1JI0A

Crystal structure analysis of the abc transporter from thermotoga maritima
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
MVSDIVLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVINRMGIALVPEGRRIFPELTVYENLMMGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGEQQMLAIGRALMSRPKLLMMDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYGYVLETGQIVLEGKASELLDNEMVRKAYLGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0 A Crystal Structure of ABC Transporter from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords ABC transporter
total genus 62
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2001-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ji0A00
4LBZA 2JA1A 3Q72A 2AL7A 3NKVA 4N0EA 3OEHA 4QNRA 1NBMA 2H92A 2R6AA 4LJ4A 3RWOA 4FMDB 1YE8A 2WICA 1XXHB 4BPBA 2DHRA 1CJVC 2FFBA 4LJ5A 4PX9A 4QM7A 4JLVA 1SVMA 1ZCAA 2X8AA 2OLJA 3AVTA 1M1YE 4CW7A 3CPHA 1P9RA 2ODWA 4GBMA 3U4QA 1K5GA 2V6IA 2QTHA 4PHGA 4Q9KA 1QHSA 4LHYA 4JLOA 4NYMR 3LX5A 4JVNA 4UNQA 2G1KA 2E9SA 1JBKA 3HU2A 1JR6A 1M6NA 3EARA 1AQYA 1J7KA 1TUEA 5L3RA 4XSGA 5B30A 2D7DA 3N5CA 3PG5A 4MRVA 2OBLA 1T3LA 5F98A 2QN6A 4II7A 3PCRB 2BJVA 2O8FB 4L5BA 2D06A 1T3HA 2B8WA 3JVUA 3QXCA 4Q00A 5AUNB 2NTYC 5KTYA 4B35A 1US8B 1E2JA 4HZUB 4TMXA 2WKQA 1DO2A 2UVQA 4Q47A 3ZVMA 3C15C 2HYIC 2HLDA 3AF2A 4NKRA 2VP2A 3G0HA 5G41A 3QXSA 4QG7A 4YMTA 3H4MA 5DHFA 2OCAA 2V3CC 4V02A 4BFSA 1S2MA 2YJTD 4A15A 1XEFA 5FUWA 1GNQA 1JR3D 3QKRA 4FMCB 2XZLA 2JGNA 4X8LA 3IIJA 4BFUA 4GOXA 3BOSA 1Q1EA 1QG4A 5DYGA 1G8HA 1UBCA 1G5RA 4MYTA 1ESNA 1CKEA 1S9DA 4XVQA 1Z08A 1EXMA 3TW4A 3CLVA 1VIYA 4DIDA 2EFCB 1ZM2A 1P5ZB 1TQDA 3ZQ6A 4B2PA 4DLRA 5E95A 3BFKA 3TUJC 2PEZA 4BLTA 1ZM7A 4XIGS 3EXAA 1XPRA 3OZXA 2IK8A 2V1XA 3FVQA 1IY0A 1UPTA 2IS1A 1R0WA 1G9XA 4A92A 2G0TA 1OIWA 4DDUA 5CK4A 3FFBA 2WM9B 1JEEA 3AQ4A 3WP0A 1CRQA 2VYFA 1KI9A 1OPXA 1WMSA 2TMKA 2O8DA 8OHMA 2RCNA 1EFCA 1MABA 2ZYTX 3C8UA 1YJ5A 5EQTA 4Q5IA 5GJVC 1G1MA 3QI2A 3R9WA 4EJSA 2CL0X 1KSFX 2KBEA 4C30A 1CJMA 3X1DA 3LBHA 1G7SA 4TYPA 4QM6A 1P75A 1XTJA 4I4LA 1NMZA 4V0MA 1MO5A 3J81k 2QPOA 1E9RA 2WV9A 4EPYA 3UXMA 1EFTA 2WWGA 4MGZR 4M9QA 5E3HA 4TYQA 5GJWC 3EC1A 4M1YA 4RFSB 2ZR0A 4LZZA 4MKGA 4JLAA 4LHWA 4P31A 4ZDKA 4AG5A 1FPMA 1QHHA 3H1TA 1OH5A 1T0JB 2ZRPA 5HZHA 5DN6A 5K8LA 1FP7A 3QPUA 2XXAA 4BFTA 1KK0A 2FU5C 3T15A 5GADl 1AS3A 3T1OA 1SXJA 1G18A 2JATA 3F5FA 3Q5DA 1XTIA 1W5SA 3QSYA 3DKPA 3Q5EA 3SQXA 1S9HA 1RRGA 2JDID 3NXSA 4M1MA 3NBFA 2NO9A 4HI0E 4L8GA 3MWLA 1M2OB 3SOPA 4GOKA 5SZIA 1ZD8A 2IS4A 3KUDA 2ZYWX 2BKEA 5KSYA 2YWGA 4MGIR 1ZNXA 2Q9AA 3R9XA 3DM5A 3X1YA 4OK5A 2XB4A 2O0JA 3ASYA 4TTQA 5CK5A 4QXAA 2DWPA 1N6NA 3VTKA 2GBLA 2YYZA 3KB1A 1Q22A 1L4UA 1XEXA 3AB3A 1G41A 1WQ1R 5EXSA 1ONBA 2QORA 1E1RD 1MH1A 2CJWA 2ZI5A 4RCYA 4ESHA 2HYDA 3AF3A 4B48A 1KNQA 1C4OA 1EK0A 3LQRA 1I4TD 4DC9A 2IS6A 3WHKA 2IYRA 1L2TA 3K0CA 4JJZA 4BLQA 1Q3HA 2XAUA 3D7MA 1N5IA 3FHTA 2HT6A 2ORIA 2EFDB 3BERA 2PLFA 2AK3A 2JIZA 3QENA 2X1VA 2IYWA 3W8RA 2ZI7A 1JQLB 1GAJA 4B3XA 3T34A 1CJUC 3SE0A 1MRNA 5JHHB 1CF4A 2ASEA 4WZBE 3FE2A 1JALA 1DAFA 1N6HA 2RGAA 1ZYUA 1DO0A 2H1LA 2XX3A 1FNMA 1CR1A 2EQBA 4FMBB 1Z0FA 4LWZA 1G20E 2GJ9A 4JLPA 4G0NA 3SFVA 3TJZA 2A5JA 4ZCLA 3B13B 4O3MA 2WOOA 2F9MA 1K6MA 2WJYA 1KI2A 1U8YA 2IT1A 4RZXA 2VP5A 2O8BB 5HPYB 3C14C 5KYKA 2BMEA 521PA 4DLZA 2OFXA 1D2NA 2IYUA 4OI4A 4IOKA 4JVMA 1II8B 1KK2A 2JJ1D 5J4KA 1XD8A 1FL9A 2RKOA 2WVJA 3L0PA 2DYKA 3T06B 2VBCA 4C2TA 4UKDA 2IEZA 5F9FA 1IJFA 2I1QA 4NE2A 2GXUA 2D3WA 4HSEA 1VCMA 4QJ4A 4QGHA 3AUXA 1N0VC 2PL3A 3TAUA 2GZHA 2BHRA 3WHLA 3EASA 3DZ8A 2BMFA 4Q1AA 1LVGA 5HE9A 5LDDC 2O8CA 4IRUB 4WIAA 3BJIC 4HAWA 4DDWA 3EPLA 5DI3B 1I2MA 4Q1BA 2QMUA 4PO8A 2B21A 1KNXA 2WKRA 2ZRLA 4LV6A 2OSBA 3AEZA 5HE8A 1KI3A 3K1JA 5FBVB 3B9PA 2FFHA 2P2LA 1MV5A 2KI5A 4WZAE 5LD2C 3P4XA 4HDCA 1GKIA 4NDZA 4BLRA 3OIUA 1LTQA 3RABA 4EQ6A 4QL3A 2WAYA 2QA5A 2QEQA 4US1R 3SHWA 2GILA 3NWJA 1QBKC 1A82A 3W9YA 2W0MA 1WCV1 3QUSA 4JLJA 2Z4SA 1XWIA 4OHXA 4GDFA 1NVUQ 4OHWA 3S1AB 2WSSA 4RD2A 3EIQA 4ERNA 4TMZA 1MT0A 5JLJA 2OT3B 5H8WA 3GJ5A 1G8YA 2RAPA 2OFWA 2W2TA 3K9NA 4HUQB 4OQXA 1OXVA 1O3YA 3RC8A 3L82B 2FJUA 1ZW6A 2REXB 4H9GA 1FTSA 1D9XA 3VX3A 1BMFA 1E9AA 1KGDA 1W0JA 3K09A 4FD2A 1M8PA 1P7CA 2WWHA 4EPWA 2XJ4A 1ZU4A 2BBOA 1G8GA 2IWRA 1FFHA 1YR7A 1YRAA 3THOA 2MMGA 2QRZA 2IYZA 4M9XA 5JBQA 3I1FA 4CT5A 2C9YA 4ZKEA 3AVXA 2AFIE 1UKYA 2DWQA 2JLUA 2QGZA 2ZE7A 4FI3C 4C0HA 4DUGD 2ZREA 1E96A 1Q44A 2EFEB 1E99A 4Z1MD 3UATA 1E9FA 4TYNA 4B73A 1KO5A 2NIPA 2QQ0A 4HAUA 5TB5A 4Z51A 3H84A 1KKLA 1N2CE 2WJHA 2XSZA 1EG7A 2J0UB 4KVAA 1KSJA 3KXLA 5FI1B 1SXJC 4DLWA 3BIFA 5FUVA 1XU4A 2ODEA 3SR0A 4IVRA 3UWOA 1NIPA 5TY0A 2O0HA 4LDJA 1M34E 4M1TA 1TUIA 3O8DA 2C2HA 5JS7A 4TLEA 5DI9A 2NZ8A 3H2YA 2EFGA 2QPAA 2IYYA 1IXRC 3TIFA 1ZBDA 2G77B 4AYXA 1E2IA 1XMJA 1UBFA 4G3XA 4LJ7A 1HH4A 5IK2D 4P3YA 4Q48A 1NY5A 1BIFA 4TQAA 4AYWA 1D8TA 2WSMA 4QNMA 3IPXA 1SVSA 3AP1A 2ECKA 4Q4AB 3X1XA 3CRW1 2PX0A 3AM1A 2GJAA 2FG5A 3EG5A 3CWQA 5FI0B 5EE5B 3ZVLA 4V0NA 1XXHE 3PQCA 2VHJA 5FH9A 2QE7A 1U98A 2F7SA 2WKPA 2V8OA 3IEUA 3K9LA 4OKSA 2J59A 1NVXQ 3CX6A 3B2EA 3WBKA 2HJGA 3RNLA 1D5CA 2D2FA 2AWOA 1R0YA 2FOLA 2QSZA 4KXFB 5GVSA 3TUZC 4WAUA 3TLXA 4ILEA 3MD0A 4Q9JA 1F5NA 1X8LA 3GJ6A 1RFLA 1JXOA 4I1VA 3TR5A 1ZRHA 1VG8A 2JJ2D 2NO7A 2Q3FA 3CPEA 4V0ME 2W58A 1GNPA 4AIIA 2YOGA 1XJCA 4QGAA 2PZGA 4OYHA 3U6KA 2NG1A 4OK6A 3DHWC 3QVUA 3GMTA 4Q7JB 3ICEA 1AS0A 1C9KA 3EC2A 3OEED 4TQUS 3RRNA 1N6IA 2ZU6A 1KSHA 4URWR 2ZRGA 4B74A 1EESA 2OAQ1 2ZJ2A 1U94A 4LPKA 4CYMA 1NP6A 3GLFE 2IUUA 4IDHA 3F8TA 2GCOB 4F4IA 1N0UA 3SYKA 4C0KA 1NG9A 2P3SA 3OEHD 2L0XA 3IQXA 4HAVA 2REBA 1J2JA 1M7HA 2ZR7A 4LYHA 3BH0A 3V4FA 1U8ZA 4ZKDA 3QXJA 1FOEB 1NJGA 4DUGA 1U0JA 1AZTA 2F6RA 3EZ2A 3GQBA 4M1WA 2C78A 4A9AA 4R98A 1KDTA 1P60A 3UK6A 4BFYA 4MRPA 3UANA 5L3SA 2BWJA 3LVQE 2VP9A 1Q1BA 4Z8XA 1EWRA 3QXHA 2WWIA 1XBTA 4TT3A 2FA9A 3HP1A 4DDTA 1DARA 1YHNA 4QRHA 3P26A 4YDSA 4QJ5A 1OXXK 1OT3A 1TQ6A 3BAFA 1NF3A 2ZJYA 5FPSA 2O8BA 2EW1A 3AF0A 4DB2A 5HR5A 1AGPA 1HT2E 3QKRB 4JMPA 1W46A 2VHCA 3GD7A 1AGRA 1D9ZA 1SVOA 2ZUBA 4ARZB 1W4CA 4PAOA 2CVFA 4ASUD 1BYIA 3A58B 3VR6A 4W7SA 5P21A 2FPMA 4LHVA 1CU1A 3K9GA 4DCUA 4LYAA 1N6RA 2HXYA 4EQ6B 4Q9IA 1RC8A 1YR6A 5IF9A 1ZUNB 1T91A 4P4SB 1Z6XA 4Z54A 3I8SA 4D25A 1R8QA 2I1VB 1P73A 2H18A 4KLZA 5EE9A 1SKQA 4URUR 1TX4B 3QY0A 3ADBA 1KK1A 4KYIB 1AKYA 2FGJA 3AF1A 3EZFA 3NEJA 2CCGA 2WBLC 4RKFA 4B3FX 2CE7A 5EZ6B 1RJ9A 2O0KA 2RGNA 2YVUA 1ZUIA 4DBLC 4DLYA 1WB9A 1AKEA 2IC5A 2O5VA 3B1XA 3ZS8A 2N42A 4AI6A 3ASZA 1NN0A 2LCFA 5LD2B 1NN1A 2W83A 3VR5A 2QP3A 3NVAA 4EDHA 3LD9A 1W0JD 3DO6A 1Z6AA 1G7RA 2CBZA 5CIWA 1LS1A 1VDZA 1XXHA 2GHIA 4NYMQ 2AHOA 3KX2A 4HB3A 5FR2A 4B33A 1U9IA 3V00A 2CDNA 1ZIPA 5DO9A 1DAEA 5CIQA 2MMCA 3KQUA 2KSQA 2PZEA 2VLIA 3CONA 4BUJA 4HDQB 3TMKA 3PJRA 5A5GA 1KMHA 4P33A 4NTZA 4UJ5A 1KI6B 4LYFA 4TMWA 2O52A 4GP7A 3A1UA 3GFPA 1T9HA 3B6EA 4YDHB 2VP0A 4IW3B 3KQKA 4XD7A 3CF6R 1U9IC 2FGKA 5L3QB 3W90A 1MOZA 2QP9X 3DMNA 3MUFA 1U90A 1W4AA 3UMFA 4MRRA 2D4HA 3UG6A 2GEUA 2OCYC 3O8BA 4M4SA 5JZVA 2BEKA 4NCHA 2B6HA 1VYTA 3Q7QA 2PMKA 4A1FA 2HCJB 5SZHB 3BB3A 1PUIA 3PEYA 1WF3A 5F2EA 1UEIA 4DEYA 1ZNYA 2HEIA 2EU8A 4TTPA 3CNNA 2J5XA 1U8AA 2OM2A 3IGFA 4PANA 5AJWA 2F1HA 5EP2A 3LQQA 3BFVA 1OIXA 4TLBA 4YMWA 2VHQA 4HZIA 1EGAA 2YWFA 2BEJA 5CDFE 3OFND 5K8IA 4HYYA 2A7QA 1RE0A 5AJYA 3EPJA 5C4MA 5FBWB 1E2GA 1KO8A 1VCOA 4HLUC 1YZTA 1UM8A 4OQLA 2ZI4A 2CE2X 1E79A 2ERYA 4KV9A 4O25A 1XTRA 1EWQA 4KODA 3RWMB 1OXTA 2G83A 2GJ8A 1T4GA 1SGWA 4BZQA 3HPQA 1RYFA 2XZPA 2C96A 2OCBA 5FTLA 1R7RA 1QHHB 1XTSA 2PX3A 2VSFA 4HEJA 4DCNA 1R5BA 1LNZA 1GVNB 4M1KA 4DHEA 1Q3TA 3GJ4A 1OFTA 1IAQA 2J9RA 621PA 5KDOA 3DOFA 4DCSA 1LB1B 2NO0A 2R44A 1WRBA 3MG9A 3THYA 3U3RA 4N3NA 5EXXA 4AG6A 4XVUA 4XH9B 1H8EA 2EVWX 4EIWA 2P65A 2DPXA 4HLQB 1BYUA 5ELXA 3T5GA 1HY3A 2CK3D 1Z6YA 4TMVA 3GFTA 4I1UA 1Z07A 2K5UA 2RMKA 5C2JB 3TQFA 3K0SA 3LNCA 3LXRA 1Y3AA 1N0WA 3MFYA 1F60A 1VG9B 1UKZA 2Z0MA 4K8OA 1Z5ZA 2PLRA 3PR1A 1E9SA 5EP4A 1W36B 3LBIA 2FDCA 1G7CA 1M7BA 1XX6A 3C7KA 3FTQA 2O8DB 1HUQA 2ZJAA 2ZYVX 3EIEA 3VX4A 3AVVA 4MKFA 1VIAA 1IBRA 3K0FA 2QAGB 1Z6GA 3LAWA 4HLDA 2VP6A 5JI2E 4R71A 4A36A 3BD9A 4BASA 3TE6A 4A8JB 3QVVA 1ELOA 5L3SB 4QBHA 2GBLC 1G17A 3FHOA 4D26A 2QMOA 3WYFA 1GDDA 2JJ2A 3VHXA 4HAXA 1W48A 3TNFA 3BH7A 1FQKA 2G0NA 2GK6A 3NBXX 3ND8A 4IEEA 2ZIAA 3E5HA 1EFRD 5B64A 4JYBA 1R10A 3KTAB 3THXA 1CJTC 1NVWQ 1V43A 1Z0DA 2PCJA 2W2XA 2ZI9A 1KIMA 2GKSA 3K0CC 2C04A 1Z22A 3EWSA 3U60B 3PUWA 1HA3A 1LY1A 4M53A 1GSIA 1UKEA 5F9HA 1VYUA 2ZRNA 1WDTA 1R5NA 4NHOA 2ONJA 4BFZA 4Z1MA 2GXSA 2V1UA 1GILA 4W5HA 4OJKA 3THWB 3OESA 2BDTA 2V7QD 4HZUA 5TXGA 4M21A 5EXPA 2XSZD 4B6EA 3CNLA 4FW9A 4PSKA 1YZNA 4Z8YA 4FCWA 1Z2AA 2ZRCA 1Z28A 3LFUA 4RY2A 3CH5A 3BS4A 2J7KA 5CJPA 4DLVA 5J4HA 4UQOA 3A4NA 3B1ZA 1NLYA 2AXPA 3SU8A 3I8XA 2R6FA 3D8BA 3L43A 5E7JA 4TLDA 4PC6A 2HDNB 3SJBA 2BKUA 4CT4B 4OJQA 1ZC3A 5AUQA 3DL0A 3HR8A 5IK2A 1ZIOA 1OYWA 2GZAA 3TH5A 1NN5A 4EPVA 2IXEA 1LW7A 1DELA 1P2UA 2VPPA 3UMRA 4IOJA 1P62B 5FL7D 1RW4A 2Q3HA 2IF0A 3BH6A 3I3SR 4WBSA 4ZCIA 5EZ5A 3NDPA 2QENA 1B23P 3NC1C 5H68A 1X86B 2PCLA 4OI1A 2ZAMA 1XD2B 4BECA 1X8JA 2HJVA 2ZI3A 3NBZC 4OHZA 2ZE6A 5J4LA 4ZIRB 1E9BA 2Q9BA 3ZQJA 2WWYA 3IQWA 3I92A 4M22A 2OV2A 1R0XA 3UG7A 2QUZA 1CEEA 2BCJQ 2EYQA 3KQNA 4B34A 3T1QA 3GJ8A 1VMAA 4IDNA 4MA4A 4IDQA 2ZRKA 3EZ9A 3X2SA 3CX7A 2R9VA 4EKDA 2QGNA 1DG3A 1Q21A 2ZETA 3CKLA 1IY1A 2XNDA 2ZYUX 1KI8A 4FCTA 2R65A 2J0UA 1R6BX 3IIMA 4QBGB 5DISB 3ZD6A 5K8UA 4AY2A 3LXXA 2BVNA 4MKIA 3SYLA 5HZKA 2PH1A 1S96A 2ZITA 1Z2CA 4LJ8A 1DADA 4ACBA 2A5YB 4B43A 1OB5A 1Z3IX 2P5SA 3N70A 1E9DA 4N1AA 1LF5A 2NPIA 2FEOA 3A1TA 1BO6A 1HTWA 4WXPA 1I4DD 1COWD 3X1WA 1KY3A 5BN4A 1G4AE 2MSCB 3R7WA 3T1VA 3VU9A 3ZZ0A 4JJKA 1UAAA 5JS8A 1VECA 1E79D 2E87A 2PJRA 3LDAA 5CYOA 2RGNC 1G3UA 1XJQA 1ETUA 3KJHA 1COWA 1II0A 2OBNA 2QAGC 2EWWA 2G3YA 3K70C 1A2KC 4TMKA 2HCBA 4UNRA 3WXMA 2GVDC 4JL6A 1KI6A 2GNOA 2GF0A 3TVTA 2A3RA 5DYIA 5EE0A 3KKMA 1TTTA 3VKGA 1S0UA 1FQJA 3NHAA 2R6GA 4JLDA 4S35A 4A0FA 1P3JA 4MRSA 2CXXA 2QROA 2AKYA 3FOZA 4P4SA 1OIVA 1GL9B 1TQ4A 3RRZA 3S1AA 2R6CA 4JBWA 2QM8A 3U7EB 1E69A 4MRNA 1KDRA 4DLUA 4XTCS 4BFXA 2GEDA 1IN5A 3FKSD 1AM4D 5LB4A 1JXMA 1QHGA 3GLHB 4LBVA 4MYHA 4ARZA 3HJNA 4QBFA 3TSWA 2ZM5A 5AJVB 3ICQB 3AVYA 4KBFA 1DG1G 3U5ZB 5KNBA 1AN0A 2A2ZA 2C99A 2LKCA 2JLQA 4NYIR 1T5IA 1LS6A 2RGCA 2GCOA 4C4PA 1CR2A 2R6DA 4FMCF 1JJ7A 1NKSA 3B78A 1A5TA 1G3IA 2ZJBA 2PBRA 121PA 5DI3A 1KO7A 4AKIA 4OI2A 1HQCA 4PAQA 4JLNA 2YC2C 1Z83A 1N3BA 4DCTA 3KFVA 4BZXA 3T1TA 2FZ4A 3OEEA 1E98A 1NSFA 3L8ZA 5E7MA 5BYJA 5FPKA 3E70C 4LV5B 2OXCA 3UPUA 2DFNA 3B5JA 2OZEA 4IXMA 3THWA 4AKGA 3PUXA 1JAHA 3I32A 3AKDA 5SZKB 4DSUA 5EE3A 4BWYA 3LH5A 4N0DA 4V0OA 4DSTA 5JMTA 3U7HB 5G3ZA 3FDIA 1S1CA 2ORVA 2W6JA 4NCKA 1P6XA 2OO7A 2P5TB 4HLUA 4KVGA 3CZQA 1E94E 3FMFA 1JPJA 3OHMA 1PV4A 2ZRBA 3QXXA 4C7OB 2IYVA 5CB8A 2IW3A 1S3GA 4LV8B 3CF0A 1Z6TA 4Q1EA 1FZQA 2F43A 2ZRJA 2CCJA 3GEEA 1N5JA 3AKCA 4RVCA 4AC9A 5H70A 1JEDA 1U0LA 2ZSAA 5EP3A 4C0QC 3QOFA 1HURA 4HLCA 5AK0A 3HYRA 1E2HA 4I99A 3GJ7A 2HF8A 4LHXA 4PAMA 3VKHA 1L8QA 4JVSB 3IKJA 3VR2A 4ZI3A 4XWAA 4TSFD 3QBVA 1NNEA 1FP6A 4HB4A 3QPVA 3L0SA 4DT1B 3U44A 1J70A 1S1MA 2NQ2C 2DCUA 3GFOA 4UJ3A 1OB2A 2ZS8A 4BLPA 4PZYA 3ZIAD 2DB3A 2DFTA 3M1IA 3P27A 4DSNA 2JLWA 1HEIA 2QBYA 1QRAA 5JCZA 4Q9HA 5C46F 2Q0HA 5EUQB 4I1SA 4KSBA 3TBKA 1OHHA 4IOMA 2IYLD 3LLUA 821PA 5E4FA 2OBMA 2PZFA 4KYUA 2IBMA 3AKYA 3CRMA 1SXJD 1K8RA 2CEAA 2NO6A 4CZ2A 2WHXA 5AJXA 4IEIA 1OFUX 2ZXUA 3TW8B 3T12A 5CB6A 4UXIA 5C4GB 1RVDA 3SQWA 1IN4A 1N6KA 3D3QA 2ZSBA 1FTNA 2YV5A 4A4DA 3VKWA 2RHMA 1E0AA 4D82A 4NYJR 3PFIA 3R8CA 2Q21A 4F91B 2ZI6A 2GJSA 3MWYW 1XTQA 5F3WB 2VH5R 2J87A 2ZS7A 4LC1A 3UMSA 3I62A 4HB2A 3BFXA 4OL0A 1G5TA 2ZSEA 2O8EB 4Q1CA 1VTKA 3PEWA 4AD8A 4FMDF 2V54A 5JHGB 2QG6A 5J40A 5JJKA 2A9KA 4B3DA 1N25A 3U3MA 2RB4A 1UFQA 2DFKB 1BMFD 3KJIA 1QHXA 4QGGA 3H0KA 1IN6A 4H1VA 2QSYA 5A4JA 2F3TA 2F3RA 3A8TA 1SKYB 2H8KA 2VTKA 1EFUA 2JLSA 3FKQA 2KE5A 3W34A 3PUYA 3VQTA 4KFSA 3VR4A 4GNKA 2KWIA 3K70B 3MCAA 1JPNA 1CBUA 4OQNA 3ZVNA 2KBFA 4TL7A 2DWOA 2GCPA 4BFVA 4ZV4A 4M8NE 4LX0A 2F9LA 4LI0A 1A7JA 2KB0A 4B3BA 3ZD7A 2C03A 5HKKD 4PC2A 3M0EA 2C9OA 3A1WA 2P6RA 2P6NA 4LJAA 1T5LA 4TLCA 2GJKA 1ZCBA 2PT5A 2ZUCA 3CUEF 3EW9A 2J0SA 1NI3A 3IEVA 4A0RA 1WBBA 1KI7A 3SYNA 1G4UR 3AGPA 1MO6A 3U44B 3DM9B 4XOIA 4GMDA 1CULC 3ADDA 1CLUA 4DLSA 1U99A 2AFHE 5HKKA 4KLNA 3N2IA 2OLKA 3W6OA 3K09C 4BGDA 5GVRA 3U3KA 3MGCA 3RDPA 1X8KA 3SBDA 1KYIA 2OG2A 1IXSB 4B2IA 4E03A 5EJEA 2UZIR 4D80A 2AX4A 3I5XA 3MSXA 4NONA 3D31A 1ZNZA 1GNRA 5BYKA 1I2DA 3PITA 3ND9A 4HUTA 3U6BA 3GLGA 2KJQA 2PJZA 3QPWA 1H8ED 3QF4A 4PC1A 1KKMA 4IVPA 4KFRA 1GITA 1XMIA 2NO1A 4M0LA 5UKDA 3SHFA 2WAXA 4Q03A 5FPYA 2J1LA 1L4YA 1F2UB 1RYHA 2FSFA 4NPHA 4DZZA 5AUOB 2ZJ5A 3VNVA 4KSCA 2AXNA 2YZ2A 5GJCA 1OE0A 2SHKA 4D2IA 2ZJOA 4B44A 1OFHA 1XB2A 2VQSA 2O8FA 1N5LA 3QG5A 4MYCA 2QRNA 3B60A 4RD1A 3QF4B 2BBSA 5FOTA 5JEEA 4PZLA 1IM2A 2F43B 3TQCA 3OIVA 2XJ9A 4A6PA 2W6JD 3GLGB 1NMYA 3SFZA 4HUQA 5BXQC 3FB4A 2XZOA 1F2TB 1UBEA 2XITA 2W00A 1YR9A 3LV8A 3Q3JB 4W9MC 4RJLA 4FXPA 2ZRIA 3FMIA 4IDOA 1W1WA 421PA 2H5EA 1TU3A 1IN7A 2XTZA 3E1SA 2IWHA 2OCPA 3GLHA 3RS5A 4GFDA 3B1VA 3KXKA 3MRSA 2OUKA 4LBYA 2ZR9A 2CVHA 4L4UA 1P9WA 1XEXB 2OHFA 3DZDA 1M74A 2YKGA 3AKEA 1XCPA 2WWWA 2ZRFA 3CM0A 4HDOB 4PSVA 4DRZA 1JQJC 2ZRMA 3CNOA 3W3ZB 1W5TA 3ETLA 5BN5A 3L2OB 3CF2A 2YOHA 2GTPA 2IXFA 4B71A 4US0R 4TT3D 2ERXA 3OF5A 2V55B 2XB2A 1SVKA 1W2HA 3K53A 1E4VA 2CCKA 1XPOA 3GJ0A 4F7WA 1RKBA 1VG0B 1G8PA 3A1VA 3RSLA 1QHIA 4BLSA 3QF7A 5G53C 3R8FA 4DEXA 1E2NA 4DJTA 5JECA 4WW0A 2CNWD 5JJLA 4POAA 4JSTA 2JLRA 2AK2A 4R2IA 2J3EA 3QIAA 1MR3F 1GUAA 5EUMA 4P4TA 1W4BA 2WWXA 4CVNA 4C2UA 3TSZA 4DSOA 2V9PA 1RIFA 2BM0A 1E3MA 4ZCMA 1OH7A 4XWOA 1G3QA 3CH4B 3O47A 5KHOC 2JLXA 1XF9A 1AS2A 1AZSC 4NCNA 4RD6A 1PJRA 5IDVA 5FL3A 1KZ7B 3NEYA 1BS1A 2J41A 3K8YA 5KSOA 4TL8A 1XZQA 2HLDD 5L3VA 2ODBA 1FMLA 4KBGA 5CM8B 1GP2A 1VCNA 2LKDA 5IRCD 1ZAKA 2Z43A 2C9CA 3I5YA 3WYAA 2VHTA 5GJBA 3BC1A 4YMUA 2BJWA 2CHVA 4Q7KA 1P4SA 5JCPA 3P4YA 4CEJA 5DNYB 4G5GA 4Q4HB 3NHBA 3IUYA 2OESA 4IVQA 4JKIA 1D2MA 1XCGB 4OK3A 4LJYA 3WBJA 1HE8B 2J7PA 4PHFA 1LV7A 2ATXA 1H65A 1Z0AA 3OIYA 2ZVPX 3B85A 2HXSA 4EPXA 2VP4A 1EFRA 3FYHA 4NU0A 4BFWA 5BN3A 1XD9A 3QEOA 4LY6A 5KPJA 3SEAA 2ANCA 3DKVA 4PC7A 2WJGA 1DAKA 2QPTA 3HPRA 4L9WA 3NBYC 2BM1A 5G3YA 2ZVQX 3LLMA 1RRPA 4FCVA 1YZKA 1IOZA 1ESMA 1L7VC 1QVRA 3OE7D 3SS8A 4A82A 4BZPA 4XWKA 1TL7C 1Z0IA 1JR3E 3AP2A 4TZ0A 1FUUA 1Z8FA 1R8SA 4C0BA 2UZ3A 3PEUA 4R9UC 1CP2A 3EPKA 1XFAA 5DIFA 1NBME 2QT1A 1OFIA 3AH8A 1XZPA 2ZRDA 3NDBB 3KTAA 3THXB 1P61B 3QKUA 2ZUDA 1US8A 1MRSA 4TL9A 4NH0A 1XD2A 1E9CA 4JLBA 1G291 3QQ5A 2DBYA 3I61A 4QJ3A 1TU4A 1R0ZA 2ZANA 4F92B 2W6IA 3AVOA 2IYXA 5TV2A 1NG1A 3ADCA 3AUYA 3IDQA 1E1QD 4FWTA 3FGNA 3W6NA 3GJ3A 3PUZA 2JASA 4AKHA 4DT1A 1ZVQA 3K0FB 4D4KA 5J47A 4IOLA 1SULA 1EFHA 3U3OA 5DGXA 1PVOA 4IDPA 4PXAA 1ZD1A 1ODFA 3X1ZA 4BE7B 4BEBA 3DMDA 4LGMA 3WMEA 4B75A 2JDIA 1OJLA 3ZS9A 2VSXA 2JLVA 1XRJA 4F4JA 2DR3A 4GRAA 1NVVQ 3FWYA 4PPFA 4QFMA 2GXQA 4JVLA 3GLIB 3TVDA 2JCSA 5KSZA 4RFVA 2FH5B 4V0LA 2BCGY 3CIOA 4R2HA 4CEIA 3RS0A 2VF7A 3PV0A 3CRVA 4PO9A 5JWOA 2WJVA 3THYB 1GRRA 2IYTA 2CLCX 4ITRC 3K0EA 3L0IB 4UXHA 1MABB 1DOAA 1E2LA 5IT5A 3AP3A 1KJZA 2BC9A 1Z06A 3BK7A 4NZYA 3V4RA 4M9SA 3DVLA 4NCIA 5B2ZA 1W7AA 4NP6A 2IYQA 4WA7A 3ONWA 2RGXA 1VYVA 2GETA 3VR1A 1J8MF 2G6BA 2C95A 2GVZC 3IILA 5TDHA 1DTSA 2GWHA 4LJ9A 5FBRB 3JVVA 3LA6A 4JSYA 4KITB 2QTVB 1YZLA 1T6NA 2CLDX 2FNAA 4PQYA 4UNNA 1CRPA 3KKNA 3QEJA 3KKPA 2MSEB 1CXZA 1NVVR 3BGWA 1TF7A 3A6PC 1E0SA 4U00A 2QAGA 4GMXA 5AJZA 4AURA 5HCIA 4LK2A 1DAHA 2ZSDA 3KJEA 5EXTA 3BB1A 1UDWA 4QHTA 2AD5A 5G40A 4OHVA 2GAAA 4IJMA 2W0SA 2YOFA 3ZDQA 1UEJA 2FSIA 1SVIA 2N46A 2ZJ8A 2DFLA 2GAOA 3TR0A 3U3JA 1E2FA 4OQMA 2J0VA 2NMVA 2D2EA 3W8NA 4B3GA 4IKEA 4QHYA 4G5QA 4LRWA 3SC3A 3WY9A 3CB4A 4URZR 1DE0A 4RD0A 2VRWA 1XP8A 3NG1A 3B8HA 2ANBA 2ZROA 1U0HC 3AVUA 3SJAA 4X8OA 2GESA 4TL6A 1SKYE 4MYUA 5FBQB 1CR4A 4IFBA 2AR7A 1VG1A 2Q6TA 2C8VA 4G01B 4RD3A 6Q21A 2GRJA 3WNBA 3ZYCA 4Q66C 3U4QB 1XTKA 1G6HA 3EX7C 1X1RA 2A5GA 4EPTA 1DBSA 3GJXC 3MJRA 1BH2A 3IBYA 3PIRA 4Y0AA 4ZO4A 2A30A 3TKLA 4A8JC 4G5RA 2B92A 3JZAA 4Q19A 1C1YA 1D6JA 1FUKA 1NLZA 2X2FA 3IHLA 2R2AA 1G19A 3KUCA 4QC2A 1RZ3A 3G82C 2YC4C 2RGGA 2JLYA 4CGZA 3GP8A 1OXUA 1XMSA 3P1JA 4CF7A 3VFDA 4ZIRA 1CS4C 2OEPA 5M04A 4X8HA 1AQUA 5FR1A 4PSAA 4MDEA 1K5DA 1YZUA 3C5CA 3GLFA 1J8YF 3MWJA 2IYSA 4KFUA 4EPRA 5KNDA 4OBEA 1W4RA 5KPDA 2C77A 2WWFA 4P4UA 4EUNA 1W0KD 1OHHD 5TARA 1NMXA 2QL6A 5LBIA 4LOAA 1QG2A 4B2LA 4JL5A 2YWEA 3E2IA 3RS7A 2AD1A 4PHTA 2WZQA 1KI1A 1KMQA 3SZRA 3KQLA 4D0GA 3I4LA 2RH5A 3EZ7A 4O2LA 1KY2A 2QMHA 2J46A 4IFEA 2IUTA 4AK9A 4G5SA 2EYUA 5KDLA 5L3QA 1VKJA 2XOKA 1D2EA 5J4VA 1MO3A 1RJ9B 1TEVA 3Q9LA 1E0JA 3B82A 3N2EA 4CEIB 4NL4H 5FOWA 2FSGA 2QY9A 3GLIA 3W6PA 1AK2A 1OXSC 2FE4A 5AR1A 4LBWA 3LX8A 4BQSA 1SQ5A 2VSOA 3PUVA 1GM5A 2VO1A 4JIMA 5DN6D 4EJSB 3KKQA 4X8MA 2IEYA 5FOVA 5BW8A 2EWVA 4GSYA 2JJ1A 5JRZA 3HWSA 3WNDA 3JZMA 2A5DA 4JS0A 4PTLA 4TN1A 1PUJA 3FPAA 1TNDA 4Y0VA 1E2MA 2Z4RA 3AF4A 3AVPA 3QKTA 3K0AB 4Q18A 5D3MB 1KO4A 2FZLA 4LUCA 3EWAA 1FW6A 1V5WA 5C1BA 1KI4A 4HB0A 1IHUA 5DSZA 4NBSA 1RRCA 1YRBA 1H8HA 1OV4A 1XMVA 4K46A 4F4CA 2VL7A 1Z0KA 1KDPA 2OAP1 1OSNA 4YXWA 2IS2A 3GLIE 5C18A 4YLGA 1ZU5A 3TAHA 2Z6VA 3LY5A 4D81A 4JLKA 1NBMD 4TLAA 5JFGA 2V7QA 5LPNA 2Z83A 3A1SA 3CX8A 1DVRA 1CJKC 1EX7A 1Q12A 3CRRA 1UJ2A 1ZJ6A 4A2PA 1JAIA 1NRJB 2FEMA 4WXRA 3RS4A 1OLOA 3BBPA 3KFXA 4Q4JB 2P6UA 3ZIAA 3KQHA 1OKKD 3T35A 2WJIA 2ZSFA 2BBWA 2OXRA 2ZE8A 2QTFA 3FMOB 4HAZA 2RHDA 4KU4A 3VHLB 3GLGE 3B7GA 2Y8EA 4BRWA 5KU1A 1M7GA 3AVQA 1E4YA 3GEHA 4B32A 1DAMA 1T3SA 4LYJA 3WMFA 2BOVA 1SZPA 1VPLA 1DPFA 1VCIA 1TPZA 2IUSA 2ZEJA 2QE7D 3A4LA 5AUPB 1P72A 1TF5A 1IQPA 4M9ZA 4YMVA 4UNSA 3I73A 4JZKA 4PO1A 5FTMA 4K81B 3U2QA 2WPDA 2F1JA 1QF9A 2FX3A 2I4IA 2YWHA 4U5XA 3ZVRA 2CL7X 1CR0A 2YNMA 4D6PA 2GF9A 2HF9A 1W0KA 1XEWY 5TVKA 4B3CA 5CITA 2QZ4A 5B57C 2ONKA 3MJHA 4OQFA 4UXJA 2YINC 3I72A 5SZJA 1W49A 1OW3B 5FUYA 4A0HA 4J0QA 1KK3A 5J4YA 1GOTA 1XPUA 2FMXA 2CLSA 2JJ8A 4WVFA 4IHQA 1G3RA 5HTKA 2WPDD 4A6XA 5TMPA 4TYWA 3C16C 3W3AA 4CEHB 4TQ9A 4TWZA 1XEWX 5KOYA 3K70D 2WJJA 2X19A 4IXNA 1P9NA 1TEXA 3KXIA 2OILA 4PQFA 5BWMA 1U2RA 2ORWA 2BBTA 1AIPA 2XTMA 3ZH9B 2GDJA 1ZINA 4L9SA 5FFMA 1PLKA 1P2SA 3DOEA 1JJVA 1SHZA 1E2EA 3BWDD 1R4AA 2IL1A 5A0FA 1AJEA 2NZJA 5CDFA 2H16A 4MGKR 1WE2A 1W47A 4BLOA 3OFNA 5JI3E 1TADA 4CEJB 5KDDA 4WZ6A 3RC3A 4YC7A 2BV3A 4Q4LA 2VHUA 4TMTA 4EFMA 1E2PA 1N6OA 2B8TA 2CMKA 4H1UA 1XJ0A 1YR8A 2QI9C 1I4LD 2FFQA 3T5DA 4C0JA 3LO5A 4Q9LA 2FFAA 3ADKA 4GOJA 5JEDA 1Q57A 5CJ2A 1QVAA 1W2GA 4KO8A 4Q4AA 2CHGA 4DDVA 1G7TA 3EA5A 1GKYA 1NY6A 3IO5A 3P32A 1TQ2A 3ZGXA 3LVRE 2G1JA 3R9IA 1A2BA 2IHBA 4I81A 1CTQA 4PC3A 2GA8A 2J45A 2H17A 4Q4HA 4V03A 2E1RA 3QKSA 1HYQA 2WSSD 2Z5FA 4MDFA 2D7CA 3HYTA 2RGDA 4GZMA 4GI7A 3C41J 3LBNA 4Q1FA 3A4MA 2CK3A 4MH0R 4DXAA 3IO3A 3OAAA 3GPLA 3CBQA 1ZM9A 4JBYA 1SXJE 3CO5A 3MWKA 1GKUB 2OE2A 3EZ6A 1E2KA 4HAYA 4ZDWA 5HCNA 2B7CA 4GP6A 4NYIQ 1W36D 1LF0A 1KAOA 3ZLJA 2WMOB 5ANRB 3RHFA 2GXAA 3RS2A 4JLMA 2QBYB 1TMKA 1DS6A 2X2EA 4C7OA 1W36C 2ZS9A 4EJSC 2A5FA 2YHSA 4RZUA 2PMDA 2ZAOA 4D0LB 4LHZA 2AN9A 4DVGA 3T61A 4RD4A 4C3ZA 3F3YA 3BE4A 4W5WA 5E7IA 2NPFA 3VR3A 3BORA 4Q4JA 1OYYA 2NOAA 1G8FA 3REFA 1HT1E 1O87A 2FPLA 3A37A 4O2RA 3KDSE 3PXGA 2QP4A 1NLFA 1PLJA 1YZQA 3ZZUA 1S3SA 1Q1ZA 3UKDA 3V9PA 3KL4A 3W5IA 3WNCA 1RRFA 4OI0A 3M4YA 1F48A 2RGBA 2QM7A 2RGEA 4KAXA 3KKOA 4L16A 4M1OA 4P32A 4DLXA 4TYYA 1F2TA 2HUPA 4CIDA 4I1OA 221PA 1YKSA 3TSOA 4XD7D 1E2QA 2J7PD 2FN4A 2WMNB 1Q0UA 4ZI2A 2N1BA 2DY1A 4KHZA 1GZSA 2GZDA 3RSOA 2O8CB 1PZNA 4F38A 1NJFA 3BXZA 3QBTA 2ZJZA 2WIAA 1WA5A 3TGPA 1E1QA 1N6PA 1R2QA 2A78A 1ANKA 3BB4A 1GFIA 1Z29A 5FTKA 3MAAC 4E09A 1F2UA 1T8UA 1GL6A 4JT4A 3QNUA 2LWIA 4A2QA 3QKSB 2FPKA 3U7GA 2FF7A 1J99A 1SVWA 2AKAB 4TTRA 4XJXA 4PZZA 3LWNA 1GG2A 4C0SA 2ZU0C 4GZLA 3EA0A 2HV8A 3IPYA 5CLLA 4D4LA 3L0OA 1GRNA 1WBDA 1ZP6A 1ZM4A 2ZRAA 1NL3A 5JWHA 1Y63A 4W5JA 2BMDA 2PT7A 4JYCA 4RSGA 1P2TA 2JAQA 1JB1A 1NIJA 2W6ID 721PA 5JSZA 4ZDIA 2X77A 1GWNA 1JNYA 4S2EA 1Q1QA 1DAGA 1KJYA 3RS3A 1KHTA 3R7WB 1KAGA 1ZM3A 1UBGA 1X3SA 2QU8A 2D74A 4GT1A 3REGA 4C9BA 5EE1A 4FWIB 3LW8A 3WRYC 1G16A 2Q3MA 2CL6X 3FFAA 3Q8XB 3TUIC 3GLFB 1AA9A 1G3MA 1II8A 1NSTA 2JIZD 5FTJA 5H1YA 3VAAA 3GCGA 3B9QA 1BOFA 3Q85A 1W44A 1GIAA 2PEYA 3SNHA 3HU3A 1OKKA 2XNSA 4XTRA 4D4MA 4TZ6A 1XCMA 1IONA 2GEVA 3WYGA 4LSGA 3SN6A 3SJCA 5K8TA 2GCNA 3NIBA 2G9NA 2IHYA 3FHCB 4PR0A 5FL7A 1KJWA 4U7DA 1S4QA 1UDXA 2CJWB 4URXR 3A36A 3VMFA 2ATVA 4LJ6A 4A0GA 1PLLA 4L15A 2XXAB 1KTVA 3R20A 4ACAA 1ZMXA 3CR8A 1ZD9A 4BEJA 4EFNA 3C5HA 2XOKD 2NGRA 4M1SA 2C98A 5CYPA 4AKEA 1KDOA 3MMPA 4GPTA 1KO1A 3F0TA 3ZZTA 3VNUA 5KSPA 3H86A 1JR3A 3LW7A 4Q7MB 4DLTA 4PPQA 3GEIA 2QT0A 1GL7A 4CDGA 1E32A 1X6VA 1RPZA 1YQTA 3QJYA 3UWKA 2IF2A 3B1YA 3RANA 4JBXA 3CR7A 4ZPXA 5FTNA 4RCZA 3CW2A 1XDBA 3RLFA 4KI0A 2EFHB 4ABYA 5CM9C 2BIFA 1F6BA 1HV8A 3C4JA 3WP1B 4JKYA 4AYTA 4JT2A 3NC0C 4EAQA 2F55A 2Q9CA 5KUTA 5BQ5A 1MKYA 5CLQA 2WIBA 3MLEA 2MSDB 2VEDA 4RFSA 5J5CA 2FSHA 2W2VA 1IY2A 5DHAA 3SJZA 2F1RA 3QE0A 5FOSA 3UIEA 1H8HD 4Q1DA 1KZGB 3SBEA 2FV8A 3BRWD 1II9A 2VF8A 2HT1A 2QNRA 2O8EA 3FKSA 1TF2A 4G5OA 4PHHA 4NCJA 1NKTA 1DEKA 4PPGA 3AGQA 4XSHA 3L8YA 5D3MA 4B47A 4DCVA 3GLHE 1E9EA 1IJEA 2QAJA 4MKHA 1N6LA 1YVDA 5D3QA 2ZPTX 4C0LA 4MGYR 4XVRA 4JL8A 1F3OA 4OHYA 5JWRA 4MUBA 2IXGA 1CIPA 1Z47A 2QQEA 4URVR 4RZ3A 3KJGA 1JECA 3ECCA 4B76A 1FNNA 1QZXA 4KFTA 5JSZB 1SHKA 4E07A 1QHYA 1OH6A 4FN5A 1B0UA 3CRQA 1UKVY 2VIIA 1YZGA 4E22A 1T0HB 4E5UA 4EFLA 3U61B 4U02A 3OAAD 2QMEA 5FOXA 1DAIA 2ZQ5A 5DLQC 5AWFC 3TRFA 4CEHA 2C5LA 3U7FB 1G64A 3FMPB 3K0AA 2FWRA 1ZC4A 4PQRA 3ZJYA 5KNCA 3EAQA 4QHSA 4F93B 2BMJA 2H7VA 3RAPR 4HATA 3K9HA 4Q02A 4UNPA 3CZPA 4YMSA 5JJIA 4QOSA 5FOUA 3KZ1E 4DKXA 3OE7A 4FIDA 1BKDR 1KOFA 1E6CA 1Q20A 4R7ZA 3RYTC 3EPHA 3O8RA 2XNDD 3NTUA 1X1SA 2B7BA 1EX6A 4GL2A 4V0KA 1QHNA 4Q7LA 1A4RA 1E1RA 4RKEA 5DE3A 1IN8A 1MO4A 2UKDA 4ZDJA 2WTUA 2V4ZA 4YQFA 4D0NA 3DDCA 4A8JA 1JI0A 5B58C 3TK1A 3M6AA 1N5KA 1GRQA 2ZTSA 5IHPA 4DIEA 1J90A 2J0QA 5FUXA 4P0TA 2CHQA 1XNJA 2XEXA 4FINA 2IX3A 4PFSA 1QDEA 1T8TA 1TAGA 1UADA 4NYJQ 1ZUHA 3G5UA 5FBLB 3HR7A 3PENA 4O0MA 3CPJB 1G6OA 4KCGA 1KSGA 4ASUA 1OH8A 5KO2A 4CRWB 1IXZA 4US2R 3DEFA 3IIKA 3HU1A 1UF9A 2ZE5A 1VHTA 2P67A 3D6TB 3DPUA 1ZNWA 4MQBA 3SDZA 2JLZA 2ZRHA 4KJZA 4TSFA 4B6FA 3HDTA 2CNWA 2R8RA 3AV0B 4QGFA 5DH9A 3EIHA 4WOPA 4YONB 2ODNA 3PEVA 1U81A 4MUAA 2XTNA 3NH9A 1HE1C 4YXWD 2I3BA 1A1VA 5LB2A 2G88A 3QG1A 4LPSA 1E2DA 1GTVA 4NMMA 4C0AC 3P20A 3RRYA 1LFDB 4G1UC 1YU9A 4Q21A 1Z63A 2OFOA 1NN3A 4AWXA 5EP1A 4BRUA 1P2VA 3PVSA 1HQYE 3W5JA 2REOA 1G21E 2WOJA 4ESVA 1WXQA 3RVBA 3WMGA 1Z0JA 2P0EA 2V6JA 1G5PA 4ON9A 3B1WA 5FPTA 2VA8A 1KMHB 3NH6A 3WRXC 3IHWA 3LRPA 4A2WA 4PPNA 2R62A 4LCBA 3AVWA 1FX0B 4QKQA 4DWJA 5L8VA 2AWNA 4M2LA 3CWZA 2F1IA 2JEOA 1SVLA 4MITA 1S8FA 4D4JA 3O8CA 3RRMA 1SXJB 2H57A 4DB4A 2IA5A 3KB2A 4Q01A 3VU9B 4QBIA 3SI7A 5FPHA 3Q7PA 1E0KA 1VHLA 1FMJA 2D62A 3OIWA 1WP9A 5JRJA 1FX0A 4RZ2A 1OF1A 1R5OA 2GK7A 4LC0A 2XGJA 3IBGA 4URYR
chains in the Genus database with same CATH superfamily
3ZGZA 3FY4A 4RA9A 1QSGA 3NKVA 1RKQA 4U2EA 3OEHA 3RIYA 1GGMA 4KN6A 2Q5LA 1MJGM 1FDVA 1P1IA 1QMPA 4CMEC 2XHEA 1OZFA 3QMPA 1KEUA 2CKMA 1WCIA 4B3JA 1QIDA 2ZSKA 1D3AA 3P2KA 2WMDA 4HDSB 6PFKA 1NUPA 2AYYA 2KW5A 3KAJA 1MW9X 2CLFB 4X95A 1GQFA 3M1YA 4OJTA 1WOMA 2KQUA 1XXHB 4B0PA 4E2ZA 4BPBA 3SBOA 4LJ5A 4PX9A 3KR0A 4JNCA 3ST7A 1SVMA 1ZCAA 3DAPA 2OLJA 2PX2A 2GARA 3N53A 2NX2A 1PQUA 2J9FB 4UMDA 2V6IA 1YA6A 4AZVA 1SCDA 1C1HA 2WJPA 1FYEA 2P9FA 3R6DA 4IYRA 4Q9KA 4LHYA 1PT7A 5H3LA 4JVNA 1TAUA 4UNQA 4Y6GB 4YAWA 1YDMA 1FU7A 2E9SA 4N41A 1RRVA 3O93A 3H11B 3HU2A 4GBGA 4J4HA 1JQ3A 4ZV7A 1VP3A 5L3RA 2D7DA 5E6RA 1CWUA 3PG5A 2JIMA 1L7RA 3QP9A 5KKAA 3ISJA 3S27A 5H9VA 4Z1OA 2BJVA 1NF2A 2J3QA 4L5BA 4LQDA 2D06A 1R16A 2H85A 5F3RA 4TTJA 5EIBC 2VHYA 1E2JA 3KT6A 3LKVA 2WKQA 4HZUB 1N2IA 2OPHA 3C15C 2ATIA 4NKRA 1AU9A 1LVUA 3L8FA 1ZN7A 2WJ6A 3NVDA 3QXSA 3H4MA 1KS2A 2JA2A 2H8GA 2WE7A 2V3CC 3DNPA 3AT1A 3OQOA 5FYDA 5C32A 2B4KA 1YFJA 1JR3D 2Q8QA 4GL4A 4C7JA 4X8LA 3ZU4A 1AOXA 1DKPA 4EK9A 1CQIA 5JCOA 4BFUA 4YV0A 3VOTA 2O07A 1U9JA 4U7TB 2XUZA 1B6SA 1X8XA 4H1TA 1G8HA 2QTLA 5DYGA 4MYTA 1S9DA 3ZU2A 2PD3A 3E9RA 2OHGA 2UV8A 4IZHA 3F6PA 4OHOA 3RT1A 1UT6A 1WXWA 1VIYA 4ZYYA 1KFCB 5HM6A 2EFCB 1BE0A 1KBQA 1ZM2A 2C8LA 2IPAB 4B2PA 2V6FA 5FNZA 4DLRA 2Q4RA 3IQGX 2QD4A 1O6BA 4F06A 4XIGS 3QWAA 4CXMA 3EXHA 3R5TA 4ZHQF 2NU7B 2JARA 4JODA 3FVQA 1IY0A 1TA4A 2JGKA 2Q3EA 1RZVA 1UJNA 3N8KA 2WD7A 3PQFA 3KETA 4BDSA 4P36A 1BWSA 1HDZA 1GPMA 1NBAA 1OIWA 3GRCA 3IIEA 1TUBB 1Q2UA 3Q7IA 1JEEA 3AQ4A 3WP0A 4D99A 4BRZA 3C6KA 5FWYB 1CRQA 2TMKA 3V1TC 2O8DA 2BFFA 2RCNA 2ZYTX 3PYLA 5EQTA 2W2LD 3LGXA 3ZCVA 1R4MB 1SY7A 2XRYA 4LDAA 2H0RA 4LC9A 1EWYA 1DDIA 2BFEB 2QYTA 5BO5A 2Q50A 1G21A 2GNPA 5CA0B 4NBKA 3X1DA 3LBHA 4AJJA 4GXTA 3KLPX 4DCMA 3SX2A 1P18A 1V8ZA 4DXHA 4YWHA 1T9GR 3AFGA 3EHDA 3LCVB 2I4TA 4BV8A 1MAHA 1Z0SA 2N9UA 5E2IA 2HAEA 2R6R1 4FNAA 3SX0A 5BSFA 1Q7TA 1ISHA 3CNHA 2QB5A 4NDNE 1E9RA 4A26A 3UXMA 3EGIA 4KGDA 5I7FA 4M9QA 2GM3A 1FDSA 5E3HA 3AJEA 1I4OA 5CB4F 5GJWC 4RFSB 3AXTA 1EVIA 1KAMA 4JLAA 5AHWA 1Y3IA 1DX6A 2VUIB 2PGNA 3NONA 4QODA 5LYYA 3G17A 4K03A 2JIDA 2ZRPA 4W5TA 2GZMA 1QHFA 2FU5C 4FI3F 5GADl 1AS3A 4IRMA 1NNI1 1SXJA 2J6CA 3T1OA 1QANA 2JATA 4QLOA 1Z2EA 1XTIA 3UKJA 2YUTA 3KUKA 4XVHA 1RRGA 4MKZA 4JI6B 5I5EA 1QTQA 1VGRA 3U4AA 4HI0E 3T99A 3N1UA 3L01A 4FHFA 3MWLA 2PX8A 3RYIB 4KIFA 4PNHA 3VNBA 1NM5C 3ZH2A 2HRRA 2HA7A 4KQHA 4FYYA 2ZYWX 3IUEA 4BN4A 3UUGA 2R8YA 2YWGA 3MUNA 1XVIA 1NWHA 2P9EA 3EIOA 1B6RA 4EWLA 5FD8A 1XZLA 1IOVA 3LU1A 1R9GA 1MVOA 3OKFA 3ZZNA 1EVLA 1ZZEA 3STTA 1RABA 1ZK4A 5AVKA 3VTKA 4V3BA 1IY8A 2FG7C 3HV2A 1L4UA 4BX3A 4BVHA 3ZX4A 2OQIA 3QJGA 3ZZ1A 3F9RA 1E1RD 4RCYA 3AI3A 4JDUA 4MWBA 4FSDA 4RMJA 3K0CA 4BLQA 1Q3HA 4DMGA 1D1SA 1Z5OA 4EVRA 1PDOA 1X0VA 2XADA 1C8KA 3D8TA 4OQPA 1JLLA 3AY7A 1T4MA 1PNVA 2RHCA 3NS7A 2UVPB 1UJBA 2JIZA 5F5NA 4CLXA 2B1QA 2FUG1 3AUKA 3LPMA 2G25A 3RHTA 5J5VA 3T34A 1CJUC 1MRNA 2G72A 5D51S 3VR2D 1N6HA 4D44A 2FSVC 1YI8A 3DFMA 4Y18A 1UBOS 4OOEA 5LOVB 3LBYA 2FMTA 2VAWA 2NUBA 1PFKA 3HVJA 3IXLA 4QIHA 2EQBA 3RTAA 5EPEA 2OMKA 5TMEA 4BHTA 4LWZA 5K8JB 2XLCA 2GJ9A 3TJZA 2LCIA 3LOPA 4G0NA 2A5JA 4L4RA 3PJEA 4MVJI 4ND3A 4O3MA 2WOOA 2B1IA 1K6MA 1FJHA 2F9MA 5AKLA 5DU2A 5AXBA 4DMUB 4JUBA 2FPIB 2W2MA 4EB0A 3VNQA 3H7IA 2VP5A 4BBJA 5AW5A 3U4HA 4UTNA 1ISJA 1NQXA 2EQ5A 1SU4A 2ZB2A 5F64A 2OFFA 1ZVJA 3UHJA 3MT7A 4LCJA 2OFXA 2Z58A 4DLZA 1D2NA 3KWFA 4XQ9A 4L4XA 1CFZA 4D3DA 3JQ9C 2IYOA 3WL6A 5ECDA 5HS4A 4MAMA 2DYKA 3OSUA 3BIXA 3EEOA 5E1DA 2G4VA 2OCXA 3O2QB 2P3OA 4LQLA 1FVOA 3A4IA 4HRXA 1X1CA 3A4VA 3PBKA 4HSEA 5ILGA 5M7EA 2A9OA 1UIRA 4OQYA 1GCOA 4J0CA 1N0VC 1K4YA 5G4KB 4B4DA 3HO1A 3MWFA 2FUNB 3NUQA 5JO0A 1XLUA 2AG0A 2XAAA 1Z9BA 1QS0B 2XDWA 3JWGA 1IBCA 5C31A 2FR8A 3WHLA 4EECA 4FPXA 3HE3A 4L2IB 5BSWA 5C5CA 1LVGA 3A04A 1KR2A 3ZE6A 3ZHCA 4IRUB 4MROA 4WIAA 5K0JA 1MW8X 3AEYA 4GH5A 3L4EA 4RZSA 1PWZA 4BNZA 2DQYA 2VJKA 4N8SA 1HL7A 1CF9A 2BEWB 4LV6A 2OSBA 1E7QA 3AEZA 1L5NA 3ZW8A 5FUMA 2I03A 2Y0PA 4WEOA 2A4KA 3Q15C 2P2LA 4L95C 4NMLA 4E6PA 1KKUA 1BX0A 5KEIA 2WNSA 2AF3C 2BM8A 2FYTA 4HDCA 5LSAA 3GMIA 3GUUA 3T7JA 3HFJA 2ZTLA 3ABZA 4P5DA 2IS2A 1J0XO 4PGHA 2NT4A 2PXHA 3V1YA 3KPYA 1T10A 5JISA 5F52A 1QBKC 3K4HA 3LX4A 1WCV1 2YN2A 1O57A 3GZJA 4G0QA 3FNIA 1AQ6A 3GMSA 3DE7X 4GYYA 1NVUQ 3GO4A 1YC5A 4ERNA 3CNEA 4QTYA 4X20B 1KQPA 2J4FA 5CUQA 1GEGA 2O2DA 1MT0A 2VPXA 2WIDA 1SIBE 2YS6A 1G8YA 1V4BA 2P91A 4QUEA 2W2TA 1NAHA 2XOEA 3K9NA 3SYTA 3ZCRA 4AJIA 4A6DA 1OXVA 1THZA 1O3YA 5BVGA 8GPBA 5KVCA 2IYFA 1JLLB 4GPZA 3IDFA 4S1PA 5DP1A 2REXB 4H9GA 1S3FA 3RO7A 3N8GA 3L02A 4IIDA 4F11A 1NA5A 2C7VA 3VX3A 4ZZ3A 4C0XA 1I33A 1P7CA 2WWHA 3VHRA 2OV8A 4BO0A 3HI6A 2BBOA 1G8GA 3KOMA 1VRWA 1FFHA 1YRWA 4ZCTA 3KHKA 3GA0A 4JBLA 1V7PC 2WA1A 4M9XA 3TRHA 3LECA 4BC0A 3KAKA 4M36A 2K7FA 4MIYA 3FTFA 4U6QA 3AVXA 3FPEA 3ESBA 1UPUA 2DWCA 3ZDZB 4Q15A 2YW2A 4LXQA 3E9ZA 4OQZA 1Z5PA 2JFGA 3T38A 3KO8A 4RQTA 1EWKA 1LLDA 4HRVA 4LFAB 1MT3A 2FK8A 3EZLA 3ILYA 4OGWA 4RDCA 2BP7B 1SZJG 3CQ9A 1JJBA 5HF8A 3UNXA 4LF5B 3KVRA 3GNTA 3K16A 1ULTA 5DMXA 1PHRA 3T41A 3VTFA 2WJHA 2XSZA 3KE8A 1GPNA 3HLKA 1B00A 2J0UB 2HU5A 1L1EA 3WGGA 4FHZA 5EIWA 3UTDA 5T4FA 2OAGA 1FEZA 2QD3A 5BY2A 2WW8A 2EZTA 1WZUA 4YCLA 2CY0A 2EX0A 3VRHA 4BMXA 2IVZA 3AERB 3FDJA 4GLFA 2QUHA 3P0IA 4HQRA 4AF6A 1H0HA 4CUKA 2C2HA 5JS7A 3MCTA 1R0CA 5K20A 4I4CA 5DI9A 1L4BA 2NTEA 4BVEA 5DEOA 4IX1A 2WT9A 4MPJA 2G77B 4M1EA 2YZ7A 2QY6A 2OQ2A 1E2IA 3VZRA 4AYXA 4UNIA 1I01A 1XMJA 2HQRA 1UBFA 4G3XA 4CQMA 2AR9A 1P9LA 2C1XA 1KEEB 1J2UA 3DFUA 1ZHOA 3EMVA 1PSZA 2WTNA 2AC2A 4TQAA 1E1DA 2MYTA 3EVNA 5WRFA 4DUZB 3IPXA 4EABA 2PIAA 1CRWG 1ZWLA 2CFOA 1C3LA 5D6OA 1KVSA 3X1XA 2J3MA 2DECA 4OBWA 1KP9A 1F12A 4P7BA 5DSTA 1JT9A 4W6QA 4ENSA 4IDEA 1F0NA 3NVKI 1HNXB 4J0JA 4K9RA 5TE9A 2WWVD 3RRBA 3SK0A 3WIDA 1E6UA 5IBRA 2VHJA 4JWTA 1PR1A 1UXJA 2F7SA 1VL0A 2RHOA 4HOYA 5BQXA 1J5XA 1PU2A 4OKSA 3CX6A 1ONSA 2H5IA 1V7QA 1JPUA 5CVUA 3PUIA 2AFRA 4RHYA 1R0YA 1T4CB 2QSZA 5GVSA 4ATNA 3TLXA 3G89A 4KFCA 1BOOA 4XI9A 2C1EA 1X8LA 3GJ6A 1X80B 5L4LA 4UM8B 2YHIA 3SQMA 3TR5A 1ZRHA 2JJ2D 1K6EA 3CPEA 3IB6A 5B6IA 2HIAA 3EY9A 1GNPA 1IRXA 4D9KA 1UZAA 5GIPE 3T4UA 1TVKB 3PCXA 3UJ3X 3GBVA 3EXG1 1J9GA 3QVUA 5EIAA 5FLYA 2ZWPA 2F3PA 2O23A 1AS0A 2QRVA 1PFYA 4TQUS 5CBPB 6AT1A 4QEDA 2P40A 1M2VB 2ZRGA 4LXXA 2ZUWA 1EGVB 2P9YA 1EESA 3C1UA 2UUPA 3SMQA 3GLFE 2ZWAA 4WN9A 3ZLTA 2GCOB 2ILTA 3ZWOA 4C0KA 3A11A 3M6XA 3ONNA 1CQIB 4JQCA 1MGOA 4DJDC 4EY3A 1EZ1A 1ZFNA 3OEYA 1T9BA 3L6RA 4H7PA 1Y1QA 2FWIA 2G63A 3DLCA 4FGUA 4LYHA 3HMQA 3QVOA 4ZO9A 2JFOA 3MPOA 4ZKDA 8LDHA 3H3JA 2JCXA 3EZ2A 5LWHA 1BSVA 1S2NA 4M1WA 5TT1A 3TZBA 4A9AA 2O3TA 3UK6A 2HA4A 2V03A 3W4IA 3B5IA 4BFYA 3UANA 2BWJA 3X3HA 2YTZA 4IGFA 4QYSA 3OT1B 1JSZA 1XBTA 2WWIA 4KAAA 4KUHA 7REQB 3I8OA 1L4EA 3HP1A 1JLMA 1YHNA 1MF7A 4XIIA 4MYRA 4Z0HO 1KRWA 5LFAA 3CA8A 4QJ5A 1OXXK 3R3ZA 4EMTA 1JHXA 2FE1A 3L8GA 3GCDA 4LHSA 5TS2A 4Z2YA 4CG3A 1RI3A 1M0EA 5FPSA 3RFUA 5FAXA 1BKSB 3FVWA 5EXEA 2DCMA 2GPAA 3F6SA 5M2QA 3IP1A 3QKRB 2E6KA 4JMPA 4R3UC 3GD7A 3IE0A 1D9ZA 2SBTA 2D8AA 2P62A 3P0HA 1W4CA 1ZX1A 2J9FA 2CVFA 4G1MB 1O6CA 3EJWA 2HC9A 4AZWA 1Z8DA 4W7SA 1CUVA 5P21A 1MCZA 1CU1A 2GCGA 1OX4A 2CZCA 4URFA 3U49A 1BDMA 3I2YX 1B7GO 1KARA 2HXYA 3DUFA 4E12A 1AKVA 3DHEA 5JAOA 1AHHA 1IMOA 1XZKA 2C31A 2E4WA 1SCKA 3FVRA 3HRIA 2NP6A 1YHYA 1Z6XA 4HDKB 1NFFA 3F5SA 2FRVA 3ODPA 2VPWA 3KQMA 3ESYA 3W79A 4KXXA 5IJZA 5ILOA 1GDTA 2NW6A 4KYIB 4GVXA 1KE2A 1BU8A 2Y1EA 3LP6A 1CE8A 2CE7A 5KQGA 5EZ6B 5G0TA 2YVUA 2RGNA 4X94A 1QAQA 3TL6A 4DLYA 1IPHA 1E6EA 3I2HA 4R2KA 3ZI7A 4NABA 4M38A 2O5VA 3B1XA 3ZS8A 1I0IA 4KXNA 2B69A 3ASZA 3HXTA 3W78A 3OPYA 1L5GB 4NY1A 4LSZA 1YKFA 3HO8A 5DGTA 4I2VA 4LY9A 1EEHA 4B3TB 1V7ZA 3C1OA 1UK6A 3Q3GE 2GI4A 2O48X 3O9ZA 5DYNA 1XXHA 1ZGZA 3DCNA 3Q12A 1VL8A 1A9RA 1B8PA 2AHOA 2PS0A 3O8OB 5FR2A 4WFQA 4ETNA 4Z4GA 2CDNA 3KZKA 2C97A 4FONA 1PGNA 1DAEA 3AY0A 2MMCA 4WOBA 3C1TA 4MGEA 5IYZB 1QB8A 3CONA 2Z95A 3ZCUA 1IUNA 2HHAA 4H15A 4EGJA 3CNQS 2UZ0A 5EWMA 1CUHA 1E58A 3TMKA 3ZE1B 1OGIA 2VDOB 4KXUA 1KMHA 3ZU5A 4D9EA 4UJ5A 2OD9A 1W94A 5A5GA 2EZUA 1KRHA 1I2BA 2AQHA 1Q7CA 2O52A 3LUHA 5BUSA 4WI1A 3D43A 3IOEA 4IQGA 1L5SA 1NURA 4W1QA 3UN1A 4C08A 4AUNA 3KQKA 2YXBA 1SA0B 2FUCA 3Q6NA 2QP9X 4FE3A 3MUFA 1D4OA 4I66A 4ODIA 3GEPA 4X66B 3NV7A 1Q19A 3J81A 5EAIA 3DTVD 4M4SA 3AZPA 3GDWA 3O75A 4AX8A 4BTLA 2QZSA 3W04A 1JKFA 1M3SA 3G6WA 4YJFA 3WMRA 4A1FA 4AW9A 5EIXA 5AP9A 1QPZA 1PGOA 3CNNA 4GGPA 1R4ZA 2MTBA 1NRXA 4EYQA 3I6YA 4HADA 2WSBA 3O1LA 5AJWA 1N4DA 3PQEA 5EP2A 3CJQA 2KLHA 2AQ8A 3I9MA 3BFVA 1OIXA 3P9KA 4YMWA 3NV9A 3NTQA 4WK6A 4DMRA 1EK5A 1EGAA 2GHRA 2QS9A 3HXQA 3ORFA 3D8UA 1YI0A 2P9ZA 3QLTA 2PWBA 4I3FA 4U7PB 4YR7A 5K8IA 2A7QA 4HN2A 4ZZ1A 1XVUA 2BZ0A 1NKVA 3WNQA 3R4VA 4K9NA 4OQLA 1ID8A 5TQ0B 2CE2X 2BGIA 2PAFA 3RWMB 1OXTA 2G83A 4RHFA 5AKYA 4BJ5A 5ALMA 1HNZB 2H1VA 4E94A 2J07A 4Z9YA 3H9JA 4P8RA 1GPUA 5IH7A 3A0RB 1QQ6A 3OTHA 1NXQA 1QHHB 2R4UA 4MAFA 4DCNA 4JCOA 3ROGA 2YYSA 3VYVA 3ANNA 2W43A 4W82A 4YHHB 2DXIA 3KJFA 1I36A 2JD2A 2IYPA 4DCSA 1E7WA 5JVDF 2RARA 3DZFA 4FEAA 4YPOA 3DYBA 1L3CA 4PYLA 5EXXA 1IM8A 3N6RA 1T1EA 4XH9B 1H8EA 1M76A 4UMEA 4B8ZA 4XVUA 4CQNA 3JQAB 5LQSA 2PJDA 1L4GA 2P65A 1HYHA 4E15A 3ABRB 1M2OA 5FOQA 3FSEA 3T5GA 2QXYA 2HL6A 4I1UA 4KN9S 3IAS6 5DOZA 2XE4A 3TQFA 5C2JB 1QP0A 4JAVC 2GDZA 2QTRA 1E1NA 2HNKA 4K8OA 4DLPA 4GWLA 1ENPA 1Z5ZA 3A7EA 1GVHA 1H4VB 1E9SA 3NWBA 5EP4A 1W36B 1OFUA 3N2ZB 3K4PA 1G7CA 1JQEA 1QP4A 5COAA 2ZYVX 1H4QA 1N0IA 4YIKA 4G4SP 1K08A 4BTEA 3PNBA 5C8ZA 3C8HA 4UTRA 2Z8XA 5BUZA 2R84A 1NE2A 1V8DA 2VP6A 3QRWA 3FTDA 4QPDA 3W05A 3V8RA 4R71A 5A5EA 1RP7A 4NIMA 4A36A 3JQDA 4BASA 4OLJA 1V25A 3TE6A 4ZTUB 1SD1A 4MUNA 4PTYA 3QVVA 1ELOA 4IBOA 4RMNA 4GO1A 5KX5B 4DR7B 2XI4A 5J2UB 3GW8A 2IXBA 4TKVA 3ULKA 1XCOA 1R8YA 1GDDA 3VPHA 3VHXA 4BYGA 1W48A 3BH7A 5G1PA 5KNDA 1E4EB 4IEEA 1QGED 3DLBA 5FO1A 5FYQA 4EKYA 2AZDA 4MWOA 1V43A 2ZI9A 3E9NA 1I6WA 2PU7A 1KIMA 2QX6A 3T9DA 3OT4A 5GM1A 1FSSA 2JRCA 3PUWA 4FYMA 1NM5A 1HA3A 4M53A 1H42A 5KVSA 4W5NA 4HX5A 2RH9B 5JNSA 5F9HA 2AS0A 1VYUA 2ZRNA 1WDTA 3H65A 4Z3KA 1ZGBA 1IJKA 3F5MA 3ZGVA 2VTBB 1X1DA 2OV3A 5K2MA 1QIMA 1C2YA 4D74A 3WQSB 1LDBA 2VJAA 4I50B 1B2RA 4GM0A 3U17A 2B25A 3CNLA 3ZLUA 1E7SA 1JFFA 5IM5A 3MMZA 4PSKA 4RV5A 2BZSA 3JRWA 4OF4A 3T3OA 4UCWA 1EGHA 1QNFA 2JFZA 2WC1A 2ZRCA 3O4HA 4ZTBA 4RY2A 4BKRA 4ISCA 5BWNA 3BS4A 4EI7A 1Q1NA 4XR9A 5CJPA 3OOYA 4R1OA 4UQOA 5GTDA 2QDXA 4IV8A 4JUIA 5COQA 3ROKA 3SU8A 3N87A 4EGAA 1XAJA 2B4AA 1SHLA 3I8XA 3L43A 4NBLA 4TLDA 1SXQA 1Y1RA 3WRYA 1BU5A 5I7AA 5L45A 2FR0A 3FOEC 1BMQA 3KPUA 2BGKA 3DS8A 3D6NB 1DINA 5AI5A 2P9BA 5EL0A 5AUQA 4CT4B 1ZIOA 1CG6A 5HHTA 1EDDA 2PZLA 3FSRA 3H4TA 2O2HA 2YZGA 3KTFA 4XQGA 2AEMA 2AEFA 3VTZA 3EDCA 3TBFA 2KS6A 5DHUA 5F1OA 1KJQA 3UMRA 2F1KA 1TDJA 2Z2JA 1P62B 2CW5A 1JIJA 1YR1A 3I3SR 4G0WA 1XAGA 4RHUA 5EZ5A 3W5CA 3NC1C 1X86B 1Z4KA 2CSUA 2OCDA 2CLKB 2F3QA 3B6IA 2PUDA 2RJOA 4P3NA 3NXKA 5E7QA 4NMWA 3NBZC 2WYWA 4OHZA 2VNAA 3UXYA 1XZDA 2AUTA 1SCUB 1V2GA 4B81A 4PZPA 3AIIA 4Q24A 3I5UA 4M22A 1DB3A 5HW0A 4HFRA 2CNBA 2IXDA 4DQDA 1AVTA 2WYIA 3CO0S 4Y9RA 3OT5A 1R0XA 1RAFA 1P3Y1 2YV1A 1ZGJA 1J9ZA 3KFLA 4H7HA 2LIPA 2XQGA 4Y98A 2BCJQ 3BMQB 3GRVA 4CM6A 4D0SA 3KQNA 1RQ7A 1CEEA 4EZBA 4IIGA 2HNAA 3OTOB 1PZHA 3A1FA 3JRXA 1KDYA 3AHHA 2ZRKA 3RIMA 3X2SA 4B6RA 4QT4A 3E82A 1FNDA 4JXKA 4EKDA 1IY1A 1XNGA 2XNDA 2ZXEA 3ZTWA 3EYWA 5GIOE 1R9JA 3IKMB 4ETMA 2H1HA 3RG2A 4Q93A 3UAZA 2R65A 2J0UA 4Y2QA 4QBGB 4DG9A 1NXWA 1APBA 4I4NA 4AY2A 1LSJA 3LXXA 4MKIA 3ZHXA 3B5EA 2JGDB 3CVJA 5CFOA 4DARA 5E2AA 2NSLA 1UXKA 2DUUA 1HOTA 3AEUA 1CUGA 2XMRA 4ACBA 2D5CA 2LDXA 3HZHA 4MEAA 4E31A 4HRAA 3T95A 4WJKB 1HTWA 4WXPA 4X92A 4BFLA 4G0PA 4PLPA 2YX1A 5BN4A 3K71B 2I2DA 1JSXA 1DRWA 2E85A 2NVUA 3MK31 3N8HA 4MNTA 2TMDA 3U7IA 1FBTA 3T1VA 4MGHA 5AJHA 3RAEC 1J39A 4JJKA 1JJFA 3VVCA 1CDZA 5JS8A 5DNAA 1U1EA 1VECA 1YK0A 4N8DA 3OLXA 5LLTA 2R1TA 4IQFA 5K5EA 3IYLW 3E61A 1PT8A 2OHXA 1XJQA 4OXXA 3KJHA 3CT6A 1II0A 5EKTA 4EVSA 2YMPA 3A6LA 4RHTA 2G3YA 2C4HA 2C94A 3AINA 1PP4A 3QVKA 4WESB 3V1NA 2HBQA 2P9TA 4UDXX 2HCBA 4CF4A 4UNRA 4OAPA 4OHMA 4QDJA 2RKBA 3V8QA 2CKDA 3WKCA 3HGMA 3R77A 1A76A 4LKOA 4F71A 2A9QA 3R3SA 4J9UE 5DYIA 3VKGA 1FQJA 1FA9A 1DJQA 2R6GA 4JLDA 1P3JA 1X9GA 3AI1A 2QROA 1XN4A 3DT8A 4KIUA 3SXUB 3MWGA 5C8YA 2Q45A 3ZTYA 2A8YA 2NVBA 3JQAD 2REQA 4EF5A 5KNBD 4KNYA 1C50A 3AF5A 2JFQA 3AEKA 2Q6LA 3P0JA 4RMHA 4PZUA 1PQPA 1USUA 3MINB 3EUEA 2DVMA 4BFXA 4ZAGA 3SYMA 2XMZA 3GAFA 1TAHA 3A4TA 3FKSD 3FNGA 1AM4D 2FJPA 1P1HA 3E7FA 4ZT2A 3M3PA 5C81A 3B7PA 3HJNA 1ZJZA 1WZNA 2HA6A 4K1LA 4UC0A 2ZM5A 1NOIA 3LUBA 3NHMA 3W9BA 3AVYA 2H4WA 3LGAA 5IJ9B 2J48A 3U5ZB 3QPDA 3IQDB 1WHTB 1P6QA 5KNBA 4NYIR 1MJHA 2IZ0A 2PM8A 1UDCA 2RGCA 2R6DA 4Z6KA 1JJ7A 1CQJB 1L4NA 4WJLA 4UU1A 2AVNA 3SKVA 3GVIA 1HZZC 121PA 1E5VA 1KO7A 2K4MA 2PLAA 2HA5A 1PKEA 3KWMA 2YC2C 1Z36A 2W98A 4YAOA 4DCTA 1GZ5A 1XRLA 3OEEA 1E98A 4WCVA 1XMOB 3WWYA 3L8ZA 5BYJA 3PNVA 3BEOA 4Q34A 2OZLA 5FLXA 1L7AA 1X19A 4G24A 2AOWA 4M37A 3MSCA 4QU5A 4IXMA 1CVIA 4FDTA 4WBNB 5SZKB 3AKDA 4DSUA 2DR0A 2BGRA 2G76A 4N0DA 3WADA 4UU8A 4BWYA 2Q6KA 3FDIA 1S1CA 1DEAA 4NFHA 4PN7A 2VJOA 1P6XA 5JLAA 2P5TB 1K6IA 3LK7A 2INGX 3OU7A 3CZQA 1F51E 1J0AA 4NFSA 4BJHB 1JPJA 3OHMA 3GEMA 1WDLA 2ZRBA 4QQKA 2Q5IA 3QXXA 3E22B 5HGXA 3GFSA 2HBRA 3FCAA 1ZVKA 2F17A 2IGBA 3CF0A 4LV8B 3RKRA 1NUSA 5TGZA 1SU8A 1THMA 4UUAA 4CFZA 2CV1A 3GEEA 1OCEA 1JEYA 1IG0A 1PJLA 4MI6A 1X9IA 3NQ41 4RVCA 2IYEA 2IZ7A 4QDOA 4Z4IA 1UBTS 2VDQB 1JEDA 4B7XA 1C3JA 3E3OA 4G09A 5EP3A 3SHOA 3QOFA 1UM9B 2QKYA 2PYDA 3GNQA 2EOAA 4YRGA 1QE5A 3GJ7A 3CLSC 4MV3A 2J6IA 2D1TA 2BFBB 4XXHA 2YDXA 4I8DA 5K03A 5ALEA 2I91A 4JVSB 2C07A 4B6QA 2ZTHA 3WLPA 4EF4A 1PE0A 1SN7A 4IMIB 2IEGA 3DKKA 3I42A 1XSEA 3EXIA 1GA4A 3QU4A 2H4XA 3L0SA 2Y92A 3GFOA 1S1MA 1ULBA 2ZBVA 2ZP1A 4C7BA 1OB2A 4DRYA 2DB3A 1VSQA 1HORA 3JQ6A 2Q4TA 4R0NA 4L7VA 5C46F 5GOTA 5IEJA 1U5BB 4K9OA 4I1SA 1VLHA 2Q1SA 4IOMA 1VI5A 2IYNA 2AHRA 1P81A 2WHEA 4CLOA 1WCYA 3G5LA 3AY6A 4IQ4A 3TZLA 3LFHA 1WF6A 4KYUA 4RYDA 1DL5A 3QUCA 2IBMA 3Q7SA 4L22A 3OF3A 1K8RA 2CEAA 3ACCA 2YV2A 2G1AA 4ITUA 4IY1A 2OAEA 4J3FA 4P80A 4E14A 4Z53A 4LFBB 2Q8PA 1OFUX 2QN7A 2ZXUA 3TW8B 1BDHA 2GPYA 4UUPA 2HPVA 1WEKA 1RVDA 1E3EA 1PJ4A 3RK1A 3F6EX 1WW2A 2BLLA 3P96A 4UD6A 1Y7HA 3PQDA 4DBLE 2J08A 2YV5A 3VKWA 4CL0A 4DBZA 2C4UA 4XDZA 4YRMA 3OHSX 3R8CA 4F91B 3R6LA 3R9XB 2GJSA 2O3RA 2I6XA 1J22A 3PJRA 2OO5A 5K0EA 2D0PB 1IQUA 2QLLA 4OL0A 3L18A 1DKNA 1TZMA 1BKYA 3GY0A 3TX6A 2O8EB 4QFDA 1LNSA 5BQPA 5D1NA 1CVLA 3TOVA 3TSCA 3PEWA 3LT5A 4J0HA 4RVFA 4XQEA 5JJKA 5KWEA 1B74A 1T13A 2CSXA 4GSLA 1CJCA 3U3MA 4EL5A 2V6GA 1Q83A 5A7FA 3UC9A 2PL1A 3QE9Y 4GXQA 4MCJA 1QHXA 4QGGA 2DQZA 3HKDA 5B53A 3TJMA 2QSYA 4TWAA 2PQ6A 3LXMA 3ZDXB 2DT5A 4XYEA 3UWMA 1RYDA 1NR1A 5CHYA 2BFDB 3ZUPA 3SIXA 4FMPA 2P9HA 4RJJA 1C3OA 2G04A 5HK8A 4GNKA 1B6GA 1Y0BA 2KWIA 3PNPA 3K70B 1CEXA 1HMPA 4OLHA 2VWQA 2QTBA 3UXHA 3I9FA 1ZK1A 4ZOLF 4TL7A 1SZCA 1NASA 2DWOA 5DM60 4BFVA 4ZV4A 1ILEA 1T35A 4IH9A 5IJ0B 4B3BA 1JHDA 5LXTB 3ZXYA 4OOFA 2B5WA 3M0EA 5EKUA 1YFKA 5AVWA 4FKBA 1T5LA 3EBLA 4LJAA 1NW7A 3CUEF 3VPXA 3IEVA 1GTG1 3PS9A 4F56A 1U4SA 1WBBA 1KI7A 4M7PA 2OXTA 2NU6B 3SYNA 2AXQA 3CVVA 3K20A 4RJKA 4C7KA 3U44B 1CRLA 5LYJA 1NFRA 1ZOLA 2I76A 4KWCA 3DZCA 1FU4A 2AFHE 1F2DA 4JGBA 4F4DA 1F20A 4G1CA 3V42A 4D9HA 1E3QA 3QV1A 4GLJA 5U1PA 1OXMA 3AR8A 2XNHA 3VOBA 3LRXA 4QFCA 1KYIA 1KZ4A 1ZGHA 3GH3A 4E03A 1T24A 3KZMA 2XNKA 2UZIR 1P33A 4D80A 2B4RO 2PYZA 3ADOA 3D6AA 1HE2A 4K3VA 2G07A 4NONA 1PS8A 1E1KA 1GNRA 5DCUA 3WDKA 5BYKA 2X86A 3ND9A 1RFGE 4HUTA 4BB5A 2RHRA 4P2GA 2PX6A 1UL1X 3FGPA 2KJQA 4DM4A 1YBAA 1OC2A 3ZE9A 3FMVA 4Q39A 3OVMA 3QF4A 4BNFA 4M87A 3KD3A 4PC1A 5IXSA 8AT1A 2PGAA 1UC5B 5EVJA 4M0LA 1ES9A 5GM2A 1EXDA 3SHFA 2QTWB 5AKJA 1WWKA 3LYLA 4Q03A 3QX9A 2P8SA 2J1LA 3WGQA 5BV0A 5F77A 1LVHA 3E2PA 2G8NA 3JAWA 8MHTA 2YJNA 4KTVE 2JAUA 2UDPA 3D6UA 3VBEA 3ZD8A 2XT9A 4MUMA 5JSYA 4HGRA 1E6MA 2PKRA 4UAUA 4D2IA 3PGLA 4Z7JA 3IUJA 1BAPA 2ESRA 2VQSA 1N5LA 1UC4B 4MYCA 2GKOA 3MHTA 4RD1A 5JEEA 4LXGA 5B7NA 4A7PA 1IM2A 1U0RA 3TQCA 3VMMA 2C4KA 3FRJA 2W6JD 1CZHA 4Y1GA 3NTLA 3PUJA 4JQZA 5BXQC 4NULA 1Q0ZA 1D09A 2XZOA 1CZUA 1RNLA 1W88B 2W00A 3KCNA 2IZ6A 2CJPA 3AHCA 3L40A 3V1UA 5A0TA 4V3CA 5BSTA 4MQEA 1XL1A 3EBOA 421PA 2XTZA 3E1SA 4O0LA 4RQBA 2OPBA 3BT7A 3F3MA 2OCPA 3GLHA 5JBIA 1UBNA 3ZQUA 1QR6A 4JP1A 3RUEA 4TXMA 3B1VA 2X6QA 1C0PA 1GTL1 2DFPA 4U4AA 3QHQA 1M5RA 3WJ1A 4OLBA 2FPWA 4EAAA 4F9EA 1P9WA 1XEXB 2EKQA 2OHFA 3CC8A 4Q3NA 2D1FA 2JFVA 1K5PA 3VH1A 2X23A 2YKGA 1GQRA 4HDOB 1X1QA 2XWPA 1A95A 4HNUA 3SC6A 1WCIB 3BEDA 3UFXA 4J6EA 3CNOA 1SG0A 2I55A 4WADA 5JMPA 2GERA 1N1MA 2PX4A 4KKVA 2G36A 4LIPD 4PFQA 4PO3X 4DWVA 3CF2A 2Q5OA 2GTPA 4MZDA 4F9FA 4HKTA 4MB2A 2ERXA 4HQNA 3VYTB 4J0GA 1RLMA 3E8SA 5KNLA 5FBKA 1X0XA 4XW2A 1W2HA 1E4VA 1T4BA 1PFVA 4R1QA 4JI5B 4AZTA 1XPOA 4G4IA 5F1YA 3K2BA 4HWRA 3RSLA 3A1VA 3HCEA 2IDKA 2FQ1A 1GPKA 3A2LA 4PX2A 5HZGA 4DEXA 5JECA 3PC2A 4PIMA 2YXEA 1GARA 1ZGAA 3VZCA 3ODGA 4N7RA 4POAA 2JJQA 4JSTA 4BCCA 5JJLA 1E2UA 1N9ZA 3U4MA 4PU0A 1D1PA 4ECAA 1GUAA 1Z8HA 3HACA 4JOSA 2XMCA 3DDOA 5LYJB 2WQ7A 2C7BA 3BICA 2JEZA 4C2UA 1PUXA 1PZFA 13PKA 1ZA1A 3ME5A 4JIGA 4C4ZA 3LCUA 1RIFA 3BG5A 3IT1A 1RCTE 1PTJA 2H9AA 4IL5A 2AG8A 3LIIA 4RJIA 1J97A 4OAOA 4XKJA 1JE1A 1NE7A 2IIVA 4XWOA 4ZCMA 1QRSA 4KX5A 1Q17A 3KRTA 1SUPA 3PR3A 1AS2A 4NCNA 1JYSA 4QQFA 5FO0A 1PJRA 1TQ8A 5IDVA 2WUGA 5FL3A 2Y9PB 1GV0A 1XZJA 2IFTA 4N01A 1N34B 1BS1A 2J41A 4INJA 1C30A 4JVOA 3V2GA 4IXWA 4PLHA 2ZIUB 3LPNA 4TL8A 1XZQA 5KSOA 4D8XA 4KBGA 2IELA 5CM8B 2VN8A 4BNYA 3N2GA 1ZAKA 4QXMA 2C9CA 2WILA 2V5VA 2YWXA 3WYAA 3BC1A 4YMUA 1QG6A 3RSZA 2AN5A 1HO3A 3P4YA 3ESCA 1FY2A 4CQMB 5EVCA 4CEJA 4DFDA 3BMCA 3DEZA 2AX3A 1VJGA 2H5JA 5JSFA 1COZA 1GGEA 1SUBA 4CR6A 3B1KA 4PF1A 3M6VA 4OK3A 4LJYA 2WRZA 5K51A 2PUGA 4MINA 1LV7A 1O03A 1H65A 1KYXA 2VI5A 2ZVPX 4EKEA 5C8YF 1FLAA 2EJWA 2V4MA 4RO0A 1EFRA 3VOSA 4BAGA 1BE6A 4RM3A 3BRSA <