I5GA 1LTHR 4J2OA 4KZPA 4MKXA 4R9RA 2D59A 3PQDA 4GX2A 3RU7A 3RJ5A 1PJBA 1DOHA 3IUSA 3BAZA 2R00C 3KLPX 4HP8A 3WGQA 4JLWA 1G1AA 1XLTA 2D0IA 1RM4A 1T1SA 5ENDA 2DAPA 2VUUA 3RIHA 1NTOA 2Y0CA 3GFGA 2OOSA 3PIDA 1YJ8A 3WQSB 5DBIA 1ULUA 4TQGA 2IXAA 2BKAA 4MO2A 3I52A 1MGOA 1I32A 3K5PA 2ZKLA 5A3VA 1NAIA 1ZXLA 4HFNA 4HFRA 3DZBA 4Y6SA 4FFMA 2OBYA 1Q7GA 3GT0A 4JP3A 1T2EA 2DPGA 3MOIA 3K2EA 3LF2A 3U4DA 1E1MA 3GDOA 3NDRA 2EP7A 1EUCA 3HB5X 4AFNA 1QLHA 1HRDA 2AQKA 3CZMA 4LMPA 4JBGA 5TQVA 5BNIA 1R16A 4DC0A 1V9LA 1SMKA 1Q0HA 5DN9A 4GX0A 1F8FA 1YOVB 4WPGA 4XYEA 2JD1A 4GL4A 4KWHA 1ADGA 3PGJA 4FFNA 4FOOA 4Q3EA 4ZVVA 2D8AA 1P1FA 4DMMA 1GAEO 1SC6A 1X7GA 3WFJA 4NK4A 2GO1A 1GTMA 3OM9A 1P33A 2P5UA 4B3IA 3OFSA 5AXBA 1PU2A 4R1TA 4CM4A 1MX3A 3E9QA 4L8VA 1K6IA 3PQFA 1OFGA 3I9KA 1JKJA 3NTQA 3JQDA 4NBUA 4MOWA 4R3WA 4B7UA 1VSUA 4KQXA 4BGEA 4BO4A 4KTVE 3V2UA 4BIIA 4EYEA 2P2SA 3FBTA 3WSWA 4RPJA 4BO1A 3F4BA 5JC8A 1PL6A 2PKRA 2FZEA 3VAZA 1TVEA 2HJRA 4OOEA 4AJHA 4B8WA 1R4NB 2H6EA 4FQ8A 4AJ4A 3IL2A 4JK3A 2VZ9A 4WCDA 1LDNA 1IZ9A 4IQ8A 1BXGB 4NU6A 5ILOA 2GNAA 1PS0A 4PIVA 3ANLA 5JAZA 2E6UX 1ZXBA 4ESOA 4PLZA 2HMTA 2UVDA 1DHRA 1PGPA 2NWQA 4FJ1A 4P22A 3VKVA 3L9WA 1LLCA 4WNCA 4IDGA 3HFSA 3L77A 5JY6A 1UR5A 4IMPA 1IPFA 1ISHA 1C0IA 4ALNA 3JQFA 1S6YA 1QR6A 4OMUA 2B5VA 4YXFA 1E3IA 1ZJZA 4KOAA 4NJOA 2B4TO 4QO7A 4YT4A 4IUYA 3ZHBA 4JCOA 5KWEA 1ZO8A 3WOHA 4W9NA 2HQ1A 4TWRA 2C0CA 3IUPA 1ZEJA 5H81A 3BHJA 2EIHA 2OORA 4YJHB 2IODA 3GNSA 4IPTA 3SXPA 2OFPA 5TLSA 3EC7A 1Y5RA 3D7LA 1WWKA 3JQAB 4MKRA 5BT9A 2WD7A 1U3WA 2FZWA 1GEGA 3VH4A 5JDCA 2VTDA 2DKNA 2FSVA 3SLKA 3C1AA 3VPSA 1U8XX 5B1YA 1ENPA 4ALJA 2X1HA 1G6KA 4KMSA 4ALMA 4CMEA 2HRZA 4F46A 3GDFA 3AW9A 3I83A 4NG5A 1GZ3A 5ILGA 3H5NA 2C5AA 4CMBA 3FNEA 4BNNA 5HM8A 4O5OA 4NBRA 4Z0PA 1BVRA 4CLRA 1YJQA 4J43A 3H9QA 1IB6A 1KY4A 4RVSA 1FDSA 3W4IA 4YAIA 4ND4A 1XA0A 4K6CA 2C82A 3PYMA 4K26A 4L0QA 4OSOA 3BMNB 4OYRA 4CJXA 5JC1A 4XYMA 4DMLA 4BNVA 3ZWAA 1K89A 1LNQA 3ON5A 4XQEA 2R2GA 4U6QA 4YPOA 2CFCA 1JN0A 5A9SA 3GEDA 4NNJA 1XU7A 2OO5A 1Q7CA 3Q9UA 4XRGA 3C7AA 5A5FA 2UYYA 3D3EA 4DBZA 4ILKA 4GVXA 3TOZA 3E03A 4OGWA 3RFVA 3K8ZA 1GUYA 2OP1A 4IIVA 3RUFA 2OL4A 1LLQA 2OGUA 2AEJA 3LT4A 2HK8A 4YA6A 2Z95A 3BMOA 3PQEA 2Q4BA 2R6JA 4BNLA 5B4TA 1EZ4A 5FF9A 3VPGA 2B4QA 1SB8A 1B3RA 1KYQA 5H82A 4I1IA 2GERA 4ZQEA 3HDQA 4E5PA 1ARZA 4GX1A 3LC7O 3KSUA 3UAGA 2JHGA 2RBEA 1MB4A 2CF5A 5JAQA 4IS2A 4CL3A 2F00A 3RFTA 5L51A 3RJ9A 4NJMA 4CQLA 2EWMA 4UULA 3PJDA 4GH5A 1T26A 1K5HA 2AEMA 1HDOA 2QRJA 1ENZA 4R01A 2PGDA 5K0ZA 2Y99A 3PHGA 3UOGA 5JMWA 1RM0A 1WPQA 1H2HA 3PJEA 4IJUA 4FGWA 4JJFA 5T57A 2HMWA 3AUTA 3K92A 4BO5A 3RFXA 3ZNPA 3TZ6A 3MWDB 2JAHA 4RVHA 3VH1A 3I9LA 5FYDA 3BTOA 3H9GA 3LT1A 4CV1A 3BHMA 1E6UA 1BDBA 2GUGA 5F5NA 1Y81A 3W4JA 2CVOA 1ISJA 4XB2A 1A72A 4DQUA 4BV8A 3EY4A 3WLFA 5IDXA 1YBAA 1B16A 1PQWA 4YQZA 1DBVO 1HE2A 4CLEA 3WQQA 1EVIA 4GKVA 1CEQA 3JD2A 1MC5A 5A9RA 2PZKA 1H0KA 1DJNA 3I6IA 5JBIA 1E7SA 3KSDO 1VC2A 1ZBQA 3KM0A 4J9UE 4PN3A 5I7EA 3KOUA 3DBHB 3GQVA 4BNZA 2NTVA 3M6IA 5THKA 2I66A 3ICPA 1RYDA 2O7QA 1V0JA 3PHHA 4MP8A 4YCAA 1PL7A 3ST7A 3PXXA 1PJ3A 2E4AA 5HWSA 4NMHA 3DDNA 5C7OO 3FWNA 3UHAA 5JO9A 4Z3KA 4CPDA 2W2LD 1IUKA 2EKQA 1VRWA 1M66A 1SAYA 1YGYA 1U3VA 2QX7A 3DZIA 4FGSA 4N54A 5A5EA 1HEUA 4OJNA 4NBTA 4PZCA 5U1PA 1XYGA 5JAIA 1PX0A 3BMQA 4IINA 3H3FA 5TT1A 1ZMTA 3VVCA 2VHXA 4CUJA 4CLHA 1ENYA 2FY8A 1JW9B 1V3UA 1ZSVA 1NFFA 2ZYAA 1FF9A 1UXGA 1ZNQO 4AJLA 2AEFA 2X5OA 4R5MA 2PGLA 3C8MA 2F1KA 1HYGA 3H5RA 1WZIA 1HXHA 4CLDA 4E32A 4R16A 1UDCA 3ZN2A 1QORA 1VPDA 2VWPA 2A35A 3P7MA 2HAEA 3CH6A 3G1UA 4LISA 2I67A 1QMGA 4YVFA 2IDZA 2V6BA 3EK2A 1ISFA 4CM7A 3LZ6A 3RI3A 2EW8A 2NSDA 4NBVA 2PD6A 3BIOA 3L9XA 1DIBA 3KETA 1DFIA 8LDHA 4UUMA 3KYDB 4MVJM 1XQ6A 1OMOA 2JL1A 4GAEA 4MIEA 1YRLA 5BSFA 4B7CA 2NU8A 1P44A 3GOHA 4MVJP 1JAYA 5JO0A 4ALIA 4A0SA 3MJSA 3NT5A 5DOVA 2FR8A 4XJSA 5DF1A 1U5AA 5I9NA 1RPNA 1UDBA 2VN8A 4S3MA 3RASA 1RYEA 1TEHA 2NLOA 1IULA 3WJAA 1LEHA 2PH5A 4QUKA 5COQA 4FFPA 3CMCO 3QWHA 3E6AA 4DYDA 1ADBA 1L7EA 5G0SA 5T8KC 3RKRA 1PR3A 1DLIA 1JVSA 5A02A 4NQZA 3FF4A 1A4IA 4W99A 3ZWYA 1SEPA 2X0IA 5JLAA 3FNFA 3QHAA 1UAGA 4YTEA 2J3HA 5KTKA 1PGOA 4XYBA 3WQRA 2QG4A 5BSEA 5JSFA 1DIRA 1EQ2A 1AHIA 4WLEA 4NFSA 3VC7A 4BNGA 1KETA 1A9ZA 3W8DA 3WX0A 4NU5A 1P31A 4ZQFA 2V6MA 4IQGA 5EIOA 2BRUA 3D5TA 3U3XA 2O4CA 2YV3A 4RVDA 2WEKA 3H9UA 4FJ2A 1I3KA 1HLDA 4J7CA 1R0LA 5IF3A 3PJFA 2B36A 2GD1O 1ZZEA 3OHSX 1K6XA 1H94A 3SJ7A 3GGGA 1VKOA 3BHIA 2I5PO 1P74A 3GGOA 5EMHA 4B3HA 5KIAA 2DTEA 1P1KA 1GZ6A 3BTSA 3IMFA 3PLNA 3DHEA 2WYWA 3I1JA 3CKYA 4OXNA 3KTDA 3AOGA 3EHEA 3GPDG 3ZW8A 1LDGA 1VJ1A 1HF3A 3H7AA 4NR0A 4FFRA 2ZTUA 1Y7TA 3UXYA 2BFMA 1LXCA 2YV1A 5FI5A 1E0DA 3GHHA 3KXDA 4ZGWA 1JVBA 4L75A 3GY0A 1NASA 4XQGA 1DRVA 1LSUA 5IXSA 5G0TA 4F6LA 2ZJ1A 2WE8A 2C20A 3Q0EA 4LRTB 4YAKA 3QIVA 1DEHA 4CMJA 4PGFA 4Z9FA 3UN1A 1YQGA 3N74A 3RQSA 1MC4A 3RC2A 4IM7A 1JTVA 1IPEA 4YBZA 1E1NA 3OIFA 2BLLA 3RC7A 3WSVA 5A1TA 1W73A 4JBHA 5IN4A 3GUYA 3KEQA 4LMRA 5CHEA 2QHXA 1ZCJA 2FR0A 2JFHA 3D3WA 1E7YA 2Z5LA 3MEQA 5CDTA 2DM6A 3WNVA 2O2SA 2VYND 1GV0A 1SNYA 1DJQA 3COSA 4L4XA 1PGJA 3JD0A 4E2XA 4UEOA 5G4KA 5I8ZA 1Q0QA 3GMSA 2WSBA 2WD7B 2HDHA 2VUSA 3ZU5A 5A9TA 1CWUA 3SC6A 4E5NA 3F46A 4U0KA 5EQFA 1O89A 4KDFA 4P8RA 5B4UA 1PJCA 3D4NA 4CMIA 1PEDA 1LI4A 2VT2A 3PTZA 2C5EA 2PGJA 4RPKA 9LDTA 4OL9A 4CQMB 2FMUA 3EGOA 4XEHA 1NM5A 3ZWCA 3QWIA 4CLRB 1GU7A 4PVDA 1PZGA 1E1LA 3I9MA 4KUHA 4UVGA 4CM8B 1HDYA 4QFCA 4Z0HO 5T67A 3R1IA 3D5QA 1WVGA 4RVUA 4TKLA 3KYCB 3T4EA 3EMKA 4Y98A 2JAPA 1I5RA 1N9GA 1SCUA 3CE6A 4J7XA 4L76A 3RAJA 1NWHA 2NVUA 3ETDA 4FJ0A 2YYYA 3ANNA 3OSUA 1V6AA 4I5FA 3WG9A 3TPCA 1K3TA 3TF5A 4OKIA 3NKLA 1DAOA 5DDIP 1SO8A 2P4QA 3QWFA 4JJIA 1VI2A 4WCFA 4EUFA 8ADHA 5A9SB 5JDIC 4Y9DA 2YFQA 4UVHA 3BMCB 4ALLA 4DREA 2QYTA 2OP0A 3F5QA 3GFBA 4XB1A 3ZWBA 1YKFA 1NYTA 1UP6A 1XKQA 4AJIA 3VTFA 3OF2A 1Q1NA 3GDGA 1J5PA 3PPIA 2ZCUA 3DAGA 4EJMA 2PFGA 3QRWA 5KJFA 3EYWA 4EEZA 3OA2A 4BMSA 1V3TA 1NX6A 3TSCA 3JTMA 1DC6A 2IZ1A 3L4SO 3Q2IA 4QECA 4YWJA 2IE0A 3DC2A 4Z3DA 3U0BA 1BG6A 3I6QA 4J9VA 4RDHA 1E1KA 3R3JA 1GUFA 4Q9NA 5K6AA 3DBLA 4BMVA 1EEHA 3ADPA 1FJHA 1ORRA 4K1LA 3AJRA 1TT7A 3OP4A 1E6EA 2Y1GA 1DHTA 3F4LA 3GNQA 1F0YA 3A9WA 4UUPA 4DLAA 4DC1A 4YRDA 4NJMB 2HO5A 3IOYA 2V7PA 3BYZA 3RCBA 4CQLB 2DUUA 4PZEA 1MXHA 1RKXA 4CLOB 4PRLA 3ASUA 5I7FA 4J0FA 1DB3A 1G0NA 3F47A 5FEUA 2UUOA 1A27A 3FI9A 4HUJA 4BNXA 1EVYA 3PDJA 4D42A 1ML3A 1GYRA 1T2CA 4PFJA 2Y0EA 4CLXA 5JYDA 3DHNA 4R1UA 3C1OA 1E3JA 5DZSA 4AL4A 2J5QA 4RF2A 5THQA 7MDHA 1DFHA 1KEPA 4OKNA 4S1VA 2VNAA 2V6GA 2BD0A 3DZGA 1O94A 1X1EA 3U5TA 5CG2A 3JQBC 3CZRA 5LC1A 3DFZA 1B14A 4Q3BA 4IJKA 1X13A 5G2OA 3UUWA 4D0SA 4OIMA 3WGIA 2D5CA 4YEDA 6ADHA 3LT2A 5IZCA 1YXMA 1C0PA 3D4OA 4G81A 3QVXA 3ZV4A 4PG5A 4I5EA 2AHRA 1B15A 3DONA 3DO5A 3JQ7A 2TMDA 5IFLA 1F06A 1JWAB 1QYWA 1F8GA 4LW8A 2FP4A 3P19A 3MJCA 1I33A 1RM3A 3GRKA 1EUZA 2DBZA 4GWGA 3SC4A 1UP7A 2O3TA 4E31A 3UVEA 1ISMA 3FTPA 1B8VA 4J16A 1UP4A 2O3QA 3BMQB 2JJYA 2W2LA 5COAA 3V5NA 4GMGA 2O3JA 4UUOA 1LC3A 1PWXA 1KEWA 4ZICA 5CG1A 3SX2A 3TL3A 3RUIA 1BTOA 3QE3A 4IDFA 2YDYA 4N18A 2VCYA 2IZ0A 1J6UA 5L7WA 3HN2A 3JD3A 5MGBA 4C7KA 3EVNA 2Z1MA 3JQBA 4RLSA 5TX7A 3WMWA 1FDVA 2AE2A 4PVCA 2X86A 4B4WA 4DVJA 3FSRA 1V8BA 1ZSNA 4DIFA 2DFDA 4JGBA 1Z74A 1OBFO 3UICA 1DIAA 4ID9A 3VH3A 3GA0A 4XDYA 2CSUA 3VPHA 4CR7A 1D7OA 3INTA 1GYQA 2OBNA 3LU1A 1WDMA 4A73A 1H6BA 5C37A 3LT0A 4YDRA 3FPLA 3AY7A 4BGIA 4D79A 1Z45A 3HFGA 4OXKA 3DZJA 3QVOA 1ZIDA 3DZFA 3H2ZA 4FS3A 5TJHA 1MUUA 2J3JA 3JQ8A 4AVYA 5I9MA 1IY8A 1WAMA 4DBVO 4ZQGA 3F5SA 3GVPA 2X9VA 1FDTA 2GRAA 1DFGA 2VYVA 3BZUA 5H83A 4BKQA 4WECA 1H6DA 7ADHA 2NU7A 3NEPX 4KDEA 4B8ZA 3IAHA 1UZMA 1P1RA 4E33A 5BSGA 5JNLA 1I01A 5L45A 1B3BA 1PGQA 1Z75A 2R00A 1LUAA 4O63O 4NPCA 1XG5A 1T1RA 5EERA 2HMUA 2GPTA 1MP0A 5DNAA 1I3NA 3GRPA 1LRKA 5U9CA 3JQGA 2H9IA 3I3OA 4TVOA 3ABIA 3DL2A 3DZKA 3E1KA 4W4TA 5AQ1A 1YS4A 4ZN6A 1LSSA 4CMGA 1NPTO 5ADHA 3KZVA 2PLAA 5HS6A 4J6FA 3ZW9A 5HS4A 4XA8A 5IZ4A 4QSMA 3DOOA 1O6ZA 2OHXA 3JQEA 3Q1LA 2ZTMA 4PLPA 3GVIA 3FNGA 1UUFA 3WS7A 2H5LA 4C4OA 2ZK7A 1N8KA 2O3UA 3AU9A 2ZATA 4BV9A 4Q3DA 4QT0A 4DUPA 1AE1A 1I8TA 2Q1WA 3ITKA 4J2HA 4ND1A 1R0SA 3FD8A 4JQCA 3L4BC 1JKFA 3PFFA 3ETEA 4IDEA 2UUPA 3JV7A 2P9GA 4J7UA 4UVDA 4FC6A 1P3DA 2W4QA 4BO7A 4BNFA 1X0VA 2DVMA 4U5QA 2E82A 2I3AA 3OJ0A 2EHDA 4A5OA 2BF7A 4FFLA 4BNKA 2B5WA 4CR8A 4D45A 3D3WB 3M2PA 1PZFA 1E7WA 1KOLA 3K9QO 3ROQA 1I24A 1R66A 2YHIB 4IS3A 1UXJA 2O2YA 2FSSA 4AICA 2DLDA 4W7IA 1NR7A 4XR9A 1SBYA 2Q46A 3EVTA 3GGPA 5AXDA 3GVHA 4BB6A 4TSKA 4CM6A 1EUDA 2VYNA 5G4KB 2GYYA 1HDXA 4PLWA 4UUNA 4L74A 2GDZA 5CDUA 3SJUA 4D43A 3CXRA 4IJWA 4UVEA 4P38A 3T4XA 1EE9A 4ZD6A 3PHLA 4FR5A 1VL8A 3FWZA 4CMIB 3JYPA 1XWFA 1WXDA 1GV1A 2JD2A 2VHWA 4IDAA 1E5QA 1OZAA 2DPHA 1R6DA 2Y0DA 3IQDB 4WNIA 4WUVA 4IZHA 3T7EA 3ZV6A 3ZWWA 3N7UA 2JCVA 2CUKA 4XGNA 3ENKA 2PZMA 1CDOA 3O8QA 4MVJE 1GPDG 4YAEA 4YJGA 4BNWA 1ZKMA 4C7JA 4ZRMA 4HNGA 3ULKA 2YQ5A 3DTYA 3F1KA 4XX0A 3L4BA 4PCVA 1CQJA 3C7DB 2VHYA 3DZHA 2CNBA 4IIUA 3WB9A 1P1JA 4CODB 4XDZA 2O23A 4AJKA 1ADFA 4G2NA 1C1DB 3KLMX 4M1QA 2C7VA 2CZCA 4JXKA 2D2IA 1HDCA 1CJCA 1P77A 3SEFA 4J1QA 2AG5A 3T7CA 5AOVA 2GF2A 5JDIA 1RWBA 2VT3A 4E2WA 4WCFB 1SOVA 1YVEI 2WMDA 2JFGA 1QLJA 2Q1SA 2Y1EA 4XIYA 4D3FA 2ILTA 3UCEA 4RPLA 5CDSA 2PV7A 3KRTA 3HHPA 2FPIA 1QV7A 2IRWA 2Y1FA 3VZQA 1A5ZA 1V3VA 2GN4A 4TRNA 4E4YA 1ULSA 1U3TA 3ROMA 1ZUD1 1J49A 2E48A 3ICCA 2RIRA 1KBZA 3JD1A 4YAGA 4FCCA 4MINA 4WJZA 1DC5A 1ZK2A 3D64A 4NDNE 2B69A 2QZZA 4TRRA 5A06A 5B12A 1PS8A 1E7QA 1DIHA 2ZJ0A 1XHLA 3EUWA 1KIFA 1EDZA 1HE4A 1RJWA 3HQ4O 3DBLB 4GLLA 1ZK0A 4KUGA 3GH3A 4R9SA 2P5YA 3G0OA 1SPXA 3G1TA 3K73O 4H15A 2NM0A 2Q1TA 3GZNB 4R5HA 3WBFA 1CF2O 4YRBA 1IE3A 3QA9A 4TRMA 4Z9YA 4FW8A 3E82A 3ONFA 3WBBA 3HE3A 1T2FA 4RQTA 2FWMX 2GR9A 2AE1A 2XAAA 3WYBA 3AUUA 3ZHZA 4CMCA 4JBIA 1MA0A 2EW2A 1AXEA 1WDKA 2C7GA 4I8XA 1B8PA 2GLXA 4D3DA 3RWBA 3UFXA 3GG2A 3HZZA 4FN4A 2J5KA 2ET6A 2XOXA 3U4HA 3VHRA 4QFDA 1QXSA 1IZ0A 1PJLA 3PVZA 3CSDA 4FSHA 1KVSA 2J5RA 1B2LA 1YL5A 4CR6A 2NU6A 4J4TA 1KERA 4N5NA 5ITWA 1XGKA 5JY1A 2PZLA 1GCOA 2Q2QA 2QRKA 2J6IA 4LCJA 4FFOA 4IMRA 5KOIA 2PWZA 3IDSA 1N7GA 5DCYA 1B26A 5J23A 1JU9A 1XSEA 3O03A 2GN9A 1E7MA 5DBGA 3WYEA 3ETGA 3F3SA 1I3MA 1BVUA 1VL6A 3GG9A 2GN8A 4HFMA 3W6UA 3RBXA 1PJSA 3NYWA 3DTTA 2W2KA 1TA4A 3GMDA 1I36A 3QY9A 3WIDA 3S8MA 3NDJA 2Y93A 2PZJA 4YT2A 4BO3A 3ITDA 3HB4X 4MJLA 4I9UA 1I10A 5ITVA 5L4NA 1JWBB 3NTOA 2CY0A 2CF6A 3V2GA 1HLPA 4BNHA 5L40A 5AYVA 2H63A 5JXWA 2G5CA 1N2SA 2DFVA 1GD1O 2WM3A 3UF0A 3TRIA 3UCFA 3OIGA 3DAFA 1ZK4A 2O48X 1LBEA 3I4FA 2NADA 5DP2A 4MP6A 4BNYA 2QW8A 3PZRA 2FPPA 1X1TA 3VDRA 4IBOA 3INGA 1DIGA 2OZPA 2P68A 2C54A 3PRJA 3WGTA 1ZK1A 3TDKA 4MKZA 2C29D 1HDZA 3R6DA 1UXHA 2D3TA 3S2IA 3WGZA 1HYHA 5DT9A 5JYEA 5HBRA 3CINA 5F1KA 2VYVD 1GR0A 1YL6A 1YB1A 4K9DA 2J8ZA 4OHUA 5MDHA 3AFMA 2VUTA 1DAPA 1ID1A 4IY1A 1Q2XA 1LJ8A 4MDHA 5CPBA 3AOEC 1DSSG 4R54A 4MVJG 5CAEA 5I8WA 4Q39A 3A1NA 5CDGA 1ZMOA 1IHXA 4BNMA 2POQX 5ES3A 1K2WA 1LQTA 4TZKA 4J1TA 4LVUA 5EINA 4NI5A 1N5DA 5U4QA 3WTCA 4HADA 1U4OA 4XJTA 2B0JA 3JQ8B 2NNLD 1EVZA 3DOCA 4GI2A 5JPIA 1Z7BA 5KKAA 5GZ6A 5TS3A 1E3WA 1L1FA 4E13A 2X5JO 2I76A 3DFUA 4XQCA 4EGFA 3RVDA 4HX5A 5JCXA 2RAFA 2PNFA 5L7YA 4XGKA 4NZ9A 2C07A 5JS6A 3ENNA 3LQFA 4RJTA 3VZRA 3I5MA 4J1NA 3A28A 2GGSA 1YDEA 2CMDA 1VM6A 4CM4B 1N1EA 2EGHA 4GBJA 2B83A 3DWFA 3DMTC 2VWHA 1T24A 3JYLA 4JJGA 3V1UA 4CV3A 1GPJA 5IN5A 1PS9A 2BFPA 3NT2A 1DPGA 4ZQHA 1PQUA 3RBVA 2X4GA 2X23A 2Q1UA 1EBUA 5DBFA 3ROKA 3JQGB 1A9YA 3U4CA 2Q50A 3OETA 5KCZA 4XYLA 3Q6IA 4NFHA 5G0UA 5T8KA 3VDQA 4A7PA 5KVCA 3ZWMA 4B7XA 1IHYA 4M86A 4AJ2A 1EQUA 1K6JA 2AMFA 5LCXA 2GCGA 4LSWA 1ONOA 1BXGA 3X2EA 5KVQA 5G0WA 1QG6A 1U7HA 5HA5A 4LVCA 3JYOA 1U4SA 4AJ1A 3L0DA 1CRWG 2NQ8A 4YR9A 4PLCA 1I2BA 5CEEA 4ONEA 5L9AA 3WMXA 4AJNA 2EGGA 4M54A 3OQ6A 3NUGA 1VL0A 1ISGA 3ZZNA 4Q3NA 2BHLA 2B37A 3I9JA 3OA0A 1ZEMA 4ROSA 4WLNA 3UCXA 4YJHA 1F14A 2YY7A 3H6KA 4J4HA 2WE7A 4L9RA 3ZWNA 5L3ZA 4EI2A 4WASA 3RU9A 2ZTVA 3W8EA 1TT5A 1YBVA 4BNUA 2I3GA 2JCXA 3P2OA 2LDXA 1Z73A 5JMPA 3M2TA 1TI7A 1G0OA 5C7IO 4WEQA 4I9NA 4BQPA 5TNXA 1KS9A 4PRKA 3S2GA 1Y5MA 3WWYA 4RLHA 4RORA 2P4HX 4YT5A 3X2FA 4JNKA 3IJRA 5IG2A 1ZW1A 2IZZA 3IC5A 1U7TA 2J3KA 2G76A 3L07A 3C24A 3OMLA 3DHYA 3ZU3A 1KVTA 2VWGA 1C3VA 4YAJA 2O50A 3GVCA 3W6ZA 5K9ZA 1OOEA 1FXSA 1DC3A 3BMNA 3C7CB 4MIYA 4PLTA 3TZKA 1NXQA 2VRBA 3WYCA 2EP5A 1Q7BA 2I65A 5HRUA 2QYSA 2B35A 3RSHA 4YJGB 4BKUA 3PK0A 2C2XA 2AXQA 1PGNA 3W4KA 4BNIA 5EJ2A 1PSDA 4M87A 4EW6A 4KTTE 4R69A 5F3RA 3U49A 1EE2A 3BTUA 3DBRA 4BO6A 1T2AA 4KP7A 4BUCA 2VOJA 3GC6A 3ZV5A 3DXFA 1VJTA 1Y8QA 2GN6A 1YO6A 3BMOB 4WLUA 2W90A 1PIWA 3ZI0A 4P4LA 5IJZA 1E5LA 4WKGA 4BHTA 2WJPA 2AQIA 1LA2A 1NHGA 1QP8A 5IAAA 1KEUA 3FBGA 3WR5A 3PYXA 3JQ9C 2BI7A 4J90A 5COBA 3GPIA 4O1MA 5FWNA 3FRJA 2NU9A 4ZU3A 4DPMA 5G4LA 3D0OA 3F6YA 4Z9XA 3PIIA 3ROPA 1Y8RA 3DMYA 3PWZA 4HNHA 5CP8A 2DBRA 4OH1A 1Z6ZA 2VRCD 1QV6A 4L73A 4QQRA 1UZLA 2JKVA 5CEJA 4CUZA 1YQXA 3O26A 4R4JA 3AI2A 3QLJA 2X58A 4DLBA
chains in the Genus database with same CATH superfamily
1KC3A 4ZRNA 2WIDA 4GSKA 1WE2A 1Y4SA 1ESNA 4D9KA 4WGGA 4AJOA 1ID8A 1LLDA 4CM1A 2GFQA 1PL8A 4RTPA 2B2XA 4P4SA 1IFXA 3PFWO 1ZN2A 5EQTA 3MT8A 3M4YA 3T8YA 3F98A 3NJ4A 2EFCB 2Q4EA 5HKOA 1WPRA 1YR9A 2EXXA 3JYQA 1M8PA 4DT1A 1FU7A 2FEWB 1HL3A 2HEGA 3DMHA 3K5WA 4XCVA 3SYKA 2XE4A 1J7JA 1VXOA 2YHAA 3A05A 4KYIB 1WX1A 1YB4A 2X9NA 1MO2A 4IH9A 4O2BF 1N2IA 4EYGA 5CDYA 5I8WA 1ZOOA 2EDAA 5KBYA 1UFVA 2AMLA 1EXMA 4P36A 1TK2A 4F3TA 3UMFA 4L8YA 4ENSA 2PGNA 3AR7A 4L72A 4MTCA 1L4HA 5CH8A 4DKXA 3RADC 3DMNA 4LZNA 4EBFA 1XMOB 4YLYA 2IHYA 3B60A 1FTQA 3CF4A 4GKBA 1LH0A 4PAOA 4JVOA 5FR2A 3B6KA 3FWHA 3RTBA 5IXYA 1A9XA 1ISIA 2JJQA 2ZIVB 2EFYA 2RHCA 3HCFA 4A15A 2ZAYA 3C6KA 2Z09A 1R5JA 2GK6A 1JEDA 3NFYA 4MUGA 4ZQCB 3ZTTA 5JW6A 1YDFA 3EZFA 1LDMA 2W8BA 3FYSA 1HZZA 1MA3A 3G6WA 3Q9NA 1JQLB 4KXLA 2PH3A 1D1TA 2ZB8A 3INYA 4GI1A 4W5HA 1EDBA 2P0EA 1U8TA 3THOA 5EJ6A 1IOLA 4FEGA 4IDCA 3B78A 3CX4A 2JIPA 1OI7A 3SQWA 3NRBA 4A8PA 4JUAA 1M6HA 2BDUA 4IGFA 3SSAA 4DA9A 3I32A 2R8YA 3PHCA 1CUSA 1HETA 3NVAA 3V80A 4CDRA 4BKRA 3L6EA 1OFIA 4A6DA 1CJVC 2FRDA 3AI1A 2OXIA 4JOCA 2G67A 2ESRA 2QV0A 1V6CA 3OZTA 4GICA 5DGIA 1EFCA 1V8ZA 1PYGA 1VLZA 2A9FA 2FEAA 2HJSA 2Q0SA 4QPZA 2BT4A 3UK1A 1TECE 4ZV7A 3B9BA 3OECA 4GXRA 4X54A 1LQUA 4JL5A 1A9RA 2J31A 1JQEA 4N0EA 4PG7A 4F4HA 5E38A 2Q99A 3MRVA 5CLHA 4B17A 1OH5A 3TZHA 4B4UA 1CUCA 1GTJ1 1YQTA 4JN6B 1Z4QA 2LW7A 2C78A 2Z6QA 1S3IA 1SVOA 3TS1A 4AJPA 2LIVA 1J0DA 2GKSA 2B1QA 1MDFA 4FWTA 4AQ7A 2QN6A 1MEEA 2WHXA 2R7LA 4YQYA 1JZTA 2CC2A 4C30A 1AQ6A 1HYEA 3KZ1E 2QZ4A 3S2FA 1W87A 4BO2A 2UZ3A 3X44A 2J9GA 4MCAA 3VH2A 5AW8A 4Y6GB 3PCXA 4K3UA 3KYDA 3H8VA 1GIAA 1BDHA 3GJTA 2AQHA 4B7AA 3PXAA 2ZBEA 3T41A 4I1VA 5JZSA 3H19A 2VQ3A 2ASVA 1AO3A 3PG5A 2ZANA 5FPQA 1W59A 4XJVA 4LE0A 1DJOA 2R86A 4A0RA 2XDYA 4X84A 1RZUA 1NSFA 1T1JA 5IRCD 3AL3A 1RYYA 2HA7A 3L02A 4RHCA 4DMHA 1JR3A 1S0UA 3CJQA 5CCXA 3TX2A 2NYAA 4HAYA 4EVSA 1IEWA 2R65A 4AZVA 3EPLA 3GUCA 3P2IA 3PB3A 3HG7A 2WZDA 1Y48E 1TQDA 2WWTA 3QMVA 5CVEA 1PLLA 2HU8A 2JCYA 4JVMA 5BR7A 1I4DD 3K16A 4QG7A 5BUZA 3HXMA 4IJVA 2P2DA 1Z83A 3QU5A 4HWKA 4OHPA 5DHPA 3VUFA 1TCVA 2G77B 1R4MA 1K9VF 3R5HA 3JVEA 4H1UA 4JC5A 3LFTA 2QW1A 5HDQA 1QJ4A 5K8UA 1ECFA 4ZYUA 2XEDA 4G63A 3R5JA 3UPDA 1N6OA 2VZ8A 3GQBB 3LX4A 3X1MA 2ZIZA 5JEEA 4M99A 1H0HA 2HXYA 1L7RA 4U7HA 1P72A 3O3OB 3TINA 3UJCA 4TMFA 1R9MA 1TO2E 4RBNA 4Y30A 1E6MA 3U39A 5B1EA 3WGHA 4OBBA 3DM5A 1WCIB 1JDJA 5KVVA 5J5CA 3PKJA 3EA4A 4CEHA 4LK3A 4O4IF 4V1CI 4F5YA 3VJMA 3FN4A 2OK7A 1RADA 2O3RA 3IUEA 3GLFB 3QOWA 4Q66C 4Y9RA 4KQ1A 4YB8A 4DZRA 1EFHA 1N0WA 1L7VC 2XA1A 3KYBA 3P0RA 2I1LA 2OECA 2YS7A 3CR8A 4M88A 4UHCA 3VZPA 4OD0A 4KQCA 2IPNA 5B1SA 3KHUA 2MSEB 3ZU2A 1M83A 3QFRA 2IUSA 1HV8A 4XPIB 4EG4A 4Z4IA 4P4UA 1FFDA 4OTZA 3DM9B 4GWLA 4N8SA 1QDUA 2NQ2C 4FINA 5TXGA 3ZHOA 3VVBA 3K2BA 5CLFA 4UAUA 5FXMA 3RYCA 3H2SA 5E2IA 3TDMA 2PT6A 4U7WA 1PK7A 1M5TA 2GK3A 5ICMA 4G65A 3VYTB 3HHEA 3K71B 1T6XA 2GAFA 1RQ7A 2Z6AA 4WW0A 3A7DA 3GHYA 3ILSA 3HVIA 4GBGA 2H4WA 1TTHA 5JQWA 5IM4A 2YKGA 2OB2A 2MU1A 4JJAA 3TOSA 2ARKA 2QR3A 4DCSA 4RVFA 3AO0B 1H1DA 4IMIB 3PI7A 1WOYA 4MVJI 1FP4A 4A27A 2WJYA 4US0R 4W5JA 3BFKA 3OJLA 1V95A 3VU1A 2JPDA 4JYMA 5JPDA 1G8KA 2GEJA 3OKCA 2OCAA 2O8CB 3WZ2A 1ZCZA 5AK4A 1IUOA 1UBSB 2C57A 3BAFA 3R09A 4M9UA 4RLFA 1NULA 4EKIA 2I2FA 1KBOA 3NHJA 1OYYA 1OXXK 4LDJA 3ONNA 4BP3A 4D0LB 3OFVA 4IUBS 1RHJA 4LXTA 2O54A 4YCBA 3STVA 5G0VA 1GUZA 1Q21A 1TT5B 3KDAA 2C9CA 1M2OA 3D4BA 3L0BA 3VAYA 4XZ3A 3FPJA 4L2IB 1M67A 2ZOSA 3DCNA 3KZOA 3E7WA 2I91A 3ME5A 2HREA 4ZAZA 3ESAA 1OB5A 4NJEB 4GLOA 1T25A 4EUEA 3L7YA 5HOQA 1ZYUA 5DSZA 3L41A 3V3KA 3HDHA 1K6MA 3N07A 3WGYA 1N32B 5EEHA 4HS4A 1WA5A 2VF8A 1I9GA 2IDJA 4CQMA 5C0OE 1FDIA 4EG8A 4OY3A 5GM2A 2IYZA 2GBFA 1GQOA 1RWMA 5TQJA 3C1TA 4B76A 1DMRA 5E4JA 6LDHA 3SZUA 4DIEA 3LVQE 4ZJUA 1HT0A 5BUQA 3GCGA 3WISA 3GAZA 4AY4A 3ONDA 2BGWA 4BQSA 4QDUA 3RSOA 4KNWA 3UOWA 1N9GB 3FOEC 3JPWA 2UYCA 5TC4A 2J46A 4U63A 2BSXA 4TL9A 5JBQA 3JQRA 1TEXA 5AI0A 5AVQA 2WNSA 2DX7A 3NUZA 2NVUB 3T5PA 3PA8A 3D6FA 3DDCA 3NBAA 4M1MA 2NMVA 5AXAA 4QU9A 4U2FA 3A2NA 3LW8A 1IXKA 2HF7A 2CYAA 4HGYA 3SZMA 3R4VA 5I7HA 1ZQ1A 3ZNQA 5JSHA 3HKBB 3R5SA 2XNHA 4RFVA 2P3LA 1KJQA 4P31A 5CLGA 3F4KA 1WF6A 4HNUA 4JVSB 1G21A 3KT8A 2IYOA 4PZDA 3UHOA 3U09A 1X70A 5F76A 1JWLA 1RAHA 2JIBA 3ICVA 1WVMA 3NI2A 3RD5A 3E5RA 3ZVRA 1NXWA 4FDTA 5EQDA 5A6VA 1VSTA 4MPTA 3RU2A 1TKBA 4JDPA 2ZSUA 3K53A 4XKJA 3VR0A 4YR7A 4UNSA 2VKQA 4O25A 4M55A 1CDZA 3QEAZ 3AM1A 2OD9A 5DHSA 1YZNA 1XXLA 5FCDA 5BQPA 3P0JA 1E6WA 4YJFA 3ECAA 2I2AA 4IKPA 3UA4A 4FVTA 2NO7A 3FRHA 4C2TA 2DSTA 2HMSA 4BO9A 4A26A 1XVTA 1CJSA 4DQXA 3FPCA 1XMXA 2QTAA 1AXGA 4BMNA 1EFLA 1WLYA 3EOAI 4TYPA 2PUCA 2J7PD 1NN3A 3HJHA 1YIDA 1XQVA 2CFTA 1KFCB 4WCVA 5PNTA 1D0SA 2HJGA 4II2A 5E4FA 2XF8A 5HZMA 2ZJ8A 4QO8A 4DA7A 3K0BA 4B6JA 3MRSA 2IU0A 2H4FA 3EZYA 3DCIA 5KNLA 2XBUA 3KB8A 2A3NA 5IVPA 1VSVA 4GM1A 4V1CA 1SULA 3KZKA 1ICEA 2CT8A 4R9NA 1Y8RB 2PMFA 3EGDB 3HA5A 1GPUA 3U16A 3ZDBA 3WLSA 5KMGB 2OXEA 3OKPA 4P08A 2IGBA 2NO4A 3JZFA 1XD2B 3AY3A 4ABTA 1V16B 1Z0KA 2ZIXB 4FDAA 5FI3A 3ZX4A 1AUVA 5LXTB 1JG7A 2F2TA 3QLUC 2CHEA 1BYIA 4OXRA 5E6UA 3UB2A 1RRVA 4X20B 4DR5B 3CY6A 3E9ZA 1OFUX 2ZB7A 5EGSA 3N0WA 3P2EA 1E3LA 4M1KA 2JG3A 2ALJA 1II0A 2YNMD 5KYGA 2PKYX 2QZSA 3AP3A 2I4LA 3IGFA 2PGAA 2OENG 5FWDA 3H1GA 2BFDA 1FNBA 1GNTA 4RZHA 3ENZA 4ZHQA 3DDSA 1QYCA 3WDMA 1WTCA 3WLOA 2XMRA 4BOYA 1W19A 4RZXA 4XQ9A 2OLJA 2GJAA 1CFZA 3IJPA 2EEZA 2LUOA 2R8RA 1JSRA 2EU8A 2J9RA 2MMGA 4KMMA 4MVJA 4PSUA 4JI6B 1DAHA 2X6QA 3DVRX 5AW3A 1OWPA 3ZU6A 3WDLA 1NVGA 3WFIA 2OHGA 1W88B 2VJMA 4Q1AA 3RUCA 1VE9A 5E9AA 2X0JA 3EDOA 5AKGA 1Q2UA 4LDRA 1U02A 2O8EA 1WOMA 4WY5A 3IJEB 3TRHA 3VO8A 3M1AA 3AIMA 1OLUB 3IXMA 5FYQA 4C4YA 1UK7A 2B1RA 3PKZA 1MXFA 4G5OA 1U3UA 4WFKA 4GP9A 4EMTA 1DO8A 1T8YA 4FYKA 3PDUA 4PX3A 3VC2A 3OZVA 3RH0A 1V37A 4LHVA 4ZJYA 2J3IA 2PU5A 5LA6F 1HZJA 1G60A 1MO6A 2N1BA 4ZOLA 4Z4GA 4BN0A 3TEFA 3GAMA 2PK3A 4RZIA 3E2MA 4TV9A 2DT5A 1XDDA 2NPOA 4C0SA 5M3BA 5LYJF 2RD2A 2PUHA 4DB4A 1E66A 1ECLA 5CXSA 4DIOA 5ARBA 5LQKA 1Y42X 1Y1RA 2YOGA 1Z6XA 3LCRA 2XUAA 1L5FA 4V0MA 4EY4A 3I61A 2XTMA 3I05A 5FULA 4CT4B 1ZGGA 1X86B 2FX2A 2ZAMA 2H52A 1HSOA 2QL5A 1SHKA 1ZVKA 3F7MA 4E0BA 2MSLA 3FKSD 1TYAE 2C00A 2QM8A 1U0NA 2V7WA 2V7TA 1MIOB 3AK4A 4OGKA 1YBFA 2HSGA 5JCJD 1HUQA 4PAGA 4C05A 3D31A 4POOA 4F6CA 4G8DA 3TOXA 4JP1A 2BGKA 2QUKA 3S0JA 16PKA 4CQNA 1O4VA 3FKQA 4Y7CA 2BR5A 3WYGA 3X1JA 1IONA 1O0SA 5JARA 4NXMB 1YL7A 4JIGA 3FGPA 1J4AA 1M1YA 1QF9A 1YONA 3L0SA 1GKIA 5EP3A 5EYPA 2X1MA 5JMTA 3I4CA 1GFZA 3NIBA 4L8GA 4R8SA 2X0RA 3T1HB 2VBGA 1A7UA 5AT1A 2RHBA 2IF0A 5F21A 3N87A 5G53C 5TGDA 1HE5A 1YB2A 1CEEA 2CFSA 3KT6A 4KIGA 2GCOA 1POWA 3AQ4A 4F4IA 5BWOA 3O8CA 2FW0A 3AY6A 5EZYB 1U28A 2Q8PA 2P7HA 2QZ9A 4GPBA 1JSCA 3RR2A 3W6OA 3DLCA 4TLBA 5B1DA 3Q9LA 3BQMB 4MUBA 3RHZA 1LFDB 5H9VA 1CY7A 1G7CA 1NDQA 4RF4A 5H4HA 5TSDA 4EBBA 3GCDA 1PFUA 1YFZA 2HCRA 4BJ3A 4EW1A 2XYPA 5KHLB 1SG0A 3HDYA 1UL1X 1DG9A 1H8ED 1QFXA 2ZULA 3H9EO 3I0MA 2YCBA 3BXOA 4HNAB 3L7KA 4EKEA 1BRMA 3C3AA 3BB1A 3GD7A 2Q6IA 3ESRA 2AW5A 3U9SA 1A0OA 2OSVA 3JATA 4MW6A 4U1RA 4DDTA 1ST3A 1FTYA 3DDUA 4FBGA 5TRTA 5J4HA 2OCXA 2DUWA 3AKYA 2QUZA 4GOKA 2KE5A 4PAQA 3TLJA 2PUFA 1UJMA 1VBFA 3EZLA 1K08A 1OIXA 3WICA 1II9A 1OIWA 4NZZA 4MAAA 3DYIA 4DCGA 1NUUA 3DD1A 3AEYA 4LOIA 3RUPA 2ZI4A 1KSJA 3TD6A 2SKCA 4BTVA 5CBPB 3N86A 3ZCXA 2RK6A 1D4OA 2ZPUA 3PUVA 4ZRDA 4EY3A 3DE7X 4KC0A 1TB4A 1Z5VA 1M7BA 3MERA 3P4XA 3QIAA 4MQBA 3ERCA 2NVWA 4GYYA 4Q15A 3ZGYA 3NO4A 4NESA 1VLQA 2C77A 3PZBA 3CN7A 4Z7JA 1E2UA 1TUIA 1EGHA 3HLYA 1UJ4A 1G2OA 2BSAA 4BQIA 4UFPA 3KKLA 5LWQA 1J0XO 1PZEA 4HEJA 1ZVVA 4DLWA 4QPNA 5LZ7A 5T4HA 4ZAFA 1PWHA 5DYGA 5DEOA 3PT5A 3EXFB 4BFUA 4BVAA 4Q1EA 2DC1A 1XFAA 3DHWC 1PQPA 2B4RO 4JI5B 4BGUA 1A71A 3KR1A 3KJFA 3PNOA 3SFVA 2HYIC 2HRQA 1C29B 2IYUA 2AG6A 1Q1QA 2HFKA 1NZJA 4YNBA 1NP7A 3WGLA 4D8VA 2QVGA 4P7JA 2Q6TA 3KEFA 5FT9A 3QVSA 1L4MA 1OXSC 3G59A 5TPWB 3MW8A 3PLAE 5C7YA 4QEZA 2B1JA 4EF6A 4EI9A 1LDBA 3ORYA 1P9RA 1TK3A 3TQHA 5JS8A 1IZYA 3EUFA 3HB7A 4U7DA 3OZSA 4AZWA 1DTWB 1J8YF 1Z8HA 5MN5A 3FHCB 1W8DA 4UPDA 3D6NB 3G2JA 3S2EA 2RAVA 4P7FA 4B44A 5JQGB 4AWBA 1K0UA 2IOQA 3G3EA 4TKMA 4AI6A 2XTZA 3I37X 3I1FA 4WINA 2X5XA 1N5MA 2ACKA 3G0IA 1BU8A 4LGCA 1NQTA 3R7SA 3RJZA 4D0GA 2DFLA 3PPWA 4LVOA 2KLHA 3DT6A 3GFQA 2EBFX 4TTRA 4Q7QA 1KQNA 2WDZA 1MOSA 1UPCA 3TZCA 3ZV3A 3CEPB 3CSSA 1WY5A 2P9YA 1E63A 2YHIA 1EFKA 2D0OB 1LV7A 2ZRNA 4WK6A 3U7IA 3VDNB 4FB5A 3ZWQA 5IP5A 1KKLA 4HF7A 3ZVLA 1XX6A 5ADWA 2QTTA 2QAJA 3NTUA 4RV4A 3E15A 2V1XA 4LGMA 2XAUA 2C4HA 4Z51A 2Y1KA 1E1YA 3EZ9A 1FZTA 3A6JA 2O57A 1EAMA 4I5DA 4M8IA 4NH4A 5IULC 1MAWA 3PHIA 3CEAA 1UBGA 1O4WA 2ZYIA 3OHMA 1A4RA 3EOBI 1N2JA 2X8WA 4U7TB 4WLOA 2FPGA 4KRYA 3T06B 1WG8A 1LV8A 2EFJA 1QU2A 3B5JA 5L3QA 2ZU6A 1B8OA 2JFXA 5LFAA 2PLRA 4JLSA 4PAWA 4PX9A 2FPOA 1Y9DA 4B87A 3ABOB 5C8DA 3U4MA 3OTQA 3PEEA 1JSXA 5K6AC 3HWWA 2JHFA 4P4NA 1Z82A 4WL0A 1X7ZA 3QKRB 1F4VA 1DQNA 5I9BA 1XEXB 4FTWA 4XVRA 1EVKA 1L5ZA 3BGDA 3QVWA 4FMBB 1XTIA 3QW2A 3V4OA 4EW3A 3D81A 1ZZGA 4L15A 3NNNA 4W8OA 1QMPA 2IV2X 1DG3A 3ZXSA 3AUXA 2B7BA 3AINA 2MCFA 2FPWA 2VHTA 3IHTA 3LCJA 4W8GA 3QBDA 1HDGO 1WSDA 3TB6A 3W90A 4PPYA 1M34A 3NAQA 4WZBB 4HDAA 3HV2A 3OMXA 4DPKA 4RGVA 2VP0A 1ORWA 4JX8A 5F23A 5I9LA 4M8SA 2V9ZA 2QRQA 2QRMA 5KQMA 1KFKB 2XUGA 2ZI6A 5CFZA 1V45E 3M6MD 1UFKA 4OLFA 4H7DA 1U99A 3EPRA 1GQYA 4UEKA 2YZGA 3OCUA 3L43A 4WRRA 1EI9A 2RCYA 2BR3A 4HXYA 3VU9A 3FLAA 2ATIA 3COYA 3GZ4A 3FJOA 1VE3A 2PSHA 4MW9A 3COPA 3OU6A 4P86A 4PXYA 3A6DA 1C5KA 3EWIA 2O20A 4P4GA 3ZLTA 3QA3E 3I01M 3TECE 3NOVA 4L5JA 1T5LA 2JA2A 4BFLA 2P3QA 3ZGZA 4M89A 1Y4DE 2H11A 3VUEA 4EO4A 2JIDA 2DFTA 1KAOA 2Q3MA 3AR5A 1R12A 3AM4A 1S9HA 3TUJC 4ES6A 1UKAA 3BK1A 3B9RA 3P71T 4WNYA 4LF5B 3HBMA 1CK4A 1MFZA 4EI7A 4QOIA 4AK9A 4U0JA 1DO2A 3IBSA 2Q8QA 5FWAA 3GF4A 1K5DA 3A4TA 5EIEA 5JWOA 3H6HA 3LC2O 3P0EA 4MW1A 1A4UA 1UKVY 2LTAA 1XDGA 4M53A 4RPGA 3ZWKA 3PFBA 5LKAA 2WPNA 4QVIA 1JEQA 2H8KA 3O38A 3PX3A 1JIXA 4UZFA 4MXDA 1PYOA 2EFEB 2I7VA 2JEYA 2V5AA 3DVAA 1P0FA 3H5WA 3N53A 3TXAA 3V9AA 3PD1A 1ZD1A 4M6WB 4R7GA 3H4MA 4Q12A 1SPBS 3GZNA 2WJHA 1LX6A 3PC4A 2CDBA 2ONKA 4ECAA 1X14A 2FR1A 3Q7EA 1XRQA 1GN9A 1O5OA 3FB1A 1O1YA 1I6WA 2O05A 4IFBA 4TYNA 5IARA 5C1IA 3F7OA 3H4TA 5CLIA 1B93A 1OXKB 1SBTA 1UBLS 1HT1E 3HRKA 3HVKA 3ZNOA 4DCTA 1OB2A 3VNVA 1PKXA 5I7SA 5KJCA 4JODA 3ESZA 3RROA 4URFA 1TZMA 2BTOA 4YRLA 3ZEAA 3HK2A 2UV8A 3UBMA 1F6WA 4ND2A 1PUJA 2C2WA 4LJYA 4R3NA 1G2IA 1QHFA 4CTNA 5B2FA 2J9YB 1YVPA 4WI1A 3ER8A 1GAXA 1SQ6A 4CGYA 3B70A 4YMLA 2PWAA 3K15A 3SG0A 2PKCA 1FFCA 2FZKA 3DBHA 2YDXA 2BZ1A 5GGYA 1Q0PA 3WWPA 2Y8EA 2X13A 2WMNB 1Q7EA 3DOHA 1GARA 3ETNA 3I2HA 4HDSA 3U7JA 4D5GA 4DM7A 2A0KA 2Z9BA 4G5YA 4EX6A 4TXJA 1KH1A 3IPXA 5K0NA 2PR2A 3SOZA 4HPWA 2AZMA 4O8CA 4CM9D 4EY8A 1CCWA 5DI9A 1J24A 1YSCA 2QNIA 2RHGB 1K27A 4QQNA 3TMAA 1LLUA 2AN3A 2Q3EA 4MZXA 4XWOA 1MW8X 4RWZA 4KLRA 4HY3A 1BJKA 4G26A 3R8XA 5K0FA 2ACWA 2XB8A 3ZIUA 5BSUA 1H22A 2F17A 2QROA 2QY9A 3A9VA 1GL7A 1Z6AA 5SICE 3USES 1T91A 5K45A 4YJDA 1H9AA 2G17A 2FCAA 4N5MA 2FCRA 3L8GA 4LQLA 1C3OA 3AVOA 4TV8F 3CZ5A 3ZNNA 2NZXA 1SQ0A 3UB4A 1NT2A 1O9BA 1EP2B 2H2AA 1B74A 2F7SA 1YQDA 2BHSA 2V03A 4ITUA 4WKBA 3QP9A 1M6WA 2FMFA 1BXZA 3L0OA 3NHRA 4MCJA 4ZYZA 3BX1A 3TAUA 1S2LA 3SR4A 1ONPA 3ZHTA 2FMHA 1CV2A 2O3SA 2VYCA 1E7RA 4YRAA 3ELUA 4L9SA 3Q72A 5K8JB 4EYKA 4LSMA 2PUVA 1JE1A 1WXHA 1V96A 1RC0A 2EFHB 3ACCA 3IKJA 5EVCA 5HZGA 1J2UA 1OF1A 5LQNA 3HI6A 2ECPA 3THRA 3K9CA 4P2GA 5ALVA 2EYQA 1DOZA 1YK1A 1RWXA 3SSOA 1T5BA 2PYZA 2IWRA 3I0ZA 3CIOA 4MIOA 2VDMB 2XZOA 4I5GA 1P8AA 5ESDA 4J2OA 4IAOA 1Y4UA 5BN5B 1BMFD 2FX5A 4GX2A 3RU7A 4TZ0A 5EIWA 3B51X 2QYOA 3VR6A 3RJ5A 1NI3A 3RYFB 1PJBA 1G3UA 2ZJ7A 2R00C 1M1ZA 3WGQA 1IJBA 1XLTA 4JDUA 1VE6A 1C2YA 5GWXA 1YHYA 2A78A 2OCKA 1AUXA 3V9PA 2J5XA 3A8TA 3T5DA 1RHRA 2CLHB 3EXHC 3LECA 3GFGA 3HUUA 3MMZA 5C8VA 4AKGA 3PIDA 3WQSB 1OGYA 3I2FA 4CG3A 5DBIA 4B48A 3MFQA 4LOHA 2E5LB 2V96A 3MLAA 2AZTA 2HY7A 4HAIA 1JXMA 2RBGA 4FW9A 4QIHA 3FFTA 4KREA 1L8QA 4FFMA 1Q7GA 2YVUA 3GT0A 5LLDA 4KR6A 3MOIA 2ZYTX 1T8RA 2AGVA 2AXPA 2P27A 3EH2A 4DQ0A 3LF2A 4LIPD 3FOZA 1UM9B 5F9HA 1H85A 5JZBA 4HNSA 2AJCA 2ATVA 2LVBA 1PNTA 1HRDA 2AQKA 3CZMA 3NWBA 4JBGA 4LMPA 4JFRA 4Y2UA 1SFRA 5BN4B 3TLXA 3PXGA 3TRDA 1Z6GA 2P7IA 3LSTA 1KGDA 2ZYWX 3X1YA 1YDGA 3G5UA 4YV2A 1CG6A 3AP2A 4GE0A 4KWHA 1ADGA 2OFWA 3DTNA 4Q3EA 4BZXA 2BGGA 3MTIA 4EVIA 4JSYA 2LCFA 1PFGA 4IIHA 1X7GA 5ALEA 3WFJA 4JITA 4DLRA 2ZBVA 1DS6A 1H5UA 2OGWA 4NOLA 2ZDHA 1PU2A 3B1VA 3HCAA 4NH0A 4EB6A 1NXSA 2XBLA 3RBAA 1OR8A 1ILEA 5CIQA 3ZUGA 4V0KA 4MWSA 2AL7A 1FRZA 2R1ZA 1OFGA 1CDEA 3DMPA 2EWVA 3BICA 3F49S 2XHEA 3I9KA 1ZW6A 3NTQA 4JB0A 4MLPA 4MOWA 1JAHA 4B7UA 4KQXA 4BJ1A 3WOVA 3ILXA 4BO4A 4KTVE 5BSVA 4L6CA 4BIIA 1XZPA 1AC5A 2P69A 1F0PA 1NUHA 2SECE 2AOXA 2ZJ5A 3R41A 4INZA 3F4BA 4RPJA 9ABPA 4NNOA 5JC8A 3H17A 5JXIA 4OOEA 3QU9A 4DSOA 4AJHA 4H1HA 3WRXC 4X64B 3KB2A 4FQ8A 3RT9A 2R6CA 2PZBA 4I3GA 4JK3A 2AFVA 4AJ4A 3IL2A 1SQGA 5FNVB 1LDNA 4YUVA 4A6PA 5BUCA 2ZXUA 1UMDA 1Z8DA 2EFGA 1HNZB 2FWRA 3PEWA 3THYA 3ANLA 2GXSA 5JAZA 3KVYA 1OTXA 3IUJA 5HGXA 4ZFNA 1Z36A 3HBAA 3GLKA 1DHRA 5SZJA 5IHXA 2NWQA 4P22A 3SP1A 3IPLA 4V2UA 3T7TA 1LLCA 1S4QA 2GFIA 4IDGA 1U04A 4IV5A 2WIFA 4K2AA 3PNBA 5JY6A 3JSXA 4BMPB 1HNXB 4QULA 5DTQA 2X3YA 3JQFA 1VKHA 1S01A 4X94A 4O2AB 2HBYA 4ZU1X 4KE9A 4YXFA 3WLKX 2C3PA 5JZOA 1E3IA 4KOAA 4F1WA 2WFMA 4E46A 2FW6A 3ZHBA 4FNOA 3LD9A 2YW2A 1QCZA 2VEDA 3IUPA 1ZEJA 1TCAA 1PD1A 3Q7TA 4JYZA 1P9OA 2OORA 1TM4E 4Q03A 4TLCA 2P75A 1AGPA 1N5JA 3O4VA 4KVGA 4A0FA 2C8LA 4GR9A 3EC7A 3Q98A 3CVVA 1H0RA 3LOQA 3D7LA 1SXIA 3UJ3X 1UANA 2A0WA 1KO5A 5BSMA 1N6KA 4B6EA 3JY6A 5JDCA 2PRSA 1XD8A 2VTDA 4OYYA 2MSWA 2QMUA 4QTXA 1N5RA 3C1AA 4O4JF 1RRCA 1TW3A 2HRDA 3BE5A 5B1YA 1ENPA 3D6MA 2H48A 2X1HA 1VJDA 4X8HA 1OLSA 1GRRA 3TQOA 1US8A 3M3DA 4B5LA 2NUTB 4OGLA 1IQRA 3D9QX 4F46A 3GDFA 4NG5A 1L5QA 1UBMS 3OE7D 5ILGA 3A9CA 1OHHD 5K3EA 2C5AA 4CMBA 4D9FA 1U0LA 5DWVA 4O5OA 4NBRA 2H85A 5EP2A 4M9RA 2CKDA 1BN6A 1T3LA 4RM2A 4AG6A 7YASA 4KQHA 1QH1B 1QZ3A 5DASA 2Z3VA 1MABB 2QRHA 3MF4A 3JAKA 3Q6MA 4J43A 8ATCA 3U19A 3W7BA 4RVSA 3NWPA 4ERNA 3W4IA 4MQMA 2JRLA 2A7QA 2AOUA 1IN1A 2C82A 3NNSA 3PYMA 4LNUB 3SX4A 3BMNB 5CB4F 4ZTBA 1E0JA 3BXHA 2WT9A 1JDUA 1J39A 3CW2A 5AI5A 3IQEA 1CS0A 3RW9A 5JC1A 2FAXA 1WCV1 4B75A 4GPAA 3AEKB 3N2KB 2BH2A 1P0PA 1EM8B 2HA5A 1SVKA 3H6GA 4DMLA 1UBFA 3T7JA 4BNVA 4G9GA 2FMXA 2WHRA 2QNRA 4AU1A 4F5DA 1N36B 3ZWAA 4G0PA 4CTOA 5F77A 3D8NA 4GT1A 2O5EA 3I04M 1UK6A 3IVGA 3KQOA 5CLJA 2M2IA 2KS6A 1OVMA 1JN0A 4EPXA 3S7TA 4NNJA 3TQQA 3M5DA 4HOYA 5DNYB 1XU7A 3SCZA 4B3MB 4WNAB 1N33B 1A77A 1G3QA 2UYYA 4IXMA 2RBKA 4UU7A 4MWGA 3K9NA 2VZEA 2VSFA 4AZ3A 3RFVA 2X8JB 3FVWA 1GUYA 1D5WA 2OP1A 1UAAA 3RUFA 2OL4A 1UK9A 3VHXA 4BPBA 3VKGA 2AEJA 3K8QA 3LT4A 1FXWA 4IYJA 3PPXA 3QPBA 4RABA 2ZRJA 1JV2B 1X1DA 1ZIXA 3PDIA 3M83A 4H3SA 1QKKA 2J6HA 3SGLA 5B4TA 1EZ4A 5FF9A 1DELA 1SB8A 4I4TB 4M1SA 3GRCA 4NZOA 5K99A 4DV0B 4IJ6A 4HAVA 1G8MA 3WK9A 3HDQA 3FPBA 4M0MA 1G8AA 1EG2A 3DNPA 5LP6F 2WWYA 1V2HE 1U63A 3WAGA 2B4KA 3EFOB 1MB4A 1Q15A 1MPXA 4OXXA 5LDHA 2FEXA 3AR2A 4RTOA 9MHTA 2CEAA 4Q4HA 1GTZA 1KQPA 1VQ1A 2JGDB 3QITA 1GSIA 1GPYA 3ZGLA 3J7AC 4GH5A 1T26A 4OATA 3EUAA 1TIBA 3HKEB 3OX3A 1HTTA 2QRJA 1ENZA 4KAAA 2CJPA 4LC1A 1HFJA 1RYZA 1S3FA 1A8HA 2BN4A 3ZDCA 2O2XA 4M0KA 3TIFA 4BV2A 3W5AA 1H2HA 2HQSA 4FGWA 1XHFA 1XV5A 2CXHA 2FW8A 2HMWA 2PS9A 3N8HA 4MV6A 3OKFA 2EZTA 1YOBA 3JW8A 3MWDB 4TQAA 4QDZA 2GZAA 4CV1A 3IX7A 3B53X 3BHMA 5TB5A 1UZUA 3NS7A 2X1VA 5I51A 3UAYA 3KQHA 2CVOA 1ISJA 1QDEA 4XB2A 3CCBA 1X7WA 3OX2A 4LRQA 3PD0A 4V3BA 3PUYA 1QTRA 1ZY2A 1W5FA 2B8TA 1CB7A 2GPJA 3WQQA 1UBUS 5LB4A 8ABPA 2AF3C 3GLHB 4J75A 4ADSG 3QYFA 5JJ5A 2WF6A 2PZKA 1MCZA 1HQDA 1H0KA 5E0OA 2O0HA 3DGFC 3COVA 3VKFA 3H1TA 2QAIA 1E7SA 4Y1RA 3V4VB 2VNIA 4PN3A 3IHKA 3GQVA 3WXMA 2K6GA 2NTVA 1JG3A 3KWJA 3OJXA 4HRXA 2I66A 2PT9A 3M5CA 3C6MA 3DG9A 5IABA 3RRNA 5J2UF 1OREA 3DE3X 3PHHA 4YCAA 3K3PA 1PL7A 2J0QA 4G8BA 1NI4A 2E4AA 5HWSA 1GTVA 3C6XA 3OD1A 5JT1A 4ASUA 4XD7A 2V7BA 3VBEA 2H1CA 4C03A 1MTOA 1NMZA 5JO9A 1S2NA 3LDAA 2G07A 4Z3KA 4JWTA 4QODA 5AP9A 2ZYRA 2JASA 3WKEA 3KQNA 1Z22A 4G5FA 1C0EA 1YGYA 1U3VA 1YNOA 4N54A 5KTOA 2ZUWA 2UU9B 1HEUA 2CE7A 1ZS9A 3LBIA 1Z15A 4OJNA 4R2KA 1VYUA 2WR8A 2MYUA 4NLLA 4XVQA 2IBSA 2AG1A 4RETA 3H3FA 1OJLA 3IJ5A 2WHQA 5CD9A 2AVNA 4Y2JA 1JW9B 2QX4A 4NS1A 5EWMA 1F0NA 5BQFA 3O4FA 2ZYAA 4HUQB 3EXIA 1FF9A 1ZNQO 2G4CA 3CEMA 4AJLA 4EY6A 4IEFB 4Y0VA 4M7RA 2JLQA 3MYYA 4B8YA 4CHGA 4ZO7A 1HYGA 3J81A 3H5RA 1HXHA 4OYLA 1R4AA 5LZ9A 1UKBA 3KK0A 2IPAB 1CY8A 4R16A 1X1CA 2OHIA 1DUSA 1G6OA 3CLRC 3DB1A 5CR9A 4RMGA 1QORA 4KITB 1VPDA 3UC5A 2A35A 4Z7NB 2ZJ2A 3P7MA 3B38A 2VHUA 3G1UA 4XGQA 1QMGA 1M0SA 3L18A 1F48A 4F2HA 5BVGB 5BT8A 1VJ5A 2IDZA 2V6BA 3EK2A 4MI1A 1ISFA 1E1QA 1JEEA 2EW8A 2NSDA 3CX6A 3IVXA 4DCMA 2JLWA 1AKWA 1UMCB 2Z98A 4XSGA 3N7AA 4P92A 2XDAA 5ELMA 1GCAA 1WSWA 2IDKA 4MVJM 1VOTA 1OMOA 4QBTA 4F3KA 4ZZIA 2A5LA 5BSFA 3R7LA 1V43A 5JO0A 2IK8A 5B1IA 4JJ7A 1KDRA 3HR8A 3OWXA 3MJSA 4MV8A 2OSBA 4ZOBA 3NT5A 1GG9A 1W1WA 4HJXA 2FG6C 4KYUA 4ZDJA 5CDFA 2QRPA 1F5SA 4LJSA 2CE2X 4LYHA 2I8CA 2PS3A 3EZ7A 1UDBA 1ISRA 1NY5A 1WMDA 3HNOA 1RYEA 1MGPA 2PXHA 3F3YA 4YAWA 2FA9A 1DDGA 4QUKA 5COQA 2HWKA 3GWZA 3CMCO 2QK4A 4EUHA 3S5UA 4DYDA 4EX7A 1L7EA 3O2QB 1L4YA 5T8KC 5K0CA 1DLIA 5AVKA 3CNHA 4RD6A 1E5VA 4NQZA 1M6YA 5FUVA 3Q85A 2CB9A 1VP3A 1VL2A 4W99A 5HVNA 3HPRA 1FJXA 3T0FA 1SEPA 2QMEA 3ZWYA 2X0IA 4LXGA 1C4WA 1ZRMA 2O8VA 3RU3A 3AV3A 1UAGA 4QATA 1G59A 4J8PA 5JHGB 3CGWA 1MX1A 3QMWA 2G0AA 4XCQA 3OY7A 4B74A 5LD2B 1YJBA 2GBPA 3SKVA 4HQOA 2PBFA 4PO3X 2FZGA 4QGHA 3WQRA 3R0VA 1M2JA 3V42A 2QG4A 3SC3A 5BSEA 3O75A 2V0NA 1OZFA 3EVFA 2IHVA 1UFRA 1EXVA 5J1SB 1EQ2A 1KJZA 1OBVA 4FXOA 1JB9A 4Q24A 3QEJA 2ZSHA 4BNGA 5AVZA 4E7OA 4NU5A 3MIIA 4H3HB 2VPIA 5EIOA 4FYHA 1SKBA 2DG2A 1KP3A 3TIGA 4RAQA 2OFXA 3D5TA 4J29A 3U3XA 4EP1A 2SCUB 2Y76A 1J8DA 4DJEC 2WEKA 1Z2OX 3H9UA 3HJBA 1AKUA 2OZLA 1WUIS 3OLWA 1HLDA 3PDCA 4B9AA 4HVCA 1DOAA 1R0LA 3HY6A 3OZUA 4RH3A 5IX8A 3IEPA 1JJFA 5DN6A 1Q3HA 5KOHB 1U8ZA 2XMSA 1X38A 4G41A 2YVQA 4GIBA 1NV9A 2YRXA 1TYBE 1MAHA 3H2BA 3TLEA 1GZ6A 3AERA 3IMFA 4DRXB 4PYQA 4TMKA 3MTQA 3DP7A 2WYWA 3I1JA 5BV7A 5BVHA 2WJIA 4M8KA 3GCWA 5J40A 2J9ZB 2R8PA 3BFJA 1BKSB 3LUHA 3GLIA 3T0IA 3MFYA 1VJ1A 4CZ2A 5GJBA 4UFNA 5JNWA 1NM5C 2N46A 4NHOA 4U5XA 3UPUA 3ROZA 2BFMA 4RJKA 2WM8A 2FGJA 1YQWA 4GKKB 3VYVA 1EBBA 1USWA 2ZIWB 4L75A 5EI5A 4U2BA 4A1OA 5LU8A 1KOGA 3L8CA 2BEVB 2HDOA 3VU8A 2UVQA 1OLXA 1R8QA 5IXSA 1WZCA 5G0TA 4BJHB 5HIMA 3Q0EA 4LRTB 2REBA 4WACA 3VNRA 4JGGA 4PGFA 5FOTA 1R00A 3QH4A 4CFZA 1MC4A 2Z2JA 3HXTA 4IM7A 1BWRA 1IPEA 4FU0A 5JSQA 5A1TA 2J09A 3S5JA 3A6ZA 2C9OA 5IEJA 2VTVA 4WFIA 2F3RA 3GUYA 3WJ1A 4P0QB 3IESA 3A6HA 4UHFA 1SU4A 2CNNA 2QQEA 3KR9A 2A84A 2QHXA 1T6BY 3D3WA 3TTWA 1E7YA 2AFHA 2CXUA 2Z5LA 5CDTA 1T3SA 2DM6A 4MI6A 2EJBA 1B23P 4RC9A 3COSA 5GV8A 3OY2A 4RMIA 2XWJI 4PXAA 1TYDE 4KBFA 2XYQA 4EFLA 1L8AA 4E2XA 4RTNA 5K0GA 1NBHA 2G4LA 1ESCA 4L6AA 5G4KA 1Q0QA 3GMSA 2WSBA 5CIYA 3F71A 4DABA 1AOXA 1O6CA 2CVFA 3ZU5A 3D7RA 3U3RA 6Q21A 1D7AA 3KSMA 2PUAA 3GLVA 5LBUA 1NI5A 4Y9TA 3VNAA 3WB2A 4IKEA 1ATZA 1C1YA 3D4NA 4HDNB 1VL1A 4MUNA 4OQPA 2VT2A 3PTZA 2C5EA 4ED9A 4BXOB 1E1DA 4OL9A 4YH1A 1JJAA 1DTEA 4MPRA 2FMUA 2XRFA 4JZYA 3LGSA 5E6RB 1H66A 4DYHA 4DMGA 1GNQA 3ZCVA 5HR5A 3QEBZ 1GOTA 4DSNA 2XJ9A 3QTBA 4A1FA