1JI0A

Crystal structure analysis of the abc transporter from thermotoga maritima
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
240
structure length
240
Chain Sequence
MVSDIVLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVINRMGIALVPEGRRIFPELTVYENLMMGAYNRKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGEQQMLAIGRALMSRPKLLMMDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYGYVLETGQIVLEGKASELLDNEMVRKAYLGVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 2.0 A Crystal Structure of ABC Transporter from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Transport protein
molecule keywords ABC transporter
total genus 62
structure length 240
sequence length 240
ec nomenclature
pdb deposition date 2001-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ji0A00
4W7SA 1PUIA 3QVVA 3CWQA 3OIYA 2ZRJA 3BH7A 2XB2A 4G1UC 1F48A 2CBZA 2OFWA 2VLIA 5IRCD 2ASEA 5B57C 5LB4A 5SZJA 1E9AA 3BJIC 4EKDA 3CPJB 1G17A 4G0NA 1GL7A 1EFRD 1U8ZA 1W49A 3EW9A 1GKYA 4RCYA 4KVAA 2CL6X 1NSTA 3CNNA 2X77A 5DNYB 5JI3E 4MRNA 3K9LA 3RS0A 3MAAC 2K5UA 1XFAA 4NPHA 4QRHA 2QM8A 2HXSA 1FMJA 1U0HC 4OHVA 4Q21A 1NIJA 2IYYA 4PSAA 4B3XA 3IHWA 3LNCA 4G5GA 2QSYA 4OJKA 1G18A 4L15A 2ATXA 3D8BA 2WJHA 1G9XA 4LWZA 1N6RA 4X8MA 1OLOA 2OCAA 4WXRA 2VP9A 4LV5B 4GOKA 1T3LA 1TEXA 4EPXA 3M4YA 3EARA 5CDFE 5HR5A 4DT1B 4PO9A 5HCIA 3A36A 5ELXA 4Q4LA 1COWA 2ZRCA 5JWOA 3VFDA 2LCFA 4F91B 4Q03A 1XX6A 4ASUD 4EDHA 3IDQA 4QGGA 3PVSA 1E9BA 1UKYA 1AS3A 1Z0FA 1Y3AA 4HATA 5FUVA 1T3SA 1K8RA 1SXJE 1SVOA 3KJIA 4N0DA 4DVGA 1E2JA 2WJVA 3EC2A 3AUXA 4TLDA 4NU0A 2JIZA 4RZUA 2WMNB 4IOJA 4Y0AA 2P6NA 3KJGA 4DCUA 2ZJYA 1I4TD 4Q7LA 4B3DA 5FR2A 4AG6A 1JXOA 2C8VA 3K70C 1U0LA 1NVVQ 4M22A 1W5SA 2PMKA 5C2JB 1RRFA 2OBLA 3ND9A 4I1SA 1IN4A 1LVGA 3KQHA 3F0TA 4OI1A 3EAQA 3AEZA 4JT2A 4A15A 2ATVA 2DWPA 1F2UA 5E7JA 2AX4A 3BS4A 3VR4A 4ZCLA 1N25A 1II0A 3NBXX 3BH0A 2ZUBA 1E99A 5K8IA 3VKHA 5EXTA 1KTVA 1NJGA 4M9SA 1P2TA 1KYIA 4LOAA 1ZUNB 2GCPA 4UJ3A 4OI0A 1BH2A 2JEOA 4C4PA 4D0LB 3FKQA 1RZ3A 3GLIE 2IWRA 3ZS9A 1YZUA 4Q1FA 3DZDA 3LBNA 2C9YA 1AM4D 4TMXA 5DI9A 4D81A 1G5PA 3GD7A 5FBWB 4PPFA 1WF3A 1YZLA 1AGPA 3QSYA 3ZQJA 1LY1A 4ABYA 2WPDA 4OJQA 1DAMA 4JIMA 3ADBA 2ZRBA 2H17A 5JLJA 1UDXA 1UBCA 4Q19A 1HTWA 1E2IA 3PENA 4EFLA 5KSYA 3MGCA 4Q01A 5DSZA 1N6KA 4C7OB 4TYWA 4BFTA 4AG5A 1G7RA 4PPQA 4EPYA 3U4QB 4C30A 4ZDKA 4AD8A 5FBVB 1I4DD 1YRBA 1VIAA 3QF7A 1JAIA 1XD2A 1NBMD 1ZNXA 2GVZC 4POAA 4BLSA 3AVXA 1HE1C 4V0LA 1SVIA 4M8NE 3KFVA 1M7BA 4MDEA 1VCMA 2XSZD 1YR6A 4WOPA 4P31A 3D7MA 3SS8A 3RS5A 1QBKC 5SZKB 4A8JC 3B1ZA 5EP2A 2QAGA 2LKDA 2Z43A 4JBYA 4BZXA 2VHUA 3P4YA 2ODWA 3HU3A 4XD7D 1UKVY 2O8CB 2CCGA 3ADKA 2A2ZA 1VG1A 1TX4B 5KNBA 2ZI6A 2LKCA 4D4KA 5LD2B 1B23P 1KMHA 4DLYA 4IRUB 2Z4RA 2O5VA 2KBEA 2JCSA 5FUYA 4OQXA 3BH6A 3QKRB 3WHLA 4W5WA 2QY9A 3EX7C 1XTQA 2I1QA 4TLBA 4ZCIA 1VYTA 2ZXUA 3SYLA 3U3KA 3MWJA 1VMAA 2VP6A 1I2DA 4NDZA 1E2HA 2W6JA 1Q22A 1GNPA 4IW3B 4TYQA 5FOWA 4CGZA 1LS1A 2WAYA 4HUTA 3W90A 2BBSA 5KHOC 4LCBA 5FBLB 2VSOA 3EPKA 5IHPA 5C1BA 3TSZA 1Z5ZA 2MSDB 3I8SA 1G4UR 1GAJA 4B2PA 4JYBA 4WA7A 1Z0DA 2ZQ5A 2QM7A 1XTKA 3L2OB 4DIDA 4A2WA 2PH1A 5KSOA 2ZJ2A 4HAWA 1XD8A 4TMTA 2FU5C 2ZE7A 3NC0C 1O3YA 3KQUA 1L4UA 5BN4A 2O8DB 3K53A 2IYVA 2VEDA 5TV2A 4V02A 5LPNA 5J4KA 2R6CA 5UKDA 3BB4A 4MGZR 2A78A 1KJYA 2DY1A 4R7ZA 2JASA 3NDBB 3DVLA 3K0FA 4G5SA 4IOMA 3REFA 3WYAA 3F5FA 3BB1A 4BEBA 5K8LA 4RJLA 3Q72A 2ODBA 2AD1A 1Z8FA 4O2RA 4EPTA 4UJ5A 3R8FA 3Q7PA 1YZKA 3T1TA 3QEJA 3TRFA 1UEJA 2CMKA 3VX3A 1OF1A 2IYSA 2ZM5A 3WXMA 5JSZA 2ZR7A 3FKSD 3THYB 4NCKA 1ZUIA 1NKSA 3BWDD 1RE0A 2ZRPA 2ORVA 3VHXA 4RKEA 4AC9A 4U7DA 6Q21A 2JLWA 3R7WB 4URWR 3ZGXA 2OXCA 1VDZA 4L9SA 4GSYA 5EQTA 3IQWA 421PA 3DM9B 5TDHA 2ODNA 1NF3A 2FEMA 2BVNA 2P5TB 1KMQA 4HAZA 1CR0A 1R6BX 5HPYB 2RCNA 5ANRB 1J8YF 4NL4H 3QXXA 5BXQC 2ZJ8A 5FBQB 5DI3A 2EYQA 2P0EA 3P27A 4HDQB 5SZHB 2OXRA 5HE8A 2O0KA 4N1AA 3QQ5A 3CB4A 3C5HA 3LRPA 3HPRA 3IIMA 1MO6A 1TPZA 3SOPA 3QXHA 5G3ZA 3QKTA 1ZCAA 4I1OA 3B1YA 3IIKA 4Q9LA 4UXIA 1QVRA 2FFAA 4MGYR 1MT0A 3IBGA 3B1WA 3DZ8A 3AKCA 1E1QA 1TNDA 3CPEA 3TUZC 5JJIA 1SVMA 3BFKA 2X19A 1VCIA 1NL3A 1QHXA 3TAUA 1S3SA 5JECA 5KDOA 4CT5A 3GLHA 2ORIA 3CLVA 1F6BA 3CW2A 3E1SA 2IUSA 2F9LA 3CH5A 2GNOA 2IA5A 3ZZ0A 3U7GA 2BMDA 2ZRGA 4OQFA 4P4UA 4TLEA 4OK6A 2NIPA 2XJ4A 2YC4C 3MCAA 4PPNA 2AFIE 3AVWA 3AGPA 4TQUS 4AKGA 4B76A 1UBEA 2QN6A 1VHLA 3PUXA 2HF8A 2C98A 1UKZA 5IF9A 1QHSA 4HAVA 3SJBA 5L3QA 3Q8XB 5KSZA 1G7SA 3KZ1E 1ANKA 1KDRA 1Q3HA 3A1UA 4XVRA 5AJXA 2WIAA 2Z6VA 2D74A 4BQSA 3FDIA 5DN6D 4Q4JB 3PEWA 4C2TA 3DOFA 4QG7A 1PV4A 1W0KD 3GEHA 3BERA 1HURA 2CLSA 3RSOA 4ACBA 2NMVA 4Q9KA 4ZKEA 4IXNA 1KZGB 4V03A 3QY0A 4DB2A 1OW3B 1EX6A 1CJKC 3GJ4A 5EZ6B 1GRRA 1A2KC 1K5GA 3UKDA 3U7HB 1GZSA 1T8UA 4Q9JA 1N6NA 2V55B 5IT5A 5HE9A 4TYNA 1CR1A 1MR3F 2XGJA 2JA1A 2BJVA 5K8TA 3LA6A 2PT5A 3B13B 4TMZA 4BFXA 1QHNA 3TLXA 2O8EB 3AVQA 5C46F 3T12A 3AF0A 4TMKA 2OM2A 5FTNA 2P6RA 2ZSBA 2WOJA 4US1R 2X8AA 3D3QA 2PZGA 1S9HA 2PLRA 2ZSAA 3B9QA 1US8A 1YQTA 1KK3A 4K81B 2QAGB 2QPOA 1Q21A 3AVOA 2G9NA 3HP1A 4LJ9A 3GCGA 4NMMA 4F4JA 4PPGA 2WTUA 3EZ9A 5JI2E 1RKBA 3CF6R 2R8RA 5DH9A 4XJXA 1XP8A 4DKXA 2Q21A 2H8KA 3X2SA 1KIMA 2F1RA 2GK6A 3BRWD 4B48A 4E22A 2XJ9A 4D6PA 1N6PA 4C9BA 3NIBA 5JHHB 1D9XA 3QF4B 2TMKA 5LD2C 2R6AA 1CRQA 2QP9X 3KX2A 4Q4HA 5P21A 2C78A 1G6HA 3UG6A 1ESNA 4YMUA 4ZDJA 1OH7A 3CPHA 1P62B 1P2SA 2FZ4A 2XEXA 1HE8B 3KFXA 2RGCA 1UFQA 3A1TA 4P4SB 1W36D 4FCVA 4QBFA 4EPVA 2PT7A 2R6GA 5JFGA 1R5NA 3AF4A 4O2LA 4PR0A 3U3OA 4FCWA 4TN1A 4NHOA 3LQRA 4U5XA 2LWIA 2NPFA 3GLFE 4KO8A 4DC9A 2RGEA 4LDJA 4GNKA 5JCZA 3DMDA 1Z47A 2EU8A 5H8WA 3RABA 5FOVA 1SXJB 3LQQA 3R20A 3L0OA 3AUYA 5FPHA 1OXUA 4NCJA 1II8A 4EQ6A 1E2GA 3CNLA 4YMVA 3SU8A 3FFBA 4TTPA 1VCOA 2AFHE 1W7AA 2J7PD 3WMGA 2GVDC 3BD9A 3CWZA 2IUUA 4TWZA 3TR5A 1E1RA 5JHGB 2VQSA 4TTRA 2J7KA 2GXSA 3GP8A 1CP2A 3EZ2A 3B8HA 4FN5A 4XOIA 5IDVA 2GEDA 2ZROA 4XTRA 5LDDC 4IKEA 4W5JA 4OHZA 1JALA 4UNPA 4B6FA 1GIAA 4Q1CA 1OSNA 2DYKA 5BW8A 2AN9A 4B75A 4JL8A 2VSXA 3T1QA 2X2EA 4HUQB 2KSQA 2CJWB 2WM9B 4MUBA 3ZQ6A 4BFZA 2W83A 1MKYA 2WWWA 3FMPB 2D2EA 4QKQA 1OB2A 3CX6A 1E9FA 1CJMA 2JIZD 1VYVA 3ZZUA 3QKSB 5J4YA 1OXXK 1PZNA 2ZR9A 4A36A 3FMFA 2XXAA 2QUZA 1W4AA 2CCKA 3A1SA 5CIWA 4FWIB 3AVTA 1XPOA 4GZLA 2IYXA 4HAXA 5CK4A 3QF4A 3I92A 5F3WB 5L3SA 2WHXA 3AP2A 1G8FA 1MO4A 3T1OA 1SGWA 3VU9B 4NYJQ 2EFCB 1SKYE 2GZAA 2WSMA 2C95A 4HI0E 3BFXA 4RVCA 1G7TA 4RZ2A 1JQLB 2FA9A 1I2MA 2CHVA 3QI2A 4KXFB 3NHBA 3T34A 3VR2A 5FH9A 4NONA 5CYPA 1CR4A 1P2UA 1T0HB 2RHDA 3LW8A 4A2QA 1U94A 2RH5A 1Z0IA 2XTMA 3NH9A 3GFTA 3JVUA 4YXWA 3RC3A 1N6HA 3C16C 4HLCA 5CLLA 2WBLC 5C4GB 1X3SA 2A5YB 1H8EA 1DTSA 1IHUA 2GA8A 3K0CA 4R98A 5A5GA 2ZS8A 3ECCA 4D4MA 3TUJC 2PCLA 1T3HA 4JLOA 3GLGE 4CEHA 3I3SR 3LLUA 3BOSA 3CF2A 1Z0KA 2QPTA 2YWFA 4MH0R 2QTFA 1CEEA 1ODFA 1YE8A 2OG2A 2OUKA 2EVWX 2Q3HA 3PIRA 1CRPA 1FOEB 4UQOA 5AJWA 4TL8A 3TSOA 3LBIA 1XPUA 1ONBA 3PQCA 5JSZB 2QT0A 4ACAA 4B34A 4EJSC 1JJVA 2HXYA 2G88A 4JLDA 2GK7A 2IS4A 1Q57A 2FSHA 4WVFA 3PUVA 2HYIC 2F3RA 5DYIA 1G8YA 2EYUA 5FTJA 4FI3C 4I1UA 3TIFA 5FI1B 3TQFA 2VP0A 2OBMA 4C0QC 2RMKA 3FOZA 4LYAA 4P3YA 4DB4A 1F2TA 1L8QA 2DWQA 3SI7A 1W0JA 2G0TA 3DO6A 3C7KA 4DDWA 3W6NA 1KI6B 4JLNA 4C0JA 1CKEA 4BLTA 2KJQA 1AZSC 3KB1A 1QG2A 1W36B 4G5OA 4IXMA 4JLMA 4H1VA 5FUXA 3U61B 3IILA 3AH8A 3GLIA 5E7IA 5TMPA 5IK2D 1AKEA 1EFHA 5LB2A 4DEXA 1XEFA 2NO1A 2PX0A 1Z2AA 4QFMA 2OFXA 3C5CA 1P3JA 4A0HA 1II9A 2ONKA 3GLIB 3OEEA 3I72A 4QBHA 2PJZA 5H68A 1YR9A 3EWAA 4YXWD 1WCV1 2RGAA 4IDPA 2JATA 3GPLA 3EASA 1S96A 2FZLA 3BE4A 4V0KA 2CK3A 4MA4A 4Q9HA 5AUNB 5BQ5A 1FW6A 5AK0A 3KL4A 1TQ2A 4V0MA 1GL6A 1GKIA 4IDNA 4JSTA 3KUDA 2OLKA 1ZU5A 2AL7A 4B2IA 4DSOA 5JZVA 2QL6A 1KK1A 1BMFA 4US0R 2GJ9A 3WYGA 5JEEA 1YHNA 1MV5A 1KKMA 5EE0A 2FPKA 2XTZA 2QRNA 4GPTA 2O8BA 1P61B 3FKSA 5EXXA 2HYDA 2FSIA 4RZXA 3J81k 1ZIOA 5BWMA 3CX7A 4KFRA 2AHOA 5D3MA 5DYGA 3H4MA 4OI4A 3ICEA 1GSIA 2EQBA 4I1VA 3CO5A 4PC2A 2G77B 2QG6A 3ONWA 1Z28A 2BMEA 4JLVA 2N42A 3MFYA 2JJ1A 5CK5A 4DLZA 4LZZA 4TQAA 4GP7A 4DBLC 2ZYVX 5KDLA 2QQ0A 1CR2A 1G3MA 2HCJB 2CJWA 3FTQA 4LYHA 3W6OA 1R8QA 3VR3A 1HYQA 2R6DA 4B47A 1W4CA 4PXAA 2FWRA 1PUJA 5FL7A 3PR1A 2B7CA 4L4UA 4HLQB 2JLXA 3W9YA 3X1ZA 1FUKA 1A4RA 2CLCX 2AXPA 1J8MF 2J46A 2YHSA 3ZVRA 1CJUC 2HEIA 4NKRA 4CEIB 3IEVA 4KODA 4ITRC 3TMKA 2FX3A 4ESVA 4C0AC 5FTLA 3AF3A 3V4RA 1J2JA 4LHYA 2W6IA 1FMLA 3EZFA 1KI2A 1DOAA 3CBQA 2ZRIA 3CNOA 4WAUA 1LFDB 2J45A 4LHVA 3RS7A 1MOZA 1E0SA 2ODEA 3QJYA 1LF0A 2BEKA 3A4MA 1G7CA 3MWYW 3PEVA 1RIFA 4BPBA 1W4RA 4D0NA 2EFDB 2ZI4A 4EJSA 1AZTA 4HDCA 4IOKA 3Q5DA 3THXA 1HV8A 3FHOA 3K0AB 1NLYA 3AGQA 2NPIA 3WNBA 1Q1EA 5FL3A 1Z2CA 5EXPA 2F9MA 2ZUDA 1E2PA 1ZM7A 1A82A 4URXR 3HPQA 5JMTA 1R4AA 4Q4HB 4W5HA 2GWHA 3TVDA 2IEZA 2R62A 1J90A 1MRNA 4JBWA 1VCNA 2PJRA 1GNQA 2KWIA 3T61A 1IN5A 3GJ7A 4PO8A 3ZIAA 5KYKA 3ASZA 2GRJA 4MRVA 3K0EA 1CJVC 4TYYA 4QGHA 4DCNA 4YMWA 1DARA 2BDTA 3P26A 1EWQA 3B1XA 1FX0B 4Q4AA 1Z63A 4OQNA 4AYTA 1NVUQ 4MKFA 1UAAA 5TVKA 5H70A 4KSCA 1W5TA 1KI4A 1N0WA 1R7RA 1E1QD 1ZNWA 1SZPA 1SXJC 1NY5A 2ZJ5A 3H1TA 4Q1AA 2UZ3A 2BWJA 3QKUA 4NYIQ 5G41A 2BEJA 1DVRA 1DEKA 1XWIA 3RDPA 2FN4A 1MH1A 1BIFA 3NTUA 4MGIR 2B8WA 4CEIA 2OAQ1 3HJNA 4JSYA 4URVR 3EC1A 3R7WA 3WP1B 2QAGC 2QMHA 2IF0A 3MWKA 4C7OA 1FTSA 3DHWC 2WWYA 2WMOB 4KI0A 4HLUC 4OQMA 2V6IA 3GJ3A 5BN5A 1KI8A 1G21E 1JI0A 4BFWA 3A8TA 1NG1A 4MKIA 1YJ5A 2WKPA 2RAPA 1G6OA 2IYUA 1W0KA 3G5UA 4IHQA 4C3ZA 3K0SA 5L3QB 3SZRA 2PEZA 5DGXA 3IBYA 1GL9B 2C04A 4RD3A 2BV3A 4DUGA 1KSHA 2YZ2A 4GFDA 2XTNA 1OH6A 2Q9BA 1SVLA 3UMRA 3VTKA 3T15A 1IN6A 1Z29A 3GLHE 2VF8A 5KNCA 4B2LA 1Z6AA 2BOVA 1DPFA 2EFEB 4JKIA 3K09A 1G4AE 1T5LA 2IYRA 4LJ7A 1XEXB 3U3JA 3W3ZB 5AUPB 3ADDA 3LX8A 1FTNA 1MABA 2J9RA 4RFSB 2BKEA 2CVFA 1KI1A 2A9KA 2H1LA 2NGRA 2NZJA 2V6JA 4M9ZA 4NYMR 5TXGA 3RRMA 4HEJA 1W48A 4OYHA 5AJZA 4YC7A 1Y63A 2VPPA 3FYHA 3NXSA 4TSFD 1LS6A 1XTRA 4B43A 1W2HA 2ZI3A 2FNAA 1QZXA 3VMFA 2BM1A 2GJ8A 2GCOB 3CR8A 3KKNA 1AJEA 2DFTA 2HJVA 2QSZA 5JJKA 4OHWA 4LBWA 2N1BA 3O8BA 3BXZA 4ZIRA 1OFTA 4ESHA 1WBBA 1QHYA 4HYYA 3RS4A 2QAJA 4Q4JA 2GHIA 3OAAA 3CKLA 2YJTD 3K70D 3P4XA 3B9PA 1WMSA 2ZITA 4HSEA 3FE2A 4ZO4A 1IJEA 3VQTA 1WP9A 3ZH9B 5B30A 4OK5A 2GF0A 1SXJA 4A1FA 1F2UB 2O8FA 1WRBA 2OBNA 4A2PA 1NIPA 4PSVA 4TL6A 1AS2A 1T0JB 3NEYA 2W2XA 3CZPA 2AD5A 2ZRHA 3UWOA 3A6PC 1G20E 4GMDA 3MG9A 2NO9A 1JR6A 3W8RA 1W46A 4LSGA 2O52A 3CZQA 2WWHA 3TSWA 4M21A 3WBKA 4P4TA 1HH4A 4GP6A 4YQFA 1G3IA 4QOSA 1M7GA 5H1YA 2NO7A 3H0KA 3REGA 3TW8B 2VBCA 4EJSB 1US8B 3U7FB 3ETLA 1DAHA 3OZXA 3A58B 3FMOB 4L5BA 1M1YE 3C15C 2A5FA 1GNRA 3KDSE 4LJYA 4NH0A 1XEWY 5HKKA 5JS7A 1TUEA 1LTQA 1Q3TA 4US2R 2ANBA 2CVHA 4DJTA 4JVLA 1C4OA 1M2OB 3MJRA 1MO5A 1P7CA 1OHHD 3RYTC 2JDIA 1OHHA 1ESMA 1QDEA 4ZKDA 2EFHB 3S1AB 3SHWA 2IF2A 2HF9A 1DG3A 1UKEA 3ZLJA 1OIXA 3U3RA 3RAPR 4ZI2A 1ZNYA 4TLCA 1RW4A 3TAHA 1BYIA 2JJ1D 2IXGA 4B35A 3IO5A 4JJZA 3GLFB 3IGFA 3K9NA 1R5OA 1E96A 2WSSD 5KNDA 2FGKA 4PANA 1E2QA 3E5HA 3EXAA 3HU2A 4LBZA 2JGNA 1ZMXA 1JR3E 1YKSA 3I8XA 2ZS7A 5JRJA 2QORA 2FPLA 3LD9A 1SKYB 2UKDA 2ZRNA 2Z83A 3NKVA 1JR3D 1TF5A 2KB0A 2F1JA 3N2EA 1QF9A 3P32A 2H92A 3KKMA 4DHEA 1YZNA 1RRPA 2AWNA 1LNZA 4U00A 1ETUA 3KB2A 3MSXA 2OEPA 4DEYA 4PQFA 4IVPA 4ILEA 4NCIA 4BFUA 5EJEA 4HZUB 2QZ4A 2CHGA 1OXSC 3IKJA 4HLDA 3O8CA 2YOFA 1WE2A 1GITA 3GLHB 1GDDA 3THWA 4DWJA 2I4IA 2VIIA 1N5LA 3JZAA 4PZYA 4B6EA 3HWSA 1XMVA 1N5KA 4AURA 1QHHA 3GJ8A 4KAXA 1ZM2A 4ZCMA 4H1UA 2FDCA 2QBYA 1KSJA 1WA5A 3GJ5A 3WRYC 2OCBA 4Q1BA 2WKRA 2WAXA 2NOAA 4L8GA 3C41J 4F38A 2ANCA 4AKIA 1XF9A 4Y0VA 5AR1A 3RS2A 2WIBA 4YLGA 2WJYA 1Z06A 1JBKA 2CL0X 2IWHA 4AYXA 3QXSA 2VHCA 2DFKB 5CJPA 3FHCB 2J0QA 1HT1E 2A7QA 2ZJZA 3UPUA 4QBIA 4CIDA 4LHXA 1RC8A 1NSFA 4M1OA 4WBSA 2WSSA 3LX5A 4C0SA 1IJFA 3CM0A 2ZRDA 3LAWA 4BLPA 2RGBA 3VU9A 1OT3A 4HZUA 4IFEA 4JKYA 4MYCA 1RYFA 4TT3A 2IC5A 1ZYUA 3SN6A 4K46A 1HQYE 1R0ZA 1D8TA 4KFUA 3RLFA 2C9OA 2REOA 3O8DA 4X8OA 3U44A 5F9FA 5GJCA 4LJ8A 3THOA 4DLXA 3GLGA 2P5SA 5JCPA 2IYLD 1H65A 1XMSA 1ZIPA 3TNFA 1WQ1R 4QHSA 2VP4A 1G5TA 1XCMA 2FSFA 1LW7A 2JJ8A 5EXSA 5CM8B 1ZNZA 1G3QA 1NY6A 4JLPA 1S1MA 4PC6A 4B3CA 2XZOA 2ZRKA 5GJBA 4V0OA 1ZCBA 1XNJA 3PITA 1L4YA 1E2MA 3ASYA 3X1YA 4EAQA 3R9XA 2JLVA 2CL7X 1RFLA 2GESA 1S8FA 4HUQA 1E2DA 2V9PA 2AK3A 1UBFA 1T6NA 2ZYWX 4YMSA 1CTQA 3FHTA 3V4FA 5EP1A 1XRJA 1FNNA 3AB3A 2HT1A 2FFHA 4ARZA 2IL1A 3GFPA 3AF1A 2XOKA 1Q1QA 4RFVA 1KK2A 3B1VA 4O0MA 4CZ2A 4JS0A 2NZ8A 5L3SB 3PEYA 1G19A 1TU4A 2ZIAA 1RRGA 3AVYA 3KKPA 4QM6A 1IN8A 2A5DA 2IYTA 5GJVC 1Q0UA 2FJUA 1N6LA 2QROA 2ZE8A 3F3YA 2RGDA 2O8FB 2B8TA 4IEEA 4M9XA 4TYPA 2ONJA 1M7HA 3KXKA 3PXGA 2GZHA 3UIEA 1X8JA 2DPXA 1Z07A 4LHZA 4PAMA 3PUZA 3VAAA 5SZIA 3OAAD 5JBQA 1GWNA 3ZVLA 5KPJA 2CE7A 2P3SA 2VF7A 2ZVPX 1COWD 1NJFA 1KI3A 3U60B 3QUSA 1JNYA 2OT3B 2VRWA 3FWYA 1VYUA 2WJIA 5J47A 4G5QA 4LPSA 4E5UA 1XZPA 1FQKA 4JJKA 2OFOA 1E2NA 4AWXA 3EZ6A 1XTSA 1ZM4A 3HR7A 3LXRA 3NDPA 4PTLA 4JL5A 2O0JA 4MGKR 1IY1A 2R44A 4DSTA 2G1KA 3A37A 4C0HA 1OH5A 4RFSA 2ZR0A 4I99A 4O25A 4DLVA 4LV6A 2PLFA 2J0UA 1ZBDA 1CIPA 2IHYA 2ZRLA 2CXXA 4DXAA 5TB5A 1IONA 1NRJB 4FMDF 1TUIA 1FZQA 1ZC4A 2V7QA 4G01B 4AYWA 3I73A 3OF5A 4JVSB 1IAQA 2B92A 4Z8YA 1TAGA 4KFSA 3AVVA 2QMUA 1DAFA 2JLRA 2ZSDA 2OILA 1EFRA 3LBHA 1RYHA 4M53A 3UK6A 3MMPA 4XSGA 1Z6XA 4EQ6B 1RRCA 2VP2A 2YVUA 2PZFA 3MJHA 3TVTA 1F60A 2WV9A 4NZYA 1YZGA 5KPDA 1KI7A 2ZSEA 4Q48A 1P9RA 4HZIA 2PZEA 2OE2A 4FMCF 3RRZA 5EUMA 2GEUA 5G40A 3MWLA 5J5CA 2YWGA 1IXRC 4ARZB 4RKFA 1P73A 3PFIA 1E9EA 2GJSA 4GDFA 2P67A 1TTTA 4JYCA 3PUWA 4FINA 4GOXA 3WMEA 1XB2A 1W4BA 4DSUA 1RJ9B 1OKKD 1WXQA 2ZI9A 4XVUA 2NQ2C 3SQXA 4M1KA 2ORWA 1U0JA 1U9IA 1VECA 3L0IB 2IS2A 1R0XA 621PA 3EPHA 4E07A 5DLQC 3QG5A 4IJMA 4PHHA 1E9RA 2REBA 1NLFA 4Z1MA 2VHJA 4DDUA 2WPDD 4DLRA 1OJLA 2SHKA 1D5CA 1D9ZA 2XITA 3H86A 3NH6A 4BFSA 1YR8A 3M1IA 3EZ7A 4DCTA 3MLEA 1F5NA 3IO3A 2L0XA 5AJVB 1E9CA 4IDQA 2J0VA 1E4YA 2WKQA 3AV0B 4HB3A 4QJ5A 1GP2A 2FSGA 4NYMQ 5HKKD 4QJ3A 1G41A 1IM2A 3I5XA 1XCGB 2C2HA 4E09A 4D82A 1X6VA 3PEUA 5TARA 3ZVMA 1AA9A 1KY2A 3GLGB 1G8HA 4LYFA 4Q7JB 1E3MA 2A5GA 4CYMA 2PL3A 3BK7A 3ZIAD 1XJ0A 3UATA 2AKAB 4NBSA 1T8TA 1X86B 3TW4A 5IK2A 3L43A 3U7EB 3VR1A 1R0WA 1A5TA 2GBLA 4LHWA 3VR6A 1TF2A 2W0MA 4LJ5A 2D2FA 1H8HA 4B3GA 1KO5A 3WNDA 5FPTA 3F8TA 2W58A 3D6TB 3Q85A 1FPMA 2IYZA 2PX3A 2BC9A 2CE2X 3GLFA 2V1XA 5KTYA 3CRVA 2CHQA 3EIHA 3OEHA 4FMCB 2V3CC 2VSFA 1SXJD 2ZETA 3SQWA 1SHKA 4IOLA 2WWGA 3TBKA 2FGJA 4B3BA 2OLJA 2ZYUX 5GADl 4KITB 3BORA 2GAOA 3SFZA 4CVNA 2F55A 2FE4A 5FPKA 4IDHA 1FL9A 4B44A 3HU1A 3T1VA 2XZLA 3ND8A 1Z6GA 2BBOA 3WNCA 2YKGA 4M1SA 3CF0A 2O0HA 2BBWA 3B60A 1JEEA 4A6PA 4DT1A 2QT1A 3Q5EA 3QEOA 3M0EA 2W2TA 4JLKA 1I4LD 3UG7A 4UKDA 3ZZTA 4WZAE 1VPLA 3R9WA 1SQ5A 5GVRA 4D4JA 2DWOA 4XVQA 1UADA 4MQBA 1U2RA 5CB8A 1VG0B 4PO1A 4DLSA 2QA5A 4RY2A 4LI0A 1HQCA 1CLUA 1NBMA 4DDVA 1KGDA 1ZUHA 3JZMA 4KBGA 1H8ED 4KFTA 5B58C 1W2GA 4PSKA 4WZBE 3X1WA 1D2NA 4RSGA 4R2IA 1DELA 3GJ6A 5L3VA 1PLKA 2F43B 1OKKA 2Q3FA 4HLUA 4X8HA 2V4ZA 2H18A 3NVAA 3WBJA 2OSBA 1CULC 2YV5A 3FB4A 4PHFA 1GTVA 4QC2A 5D3MB 1OXTA 5DIFA 1W44A 1R5BA 3BB3A 1EFUA 4P33A 3KXLA 3W5IA 2FH5B 3QBVA 3LXXA 4TL9A 3B82A 2A3RA 4BWYA 3KUCA 3SDZA 1BYUA 5DO9A 4CEJA 1IBRA 4NP6A 3THYA 1QG4A 4ZDWA 1Z6YA 2XNDD 3AP1A 2XXAB 3CX8A 5FOXA 2VHQA 3IEUA 3L82B 3I5YA 4G3XA 2E1RA 5G53C 2O8DA 1QVAA 1G8GA 2IYWA 5CYOA 1WBDA 1TF7A 4ERNA 5B64A 3G0HA 3A1VA 1XTIA 2GXAA 4LGMA 2MSEB 4TZ6A 3M6AA 3OE7D 2RGNA 4K8OA 1TEVA 1OIVA 2O8BB 1R2QA 3UMFA 4XIGS 4ZIRB 3K0FB 3KQNA 3QPWA 4M9QA 3MUFA 2DR3A 1GKUB 3E2IA 3RRYA 1VG8A 4B71A 2YOGA 2J0UB 2JJ2D 3NBYC 1FP7A 4BFVA 3PUYA 1T9HA 1E9SA 2RHMA 4HB4A 5KDDA 4JVMA 3B2EA 1E1RD 1KSGA 2Z0MA 2FEOA 2C99A 2ZI7A 3CRW1 1K5DA 2WZQA 3C4JA 1RPZA 1NVWQ 2J41A 3KJEA 2R6FA 4LC1A 5KO2A 1VTKA 2P6UA 3SFVA 1TU3A 1SVKA 2D06A 1ZRHA 2JLYA 2WWIA 3LY5A 3AM1A 4Q5IA 1MO3A 4NTZA 4E03A 1OFHA 2F7SA 3GMTA 1G3UA 3OFNA 2X1VA 1U98A 1E69A 2NO6A 2CEAA 3HDTA 2P2LA 3EPLA 3GEIA 2IW3A 1CBUA 3QXJA 2BHRA 3GFOA 4H9GA 4LC0A 4M4SA 1BO6A 2RKOA 1H8HD 4FXPA 5JS8A 4IVRA 3K0CC 4LBVA 3HR8A 821PA 2B21A 5KUTA 1UM8A 4BZQA 5DI3B 2IX3A 3I62A 4BECA 1DAGA 4EFNA 4EUNA 1KHTA 5FOUA 4RD1A 1AIPA 1HY3A 4AK9A 3VKGA 1EWRA 3PV0A 2EW1A 4G5RA 3O8RA 1N5IA 3FVQA 4N0EA 4NCHA 2G3YA 4BE7B 1M8PA 2RGGA 1X1RA 4AKHA 2W0SA 1E2EA 2ZE6A 3W6PA 2C77A 4C2UA 1E2LA 2W6ID 2WJJA 4TQ9A 2IHBA 4S35A 3SBEA 2O8CA 3VR5A 3KTAA 1XXHA 1VIYA 4JLJA 5FBRB 2FF7A 3QNUA 1NMYA 2IS6A 3WYFA 4YMTA 1NN3A 1E4VA 1DO0A 4FW9A 4MYHA 2BCGY 3E70C 2HJGA 1J99A 4AY2A 2ZAOA 4LJAA 4V0ME 1NN1A 1JAHA 4Q4AB 4QBGB 3ICQB 1KNQA 3NWJA 1JECA 3TKLA 3ZJYA 1TQ6A 2CDNA 1EG7A 4BASA 4BLRA 1UF9A 3DL0A 2KI5A 1UBGA 4DIEA 3IHLA 4FIDA 4NE2A 1SULA 3X1XA 1KI9A 2H57A 1ZU4A 2IXEA 1NMZA 3Q7QA 3X1DA 5J4LA 4PQYA 1VKJA 2P65A 5FFMA 1S0UA 3OIUA 2E9SA 3B85A 4XWAA 1BS1A 4JT4A 3HYTA 4XH9B 4GZMA 4KCGA 2VTKA 4LJ6A 1AQYA 2I1VB 4PFSA 4NCNA 5CM9C 3RANA 2REXB 4LY6A 2GZDA 2O8EA 1TADA 3LDAA 3TJZA 3ZYCA 2Z5FA 121PA 1LV7A 3OFND 2YINC 1KKLA 2J1LA 3P1JA 3TQCA 2YWEA 3B6EA 1YRAA 2J3EA 1KJZA 3QXCA 4F7WA 3OIWA 1P72A 1NVVR 4UXHA 5KU1A 2V7QD 1P9WA 4Q1EA 4DCVA 3OEED 3EIQA 2GCNA 3I61A 2D7DA 1S2MA 5CJ2A 4BEJA 1Q12A 1OIWA 1DAIA 3QE0A 4XSHA 4CT4B 3GJ0A 3C14C 4PHTA 3SJZA 3LV8A 3TE6A 2IK8A 3JVVA 3DMNA 1XBTA 3LWNA 1OFIA 1MABB 1BOFA 3A1WA 1XEXA 1L7VC 2OO7A 2OCPA 2W2VA 3FFAA 2FFQA 4AI6A 4M0LA 2B7BA 2GF9A 4L9WA 2Q3MA 1FFHA 4OQLA 3TUIC 4JBXA 4HAUA 4PHGA 3PCRB 4PC7A 5HTKA 2BIFA 1R0YA 2C03A 4Q00A 3T5DA 4F4IA 4KVGA 3T35A 1AK2A 1SVWA 1XXHB 2F6RA 3UXMA 1IN7A 2C5LA 1EESA 1KAOA 4ZV4A 1ZINA 5E95A 1J7KA 3U44B 3BBPA 4KLZA 3THXB 4F92B 3CUEF 2ZRMA 2CLDX 2J87A 2KE5A 2Y8EA 4CEJB 1Z3IX 4D2IA 2WWXA 3TH5A 1NVXQ 1GRNA 2YOHA 4RD4A 4RCZA 4RZ3A 3WP0A 5J4VA 2YYZA 5EP4A 4Q02A 2BJWA 1GVNB 1PVOA 1E79D 1P9NA 1V5WA 3AVUA 2QTVB 2WOOA 3VHLB 2ZJAA 3H84A 2QP4A 4BZPA 3RRNA 3DPUA 1ZVQA 4TMWA 2IXFA 4UNRA 3SBDA 1S9DA 1FNMA 3IPYA 5CB6A 3ADCA 1IY0A 1GILA 2WJGA 4B32A 1DS6A 1DG1G 1S1CA 2RGNC 4R71A 5EZ5A 2ERYA 1KDTA 1X1SA 1EK0A 4JLAA 4BUJA 2ZUCA 5D3QA 2OAP1 1C1YA 4OL0A 1JPJA 2DBYA 3WHKA 4CRWB 1HT2E 3N70A 4OI2A 1E9DA 5DHAA 4Q47A 3K09C 2Q6TA 4PX9A 3RS3A 3WY9A 521PA 1WB9A 3B78A 3H2YA 5AUOB 1KDOA 2D4HA 1MRSA 3LFUA 1QHHB 1ZJ6A 4KYUA 1E79A 3V00A 2AK2A 4J0QA 2ZAMA 4LJ4A 3UWKA 1JEDA 1F2TB 1KZ7B 1S4QA 1T4GA 1CS4C 1XCPA 2GXUA 3NC1C 3TGPA 2JLZA 1XJCA 1EFTA 3KKQA 3VKWA 1TL7C 1E0AA 4UNSA 2OHFA 1G291 3W3AA 3RHFA 4FMBB 4P32A 1NKTA 4CF7A 1GRQA 4Z54A 1FUUA 5FTKA 1E6CA 1A2BA 4PC1A 4HB2A 1YZTA 2H7VA 4KU4A 4F93B 3TR0A 3EPJA 3DKVA 1E2FA 5CDFA 1OV4A 4BRWA 1XTJA 4DCSA 2GDJA 1NP6A 2QEQA 4L16A 4URUR 1XMIA 1DE0A 2G0NA 3QG1A 1D2EA 2EFGA 1ZD8A 2BCJQ 2XOKD 2J5XA 5JEDA 1II8B 1QHIA 2HCBA 4Z51A 1QHGA 4IEIA 3KQKA 1KMHB 2BMJA 2ZE5A 4FMDB 4TSFA 3EA0A 4JZKA 3ZD6A 2G1JA 4QL3A 4Q9IA 3HYRA 3GQBA 3R8CA 8OHMA 3IPXA 3BGWA 1JXMA 1KNXA 4QHTA 4XTCS 5JRZA 2I3BA 3MRSA 3SJCA 1IXZA 4BLQA 1NLZA 3NEJA 2IT1A 3DEFA 2EWWA 3GEEA 3SHFA 4Q66C 2GJAA 4I4LA 1NI3A 2QNRA 1XPRA 4QNRA 4B73A 4P0TA 2VP5A 4YONB 2ZREA 4LRWA 1OB5A 5HZHA 4JMPA 3KQLA 1P6XA 1DAEA 4I81A 5FL7D 2BM0A 4YDHB 4II7A 4LPKA 2F43A 3QKRA 3QENA 3EG5A 1G3RA 5KOYA 5AJYA 3K8YA 4Z1MD 2PCJA 1AQUA 3CRRA 5EP3A 2DFNA 2VO1A 3PG5A 3LO5A 4C0LA 2C9CA 4PC3A 4AIIA 5FI0B 3OESA 1UDWA 1M34E 1P75A 3QVUA 4A9AA 2HLDA 1OYYA 3RSLA 1OE0A 1IQPA 4A92A 2HUPA 4ON9A 3SJAA 3L0SA 3U2QA 4KHZA 2PBRA 1ZW6A 4F4CA 2J0SA 2ZVQX 4A82A 2D3WA 1N6OA 3Q9LA 3EA5A 1G64A 5TY0A 1E32A 2R9VA 4GRAA 2G6BA 3LW7A 3U3MA 2IS1A 2DFLA 2MMGA 1EXMA 1G16A 2OESA 3T5GA 2JDID 3CIOA 4DZZA 1E0KA 4EIWA 4YDSA 4XWKA 1N2CE 4GOJA 2CK3D 3RWMB 5HZKA 2ZU0C 1ZP6A 4QHYA 1TQ4A 1NN0A 3W8NA 2W00A 1K6MA 2FFBA 1HUQA 2Q9CA 1Q1ZA 1KO7A 1VHTA 2XX3A 1OFUX 4GMXA 1YVDA 1R8SA 2WICA 5GVSA 2JLUA 3CH4B 2PMDA 4PZZA 2H16A 1Q1BA 4LK2A 2AR7A 3BC1A 2ZRFA 4A8JA 1C9KA 2VYFA 3TK1A 4M1MA 1JPNA 1U81A 1U90A 1YZQA 4BRUA 3U6BA 3IIJA 4BFYA 3IQXA 4KSBA 1IY2A 4EFMA 4KLNA 4GBMA 2GILA 1JR3A 1Z08A 2ZU6A 4A0FA 2XB4A 1ZC3A 2YWHA 1P5ZB 3UANA 3THWB 3K70B 2QPAA 3QOFA 5EE1A 3U6KA 4BLOA 4IVQA 4D0GA 4TTQA 5JWRA 1KDPA 1W0JD 1XMJA 3B7GA 5L8VA 2NTYC 1GOTA 5HCNA 5A0FA 2G83A 3L0PA 1OH8A 1B0UA 1T5IA 3K9GA 1YU9A 5DHFA 3UMSA 3WRXC 3SC3A 3NHAA 5E3HA 1NBME 2JLSA 2ZANA 3R9IA 4CW7A 1UEIA 4EPWA 4O3MA 4ASUA 2CNWD 2IBMA 2PEYA 1G5RA 1W36C 4MRPA 3ZD7A 1RJ9A 1TQDA 1M74A 1KSFX 3RWOA 4DLWA 1BKDR 2ZEJA 4OBEA 4XWOA 1PLLA 3PJRA 2QMEA 5DISB 5C18A 4OKSA 2N46A 5E7MA 3U4QA 3LVRE 2KBFA 1IOZA 4PAOA 1P60A 3SEAA 1EFCA 1SHZA 3QIAA 4DRZA 4P4SA 4JL6A 4Q7MB 2WWFA 3AF2A 1Z6TA 1Z0AA 4TL7A 5JWHA 1A1VA 4FD2A 4Q7KA 3A4NA 5CLQA 4IDOA 3AVPA 1ZM9A 2BBTA 3RVBA 2Q0HA 2GBLC 3S1AA 3OE7A 4S2EA 4ZPXA 1CU1A 2VH5R 5G3YA 3VNVA 1N0UA 4GI7A 4RD2A 3IUYA 3CR7A 1KO4A 1X8LA 1ZAKA 1P4SA 4QXAA 2XAUA 3AKDA 4WW0A 5BYKA 4B33A 3CONA 1XEWX 4LX0A 1Q44A 1OYWA 4WXPA 2HT6A 2NO0A 1E0JA 3AQ4A 1BMFD 2XNSA 1Z0JA 3DDCA 2D7CA 4FCTA 1U99A 4QGAA 2GEVA 1GUAA 3SYKA 3N5CA 2F3TA 3OHMA 3Q3JB 4QGFA 1ZM3A 2CCJA 2Z4SA 2QU8A 4TT3D 2AKYA 1KJWA 5L3RA 1XZQA 1SKQA 2GXQA 2JAQA 4MITA 2QMOA 2QGZA 5EE3A 1FX0A 1KAGA 1N3BA 1U9IC 1S3GA 2NG1A 3KTAB 3OIVA 3VX4A 4QJ4A 4RD0A 2AXNA 5EUQB 4GL2A 5FTMA 1N0VC 1AGRA 1UJ2A 4MRSA 1PLJA 4EPRA 1DADA 4U02A 1G1MA 3O47A 1A7JA 3SYNA 4MKGA 5B2ZA 1E2KA 1E98A 1NMXA 1P2VA 2QP3A 3I4LA 1M6NA 5K8UA 1SVSA 1OXVA 2B6HA 4A4DA 1G8PA 2JJ2A 4LV8B 2AWOA 1XU4A 4TLAA 1GM5A 1GFIA 2GJKA 3NBFA 4TZ0A 2HDNB 1FQJA 4V0NA 1EGAA 2A30A 3U5ZB 3FPAA 4AKEA 2V1UA 1U8YA 2QQEA 2ZTSA 5AUQA 5BYJA 3SE0A 2VL7A 2C96A 2FG5A 1CJTC 3QPVA 2CNWA 2MMCA 1KK0A 1XD9A 2ZSFA 3LH5A 4PZLA 3P20A 5FUWA 2GCOA 1VG9B 5AWFC 3ZS8A 2WVJA 4A0GA 3I32A 2H5EA 5F2EA 4D80A 1AS0A 3FGNA 1YR7A 1D6JA 3W34A 4DUGD 2XNDA 4IFBA 4M1TA 1KOFA 4RD6A 3DOEA 3KXIA 3NBZC 1LB1B 4Q18A 4R9UC 2MSCB 3QPUA 3FMIA 4B74A 2W6JD 1JB1A 4DLTA 3KKOA 3K1JA 1XXHE 2ZJBA 4URYR 4ZDIA 5C4MA 1E94E 2D62A 2HV8A 4MKHA 1DAKA 4A8JB 2ERXA 3CRMA 2YNMA 4CEHB 2FV8A 1RVDA 4Q1DA 1WDTA 2JLQA 3SNHA 1NG9A 5J4HA 3DM5A 5EE9A 5M04A 5CIQA 4DDTA 1JQJC 1N5JA 1LF5A 1UPTA 2R65A 4WZ6A 1IXSB 1DO2A 2UZIR 2ZS9A 4MRRA 4Z8XA 3SR0A 2FMXA 3AKEA 1J70A 1XDBA 3BFVA 4LUCA 1NN5A 4NYJR 5E4FA 5GJWC 2QI9C 2OZEA 2OV2A 4KJZA 2F1IA 4B3FX 2ZJOA 3D31A 1QRAA 3MD0A 2A5JA 2QENA 4D26A 1HEIA 1V43A 1ELOA 3DKPA 2Q9AA 2YC2C 4OHXA 1F3OA 2F1HA 4ZI3A 2IEYA 3RC8A 1JJ7A 3LLMA 2E87A 3QBTA 3W5JA 4HB0A 2DB3A 3BAFA 5A4JA 5BN3A 2V8OA 1D2MA 2QE7D 4TMVA 3L8YA 721PA 3AKYA 1T91A 3N2IA 4M1WA 4W9MC 4FWTA 2XZPA 4UNQA 4UXJA 1AKYA 3WMFA 3OEHD 4HAYA 2FPMA 2ZI5A 4QNMA 3ZDQA 1CF4A 1Z22A 1OPXA 3I1FA 1U8AA 5EE5B 5FR1A 5LBIA 1W47A 4D4LA 4QM7A 2VHTA 2ZPTX 1EX7A 2VA8A 5DE3A 3K9HA 1Z83A 2RB4A 5CITA 4LBYA 1AN0A 2QGNA 5FPSA 2IYQA 1TMKA 2ECKA 5DN6A 1GG2A 3QKSA 4MYTA 4MYUA 2ZRAA 2QTHA 5KSPA 2R2AA 2GTPA 2X2FA 4KBFA 2BMFA 3ZVNA 2EWVA 1N6IA 3GJXC 3K0AA 4M2LA 4D25A 5FOTA 1ZD1A 2J7PA 3L8ZA 4XD7A 2GKSA 1NNEA 4KV9A 2DCUA 4DSNA 3LVQE 3KJHA 1CXZA 2BKUA 3BIFA 4N3NA 4A0RA 5JJLA 2J59A 2V54A 2QRZA 4URZR 1O87A 3A4LA 4C0KA 1X8KA 1L2TA 1DBSA 2OCYC 2XSZA 3B5JA 4M1YA 4LYJA 4R2HA 3V9PA 1HA3A 3EIEA 4NYIR 4PAQA 1W1WA 2GETA 2RGXA 4JLBA 1Q20A 4UNNA 3T06B 4C0BA 4X8LA 3G82C 5F9HA 4OHYA 1KO8A 4KYIB 2QBYB 1PJRA 4CDGA 1KY3A 1XD2B 4DLUA 4PQRA 1FP6A 4A6XA 3RNLA 3VNUA 5FPYA 2GAAA 2DHRA 2FOLA 3NG1A 5F98A 1XJQA 1KI6A 2HLDD 5FOSA 4JVNA 2IUTA 3CRQA 2QE7A 4OK3A 1KO1A 5J40A 2UVQA 4GT1A 3EWSA 4MDFA 4BGDA 2ZYTX 4HDOB 3C8UA 4WIAA 3AP3A 221PA 1R10A 4MUAA 1ZD9A
chains in the Genus database with same CATH superfamily
1AQIA 1BHJA 1PS8A 1PUIA 4FHZA 4XM1A 3CWQA 4BKMA 1Y98A 2ZRJA 2B34A 1F48A 4PX5A 7MHTA 2X7XA 1PNQA 3FVVA 5E8RA 5C8YB 2ASEA 1YI1A 4B46A 2Q6LA 1PP4A 1UDAA 3BJIC 1AGNA 3K1YA 3CPJB 1H1DA 4NEGA 1U8ZA 2QTLA 3M3HA 2ONZA 5DEOA 3S81A 1GKYA 4RCYA 1TQ8A 1Z3CA 2ZAIA 1NSTA 4OH7A 1EA7A 2X77A 1UK9A 5HG0A 4URHA 3RS0A 3SAJA 2K5UA 1LQ2A 2Q4BA 2WD9A 4KP7A 1U0HC 1B41A 3MTQA 4B3XA 3KUXA 1XGKA 4ZCQA 1EK5A 1DTWA 4WASA 1J0AA 1H2FA 2C31A 4OJKA 1UR5A 5EEHA 3LY8A 1C1DA 3ABZA 4MHOA 2W6MA 3HXMA 1GLVA 5JSFA 2B36A 2RAFA 4F9EA 2Z04A 2PKRA 3Q7IA 4D9NA 1V39A 2GUGA 4X8MA 4PS1A 1ISHA 3RBAA 1LVUA 4MIYA 3SYMA 5B1YA 3DWFA 4NX2A 1T3LA 4E4TA 1TEXA 4JUAA 4PLZA 5BSHA 2E4YA 3HADA 5CDFE 5HR5A 1UK8A 2GOYA 4LOHA 3H5RA 5JD5A 2Q7DA 1COWA 2ZRCA 1H5QA 4B6OA 2HD4A 2VK8A 4ZVKA 3SK0A 4Q03A 1XX6A 1HE3A 3L7KA 3IDQA 5EXEA 1QANA 3PVSA 1UKYA 2HKIA 1AS3A 2FW7A 3WLNA 4Q34A 2JCGA 4N0DA 4DVGA 2ZYAA 1Z4KA 4BP1A 4JR0A 3EC2A 1NYTA 4OEHA 2RGUA 4NU0A 2JIZA 2EP8A 3KT6A 2WMNB 1NP3A 1RFGE 2DPGA 2BE9A 5F1PA 4M0DA 5K03A 1TVKA 4FDMA 3OJ0A 4K2HA 1K8QA 2X5XA 2M6KA 3STUA 5KVAA 1I4TD 3C3EA 2L69A 2OGSA 2QR3A 2XHZA 3WE7A 1L5YA 3CBGA 3K70C 4YO7A 1HLDA 4EG5A 1H6AA 4M22A 3HVRA 4CIYA 3PS9A 1XLTA 2VDPB 4HNUA 1YKGA 2ZSJA 1VI2A 3JQ6A 3KQHA 1NMQA 1SUAA 1UJCA 1LCIA 3G13A 1QPBA 1W4ZA 3B3GA 1FS5A 1U04A 2AQ8A 4FILA 3D8RA 4OSOA 4QASA 5K51A 3AEZA 4F71A 4Z7OB 1CCWA 3DMPA 1ZVKA 2DWPA 4HOYA 3SMVA 1F2UA 3RAJA 3UMBA 4F1KA 3RJTA 4CV0A 1A5AB 3WV5A 3IXQA 3I9JA 4QUBA 1TM5E 4TYMA 4TV8B 5CJJA 3VR4A 2R6JA 4ADSG 3NBXX 3D3WA 2A9QA 1KY5A 1OGJA 2EZ4A 1AKQA 1Y5IA 3RVQA 2JBAB 3EG9A 1NJGA 4M9SA 4O29A 4BO0A 1KYIA 4OAQA 5I4BA 2GCPA 5EIHA 5ES4B 4ZAGA 1KL7A 2WJPA 4BNVA 4CCWA 3GWZA 3R2JA 4D0LB 2BISA 2YJ4A 2JGJA 1RZ3A 3ESXA 3FKQA 3NIDB 1QWOA 4NAUA 2IWRA 3DV0B 1XYYA 5L4LA 5GY7A 3EOZA 2YBDA 3V6LA 2A0KA 3FJYA 4KIJA 4MR9B 1Z4IA 4WNIA 1O8BA 1YZLA 2Y0EA 3QSYA 5A5FA 3MQFA 4IX1A 2NSYA 1LY1A 3W8EA 3LPNA 3EF0A 3WFJA 1QVWA 1ZVJA 2WPDA 3INTA 1NAHA 4JIMA 1ZOLA 4OJQA 2NU7A 4UTRA 5LM3A 2GYUA 1XCLA 1NW9B 2JI4A 4LC9A 4CLHA 4PZ0A 5AW8A 1FFEA 2J3MA 2ZVDA 4JMLA 2QM3A 4Q19A 1Q77A 4ARSA 2O20A 1G8MA 2X9GA 3MGCA 3MB5A 5DSZA 4C7OB 3LKZA 4AG5A 4F0JA 5JAZA 1B00A 1T0IA 1G7RA 3U4QB 3M7IA 1SVNA 4XJTA 3GPDG 2GKOA 4YRZA 3FCSB 1XKQA 5BO5A 1PR1A 2VCYA 3PRYA 4RPIA 4LDAA 2RAVA 5D3ZA 4JU9A 3TMYA 1JDVA 5A0TA 4L4RA 5DBHX 2IE0A 1HLGA 1P5HA 2FEKA 5FHQA 1C7QA 4POAA 9ABPA 5JVDB 1SVIA 4KO4S 3HY3A 4KYTA 3M1YA 3NIGB 4QAJA 4UUPA 1VCMA 4H3HB 3D6FA 3DQPA 4ND2A 1YR6A 2HF2A 4MVWA 1ENPA 4CLOA 3TECE 2OC4A 1OYOA 3OURA 1HQKA 5WRFA 5K01A 5TT1A 3FPGA 2DLNA 4EY5A 4GMGA 3BIWA 4DV2B 2DEUA 1O5OA 3IOCA 4DM4A 4ZYYA 3D4NA 1XQYA 4BZXA 4P80A 1BXGB 3QX8A 3W1EA 1YS7A 1BROA 2ZAGA 3OE5A 1JDBB 1U9JA 4TRRA 3CJQA 3R24A 1J2YA 2CCGA 1WJGA 2WYOA 1B23P 4D4KA 5BUSA 3HI4A 4DLYA 3EEFA 1XTPA 5EYPA 1MT3A 2HPZA 4CKZA 1OJ7A 3Q2OA 3UHJA 5AI8A 3BHIA 3U13A 2B94A 2HN9A 2I1WA 3COZA 4ZAZA 2YXBA 3ORFA 2Y1GA 5C4IA 4FU0A 3SYLA 2PHZA 3DDHA 3U3KA 3SIWA 1VMAA 1ZY2A 2VP6A 1I2DA 4H7PA 4M0EA 1JEQB 3O8LA 4G81A 2PFGA 3IP6A 3JWIA 5FOWA 3FI0A 5IYZB 4CGZA 1LS1A 1Q7EA 4OHUA 3EZYA 2GBFA 3CA8A 5KHOC 1B1CA 2Q7OE 3KSUA 3I1YA 3PUJA 4UHDA 2AH5A 5LA6F 3EPKA 4J2HA 1SCIA 1KFCB 1Z5ZA 3BSFA 4MPPA 3I8SA 4AJIA 1KZ4A 2R8YA 4QEDA 1YE3A 2AZMA 1WEKA 5T57A 2V3WA 4DIDA 1T5OA 3V8BA 3AR4A 5CVVA 4RJTA 2ZJ2A 1L7QA 1XDWA 1RHJA 2VWGA 1XD8A 3NP7A 4HAWA 4Y9TA 1CY8A 2FU5C 4QREA 4CQLA 1CUJA 3RADC 1AGYA 3FFXA 3X1MA 3VSAA 2JEZA 3UQZA 1HK7A 5LYYA 3I9FA 5TV2A 3RS8A 4V02A 4EEXA 1P77A 5I7RA 5HSGA 3NALA 1C0EA 1V41E 2GHQA 3EYWA 4P36A 2GNPA 2C3UA 4BNJA 3GELA 4TSRA 5TR9A 1UT6A 2DY1A 2SBTA 2JASA 1YJQA 1MN6A 4R7ZA 4XDZA 1G42A 4ZV7A 3I05A 2Y1EA 5ALTA 5BYBA 4ENSA 5B7NA 3K0FA 3HA5A 1UP6A 4IOMA 3WYAA 2EKPA 4DDKA 4J7CA 4CNQA 4FLFA 1JHZA 2VK1A 3LWZA 5ABPA 4KPEC 2O06A 4RKQA 4FZVA 2ADMA 1YT5A 1Z8FA 3OH8A 1XK7A 1J9GA 2FCAA 4OPMA 5TEWA 4BP8A 2VJKA 1IXKA 1C9MA 4HH1A 3C4QA 3HCNA 4IG4A 3T1TA 2CBXA 3IPLA 2F8TA 3CTPA 4XX0A 1TRKA 1TD1A 3HNRA 1ULHA 3QPAA 2JFZA 2ZM5A 4ZI7F 2HLPA 2ZR7A 4B7ZA 4C4RA 5I7VA 4NFSA 5JC1A 4BE4A 3N8IA 1QB8A 2XMBA 1DJLA 4Q3NA 5IDQA 4B0OA 1B6RA 1M6YA 2Q3CA 3BWDD 1S4MA 4JVOA 6NULA 4FOPA 1WQ3A 2JLBA 2JLWA 1E6EA 4QEZA 1LKZA 5D85A 1L4KA 1SB8A 5F1YA 3OZVA 2XD9A 1VDZA 3WL7A 3S5JA 3JQAD 3DM9B 2QIPA 1V5IA 1MMFB 5TDHA 3UXHA 1MHTA 5IKOA 3W2HA 1FFYA 1NF3A 2J3HA 2P5TB 1JIKA 3A2MA 4D8UA 3PPYA 1PFYA 2FW1A 4HAZA 4ZK6A 1WKCA 2HNBA 2DUJA 2RCNA 4GYKA 1J8YF 2H85A 5LYJF 1P5JA 3I6YA 3TDMA 4YXFA 4DNQA 1WVMA 2H1FA 2EYQA 2ZJ7A 4LQLA 5SZHB 3CB4A 3P9XA 4MWEA 4EY3A 1MO6A 2DPMA 1KZ9A 3LQ4A 1W87A 1K8ZB 3IMEA 1HDRA 3QXHA 4NENA 4AN4A 1K4MA 2HA0A 4UXIA 3H42B 4CTNA 4FDAA 4HT3B 2C92A 1MT0A 4XWWA 1W0CA 3HL4A 3TBHA 3AKCA 3V55A 2BHSA 3FUUA 3TUZC 1SVMA 2CC2A 2I7CA 1PWHA 4B9EA 1NL3A 2W2LA 3PFBA 3PEEA 4UBOA 2FUNB 5JECA 1KQGA 3NKLA 3QXGA 2JGMA 3L77A 1UJ4A 2X4DA 3CW2A 1UPAA 2XCQA 2F9LA 3HCCA 1BD4A 2GNOA 4N40A 3ZGVA 2BMDA 2ZRGA 4AMBA 1RXYA 1WXEA 3U7GA 4OQFA 4RUKA 4TLEA 2WU3A 1O77A 2NIPA 3E9EA 3IP9A 3M5PA 4ITUA 4J7XA 5JAUA 4G0UA 3AGPA 1X9IA 2FPGB 1UBEA 4QWWA 1KU6A 4B79A 5B5SA 3DFFA 5AP9A 2C98A 1UKZA 2BM8A 3TJRA 2NYAA 1QE3A 1OC4A 1ZSVA 3KZNA 3L0ZA 4ZVLA 2WIAA 2P9ZA 4H0NA 1G2OA 4BQSA 3EGIA 2JFFA 4JXKA 1AXEA 1H1LB 1PV4A 3TGLA 4CLRA 1GA4A 2LV8A 4YI3A 3BERA 1O94A 3P2KA 1FK8A 3M4XA 2QTMA 3WLTA 4ACBA 2NMVA 5B3AA 4IXNA 4V03A 1GZ5A 3UGQA 1NYLA 1KAMA 3U17A 5G1NA 3E15A 2YYYA 4FEEA 2OV3A 1CJKC 3RK0A 1Z5PA 2QUHA 4MS4B 1A2KC 4LS3A 2O3UA 1GZSA 3GRZA 3ECSA 3LIPA 3NUZA 4HPJB 1HL3A 4LDNA 4O4HA 4KN6A 1MR3F 4S2UA 5HE9A 3HJGA 1D6NA 3KQTA 1JHVA 5B4VA 5K3EA 5K8TA 5K3FB 1BKSB 1Z7WA 4TMZA 5CUQA 5H9VA 2A1UB 4QPJC 2YMQA 2FR1A 1VHQA 3T1HB 1KQ3A 2QW1A 1S3FA 2EEPA 3HVUA 3N39C 3T12A 3VVBA 1IUKA 1GFWA 1Y3IA 4ND4A 3AIOA 4US1R 3R5TA 3H3JA 1E7MA 4EMSA 4CMCA 2PZGA 3C6XA 1Q0RA 1APBA 4LZLA 3DFZA 4F5YA 2FSVC 1US8A 2H1IA 4U4AA 5JNTA 2FAXA 1Q21A 1PSWA 2C9ZA 3NATA 4AY4A 1PFWA 1AB6A 4LJ9A 5K0SA 2CMFA 3B7PA 4PPGA 4YPVA 4EI9A 2PLAA 3QBDA 4J6EA 5JI2E 3CF6R 3NHJA 3NX4A 4H15A 1HDXA 4PVCA 3ZXIA 4DKXA 1XP8A 1OLXB 1ZJ4A 1QH1B 1KIMA 1CEXA 2OHGA 4FX2A 2Y2UA 2B4AA 4NS4A 3W79A 5JYEA 1VLMA 2ODTX 3K2BA 4I2VA 4XI9A 2AOVA 5A5EA 1D9XA 1YUNA 2PUEA 1M10A 5DKFA 3MGBA 4ZMSA 4OXNA 4Q4HA 2C78A 4IIDA 3P9QA 1G6HA 3T5PA 2C1EA 5C8YA 2VDNB 3CPHA 4LNUA 1HZZC 2A9OA 3G8BA 1I5EA 2QL9A 1UFQA 2ZGVA 3GRKA 2PQ2A 1K7YA 4QBFA 1BKYA 3K0KA 3O21A 3L8GA 2CUTA 2Q4OA 3LXUX 4KEAA 4TUYA 4O2LA 5JFGA 2C4NA 1NPDA 3VC1A 4NHOA 3LQRA 4O2BA 4G0OA 3WGOA 4R2LA 4KPUA 2ABWA 5TPZD 3JPWA 3LVBA 4WFIA 5ISMA 4KO8A 2FJ0A 1HE2A 4JUFA 3UKOA 3ZU4A 3GOHA 4OHCA 2REQA 2RGEA 1YVRA 2H0RA 2I62A 2C3OA 1UDRA 1IDOA 4WJZA 2JI8A 3Q8KA 2EU8A 1VI6A 3OPMA 5DM4A 5EHIA 1QRRA 4HHEA 4PEVA 2OYCA 3BA6A 3R20A 2C1ZA 2WI8A 3ROPA 3QV2A 1E2GA 1PT6A 3VPCA 3TLGB 2MYNA 3JASB 2H63A 1C7IA 1AZLA 5KNBH 2HNAA 2GX6A 1W7AA 4RZHA 2J7PD 2EV9A 3WMGA 1EWVA 2FETA 2Y66A 3BD9A 3CWZA 3SF0A 4EG4A 2XMQA 3K2EA 3ZVKA 1A96A 3BTOA 4P98A 1E1RA 4E1BA 3A2KA 3L40A 3EZ2A 2H9AA 1ZWLA 1I6LA 2OCIA 3TCNA 2A5LA 4D3YA 1KPIA 3R6GA 2HGZA 1SC9A 3CGGA 1HG1A 4DWVA 2ZROA 5LDDC 1PS0A 4MPDA 1TD9A 1TAQA 2P9JA 3GLTA 4IKEA 5JPCA 5EHNA 1DO8A 2NZUG 4UREA 3KJQA 2O7SA 1FJHA 4Q1CA 1OSNA 1UP7A 2DYKA 4YUWA 4RDXA 1JDTA 4B75A 3VHQA 2I54A 5DOZA 3T1QA 2ZWIA 4HUQB 4C6HA 3MPOA 3O8OA 3IKVA 4O6VA 4BFZA 4EM6A 2E4UA 2WWWA 1PWZA 1OB2A 4XASA 4OLJA 4BQEA 2AW5A 1X1AA 3OX1A 1QE0A 3ZNQA 1RPNA 3F9CA 4L85A 5DASA 5J4YA 4HKTA 2ZR9A 5E2AA 1W4AA 4G5HA 2XCOA 3SQMA 4UFPA 3PQ6A 3M49A 1IRIA 3GFFA 2MYTA 1TA4A 4HAXA 5ALFA 1XPOA 1T9AA 3DDNA 3QF4A 4IV5A 4IUBS 5F3WB 4E5KA 5L3SA 4C01A 4P54A 3PR2B 1P44A 3ISJA 4ZVQA 1MO4A 1SGWA 4JUCA 2CMHA 1N1MA 1YASA 3S2UA 1SKYE 2V7PA 2GZAA 3K05A 3UJ9A 3QLUA 3BFXA 3KWLA 1EP2B 1G7TA 3PU6A 2WUGA 4RVCA 1QP8A 2FA9A 2VSYA 4MZXA 2IHZA 1X0VA 5FB3A 1M6VB 3D7RA 2HA6A 2Z57A 5FPQA 4WK0B 1KEEB 3Q6MA 1J2TA 1P2UA 1RLOA 1T0HB 4FYYA 4A2QA 1U94A 3GH1A 2XQFA 5C8ZA 4GKJB 4TKUA 3P52A 3SBXA 2IXDA 1NI4B 1WS6A 3GRAA 5C4GB 4EY6A 1JMVA 2JG3A 5BV7A 3E2MA 1IQUA 1H8EA 2A5YB 2G25A 2GA8A 4HQRA 4QU0A 2ECQA 3OFJA 4W5RA 1USGA 4FSDA 4QGSA 3PHCA 3JYNA 3ECCA 5TQ2B 1Y4AE 5IW8A 3Q3IA 4PQGA 3GLGE 4CEHA 2Z3WA 1W93A 3I3SR 4EYOA 2QPTA 2YWFA 2WUDA 2IZ7A 4LECA 3W1VA 3PIRA 3SYTA 5CHEA 4UQOA 3TSOA 4B4OA 2XNJA 4TL8A 4AG3A 3ZCUA 2Q29A 1Q6ZA 2AJDA 1KEVA 1ONBA 2OM6A 3GIDA 1PEYA 1DLIA 1BW9B 5SV2A 4B34A 1SCQA 1JDBC 1WG8A 1JBQA 4JLDA 2RKWA 3DE0X 4O4IA 3KQPA 3KC2A 4XCVA 2XBLA 2HYIC 3X2FA 5DYIA 4A2CA 1C7RA 1SKUA 2EYUA 2PGLA 3G79A 3IT3A 3O4RA 2Y92A 1ONNA 3QWFA 4KE7A 2Y2VA 1T1JA 4L8YA 8ATCA 4X7PA 1KH1A 2XGGA 1H3FA 1ECCA 1I7PA 1X7XB 2VP0A 3GGSA 3O3CA 4NF2A 4K1XA 4C0QC 5F51A 2FE1A 5SY6A 3FOZA 1RXWA 1CY4A 5C3MA 5CAEA 2HZBA 3I2YX 1G21B 3IURA 1H1TA 5GM1A 1F2TA 1L8QA 3WWYA 2AC7A 2YFHA 4ZVNA 3M3PA 4KXQA 5JE8A 3TO5A 1MTZA 4KNVA 3STWA 2UVPA 1SOMA 3L79A 4DDWA 2OFPA 1ZQ9A 1J09A 1KQFA 3PDIA 2CFOA 1IE3A 5BOSB 1U5CA 4G5OA 4KQEA 1X2BA 5EXDA 5AIBA 5E2BA 5EVJA 3TQRA 4KO1S 4H1VA 2R6ZA 3ENWA 3F2VA 4D92A 1C9DB 3DEYX 4JEHA 3PB3A 2F4VB 3BGSA 3GLIA 1KFJB 2DCMA 2EF0A 2ZLBA 3V97A 1AKEA 1EFHA 1T2FA 4PINA 3JRWA 4DLKA 2FMKA 2BUBA 3IR7A 3HCFA 4WADA 2NO1A 1Z25A 2VJNA 3ONFA 3C5CA 3GUVA 2ODPA 4Q9DA 4TWBA 4CCYB 5THXA 4RU1A 1XJ5A 4ZK2A 1JL3A 5K6TA 1NUSA 4AS1A 4AZ3A 1RYYA 2IY8A 1OBVA 4WCVA 5ALMA 5FNVF 1YR9A 2TSYB 4KPUB 2WE8A 3EWAA 4KR9A 3USCS 1JLLB 3OD1A 4KQ9A 1HC7A 2ONCA 2JATA 3DEAA 1S96A 3CF4G 3GUHA 2QJOA 5E0OA 1NDHA 5M2QA 1WCXA 3ZZNA 3RHTA 2QRMA 4YY3B 3DC2A 3JQBA 3IKMB 5AUNB 3H1PA 2ERCA 3T3GA 3GLVA 3KLOA 4LVUA 4ZTUB 1GRVA 1GKIA 5BSKA 4ITVA 3FAZA 5JZVA 1UM9A 3B53X 3U3XA 4YAUA 1KK1A 1IG3A 1BMFA 2PWZA 1TPYA 4IIYA 1ECLA 4GLJA 1SQ0A 1Q83A 2JD1A 1Y34E 3AUFA 3KR2A 3PFWO 4BQFA 5JEEA 4MWSA 5EE0A 1O57A 1P61B 2DHQA 4UHJA 3FKSA 1QTNA 3OTGA 2FSIA 1TKBA 4RZXA 3LT0A 3N8DA 4UMDA 5EXXA 4KFRA 1UMKA 4HS9A 4KN5A 4YBZA 3TIXB 3ICEA 3Q11A 4R2JA 4FEAA 2PSJA 4PC2A 1FLAA 3MFYA 4MVJP 4KIGA 5CK5A 3F73A 2WLTA 3H2JA 4FX5A 1D2HA 4CF3A 1K98A 5KDLA 1O2DA 3LNTA 3SR4A 4F2PA 4F96A 1CUYA 1ZZEA 2AJCA 2HCJB 1M9NA 5I3CA 2V0NA 4BAGA 2I2XB 3GU3A 2HCFA 1L4FA 3TB4A 4IDDA 3AHGA 5IJ9A 4PXAA 3CVVA 3DCJA 4Q9IA 4KC0A 2GERA 4F3YA 3TTWA 5IASA 2JBWA 1L8AA 3IBCA 1X94A 1YJCA 4YS6A 4LOIA 3JQBC 5T3YA 3EDRA 3K5IA 3HRKA 4CEIB 3C3DA 4MDHA 1X39A 5CEFA 3IEVA 1NUUA 4YP5A 2XBMA 5FYQA 4ZI5A 4Z9YA 4MR7B 2W6IA 5DYYA 3EZFA 4MNTA 3C6ZA 2FG6C 3OJCA 3A3YA 3CNOA 2J45A 3P9RA 1KGSA 3CEAA 3UTDA 4F86A 3GGDA 3BCSA 1MOZA 3GXBA 4B45A 4WCDA 1H93A 1LF0A 4XM2A 2CV1A 5BSFA 4YCDA 1YB2A 4J3JA 4AP9A 3C24A 5L4SA 2W4QA 3ROFA 1GNVA 1KEZA 1RIFA 4BPBA 4RTNA 4D0NA 4CIBA 2EFDB 1CS0A 4INOA 1VZ3A 4CMAA 1HDZA 1BA2A 1LLCA 2EP7A 4WBNA 3U9LA 3OQNA 1K4YA 1T4BA 2BDUA 1B76A 2BR4A 1JHUA 3KVNA 4RQTA 4YFYA 1NLYA 5ALXA 1VP3A 1YK1A 1WUYA 4DCOA 2I80A 2Y9PB 1L5HB 1AMNA 4PIVA 3ZH2A 3IAFA 2K7FA 1Z2CA 2ZUDA 4GNRA 1M0SA 1K0UA 2J6BA 3VBEA 2VQFB 1ZM7A 4YCMA 3EEQA 4EF4A 5JMTA 1D7AA 2KLBA 2WZBA 3E7PA 4GI3A 3VNUA 2HRRA 2FSVA 5G4LA 4DQDA 1C1DB 1H5NA 3ZJ5A 1JIQA 4J16C 1V2GA 5KWSA 3ZLUA 1MRNA 1M1NA 5EWMB 5EPUA 2GAIA 1YA4A 2KWIA 2Y93A 2YS6A 2OVBA 4PO8A 1XK6A 2E2WA 2GRJA 3ASZA 1JZQA 3I8OA 5CH5A 1SR8A 1Q84A 1CJVC 1QX4A 2XZDA 4K6KA 3EUFA 4N9QA 3NHZA 4IJUA 1X1DA 4QGHA 3TNLA 1XIVA 3O03A 2XADA 4QPZA 1RHQA 1LEHA 3OOWA 4QVKA 3Q15C 5B53A 4DILA 2IOYA 2BGWA 1YXMA 4GMKA 4MAFA 1AVTA 1N9GB 4ZICA 5IEJA 2WTMA 1UAAA 4J94A 2J3IA 1M2VA 1TT7A 4GM4A 4ZU6X 5TVKA 5IBPA 1T4CB 1KI4A 5ECWA 1PG2A 1C1XA 1ZNWA 3EXHA 5C51B 4NC9A 1EZ1A 1SZPA 3EUAA 2PSEA 2X1LA 3G68A 3AJ9A 1LPMA 1RI4A 5IKEA 2FZGA 1NY5A 3H1TA 3LC2O 3NLLA 4Q1AA 3FTPA 1KDYA 3OOHA 1I4WA 1QORA 3KE9A 4NYIQ 5G41A 3V7WA 1DEKA 3LHFA 1CQXA 3O83A 4WA8A 3EDOA 1NQAO 4ZREA 1EINA 3KUUA 4NK4A 5F9MA 3IODA 1Q14A 4CM9D 4YRKA 1ULZA 5A9TA 4E3WA 5B6PA 5IH7A 2MR6A 4CEIA 2OCKA 2OAQ1 4J3FA 1SXPA 2JCXA 2X0IA 3K4HA 4AN1A 2QAGC 4C4YA 3BA1A 3NTLA 3NPAA 3R0ZA 3OKCA 3B12A 3M6WA 2WWYA 2C2KA 2FMUA 4MS4A 3RNOA 2BF7A 2ZFUA 4FBLA 4YRSA 4QODA 2D1TA 3PLNA 4JT8A 1ADGA 5AOBA 4AJPA 5IVDA 4BFWA 2WKPA 1GPAA 3G5UA 3NDIA 4C3ZA 1WX1A 5KTMA 1JDZA 5KWVA 3K8OE 1PL6A 2GO1A 3QW2A 3SZRA 1RPJA 2ACWA 2PEZA 3IBYA 4Q3DA 3IESA 2C04A 4LXYA 2BV3A 4H6XA 3UT5B 1EVJA 2UUOA 3HFJA 3JZFA 2ZXFA 4DUGA 1OH6A 2XTNA 4KWTA 1SVLA 1NE7A 1A5ZA 3AHJA 4P81A 5ICFA 3R0JA 3A6ZA 2YV3A 3GLHE 4RPLA 1YB7A 5KNCA 3QY9A 2ORED 3UXMA 5D3KA 3W3ZB 4LJ7A 1XEXB 2XCIA 3LHIA 1LTKA 3RU7A 3LX8A 2OXTA 3ZV3A 1MABA 4AUMA 4K0KB 2CVFA 1KI1A 2A9KA 1Z16A 1JKXA 1IPEA 4JJ7A 4TQGA 5TXGA 3ZDDA 2QK4A 4HEJA 1E9VA 4YC7A 3ELYA 2D5CA 3GA7A 4QARA 2WHRA 4QDTA 3NXSA 3PNYA 4MKRA 4K9PA 4HTFA 4UZFA 4C6RA 1JTVA 2QW0X 4HBGA 1T15A 4QXPA 4D8VA 4JBNA 3NWBA 3EJ6A 3P9IA 2CSXA 1W2HA 5IMBA 2FNAA 1QZXA 2W2KB 4ZEMA 2IELA 4PLTA 1NVKA 2HSDA 1DCKA 3WOHA 3ZGOA 5AKGA 1C9NA 2N1BA 2RBGA 2UZAA 3WLJA 5FWYA 1C9JA 3H97A 2QAJA 3F90A 4PG6A 4Q4JA 4QVIA 4L5CA 2HDWA 3ZNOA 1O5IA 2OG1A 4NECA 2HBYA 4FOTA 3WWDA 1WMSA 4MUGA 2A0XA 3S40A 1P2BA 3GLQA 4ZO4A 4CTMA 5CFZA 1TLLA 1QQTA 5ENZA 4OK5A 2ZJFA 5AVUA 5L7TA 3T7SA 4PICA 2NAPA 3CN7A 3VYUB 1F2UB 3AIIA 4PPYA 2BHTA 3MS4A 3OZ7A 4RIHA 4CG3A 1WRBA 2OBNA 1U9ZA 2WM3A 1WU8A 2ZB8A 4L4XA 4X20B 4F45A 2UZ4A 2H7YA 1AS2A 4FFWA 3K7EA 3P5BA 1N1DA 1OREA 4P22A 3UBMA 3W7VA 1K75A 4RF4A 3A3PA 1IY9A 4AJ2A 2PZ8A 4LNAA 3MBIA 4IDEA 2Z1DA 2NO9A 2EJCA 1JR6A 3W8RA 4OUKX 3EMVA 1L5KA 4FNOA 4HK4A 3S1SA 1W34A 4MW0A 2P2ZA 5JCJA 3TL2A 1J8FA 2QR2A 3K9QO 4MVCA 3HV0A 1EP3B 1UMCA 1WTAA 3WBKA 4GXQA 3OPYA 4YQFA 2BF4A 2GZ3A 5HP4A 5ICMA 1ZRSA 2X7HA 3N2NA 3REGA 4CXMA 2VBCA 4V3BA 2IYOA 4F6CA 5KNCH 4DREA 3VGJA 5JQGF 3OZXA 1WXWA 1F17A 2IHVA 4N01A 4LI3X 4BNWA 5DHRA 4LE2A 4K6FA 1GA1A 1FB5A 3EWNA 1G8KA 1GG8A 1XEWY 4PGGA 2XGMA 4PLGA 4X1YA 3T0IA 1L1RA 1GVHA 5FOQA 2W9XA 5IAEA 1LTQA 1Q3TA 3DEZA 4NDNE 5CCBA 3RJZA 4DJTA 1DKNA 1C4OA 1RM3A 5J2UA 4EP1A 3OCZA 3KLMX 4XCQA 2V0CA 2G1PA 1OHHA 1N1GA 4ZKDA 4CUZA 3K6KA 3TLAA 3R7FA 3WICA 1GL3A 1R18A 3BTSA 3UHAA 1EDBA 4G67A 1XZFA 4ZANA 4ALJA 1OIXA 3CINA 3AUSA 2C3PA 1DXHA 5DSTA 3ENQA 4CLDA 3AHHA 3GNSA 1WIWA 4NY1A 3I58A 5JXIA 2HIHA 2I5PO 4BTLA 5K1ZA 3G7NA 1BYIA 2O4CA 3KSMA 3ZK9A 3A9UA 5CLGA 3QPBA 1VKZA 3ED1A 4OIFA 4N47A 4CM7A 1E96A 2WSSD 4KXLA 2YNMD 5ES3A 2Z2JA 1LBHA 5KNDA 1DJOA 4MIKA 1E2QA 3VMMA 2IDMA 1ZN2A 5ITZA 3EE6A 1NWHA 2JGNA 1ZMXA 4LAFA 4BNGA 3L6BA 1VPEA 3A9VA 2QORA 3LD9A 2Q3LA 3NKVA 1JR3D 1FVFA 2F1JA 4MV6A 4BPRA 3P32A 3WTCA 4EKYA 4B1FA 3HGMA 2NSHA 4BC0A 2OENG 2FF5A 1RRPA 4N3AA 1Y6RA 1KU0A 1LNZA 2WJWA 4FR0A 4U00A 2OZKA 4ENRA 6REQA 2VLBA 4GMFA 2JPDA 4R1UA 2E0IA 4BFUA 2AR9A 5CP8A 4HZUB 3IJEB 4G23A 4MHSA 4Q12A 5DTIA 5KVQA 3QYFA 3AJAA 3TNYA 1I7QB 3BN3A 3HEBA 2VDJA 3PXDA 5SYMA 2HGSA 3GLHB 4J2OA 1GDDA 3FRIA 4NFYA 3THWA 4KQ2A 1VJ5A 3GP3A 3HBFA 5TGTA 3DMGA 1N5LA 5AM2A 3R3WA 1FNCA 3CLKA 2Z5VA 3HVJA 1SBYA 4PZYA 2HQOA 1XMVA 2IOQA 3HWSA 4IIUA 3R7BA 1N5KA 2OMEA 5DTJA 3QLJA 4KAXA 4KX3A 4QVGA 4UPEA 2WFLA 4ZCMA 2FDCA 2QBYA 3AB7A 2P77A 3PPVA 3EVEA 3CX3A 1SJ9A 5I5EA 1U2ZA 4NH4A 1OVGA 2VI5A 3FSJX 5K4HA 3OE4A 4E5YA 3AR7A 1QM5A 3G2IA 4F6RB 4WINA 2IP1A 5AR1A 4JYZA 5BN3B 1U80A 2FUG1 2XYQA 2WJYA 3R23A 3I9KA 3DW3X 1Z06A 2CL0X 4V0SA 5CNJA 3HB5X 1ZJZA 2H0QA 1YRYE 5TX7A 1JP7A 2VHCA 1PQWA 1T6BY 1GZVA 1HYBA 1QDLB 3CW9A 1W88B 3VPBA 4EK9A 3AC0A 3DUWA 3D0OA 5CH3A 3GT4A 5GIPE 1OXMA 4QBIA 4D1YA 2H1SA 5BOSA 2WQZA 5EZSA 1GNSA 2EG5A 3CM0A 3LRTA 2L17A 2D00A 3LAWA 4OJNA 2JLZA 3TRJA 3DMYA 4BLPA 4M46A 4I9NA 2XUIA 4IFEA 1QNFA 3GMSA 4G63A 4WBXC 1DC5A 3VSBA 1WSBA 3ZHRA 4KN9S 1EHIA 3HKBB 3P45A 5J59A 3HKEB 4H3SA 3SN6A 4MR8B 1RI2A 2XCRB 1D8TA 4KFUA 3QU9A 4UEQA 3BF7A 2VT2A 3I2FA 1JA0A 4OB7A 5JCPA 5CA1B 2IYLD 1S2LA 3HGQA 5H3HA 4RTKA 3D81A 1UH5A 2R1TB 1ZIPA 1LBTA 2BELA 3TNFA 4QHSA 4S0XA 2FSFA 5JCXA 3KD3A 1EFKA 2C8LA 3RIGA 1CRPA 1G3QA 1NY6A 1X15A 1GFSA 3NOQA 4MI6A 3UUEA 2XZOA 2BTQB 3PITA 2ZT5A 1E2MA 4D0RA 3Q3CA 4YRPA 2XWSA 1UWLA 3UC9A 4RF2A 1HNXB 4ABTA 4Z0PA 4Z9BA 1GSHA 1H0HA 1RFLA 3NJ8A 1UM9B 2HWKA 4P3XA 4PZDA 1S8FA 2RC5A 4HUQA 4QT0A 2V9PA 3QPCA 4JB0A 3ESYA 4DQ0A 5A6SB 5JD4A 2YZGA 3ZCQA 2QJTA 3F5QA 3M6MD 3MK31 1HYGA 3FOBA 1CVIA 5COQA 1H9CA 2HL6A 4FS3A 3NRBA 5DTQA 1VPDA 4IIJB 2RK4A 1H2WA 1CUGA 3AB3A 3QQPA 2BGMA 2FFHA 4LOKA 1XDDA 4YGXB 2IU0A 3AF1A 5JNWA 1V0JA 3B1VA 3I04M 4RQAA 2Q1XA 3LDGA 1YR1A 4JS0A 4MK4A 1TUBB 2NZ8A 4HH4A 4NCAA 5L3SB 2AI1A 3FPJA 2B1GA 1K6JA 1M54A 4N7MA 4ND7A 4XUEA 1ZH0A 4LSWA 5AO9A 1XAGA 2C82A 1PJ4A 1IN8A 1O96B 2CXRA 2PX5A 2GCIA 2G70A 2WT4A 2ZIZA 3HUEA 3PSHA 4EBFA 1ODLA 3BEDA 4ETIA 2O2ZA 4I4TF 4KWCA 4TYPA 1NJ2A 3GFGA 1P9LA 1V7PC 2GZHA 1WB5A 4PAMA 1ABBA 3IQZA 1XMOB 3NC4A 4RTRA 4DA4A 1SOAA 1IIBA 1SY7A 4K28A 5KPJA 4F97A 1C2TA 2O23A 4BDSA 1BDBA 2ZVPX 1HE4A 3NASA 5IWAB 3HM9A 1CQJB 1QH8B 3QUSA 3KR1A 2VRWA 5HBGA 4EZEA 1QTRA 4G5QA 1KRHA 4LPSA 5EWLB 4YB8A 4IILA 1DXOA 2FTKE 2OFOA 2XMSA 2XY4A 3EZ6A 4CM3A 1HLPA 1XTSA 2OQVA 5FYDA 4PTLA 3L1JA 4MGKR 3LX6A 2R44A 2DWUA 2C0CA 4DSTA 3GEBA 2PS3A 3MF4A 3F67A 3VDMA 1XMXA 3GRUA 3R6DA 1GCGA 1ZH4A 2ZR0A 2VUHB 2I67A 2YHBA 3KBBA 4DLVA 2J0UA 5T4HA 1B74A 2E5FA 2IHYA 2EL7A 3TZBA 2CXXA 4WMLA 5ALUA 4DXAA 2QX4A 3V8EA 4NG4A 5CFQA 4MRMB 1IONA 4HL6A 2V7QA 5IG2A 1JKMA 3ENZA 2L19A 1NM5A 2GK3A 4IF6A 1N8TA 5GM2A 3WQBA 1A8SA 2WWRA 2DQYA 4ESEA 2VDUE 3JSAA 1EGQA 4GLFA 5AM4A 3UK0A 3D3EA 1DAFA 3OZGA 2ZSDA 2DQSA 1EFRA 1CZOA 3LBHA 3ZCPA 4ML3A 2GYYA 4XSGA 4UNIA 4JBHA 3PEFA 4PRLA 1GAEO 1XHEA 3JD1A 4TM7A 2P1RA 4PYLA 2PZFA 1L5FA 1R0KA 4P83A 2A1UA 2P9EA 2WV9A 1YZGA 4PWZA 1KI7A 2JVJA 2ZSEA 4JP2A 4BO8A 3VAYA 4E2XA 4QPCA 3OP1A 3ANYB 4BVFA 1QAOA 1PFKA 5G40A 5GV8A 3GAAA 3PC7A 1GG5A 3FSGD 3WKDA 1DNPA 1WHTB 1ZA1A 4RKFA 2GJSA 1IFXA 4HWPA 5A5VA 1J5XA 1GEGA 2IEIA 5CT5A 3PUWA 3QE3A 3WMEA 1AQNA 2ASVA 4F4FA 1KS9A 1RBZA 1RJ9B 1YJBA 1C1XB 3H16A 3II6X 1WXQA 4UM7A 1T4CA 4GPIB 4M1KA 1GR1A 1I6WA 4CDMA 5BNZA 2IS2A 3CUSA 2XUJA 5ER6A 4HVAA 1QOZA 3BX1A 3IIIA 4IGEA 4PHHA 2FKAA 1U63A 4DDUA 2WPDD 3DT9A 4LIPD 1D5CA 1JSRA 4JB8A 1D9ZA 3Q8WA 4TRJA 1FXWA 3D2AA 3C70A 3NH6A 1YR8A 2E48A 4Q3AA 3QLTA 2YRXA 3MLEA 1RPTA 3DSRA 3W5DA 1JEJA 5I45A 4TTSA 3KOZA 5K0ZA 1E9CA 4IDQA 5CPBA 2G9RA 3D3WB <