1JI0A

Crystal structure analysis of the abc transporter from thermotoga maritima
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
MVSDIVLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVINRMGIALVPEGRRIFPELTVYENLMMGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGEQQMLAIGRALMSRPKLLMMDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYGYVLETGQIVLEGKASELLDNEMVRKAYLGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter
publication title The 2.0 A Crystal Structure of ABC Transporter from Thermotoga maritima
rcsb
source organism Thermotoga maritima
total genus 62
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2001-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ji0A00
3I8SA 4BRWA 2Y8EA 5JLJA 1KY3A 2BDTA 4URUR 3MWKA 4IEEA 4LJ4A 5IDVA 3ZVMA 3ND8A 1XTKA 3T1VA 4GL2A 1OXTA 4URXR 1TMKA 3IPXA 1NBMA 3RHFA 4FW9A 1DG3A 2AXPA 3R8FA 4GP7A 3BS4A 1IBRA 2IS4A 3BB1A 5JJKA 1R8QA 1N6HA 1SKYE 2YOGA 4LPKA 4OHZA 3PIRA 2IS6A 2AN9A 3TIFA 4OI0A 5EQTA 4CEIA 2O8EB 3ZYCA 1E0KA 1YHNA 2QAGA 3MUFA 1E79A 3ONWA 4B76A 1G4AE 2LKDA 4DB4A 4F4JA 1UAAA 2ZRPA 3KDSE 1M74A 3ADCA 2JDIA 3QENA 4TYQA 1G3QA 1E98A 2XZPA 4KFUA 3KB1A 1G16A 1JXOA 5ELXA 4HSEA 5FH9A 4MYHA 4YQFA 2ZS7A 2G88A 3OE7A 1YKSA 1I4LD 2BBWA 3K53A 4LHZA 2GA8A 2XITA 3UATA 4Q4JA 3WNCA 1SXJE 1W0JA 2O0KA 3QPUA 1T91A 2A5DA 3KXLA 4B2LA 4EPTA 2GF9A 3NTUA 3VU9B 3VHXA 2ZRKA 3CR8A 5CJPA 3WYAA 1P2SA 3U3OA 4TMXA 1KNQA 4XH9B 3RABA 3K0CC 2IF2A 3BB3A 4KFSA 4GZLA 1A2BA 1C9KA 2ZRIA 2BCJQ 4JLJA 3I62A 2J0UB 1TU3A 3S1AB 2W6ID 2AKAB 1VG8A 3PEWA 3AP2A 2A9KA 5F9FA 1FP6A 4MUBA 1Z83A 1NL3A 1P7CA 5FBQB 1AKYA 2FEMA 2WPDD 3WP0A 3ZZUA 5IK2D 2MSCB 1X8LA 4JSTA 5FPTA 5L3VA 4DSTA 2ZRFA 1DO0A 1AIPA 1J90A 1XF9A 1AS3A 3L2OB 1YZTA 4PO9A 3SBEA 3X1WA 2XJ9A 1HE1C 1G21E 3NIBA 1JECA 4JMPA 1ZU4A 5FOWA 2BM0A 5AUQA 2OFOA 4TMVA 1QHXA 2C99A 5H68A 4DWJA 3THWA 2C9OA 2GEUA 1QVRA 2BOVA 4L4UA 2D74A 5GJCA 3ZH9B 4TL9A 2XZOA 1RW4A 2ZR7A 3WYGA 2ORWA 4TLDA 1OJLA 1RKBA 2AK2A 2CCJA 2GTPA 4AG6A 3SOPA 3GLIE 3C8UA 2ZITA 2JIZA 3T35A 4LK2A 3LVRE 4DSOA 3PUZA 2ZRGA 4GOXA 2GEDA 2CHGA 5JCZA 4ESVA 2QENA 1U9IA 2ZE5A 4A9AA 1W5SA 3QJYA 5C4GB 3VR3A 4JVLA 1ZD1A 1Z8FA 2WOOA 1JQJC 5UKDA 2JCSA 4JLNA 2W0MA 3BE4A 3Q85A 5C1BA 4US1R 2OCBA 3KXIA 1E32A 1XCPA 3C5HA 3KB2A 2QE7A 3GEHA 2CVHA 2AK3A 4PQRA 5FPKA 5FUWA 3CNOA 1LTQA 4NYJQ 4LV8B 3AVPA 1GVNB 1ZNZA 4A15A 1E2MA 3QE0A 2PL3A 5E4FA 2QZ4A 5FL7A 1EXMA 4BLPA 5TY0A 1NMYA 4LPSA 4GOKA 3QG5A 1RRGA 1DE0A 1ZM2A 2VP9A 5SZJA 1OT3A 4LHXA 1ZP6A 4PSVA 4PXAA 1M8PA 4LC1A 5DI9A 4CVNA 2WOJA 1J8MF 1T3LA 3I5XA 4D26A 3Q5DA 2ZRCA 4Z51A 4NCHA 1N5IA 4TSFA 1J7KA 3T34A 1NJFA 4P31A 3QIAA 4X8MA 3AVOA 4GPTA 1SQ5A 3EA0A 3TAUA 3QUSA 3I92A 4RD2A 1L8QA 2FOLA 4M0LA 4RZ2A 1U0JA 5G41A 1AQUA 2QSYA 2G6BA 2ZREA 3BWDD 2PZEA 4ARZB 1FNMA 1HQCA 5JFGA 4EPRA 3VMFA 4F38A 4E07A 4QHYA 3AVQA 5E3HA 2GF0A 1TL7C 3FOZA 4B48A 4Q4AA 1ZC3A 3HR8A 4QGFA 3GFTA 4UJ5A 2V6IA 2ODNA 2IA5A 2IF0A 2IYTA 4HB3A 2ZSBA 2GXQA 5CLQA 5FBRB 2WWWA 2R8RA 2Z83A 3QBTA 2J7KA 3LQQA 1II9A 2QTHA 4Q19A 2QPTA 2HYDA 3CX8A 1SVOA 1ONBA 4LC0A 3RSLA 1FX0B 3V4FA 3LV8A 4B33A 2ZJ8A 1IXRC 1AQYA 3BFVA 4H9GA 2YVUA 3AVYA 3AVTA 1PLJA 5AUPB 2QGNA 3CZQA 5GVRA 4KXFB 1RE0A 4DDVA 5CK4A 5HKKA 2VSOA 4HUQA 3L0SA 1CKEA 4HI0E 1IN7A 2EYQA 3T12A 2IS1A 1XNJA 2J5XA 2QUZA 2CK3D 2GJSA 5GJVC 3UKDA 1EK0A 2OT3B 2WWYA 3EX7C 1NN3A 1LS1A 1E96A 1XZPA 2HV8A 2PX3A 2FG5A 1N25A 4ZKEA 5FOUA 5JJIA 1NSTA 2X19A 4ZCIA 3H2YA 3F5FA 2HXYA 3I1FA 3LH5A 1GM5A 3LD9A 2RMKA 2G0NA 3X1XA 2O52A 2V1XA 3D6TB 2O8FB 4S2EA 3CPHA 3EWAA 3W5IA 5L3RA 2JLVA 2RH5A 2A78A 1MT0A 4FMCB 5CM8B 4K8OA 3RNLA 1XP8A 1Z3IX 5H8WA 3FKSA 4BZQA 3AH8A 3GD7A 2REBA 2EVWX 4U7DA 3B85A 1BH2A 4ASUA 4LJYA 3ADKA 3I3SR 1KDTA 2VP0A 2RHMA 1E2QA 4PSKA 4BLOA 1J70A 1H65A 4JT4A 3X2SA 1A5TA 4PQFA 2PEZA 4M1OA 3T1QA 4URYR 3E2IA 1AS0A 2GRJA 5EZ5A 4MYUA 5C18A 1M1YE 2NTYC 2N46A 3K9GA 4LBWA 2O8EA 4D2IA 1MABB 1U94A 2EFGA 3U4QA 2BV3A 3TR5A 721PA 4CT4B 1Z29A 3VX3A 4LJAA 2FH5B 5D3QA 5CDFE 1YR9A 2F1HA 1M7BA 4XVQA 2QMUA 1U81A 1Z28A 1M2OB 3ECCA 4II7A 3EZ9A 2BJVA 4E03A 1E9FA 4RKFA 4AYWA 2R6GA 4TLBA 4URWR 4M9ZA 1KZGB 3LW7A 3D31A 1F2TB 3EG5A 4V0LA 4JVNA 3VR2A 4A0FA 3U7FB 3FHOA 4KO8A 4KHZA 2AWOA 2V6JA 3QKTA 3LBNA 3VU9A 2CL7X 1R5NA 2D62A 3BOSA 1Z5ZA 4P0TA 3WMEA 1G41A 3F0TA 1CF4A 2QP9X 5KUTA 1UBEA 2IWHA 2IXEA 3SS8A 3V9PA 4C7OB 4HYYA 2WVJA 3B1ZA 1P9WA 3PV0A 4EPYA 1KI6B 4FMCF 1ZNWA 1J2JA 1JPNA 1NVVR 2ZRLA 1UKZA 1Z2AA 2PCLA 4A0RA 4V0ME 1S1MA 4D25A 2J0UA 1JBKA 4OQXA 5BYKA 3GJ4A 1E9RA 3IO3A 4P33A 4JSYA 1GITA 2QPAA 4M9XA 1E9SA 1OIWA 2XTNA 5ANRB 3C7KA 2O8CB 4NL4H 1OHHD 1GAJA 4Q4HB 3W34A 4P32A 1XEXB 3AF1A 1XJQA 3DHWC 1PUIA 4M9QA 4CW7A 2QM8A 1U2RA 2GEVA 2FA9A 2WHXA 5EP3A 3BH6A 2D06A 3UWKA 2QY9A 1D2MA 1JJ7A 4E5UA 5IF9A 1LY1A 4BFXA 1BIFA 3TLXA 5BN5A 3A1VA 3LNCA 3P4YA 4G01B 4XWKA 1RRFA 2GZHA 4FI3C 2F55A 1M34E 4DDTA 2C5LA 1TQ2A 2NIPA 2VH5R 5H1YA 8OHMA 4OQFA 1YZLA 2VP6A 4FINA 4BFUA 5DHFA 3GLHE 2W83A 2QEQA 4IOLA 1P73A 2Q3FA 3A4NA 1IAQA 1JPJA 2QQ0A 2QBYB 1VMAA 4W5JA 2P65A 5BYJA 4PPNA 2OLKA 4M1TA 1S3SA 3NKVA 4DB2A 2QNRA 2V7QA 4IRUB 3BXZA 3O47A 4YMTA 421PA 2DR3A 4PANA 1QRAA 5CITA 1JEDA 4QKQA 1OB5A 4BLTA 4KVGA 2CLCX 3B13B 3AVXA 821PA 2G77B 1OKKD 2DWPA 5SZHB 3VNUA 3IILA 1ZIPA 5FBWB 3ZIAA 2JAQA 2GZAA 3P32A 1V43A 2GAOA 2FPLA 2IEYA 2QRZA 5KSPA 4OQLA 5GADl 4L5BA 4A1FA 1SVIA 3T06B 2Q3HA 1Z6TA 2ZSFA 1J99A 5DIFA 3BD9A 3OFNA 3CRVA 2ZRNA 3K0AA 1CJTC 4FWIB 4OI2A 1G7TA 4V0NA 1P9RA 1JXMA 3MD0A 3QKRB 3SYNA 2YWFA 3MG9A 1H8ED 3QEOA 4PZLA 2GETA 3C4JA 1UBCA 1P60A 5FUVA 1MO5A 3FGNA 3AF4A 2LWIA 3QF4A 4B3DA 2IYVA 1KO7A 4LV5B 4NYIR 4AWXA 1CU1A 4JJZA 2N1BA 1IN4A 3EIEA 4MUAA 2XOKA 3VX4A 4AY2A 4ZKDA 3UMFA 1RYHA 4TZ0A 2FFHA 3BK7A 2B8TA 1E1RA 1XEFA 4MRPA 3EXAA 2CLDX 3B1XA 5C4MA 4G5SA 2P5TB 3DO6A 1SXJD 3RDPA 4CEIB 221PA 2GZDA 4JLBA 2QAGB 3SNHA 2DFTA 2F9MA 4L15A 3K09A 5AJXA 4L9SA 1B23P 3C14C 3CPEA 4DUGD 1FX0A 4QBFA 2YV5A 2HF8A 2R44A 1N5LA 4ACAA 5FFMA 2FPMA 4PO1A 1Q1BA 3N2IA 2DY1A 1GKIA 4AKHA 1DARA 1LS6A 2GJKA 4YMSA 4A2WA 4B32A 4HUTA 3GMTA 4WW0A 3IGFA 1WBBA 1E9AA 4DT1A 2FSHA 2OO7A 1VCMA 2IYUA 4ZDKA 1XCGB 3U7EB 4Q4JB 4NCNA 3HYTA 3IIJA 2P6NA 4Q1AA 4ZIRA 5A0FA 1W7AA 4UNRA 1W0KA 2GJ9A 1N0VC 2WKRA 3RVBA 1XD2A 3EIHA 3AV0B 2PH1A 4MRRA 2Z5FA 4PPGA 1R2QA 3IUYA 4M21A 3NHAA 3OIWA 3DVLA 1W1WA 3SR0A 1XJ0A 3FB4A 2QT0A 2BMEA 4LYFA 1IN6A 2VHUA 2VHTA 4PFSA 4XTCS 1O3YA 1UBFA 4Q1CA 4B2PA 4US0R 2Q21A 5HE8A 4M2LA 2IEZA 2W2TA 1E1QD 1FNNA 1MOZA 4MQBA 3UG6A 2IWRA 5FTJA 4Q18A 5EE3A 4Y0VA 5JHHB 2B92A 3BIFA 3K0FA 3T1OA 4C0QC 1RC8A 2XJ4A 4HLUA 4IVRA 1HA3A 1E2JA 1Q1QA 1VYTA 4RFSB 3NBXX 3IO5A 4LV6A 1VCIA 2AHOA 4KSCA 2QAGC 4TWZA 2QORA 3BAFA 3MJRA 1XXHA 2W6JD 4E09A 3KJHA 1CJMA 4WXRA 2E87A 3X1ZA 2L0XA 1ZJ6A 3THWB 3GLFA 2ZI7A 3FMPB 1CRPA 1TF7A 1E6CA 3WNBA 2AX4A 5LPNA 5FOSA 1OV4A 3EC2A 2VF8A 3RC3A 2QMHA 3L0IB 2VSXA 3MLEA 4G5GA 4JZKA 4YMWA 4E22A 3TUJC 3BC1A 2HUPA 1BYUA 1ESNA 4BUJA 1KNXA 2PZFA 2ZYVX 5J5CA 4A2PA 2BCGY 4QHSA 3P4XA 1OFUX 3RRZA 1VYVA 3PUXA 3SQWA 4I1OA 2VRWA 1NG1A 5SZKB 3U3RA 1LV7A 4OL0A 3TVTA 1YU9A 3B1WA 3UMRA 1CS4C 4KFTA 2P2LA 2NOAA 3CRQA 1KI6A 4IDPA 2D2FA 2D7DA 4JS0A 4PHHA 1KDOA 1S3GA 4LUCA 1E99A 4R7ZA 2WJVA 2Q6TA 1HURA 3A1TA 1GNRA 1Z0AA 4TMKA 3SFVA 4YC7A 1N6NA 4AYTA 4AKEA 2R6DA 4RKEA 3GLFB 3CF2A 2BMFA 1D9ZA 1P62B 3JVVA 3KKNA 3TMKA 1DBSA 5EXXA 1DO2A 1G6OA 2V4ZA 3TSWA 1FTNA 4QL3A 3EPJA 2V55B 2ZSEA 4K46A 3W3ZB 2W2VA 1CTQA 4ZPXA 3R9WA 2W6IA 3WY9A 4FCWA 5CLLA 4M1SA 2WSSD 1YQTA 1W36B 5JSZB 5TB5A 1KYIA 2H8KA 1AJEA 1W5TA 1E2EA 4EJSA 1XEWY 2WPDA 3KQKA 5KNBA 2PBRA 1P2UA 3L43A 4DVGA 2BVNA 4QM7A 2OV2A 2VLIA 4TYPA 5JJLA 2QSZA 1XTIA 4K81B 1YZGA 2PJRA 4Q4AB 1G8FA 4Q9LA 2GNOA 2IUTA 4I99A 4FIDA 1QHYA 3E70C 1JEEA 1U9IC 3QVUA 2OFWA 5CYOA 2XB4A 2BBOA 4DLZA 4LCBA 2ONJA 2C9CA 1MO6A 5J4LA 1F48A 2ZEJA 3CONA 4W9MC 1Z2CA 2DWOA 4PZYA 2EFDB 4V0OA 3CH5A 4CT5A 1N3BA 1ZUNB 1GL7A 3RC8A 4Q01A 2MMGA 4UJ3A 2GKSA 2WWGA 1OXUA 3E1SA 2D7CA 1W4AA 2IC5A 4ITRC 3RRNA 2PX0A 4OK5A 1ZVQA 4HUQB 5FI1B 1GUAA 1BMFD 1UM8A 2GK7A 3I73A 1E0SA 1ZINA 5CB6A 2C2HA 3VR4A 4R2IA 2ZI9A 5AK0A 1KO1A 1QHIA 1NVUQ 5JMTA 2IYWA 1KK1A 1U90A 5EXPA 5FOXA 4CYMA 4C9BA 3PUYA 1N6RA 4B34A 1OPXA 5KU1A 2H5EA 2ZU0C 1T4GA 4C2TA 3HR7A 2NQ2C 1W36C 1E0AA 3TQCA 3AQ4A 4RCZA 3F3YA 1IQPA 1P2VA 3AP1A 1F60A 3VKHA 3CF6R 1R5OA 4KAXA 2HXSA 1X3SA 3U6BA 1SKYB 2HLDD 1ZU5A 3AEZA 1XU4A 2ZROA 2AD5A 1CLUA 1KHTA 4JLVA 1RRPA 3VKWA 4AIIA 1E4VA 4KBGA 5J4HA 1MO3A 3BGWA 1LNZA 1ZM7A 5KPJA 5FUXA 3ADBA 1WA5A 5C46F 2V8OA 3RS0A 3AKCA 3NEJA 3U4QB 1NF3A 2XSZD 2HJVA 4Q02A 2ODBA 2RGGA 2C78A 3K9NA 4HEJA 3UK6A 3B2EA 2Q9CA 1JR3E 4KFRA 4LYAA 1XDBA 1ZAKA 2CMKA 1QHHA 3QXHA 4F7WA 4PC6A 2OXCA 3QSYA 1CJVC 4P4SA 5K8IA 2DFKB 1IY2A 1HV8A 2ZSAA 1ANKA 3SDZA 3UG7A 1YZNA 4ZCLA 3DPUA 4JVMA 4OBEA 3VNVA 1G3IA 4WZAE 4LY6A 1W2GA 2JJ8A 4B75A 1BKDR 2F43A 4LBZA 5AJYA 5JZVA 1JAHA 1P2TA 3I8XA 1G4UR 2WKQA 3CRW1 4IKEA 4PAQA 4A8JA 4OK6A 1MRNA 4TLEA 4EFLA 1FP7A 4FWTA 2DB3A 1DAIA 3NDBB 2CK3A 2DCUA 4J0QA 3BB4A 4WA7A 1KOFA 4BFZA 1DOAA 1CRQA 1FUUA 2ZSDA 4R2HA 1KMHA 1T3SA 1Z6GA 5HCNA 3OIVA 3TSOA 1BOFA 4DC9A 4DCUA 2A5FA 1JJVA 2GVZC 2CJWA 1WCV1 2ZR0A 4RFSA 1NMXA 1N6OA 1NN1A 1T3HA 3HP1A 4NHOA 4L9WA 1ZIOA 3VFDA 1D9XA 2DHRA 4IXMA 2DBYA 4PX9A 5E7MA 1XMVA 1MR3F 4B74A 4B3FX 4TMZA 1UEJA 4S35A 2UKDA 3LFUA 4Q48A 4TMWA 3GLIB 1MRSA 1QVAA 1KI4A 3D3QA 6Q21A 2MSEB 4JKIA 3GFPA 5FR2A 3PEYA 1KAGA 5EUMA 1XBTA 1ZM3A 1E94E 5TARA 1WDTA 2CVFA 4JKYA 1FFHA 4NTZA 4FCVA 2KBEA 3PFIA 3V00A 4ZV4A 2H16A 2EWVA 4G5QA 4OI1A 3Q7PA 4JVSB 1KJZA 4C0JA 1TUEA 2FU5C 5FR1A 5EE1A 3OEHD 1NNEA 4M1MA 2DWQA 3QY0A 4TL7A 3DL0A 4R71A 4Z8YA 4W7SA 3A1UA 2GCPA 3EZ6A 5EE5B 4AK9A 5K8UA 1E9EA 3HWSA 3CWZA 3TSZA 2X2EA 3GJ7A 1RZ3A 4IDQA 1KSHA 3IDQA 1W48A 3SC3A 2Z0MA 3DZDA 2F1JA 2FWRA 4LJ6A 3U3JA 4PAMA 5JI2E 2OFXA 3OZXA 1D2NA 5P21A 2ANBA 2ZAOA 5G53C 3VR5A 2G1KA 3LAWA 1KI7A 1KO5A 4URVR 2CHQA 2FE4A 2CL6X 4NYMR 3LQRA 2WJGA 4ZCMA 4EKDA 1YJ5A 3B1YA 3UIEA 2MSDB 1NN0A 3C41J 1P75A 4G0NA 4EPWA 1OIVA 1QG4A 5JBQA 3K0AB 3TKLA 2FSGA 4GMXA 521PA 4RY2A 4DLTA 2J0VA 5FBLB 5JSZA 3WMFA 2ZJ2A 5DNYB 5DISB 1RJ9A 1Q12A 2HJGA 4B71A 4D80A 4LOAA 1OHHA 1X1RA 3QF4B 4P4TA 5KDOA 1IHUA 4NZYA 1K6MA 2IX3A 1A2KC 1H8HD 3FMOB 4Q5IA 4BZXA 2VP4A 4MGZR 3BERA 4MGYR 3HYRA 1QBKC 3E5HA 5FPHA 4XIGS 4BPBA 4AI6A 1T0HB 4B3XA 4MDFA 3KKOA 2OZEA 2XGJA 2H18A 2PEYA 2FN4A 5AUOB 5B64A 3SJZA 1O87A 2J41A 4UNSA 3CH4B 3SU8A 2JLUA 1IJFA 3GEEA 4LBVA 1P9NA 1KI1A 3REFA 3GLGA 1W46A 4UKDA 4CGZA 4TT3D 1W4CA 4C0BA 3K0EA 2WAXA 2QGZA 1ZNYA 3CNLA 1KTVA 3NEYA 3QPVA 1OFHA 2YKGA 2QG6A 3AVWA 1UJ2A 3A37A 3ND9A 4JLPA 4DT1B 5KYKA 4HDCA 1TNDA 1UDXA 3R7WA 4EPVA 5FPSA 1UADA 4ZIRB 3NVAA 2AWNA 2GJAA 4CZ2A 4UXJA 1CJKC 3VTKA 1XD2B 5B30A 2QRNA 1S8FA 1OKKA 1P6XA 3NBFA 4M53A 5IRCD 2IYQA 1OXVA 4UQOA 4ACBA 4NH0A 1EX7A 4XWOA 1TQDA 5CIQA 3HPQA 3QPWA 1Z0JA 4LRWA 5J4VA 2W00A 1AA9A 3CB4A 1COWD 1AN0A 2ZYTX 4HAUA 1GDDA 2I3BA 4B6EA 2A30A 2ECKA 1NY5A 5J40A 3K0FB 2D3WA 1H8EA 1WP9A 5DSZA 2WAYA 3CKLA 2ZRMA 3QI2A 2IXGA 3RRMA 4B35A 1OE0A 4D4KA 3K09C 1UKVY 1XXHB 1U0HC 2YC2C 2ZI3A 3PG5A 4JL5A 3T1TA 2GDJA 2JLSA 1GZSA 1DPFA 3EPLA 5FL3A 1KJYA 2ATXA 2RGCA 2WZQA 2NZJA 4RD3A 3RAPR 1NN5A 1C4OA 3SEAA 2Q0HA 3X1DA 1OH7A 1I2DA 3T15A 2ZANA 2G83A 4HB0A 3CRMA 5JCPA 1SXJA 1W44A 4Q9IA 2WV9A 3U3MA 1E3MA 1TF2A 1NIPA 2Z6VA 1RRCA 5J4KA 2VBCA 4DLXA 4DUGA 4QNMA 2ZU6A 4JLDA 4PSAA 4EPXA 1ETUA 3W6PA 2JLZA 5BN4A 4PQYA 2VYFA 4NP6A 5SZIA 2Q9BA 2FSFA 2OESA 3QNUA 3IBYA 4A6XA 4PHTA 4Q7KA 4KU4A 3U7GA 4QC2A 1YRBA 5EP1A 2WM9B 5F9HA 2X1VA 4LDJA 2YC4C 4U00A 3U61B 3TGPA 2RB4A 2XEXA 2H92A 4QGGA 3K0SA 4YONB 4ABYA 2IYZA 1E9DA 1OFIA 2O0HA 4G5OA 4KI0A 1KSGA 2JA1A 2BBSA 4L16A 4QRHA 4OKSA 4HLUC 1G17A 2WJJA 1XPRA 4HAXA 5CK5A 3TBKA 4QNRA 2DFLA 2QMOA 1NI3A 2FFBA 4WZBE 1T9HA 1XTRA 5CIWA 3RS2A 2QAJA 4QGAA 2IYSA 3QQ5A 1WF3A 5JWOA 1E1QA 3LA6A 4ZO4A 2N42A 3GLIA 3AF2A 4EJSB 5B58C 2FMXA 3LDAA 4DXAA 4EFNA 4IFBA 1KK3A 3FPAA 3GLHB 2P6RA 2ZM5A 1Z06A 4TTPA 3I72A 3LW8A 3IPYA 3WNDA 2XAUA 1OYWA 1ELOA 1FZQA 2NPFA 2ZRJA 3NBYC 3SYKA 4WIAA 4D4JA 3M0EA 5BW8A 3HJNA 3BH0A 4M8NE 4PHGA 1M6NA 2J87A 2W0SA 3FFBA 1RIFA 1Z6YA 3IEVA 2LCFA 1R5BA 4DCNA 1RVDA 3Q8XB 1NG9A 4W5HA 5GJBA 1Z0DA 3TNFA 3JZAA 1PVOA 1E9BA 1KGDA 4IDOA 2X8AA 1XMIA 2J7PD 2UZ3A 4DEXA 4FMDB 1KZ7B 1XTSA 2GXUA 1QG2A 2XNDD 4TYNA 4CEJA 1T6NA 3PEVA 3PR1A 4Q7MB 3X1YA 1W49A 3GFOA 2EFCB 4FN5A 2BJWA 1LF5A 1US8B 2AR7A 1X8KA 1A82A 2QPOA 4LI0A 1R0XA 4A36A 4JLAA 5FTNA 2Z43A 5AJZA 4B3BA 3ASZA 1R6BX 2ZUCA 3DMDA 3L8ZA 1AKEA 2GXSA 1S9HA 5DE3A 4CRWB 3KQHA 4I81A 5LB4A 4ERNA 3GCGA 1FW6A 3NDPA 4Q4LA 2OM2A 3U44A 3K70D 1D2EA 5E95A 4N3NA 4EJSC 4OI4A 4EQ6A 3B7GA 4US2R 1N6IA 2QTFA 4NPHA 1GNPA 1YE8A 2FNAA 3AB3A 4RD0A 5DI3A 2GXAA 2OCAA 1JR3D 2CEAA 4GNKA 2JLQA 3T61A 2ANCA 4G1UC 3AP3A 4DSUA 4BRUA 1GFIA 4IDNA 3UXMA 1KI2A 1NVXQ 1ZRHA 1CR1A 2BHRA 5EUQB 1XPOA 4FCTA 5DH9A 2WSSA 5F3WB 4BFWA 2VL7A 1N0UA 1KMQA 2R9VA 2PT7A 2VHQA 4LJ8A 4WBSA 4C2UA 1I2MA 3ZZTA 2BM1A 2MMCA 4RVCA 1E2IA 1YR6A 3TW8B 3TR0A 1VG9B 1R0WA 4C0KA 2RGNA 4PC3A 4RD1A 4YMUA 2EWWA 3SI7A 4UNPA 4M4SA 5KNDA 2PLRA 4FMDF 4DZZA 2X2FA 3THYA 1QHHB 4RJLA 4DDWA 2A2ZA 3LX5A 2ERXA 2R6CA 3H86A 2KWIA 2OBMA 4OHWA 3CX7A 4NYJR 4P4SB 5FTLA 4RSGA 3ZGXA 1T8TA 4ZI2A 2WKPA 1NBME 4Z54A 2UZIR 1JR6A 1NMZA 2I1QA 3L0PA 5DO9A 2C9YA 4TLCA 1DAFA 1Z22A 1IN5A 5EXTA 1DADA 2VHCA 1IJEA 1U0LA 3KKPA 4RZXA 2A3RA 2A7QA 3KX2A 1ZM4A 4JLOA 4MH0R 3JZMA 3ZDQA 2F43B 1MO4A 2FF7A 4MGKR 3T5DA 4A8JB 4Q1EA 5E7JA 1W4RA 1G9XA 4BASA 3AVVA 4A0GA 1BMFA 1R10A 1I4DD 4C0HA 3UANA 1ESMA 1E2GA 2ZJAA 1FPMA 4DLYA 2WJYA 3U3KA 1K5DA 2FPKA 2ZS8A 3CZPA 4UXHA 4IOKA 2BBTA 3NWJA 2QU8A 2ATVA 5JS8A 4I1VA 2GCOA 1AGPA 1KMHB 5L3SA 4AC9A 4D0GA 2REXB 5D3MA 1HTWA 3EC1A 3LRPA 3MFYA 3R8CA 1KSFX 1TEVA 1YZQA 4TQUS 3W6OA 2CJWB 4BWYA 3CBQA 3QOFA 4TQ9A 4KITB 4LHVA 4IJMA 2NO0A 3KL4A 2OBNA 1Q44A 4QHTA 4XVRA 1XPUA 1SGWA 2RGBA 1F2UB 1RFLA 5CDFA 3SYLA 1AK2A 1L4YA 3UMSA 3C16C 3WP1B 1TQ4A 2TMKA 1P5ZB 3A6PC 2VO1A 2NPIA 4MKHA 5C2JB 1CR4A 2ZE6A 3A1WA 5KTYA 4B6FA 1TUIA 1ZUIA 3K8YA 1II0A 2O8DA 3ZS9A 3MMPA 4NCIA 4LYHA 1WE2A 2J59A 2J3EA 4GRAA 1VCNA 4TYYA 2ZUBA 4JIMA 2XSZA 2R62A 1QZXA 2V9PA 3F8TA 4F4CA 3MSXA 4AYXA 4W5WA 4HDOB 1P61B 2WWXA 1JNYA 4BZPA 2EFHB 1S4QA 3IIKA 3A58B 4WVFA 4FMBB 3N70A 4JL6A 3FTQA 4MYTA 4A8JC 3FHTA 1GWNA 1HH4A 3NG1A 1G8YA 1VTKA 4V0MA 5LB2A 1XX6A 2GWHA 4M1WA 3U60B 3PUWA 1P4SA 3U44B 4DIDA 4O25A 4XD7D 2YHSA 2WTUA 2JLXA 5JHGB 4XTRA 4Q9JA 1QHGA 3QF7A 3WHKA 1G3UA 5J47A 3DEFA 3MWJA 5HE9A 4HAWA 3U2QA 5A4JA 4O0MA 1SVMA 1VG0B 2KI5A 4UXIA 2CNWD 3NH6A 4DLWA 2OCPA 3EW9A 1G7SA 2A5GA 5JWHA 5HZKA 3CIOA 4NMMA 4TTQA 4YMVA 4IDHA 2ORIA 1TTTA 2RKOA 4MA4A 4LSGA 1EFUA 2B8WA 2RGEA 4NU0A 1CR0A 4C0SA 4PAOA 1Q20A 1SVKA 1E2DA 1Z0FA 2QP3A 1KKMA 2PMKA 3JVUA 2WWIA 2B6HA 4JBXA 4KSBA 1U8YA 1WQ1R 4Z1MD 1YR7A 5HPYB 2BIFA 1G7RA 2C03A 3WHLA 4DSNA 4YXWD 1AM4D 1S0UA 1SVWA 4MDEA 1RJ9B 2ZJOA 3RANA 1PUJA 5IK2A 3PUVA 4MKIA 2CE7A 2C96A 4X8OA 3QEJA 3THOA 3GLHA 5CM9C 2ZI6A 2V54A 3FKQA 2NMVA 4WOPA 2DYKA 3KQNA 4TQAA 1DAKA 4IHQA 4TMTA 5FTKA 5B57C 3DKPA 2ONKA 2GBLA 3W8NA 3GLFE 4OQMA 4HATA 4U02A 1FMLA 5TV2A 1G5RA 5IT5A 3ZZ0A 1GKUB 5JEEA 5BWMA 4NONA 2VIIA 2YZ2A 1EFRD 1N6LA 4EIWA 4P4UA 1EFTA 3GLGB 4QJ4A 1KAOA 4V02A 4B73A 1XMJA 3MWYW 5G3ZA 5DN6D 1GL6A 4PHFA 1VKJA 3AKEA 3OEED 1DAMA 4DDUA 2PZGA 1X86B 3DMNA 3QXCA 1WMSA 3SJCA 4M9SA 4OHXA 1US8A 3R7WB 2BKUA 1V5WA 1G5TA 1HT1E 2OE2A 2EYUA 3OIYA 4A82A 3DZ8A 2CCKA 1UDWA 4QBHA 1KK0A 1Q22A 4MGIR 3KXKA 2V1UA 5HCIA 3CW2A 4N0EA 3MJHA 1OFTA 2A5JA 3U6KA 3GJ5A 5LBIA 3B5JA 3Q9LA 3QG1A 2BWJA 1N5KA 1J8YF 1N0WA 2JATA 3DOEA 2VF7A 5M04A 3BFKA 3B8HA 3MGCA 3TVDA 5A5GA 1YZKA 2W2XA 1WB9A 1Z63A 3Q72A 2YWEA 3QKSA 3O8CA 3H84A 5FOVA 2GHIA 4GOJA 4JJKA 4Q03A 3NXSA 4WAUA 4B47A 3K70B 3ZVNA 4EDHA 3PJRA 2ZAMA 1UKEA 4DKXA 3QXJA 1NVVQ 2VP5A 4X8LA 1X1SA 3I4LA 2ZYWX 1OYYA 3SJBA 1QF9A 3REGA 3W5JA 4F91B 4C30A 3TUIC 1H8HA 2F1RA 4CIDA 5J4YA 3KUCA 1G5PA 1XD8A 4C4PA 3V4RA 4JT2A 2FFAA 3W8RA 2OXRA 3KTAB 1DELA 2BC9A 3L8YA 3Q5EA 4Q1DA 4A2QA 3H0KA 4EAQA 4HLQB 3SJAA 1SXJB 1T5LA 1WXQA 2WIAA 5HTKA 1G3MA 2C95A 2H7VA 2WIBA 3K9HA 5BXQC 2DFNA 1DAHA 4C0LA 2B7CA 2D2EA 1ZBDA 3SE0A 2HT6A 4URZR 1G64A 4TT3A 4EFMA 4KV9A 4ZDJA 1G3RA 2VP2A 1KI3A 1II8B 2CHVA 5G3YA 4RCYA 3FVQA 5FI0B 3RS7A 3TJZA 2KJQA 2RGDA 3GJ3A 4G5RA 1D6JA 2ZJBA 1ODFA 4OK3A 4WZ6A 4KVAA 4TYWA 1IY1A 3FMFA 3RS5A 4AKGA 4BEJA 3AGPA 1Q1ZA 3K9LA 2IYYA 2V3CC 1KJWA 2H17A 2RGXA 4KYUA 1G1MA 1OF1A 1NKTA 3K70C 4IFEA 2EW1A 4I1UA 1FUKA 4O2LA 2VHJA 1R4AA 2WWHA 1QHSA 4Q47A 1OH6A 3A8TA 3OAAD 3ZJYA 5EE9A 1F2UA 3EIQA 4Q1BA 1AGRA 3EPHA 1IOZA 3PVSA 4LJ5A 1KO4A 2JJ2D 1COWA 1BYIA 3KUDA 1NIJA 2ZRDA 3KKQA 3KZ1E 2YNMA 4F92B 4GZMA 4HZUB 3IIMA 4MRNA 1A1VA 2AXNA 4FXPA 4B3GA 4HB2A 4NKRA 3SQXA 1SXJC 3N5CA 5FOTA 4BECA 1GL9B 1UKYA 2QROA 4BFYA 2YOFA 4ON9A 1DAGA 4QGHA 4XJXA 4JYBA 4H1UA 3C15C 5BQ5A 2ZYUX 3IQXA 1L7VC 2JJ1D 4DLUA 3IQWA 4O3MA 2A5YB 3HU2A 3QVVA 4KCGA 3TUZC 1S9DA 121PA 2JLRA 3LXRA 1IONA 1S2MA 2CXXA 1DS6A 1GNQA 1HY3A 2KE5A 4HAYA 2H1LA 4PC1A 4KJZA 1KSJA 4NYIQ 4DHEA 3ETLA 2XXAB 1FMJA 1HQYE 3QXXA 2FEOA 4KLNA 2F7SA 3EWSA 2F3RA 1NY6A 1WBDA 4RZUA 5TVKA 1OXSC 1Q21A 2OBLA 1VHTA 3KJEA 4CEJB 3L82B 4JLMA 1M7GA 2ZVPX 1Z08A 3AF3A 2P67A 4GDFA 2I1VB 4QBGB 1L4UA 1OXXK 1VCOA 2IUSA 3GJ6A 3W6NA 1GIAA 1GOTA 2ZI5A 2IUUA 3UPUA 2IS2A 3GQBA 3PQCA 4HDQB 1NKSA 2IT1A 2VTKA 2AFHE 3TE6A 1BS1A 3FMIA 4Y0AA 5DLQC 1PZNA 1TPZA 2ZQ5A 3LLMA 5G40A 2GK6A 2ODWA 1Z0IA 1N5JA 3B1VA 1ZM9A 3BRWD 5CJ2A 3RLFA 4CDGA 2NO7A 4MKFA 5KSOA 3ICQB 1P3JA 4EQ6B 1SKQA 2GILA 5DI3B 1XEWX 4C0AC 3BJIC 3RS4A 2FX3A 4QOSA 4LHWA 1ZUHA 5F2EA 3PXGA 1I4TD 1JAIA 2AKYA 2C77A 2NG1A 3TQFA 1EFCA 3HU3A 5KDDA 5KO2A 1R7RA 2EU8A 1Z0KA 3DDCA 2W58A 1T8UA 3KQLA 4ZDIA 1R0ZA 2YOHA 1NBMD 4QM6A 4R9UC 4P3YA 3IEUA 4IW3B 1LFDB 4IOJA 3Q7QA 3G82C 3CUEF 1VG1A 2XX3A 2O8BA 3FYHA 3GJ8A 3B9PA 4Q9KA 2Z4SA 2YINC 3LBHA 1F3OA 1XZQA 1PLLA 2J0SA 3FDIA 2G9NA 1E79D 4V03A 3THYB 1KK2A 1OSNA 3EZ7A 4Q7LA 2ASEA 4MITA 4TL8A 621PA 1CXZA 2JDID 1YR8A 2VPPA 3Q3JB 4HB4A 4OHYA 3ZS8A 2FZLA 3TK1A 3WRXC 2BEJA 1LF0A 3GEIA 3OE7D 3EZFA 2ZRBA 3H4MA 2R6AA 1U99A 2IHBA 3DKVA 3GP8A 2QM7A 3MRSA 2B7BA 2J7PA 2JASA 5KSZA 1W0JD 4I1SA 2XNDA 1HE8B 4IEIA 4YDHB 4JLKA 2K5UA 4OJQA 1Z07A 2JEOA 4BLSA 1ZNXA 4CEHA 2FGKA 1AS2A 3KJIA 2PCJA 3THXA 1VDZA 4CF7A 3A1SA 1E2FA 5E7IA 3WBJA 2NO9A 4XOIA 4TL6A 5TDHA 1LW7A 4LX0A 2GCOB 3B6EA 1DEKA 5L3SB 5D3MB 4LGMA 4IVQA 1ZYUA 5JECA 1KDPA 1SHKA 3VHLB 2OAP1 2YJTD 1IN8A 1UBGA 3AKDA 3PITA 5KHOC 1T5IA 1VYUA 1R8SA 1N6KA 1IXSB 3UWOA 2OEPA 3SZRA 4Q66C 1XWIA 3BFXA 3KFVA 3ZQJA 3ZLJA 1JR3A 3G0HA 1Q57A 3GJXC 3K0CA 4GMDA 2QA5A 2E9SA 2ERYA 2WMOB 1SHZA 4MYCA 3RWMB 4AURA 2RGNC 5FTMA 5AWFC 3VQTA 4BFSA 3GPLA 3QBVA 2HF9A 2IYXA 3CPJB 3TAHA 3WMGA 3CX6A 4GFDA 3VAAA 3KTAA 2O8DB 3VKGA 3CR7A 2GJ8A 4TZ6A 3ZVLA 1Q1EA 1MH1A 4IVPA 1Y3AA 2G1JA 2RGAA 1HT2E 2WJHA 3WYFA 2BEKA 1EX6A 2CL0X 2O0JA 2AFIE 3G5UA 3U7HB 1SVLA 3BH7A 2JIZD 1U8ZA 2ZPTX 3ZVRA 4KODA 1FQJA 1TX4B 5JS7A 3FFAA 1W2HA 4AG5A 2FZ4A 1DG1G 1II8A 1DVRA 2ZJ5A 2CE2X 4DCTA 3AKYA 1XTJA 2PJZA 1Z47A 3NBZC 1DTSA 3M4YA 4HLDA 1UF9A 5AUNB 1XXHE 3IBGA 4Q21A 3VR6A 3AUYA 2JLYA 3NC1C 4L8GA 3LO5A 4DLSA 3LLUA 3WBKA 4ZI3A 1IM2A 3SFZA 1IXZA 4PTLA 2RHDA 3SN6A 1IY0A 1UPTA 3KFXA 2QE7D 3RWOA 4DIEA 1CEEA 2ZVQX 4JBWA 3W3AA 3SHWA 4GI7A 4HZIA 5JRJA 2J1LA 5H70A 5FL7D 4PZZA 2XNSA 2P3SA 1GTVA 4B43A 3CO5A 1GRRA 1NP6A 4M1KA 3AUXA 5L3QB 3NH9A 1CBUA 2IBMA 4HLCA 3TRFA 3A4MA 1X6VA 2QP4A 4N0DA 1A7JA 4TSFD 5B2ZA 4DLVA 1TU4A 1R0YA 2O5VA 2G3YA 2XZLA 4LWZA 1E2KA 3OHMA 4BQSA 5HZHA 3S1AA 3BORA 3KKMA 4HZUA 1W36D 2HCBA 2OSBA 1M7HA 4IOMA 2C98A 4H1VA 4BLQA 3PEUA 4F93B 2OILA 4PPFA 3AVUA 2J45A 3M1IA 1JALA 1QHNA 5KDLA 1XFAA 2IW3A 2W6JA 2QT1A 1NVWQ 1EWRA 5AJVB 4O2RA 1N2CE 2AD1A 2ZETA 1U98A 5LDDC 1KDRA 2GAAA 1SULA 3ZD6A 2IHYA 5EJEA 5L8VA 1GP2A 4LYJA 1PV4A 2J46A 1MKYA 3TH5A 2XXAA 4N1AA 4UNQA 1KO8A 2KBFA 2IK8A 1NRJB 4TLAA 2LKCA 1VIAA 1G20E 1PLKA 2ZJYA 3A36A 3CRRA 4Q9HA 3O8RA 4JBYA 5JRZA 2R2AA 1OW3B 4NCKA 4LZZA 1RYFA 3IHLA 3LWNA 5FUYA 4D81A 5HKKD 3HPRA 4WXPA 3B82A 1ZW6A 2FFQA 1D5CA 4HAVA 2VA8A 5IHPA 4XD7A 1XTQA 1KI9A 3IHWA 2EQBA 5KSYA 4QJ5A 3RSOA 2QTVB 4D0LB 1RPZA 1U8AA 4M22A 1E4YA 3FHCB 4XWAA 2CDNA 2ZE7A 2CNWA 4DRZA 2WSMA 5AR1A 1E69A 5JI3E 3EARA 2XTMA 4BE7B 1S96A 5DYIA 4BLRA 4QJ3A 3HDTA 4POAA 1G6HA 4A4DA 3SBDA 1Z6XA 4PPQA 3QKSB 5LD2B 2IYLD 2NZ8A 3LY5A 2Q9AA 2ZR9A 3FKSD 1OH5A 4Z1MA 4ASUD 2GBLC 2PMDA 5EE0A 1FOEB 4YXWA 2QN6A 1N6PA 4LJ9A 3D7MA 1FQKA 3PENA 2F9LA 2QMEA 2ZXUA 4BGDA 4ARZA 1P72A 3R20A 2EFEB 3L0OA 1UFQA 3B60A 4QBIA 1OB2A 1TADA 1VPLA 3IKJA 1GKYA 1KI8A 4NBSA 4BFVA 3U5ZB 2ZI4A 4MKGA 1AZTA 2B21A 4DLRA 2X77A 4LHYA 1B0UA 4BEBA 2ZS9A 1SVSA 1ZMXA 2UVQA 4RD6A 2IYRA 4MRVA 3LBIA 3W9YA 2Q3MA 4PC2A 3WXMA 4RFVA 1E9CA 1CP2A 1EFRA 3FE2A 4B3CA 1G291 4DJTA 1GRQA 1VHLA 2JGNA 3TW4A 5DN6A 2VQSA 2FSIA 3ZD7A 3N2EA 3OEEA 1UEIA 1YZUA 1L2TA 4XSGA 5GJWC 5DYGA 4A92A 4V0KA 3O8DA 1W4BA 4DCSA 3DM9B 2OLJA 3P27A 4F4IA 4QG7A 4B44A 2R6FA 1EFHA 3FWYA 2F6RA 1D8TA 2FV8A 5CYPA 2ZRAA 3RYTC 2VEDA 1SZPA 4I4LA 3T5GA 3A4LA 3CWQA 4YDSA 1G8GA 1JQLB 1ZD9A 1GG2A 3OIUA 2ODEA 3GJ0A 2YWGA 3LVQE 2ZUDA 3OF5A 4GSYA 5LD2C 1QDEA 4IXNA 2FGJA 4AKIA 4D4LA 2CBZA 1E0JA 3DM5A 1GSIA 2IL1A 1JB1A 4GBMA 4ZDWA 1S1CA 2REOA 1K5GA 3H1TA 4RZ3A 3W90A 2ZJZA 4YLGA 1C1YA 3I5YA 1GILA 3ICEA 2O8FA 3BBPA 2HLDA 1W47A 3MWLA 2HCJB 2QL6A 5KOYA 1OIXA 1XMSA 3AF0A 2P6UA 4DBLC 4A6PA 4QXAA 3LXXA 4NYMQ 1G8PA 2P5SA 5DGXA 2AL7A 1NJGA 1NSFA 3ZQ6A 1G19A 5HR5A 3CF0A 3P26A 5BN3A 2QQEA 2CCGA 2NGRA 4D0NA 5KPDA 1YVDA 3ADDA 1XB2A 4ESHA 3J81k 2WMNB 1MABA 4RD4A 1KY2A 3R9IA 2OCYC 3AM1A 1JI0A 2OG2A 1CULC 3EZ2A 1AZSC 1TF5A 4D6PA 4A0HA 2D4HA 5EP4A 3CLVA 4EUNA 5EZ6B 2HDNB 2JLWA 2BMJA 4OQNA 4R98A 1PJRA 1XD9A 5JWRA 2HYIC 4FD2A 3I32A 3C5CA 2V7QD 1Q3HA 2IXFA 1F6BA 1XCMA 2KSQA 3SHFA 4GT1A 2P0EA 3EASA 2OAQ1 1CIPA 1HEIA 3D8BA 1ZCBA 4X8HA 1TEXA 1F2TA 5K8LA 2H57A 2YWHA 3CM0A 1F5NA 1NLZA 5K8TA 3QKUA 2BKEA 1G7CA 5TXGA 4Z8XA 2ZIAA 3ZIAD 5L3QA 4KBFA 3NC0C 1G8HA 3RRYA 3LX8A 1E2NA 2ZE8A 4C7OA 3EPKA 2F1IA 5FPYA 4JL8A 1E2HA 2NO6A 2OHFA 1CJUC 1EG7A 1HUQA 3OFND 2PT5A 4NE2A 1ZCAA 3HU1A 1Q3TA 4NCJA 1XJCA 2C04A 1KKLA 3PCRB 3I61A 2HT1A 3K1JA 4PR0A 4XVUA 1Y63A 2Z4RA 2ZRHA 5EP2A 1K8RA 3QXSA 1EGAA 2NO1A 3P1JA 4OYHA 3OAAA 1TAGA 2WJIA 4B2IA 2O8CA 2RAPA 4Q4HA 1LB1B 1XEXA 2YYZA 2I4IA 4JYCA 1XRJA 1ZC4A 4GP6A 4U5XA 2JJ2A 3VR1A 1EESA 3B78A 4C3ZA 2XOKD 1X8JA 1DAEA 1Q0UA 2DPXA 2E1RA 4HAZA 3M6AA 1LVGA 4G3XA 1WRBA 2O8BB 4QFMA 2FDCA 1E1RD 2ZTSA 1EWQA 5JEDA 1T0JB 3MCAA 3EA5A 2WWFA 4Q1FA 2OUKA 1Z6AA 5F98A 2JJ1A 4Q00A 5AJWA 5EXSA 2J9RA 5FBVB 1CR2A 3OEHA 1OLOA 5TMPA 2KB0A 1GRNA 1YRAA 1HYQA 3EAQA 4ILEA 4TTRA 1NLFA 3KQUA 2ORVA 2XTZA 5CB8A 2GCNA 2GVDC 2QBYA 1BO6A 2CLSA 3KJGA 4M1YA 4XSHA 3DOFA 4NDZA 1TQ6A 1VIYA 4PC7A 2C8VA 4KLZA 4AD8A 1VECA 1FTSA 2WICA 2PLFA 1OH8A 1FL9A 1MV5A 3OESA 4UNNA 5DHAA 3WRYC 4Q7JB 1W0KD 4LBYA 4KYIB 4OHVA 4CEHB 3THXB 3R9XA 3GLGE 2XB2A 2QI9C 3B9QA 4D4MA 4PO8A 2VSFA 2G0TA 2F3TA 3ASYA 2FJUA 4OJKA 1A4RA 2HEIA 3NHBA 1KIMA 4MRSA 3CNNA 1ZD8A 2J0QA 4DEYA 1G18A 3RS3A 3MAAC 3O8BA 5GVSA 4D82A 4LJ7A 4BFTA 2SHKA 4TN1A 4DCVA 2BMDA 2WBLC 2R65A 1E2PA 3QKRA 1E2LA 3AGQA 2RCNA 5KNCA 1NLYA 3P20A 2GESA
chains in the Genus database with same CATH superfamily
4IQ8A 4XLTA 2Y8EA 5JLJA 3TTUA 1KY3A 2BDTA 4URUR 1T8WA 3MWKA 4LJ4A 4U9UA 2CFOA 5FBZA 5T4FA 3WGKA 4D9KA 3ZVMA 2RGRA 1CY4A 4JU9A 4L5YA 3G1WA 4R69A 3RVJA 2NYUA 1Z39A 3BS4A 1P17A 3BB1A 3BZWA 1JW9B 1R8QA 4QUHA 2GZ1A 5G0TA 1ZD5A 3I3OA 5JJCA 2JKYA 1N6HA 4MUNA 4LPKA 2ZQZA 4QU5A 3AOEC 2M6SA 5EQTA 3D6HA 1UJNA 5FT9A 4BXOB 1DJPA 3DAFA 2BELA 1RAAA 1PQWA 2QZPA 3DE6X 4L0CA 4XKJA 4AJEA 4Z7OB 2QMZA 4ARAA 2LKDA 1UDRA 2C2XA 1CFZA 2ZZKA 3EYAA 5T8KC 1IH8A 3LUFA 1LPBB 3KDSE 3SHOA 2BDUA 2RE8A 3WX0A 1OYVA 1WETA 4B83A 5AVVA 3C3AA 5AKZA 1E98A 4KFUA 5IC6A 1QMPA 2Q99A 3OMLA 3UWPA 4ZJYA 4CLRA 3T3NA 1JXOA 1INLA 1O6CA 5ELXA 3LVBA 1SUCA 4GS5A 1YKSA 5F7ZA 1I4LD 3GA5A 3AI3A 2XNCA 1DT5A 1G9TA 3D8NA 4JN6B 3VNAA 5JXIA 3HK2A 1QGOA 2FLVA 3QU4A 4P3KA 3UATA 5JOQA 1QYDA 1W0JA 3UK1A 5A0TA 5CP8A 4UVHA 2Z4TA 2A5DA 3DUFB 5EZYF 3RUHA 2FF5A 5C5IA 2GF9A 3O4VA 4LY9A 5REQB 1KE1A 1QORA 2ZRKA 3PUJA 4CFYA 3CR8A 1MIOA 2CXOA 5CJPA 4C4TA 3WYAA 1KGSA 3COPA 5EJIA 5KQSA 4TMXA 1KNQA 4NXNB 1RXCA 2V7BA 4HGRA 1OLUA 1XJ5A 2I4RA 4BP9A 1T36A 5BW4A 3TXYA 1K98A 1QZUA 2ZRIA 2HHAA 1TU3A 4CF7A 4CIVA 1E3LA 2PUEA 2VF4X 1VG8A 3LG2A 3AP2A 5I8ZA 3PEWA 5GQSA 3KYCB 3GLKA 1Z83A 1XA0A 2FEMA 2WPDD 4CKEA 2UYQA 3U81A 2RHWA 2ZJ7A 1T5DX 1C4KA 1N3YA 5IM4F 4ESOA 3F6BX 2WU8A 1I36A 2IHTA 1N8SA 1XF9A 3BJEA 3IVGA 5TQJA 4EUFA 1BDJA 5PNTA 4D44A 1TM5E 4IAOA 4IFIA 3SBEA 3X1WA 1LSOA 2VKQA 2Z2JA 4Q7EA 5L4NA 3WFZA 2QK4A 3GH3A 3DC2A 1TZJA 2BM0A 2X4LA 4TMVA 2AXQA 3NI2A 4D46A 4DWJA 3MT0A 2QN1A 3HSSA 2PAFA 4MCHA 2BOVA 4L4UA 2VJMB 4L9RA 5GJCA 1NX9A 3DEKA 1GKKA 4OHCA 3JQAB 1J39A 1DEHA 1RW4A 4NJEA 4BNZA 2XZOA 2YR0A 2LCQA 5BWLA 2CCJA 1JAXA 2GTPA 2IDZA 2Q3LA 2QY6A 3K96A 1OC2A 3NX4A 4JQCA 3E9MA 4Q15A 3T35A 1PG0A 4LK2A 3QV1A 4AFNA 2JNWA 3FNHA 1HDEA 4CIBA 5JCZA 2QENA 1U9IA 3WNBA 2VXOA 3EVGA 5HMLA 2QRHA 3VR3A 1UJ5A 1CF9A 1SURA 1SQGA 3S3TA 3B51X 3OLYA 3RFCA 2XVZA 1N2XA 4WZZA 5P8WA 1JDUA 4JLNA 4C4YA 4RTQA 3VR4D 3DV2A 3BE4A 4IUYA 4O8CA 3FHLA 3M6LA 4YREA 2OCBA 1DQZA 4PGAA 4B0OA 4PYNA 4GKKB 4O4IA 3K5WA 3GEHA 3QNWA 4GPBA 4MVJE 1DJNA 1PR5A 2CVHA 5FPKA 1U1EA 2ZBQA 1ZNZA 2WC1A 2CWWA 2PL3A 1EXMA 2AE1A 2VA9A 4RK5A 5TY0A 3RC7A 4BLPA 1WMAA 1RRGA 2IYPA 1ZM2A 3F6EX 1Z5WA 2VP9A 4AJ1A 1SU8A 4HDKB 1X13A 2XWQA 1CQJA 3P9NA 1UFRA 4LWPA 1M8PA 4PSVA 4PXAA 2B34A 4QOGA 5DI9A 4AIRA 3B12A 4JWTA 2LGJA 3OCCA 3Q5DA 4QQNA 4Z51A 1N5IA 2QD5A 2RBGA 4QASA 1J7KA 1TCUA 3K9WA 4TSFA 4P31A 4X8MA 3STUA 5C7LO 2AW5A 3GN1A 2O5RA 3N8NA 4MQFA 2NQTA 3QUSA 4LZWA 4RD2A 1U9ZA 4RVDA 4ZVVA 2XGOA 1L8QA 1V0JA 5EWLA 4M0LA 3V8RA 4YUZA 4E3ZA 4Y30A 4RZ2A 1H4VB 5L53A 2QSYA 1A4UA 2G6BA 2ZREA 3BWDD 3OHPA 4RTOA 1D0IA 1HQCA 5JFGA 5T41A 4EPRA 4G2NA 1XZNA 3AVQA 1THGA 1JHQA 1Y5MA 3TFOA 3M70A 1DJQA 4UEWA 5ED4A 3LVFO 2W2PA 3N2ZB 1ISGA 3VPBA 1DIHA 3PQ4A 2DLDA 4OUDB 5DNAA 1X8XA 3JATB 3ESYA 1Y8ZA 1JNXX 3EXHB 3L18A 3C1UA 3KKLA 2X40A 1U8UA 1E1KA 2GH1A 1BX1A 1F1BA 2IF0A 4I1YA 3RO7A 3WB9A 4IUBS 1DXHA 4HB3A 3HRKA 5HIMA 5CLQA 4UUOA 2WWWA 1NXWA 3BTSA 3MYYA 2HHJA 1Q7RA 2VUUA 3MILA 1ZGZA 3P9PA 3AI7A 4AUEA 2Z8YA 5HGXA 3ERCA 3LQQA 1II9A 4IHJF 4EUHA 1IK6A 5EEHA 2HYDA 3CX8A 1DIBA 1ONBA 1OBVA 2H07A 3R0ZA 3L7JA 1TDJA 3LV8A 3V4FA 5LP6A 4PV7A 1IXRC 2A9OA 6CHYA 2I4LA 3BFVA 2FI1A 3GK3A 4H9GA 2P9CA 4P3OA 3AVYA 1NURA 3L0BA 1LBQA 4C20A 3GVCA 3WKAA 5AUPB 3HA5A 4KXLA 5JZSA 4KR9A 4RL6A 1CKEA 4EB6A 3GVHA 5DBHX 5JLAA 2J5XA 3DZCA 5H80A 4YA6A 3VVCA 1IHYA 3UFXB 3PHGA 5FPPA 3E5RA 4R5HA 3IEPA 1SC4A 4ZV9A 5HYVA 3C2QA 1RZRD 1NN3A 1LS1A 2CLFB 3L1HA 1XZPA 2FCRA 4ZWNA 5KYNA 2X0JA 5EJ5A 4PLTA 3UWSA 5KJCA 3ETEA 3KEGA 4ND4A 4BKOA 3W04A 4ZCIA 5BMVA 1Z4NA 1YAJA 3F5FA 2ZJ4A 3LH5A 3N8DA 5EI5A 4H3KB 3UJ8A 1J9GA 3ZEAA 2RMKA 1R4ZA 4U7JA 5HP4A 1SUAA 5DLYA 1XA3A 2VJYA 4S2EA 3ZWKA 4OPMA 3CG0A 3CPHA 4QUGA 3W5IA 4B7UA 1RCFA 1RT9A 1U5AA 2H31A 4FKZA 1AUVA 2NVOA 4FMCB 2CL5A 4X7RA 4E7PA 1R3UA 3CEJA 3ORYA 3BEDA 4ROTA 4AECA 2EVWX 2ES4A 2CV0A 1PK7A 13PKA 2C5AA 3BXHA 2Y0BA 2VP0A 4MV4A 2RK4A 3PQDA 4TZTA 1EZ1A 1QYCA 2NSLA 3KVVA 5D1HA 3SP1A 1J70A 3D5QA 5IKMA 1IPEA 1Q0LA 2C5GA 2ZT7A 3KVRA 1XZLA 3HKCA 4N6GA 3T1QA 2F9FA 5EZ5A 3LUDA 4ZVNA 4MYUA 2FQXA 4CPDA 2NTYC 2C0PA 2ORYA 1TQHA 3P9CA 1MABB 2EFGA 4RDCA 3IQIX 2PL9A 3EY4A 3A6FA 1TJYA 4LRUA 1FDUA 3NHJA 5BWBA 3G2JA 4HQFA 3PTZA 4CT4B 4KMSA 1W5AA 5A6SB 4X1KA 1L5RA 2FH5B 2X8JA 1Z2DA 4B6GA 4G4SO 3LBAA 2QZSA 1RFGE 3SDSA 2VG8A 3AG6A 4UUQA 4KH0A 3MBIA 1Z28A 2QUAA 4II7A 3DCYA 2BJVA 1FW8A 4EYGA 1KVQA 1E9FA 3DS8A 1NSYA 3GIDA 3VC7A 2F3PA 3EG5A 4QDTA 3U7FB 5I5EA 3RHSA 1ZLYA 3WISA 2FVYA 1J0AA 5IN5A 1U3TA 2OHJA 1XAHA 4KO8A 4KHZA 3HHPA 5EL0A 4FU0A 1JBEA 2IQ5A 3QKTA 4R3NA 3VR5D 2CL7X 1IK4A 3BOSA 1Z5ZA 2V65A 4KWTA 5HK8A 3WMEA 4U7TB 2QP9X 3NJRA 1MVNA 2IWHA 1V6CA 3QW4B 5FDFA 2A1TR 3OMXA 4O2BB 1SMKA 4HYYA 4W63A 4F91B 2HU2A 2WMDA 4RABA 4RDHA 2QVCA 1ZNWA 1J2JA 3K9QO 3QU2A 4FMCF 5F33A 4PN3A 4WTOA 1UKZA 4MPDA 1W76A 5IEJA 1TCAA 4V0ME 4A0RA 1UODA 4J6EA 2N75A 3A6EA 4ZXPA 1ARZA 4RF3A 4DMKA 1M2JA 3E8MA 1B74A 1DWOA 2UYHA 1IBLB 5LQAA 4BNXA 1RYMA 3H5NA 5A4IS 1E5TA 3AM5A 3AEUB 1E9SA 5B55A 2AV6A 1LJLA 3C7KA 4BKQA 4DR6B 4NL4H 1ORVA 1GAJA 4Q4HB 3OLWA 5GONA 3W34A 1H6DA 3HKEB 4FGLA 1MB9A 1KAQA 4JI7B 1PUIA 4M9QA 3NDJA 1JX6A 5AVJA 4CJXA 4G9EA 3H5TA 2YHIA 3DVRX 2QM8A 4DMHA 4YBZA 3H5AA 3BH6A 2D06A 3QLUC 3UWKA 1GVHA 1JJ7A 3QPAA 3WIUA 1G20B 3RI3A 5IF9A 3SF8A 4R7TA 3QLJA 4BFXA 4BOYA 5BN5A 3EVDA 4XWKA 5MF6A 1P18A 2GZHA 2JI6A 4ZTBA 5GM2A 2CWDA 4FYYA 2SECE 4YP1A 3ZE6A 1FFYA 4JOCA 3E7WA 3T3DA 3BWXA 5D7BA 5FPQA 5F3DA 2C5LA 1FFBA 2FEKA 4OQFA 1CDEA 1YZLA 2P9JA 1U80A 4FINA 1L8AA 4QODA 5DHFA 3RAEC 5DKFA 1AGNA 3ELWA 3GLHE 5THKA 3GP5A 3S8MA 1RQRA 3G8YA 4S24A 1RXWA 5BT9A 1JPJA 3AW9A 4W5JA 3VOAA 2P65A 1QPBA 2ZWOA 1DJLA 1E0DA 2ZYSA 2X4IA 4O2BF 2TRSB 1S3SA 3I04A 3N7UA 3TTSA 1S89A 3EAFA 1W9MA 3A7EA 3IDFA 3IDSA 2G72A 2XD4A 1Y4UA 3C0KA 1SVNA 1QO9A 3VJKA 4Y1RB 3IXLA 3PGA1 1NPDA 3NP7A 4G24A 2DU8A 2RKWA 4KVGA 1DIAA 1V1MB 2CLCX 3OQVA 1WO8A 3PL5A 3R9XB 2C9BA 2G77B 3S68A 4UEJA 3N2YA 1OKKD 1UBLS 1RXUA 3NBMA 2WZDA 4JVOA 3RAFC 3HCWA 4WLEA 4XLZA 3MW8A 5D87A 3ZIAA 2JAQA 5EQDA 3DXZA 2A35A 4Q3EA 5J43A 3VJLA 2H2DA 5BVHA 3PT5A 4A1FA 3LPCA 1MUUA 2Q3HA 1XIVA 1B16A 3C7AA 4JQYA 3T7AA 3ZU3A 5DIFA 3BD9A 1MEEA 3OFSA 1ZPDA 1AUXA 3CRVA 2ZRNA 4CTJA 2Q7DA 3SK0A 5LKAA 4EG6A 3MG9A 1NV8A 2V9CA 4J91A 1H8ED 3OIDA 4DVJA 3OZFA 3GEPA 3CKYA 4XA8A 2C2GA 3PYMA 1UBCA 1WY7A 2ZPUA 4NF2A 5FUVA 5FAXA 3T7KA 1MO5A 3WLFA 4XQ9A 1GZ3A 1E6EA 1U65A 2KS6A 1VSBA 2K2WA 4FC7A 3WQRA 3AR9A 2B2NA 4MOWA 4LV5B 1TO2E 1TRKA 4AWXA 4BBAA 1V9SA 2N1BA 2Q29A 3BJRA 1EE2A 4YRCA 4ZOQI 5D3KA 2XOKA 3J7TA 4KQHA 3WZLA 4AY2A 1XVAA 2QLBA 2DBRA 3OEWA 5CA1A 1RYHA 5L45A 3CZ4A 3K8OE 1YJXA 3U1VA 1E1RA 3GGOA 1RHMA 3ENZA 3EXAA 2GN8A 1CDDA 2I62A 5JZOA 3DBVO 1SXJD 3LUCA 1HDIA 221PA 4QFBA 1TZCA 1TJPB 1VJ1A 4JLBA 4ZODA 3QTTA 5I45A 2Q3DA 3C14C 5FOSA 4XOUA 1ZR4A 2ACEA 1N5LA 1TU0A 1ESEA 2BTQA 4X3OA 2QYTA 4PX3A 5E9QA 1UDBA 4POOA 1Q1BA 1CVLA 2VDRB 2QTGA 1R6UA 3GGGA 4MLZA 1N8NA 2G04A 2R84A 4ZT2A 4CLRB 2PUBA 3KOYA 4AKHA 4B32A 4YMSA 2ZXEA 5H3HA 2XQKA 4JX8A 4QO8A 5K6AC 1VYHA 3PZBA 3PDUA 2VPZA 4M0FA 4DNFA 4DT1A 2X3YA 5F2NA 3G2LA 2IYUA 4ZOLB 4K6CA 2F3UA 1N4DA 3CSSA 5KKAA 3KQQA 3NU1A 3U7EB 4NCNA 4F72A 3HYTA 3L1UA 2JFHA 3VSCA 4Q1AA 2P6NA 4IILA 4ZIRA 4C3VA 2HQRA 5AHKA 5AKGA 3G0IA 1X19A 3NQ41 4KQCA 5E6RB 5E4YA 4LFBB 1W0KA 2ECOA 2IEAA 3ICVA 3PNLA 3RVBA 2X5KO 3ZQ4A 4DR2B 4JB3A 1L8XA 4NEQA 3QMPA 5GOTA 9MHTA 1E66A 1OLUB 4M21A 5A71A 3UHJA 1T36B 5A9RA 3NHAA 3I9NA 1JKFA 1SIUA 4CNBA 2JRCA 2VHTA 2NW6A 3T3MB 1L7AA 2OQVA 1OR8A 1Z5UA 4AS1A 2FG6C 2I7CA 3UG6A 2WYIA 1FNNA 1MOZA 1DT3A 2WSIA 1GG8A 4DC0A 5EE3A 4CKEB 1I51A 2C61A 3GGSA 5DBGA 3BIFA 2HFKA 5IH3A 5I6DA 1AA6A 2BHTA 3IIIA 2PPLA 3IO5A 2DKNA 1R4NA 2I65A 3JR3A 2AHOA 4LV6A 3OOJA 4OTZA 2GBIA 3NHSA 2N9UA 4S04A 5CPBA 1YCGA 3MJRA 3U49A 1E8DA 4RORA 1ZI9A 2W6JD 3A0UA 4KXXA 3FFXA 3JX9A 1HTTA 3R74A 3T9EA 4JJ6A 1TD1A 2CXRA 2ZI7A 3FMPB 4L57A 3TCNA 4CKYA 2D7JA 5DCWA 3NUQA 4XGKA 1TJ5A 3W7VA 2WUEA 1A0OA 1V6SA 1AHHA 4NJEB 4KQ6A 1Q0ZA 2EXXA 1T5TA 4XGRA 4D96A 1FDVA 3T9DA 3ISVA 4OLJA 4WNAA 4I4NA 4YMIA 3X0DA 5B53A 1OV6A 1M2OA 2B82A 4N8SA 4YPFA 5C51B 5GINE 1PJTA 3A1FA 3PD1A 1HC7A 2BGTA 4TV8A 2H52A 3SEFA 3P4XA 4A8TA 5GWXA 1I80A 1OFUX 1UAGA 1SHLA 2YRXA 3NALA 2W6QA 2FETA 1RLJA 4JP5A 5J1SB 3U3RA 2PHZA 1GN8A 2B1GA 4RE5A 2IP1A 1B1AA 4IY1A 4UEQA 3T4XA 1YU9A 1BS9A 4LTDA 3TVTA 2CFCA 1MENA 4HNTA 2RC6A 3UMRA 1CS4C 1VXOA 2ZSUA 4KFTA 4ZZIA 1HTBA 2JFFA 3H2KA 3MOSA 1O97C 3BCRA 3HS3A 4BB0A 5CDGA 1E60A 2NOAA 4MV3A 5HS4A 3Q2KA 5L6LB 1MGOA 1KI6A 1M6YA 2XKJE 2D2FA 3ITDA 2NU9A 4GM4A 1J8QA 3K2EA 4GZ3A 1MGPA 3I6YA 2Y1GA 5IAEA 4ALLA 1KZ9A 4PHHA 3RSZA 2JJQA 4D42A 1S3GA 2P11A 4O1HA 5DMHA 1WW2A 1S2OA 3CUYA 3IX7A 4W8OA 3ZW8A 5BMOA 1N6NA 4IPTA 4AKEA 3GLFB 4I6EA 2BMFA 2VYVD 1D9ZA 3TW0A 1P62B 2LDXA 3JVVA 4FJ2A 3LZCA 2A1TS 3FOEC 4N8DA 3I01A 3KSUA 5T6MA 3PD7A 1JEQA 2V4ZA 4MQFB 4QL3A 3VR6H 4AQ7A 1UBOS 2ZPAA 3GNQA 4A91A 1O94C 1VZ3A 3ZZ1A 5I9LA 3RARA 4TV9B 1NU8A 3OCWA 3TOZA 3NO4A 5CLLA 2R8YA 1KYTA 3IHTA 1KETA 1V5FA 2Y1OA 2I4MA 1YUMA 5ENVA 1J33A 3WTCA 1IWOA 2GEKA 3GRRA 3ZV7A 2CNNA 3D4BA 3L43A 3VKVA 3W3AH 3UT6A 4YR7A 2G4CA 4JJEA 1Y1PA 2BVNA 2VLIA 3BGOS 4TYPA 4ZI5A 2NO4A 3K4HA 4K8RB 4YFYA 4DG5A 2PJRA 1CF4A 2CFIA 2K2QB 1A5BB 2YWJA 5F7OA 1FYWA 1SCUB 3E70C 5K1ZA 2EL9A 2XB4A 5JAPA 1ODKA 3LDGA 5DXAA 2Y66A 1BU5A 4C06A 2ZEJA 1Y8AA 4JC8A 4FSHA 2HWWA 3JAKA 4IQGA 3UC9A 1T2EA 1KXJA 2QD3A 3CEHA 2O23A 4B6SA 2Z6QA 3S44A 4P80A 1ZCJA 3RC8A 3INNA 3PX2A 4O4IF 4HEA1 1QH1A 3LC2O 5CXXA 4KR2A 5HF6A 1RBQA 3PNMA 2WWGA 2NX2A 2MWMA 3A6KA 3O1JC 5BSFA 1O96A 1WLYA 4ITRC 2R3SA 2H29A 4JT8A 1ZH4A 2FE1A 1F14A 5DM70 1XGKA 3I6BA 1O95A 1MJHA 3M34A 5FI1B 9GPBA 1J2TA 1CS0A 1FNDA 3OQIB 1UM8A 3AR6A 5H7XA 4EB6B 5KTOA 4DV6B 1Q1AA 1W1UA 4R2IA 4G4JA 5AK0A 3ZNOA 3K4QA 5JMTA 1MJGA 1RC0A 1GPUA 1U90A 5EXPA 3IP1A 4ID9A 4CYMA 3PUYA 4B34A 3BXGA 5FJIA 3NNDA 2HCTA 4P82A 5BMVB 1YZFA 5HWSA 3N7TA 2NQ2C 1RHRA 3WB1A 4EGFA 4RCZA 2X9QA 3F3YA 2JIQA 4CTMA 4TYMA 3DNMA 4Z9BA 1R5OA 2VAPA 2WY2D 2VWHA 2OB1A 5F5NA 3EF0A 4MQ4A 4OY3A 3D6NB 3ZW7A 3U6BA 1KZ1A 5C5EA 1LSJA 2HLDD 5JROA 3D6VA 2I6TA 3J7AC 4ZRMA 3O4IA 2TS1A 5FYDA 5JG7A 3M5PA 4ZU3A 1SKBA 2VDNB 4QYMA 5DTMA 4A26A 4LECA 5JAHA 3KWMA 5K01A 3F6RA 2AD5A 1CLUA 1WTCA 4JLVA 5EIAA 1Q6ZA 1RRPA 3FLEA 3H4TA 2FRDA 3TVYA 1FZTA 1P6UA 1SUDA 1E4VA 1BEZA 3V5NA 5SV2A 2X9NA 3HKCB 1MO3A 1RJFA 4AZWA 3UT5A 3ROFA 1J00A 5KPJA 5FUXA 1O6GA 1T4MA 3IXQA 1WB5A 2QWXA 3JPYA 3CNHA 4J94A 4J0EA 4JH0A 4LYGA 4NOJA 4D74A 5KYYA 3CEAA 1JDTA 1GPWB 1NF3A 3BWYA 2XSZD 3TW8A 5LP6F 1RYZA 2AFRA 2HU7A 5I7SA 2Q45A 1ZA1A 3EVBA 1LK7A 5G1OA 4HEJA 1EDBA 4X1KB 3B2EA 2X8JB 3WLPA 3CVUA 2BPOA 3RVQA 4RK6A 4DJ5X 2EKPA 4JI6B 5KTMA 5C52B 2J5BA 1F17A 2CMKA 2RK3A 3KPJA 3NJ8A 2UUOA 3IJEB 3GUHA 1CJVC 1KY5A 1V11B 4XIIA 1A8UA 1QIDA 3ITEA 4Y3UA 3IJRA 1IY2A 3HUTA 5DRYA 3OI7A 3KV1A 3VVLA 1N2BA 5K3SA 1K7FB 1PGQA 3SDZA 4DLKA 1U6JA 3O8OA 4ZCLA 5ILOA 4QU0A 1G3IA 1HETA 4LY6A 4R8RA 4DMFA 1BWRA 2YYAA 3MJCA 1FB5A 4FR5A 4Y0NA 5BMVF 4COOA 2G08A 1XFDA 3QNMA 3N9IA 4F9TA 5JZVA 2B4TO 3WA7A 4K03A 1EVYA 2WKQA 1ODSA 2FSVA 2PKWA 4ZRNA 3QPDA 5JXJA 3EGEA 4YDQA 1Z15A 1PJ2A 4OBXA 5G0UA 3SEQA 4EP1A 5IG2A 4U8GA 2YJZA 3LQYA 1DAIA 3NDBB 1Z0ZA 4EB8A 1YL6A 4WA7A 2J5QA 3T3HA 5LSAA 1OLSB 1KOFA 2WJPA 1DINA 1CRQA 1DOAA 1CSEE 3OOSA 4CI0B 2DAPA 3T1YB 1KMHA 4ZVQA 1IHPA 1T3SA 1MB2A 1QGYA 5HCNA 2EOAA 3TSOA 1BOFA 4QICA 2A5FA 1TMGE 1UMCA 2CJWA 3OPVA 3ZHZA 2GFHA 4UHHA 2YFKA 4IFTA 3LCRA 1YBVA 5GONB 3W9BA 1NMXA 4PRKA 4PGFA 1NN1A 3HP1A 4NHOA 1TK3A 3FH0A 2VTEA 4B74A 5E7MA 2AH5A 1MR3F 2VAWA 4L1KA 3R3SA 2KLHA 4LX8A 4OQZA 5FXMA 4JWKA 4S35A 2DSTA 2PL5A 2WE8A 2YW9A 3HBMA 2YICA 2VJBA 3JWEA 4RADA 4WOBA 3BTUA 3UTDA 2PGNA 2PZKA 1Q7CA 3SF8B 1KAGA 4FP9A 5BN5B 4WY5A 2Q5LA 1T1EA 1DQYA 2CVFA 3NHMA 4LSZA 5AW2A 4NTZA 5AP9A 1JJIA 2QSJA 3V00A 3C7CB 2Q6LA 1FPQA 1NI4A 1ULZA 1RPJA 2D0DA 2QTZA 3G13A 2NACA 3NYWA 3OC0A 4OHUA 4OI1A 3TJRA 5BP7A 3BAZA 4C0JA 4CR7A 1H5QA 1TUEA 3PC8A 4RDIA 5HJEA 4CDNA 1NNEA 2DWQA 4UW9A 5EPUA 1KDYA 1MVOA 4FXOA 3ZDBA 2YRWA 4WLFA 1NJ8A 5CXSA 2VQFB 5E9AA 2J3QA 4BMPB 4YAGA 3NNNA 4XCQA 2O7QA 3RC1A 4RS3A 2I29A 3P71T 4PIVA 4ALNA 1RZ3A 2FQWA 3IDQA 3RV3A 3UHAA 4IWYA 1XDZA 2Z0MA 3DOJA 1MX1A 1OAOC 3LKBA 5LWQA 4K6OA 4PAMA 3W05A 2Q6OA 2PM8A 3TM4A 1S8NA 1W5BA 4M9CA 5P21A 1SPXA 4KIUA 4FHFA 1GZ7A 1KI7A 1KO5A 2ECPA 3KETA 4CMIA 2FE4A 2CL6X 4DRYA 5GONF 1YH3A 3LQRA 4NOLA 4E13A 3TZBA 4BAUA 1U2DA 3SMQA 4EKDA 1MXFA 1RYNA 2IE8A 1YQDA 3QE2A 4M0UA 4EKYA 5BVHB 4WT7A 2WAMA 4GZ6A 4AMZA 5ALMA 3GV0A 1OIVA 3O95A 3ZXIA 4BFCA 1NBIA 1UJ4A 4O4LB 4YRTA 1MB4A 2DPGA 2V98A 4GMXA 4UEKA 2I9PA 4FYWA 2BJHA 3LXMA 1NM5A 1XTPA 4XCXA 4NESA 2BFWA 4ZO9A 1U3CA 4LGVA 2GT1A 4KNVA 4D80A 3WWYA 1J1IA 1X7XA 2WPNA 3D59A 3HYCA 3PFKA 2HJWA 4O02B 4R9VA 3SS7X 2VNHA 2HHCA 3C6BA 1GGNA 4NZYA 4OO3A 4QUAA 1BVYF 3FMOB 2Z5VA 3LSTA 3AHJA 3ENKA 5AKLA 2DH6A 5E3IA 3VI4B 3BERA 2ECFA 1NBHA 3B6MA 3PKIA 4MGYR 4XIGS 4E4YA 3QEAZ 4WBNB 3RAJA 4D5EA 1J0DA 4B3XA 4ZT3A 4S1NA 2OZEA 2PEYA 1JFTA 3OM8A 4P58A 3DMPA 1MB0A 3HJCA 3LPNA 5B64A 1O87A 3O31A 3TTTA 3WJAA 4UNSA 1EE1A 1R9GA 1IJFA 5IBPA 3F6PA 4TS3A 1ZITA 3REFA 3CLRC 1Y1SA 4YRNA 4UKDA 3GLGA 4LIPD 4CGZA 1W4CA 2BTQB 2RI0A 2QVBA 1JHMA 1EXNA 1DQPA 3B3JA 3B36A 4JZYA 4A6DA 9ATCA 4NV0A 4GUDA 5DGCA 1RXSA 1Z17A 1KTVA 1D6MA 2AEEA 2PDAA 3IP5A 3L5KA 1VHDA 1GAQA 3KR9A 4RNCA 1IL0A 4XVCA 2YKGA 2JFWA 4HUJA 4PSUA 4YCBA 2D5CA 3AVWA 1DKNA 3RJTA 4G0YA 4JLPA 4LZLA 4DT1B 1TNDA 1UDXA 1NXXA 2XUIA 4CHTA 4NDAA 4I1RA 2YXEA 4XQEA 1DNPA 5FPSA 5T3YA 2AJDA 1NAIA 3HI6A 4ZIRB 3X3HA 3E84A 3CJRA 1K7EB 4CZ2A 4HS9A 3VU0A 4UZEA 3Q8WA 1JF8A 5KWIA 4TMYA 5DW0A 2W37A 3ZUPA 4RTMA 1USKA 4WASA 3V2HA 3NOXA 1YSCA 3DOIA 3GI1A 1OXVA 2J32A 4I8DA 4U7GA 1EX7A 4O5AA 5CRIA 1TQDA 5CIQA 1XK6A 4J0HA 3QPWA 2H3HA 1Z0JA 3DDNA 2OL4A 4LRWA 2W00A 3KEOA 2ODAA 4C21A 1YBMA 5K0ZA 1AN0A 1IQRA 1BWPA 1GT91 1L4FA 3GVIA 3NHZA 3R0JA 4F3KA 1LJ8A 1IXYA 1KZ4A 3B2QA 4UBNA 2RJOA 1P74A 1Z0UA 2JLCA 3FDZA 1NHGA 4C7JA 2P35A 2XUZA 3NNSA 1YOVA 3QELA 1XR3A 2IXGA 2DC1A 1IN1A 4D4KA 2LCIA 3RVKA 2NPOA 1HLDA 1I2CA 2PWZA 1KZYC 4I4TA 3SZLA 4GXRA 3T4UA 1Q0QA 4RVOA 1GLNA 1Y5NA 1A5AB 1EZ4A 2JLSA 1CUJA 2YZNA 1DPFA 1U3GA 4IF6A 3EPLA 4PZCA 5DWQA 4C4SA 1RSZA 1USWA 2RGCA 3RAPR 2AZXA 4YCCA 4BN0A 3SEAA 3X1DA 3ZU6A 2ZANA 4LVUA 1TLTA 4TKZA 4Q9IA 2WV9A 4WNAB 5ENZA 4E32A 2GD1O 1E3MA 1FA9A 1RI3A 1JIJA 2H2WA 3N59A 2JBAB 2B5WA 4DUGA 3DTTA 5LYJA 4MPTA 3E9NA 4TV8B 1OGJA 4YXFA 1D3AA 1ETUA 4XIFA 2OXFA 5C1IA 5BN4A 1WB4A 3KEMA 2BUAA 2FSFA 1ORHA 3OX2A 4HXYA 4OHBA 5IZ4A 2HZBA 2RDMA 1FQWA 3SQMA 1P1FA 5J58A 5HFNA 3WVNA 4Y7DA 5B4UA 2R1UA 1Y9ZA 4KU4A 5SY9A 2H4FA 2W2NA 1YRBA 2WM9B 5KJ6A 2MT9A 4RHYA 3WGGA 2HR1A 5EJ2A 3AUAA 4HQ6A 1R6XA 2Q9UA 1JG6A 3RJ5A 3TGPA 3OM1A 4IUDS 5KYTA 3MS7A 5HZGA 1BEUB 2VC2B 1P77A 4YONB 1PSWA 2OBFA 3UF0A 5F1YA 3AIIA 2AI3A 3MMZA 3G7NA 3FFWA 4K9NA 1RS0A 3PUKA 3VYSB 4GW3A 4MIEA 4HAXA 5CK5A 1Z82A 4CM4A 1BWQA 1Z25A 1XTRA 1JIKA 2PKYX 3DT6A 3LUJA 2AYYA 4WXMA 4JJ4A 4JXXA 3ZGNA 3WQSB 1MX9A 2Y6VA 1TTHA 1AB5A 1W581 3FNRA 1E1QA 1QLHA 3Q7RA 4GMFA 4I0WB 3Q2IA 4JHLA 3PVZA 3H8SA 2NT4A 1FTWA 3AF2A 3BTVA 4LWOA 4AUMA 3EBLA 4DXAA 3LDAA 3V7FA 3HB1A 3JTMA 3TINA 1JJBA 4EFNA 3ZHVA 2TECE 3IESA 1KK3A 2D2IA 2QVGA 3GLHB 4G0QA 1ESCA 5D1NA 5F7JA 3RS8A 2PN1A 3PYLA 2HADA 3SKVA 3CZ9A 2J9FA 2W2MA 4TV8F 1EBUA 3SX4A 3UO8B 2NXNA 2PKXA 4ND1A 1QHEA 4F5YA 3D2AA 3LW8A 3ML1A 5EMNA 2XAUA 4DG9A 2PWBA 4ND2A 3ZKWA 2HBRA 3SYKA 4C01A 3ONVA 4Q9NA 5KYVA 3RBVA 4C3OB 1GZDA 1K7XB 3GFGA 3HJNA 1C41A 3JAKB 1E5QA 4N3CA 4PLHA 3JZDA 4DIKA 4YRMA 2O06A 1M6NA 3FFBA 1DV2A 1A98A 1Z6YA 3I37X 2OMKA 4TLMB 1UXJA 2YJ3A 4TKUA 3TZLA 4E5PA 3Q8XB 3U56A 1DXQA 1NG9A 5GJBA 4Q9DA 2PUCA 4GUAA 4HCJA 4MUIA 2JGJA 2WJ6A 3TNFA 4YJ3A 4CI9A 1VSVA 4EGAA 1KGDA 5HKBA 2XVAA 5AVWA 4DEXA 1JHAA 2QMYA 4FMDB 2AQ8A 1XTSA 4PGHA 1Z62A 2VK2A 1T6NA 5AQEA 4ZU6X 4ARVA 1CS0B 3PIDA 2E2WA 1N5DA 3GFOA 4F3TA 4QDKA 3QFTA 1US8B 2WT8A 4FFMA 4UTXA 1RLTA 4MR7A 4R2MA 3OZSA 3EVTA 1IEWA 3B48A 4LDNA 2Q5OA 1R0XA 2HLPA 2Z43A 3GJTA 4MUGA 4NAUA 1DC4A 2ZUCA 2O3SA 5AJZA 2AS0A 4ND8A 2ESRA 2Q62A 3CVOA 2GTIA 2GXSA 4IDDA 4LE0A 5JFTA 5J2TA 1I14A 1S9HA 2G28A 4L73A 3WKBA 4I81A 4GR4A 4YHBA 5JSHA 2OM2A 3U44A 2WA1A 1XMXA 2CSUA 5ALHA 4JBNA 2VPWA 2Z57A 4YLEA 3BFJA 1G63A 3B7GA 1N6IA 5IDXA 1J09A 1P0CA 1KDVA 1QH8B 2FNAA 3ADPA 1SCQA 2YIJA 3GLVA 5DI3A 4BCCA 1H1TA 5A02A 2CEAA 4GNKA 2ANCA 4ZYYA 1T9KA 4CN8A 1W5EA 4DSUA 1V8OA 4C5CA 1ZJ4A 4IDNA 1ZRHA 1CR1A 1TGYA 2BHRA 1AO3A 3A2LA 4GR5A 1XPOA 4FCTA 1I7NA 1EJBA 2WSSA 3L6RA 3KRTA 2VL7A 1JU4A 1N0UA 4HJXA 4HXGA 4M54A 4LJ8A 3RU3A 3UT5B 2G71A 5I9TA 4EA7A 1HDCA 3KDAA 4JODA 2VRCD 3RSCA 1H3EA 1N0IA 4WUTA 1JE1A 2JJYA 5KYYB 2Q4DA 3EEIA 5CBKA 4RVCA 1YR6A 3TW8B 3CEMA 3TR0A 1NOJA 1W75A 5A4MS 1VG9B 2GLUA 3OKAA 1NMEA 2HWUA 2CJFA 1J20A 4RD1A 4FCCA 4NZPA 2QIOA 2EWWA 1A69A 3C74A 3H2ZA 1CUDA 3I2JA 3MFQA 3NGMA 2PLRA 3NS7A 4FMDF 4NFLA 3W5HA 4EA9A 1W85B 1XL0A 3K35A 4QOIA 1ORWA 1CJBA 3HRIA 2DBVO 3H86A 3LX5A 1L7OA 3MJFA 3QOYA 3PQ6A 3ZLBA 2OBMA 4BMVA 1PR9A 1PV2A 3P7MA 1B76A 2OPBA 2PAAA 1UR5A 3OFKA 3QUAA 4H15A 4JGGA 4RSGA 3JZIA 3OCVA 4MQLA 3LUGA 4X54A 1ISFA 1NXVA 1R37A 3DYBA 3EPRA 2I1QA 1M33A 5F73A 3O8OB 1NU6A 3I42A 1DAFA 1DADA 2VHCA 1IJEA 3EEBA 1WSBA 1LRJA 1YKFA 2H2HA 3A9RA 4DR1B 2A3RA 3KX2A 3DFFA 4MH0R 4XWGA 2WWRA 3QJ5A 1W96A 1E20A 3W3AD 3RK4A 3SM3A 4ALKA 1K9SA 1NQUA 1G9XA 5HRCA 1RWVA 3CNQS 3H0EA 1JR6A 5I9IA 1LSUA 1AMNA 3BHMA 4QDJA 4FSDA 1JFFA 4O4LA 4C4RA 1CE8A 1E2GA 1ESMA 4X84A 3NFRA 3URKA 4DLYA 3DDWA 2FPKA 1W93A 3NAGA 2VZ9A 1ZJ5A 4ND7A 1TIKA 2EBHX 5LM3A 1UBHS 2QU8A 4AO6A 2ATVA 5JS8A 3PHBE 4I1VA 1KU6A 4BRSA 1KMHB 4EABA 1KJ8A 2JEYA 4D0GA 1QS0A 1JSXA 2FWIA 5DNDA 1UXGA 3ZLUA 3LOQA 4RGVA 4W82A 4RTRA 3U0VA 1UMCB 2CJWB 4KITB 3BULA 5FA5A 1KXZA 4LHVA 4IJMA 5T3UA 1ZGAA 3KZXA 2OBNA 3CSDA 3I30X 5DEOA 1EFPA 5EVJA 3KOWA 1XPUA 1YRQA 4TTVA 2XQGA 5I9BA 1F2UB 3QVLA 2OGSA 1L4YA 2OTCA 1Y8QA 2Y0CA 1YJCA 4L6IA