1JI0A

Crystal structure analysis of the abc transporter from thermotoga maritima
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
b'MVSDIVLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVINRMGIALVPEGRRIFPELTVYENLMMGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGEQQMLAIGRALMSRPKLLMMDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYGYVLETGQIVLEGKASELLDNEMVRKAYLGVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter
publication title The 2.0 A Crystal Structure of ABC Transporter from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
total genus 62
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2001-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ji0A00
1YU9A 3KUDA 2Q3FA 4C0LA 4JYCA 2QP4A 4V0ME 5CK5A 5EXPA 4XWOA 4PZYA 2NPFA 1HT2E 3O8CA 2GJSA 3HR7A 3LY5A 1E0AA 2IS2A 3JZMA 1AM4D 3BC1A 4LJ4A 1W1WA 4HAZA 3RRZA 2F1IA 1GKYA 2V7QD 4BPBA 3RNLA 2IA5A 4M9XA 1XXHA 2BIFA 4EIWA 3K0FA 1KI8A 5KNBA 4LYJA 4S35A 2W0SA 1B23P 2C78A 4IOMA 5BW8A 2JIZD 3L8ZA 4F4IA 3CZQA 1E2KA 1KDOA 4Q01A 4NP6A 2ZRFA 1GKUB 2CNWD 4BQSA 2KB0A 4XVRA 1CRPA 3IIMA 3GLGB 4OI1A 1TEXA 2ZR0A 4NYIR 3PEYA 1U8ZA 4G0NA 3SQXA 1TF7A 1G7TA 4PQYA 1ZMXA 2ZE5A 2XJ4A 3WMGA 5AJYA 4M1YA 3WYFA 4DDTA 4BLOA 1TF5A 1Z0KA 2JA1A 4NL4H 3GLIE 4KODA 3U2QA 2ZRMA 5EZ5A 2ZIAA 1M6NA 1TF2A 3M4YA 3G5UA 2EYUA 2WVJA 3T06B 2G0TA 1NRJB 3C16C 4Q4HA 3FMFA 3SYLA 3EZ9A 4TL6A 1ZM9A 2QP9X 4F38A 1TEVA 3K0AB 1PVOA 2O0KA 4JMPA 3BERA 3PXGA 1CF4A 4F4JA 1G41A 4GZLA 1ZNWA 4URYR 4AYXA 5JFGA 1DAIA 2LKCA 4M21A 4D4MA 3CNOA 1UDWA 3LBNA 4M22A 5FFMA 3T1VA 2IUTA 4JL5A 4LJYA 4MDFA 1MRNA 3NH9A 4LV6A 4XTCS 2FFHA 4OHXA 1ESMA 2JEOA 3NIBA 3IBYA 3HU1A 3S1AB 2GKSA 2L0XA 1Q57A 1GNQA 1M1YE 2W6JD 4DEYA 4N3NA 2PCJA 3LH5A 5TMPA 1W46A 1RE0A 4PC3A 4KHZA 4Q19A 4TMXA 1E0JA 2FWRA 3LLUA 5GJVC 3BH6A 2GXSA 1XWIA 3AGQA 3CBQA 2HCJB 4Q4JA 3UMFA 3LBHA 5GVRA 3K8YA 1JECA 2EW1A 3THXB 3QXHA 4DCTA 4GFDA 4O3MA 3KFXA 5JWHA 5AJWA 4JSYA 1XMSA 5DHAA 1ZM3A 1E1RA 4O2RA 1GM5A 3KXKA 3KX2A 2P5TB 4F7WA 1L4UA 2HYIC 1FMLA 1QHGA 1DARA 4WOPA 3TKLA 2YOHA 3TQFA 4CVNA 3QPWA 5C4GB 3L8YA 4ZPXA 2J87A 3AGPA 3IO5A 2CLSA 3KTAB 4LBYA 4U5XA 5DGXA 1ZCAA 3QPVA 2AWOA 3VNVA 1QHHB 2J3EA 5FL7A 4JLMA 5JWRA 1E0SA 4IXNA 3FGNA 4DSUA 4PR0A 4KVGA 4OHWA 4AIIA 5BWMA 1COWA 2GZHA 3QVUA 2UKDA 1LF5A 2ZU6A 2XSZD 1EXMA 2IT1A 2XZLA 2OXCA 4C7OA 1N5JA 2H17A 1TQDA 1R8SA 1HQCA 1Z2CA 2GILA 2J45A 5KDDA 4DLXA 3M6AA 4UNPA 1FQKA 2ZRGA 1OH5A 2CL7X 2ZAOA 2OEPA 3Q7PA 1FUKA 4YQFA 4Q18A 1T3HA 4YMWA 3AEZA 3D8BA 1XEWX 2C96A 2FSFA 1E2HA 1Z28A 2RGEA 2JLWA 1FP7A 1G3RA 1HY3A 4UNSA 1R2QA 4LHYA 4V0KA 5F3WB 4PSVA 4AG5A 1VPLA 4KFRA 2YJTD 3NEYA 2IYRA 1KK3A 2QEQA 3VKHA 1EFCA 2FN4A 4URXR 5K8LA 4EUNA 1ZU5A 3P32A 3F8TA 4IW3B 3THYB 2O8FA 5FPHA 2YWHA 3VR6A 4JT4A 1OT3A 1KK0A 1KY3A 1E98A 2VL7A 2WOJA 2DYKA 4DCSA 3ASYA 2YVUA 4ESVA 3EA0A 2JLUA 4XJXA 5DISB 3KKNA 1DADA 5LB4A 1SQ5A 1R0XA 2OG2A 4OYHA 4PXAA 2ZR9A 4A15A 1WBDA 3A1TA 1HURA 1G7SA 2XNDD 3QG5A 5TV2A 1G16A 4M1MA 3GLFE 1N6KA 4BLTA 2J0UB 5C1BA 3CPJB 4ZI3A 2ZE6A 1IN7A 3GJ7A 1JR3A 5G53C 3LD9A 5SZHB 3TGPA 5F2EA 4KV9A 5FTMA 1NVXQ 4S2EA 1T0HB 2N42A 3U3RA 1RJ9B 4EPYA 3U7GA 2BJWA 1EX7A 1QVRA 3ZDQA 4W7SA 2CBZA 3M0EA 5CLLA 5CB6A 2O0JA 2H1LA 1Z5ZA 3R8FA 3UWKA 2P0EA 4Q66C 2ZPTX 1CU1A 1Z0FA 1NBMD 3A58B 3BE4A 3QEJA 3G82C 4GMXA 3SN6A 2BV3A 3ADKA 4TYQA 4B75A 2RGXA 3SS8A 1GFIA 4V0OA 5EUQB 1HQYE 5P21A 5M04A 2ZI6A 3QXCA 1Q0UA 2H8KA 1A4RA 4XSGA 2JJ2D 2NTYC 3WNDA 5HZHA 1KK1A 4HB3A 3U3JA 1UKVY 4BFSA 4Q02A 4I81A 1Q22A 4KBFA 3HDTA 3TSZA 1G19A 4M9SA 2OHFA 4URWR 2QT0A 4Q21A 3QKRB 3SU8A 4GMDA 4EFLA 3JVUA 3X1ZA 4DSNA 1N5IA 5DI9A 3F5FA 4W9MC 1LS6A 3SQWA 4B3XA 1U9IC 1G4AE 4PZLA 1II0A 1FQJA 1OFUX 1KSFX 1NLZA 2EFHB 4D81A 1VG9B 5CITA 2QN6A 3AUYA 3H86A 4J0QA 4UKDA 2IK8A 5FOWA 1IOZA 2DFNA 4IVQA 3U6KA 1NLYA 2B8TA 4NKRA 521PA 1CLUA 3TR0A 3CONA 4G3XA 1OFIA 2GHIA 5EUMA 4L4UA 4YLGA 3U5ZB 2RKOA 1F3OA 1IN6A 1WRBA 2ZI4A 3NTUA 4FMCF 4MYHA 3NVAA 3R7WB 2QAJA 4Q7LA 1X6VA 1SVMA 2HLDD 3NH6A 4ARZB 4PANA 1W0JA 4JVLA 1F48A 2FNAA 1VG0B 2JJ8A 3ZD6A 2J1LA 5L3SB 1EFRD 2UZIR 5H68A 1TUEA 4H1VA 5GVSA 3PIRA 4B2IA 3SJCA 3WMFA 5G3ZA 2CE7A 4BECA 2WWXA 4DT1B 2QE7D 2O8BA 1DAMA 3T1QA 4O0MA 2CE2X 2OESA 4GDFA 2D06A 1HYQA 1G17A 1VHTA 1M7GA 5GJWC 1E9BA 4FW9A 4LZZA 5JBQA 3GFOA 3QI2A 1PV4A 2AN9A 3SBEA 5AUPB 1E1RD 1X8JA 4Q1FA 2RGGA 2W2TA 1EWRA 2IYLD 3MG9A 1K5GA 2ZS9A 5AJXA 1G3MA 1IN8A 1XXHE 3A4MA 1CJTC 1M74A 3CX8A 4OI4A 4B6EA 4HSEA 1P9RA 2BEKA 5FL7D 4QOSA 4TMKA 2GNOA 2CCJA 2ZAMA 3IQXA 4MQBA 3I5YA 3KQLA 1KAGA 3AP3A 3MAAC 2GJKA 3DDCA 4JKYA 1NBME 3U44A 4HAWA 3BORA 1K6MA 3VKWA 1NVVQ 3H1TA 4RKEA 4DB4A 1OHHA 2V9PA 1JR6A 4QHTA 4WXRA 5BN3A 5H70A 2D2EA 1CBUA 1R8QA 1U8YA 1N2CE 1XPOA 2V6IA 3VR1A 1U2RA 4DDVA 2FX3A 5J4KA 2IHYA 4BFTA 3MSXA 1X1RA 3FTQA 4NONA 1V43A 3IUYA 1UKZA 1KNXA 1SXJE 1N0UA 4MITA 3RVBA 1B0UA 1Y3AA 1UKYA 3TW8B 4BLRA 2QRNA 1T9HA 2HUPA 1M7HA 4B73A 3EZ7A 3MWJA 1DPFA 1YVDA 1KMHA 2R62A 3DO6A 1E2QA 4M9ZA 3PJRA 4QC2A 1L2TA 1MRSA 5HE8A 2DCUA 3U3OA 4I1VA 3U3KA 5EJEA 2QU8A 4XVQA 4B48A 5UKDA 4DLYA 1NJFA 3TSOA 1N6LA 4FCTA 1RVDA 1VCMA 4MKHA 1TAGA 4FMDB 3B2EA 4PPFA 4F92B 3IBGA 1XX6A 2OFOA 3ECCA 3SJZA 1N6PA 3FHCB 1PLLA 4QGHA 4BRUA 3AVTA 3MLEA 1XJQA 4HUTA 3Q8XB 4TMVA 2W00A 5F98A 2VHTA 5JJKA 1A82A 2W58A 2A5JA 3GJXC 4PC6A 4E09A 4AKEA 1AKYA 3SFVA 4CIDA 2VIIA 1W36D 2ANBA 1TPZA 3SBDA 3FKQA 1F2UA 1FOEB 2QBYB 2FSIA 5FBVB 2W0MA 1Z22A 3B60A 1S3SA 2H5EA 3BK7A 5KDLA 2OILA 3MJRA 2NO7A 4BFYA 2MSDB 3MWLA 3FOZA 4MKGA 1DAFA 2CLDX 3CRQA 4WAUA 5FOXA 1G8HA 4XWAA 1KOFA 2DWOA 1KYIA 1NG9A 3HPQA 3WRXC 2CMKA 3RWMB 1GZSA 3EA5A 4TT3A 4XIGS 2V1XA 4HEJA 4MUAA 4I1SA 1CEEA 4FWIB 2JJ1A 1UAAA 3KKMA 4QBFA 3P4YA 1GKIA 2W2XA 1XTRA 1HE1C 2X77A 2ZI3A 2ZRLA 1E9RA 3O8DA 4TZ6A 3NXSA 3FB4A 2DY1A 4LV5B 3OIUA 3TLXA 4TQUS 1P2VA 2XTZA 3DM9B 1T0JB 2BM1A 4DLSA 1QHXA 1AKEA 1TNDA 5CM9C 1CJUC 1G21E 3LWNA 4AI6A 2R8RA 2CK3A 5JHHB 5FUWA 5FOSA 3WYGA 4RD3A 2CEAA 4B3DA 4JYBA 4HAUA 1W4BA 1NIPA 1P6XA 1T3LA 2AWNA 4Q4AB 5FOUA 4LGMA 4LJ7A 4ZDJA 1R5NA 1G3IA 3OEED 1E2MA 4BFZA 1U8AA 4Z8YA 1YQTA 4ZCMA 4BZQA 2FDCA 1NKSA 2FZ4A 3A1SA 3IKJA 5H8WA 3MRSA 2E1RA 2FV8A 2VHQA 4YMSA 3IILA 4TL9A 1W4RA 4PHTA 2ZJAA 4BEJA 3C8UA 4Q47A 5HKKA 2QNRA 4KCGA 3T61A 2XXAB 1XF9A 1Z06A 4UNQA 2GRJA 2IYXA 4XH9B 4CT5A 2D62A 2J7PD 2PBRA 4M1SA 2IWHA 2AFHE 5DNYB 3NDBB 1Z0IA 2XNSA 3VR3A 5JWOA 3EARA 2WWWA 4DB2A 2CHQA 4MYTA 3D3QA 1Z07A 4V0LA 2Z6VA 2A3RA 3B82A 4NBSA 2QI9C 2C98A 2IS4A 5EP2A 4MKIA 3UG6A 5E3HA 3IPXA 3BIFA 2GEUA 2NOAA 5J5CA 3TUIC 1E9SA 4DBLC 5BN4A 4PX9A 2WSSA 3THOA 4B3BA 2HT6A 4PSKA 4R98A 2QGNA 3I8SA 3V4RA 1Q3HA 2Y8EA 3GEHA 2WJIA 4JJZA 2AD1A 2HXSA 1OIWA 1MABB 3F3YA 3K0AA 1N0VC 1OF1A 1E4YA 3U3MA 5FTLA 5L3RA 1GUAA 2YC2C 4KYUA 3WNCA 5EE0A 4DUGD 5J4VA 1UEJA 4Q7KA 3K53A 1G3UA 3THWB 2GWHA 3AP1A 1HUQA 2O8DB 2WWIA 4HB2A 4NYJQ 2CCKA 1AGRA 2HEIA 4L5BA 4QKQA 4TLAA 3S1AA 2YNMA 4O25A 1ZM4A 2J7KA 3QG1A 3R9IA 1CJVC 4RFSB 2KJQA 4AY2A 3E5HA 5CIQA 1J8MF 4PHHA 4A0FA 1JXOA 2OUKA 1WF3A 3VU9B 2ZYWX 5JMTA 4R7ZA 4V03A 2HF8A 4HUQB 3O8BA 2QL6A 4V0NA 3THXA 2PMKA 2HJVA 5J4HA 2QG6A 2CL0X 1RYHA 2MMGA 1FNMA 1ETUA 5DI3B 1Z08A 1AS3A 5FUVA 3OZXA 1US8B 2WJVA 3FYHA 3ZZUA 4UNRA 4DLUA 1GITA 3SYKA 1VHLA 2V4ZA 2F1JA 2D7DA 4RFVA 3P4XA 2ZETA 3A36A 2QAGC 3A1WA 3KTAA 4NYMQ 1DTSA 1QHHA 1II9A 1ZD9A 2C9OA 2VP6A 2VBCA 1QHIA 4DXAA 2MMCA 3C5HA 5EP3A 3DOEA 2SHKA 5DE3A 1Q12A 1W49A 4FXPA 3GJ3A 2VP4A 1JAHA 5HZKA 2R6DA 2ZUBA 4D82A 5FPTA 1N6OA 2OAQ1 4K81B 4EQ6A 5AWFC 3TH5A 1T8UA 2GXUA 1ZINA 3LV8A 5A0FA 1XMJA 2ZJOA 4A92A 3X2SA 4C0QC 4C0HA 5JI3E 5TVKA 2F43B 3FVQA 3NWJA 1LTQA 4FD2A 2QORA 1U0JA 5CB8A 2ZSDA 1UKEA 2BJVA 2Q9AA 1DVRA 5KHOC 2BMEA 3QNUA 1KI6B 3CNLA 3LX8A 3B1YA 3PEVA 1AS0A 4U7DA 4AKHA 1BIFA 1E4VA 4TT3D 4YMVA 1Q1QA 2GZAA 4V02A 1XTIA 4BEBA 3HJNA 3GQBA 5BN5A 3CH4B 3TRFA 3SC3A 3THYA 1TU3A 2O8EA 1OFHA 1WA5A 1G8GA 4FN5A 1IJFA 1BMFD 3EPJA 2FH5B 3RAPR 5KSZA 2IUUA 4LJAA 1Z0JA 4GBMA 4LHWA 3GLIB 1FP6A 4BZXA 3NKVA 2J59A 3ZVMA 2AFIE 4LJ9A 3QSYA 1RRGA 3AF1A 3N2EA 1Q1BA 3PVSA 2Z4RA 4ZDKA 1XEWY 3QXJA 2QAGB 4JKIA 1NIJA 2FPLA 4OQFA 2J0UA 3TNFA 1N6IA 4MGKR 1EG7A 4BASA 1E94E 2ZS8A 2QPAA 4HAXA 2GVDC 3U7HB 2PLFA 4Q4LA 1RJ9A 2JLRA 1W47A 1G5RA 4PQRA 1L4YA 3B1ZA 4YXWA 3RS2A 3WHLA 3A1UA 3PUXA 4PTLA 4C3ZA 5JEDA 1P2TA 2OM2A 3K09C 3WHKA 1SULA 3PFIA 4LJ8A 2OLJA 3LW7A 3HYRA 3WRYC 2FFAA 4TSFA 3O47A 2WWYA 5KNDA 5LD2C 1JQJC 1DAKA 1XJ0A 1D2NA 4NMMA 5B57C 5DH9A 1AIPA 2OBNA 3W6OA 5L3QB 5LPNA 1H8HA 2GCOB 5FUYA 3OESA 4K8OA 3VX3A 1OKKA 1NJGA 3GFTA 5JSZB 2V8OA 1YE8A 1IJEA 1EESA 1E2FA 2ONKA 3KJGA 4B3GA 1I4TD 3OAAD 4A2PA 1HE8B 2P67A 4Z1MD 3QKRA 4XD7A 2R65A 3ETLA 2V55B 2XOKA 1CJMA 1TX4B 2AD5A 2WSSD 2JLXA 2ZSFA 1PLJA 4A0HA 1RPZA 3QIAA 2EU8A 4QNMA 2ZSEA 821PA 1FX0B 2IXEA 4C0SA 3CIOA 4Q00A 4RD6A 3W3ZB 2BBSA 1F2TB 2XTMA 4GP6A 5BYJA 1Z83A 3QBVA 2F7SA 4M0LA 1X8KA 5TY0A 1JJ7A 4M1TA 4HDQB 3VQTA 5JS8A 2QY9A 3WBJA 1ZM2A 1CTQA 3U61B 2RB4A 5HPYB 1YJ5A 1CS4C 1U90A 2E87A 1XD8A 3GLHE 3A1VA 3T15A 1P2UA 4ITRC 1CRQA 3PITA 4RKFA 1R5OA 1U0HC 1DG1G 3R7WA 3C4JA 4ZIRB 621PA 4E22A 3CNNA 1EGAA 2B7CA 1NVVR 1UM8A 1XD9A 4ARZA 4NCIA 4LUCA 2JDIA 2D3WA 3F0TA 1EFTA 4TQ9A 3UWOA 2XZOA 5LD2B 3L0SA 2TMKA 3CWZA 1KI3A 2WAYA 2H16A 3L43A 2PCLA 2WBLC 4JVSB 2QMUA 5E7IA 2WMOB 3RS0A 3ADCA 2G83A 4UXHA 4DT1A 3IEVA 2W83A 1FMJA 2IUSA 2OT3B 5KNCA 1KI1A 3HYTA 4AKIA 5B30A 1TADA 1J99A 3IHWA 4CZ2A 4QHYA 4BZPA 1X86B 1XCMA 2IBMA 2BOVA 2Z43A 3L0OA 4DLWA 1G3QA 4YDHB 3NHAA 5BQ5A 5TARA 3I92A 1U9IA 3W8RA 4URVR 3WP0A 2HV8A 5G41A 2ZRPA 4LYAA 3TBKA 4JL6A 3B6EA 4L9SA 4IRUB 3CX7A 2ZANA 4ON9A 2RMKA 2DR3A 1LB1B 4PPNA 4FINA 1QBKC 3GLFB 2AK2A 2HJGA 2W6ID 3G0HA 1G8FA 2QTHA 5JZVA 5K8UA 2ZRHA 5LB2A 4D6PA 2IYUA 2Z5FA 4QRHA 1VYUA 2YYZA 4ASUD 4IOLA 1CP2A 4C0AC 2ZE7A 2GF0A 1E79D 4N0EA 3ZIAA 1TTTA 1YRBA 5B64A 1ESNA 1VMAA 4OKSA 1DO0A 4DC9A 2WMNB 2X2FA 1LFDB 2ZYTX 2G0NA 1AQYA 1MO5A 2PJZA 3AKEA 3L2OB 4MUBA 2IYSA 3ONWA 2N1BA 3D31A 3HP1A 2G88A 4LBVA 2GZDA 4NPHA 4OBEA 5JJLA 2AL7A 1IONA 2ZUDA 2HDNB 4DZZA 5J47A 2JLVA 3KB1A 2FSGA 4LOAA 1JNYA 2Q21A 1NVUQ 2XX3A 4GP7A 2O5VA 1Z6TA 5AR1A 4C2UA 3QKUA 4K46A 4LJ6A 1XJCA 3REFA 1VTKA 4CEHB 5G3YA 2D74A 3ICQB 2D7CA 5FBQB 3B1WA 4IDQA 4AK9A 3ZS8A 3AVVA 5C2JB 2FPMA 4P0TA 1XTKA 1VYVA 3B7GA 1TUIA 2PZGA 3BAFA 4M8NE 5KSPA 2J46A 5JI2E 4Q1EA 3RHFA 1E9AA 4UJ5A 2NMVA 1Z6YA 2NPIA 5CDFE 1DELA 4TLCA 2KI5A 1G8PA 2VO1A 3TK1A 5F9HA 3ICEA 1NL3A 2EWWA 2NO9A 1FFHA 2C2HA 4EPWA 4BFUA 2REBA 1GILA 1NF3A 5KPDA 4A0GA 2FPKA 4DJTA 2C99A 4HZUB 1Z63A 2VF8A 1M7BA 1YZKA 3KZ1E 4ABYA 4G1UC 3ZLJA 1KO1A 3RC8A 2RGBA 2VP0A 3AF4A 4Q9HA 2RGCA 3OFNA 3CLVA 2QBYA 2CXXA 3E2IA 2NZJA 3W6NA 4YXWD 2FJUA 4A6XA 2ATVA 3JVVA 1D2EA 1JB1A 4UQOA 1JEDA 1I2MA 5FR1A 1N5LA 3CPEA 1MO3A 3PUZA 1N3BA 5B58C 2LWIA 3EZFA 1OE0A 5DLQC 4DEXA 1SXJC 2JGNA 4KI0A 1GNPA 2WJHA 2XITA 2ZRAA 4B43A 1E0KA 4HLQB 4Z8XA 4AYTA 4CW7A 1QVAA 3SI7A 2F1HA 4D25A 3AH8A 1N6NA 2ZJ2A 1G7CA 4W5HA 4TMTA 2JCSA 3SDZA 4DRZA 5GJCA 1GRQA 1IN5A 2ZREA 4DWJA 2ZS7A 2QUZA 2QQEA 1PUIA 2K5UA 1YR8A 2YZ2A 5A5GA 2JATA 5DHFA 3K70D 2WIBA 1WP9A 3ZZTA 3AUXA 1NKTA 2BBOA 3RRNA 1IM2A 3ND8A 3DKVA 3RLFA 3B78A 1J7KA 1P9NA 1XXHB 3OE7A 5FBRB 4Q4AA 3X1XA 2WIAA 4WZ6A 3ZVRA 4UJ3A 4A36A 1KHTA 3TQCA 1OPXA 2PZFA 1FNNA 2DFTA 4LSGA 1U99A 4JZKA 3TUJC 4C9BA 2A30A 4QNRA 1R0WA 3EPKA 2ATXA 1UDXA 2Q3MA 4BLQA 4TMZA 3M1IA 2WZQA 2ZRBA 4FCWA 1DBSA 3SNHA 2XXAA 2B21A 3RANA 4WA7A 1YHNA 2WJJA 2JDID 4TQAA 3AKCA 3IIJA 3BH0A 4FMBB 1Q21A 3CW2A 1OIXA 1DAEA 2O0HA 1SXJB 2I3BA 2LCFA 3B13B 2NZ8A 2PT5A 4JBWA 4PFSA 4WZAE 5E95A 3VR2A 4IVPA 4D4LA 2VA8A 4PO9A 4QG7A 3U60B 5ANRB 4EKDA 3WXMA 3PQCA 1E2PA 3DL0A 4RSGA 4ZCLA 2EQBA 1E99A 2ZI9A 2I1QA 3LBIA 5LBIA 1DAHA 2AKAB 1ZD8A 1NY5A 4DCNA 3UK6A 4B35A 5KOYA 2CJWB 1XZPA 3L0PA 1YZGA 2X1VA 2ZRJA 4FCVA 4KAXA 2JLSA 2B92A 3NBFA 4IDNA 3WYAA 1MABA 5D3MB 5JECA 4CDGA 4QBHA 4B32A 4HAYA 4KSCA 1FPMA 1K5DA 1W5TA 2KE5A 4QFMA 4NYMR 1P75A 1CXZA 5L3VA 3K9HA 1ZM7A 2B6HA 3AB3A 3DOFA 3NG1A 5J40A 3U7EB 3THWA 1CULC 4OJKA 1KY2A 4JIMA 1NG1A 3SHWA 5JLJA 2F1RA 2O8DA 3EC1A 4AKGA 3EWAA 1E96A 4LC0A 1XB2A 2GJAA 1G64A 1YZLA 5J4LA 1COWD 4IFBA 5FUXA 3LDAA 5J4YA 3TIFA 2OCPA 2YWFA 2PH1A 4IDPA 4BLPA 2AK3A 3KJIA 1UBFA 2VF7A 3VU9A 1XTSA 4LBWA 1W4CA 1II8B 4HUQA 1F6BA 3GMTA 4D0NA 2JLQA 1W44A 2WPDA 3QE0A 2ZE8A 2C77A 221PA 2BMDA 1P9WA 5DI3A 5KTYA 1US8A 3T1OA 1IXRC 4JL8A 4TYNA 3NBXX 4IEIA 1S9DA 4P3YA 2AX4A 1OFTA 4CEJA 4TMWA 1QDEA 3MGCA 2H7VA 1UPTA 1Z6GA 3Q85A 5EZ6B 3CR8A 2CL6X 1W36C 2WWHA 1XZQA 1KJZA 4V0MA 4LCBA 5B2ZA 1NN5A 1W48A 2GVZC 1G4UR 1YZNA 3PEUA 3WP1B 3DVLA 1F5NA 2ZXUA 3VFDA 3FMPB 1XD2B 4DIDA 3T35A 3ZJYA 3MUFA 1E69A 5BXQC 1QHSA 2WM9B 2RAPA 1GWNA 4ZDWA 4LK2A 3KXLA 4AWXA 4Q7JB 4E03A 1GTVA 1I4DD 3UIEA 1Z0AA 4XOIA 1K8RA 1G5PA 1FZQA 4MDEA 2I4IA 1YKSA 3AP2A 1JR3D 1NI3A 1VCIA 4MYUA 4QBIA 2NG1A 1AA9A 2JASA 4NE2A 1LF0A 3BH7A 3EAQA 1D9ZA 1KI6A 4QJ3A 1CJKC 2IL1A 4ZKEA 4RZ3A 2IF2A 4P4UA 3CRRA 4BWYA 1SVSA 1S1MA 1ZUNB 2H18A 3I1FA 4LJ5A 4TWZA 1W2GA 4B47A 721PA 1OYYA 2GEVA 2EWVA 1EFUA 3BFKA 3RS3A 4NHOA 3LVQE 3D7MA 4JLJA 2OBLA 1E9EA 2RGDA 1GL7A 4RY2A 3DZDA 1OXSC 2ZVQX 2GDJA 1XMIA 1HTWA 2KSQA 3QBTA 1G6HA 3QY0A 3H2YA 3RS4A 3X1WA 3GLIA 2A2ZA 1CR4A 2R2AA 3VR4A 1BO6A 2OFWA 2RHDA 3ZZ0A 3V9PA 2HCBA 2WICA 4LBZA 2AHOA 1BH2A 2QAGA 1XEFA 4IFEA 4OQMA 1GRRA 2BCJQ 1ELOA 3BGWA 4L15A 5K8IA 1W36B 1TL7C 1ZD1A 1MT0A 2HXYA 5DO9A 5LDDC 4NCKA 4A6PA 4HAVA 1LW7A 1RIFA 4CEIB 3QXSA 1PZNA 3HR8A 4LYHA 3ZVLA 5IT5A 1TMKA 2VLIA 4JLKA 2FSHA 2XB2A 1VKJA 3L82B 1I2DA 3AVUA 5DN6A 1T91A 3IO3A 1WMSA 2VH5R 1HH4A 4RD2A 3OIVA 3VAAA 4A4DA 2ZM5A 4UXJA 1SHKA 3IPYA 5FTKA 4LRWA 2BBTA 3FMIA 3FPAA 3GCGA 1ZNYA 1OXUA 2C9YA 1EX6A 2VYFA 3KB2A 4JLPA 4JLOA 3LQRA 4RD4A 4A9AA 2IYYA 1YR7A 2F9LA 1G6OA 2WWFA 5A4JA 5L3QA 1ZP6A 1ONBA 2BBWA 3QF4B 2GCOA 1T5LA 2H57A 5IHPA 4G01B 5JSZA 4NTZA 5EXSA 3U4QB 1W0JD 4II7A 1I4LD 2HYDA 1A5TA 2IEZA 1FUUA 3DZ8A 1T6NA 2KBFA 3GJ8A 4Q03A 1Z0DA 1DOAA 3GLGA 2ORWA 1XP8A 2PX3A 2R44A 1RC8A 1SVWA 4EPRA 2A78A 4H9GA 4B3FX 2B7BA 3CM0A 1FX0A 1ZYUA 4C0BA 1SVIA 3GJ4A 3JZAA 2RCNA 1E2IA 1NMZA 3H0KA 4D0LB 1F2TA 4LHZA 2F6RA 4R71A 5AK0A 3W90A 2IS1A 2D4HA 2F55A 2GXAA 2EFCB 4RD0A 4CYMA 2GAOA 1JR3E 1GIAA 1R4AA 2P6NA 1XPUA 1UBGA 2JIZA 1UFQA 4P4TA 2KWIA 2WJYA 3AF3A 4DSOA 4ZIRA 2HT1A 2GJ9A 2UZ3A 1NP6A 2VQSA 1NSFA 4GSYA 4KLNA 4NCHA 1SZPA 2OCYC 4GOJA 3FWYA 3CKLA 4Q9JA 3AVPA 1G20E 4IOKA 2DWPA 2EYQA 3W5JA 1LNZA 3LLMA 4IOJA 3K09A 3BB3A 2VP9A 1QG2A 2LKDA 1SVLA 3W34A 4QGAA 1OHHD 1N0WA 2RH5A 3R9WA 2O8BB 1G291 1T4GA 4CF7A 1L8QA 3IDQA 1P61B 3CF2A 1SKQA 1OXXK 2WKRA 2GETA 4WBSA 2BKUA 2BWJA 4OK3A 3E70C 2QGZA 2GK6A 4GT1A 4I1UA 3MJHA 4E5UA 2WPDD 1IQPA 1DAGA 1QRAA 2Q0HA 2QQ0A 5KYKA 4B3CA 4Y0AA 1KNQA 4C30A 4TYWA 3ADBA 2VEDA 5FI1B 3ASZA 1NMYA 2VHCA 3QEOA 3BRWD 4OQXA 1F60A 4IVRA 5ELXA 1LS1A 1G18A 2RGAA 2PT7A 2QMEA 1E32A 1ODFA 2WKQA 3MFYA 4KO8A 4LC1A 4ERNA 1SKYE 1KZGB 4WVFA 4M4SA 4A8JC 1VECA 3BB1A 2CHVA 2BVNA 2WV9A 4M1KA 1OSNA 4OK6A 2YV5A 3NBYC 3GLFA 4Q48A 2WTUA 2OXRA 1MO6A 1PUJA 4MGIR 4Q9IA 1GL9B 4EPXA 421PA 2W6JA 3BXZA 1HT1E 4HLUC 5L8VA 3P27A 2BCGY 4RD1A 4U00A 2X8AA 1NN1A 1H8EA 2V6JA 2R6FA 1R0YA 5FPYA 2QP3A 2GJ8A 4ACBA 5AUNB 4HLDA 5FR2A 2AXPA 1C1YA 5CJ2A 2V3CC 5C4MA 2B8WA 1J8YF 4MRNA 5DSZA 2OV2A 4OI0A 2OE2A 2BC9A 1BKDR 1XTJA 1ZUIA 1E9FA 1GNRA 1KKLA 2REXB 1XEXB 3TJZA 1JI0A 2VHJA 4DHEA 4GPTA 4LDJA 2C8VA 121PA 1QHYA 2OSBA 2Z4SA 5JRZA 4DLRA 4CEHA 2BKEA 4NH0A 4YDSA 2JJ1D 1OXVA 3SR0A 3GJ0A 3P26A 2V1UA 1T5IA 4PPQA 3GFPA 2XJ9A 1PLKA 3IQWA 3K1JA 5CYOA 4Y0VA 3O8RA 2XSZA 4CGZA 1P5ZB 4DDWA 1UBCA 1R5BA 5FTJA 4A8JB 2BHRA 1W7AA 1OYWA 4X8HA 2BDTA 1NVWQ 3HU2A 5KSOA 1C4OA 5HTKA 4P32A 5FPSA 1GAJA 1BYUA 1JXMA 2IXGA 2REOA 4D4KA 2CK3D 4G5OA 5HCNA 5JEEA 2NIPA 1G9XA 4UNNA 4ZKDA 2GBLC 2EFEB 3C7KA 3GLHB 4JBXA 5GADl 1NSTA 3K0EA 2RGNC 2J0QA 5DN6D 2CLCX 1NY6A 4GOKA 4IHQA 4XTRA 3QKTA 1ZIPA 2QA5A 1PJRA 4L8GA 3RDPA 3SOPA 2RHMA 3ZVNA 1R0ZA 2FFQA 3H84A 4I99A 5SZJA 3RC3A 4Z54A 4BFXA 4OQLA 4F91B 4QM7A 3AVOA 1Z6XA 5FOTA 2X19A 3ND9A 5HKKD 4D80A 3R8CA 2DPXA 1IXSB 3A6PC 1UBEA 1TQ2A 4IKEA 1E6CA 1Z47A 3UATA 2XNDA 3TVDA 1IY2A 5KUTA 1R10A 2WHXA 2ODNA 2A7QA 4M1OA 1MR3F 3GJ5A 1TQ6A 2PL3A 3R20A 4PAQA 1N6HA 5AUQA 1FTSA 3ZS9A 1A7JA 1DG3A 5BYKA 3C5CA 1P62B 3CX6A 5JHGB 3PV0A 4AC9A 1KJYA 2BM0A 5FBWB 5IDVA 1VIYA 1WQ1R 3LFUA 3N2IA 3IGFA 3RWOA 2IYVA 1P7CA 3LX5A 3SFZA 4XWKA 4B2PA 2OCAA 1KI4A 3K0CC 1EFHA 5KU1A 2GA8A 1NBMA 4X8OA 3T12A 1KSHA 1OXTA 2P6UA 3KL4A 3T1TA 3Q3JB 1KDTA 4NU0A 4RJLA 3WBKA 4WIAA 4Q7MB 4ZDIA 2G9NA 4AD8A 2JJ2A 3CWQA 1KO8A 3RYTC 4M1WA 5H1YA 1X1SA 2G1KA 3CF6R 1O87A 1SXJA 1SGWA 2ANCA 3QKSB 3GJ6A 2F3RA 3PR1A 1KI2A 1NN3A 5TDHA 5L3SA 3BS4A 2IXFA 4P4SB 1Q3TA 4N0DA 4JS0A 2C9CA 2O8CB 2XZPA 1Q44A 1SHZA 1YZUA 2C04A 4U02A 1ZRHA 1KGDA 3FE2A 4MGZR 2Q3HA 4YONB 3SEAA 5HR5A 4TLEA 1JJVA 2AR7A 1GDDA 1W5SA 2CJWA 3BOSA 3PUVA 2GK7A 3FKSA 1SVOA 1ZVQA 3TAUA 3CF0A 3IEUA 1M34E 5D3MA 1D5CA 3SJAA 1J2JA 5JRJA 2DB3A 4B6FA 5EE3A 4MA4A 1RW4A 4AURA 4OHZA 4PHFA 1E2EA 1E9CA 2ZRKA 1JAIA 1JPNA 2FGJA 2QTFA 3CRW1 2XAUA 5C46F 2QM7A 1JEEA 2HLDA 2ORVA 2R6GA 1N6RA 4LY6A 3TAHA 3GP8A 2ODWA 3OF5A 5G40A 5C18A 1WB9A 1EFRA 2Q9BA 1GRNA 2WWGA 3EWSA 3ZH9B 2FE4A 1H8ED 2J41A 2Q9CA 1KDRA 2VRWA 3OHMA 4PO8A 1TU4A 1OW3B 1Y63A 2QE7A 3A4NA 1ZJ6A 1Q20A 1P73A 3DEFA 1OV4A 2VP5A 2QM8A 1MH1A 2JLYA 2R9VA 1II8A 3Q5DA 1GOTA 3UG7A 1X8LA 3GLGE 1O3YA 1C9KA 2P3SA 1N5KA 2EVWX 1KMQA 4JLAA 1XRJA 2ECKA 3W8NA 4DLTA 3TUZC 4EAQA 2BMJA 2OZEA 2ZJYA 2OO7A 3V4FA 1RKBA 2QSYA 3K9NA 1RZ3A 1ZNZA 2QMHA 3BBPA 2ONJA 2J0SA 3AQ4A 4KFTA 1Z6AA 3DM5A 4BE7B 4WXPA 2R6CA 4JSTA 3DPUA 4EJSC 2A5FA 2DFLA 2Q6TA 2P65A 3NDPA 3ZGXA 3FHTA 1MV5A 4P31A 3B85A 2OLKA 3Q7QA 1RRPA 1ZC4A 2VSOA 3N70A 4PZZA 1OB2A 1U94A 4QXAA 3DMDA 4FMCB 1KDPA 2D2FA 1AS2A 1A1VA 4RVCA 1YZTA 3RSLA 4ILEA 4EQ6B 1XD2A 3REGA 2DWQA 1J90A 1U0LA 4OL0A 4URUR 1ZUHA 3Q72A 4NZYA 1ZAKA 4B44A 3VTKA 4POAA 1R7RA 4DLVA 1CR0A 4MRRA 4Q1BA 3HPRA 1V5WA 4US0R 2CDNA 3DMNA 2QRZA 4RZXA 1OJLA 4MYCA 8OHMA 3FDIA 5KSYA 2IX3A 1QZXA 3BFVA 1X3SA 4Q9KA 3UPUA 1H65A 3UXMA 1UF9A 3EZ6A 4JVNA 1S8FA 2I1VB 2O8EB 4H1UA 1D8TA 2ZU0C 3DKPA 1FTNA 1AGPA 1T8TA 3BB4A 3NC1C 2G6BA 2ZI5A 3OIWA 1LY1A 4B74A 2GTPA 4TSFD 3EG5A 3LAWA 5EP4A 3K70C 4IDHA 3UANA 3QPUA 2OAP1 5FL3A 2ZQ5A 4RCYA 3SHFA 1HV8A 3H4MA 5EE1A 2JAQA 3B8HA 4L9WA 1H8HD 1XFAA 4PC1A 3NC0C 2BEJA 4I1OA 4PAOA 1OKKD 3HWSA 2ZYUX 1SVKA 4KXFB 1WBBA 2GAAA 2YINC 4A2WA 3FFAA 4EJSB 2DFKB 4BFVA 1U98A 2ZJ8A 4RCZA 1DO2A 4URZR 1YZQA 3KFVA 4KJZA 3B1XA 1M2OB 2QT1A 1XMVA 2ODEA 4KLZA 4XD7D 3EW9A 2NGRA 2XOKD 1GSIA 2ZVPX 4G5RA 4GNKA 3EX7C 3LA6A 3QXXA 4PHGA 4CEIA 4EFNA 4EPVA 1UADA 2E9SA 2OFXA 1VIAA 2QPOA 1KSGA 3VHLB 4A1FA 3MD0A 3T5GA 5EXXA 2IYWA 3QENA 3L0IB 3CUEF 3KQHA 3OEHA 3EIQA 3K0FB 1JPJA 1RRCA 4DDUA 3EASA 3AVQA 5CM8B 1MKYA 3DHWC 3TW4A 3KQKA 3MWKA 1BS1A 2J5XA 1D2MA 1KTVA 4JT2A 1CKEA 2YOFA 3Q5EA 3QF4A 4Q1AA 5CIWA 1SXJD 2W2VA 3I62A 4JLVA 1ZU4A 4HDOB 1ZBDA 5HCIA 3C41J 4KVAA 3U4QA 5CK4A 4A82A 4NYJR 2CCGA 1OB5A 2ZRDA 2ERYA 2GCNA 3LQQA 1XCPA 3RRYA 3K70B 2ZSAA 4B33A 1IY0A 5FI0B 1Q1EA 4AYWA 4ZI2A 3P20A 1G8YA 3AKYA 1M8PA 3BWDD 3LNCA 2PJRA 1HA3A 1IAQA 4PAMA 2ZI7A 2KBEA 3FKSD 3PCRB 4L16A 1AZTA 1WE2A 3OEEA 2NO6A 2OCBA 3PEWA 2XGJA 2A5DA 1QG4A 3AF2A 2P2LA 4YMTA 2IYZA 3QF7A 4QGGA 5AUOB 4Q4HB 2FEMA 1XU4A 1FW6A 2IF0A 4C4PA 4PSAA 3QUSA 4M2LA 4DCUA 1KO5A 4W5WA 1IXZA 1DE0A 3PENA 3RSOA 3I8XA 2WJGA 5FOVA 4Q1DA 1S3GA 1KO7A 1Z29A 2CHGA 2ZJZA 2ZRIA 5E7JA 1MO4A 3UKDA 3AM1A 4OHVA 3I5XA 1UJ2A 2PX0A 1D9XA 4GZMA 1ZCBA 2J7PA 3K9LA 2CVHA 4HB0A 1GP2A 1KK2A 2N46A 2ZJBA 1VYTA 2HF9A 1OH6A 2ERXA 5K8TA 1XDBA 1NMXA 4NYIQ 1YRAA 1P60A 2WOOA 1Q1ZA 2QSZA 3ZIAD 4PQFA 1S9HA 3SYNA 4HZIA 2WAXA 1MOZA 4FI3C 4I4LA 4RFSA 3KJHA 3PUWA 3Q9LA 4OJQA 4Q4JB 2G3YA 3QOFA 1S96A 4DLZA 1VDZA 4E07A 5KDOA 2AXNA 2FG5A 2FEOA 5EXTA 4LX0A 1ZIOA 3LW8A 4TLDA 5EE5B 2YC4C 2NO1A 2PEYA 3UMSA 2FMXA 2EFGA 4DUGA 2MSEB 4B71A 4JBYA 3RS7A 3I72A 3W9YA 4LPSA 5JCPA 1E1QA 3A37A 3ADDA 2ZRNA 5KO2A 2GF9A 4YC7A 2FZLA 4XSHA 3SJBA 1W0KA 1UEIA 4QM6A 4KITB 1A2KC 1A2BA 4ZCIA 4HDCA 1P72A 3CRVA 2O52A 3EZ2A 4C7OB 1G5TA 1P4SA 5FBLB 1T3SA 3KKOA 2XTNA 4BFWA 1DS6A 3U6BA 3PG5A 1GVNB 4NCNA 3GD7A 4BRWA 3A8TA 1BOFA 2WSMA 1KJWA 3OFND 1G7RA 4W5JA 4WZBE 4TTRA 4LV8B 5F9FA 3VHXA 2QENA 2F43A 1RFLA 2IS6A 1IN4A 1RYFA 4CRWB 2YWEA 1XEXA 2OBMA 1KIMA 4BGDA 2FFBA 4HLCA 1S4QA 3BJIC 1EK0A 1FL9A 4US2R 5HE9A 4QBGB 2CVFA 4NCJA 4PPGA 2O8FB 3X1DA 1IHUA 4EFMA 1HEIA 3T34A 3T5DA 3W3AA 1TQ4A 3KQNA 2C5LA 3LXRA 1AJEA 3FFBA 1CIPA 4JLBA 3SZRA 3W6PA 4B76A 3MMPA 4Q5IA 4A8JA 5IK2A 2PLRA 4IJMA 4M53A 3U7FB 3A4LA 1JALA 2YWGA 4Z51A 3LXXA 3W5IA 3TE6A 3LVRE 3GEIA 4LHXA 3EXAA 4ESHA 5D3QA 3ZQ6A 1XPRA 4JVMA 3GLHA 2ORIA 4RZ2A 2ZSBA 4TLBA 4ZV4A 2IC5A 3B1VA 4HLUA 2V54A 4QHSA 3OE7D 5EP1A 3J81k 4P33A 4OK5A 5CJPA 4C2TA 4JLNA 3OEHD 6Q21A 4RZUA 1CR2A 1E2NA 4ACAA 5FH9A 4A0RA 2YHSA 2XEXA 2PMDA 4PC7A 3CRMA 3QQ5A 3I3SR 3X1YA 4Q1CA 4WW0A 4D0GA 1BMFA 3I73A 3TSWA 5E7MA 4KYIB 2QPTA 5FTNA 3IIKA 1VCOA 3EPLA 1VG8A 1QHNA 3K9GA 4TYPA 1G1MA 3WY9A 1S1CA 3HU3A 4OI2A 4TN1A 4GRAA 5AJVB 3UMRA 3BD9A 2FF7A 1CR1A 4OQNA 3B9QA 2PZEA 3KKQA 2ZUCA 1GG2A 1IY1A 1W2HA 3CH5A 4TL8A 2ODBA 3RS5A 1OLOA 5KPJA 3MWYW 4FIDA 1ZNXA 3I4LA 5E4FA 5JS7A 3OIYA 1E2LA 1JQLB 3KQUA 3P1JA 3CR7A 1SKYB 1P3JA 4GI7A 4R2IA 4TYYA 1E3MA 3AKDA 3VMFA 4JLDA 2IYTA 3QJYA 4AG6A 1KZ7B 3ZYCA 1YR9A 4FWTA 4GL2A 1VG1A 1WXQA 3WNBA 1KAOA 2V7QA 4DSTA 4DVGA 1KI7A 4KFSA 1W4AA 2X2EA 4Q9LA 4KBGA 3AVYA 3CZPA 2ZJ5A 1VCNA 2GBLA 1D6JA 1OH7A 1NNEA 1XCGB 2RGNA 1E9DA 4EPTA 1GL6A 2A9KA 1XBTA 1Z8FA 1ANKA 2QTVB 4QL3A 5DYIA 1EWQA 4FMDF 1XNJA 3R9XA 2FOLA 3LO5A 4OHYA 4DCVA 1JBKA 3VNUA 3QKSA 4US1R 3D6TB 2CNWA 4G5SA 2C95A 3OAAA 3PUYA 4G5QA 4LHVA 4ZO4A 4TZ0A 3ZQJA 4Z1MA 4C0JA 1LV7A 4HATA 2FA9A 1Z3IX 2G1JA 2AKYA 3MCAA 4HYYA 4P4SA 5CYPA 5TB5A 4LI0A 2O8CA 2UVQA 2IYQA 2A5GA 3AF0A 2VPPA 3KUCA 3LRPA 4D2IA 4YMUA 4X8MA 1KI9A 2ZYVX 5DYGA 2F9MA 3B9PA 2VSXA 4F4CA 3KDSE 3I32A 5GJBA 4PC2A 2IW3A 1QF9A 3V00A 4GOXA 3QVVA 5CDFA 2F3TA 4HI0E 5EE9A 3IHLA 3E1SA 2ZITA 1E1QD 1WCV1 2VSFA 1E2JA 2BMFA 2VTKA 3FMOB 5AJZA 4MRPA 2NO0A 4PO1A 1W0KD 2IEYA 1RRFA 2ZTSA 3K0CA 4DKXA 3TR5A 2ZROA 2YOGA 1NN0A 3U44B 1U81A 4HB4A 2PEZA 4D26A 2VHUA 3SE0A 1AZSC 1KKMA 1S2MA 4LPKA 1XTQA 1IBRA 1AQUA 3KKPA 3EC2A 4IDOA 2WKPA 2ZR7A 4F93B 2A5YB 4LWZA 4B2LA 3GEEA 3K0SA 4KU4A 1BYIA 5EQTA 4DIEA 4B34A 2R6AA 4R2HA 3VKGA 3AVWA 4A2QA 2FGKA 3RABA 1KMHB 1AK2A 2P5SA 1DEKA 3RRMA 5JCZA 4CEJB 3EIHA 3WMEA 4IEEA 4N1AA 4TL7A 4QGFA 2J9RA 3N5CA 4EDHA 4MH0R 4R9UC 2VP2A 2GEDA 2W6IA 4XVUA 2GCPA 1KSJA 2H92A 3KJEA 2YKGA 1OH8A 1N25A 1AN0A 4BUJA 5IK2D 2NQ2C 4ASUA 2J0VA 4G5GA 1L7VC 1E79A 2GXQA 2QMOA 4MRVA 3EPHA 1R6BX 4D4JA 4JJKA 5DIFA 3BFXA 3TVTA 3AVXA 3B5JA 2Z83A 4MGYR 2IWRA 1YR6A 3AV0B 4BLSA 1E2GA 2FU5C 4TTPA 4X8LA 4HZUA 4QJ5A 2JLZA 2EFDB 2QZ4A 1F2UB 4KSBA 1J70A 5TXGA 3CO5A 5SZKB 5IF9A 3ZD7A 3CPHA 3C15C 2DBYA 4C0KA 4MRSA 1OIVA 2ZEJA 3EIEA 2XB4A 4IXMA 5CLQA 2QROA 4KFUA 4M9QA 4LYFA 1NLFA 1WDTA 4TTQA 2P6RA 3I61A 1KO4A 2Z0MA 3NBZC 4CT4B 5FPKA 4O2LA 3TMKA 1Z2AA 2MSCB 4QJ4A 1S0UA 4NDZA 4MKFA 1ZW6A 2C03A 3CB4A 5SZIA 2DHRA 1P2SA 3VX4A 1LVGA 3NHBA 2ASEA 3FHOA 3NEJA 5JJIA 3C14C 5IRCD 4UXIA 3GPLA 2IHBA 2ZRCA 2GESA 1E2DA 3VR5A 4EJSA 1ZC3A 2G77B 3KXIA
chains in the Genus database with same CATH superfamily
1L5QA 1YU9A 3NIGB 5CLHA 2QP4A 1SCIA 4YPOA 1QC5B 2R68A 4V0ME 5CK5A 1KVRA 4XWOA 1KE1A 2JIMA 1L1FA 1DAOA 2LRHA 3PPYA 5HDBB 2H8GA 3M83A 3WB2A 3R5SA 5T5QA 3THRA 3BC1A 3LC2O 1W1WA 3RRZA 4A23A 4BKOA 4J7CA 3OI7A 2X3YA 1QQ7A 2HGZA 2OGSA 3NJ8A 4BPBA 2HK8A 5COBA 3FJYA 4M9XA 4OYLA 4AS1A 2RI0A 5A3JA 4YT5A 1ULTA 1CK4A 1V6SA 4QU0A 4QDKA 4XCVA 2EGHA 3FYUB 1HDEA 4RA6A 1U8CB 4DHWA 4EIWA 1KI8A 1STOA 4DLPA 5IYZB 3QTTA 4A91A 3ISVA 1UCFA 3PDWA 1BEUB 1QCDA 1NJ5A 1TC1A 2C78A 2HMTA 1SM4A 1L1EA 2QZSA 3L8ZA 2BY4A 3UTCA 1V5IA 2EBFX 4Y6OA 1JQBA 3BVPA 2JFBA 5JDIA 5KQRA 5D3ZA 1JKJB 4JI5B 1KDOA 5ESRA 4JI4B 4J7XA 4BO8A 3BYZA 2IYFA 2KB0A 3I6YA 4KWCA 1N5RA 4XVRA 1AQ6A 2ZM6B 4C4TA 1QGZA 4AY3A 3RQIA 4FSHA 3U56A 2VYCA 3QYFA 4L0CA 4YRTA 3FSGD 3WMGA 2MSNA 1T3ZA 4JVOA 2VDUE 3BJRA 3QOYA 1MUUA 4A27A 3CUWA 4DDTA 5K2OA 1CIJA 1TF5A 1Z0KA 3A04A 3CJRA 4NL4H 1DUVG 4KODA 4OGKA 3U2QA 3E03A 1WLYA 3O4JA 3TL6A 1M6NA 3CG4A 4CLOB 4FQ8A 1U1CA 2GPYA 2WVJA 2BGLA 4LQLA 3T06B 5ITZA 3OE1A 1KQNA 3VKUA 4MRMB 1B73A 4HWOA 4TL6A 1M8JA 1QRSA 1I32A 4RH0A 4EGFA 4F38A 1ULAA 1LPSA 3K8OE 4FGWA 3K0AB 5A5EA 2G8LA 4LGVA 4JMPA 2HO4A 3BWEA 1U4SA 4F4JA 4IV5A 2I5PO 4YRLA 5FLYA 2AJDA 1C4WA 3ZU6A 4AYXA 1V1MA 4R8MA 1HORA 4M21A 1RAAA 4DBZA 4WKGA 5LIPA 2XUPA 1UDWA 3CNOA 4FHCA 1UOQA 5C1PA 1LJLA 2P6OA 3ZV5A 4JL5A 4LJYA 1GGJA 1RJFA 1XRQA 3BA6A 3LUFA 2WZDA 1TGVA 4FE7A 1ESMA 2JEOA 4LV6A 3IBYA 4OHXA 4H0NA 5EKDA 4E5NA 5JZ9A 3G7NA 3HUDA 4LRUA 1CUZA 4AMYA 1GNQA 3UV7A 2R8YA 1M6HA 3GHYA 4X3PA 2XVYA 1Z45A 5JAUA 4DEYA 3HXTA 2FI1A 3BHIA 1FFSA 2PCJA 3NNDA 1QE5A 1NZFA 1X77A 3BFJA 3PWKA 4PC3A 5TMPA 1WZNA 1JF8A 3SYRA 1E0JA 2FWRA 3PWZA 2ZDGA 5HRUA 1XWIA 3NDIA 4HWTA 1T8RA 3CBQA 4IINA 2W43A 3V4OA 2HCJB 3I83A 3UMFA 1Y3IA 4KN9S 4JKOA 2VDQB 1OCEA 3RBZA 1NV8A 4EA9A 5JU6A 1C8LA 1ODLA 1LZKA 4LXUA 5AJWA 1QRDA 3O92A 3W7VA 2UYHA 1ZM3A 5F21A 1GM5A 2BHNA 5H3LA 1DIAA 2IDMA 2WMDA 3CW8X 2P5TB 3WGNA 3Q15C 1FMLA 1QHGA 4WOPA 4D42A 4KQ9A 1JPUA 4LZNA 3L0ZA 4QUIA 3L8YA 5C4GB 4BNDA 4RTSA 2COUA 4GGPA 3IO5A 5DBIA 2X0FA 2H63A 3UUGA 1QHEA 1A97A 2AWOA 2VTVA 4RKRA 4JLMA 4QDTA 2X0JA 3HV2A 4IXNA 5M5BA 2IY8A 1DRUA 3NNSA 5LIRA 2V7XA 2GHTA 1COWA 3ED1A 5BWMA 3AHFA 3DBRB 5DNAA 4HQKA 1LF5A 3QWBA 1KZHA 2IT1A 1WNTA 3R5TA 2GN2A 2OXCA 4PLTA 3FXAA 3AR8A 2O2IA 6REQB 5CEJA 1XTBA 1E7QA 3ODPA 1PE0A 1QHFA 4CI0B 1TQDA 3UXYA 1AX9A 4AICA 5KDDA 5EJGA 4MGHA 3NOQA 4UNPA 2ZRGA 5K3EA 2OEPA 1UDCA 1M1XB 4Q18A 1LLCA 1CUHA 1KMCA 1XEWX 2YJ4A 1MO2A 3OCXA 1EJ2A 2C96A 4K9LA 4LIPD 4NJOA 2HA0A 1N7IA 2JK1A 4LHYA 4NEGA 4V0KA 2QYOA 1VPLA 4QO8A 2XADA 3HVJA 4FDVA 5KCMA 4MLDA 1LWOA 4TRMA 4YUXA 3LQ1A 1WXFA 1KK3A 3VKHA 2TMGA 3KHUA 4HYEA 5IANA 2IY9A 3Q0IA 2GJ4A 3RU2A 1N0HA 3E9RA 4ZZ3A 1EBFA 1CUWA 3F8TA 2Q1SA 3KEFA 4QOEA 2O8FA 3UH0A 3JQ9A 1A9SA 5L51A 1KY3A 1E98A 2FUEA 2G63A 2VL7A 1BFUA 1GZ4A 1ORVA 2IZ0A 4DCSA 1ZR2A 3HEMA 3MILA 1WKVA 1TYCA 2XWSA 2J3LA 3Q2KA 4L76A 5B4TA 3IDFA 1L7PA 1MNAA 4XQ0A 1KS2A 5KQMA 4GKVA 1RHKA 5EKXA 1QH8B 2OG2A 3Q7RA 4PCAA 4A15A 4C4YA 4PX3A 2ATIA 3NM6B 2XUHA 2RGRA 1G16A 4HQOA 4M1MA 1PR6A 3R3ZA 1ZX1A 1RXIA 3RH0A 2ZJ0A 1DDIA 2BMAA 4WGFA 2BEUB 2OORA 4A5SA 3AF6A 3H6HA 1YQ9A 4HVCA 3G0HA 1AG9A 1NVXQ 4S2EA 1YDFA 2RGUA 3NZEA 5C5CA 4BQOA 2WLSA 4IO1A 3SPXA 1OXBB 2CNOA 1QVRA 2YJ3A 5LQMA 4X1YA 5CLLA 2O0JA 3DJYA 5FQOA 3R8FA 1G20A 4XFKA 5KYUA 1J2YA 4P81A 2BI8A 2G9QA 1XR3A 1U3CA 3KE9A 1NBMD 1W88B 3HBJA 1BDJA 3BE4A 1BSVA 1NJSA 3IPAA 3BCSA 3QEJA 2EDCA 2RGXA 3SS8A 1RKVA 5LZ9A 1X19A 2PX2A 5EUQB 2QT9A 1Q3KA 5P21A 3HWX1 2H8KA 5SY4A 4XSGA 4NH4A 3ZWXA 3WNDA 3V4SA 4L22A 3OLVA 3ZBTA 3H5TA 4WNIA 2Z1DA 3O3CA 2YR0A 4I81A 3DLHA 1JQDA 3QNWA 3T9BA 2YXLA 1NF2A 3SU8A 4GMDA 1CY6A 4XUEA 2AJCA 3X1ZA 2AZMA 3L3BA 3SQWA 4DPMA 3RNOA 2R47A 4PZLA 5FULA 1FQJA 1BU5A 1K08A 1KSFX 1F1BA 5EQDA 5GONA 2X9NA 2J5BA 4EFKA 2QN6A 2WB4A 4G89A 4HH0A 4UATA 1O6ZA 3PHCA 3WWPA 2IK8A 2BGIA 1HNZB 4DM4A 1G38A 1Z82A 4C0XA 1SJ9A 1ZMTA 2DFNA 3DDUA 1U7HA 2H7XA 1CUYA 1BKSB 3LHKA 4XUCA 3MJVA 3P94A 521PA 3PJGA 5CBPB 1YQGA 4MS1A 5BORA 3MLBA 3AEQB 2FCRA 4RANA 4UTPA 2JANA 5FYDA 2G4CA 1QP4A 1Y48E 4GAEA 1M1NA 3G8AA 2C1XA 3HABA 1WD7A 4E2FA 1F3OA 3R7WB 3LCVB 1G5QA 4FFRA 1F8FA 2PM8A 1X6VA 2CB0A 3EOBI 4L5CA 1J8QA 2AG0A 4AL4A 4ARZB 5B7NA 4QU9A 4JVLA 2AYXA 1VG0B 4J1QA 5E3IA 3ZD6A 1E1NA 1SQFA 1MRZA 2OQRA 2WHEA 4UBOA 4WZBB 3BJEA 4IQFA 1SZCA 1TE2A 3VV3A 4WOCA 1JLRA 3GOQA 3WMFA 3SCZA 3GQVA 2M9MA 2XIJA 1IQUA 2I7DA 4RIHA 4BWVA 1EZZA 3R77A 3OUTA 2Z1NA 1JHUA 1DAMA 1JWBB 4PFQA 2OESA 2QX4A 4R8SA 1V8PA 3LX4A 1HYQA 3LOQA 2VKQA 3MOGA 1VHTA 1ZI6A 1M7GA 4JB3A 1Y3DE 1XTZA 4RX1A 2ZYHA 3FSRA 4FW9A 2G76A 4LZZA 3N0VA 3WYDA 1L5KA 3JQPA 4XGIA 2AN9A 3PKJA 1E1RD 1X8JA 1AUOA 1CPYA 2EG5A 2NV2B 3FJ1A 3GLSA 4BNLA 3WL7A 1SIOA 4D5EA 1MQAA 5FEMA 3EFOB 1E63A 3H75A 4X00A 5I8WA 2ZR8A 2RAUA 4EL0A 3A4MA 4NOJA 1KDYA 3G5TA 4P35A 1A5BB 3TTTA 5C31A 4RM2A 1ARZA 2P4UA 2BEKA 1SUAA 4QOSA 4KWIA 2RK6A 1RQ7A 3EN0A 3JAKB 1T34A 4TMKA 3I5YA 5BSWA 2EKQA 3EEIA 4XB1A 4XE5A 1RBQA 2QD5A 1EVKA 3A6GA 3AR2A 2X4DA 1K6MA 3VKWA 3C3XA 3L4EA 4RKEA 1E5VA 2CLEB 2OQIA 3SIXA 2HW8A 4K87A 4MROA 2Z3ZA 1WB6A 2FZWA 1S7CA 1CBUA 1R8QA 2XI4A 1PQUA 3WLHA 4DDVA 4Y7CA 1U2RA 1X1RA 4YUZA 1HWYA 3AOGA 1BZYA 3CE9A 3FD8A 1UKZA 5ALHA 1SXJE 1C9DB 1N0UA 2D3TA 2HSZA 4MITA 3RVBA 3U7QB 1AMNA 4TLLB 1Y3AA 1XMPA 1UKYA 4O5OA 3TW8B 4ZHQB 1MHPA 4JCCA 1Y6ZA 4MEJA 2OECA 2Q1WA 4XZ3A 4A2CA 3P9CA 4B73A 5IFKA 3MWJA 1GVHA 2N9UA 1DPFA 1YVDA 5E7QA 1JV2B 2R62A 4D79A 1E2QA 1YGPA 4M9ZA 3PJRA 2FOXA 1MRSA 2JLBA 2OOSA 2EZ9A 4X20A 2Q49A 1GY8A 1ENYA 2PFKA 3GRRA 4B48A 4XDZA 5AW3A 1Z75A 1FYDA 3OX3A 4FCTA 2VDJA 2MCFA 3TM4A 1RVDA 1W94A 3Q10A 3O4HA 1VCMA 2HWXA 3SF8B 3R8XA 4FHEA 3JATB 5TQ2B 1PJ8A 3COPA 2V0NA 1AK9A 2PPLA 2V7GA 3JQGB 4PPFA 1QKIA 2QUAA 1YI0A 4NF2A 4F92B 4B3RB 3CIFA 2PZBA 3IBGA 1XX6A 4UZEA 3TLJA 2WYVA 4PCVA 3LUCA 3EIFA 4ENUA 1N6PA 4XWTA 3BG5A 3FHCB 4ZQEA 4QGHA 2Q7DA 5EZYA 3K9CA 1LDYA 4BRUA 2FZVA 3O90A 4ND5A 4UCQA 4D96A 1TK2A 2W00A 3H2ZA 3V1UA 5BWCA 2D8AA 2RHGB 3GJXC 3WV5A 4E09A 4ZZ0A 2VIIA 2V65A 1VB5A 1V4BA 3NJRA 2Q4TA 1R74A 3AESA 1FOEB 1X80B 3K6SA 2QBYB 3TOSA 1HSZA 3HVRA 1K9SA 1QIEA 2OILA 3ZV7A 2NO7A 5LZ5A 1NNI1 2WYIA 2R8EA 2YMQA 4PNPA 3JVEA 4MKGA 3OCYA 5JO9A 4BJHB 3FOZA 5D2CA 8GPBA 1HNNA 1XZCA 1XLVA 3M9WA 4ZEWA 1KEVA 4JSRA 1A9TA 3A6LA 3WRXC 5ALIA 1OBCA 4EX7A 1W76A 1P4HA 1FP2A 1UZUA 5AVRA 2FG7C 2WZCA 5EHZA 4I1SA 3ZJVA 1ZESA 2GA9A 4FOPA 5LZ8A 1VMIA 1OLSB 4RJTA 5AI5A 1TO6A 4KGDA 4B6GA 1QE3A 1GKIA 3T3GA 3OTQA 4CQLB 4FX2A 1N57A 1T36B 2DWCA 3B3QA 4TZ6A 1H4SA 1E18A 3NXSA 1E1KA 3DHYA 4IXTA 1ONSA 1ZOOA 1O95A 1JHAA 1LKZA 3Q6NA 4UAVA 3CLTD 4X41A 3WGVA 3EBOA 2EC5A 1P2VA 1H05A 3DM9B 2P8JA 4DLSA 3CTMA 3EUAA 1TNDA 3H2JA 3M4JA 3PCTA 4MS4A 1DJMA 5CM9C 1XRLA 1GGKA 4UMDA 1QC5A 2CK3A 1YL7A 2OB1A 1ZOPA 2IYOA 3ODGA 1QVWA 2CEAA 4WUTA 5H4HA 4B3DA 3F98A 5IKEA 3OUZA 4V1CI 3FLEA 2CVPA 1J22A 3OPXA 1LU9A 5FOUA 4LGMA 2C2KA 4HFMA 2JIDA 1G3IA 1NONA 3FWNA 3OEED 1XFDA 5LA6A 5HTOA 4F7DA 3TTXA 2R6ZA 4MA5A 4OHBA 2ZSJA 2FZ4A 3A1SA 3DWGA 5K0JA 3FYUA 4DLAA 2P75A 2WT4A 5H8WA 2FV8A 5IYZA 4KR3A 5F9MA 3FWPA 2UZAA 3IILA 1DO8A 4H08A 1NW4A 2E4UA 2OZLB 4TOIA 1W4RA 5A4MS 1NWCA 4MVJP 4Q47A 3WKBA 3KSBC 3TB6A 3TPZA 4R51A 2PMBA 3LQ2A 2H1RA 2WY2D 1AN9A 3P0EA 1JKJA 4LNHA 3HNPA 1Z06A 1SHJA 3INNA 1MC1A 2GZ1A 4GEKA 4RF5A 2BGNA 2DE0X 4LGYA 5FWAA 4I5GA 4CT5A 5BNZA 3HBLA 2F4NA 4MKRA 1X70A 3DZHA 2VQEB 1DUSA 1W25A 2YY7A 3QUQA 4GLFA 4YRFA 3OM8A 3PQDA 3TRJA 2G72A 1RXEA 2VP3A 4S2UA 1NU6A 3EPPA 2WWWA 1YB4A 4MYTA 3DE3X 3QI7A 3UA4A 2A3RA 2QI9C 2C98A 3E7WA 3WL4A 3WZLA 3IKMB 1MDBA 1SA0B 4WZZA 1NI4B 3BIFA 2R85A 5FUBA 1PP4A 3CURA 1XI2A 3BMQB 4O2AF 4PSKA 4R98A 1JDPA 3GPBA 4ZI5A 4B3BA 2HD4A 1W9MA 3I8SA 2GM4A 7MHTA 1XAGA 2Y8EA 2WJIA 4YAEA 4GE3A 1E0DA 5AH0A 1EVJA 1P0MA 2OCXA 3O5AA 3NV7A 3PIIA 2AD1A 2HXSA 4U3JB 5IJZA 4YMIA 1U31A 4FK8A 1YQWA 5AXBA 3F3YA 3IDOA 3K0AA 1EVZA 1N0VC 4PZPA 1OILA 3VYVA 3OZSA 1KVQA 5HBGA 2V9ZA 5FTLA 5IBCA 1GUAA 4IIJB 1R9NA 5EPEA 5JXHA 3LZDA 1U3WA 3O4RA 4LDAA 4ENWA 3K53A 3THWB 1HUQA 1R6DA 1RS0A 3HI6A 4RS3A 3ZXUB 4CKWB 2WWIA 2G07A 4NYJQ 3CVXA 4L5BA 4QKQA 1DRKA 1L7EA 5SICE 2VRNA 5LJIA 3DWFA 3QKWA 4BO5A 2EIHA 1GRCA 3A6DA 4JHLA 4O25A 1ZM4A 2VAVA 1V6AA 3QG1A 4YBZA 4DWOA 4AY2A 3E5HA 5CIQA 3MBIA 1OGJA 4PHHA 3N0TA 2WT9A 4BXOB 1C7QA 3E23A 3HADA 1WF3A 3N6RA 4GWLA 3KKKA 1WQ3A 4L5YA 4L75A 3VU9B 3ZQKA 2ZYWX 5KTOA 1SFRA 2PYDA 4HUQB 1J0EA 2QLBA 4N12A 2QL6A 1IUPA 2PGJA 4C22A 1JQEA 2HJVA 5JC1A 3NX4A 3RHZA 4FYHA 4DREA 4LF9B 2MMGA 1RJGA 4CCWA 3OTWA 4UEJA 3TXAA 4ZJPA 1ULBA 1K7YA 2QLNA 2DFDA 2WJVA 4KV7A 4WECA 4Y2SA 2JGIA 2V4ZA 1BJRE 2D7DA 3IV7A 3WTCA 2VWPA 3W04A 2ZETA 1V11B 4C6HA 1WCXA 4R1NA 4RMIA 1ZJJA 4PYQA 4MV9A 4NYMQ 3HXMA 1DTSA 1NPTO 3MCVA 1II9A 3JV7A 4PZUA 2QIPA 1ZD9A 3SKXA 3UHPA 1U0FA 1TCCA 4RBNA 1RQGA 3DOEA 1Y9DA 3DBRA 1T6BY 1RZVA 2R79A 3M1YA 6REQA 4R31A 2VP4A 4A0QA 3OZGA 4YDQA 4M7OA 3TQQA 4HVTA 5AKLA 2ZUBA 3JPWA 1JSZA 1W5EA 2BR3A 1GADO 1KDVA 2R1ZA 5ARDA 2JEYA 3HJBA 2GXUA 1FMFA 5A0FA 3V34A 1DC6A 1XMJA 2ZJOA 4AB1A 4C0QC 4M89A 3LOUA 3VAZA 3KT6A 3AFMA 3PYXA 1Q7EA 1LTQA 2JFNA 2QORA 1U0JA 4OKIA 4ER0A 4YCNA 1EBBA 3OM9A 2Q9AA 2IXTA 5CA0F 2WNIA 4YJ3B 4JUFA 4DOMA 4AY4A 3IKLA 3DUWA 5IKPA 1UEXC 3A9UA 1TAQA 4TT3D 2GZAA 5EXEA 2WIDA 4K3VA 3V8NA 5LQKA 3SK0A 3HJNA 2F90A 3QEKA 4C4RA 3E53A 3CH4B 3GEDA 3E05A 1TU3A 5ADWA 1UXJA 1G8GA 4FN5A 1IJFA 1BRMA 4KITB 2FH5B 5AKHA 2CVOA 5KSZA 3FY4A 3I1YA 4ZEMA 3N0XA 1X15A 2XCUA 5KHLB 2LP4Y 2NT3A 4ABTA 1BQEA 4GBMA 1SHTX 3MF4A 3MINB 4I3FA 1D03A 1OX6A 1JHQA 4ZVTA 2JA2A 5AI9A 1QH8A 1GXSB 4XGNA 2EZ8A 2O57A 3UYLA 1A27A 5EAIA 4LJ9A 3AF1A 3PVSA 4R1PA 1PR5A 2Z4RA 2R4QA 4UARA 5HUJA 4J49A 3KT0A 3TNFA 4MGKR 2PGAA 4L1KA 4PYRA 3OE4A 2O2HA 4D6YA 2BEUA 2PWBA 1L4NA 5I51A 4QTUB 1YS2X 2DC1A 1JIIA 4MQUA 4TRJA 1KKUA 2PLFA 4Q4LA 2VWHA 3S28A 4HDAA 5AKJA 5F4ZA 3W05A 3PRYA 2H7YA 3I04A 4M3NA 1L4YA 1HMYA 4RQTA 3G68A 3GUZA 3OOEA 2E6KA 1GLNA 1BFKA 1E3IA 2ZBEA 4YRQA 3PUXA 3QPBA 5F33A 1T3TA 1W88A 2OV1A 5DT2A 3WHKA 4LFBB 4LJ8A 4E11A 3QHAA 2OLJA 3LW7A 4REQB 5G2OA 4F3KA 3FPSA 3O47A 2O7NA 5LQJA 4BEVA 1DAKA 3VMMA 3B3GA 3P9SA 4WD3A 3H2HA 2I3AA 4L02A 1NKVA 2OL4A 2VJOA 4NMMA 5AO9A 1AIPA 4Q34A 4B79A 4EM6A 5L3QB 4S04A 4ZQGA 5LPNA 2NZYA 1S3FA 1H8HA 4GECA 4JC4A 3SAJA 4BX0A 3RIYA 4YAOA 2BELA 1Y1TA 2EAUA 2N75A 2FLVA 3OM0A 4IWNA 2V8OA 5DNVA 5EKSA 3C3DA 4IMJB 1UMDA 1HEUA 4DIKA 1FX1A 2H7CA 3KJGA 4B3GA 3D4BA 4M76B 5IC6A 3M5PA 1HE8B 3HZRA 1ZEJA 3DR3A 2P67A 1FSFA 3BXGA 3TCKA 4AJEA 2Y9PB 4BNMA 1LFAA 4MWSA 3ELBA 3NHFA 2FE1A 3IJPA 4JASB 1PX0A 1P1IA 1MPTA 1TX4B 3QU7A 5H9VA 1V39A 2R3SA 2WSSD 4P34A 5TT1A 4UOEA 5C52B 2JLXA 3WL8A 4C5AA 3SM3A 5JY1A 2EU8A 5KHAA 1YQDA 2LXNA 5BOVA 4AG3A 4HT3B 4MYRA 4C0SA 2UAGA 1QIHA 3AK4A 3W3ZB 3LPNA 1QE0A 1RLTA 4R68A 1DC7A 4GP6A 3TL3A 2NZWA 2VPIA 3CPSA 1SC6A 4HDQB 3VQTA 2J3DA 2QY9A 1ZM2A 3AEQA 3RIHA 1ZOSA 1CS4C 2YIVX 1JTEA 2E87A 1XD8A 3RGWS 4JYAB 1P2UA 4ITRC 1CRQA 3CLRC 3HKDB 3M34A 3R7WA 4ZMBA 3ITNA 2GMWA 5DYTA 3FW1A 2GI4A 4MO2A 2VKTA 1A88A 2B7CA 1C9JA 1KYYA 1XQVA 1NVVR 3G2OA 3I01M 1NR1A 4M55A 4PYOA 1K06A 4TS1A 4ARZA 4P3OA 4KXNA 3AJEA 4ZO9A 2XE8A 5J2UF 2Z2XA 3ZCVA 3EAGA 3TD2A 4MVWA 3AEUB 1Q0QA 1T2AA 2R00C 4NZ9A 1BH6A 4WZBA 2XZOA 4PFKA 4IG4A 4CIYA 1M6EX 3OOHA 5F3DA 1O6CA 1K92A 4K2HA 3U40A 1YZHA 4X7MA 1NVGA 2WBLC 4YMGA 3LUDA 5D8DA 3FH0A 3RTEA 2OT3B 2OPBA 4KTTE 2HV9A 4IIHA 4ZZ1A 3GROA 4XYEA 1X7HA 2HK6A 4HYQA 4ZAGA 3IHWA 2G5GX 5GP1A 2B0JA 4MVJM 4EP1A 1K97A 3GHHA 3L6OO 1JLHA 2Z43A 5JBIA 3A7DA 3ZWVA 2ZIEA 3ZGZA 3L0OA 4XDHA 4D4IA 3NHAA 5TARA 4F4HA 2FEWB 2QAIA 1U9IA 1XV5A 2XDYA 3EFOA 3GRCA 4QJBA 5DEOA 4YRBA 3ESYA 2YFQA 1IK6A 2QTWB 2ZRPA 3TBKA 4AMBA 4RACA 5E9JA 2QD3A 2C3UA 2AUTA 1I0IA 4NZOA 1QGOA 5KEIA 4L9SA 4IRUB 1CJSA 1IEQA 3LZCA 4ON9A 4UM8B 5DBFA 2DR3A 1F06A 3DMPA 1LB1B 4C0WA 4PPNA 4YRDA 3JAKA 4FINA 1UP4A 1G8SA 2P35A 3D8NA 3GLFB 1NQVA 1EHCA 2H6EA 3C97A 4OXYA 2W6ID 1NVDA 3ITDA 1G8FA 2QTHA 2F8LA 2X8WA 2ZOSA 3CGWA 5IG2A 1DXHA 1Y6RA 2BFFA 4FR2A 5HKAA 2XD4A 1IC6A 1HDOA 2YYZA 4ASUD 4DLBA 4AP5A 5JSFA 4DCPA 4L4YA 2ZE7A 2GF0A 3GDFA 4JYMA 4MLCA 5ER9A 4FS3A 3ZIAA 2VHVA 1TTTA 2HIMA 3AL0C 2QX6A 2JHCA 4FFVA 4BCCA 1VMAA 4IUYA 1W59A 2P9EA 1Z88A 1ZK1A 3C45A 4G6ZA 2ZYTX 3UUFA 2XMSA 3EIOA 1CZLA 1QPBA 1U9YA 2AE1A 2HQOA 4PBTA 5GOZA 3U7QA 1GRVA 1N1EA 3ONWA 3NCTA 3TW8A 4ZHQA 3HP1A 4P22A 4EVIA 1JSRA 2G88A 2P5YA 1GSOA 1RI2A 1QB8A 3QUBA 4EG4A 4OBEA 3V7NA 3UCXA 2AL7A 5J47A 4P92A 1JNYA 2EW2A 2Q21A 2WA1A 1VSBA 2O5VA 5DXFA 5B1YA 3GDGA 1KEZA 2JFPA 5AR1A 3LUBA 5AM3A 2J9FB 3FLBA 4RE5A 3T0GA 2D74A 4NDNE 1PKXA 2WJWA 5H83A 3B1WA 5A3VA 5ARCA 3F5SA 3SF8A 3JATA 1TJ4A 4LC9A 4X3OA 5TQ2A 4QASA 3BAFA 3RUDA 1TUIA 3JQGA 2I7TA 3L18A 5HP4A 1ENZA 1EDDA 3P9PA 4KE7A 4Q1EA 4MMZB 3RHFA 5CDFE 2NMVA 3F1KA 5AK4A 4EQZA 1OXKB 2NO9A 4HNVA 5JS1A 2C2HA 1RAEA 2QTAA 3AI7A 1NF3A 5C7IO 3ZHUA 5KPDA 4OIFA 1SD2A 2FPKA 3PPVA 4TTVA 4UPDA 4DJTA 2C99A 2HNBA 1Z63A 2VF8A 1M7BA 3KZ1E 4BGUA 4ABYA 1VGVA 2Q99A 3R5KA 2CV0A 3O83A 4O4IF 3OZBA 3T3MB 3OVMA 3AF4A 4Q9HA 4FLFA 3CLVA 1X80A 4H3KB 2QBYA 2C2ZA 2Q3LA 3A3PA 4OD0A 4QOJA 3E2IA 2NZJA 5E0OA 2J0EA 3NBUA 4BQIA 2JF0A 2YN4A 4Y2YA 2RHRA 1IDOA 2R84A 1CQJB 1JB1A 2B83A 4KIJA 4BKUA 3K5PA 1I24A 2C7RA 2FPXA 3HLKA 2B2NA 2OY0A 3B38A 1FJ2A 1YFKA 4RK1A 3TNDA 4R0MA 3STUA 4P5DA 5DF1A 1G2IA 4BU0A 4DEVA 4JXJA 1OE0A 5BQFA 5KNDD 2NVOA 1QUEA 4IQ0A 1MB3A 4ZQHA 3BQNB 5JXWA 4KI0A 2J3JA 4UASA 4R2WA 3MEQA 1OLSA 5EJ9A 3JRWA 3FUCA 5BYBA 2O2GA 4Z8XA 4MVXA 3TIXB 5LQNA 4LDRA 5KNBH 1TVEA 1PT5A 4CQLA 1ZQ9A 3PDIB 4K9NA 3IPRA 1T36A 5IAEA 5DNUA 5DLDA 3GZTB 1UJ6A 4W5HA 2CV1A 1IQ0A 3SDZA 2VQFB 3KSMA 4YFVA 4A6DA 4DMHA 2CNNA 2XHEA 2ZDQA 3B8EA 1L5YA 5CVDA 4DRZA 2W93A 2YDYA 5KTSA 3U37A 4X1IB 2ZREA 3WK7A 5EJ5A 3OBIA 4P5PA 3DEAA 2YZ2A 3PQEA 1J1UA 2XQGA 3R3VA 1D2HA 4Y98A 5SYAA 3LM8A 3ZZTA 1NKTA 1EHIA 4N5DA 2WF6A 1IM2A 2IZZA 3ND8A 3FGZA 4RF2A 2D0OB 3AIIA 1RI3A 3JASB 3Q7SA 4GM1A 3HDQA 5BSMA 1I4WA 2P27A 3AR9A 4RIEA 4E21A 3P0JA 4FOSA 4NJMB 1U0TA 2N1MA 3ETGA 2IXBA 4UJ3A 4A36A 1ENOA 5HMLA 2AOVA 2XCLA 1OPXA 3PNSA 2GK4A 5K20A 4BN4A 1UBJS 4R7GA 2FZEA 5CW2A 4QNRA 2AA3A 1R0WA 1R4NB 4KLRA 3E1GA 4OCZA 4BJ3A 1UDXA 1ZH6A 2Q3MA 4DJJA 2L19A 4TXHA 2VYQA 3M1IA 4NESA 2WZQA 4ZAXA 4EVSA 1DBSA 1MHTA 1N2IA 2B21A 1MP0A 4AX4A 5I45A 2JDID 2CXSA 5F3RA 3BH0A 2ST1A 1Q21A 4BMOB 2QJOA 3P0HA 5DTQA 3JQ7B 5ITSA 4NAUA 1LNSA 4UTVA 1C8KA 2PL1A 2RD2A 3B13B 5IWAB 1Y8ZA 2NZ8A 2PT5A 4JBWA 5E95A 3VR2A 1TCAA 2PWPA 3D64A 2VA8A 3CCBA 4IVPA 4PO9A 3A11A 5TS2A 3UYKA 4D4LA 5CH3A 4CMJA 5HOEA 5CCXA 2QLJA 4WKNA 4HL6A 1E2PA 2FPOA 4RZSA 4CG2A 1CUCA 1HM5A 2EQBA 2QW1A 1UJNA 2XKJE 3IEIA 1SA0A 1L9XA 2CBXA 3GUCA 1PJ3A 1NI4A 3O7WA 4A16A 5EWMB 2G80A 4YRZA 3WGKA 3ZLBA 4OGGA 4C6TB 1VZ2A 2FDXA 3BMQA 4C7JA 1WZUA 1YJCA 1DKMA 1E3TA 4E5PA 3I42A 5TVGA 3SP1A 4WEOA 4HVAA 2CF6A 1XZPA 1KWKA 1CRWG 1YZGA 5AFSA 2ZRJA 1UQUA 2B92A 4U3JA 3WYAA 4J9VA 2ZGVA 1KPGA 3IT2A 3QWAA 4URHA 3LPAA 4Z53A 3FHJA 2UYOA 2E4XA 1XWWA 1JHDA 1DRJA 1CP3A 4GWKA 1IZ8A 4IIJA 3ULKA 3O75A 3O7MA 5ALXA 4Q3DA 4LYDA 5E6SB 4CBVA 2GZRA 3G02A 4Q82A 5DPMA 1BX0A 3BL5A 1ZM7A 1O89A 3DOFA 2NSYA 1D1QA 1P1CA 3MTQA 4KK4A 3THWA 3H2BA 3OMWA 5DCYA 3GLVA 1KY2A 3OPNA 4JIMA 4CKWA 3L92A 3TLGB 1CQZA 3PFGA 1E96A 1ZG3A 7ADHA 1IATA 4UCXA 1YRWA 3GT4A 1Z7EA 1G64A 1SU7A 5J4LA 5HGXA 3L7LA 1R0RE 4IY1A 1E5TA 1XQYA 3TIFA 5J4YA 4JLSA 2G9VA 3LC0A 4IDPA 1NYQA 4IGEA 4UZSA 5FJIA 4B82A 3F96A 4PZ0A 4IZ6A 1DV1A 4Z49A 4I1RA 3D6AA 4BXOA 1R66A 2O7RA 4WCFB 1HT3A 2CZCA 3OE5A 1E66A 3VU9A 1XTSA 4E12A 2Q3BA 1CX9B 1II8B 1EUDA 4CCAA 4MK4A 4HUQA 1F6BA 3GN1A 2IOFA 3TBFA 4D0NA 2WNSA 2ZQZA 1SD5A 1GNVA 1DDOA 3D8HA 1MVLA 3EXIB 3P2KA 3LKZA 5KQPA 3R40A 1RPJA 2IODA 3GAMA 3QE0A 1IHYA 1BX3A 4C21A 1U2SA 2BMDA 1Q7RA 3MRXA 5KTYA 2W2QA 1BOOA 1BVUA 4ZJZA 1L7BA 3AL2A 1XNQB 1ZRMA 3LXMA 3T1OA 2DX7A 3BRWA 3VZPA 5ES4B 4K6FA 4TYNA 1Q2XA 1FDVA 4IEIA 1MVOA 4WRRA 4AZ3B 4EY5A 1V6CA 2GD2A 1V11A 2QVGA 3MGCA 4TMWA 5IZCA 1YKFA 3GH3A 3UJ9A 1UPTA 2H1CA 1JRLA 3EAFA 2BTEA 1CFZA 2VJCA 3G2LA 4L3OA 1G21B 4PY2A 1XZQA 4LVUA 4FHZA 3K4QA 3VR6H 5B2ZA 1C9EA 2IE8A 1NN5A 1W48A 4R4JA 1G4UR 3ZWWA 2UU9B 3LKBA 3PEUA 5EL0A 1XD2B 5KU7A 4DIDA 2OK8A 3N2LA 3EODA 3O03A 3MUFA 3T7KA 4C7VA 1QHSA 1GWNA 2FX5A 4ZDWA 1VC2A 4E03A 1I4DD 1Z0AA 1QLWA 1WF6A 3MIIA 1K8RA 1XTPA 4XOIA 5DBGA 3C4QA 1K0FA 1NP3A 4LN1A 4P7BA 2JHAA 1H2RS 1ZH8A 2I4IA 3AP2A 5AI6A 3BWBA 2BM9A 1VCIA 1SUDA 1FFCA 4MYUA 4QBIA 2JASA 3ZN2A 2FP4B 5BUSA 4F6RA 1LF0A 3BH7A 4YJ3A 3PPWA 4BO0A 4BOYA 5BWNA 1D9ZA 4HX2A 3H19A 4QJ3A 1DKUA 4HK4A 3GFFA 5CB4F 4ZKEA 1W0CA 1SKAA 1VIVA 2GN1A 2IF2A 3IP6A 3CRRA 2A9JA 5A0TA 1NF9A 3F7TA 3P45A 1KQFA 2M6RA 2Y76A 4B47A 2AFHB 4F3TA 1JDBB 2O8VA 3H1EA 2EWVA 4JQCA 5G1OA 3MAGA 4ZCPA 4RZHA 2PZ8A 2VSNA 2WG2A 3LVQE 3L8GA 5IPFA 1OFGA 4B6PA 2QRVB 3VTAA 2OBLA 4FVTA 2VNAA 2B98A 2A1UB 3MINA 4MVJG 3K9BA 2OFFA 3NUQA 3T99A 2GDJA 1XMIA 3QBTA 3QY0A 3ZWCA 3H2YA 1GXSA 2JBHA 1T2CA 2CLHB 2EARA 3VR4A 3EXEB 4D46A 1XAHA 1ZAYA 3QLVA 3X2EA 1D5WA 3FOFC 5CPFA 1Z2PX 1PN3A 4XYMA 2AHOA 5I9NA 4AY6A 2RC5A 5DULA 5I7VA 1GRRA 3U6KA 3CH7A 4HQ0A 2HRDA 3AR6A 1PGJA 3TIGA 4DGQA 1DBVO 5LDDC 2BUAA 1OI4A 3TE7A 3TS1A 4A6PA 1ZGZA 3WR5A 2EZUA 1B14A 2NTVA 2I9PA 3HBFA 4LYHA 5IT5A 2A0UA 4JLKA 1SKBA 2ZSKA 1VKJA 3DVRX 3L82B 1I2DA 3VSBA 1HLDA 1JA1A 1T91A 1RMQA 3I5UA 4YROA 4RHEA 1N2XA 4ARAA 1I7NA 2J5RA 4A4DA 4REQA 3IPYA 3S2GA 1L7RA 3LHFA 2OK7A 3KB2A 1IZZA 4RD4A 1M6YA 2VYFA 2WM8A 3C3YA 3LQRA 1QZ3A 4YJDA 2XWQA 4CMAA 4M0UA 3HHPA 5A4JA 5IFLA 5L3QA 2BBWA 3RYCB 1H5UA 1WVIA 1OQAA 2GCIA 5IHPA 3QV1A 1LRKA 3C3KA 4CF5A 2XAAA 3ET5A 4QFCA 4H1TA 1L7DA 3S1SA 4U7TB 1NOKA 5EXSA 4BN0A 3C48A 5AHWA 5TMBA 4DA4A 1UMBB 1A5TA 3FCXA 2IEZA 3M49A 4OQQA 4E1VA 1FUUA 2KBFA 2KQUA 5A9TA 3O3OB 2L18A 1DOAA 3ND6A 2JGDB 1Z38A 1VRVA 1YMVA 4GX0A 4Q3EA 5DHUA 1EDBA 1F8GA 4EUHA 2BRUC 1AKQA 3HO8A 2VNIA 3PDHA 5FRDA 2Z98A 2IZ6A 2D1FA 4RESA 5LYYA 3RFXA 3S8EA 3ST7A 2IU0A 5EN4A 2PBLA 3D7LA 1Y80A 2DGDA 3RYHB 2YBEA 4F04A 2POQX 4MWDA 4QE3A 3GJ4A 4UDXX 4D0LB 3RU7A 3FDFA