2QLLA

Human liver glycogen phosphorylase- gl complex
Total Genus 291
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
291
sequence length
835
structure length
805
Chain Sequence
LTDQEKRRQIIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNVLDRNLAENISRVLYPFEGKELRLKQEYFVVAATLQDIIRRFKASKFGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular recognition of the protein phosphatase 1 glycogen targeting subunit by glycogen phosphorylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Glycogen phosphorylase, liver form
total genus 291
structure length 805
sequence length 835
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2qllA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2qllA01
1IIRA 3O3CA 3CEHA 3NAZA 1LWNA 2R4TA 2GT1A 1L5SA 3UYKA 3ZCQA 4G2TA 3DDSA 2QN2A 1K08A 1PYGA 4CTOA 3BD8A 3D0RA 3L7DA 3MTDA 1FU8A 3EBPA 1P4JA 3Q3EA 3BCSA 5I45A 1NOJA 4M7PA 3MS2A 3AMVA 2BISA 4NEQA 4N39A 3S28A 4KQMA 3HBMA 3VDNB 3T3HA 3C4QA 4AY6A 2VSYA 4YUAA 4LEIA 2X6QA 3MRVA 1XL1A 3DZCA 2OFFA 1P4GA 2QRMA 3CEJA 3NPAA 1QM5A 3G2KA 3MT8A 1A8IA 4NC9A 3DDWA 2HY7A 2R4UA 4RIFA 1LWOA 2QNBA 2XA9A 2QRHA 2F9FA 5TMBA 1Z6QA 1NOIA 2XGSA 1L7XA 1FTWA 4FKZA 1Y6GA 2IEGA 1NOKA 4CDRA 2PYDA 2G9VA 3ZCVA 3L7BA 2ACWA 1VGVA 4N9WA 3UYLA 3L79A 3G2IA 1Y6FA 2IYFA 2ASVA 3G2NA 3BEOA 2QLNA 1NZFA 3G2JA 5HXAA 3ZCTA 3D0QA 2X0EA 3L01A 3CUWA 2PQ6A 2JLBA 2F3SA 1Z8DA 4LDPA 1NLMA 3L7CA 4CTMA 3RSCA 3HBJA 1C50A 1PN3A 2IEIA 3PE3A 4RENA 3WAGA 2XGMA 2GM9A 1Y8ZA 2F3PA 3QHPA 1GZ5A 3BDAA 3Q3IA 2F3QA 1P2GA 2FF5A 2AMVA 2QN9A 2X0DA 3OTGA 5DLDA 5LQDA 3OT5A 4F9FA 1EXVA 4XI9A 2X0FA 4HLNA 2VCHA 2H1HA 2QN8A 3CUUA 1QKJA 1JIUA 1UQTA 2SKCA 1NZDA 3T3IA 3BD7A 3T5TA 4GZ6A 5TMEA 1Z6PA 2ZB2A 1FU7A 1V4VA 4L22A 3C4VA 1WV1A 5JTUA 3WADA 3RSZA 1XKXA 3L7AA 4MI3A 3H4IA 3CEMA 1GG8A 4M60A 4PQGA 3WC4A 4FZRA 1AXRA 1M5RA 1XV5A 4WACA 2G9UA 3HBNA 2GJ4A 4AN4A 5JTTA 2GEJA 4MHOA 1YA6A 2VCEA 3IA7A 1RZVA 2XMPA 2C9ZA 3OY7A 1HLFA 4MRAA 4RIHA 3BCRA 2O6LA 3QKWA 1ABBA 2GPNA 4REMA 4EKEA 4XIFA 1PNVA 2H1FA 4AMBA 2GPAA 3Q3HA 4WHMA 1E1YA 4MI9A 2BGUA 4X6LA 3OKAA 4YI3A 1WW2A 2X6RA 3T7DA 1WUTA 1GFZA 3MTAA 3E3LA 1RZUA 3T3GA 3OKPA 1WUYA 2QRGA 3CX4A 1FTYA 3H4TA 4GYWA 3NB0A 4AY5A 4WADA 1WW3A 4YI5A 5IKOA 2R60A 4RELA 1GPBA 2XCUA 3CUTA 2GPBA 2XA1A 4EJ2A 2XCIA 3E3OA 2JZCA 3E3NA 5C1DA 3MT7A 4KQ1A 4BQFA 3RT1A 2AV6A 1C8KA 2SKDA 1JG6A 3ZCSA 5D01A 2BFWA 4GZ5A 1FS4A 4AMGA 3OKCA 3SYMA 1XOIA 2F3UA 1JIXA 3RHZA 1O6CA 1FC0A 2BGTA 7GPBA 5BNWA 1L5WA 1JEJA 2ECPA 3C48A 4M83A 4RBNA 3D1JA 1SXPA 3NCHA 3OTHA 5TMDA 1EM6A 1Z62A 4F96A 3G2LA 4MICA 3SYRA 2ATIA 3TAXA 2IV3A 5GPBA 5DU2A 1XL0A 1P2BA 3MRTA 2G9QA 3FROA 4RIEA 1P2DA 1BX3A 4BQIA 1L5QA 4RIGA 1GGNA 3DD1A 3VDMA 2AZDA 3NP7A 2QLLA 9GPBA 2FETA 4EL0A 1F6DA 2P6PA 1NVKA 3MT9A 4CTNA 2QLMA 4BFCA 4EKYA 4X7MA 4GZ3A 5ENZA 3S29A 3ZCRA 4F97A 2C1XA 4X7RA 2IW1A 1GPYA 4KQ2A 3OTIA 3S27A 3ZCPA 1RRVA 4N3CA 4QLBA 3TOVA 2QN7A 5IKPA 1B4DA 1J39A 2IUYA 5DXFA 3MTBA 2Q6VA 4NESA 4RIIA 3CV3A 4MI6A 1FA9A 2R66A 1E4OA 3T3DA 2PYIA 4Z5XA 4HWGA 3NC4A 4MHSA 1UQUA 3MRXA 2WTXA 3MS4A 1FTQA 3VUFA 2IV7A 3T3EA 4BQEA 2PRJA 2QRQA 3BCUA 2XA2A 1AHPA 1L5VA 1SXQA 3MBOA 2QN1A 1P4HA 2ACVA 2QN3A 3S2UA 1L5RA 2IYAA 1P29A 1H5UA 1K06A 2GEKA 3NP9A 3OY2A 1C3JA 1XC7A 1GPAA 3TSAA 4N3AA 3ZCUA 1UZUA 1YGPA 3CUYA 2YJNA 4W6QA 5D00A 3MS7A 3EBOA 1PSWA 3MQFA 4GPBA 2VG8A 2R68A 1JG7A 2AW3A 1WV0A 1KTIA 3G2HA 4N3BA 2KS6A 2XGOA 1IXYA 3GUHA 1L6IA 3CUVA 2VSNA 4X7PA 3VUEA 4EL5A 6GPBA 3HBFA 5TVGA 3GPBA 3IAAA 3S0JA 1FU4A 2JJMA 1C8LA 2PRIA 1JIVA 3MSCA 2FFRA 2C1ZA 8GPBA 3BD6A 2C4MA 1F0KA 3COPA 4GYYA 2G9RA 2SKEA 2QZSA 2QRPA 3PE4A
chains in the Genus database with same CATH superfamily
3R5KA 3CEHA 3NAZA 3S2EA 3IOYA 2WWGA 2R4TA 2HHHB 3N8NA 2H2IA 1LJUA 2ZANA 3CVJA 4RSHA 4U8GA 2V7TA 1K5HA 4NH0A 3D3EA 5JQGB 5BN3A 2X7HA 3EPKA 5EZQA 4LMRA 1SZDA 2Z2IA 4X54A 3JYHA 3ZV3A 5B36A 2BTEA 5IBQA 4EO4A 3CC8A 3R3XA 4P2BA 2RHTA 3IESA 3VO8A 1CUZA 5JNVA 1XZCA 2R79A 3OUUA 3DBVO 3C6KA 1UPBA 3WK6A 5F73A 3WGIA 2DQZA 1ECGA 4QTXA 1F4LA 2P78A 4EAQA 4HXFB 5KOJA 1AQNA 3MZ0A 1OZFA 1SBIA 4ZAVA 2JHGA 5EIBC 3V4PB 2VDKB 5BSKA 3DZHA 3I2HA 1XU9A 2I9PA 4MJ7A 5FQNA 2ZIFA 1QYCA 1T3GA 3A1TA 2ZJ5A 3BXFA 3OC0A 5DNVA 2UYCA 4XSGA 2ODEA 2XR1A 3FDIA 2FWNA 2PKEA 2JJ2D 1XIVA 4DQKA 5KCZA 4UM8B 1TTTA 1QLJA 3PDIB 5E3HA 2B36A 1HQYE 3KSDO 5DEOA 4I4TA 3MRVA 5FBQB 4E2FA 4XLTA 3KR2A 4UBLA 1WUHS 2VOJA 1PT6A 2RB5A 2P9ZA 3FKJA 3ZHXA 2B2XA 4ESVA 5KTNA 1OH5A 4HAIA 1SQ0A 4XD7D 1ZZEA 2G76A 2Q3BA 3PE6A 1IXKA 1A9RA 3NRJA 2YL2A 1XWFA 3H2JA 3N74A 4I3GA 2ZB8A 1EK6A 2ZYSA 3LUJA 4PINA 4Q1AA 3FYSA 4G41A 4K0RA 2BSQA 1MB0A 1T10A 2DCMA 2RGAA 4MV8A 4U7HA 3WMEA 1P2SA 3AHFA 3IDQA 5J3JA 3I0NA 3EC7A 4YLYA 2ZRJA 1U5BA 3L77A 4KNWA 4NK4A 4MWBA 3PLNA 3STTA 4RY8A 2WAYA 1XCJA 2E4AA 3FUCA 3RS0A 5I48A 1UXJA 4Q24A 2PNFA 1T6YA 3AJ8A 4CIXA 3LXXA 2QG4A 3HY6A 2ACWA 3PXAA 3JVUA 1U28A 4RDXA 4GH5A 4RACA 3ZQKA 3W5DA 4OHPA 3HVRA 2IUUA 5HE8A 3PTZA 5KBYA 2ANBA 1NKVA 1XCOA 2GHIA 4O2BF 4FIDA 5F9MA 3NUGA 5SY9A 2ZWAA 2XF2A 4BO5A 2UUPA 2FHPA 2Z4SA 4WQMA 1Y8CA 1E60A 2WUWE 3QVKA 4ARAA 1I5EA 2IIVA 3OJWA 5ALPA 4ZHSA 1I4LD 2ZZMA 1A9PA 5CVDA 1UP7A 1A9QA 2JLBA 2P9GA 4HTFA 5LIPA 3HB9A 4OUDA 4ZARA 4TMZA 2G8NA 1AKVA 3M0EA 3PDUA 1Z12A 4OG2A 3SVZA 3UG6A 2ZIZA 4WLFA 1IXZA 4G8BA 1XDGA 2CWWA 3GDOA 4JZYA 3JYLA 3K8YA 4MIEA 4ENTA 5JAMA 4ML3A 5IT4A 4P22A 4IO1A 1Q19A 3LUBA 4I46A 4OO3A 3A4TA 1J2JA 4YASA 4NJMB 5KHAA 3BZUA 3Q6MA 4Z7OB 3WAGA 3AR4A 1K8ZB 1MX5A 2LR0A 3ZXYA 4N18A 4KO3S 4MTCA 2P9FA 2D0DA 2Q9UA 3Q5GA 4WERA 2ZTVA 2LZ0A 3EXHC 3B5JA 5KPDA 4QPPA 2A9RA 1MC1A 1VOTA 2VUTA 3AB3A 2PZLA 5EHZA 1GAWA 5AI0A 3SJZA 4RZXA 2XJ9A 2NIPA 4XI9A 5ADUS 4MKXA 1ULAA 2JGJA 3Q9UA 4HLNA 5B6IA 5AH0A 3EFEA 4R2XA 5DI3A 3JX9A 2C2ZA 1F1BA 3W5UA 3VVMA 4L5YA 4TL9A 4YJFA 4HK4A 3UJPA 1U4NA 3CO0S 5GJWC 4PQEA 2L0XA 3OQJA 3PI7A 1M74A 1KI3A 4MZXA 1I5OA 1VC2A 4G0YA 3PK0A 4LY9A 3F98A 2XJ4A 3G1UA 4EFKA 3GJ4A 1VSBA 2C2WA 1ZU4A 3G9ZA 1XTRA 4UUBA 1HK7A 5TY0A 2VF4X 3IV6A 1SHTX 2WVHA 2OAEA 3I37X 3P0IA 4GPTA 1J2UA 4FINA 2O4CA 2BELA 1MQ9A 2Y1XA 1Z83A 1XA0A 2CLOB 1B2LA 1YB6A 4M7RA 1DE0A 1QYVA 1Z5WA 1P0MA 5B7NA 2WU8A 5FJIA 2PUTA 3CZ4A 3TZLA 1NMSA 1PHPA 4OMFG 1L5YA 3FJOA 1NJ2A 4TLCA 3M7IA 1QQ7A 3KWLA 5FCDA 1UT8A 3CRQA 1CY4A 1PD1A 3GJZA 3K2IA 2J3DA 1FZTA 1I10A 4PSAA 4C7XA 4EUFA 1R9MA 2VI5A 1E2BA 3PD0A 4ZVRA 1MO6A 1UUFA 4A0SA 1XCBA 4HX2A 2QXTA 3GGGA 2HIAA 5E1OA 3GAMA 3IA7A 5TQJA 4AJ9A 2PZMA 2A4MA 4DVGA 3J7AC 3IVCA 3K9QO 3DDNA 3WV4A 4OQLA 2DWCA 4ZYYA 2J87A 1CZNA 3F7OA 4FE4A 5TPWA 5JIBA 3QELB 1L4LA 1HYHA 4DWOA 1HYEA 4R7TA 3HJFA 1YQEA 5JDIC 3LSYA 4DB4A 5FOUA 1F2VA 1EK1A 1DBSA 2HJVA 2WMNB 3N1UA 1PS8A 2I2DA 3FMFA 5GAJA 3IXQA 3SJUA 4WBNA 3MQ4A 3QOYA 4ZYVA 5CVVA 5A02A 1EGQA 3DD5A 2OXCA 5DNCA 5JZBA 3H9UA 3PEYA 5KMGA 3KU1A 1T9AA 4V0RA 1NKTA 2WRZA 1EM8A 1YZNA 4XPIA 1Z4PX 4K05A 5C3UA 3RU3A 2W98A 4O1IA 1LCIA 3KB2A 4N47A 1WW2A 1SBZA 1MN6A 5AHXA 2DOKA 2GPWA 4GXQA 1CG6A 4HPWA 4TM8A 3NHWA 3UNXA 1K3FA 3ZJVA 3HJCA 3LRPA 1GFZA 3RS4A 2D1FA 2XUAA 2JDIA 2ZAGA 3L1JA 1ISPA 5I8WA 1M8JA 1UEXC 3EULA 4PYNA 2QUZA 3OD5A 1HRDA 4ASUA 3GJRA 1PBNA 1N2HA 2FPRA 1AS3A 1XTIA 2ZM6B 2A1UA 4ZDWA 3WLPA 3H4TA 2GB4A 2OCYC 4JJ7A 1DIHA 4XVRA 3L0CA 5M34A 3DAPA 2JFHA 1MO3A 5K99A 3IUQA 1W75A 3DLTA 1UDCA 4D0GA 2ZRQA 4FUTA 5KJ6A 2Y27A 4BO0A 4BDSA 3C85A 2DF8A 1RPJA 5DBFA 3Q8WA 4GSLA 1AZLA 5CB4F 1CWUA 1PO7A 4DUGD 1L9KA 4BP1A 4DEXA 1WLSA 4LFBB 4GF5A 4UUOA 3KE8A 3OZIA 4EJ2A 2QAIA 1CEXA 3G8DA 1XU7A 4LJ4A 4R01A 1LFDB 1QANA 1RWBA 2RGXA 2RH5A 5AVSA 4GI3A 1Q7CA 3EE6A 5FLXA 1G8JA 2V3VA 1YDWA 3STUA 1Y81A 2YBEA 2MTBA 3DZ8A 3QIAA 2W37A 4MRRA 3CZ5A 2QY9A 4AX4A 3ESCA 2Q6OA 3FTPA 2EFGA 3FPHA 2AJ8A 3H8VA 3G89A 3GT0A 1A9YA 2AV6A 1TVMA 3BXHA 2QAGB 2V58A 4HRVA 3EXIA 4YQYA 13PKA 4F6CA 3MHTA 1IQ0A 1VXOA 5AVZA 3ZHYA 3O93A 4WBSA 3ZCSA 5KSPA 1F7UA 4Z7JA 4OJMX 4Z0TA 4MPPA 1QCZA 1T5LA 4BQNA 1HWYA 2E18A 1TQ6A 3PXDA 4YRBA 1OH6A 1O6CA 1FC0A 3EMVA 3TNLA 4JI0B 3RC8A 1T2CA 3H16A 1XCMA 1MOZA 1EPUA 4IVPA 5DYNA 4IKEA 3ELYA 2REBA 3LT2A 3WYNA 3EC2A 2L18A 4NMXB 4O4HA 1WBDA 2AE1A 3OPYB 4IGIA 3D1JA 1QJ4A 1IJEA 1UXHA 1DEXA 1XKQA 1NBOA 3NCHA 1CY2A 5J2TF 2PD3A 3D64A 4HDCA 3ZIUA 4ZYZA 1C4OA 3C6QA 3EVCA 3UOAB 3Q8XB 4X1YB 5EXEA 4YQEA 3FDFA 3DMTA 2R8XA 4MPRA 5E6SA 5I9TA 4AP9A 1QZTA 3JR3A 5HIAA 4NBNA 3WJ7A 1NPDA 1SC6A 4NJOA 1Z62A 5DBEX 2J5XA 221PA 2EBFX 1CRPA 3AR9A 1D2RA 3OZXA 3RIXA 5KQSA 1ZPDA 4FT2A 3SYRA 1S0UA 3B2EA 1NW7A 3K1JA 2W2MA 1VJDA 4AXXA 4YUYA 4YRMA 3CQ9A 4MR7A 1R8YA 3TOXA 4I5DA 3CWQA 5GPBA 4ZJUA 1N36B 2XAUA 4NXNB 4O3MA 1WCV1 5BUQA 1X9GA 1BWQA 1GFWA 1EAYA 4QUBA 3QQ5A 1Z5UA 4E13A 1RXUA 1DINA 1QG6A 3NCTA 4CKWA 3GG9A 1DQNA 1F6BA 1ZD5A 2B25A 4D3SA 2DEUA 1Y9AA 3B7WA 5I4IA 1R15A 1SXGA 1DDOA 3GRZA 5B58T 4MW5A 3U62A 1SOUA 1GQFA 4E88A 4Q3AA 4E6EA 3GGCA 3K1AA 2DH6A 2IW3A 5C8YF 1Z13A 3ONEA 3HYNA 5D1NA 2NV0A 4P58A 1OCEA 3M9XA 1XXHA 4NOLA 1Z9BA 4E12A 4XDGA 4LNAA 3NP7A 2ZG6A 2W8ZA 1NLYA 4KIUA 1GNRA 1GQRA 2FETA 3BKWA 2XCTB 4X20A 1TF5A 4BO8A 1A9TA 4AN1A 4J9UE 3U4QA 3DP7A 5BYKA 1Y7TA 3GNSA 3FMPB 2VTBA 1JB9A 2RE8A 1BKDR 4X8OA 6AT1A 3K0KA 1B6RA 3PNVA 4ZO4A 5ER6A 4AMUA 1WBBA 4ZALA 3BEDA 3ZH2A 4X7MA 5AM0A 1ZMBA 4JUCA 2IELA 4LKOA 3EGIA 4X7RA 3NALA 4YT2A 4LJYA 2IW1A 1WXXA 2ON6A 3JQPA 4KACA 2NG1A 4TQ9A 2X5XA 3HDJA 2IS6A 1QRSA 2I62A 3FF1A 3QUCA 3R5HA 4FYKA 1F3OA 3FSJX 3VZPA 3PJRA 1CU1A 4DYDA 3G0HA 1P91A 4JOQA 3TE7A 1NNSA 1R4ZA 1E1RA 4FMPA 3SC2A 3ZR4B 3TUJC 3OCXA 3X1WA 1MAAA 2JL1A 1QP0A 2DLNA 2QUKA 4OI2A 3ETDA 2HIGA 4PRYA 3HXPA 4RIIA 3CNBA 1KY2A 1F6WA 1ZNYA 3OBIA 5ENVA 521PA 1LTQA 4G5OA 1JDJA 3NWJA 2CSXA 1U9IA 2ZRBA 5F52A 4D9HA 3OTQA 3EIHA 1NAIA 3IMGA 2WYOA 4EY8A 5AW8A 2ZYTX 5C80A 2B69A 1BHSA 4BRSA 1P18A 3WGVA 2PGAA 2XUPA 1OBFO 2Y0CA 1FF9A 1WAMA 2IA5A 1GJRA 4PXSA 3QK7A 4XFJA 3V1UA 4MA0A 1SVIA 4KYUA 2WSSA 1NTOA 4QVKA 4RTRA 3PGA1 1GPDG 2WE7A 1PL0A 1J5PA 2YOGA 3I6ZA 4WOJA 1YAHA 5KSYA 1CHNA 1DS6A 2AQHA 1W0JD 1EX1A 1Z4JA 2V7WA 5ITZB 1QQAA 4CF7A 3IKMB 4Y18A 3MWEA 4ZO8A 3Q8KA 2EKPA 5CITA 1K9VF 3ROTA 3RUPA 3ZV4A 2BMFA 3WWYA 1J56A 1V7PC 2NUAB 1BDHA 4D8YA 4MOWA 5JQGF 3LK7A 5JV5A 3LDGA 1Q44A 5FTMA 5JJKA 1EFKA 1L5RA 4B82A 3PQ2A 2GEKA 3BGWA 4MROA 3D8NA 1TX4B 5DYWA 1CX9B 2EF1A 3AXTA 4FWIB 3EZ6A 4IBOA 3CSUA 3SHQA 2V7GA 3VO9A 2J9FA 1ORVA 1Q1EA 1ZYUA 3H0EA 1Z2OX 1MABA 2GN8A 2ZVQX 3FGNA 4UCQA 4C0XA 2ODAA 1DG9A 3UWPA 2UU9B 3KAQA 2R6R1 5ETJA 2ZUCA 1VLQA 2P35A 1PLKA 2C5HA 4PLWA 4RL4A 5U4QA 2IEZA 3K35A 2AFHE 1P7WA 1OLUB 1J24A 3SPXA 2J6BA 1LF0A 1O8CA 1GAQA 2ZSHA 3EVEA 3O92A 4GPAA 5CGQB 4B7ZA 4N5LA 1FFCA 4B48A 5HS4A 4V3CA 4LC9A 4MWEA 1R5NA 4RGBA 2V7UA 4FXPA 1TGYA 5FDFA 3C6XA 4CETA 4IQFA 5KB3A 1COWD 1M8GA 3MUNA 2XVZA 3GDFA 3W2GA 3SQDA 4RH0A 5KUTA 1RIFA 4J0CA 4CN9A 5B7QA 4GC5A 1GUYA 1A9OA 5I3CA 3I61A 1E98A 4ESEA 1M2OB 4MVJG 5BPFA 2RGDA 4ND2A 4DUZB 2PKQP 2WYWA 2XIQA 3RFXA 5ELMA 3ACBA 4JJEA 4OQYA 4LVUA 4Z0NA 3KQQA 3NOQA 4ZVUA 2VN8A 3C3WA 2BEWB 2CLLB 2WJZB 2ZUVA 1X42A 3SS8A 3UB4A 3FGPA 4BNDB 2WJAA 1Y3IA 4CFZA 3ADBA 1TDJA 5T67A 4BN5A 1TKBA 2QV0A 3CKMA 3ESAA 4XRGA 2OXTA 4PC1A 1MFPA 3A6JA 5JLJA 4FMBB 2D2FA 1U3FA 1YF3A 1J09A 4H6XA 3FTEA 3K5PA 1MAWA 5EYPB 4ICIA 3ZDFA 3QUAA 2I4RA 2V9CA 4H7PA 2Q49A 1M54A 2XBMA 2DPMA 4ATNA 4X91A 2RAVA 3ROMA 2F8SA 5U4XA 3HEMA 5L3RA 3UYKA 2WK1A 4RVNA 4H0CA 1JHQA 1IEQA 1V45E 1X77A 2AJCA 3B6ZA 3KSZO 5G3YA 1INLA 2FUG1 1A69A 1OFUA 4I2VA 2W7TA 3CT6A 5HFAA 1D5WA 2HU7A 3AZQA 1PYGA 1TK3A 2CW5A 2ONYA 2YV1A 4GIBA 4MWTA 4OREX 4DIUA 5L3QB 2ZAYA 1LFAA 2J5BA 5FTWA 3V1YA 2Z43A 3H5TA 1VPWA 3Q3EA 5IM5A 3V8RA 2FRXA 5I7VA 4F2HA 5KOIA 2VUUA 1XDSA 3BCSA 4HL6A 5DRYA 5HOQA 2XQJA 1BQEA 5JS1A 4JP2A 2H17A 2AOXA 5JC8A 2YFHA 1T2NA 4ARBA 3KJXA 1UOQA 5J2TA 3HQ4O 1SKBA 4YJGB 3T7AA 1TA9A 3I9LA 5U9CA 2NNLD 1C9KA 4BRZA 1IPFA 5HJ2A 4KQMA 1YKFA 3DPIA 4BYMA 3FCUB 3VDNB 4CLHA 1PK8A 3D6FA 4FFDA 3JZAA 4O0MA 4KTVE 3ZE9A 3K5IA 1EBUA 3UXHA 4EHBA 4XA8A 4MV5A 2OFFA 3NYIA 4CLXA 1N8NA 1A7AA 2VS1A 1LZKA 4AO8A 1I4WA 2C94A 1TQ8A 3EVAA 3A26A 3B8HA 1II8A 3QMVA 3RYFA 4IILA 4C04A 4W5TA 4DKXA 1Z07A 2A4KA 2C59A 2J6CA 3BRCA 4YCJA 1LWOA 1FNNA 2XLCA 2XSZA 3P2JA 4QL3A 5JMTA 2QRHA 2F9FA 3SDZA 16PKA 1T9CA 2W48A 1GYRA 4ZMBA 5LN1A 1X8JA 3E5HA 4JELA 4W5WA 3QF7A 2R97A 4UZEA 1OLSA 2GD1O 1T0PA 1RC1A 4ERNA 3EG9A 2NGRA 3IH5A 3SAJA 4I2NA 4MQEB 1HTBA 2PYDA 4OGKA 3K3PA 2YJ6A 5CYPA 2EJVA 2CEKA 4ZMRA 4Y2XA 2ZSKA 2I03A 1WVIA 1R4MA 2X3UA 3KUDA 4MDHA 2K87A 5M7EA 4F3TA 3I5AA 3PGVA 5KU1A 2PUGA 3PWTA 1RE1A 2VH5R 1CZKA 4LAFA 1NZFA 2WTBA 3D4LA 3EGOA 3N2NA 4MNTA 1HR0B 2CKDA 4ARIA 2YWDA 1WXGA 5D6NA 1KQGA 2QAGC 1P19A 3VPXA 2VRWA 1BE6A 1HGXA 1E9SA 2X9GA 4DA7A 3RTBA 1E6MA 4KOEC 5FNVA 3SBDA 3JQ9C 3TINA 4EB6A 4KSCA 1R0RE 4IH1A 2A5GA 3BFKA 4PCVA 3MLEA 4KP7A 4COKA 1G1MA 1J22A 1VQ1A 4DUPA 1KSHA 3CX6A 3HLKA 2YMMA 1ZQ9A 1MXFA 3RPEA 2OAQ1 5E0KB 2GYYA 1AQYA 3JATA 4TX1A 1KVTA 2TMDA 1JPNA 1GZHB 2R62A 3L7CA 4GE0A 1CQZA 4LJKA 4NZNA 5DE3A 5JROA 3WGHA 3DMNA 4BMNA 4HAWA 1MG0A 1VG0B 5F1PA 1XKLA 3RSCA 2NXWA 2GBCA 2AJTA 3DL7A 1C50A 1BMFA 1LBHA 1Z8HA 2YMQA 1WB9A 3ZWPA 3O47A 4H15A 1P4AA 1TADA 4LRXA 1TYCA 3TBFA 1KPGA 2XSZD 3PICA 1ZI8A 4UM9D 4J0EA 4JLAA 5B7GA 1Y4ZA 1RC0A 4N82A 2XCOA 4DR1B 3N2ZB 3OCJA 2HMAA 4CF5A 1YV9A 4WBNF 3P45A 1GPWB 5ALMA 2PEZA 3X1DA 4OLAA 3RC7A 5KNDH 3G02A 3EMDA 1K27A 4BS9A 4HZUB 4YV1A 2VA9A 4U2EA 4EG3A 2GR9A 4L5CA 3L8EA 4RNDB 1V43A 1LSJA 3QBVA 1TD1A 2Q4RA 5LZ8A 1JDTA 3QPUA 3WG9A 1VE3A 1QKJA 4ZT5A 3TSZA 1WCXA 5CDFE 4GU5A 4EW2A 4NMMA 4LGCA 1CETA 4U2GA 2YN2A 5I6DA 5CXXA 4WLVA 2BD0A 4CKCB 1SBHA 1V4VA 5KYUA 4PSKA 3RQIA 2FSSA 3GJQA 2F2TA 3T95A 4P54A 1H1DA 2C4TA 2UAGA 3IQWA 2O2CA 2X4GA 5E2BA 3INRA 3ZZMA 2CVPA 4BLTA 5EJFA 1RW4A 2IP4A 1KDTA 1GNVA 3PQ3A 3COYA 3FNEA 2X8JB 3WSWA 3VC1A 4LZPA 4UMVA 3C41J 4AP6A 4YCAA 2HLNA 4YRZA 1LDEA 1U4SA 1BVUA 5CVJA 5EKSA 2F62A 1YR7A 2ZRHA 4Y9TA 4DLKA 1TFRA 1P3DA 3UOGA 1C9DB 3EH1A 4C07A 4AN4A 2VTKA 4A03A 4W9NA 2ZJ0A 3RG2A 1YA6A 3G0GA 2VCEA 3NNSA 3K9NA 2C31A 4BY9E 2EOAA 4H3HB 3RYCB 4UZSA 5H16A 3D4BA 3UT5A 2A3RA 5DM4A 3BWMA 4DZZA 4B3DA 3NHBA 5HKKD 4UVGA 1W88A 2I29A 5ITVA 5EMLA 1C7RA 1ESMA 2ZUFA 4ZRNA 1OLXB 4JBLA 5H02A 3GUUA 1DC4A 2XAAA 2D59A 2O7RA 2YYZA 2FZEA 3EXAA 1X19A 1P9WA 4R3WA 1RADA 2GNOA 4LG1A 1CB0A 3RYIB 4HDKA 3O2NA 4CU5A 1AKEA 4F5YA 1QC5B 4MWZA 3ZWMA 5FOQA 1B0PA 4OIFA 2HSGA 3ZIAD 1P7PA 2BM0A 3M33A 1A96A 1Q1NA 2GTHA 4MAMA 3C8ZA 4NFLA 5HCUA 4S35A 4EF4A 3MA0A 5AJZA 1M2WA 2NO1A 2P9HA 2VNAA 4X6LA 4DWJA 4CMIB 5TLSA 3VNBA 1A2QA 2QRKA 5ALZA 2F8TA 1RYDA 5IHXA 4LUCA 3DS8A 1PHRA 5D5HA 2F6RA 5AICA 2O50A 1YR8A 1STOA 2OPBA 4CMAA 1ZRHA 1WUKS 3IPAA 5JUWA 4AT1A 1X7HA 2EDAA 2PH5A 4MR9A 5ILOA 1IUNA 2PLNA 3QYFA 1DP4A 2KW5A 5IVIA 1G8KA 1TZBA 4XGKA 2IXTA 5AK3A 1XZ8A 5K01A 2BBSA 1CUAA 4MIYA 4L1KA 1O94D 2C78A 3NGLA 4O2BA 3NWBA 4JQCA 3TRJA 4UC0A 2AFIE 3TNDA 4GO1A 4MW2A 1RMTA 5F2EA 5CEEA 4I9UA 2WM3A 4TQAA 2IE0A 5DISB 4ND6A 1JKXA 3U4CA 4Y2JA 1YB7A 5J4HA 1I3LA 1VLJA 1DKMA 4EW3A 3IJEB 2ZI5A 3UO8B 4DR5B 3UTCA 3HDVA 3LDAA 2FMHA 1XQXA 4IRUB 4RKRA 3WMWA 2LBPA 2QL7A 4WCDA 2PBZA 2PUJA 4OHBA 3HRKA 1ENOA 1VI2A 3AJAA 2G1KA 3G79A 1TUGA 2BUBA 2FPUA 2JJ1D 4D02A 2YNMD 4BFUA 3C4JA 2PX3A 2FX3A 2I3DA 1XYVA 3B1WA 5DBOA 1CZUA 1EFRD 3IT3A 3MGGA 3NANA 1U1EA 1Q84A 4EAAA 1WVGA 4GI7A 1NKSA 2AXPA 1FS4A 2VWHA 3ONNA 5A5EA 1IFXA 3SYMA 2QMOA 4DIDA 4F9EA 3UK6A 1HQCA 4A6PA 2CXNA 4Q05A 5JNRA 1AX9A 1KJYA 3VSEA 1LJLA 4BNXA 4IX1A 1LNSA 4N8EA 2YVUA 1TW3A 2IJGX 4NENA 3O8OA 5JS7A 2FVYA 1MG5A 4KVZA 4NONA 4MQUA 4AUKA 2PUDA 3MGAA 2CFTA 1XA4A 1AK2A 3AKZA 4QBTA 2ZWPA 3QJ5A 4NZ9A 3H8SA 4R98A 2OQIA 1QLWA 1T6XA 3KG2A 4WZBB 4KREA 3ND8A 4AKSA 3IFSA 3NDJA 2JVJA 1SAYA 1G1AA 2Q4OA 5KTMA 2HO4A 1FFDA 1GV0A 2DGDA 1QHSA 1BTOA 1T9GR 2DKOA 4KO4S 3ZDEA 4WGGA 5A6SA 2YRWA 3B7GA 5AOCA 3RWMB 4AJJA 3WL7A 4Q9NA 3UG7A 2IYNA 5IARA 3ZQUA 2Y1GA 2ODQA 3NPMA 4D41A 4LDRA 1OAAA 2B92A 2PLAA 2ZULA 2HAEA 2XBLA 3EIWA 3K2QA 1RYHA 4EG1A 3QKIA 2UYOA 3ZEIA 1EQUA 1NFRA 2J4DA 1EWYA 3GIDA 1T2VA 4G1FA 4R2JA 4B83A 1G4HA 4CN8A 3FW1A 2OORC 2Q29A 4IGEA 1JB1A 2FF7A 4GXRA 4BAGA 2ZIEA 1GDHA 3F90A 3MOIA 1ABEA 3W9BA 2QZ9A 3U4HA 4H3KB 1N2IA 1JJ7A 2ZI3A 4LHZA 4J7CA 4KC0A 2YQ4A 4EGQA 4RQTA 5HIKA 1PR2A 5ITSA 1ZMTA 3RBZA 2C54A 1ADYA 1W1WA 2FU5C 2IHZA 2J45A 2PL5A 3AOEA 4JHLA 4B4VA 2YHIA 3F3MA 3K15A 4HBGA 4HI0E 3C16C 5GMOA 3JQGA 1IY0A 2GLUA 2EC5A 2V98A 1WMFA 2B99A 4OHCA 1PWZA 3ZIDA 5MFZA 4ARUA 4CLOA 2V7QA 3QKSB 7REQA 3ACDA 2P6PA 3MT9A 4MYDA 1FUKA 2CHFA 1CZRA 1YJAA 3EZXA 4WLEA 2Q5LA 2SHKA 3ZKWB 5DHQA 3IOCA 3OLQA 3R7FA 4QUKA 3WIEA 2FZ5A 1DO0A 3TKLA 1P5RA 4RDCA 3V34A 4YV2A 2O19A 3K6SB 2O5EA 1LV8A 5EHGA 3SEFA 2Z6VA 4F97A 1P39A 4F71A 2AKEA 5DHPA 2IBTA 3PKZA 2V3CC 1RAEA 1ZGGA 4K9QA 1OYYA 3I9NA 1OWMA 1GPYA 4FD3A 1MORA 2XXJA 4XQEA 3W4KA 4EVRA 5A3SA 3BSWA 2C95A 1B8OA 2C2GA 2W6NA 3CJRA 4N3CA 3Q88A 2CK3A 4P3OA 5EZYA 3SMVA 1B3RA 3M83A 1K6IA 4ROSA 5KCMA 3WRXA 4QJ5A 4YIHA 2Z3VA 4RHXA 5JPDA 1PW7A 3S2ZA 5IKPA 1TAGA 1NVTA 2OFWA 3R6LA 4OL0A 4BNWA 2P9EA 2Q6TA 2D06A 4LDZA 4ZVTA 3QWIA 3WISA 3AG6A 1LRJA 1CRZA 1N6NA 2IBMA 3CV3A 4L8VA 2VRCD 1ZCFA 3E1SA 2R5NA 4PE5B 5ESRA 1OHHD 4LYAA 5CCXA 3H5LA 3WS7A 4P3PA 2Q6IA 4YTEA 1R6UA 3GFQA 5CIWA 3RG8A 3W77A 4Z5XA 2OGWA 1SZCA 4DB2A 3RK1A 3LL7A 3WL4A 4C6SA 1E4EA 1Z8FA 4JJIA 1COZA 1SBTA 3RI3A 1YS2X 4JZKA 1KEEB 4GGMX 3I28A 3DBOB 3W7BA 3WIVA 3NC4A 4X3OA 2W4IA 1G9SA 3QLJA 1HEYA 4WFJA 2WYHA 1XP8A 2O8DA 2BUCA 3DHEA 3PEFA 3N39C 4YREA 1DWUA 3T06B 4KK4A 4BQEA 3M82A 2ZROA 2Y1CA 1CVRA 3OX1A 1Y5RA 2V7QD 3JALA 4G5SA 3PRJA 3RFFA 1G20E 2GRJA 4CLRB 1U2QA 3U7RA 1JFTA 4YCMA 2I22A 2GZMA 2ACVA 1II0A 2WU3A 4YEDA 2VTBB 3UHOA 1UR5A 4PSDA 2GCOB 4RUKA 5A4MS 1CVLA 5LQJA 1RD4A 1YHZA 2IWHA 3NAQA 3PGMA 1O6BA 3JWPA 3V6MA 1NXTA 3RSGA 8ABPA 1B1AA 2C04A 4C0JA 5IT5A 2JHAA 4HRAA 4YJDA 3WLEA 1KETA 1UKZA 3ITNA 4NZMA 1SQ5A 3MPOA 3YASA 2QMHA 1NUAA 3P20A 3A1CA 1XUOA 1TAHA 1LK7A 2NACA 1AKQA 4J1TC 1U0RA 2BHLA 4M55A 4JLNA 1FFAA 4CEJA 1OYVA 2H08A 3F2IA 1RQGA 3FLAA 4RZUA 3L6CA 2ARKA 3SBXA 1SVWA 3RT7A 3B1JA 3GLTA 4NPCA 1UBTS 2GN4A 2OSVA 4W6QA 5JJIA 1YB4A 2O0KA 5F7OA 2O8BB 2UYYA 2SICE 3MQFA 1BEEA 1ETUA 4CKXA 2MCFA 1Z7GA 4GMDA 5BY2A 4G4SO 3NU1A 4PYLA 3AK4A 4AROA 5A62A 1QGYA 3GROA 3G2PA 4BB0A 5I9LA 3IIKA 1O6FA 1B0AA 1IZYA 2DJIA 3MYYA 2PUBA 2QVLA 1EUCA 4FPXA 2CUZA 1HE8B 3LY5A 1OWLA 4Z8XA 1JHOA 2E49A 1QK5A 2EBUA 4F3KA 4GYJA 2H2DA 1RVDA 4RD6A 4C0KA 1KJ9A 2RAPA 4FFOA 5DW3A 4ZK2A 2H7YA 2ZSIA 3CVWA 2D4HA 5LD2B 2IDMA 1F9EA 1W5SA 3C5VA 1XZKA 3G8YA 3GD7A 3L6BA 3OPNA 1C8VB 1FYWA 3AR2A 4K9NA 1CQJB 3RLFA 1CNFA 2QVYX 4J76A 2GHQA 2NV6A 1U8XX 3SIPA 4NK5A 5H7XA 1TEZA 5KNBH 1AGRA 3NBKA 4CT0A 4BECA 1S2NA 1FU4A 1XPJA 2WOOA 1E59A 4ITVA 3FMIA 4A0FA 2C1ZA 4AO7A 3O4FA 4B0OA 1H6CA 1G8PA 4P7BA 1FSFA 2BRUC 3F96A 5HGXA 3PU6A 5E4TA 2PRZA 3KRTA 2SKEA 3OQNA 1XTJA 1Z26A 1GSIA 2BFEB 2QJTA 3ZKAA 3ROFA 2H4XA 4OKIA 2BP7B 4J16A 3MJ4A 3PE4A 5JE8A 4XAQA 5DTJA 2Z6AA 3PPVA 3I2YX 2ECOA 2PX2A 2C8KA 4JFAA 2FXVA 2YUIA 1KMHA 1XR3A 1GQ2A 3H1TA 2J8ZA 3K0BA 3P97A 1GO2A 2CNOA 2W2LD 3CNQS 2A2ZA 3PQEA 1GITA 1US8A 4AJIA 3QQPA 4GVPA 4Z4QA 4HVAA 1WCWA 2RK3A 3TLCA 1EI9A 3TEMA 4ZZ0A 3P5SA 1EYZA 3SQMA 5BVGA 3W5JA 4CTOA 3L3BA 3ZG6A 2P75A 4LHWA 1X1SA 1EFAA 3JVEA 3THWB 2Q5FA 1YFKA 1KJ8A 1PU2A 2WR8A 1U7OA 1XRMA 4OK5A 3ZLUA 3IMCA 121PA 1VMDA 4G4GA 1OI4A 1QZXA 1TOAA 1CIVA 4O33A 3O3OB 4D7AA 2CF6A 3KB8A 1DOZA 1U65A 1Z4MA 2FVXA 3DFIA 3F9CA 4EY3A 1YMUA 2GAOA 4LVOA 3IVXA 3DTYA 4J4BA 2A8YA 2V7PA 4U1RA 4H17A 2EFJA 3S28A 3WE7A 2IHNA 4JBIA 1SY7A 2UZ1B 3FWPA 1DG1G 1HDXA 3BRWD 3N86A 4C20A 3HA3A 4X71A 2P6RA 2WB2A 3ZWYA 2XKBA 2RHMA 2BTQA 1LRKA 3NHUA 3LFHA 3JRXA 4GHWA 3JQFA 3RC3A 3UH1A 2R7MA 1HEIA 3H5NA 5CA0F 2HSZA 4NYJR 1QP7A 1NW6A 1XVTA 1KPHA 3PG5A 3IHWA 4RZ3A 3U7GA 3TL3A 4QHSA 4N6NA 4DA8A 3FMVA 5JQGA 1S7GA 1VLLA 3BTOA 3SOPA 5BMVB 5EMHA 3MD0A 4E11A 4ZVQA 1Z6QA 1XYGA 1KQPA 4KGDA 4LZNA 4ZT6A 4U6NA 5EKTA 4RMIA 1E3WB 3KOZA 1Q2UA 3TL2A 3R7WA 4EGCB 1KMCA 2VSFA 3FHJA 4ADSG 4O1HA 1PWYE 3EPRA 2F00A 3HUUA 4NEHB 5IC5A 1KO8A 4LE0A 2PS1A 2QMUA 2W6QA 3G2IA 4NF2A 3BK1A 5A4IS 2WHEA 1YHNA 3BZWA 4IW3B 5BT8A 1APBA 4FQ7A 2NLOA 3BE4A 3M89A 1IE3A 4JJKA 4L08A 3GPCA 1I7NA 2FOIA 4RVGA 3Q6IA 2ZUSA 4E2XA 4RSMA 5J1SB 4YX9A 1EHYA 1C7IA 3QUBA 1UKEA 4WK6A 4AY2A 4K9PA 5DH9A 3LBAA 4OB7A 1EFDN 4D26A 3LXUX 2CVQA 3TXXA 4KODA 3VO1A 1V1RB 1ULBA 4WOBA 2AEMA 2FR8C 4PRKA 3EXG1 5ALJA 2H85A 4UEQA 1J1IA 2HA7A 2VNHA 3I64A 2F3SA 2AFVA 5ALSA 1LPBB 4ZEXA 1YMVA 4DG8A 3AWDA 4BIIA 1SG9A 3L4EA 2I4LA 5IP5A 4D4GA 4JI4B 2WIDA 5DOVA 3TJRA 4R2KA 4YH1A 4QU0A 2QORA 4FYWA 2AG0A 4MYRA 5FTKA 1KZHA 1R27A 2CMHA 1USVA 2LWIA 2WTUA 3GZNB 1KH1A 1O97C 2GEFA 4IQ8A 4L15A 5K0EA 1NULA 3L1HA 2NPFA 1YZKA 1A2KC 1TIKA 1E2NA 3L0YA 4L4UA 5LYYA 3NATA 1KMMA 5DLPA 3IQFA 3KXLA 2XGMA 3D3KA 4DMLA 3N70A 3WDSA 4BO1A 2Z2ZA 3CGWA 4YP1A 4NAUA 1NBAA 5GQSA 3OIFA 1GZ5A 1LBSA 3BDAA 3PQ4A 4LYFA 1FNBA 5IBPA 4DQUA 5BW5A 2OHHA 4UHDA 2VYCA 1XDBA 4MCJA 4FFRA 2PLRA 2ZCVA 4QYIA 4Q4JB 2ZB7A 3NHJA 4C30A 2C7VA 3I05A 1Q17A 2I1VB 2WZBA 3TF5A 3GLSA 5D2CA 3ODPA 3OOWA 1TQDA 4X85A 3THYB 1CUBA 1P62B 3QWHA 4WBXC 1XCPA 2OQVA 3WRYC 4ZI3A 3U31A 1M76A 1VPDA 1NQXA 3EODA 4X1IA 2CV1A 4FYYA 4D3XA 3HUFA 2FB9A 3D3WB 3B9QA 2AT1A 2OFPA 4JHXA 5I9IA 1AGXA 1XBTA 3HZOA 5DNYB 1R0LA 3BOSA 3H83A 1AKTA 5K3FA 5JPCA 5CVCA 3JWIA 4PGAA 1Z6PA 4ABTA 2J4FA 1RJGA 3QTBA 2FP4A 4KFRA 2ZS7A 3JD0A 4E08A 4BXOA 1WPRA 4GG1A 1KMNA 821PA 4J75A 3MCUA 3WADA 2RK6A 1MNAA 3KKPA 3DOFA 2CFRA 1BQ4A 2FQQA 2IXGA 2Q3MA 2C61A 2YXNA 1XKXA 2HM7A 2ICAA 3A14A 3BBPA 4ZANA 1E7RA 1U1FA 1O5OA 2L82A 1DQRA 4ZOLB 3RFCA 3H4IA 1IRIA 2YVKA 1X7YA 3OA2A 3BS4A 4XGRA 2VQEB 3U39A 1DQSA 1U28C 4JUDX 1BHJA 4EIWA 4Q1EA 4E7PA 3JZDA 3UVEA 1OGIA 4NV1A 4HY3A 5CD1A 4B3XA 4B46A 2MR6A 3DZKA 3TDKA 3TW6A 4IG4A 4I50F 2I4NA 2NNWB 4Q7EA 5K0TA 4MHOA 3CA8A 4LX8A 3IRUA 5FUQA 1G3RA 4R9NA 2XMPA 3VC2A 4MRAA 3N9IA 3GEEA 4PYJA 2H3EA 1O1YA 4HDAA 2PU7A 4D9GA 5IZCC 1LH0A 1WB5A 2V4UA 1CUYA 1A04A 5IJAA 4JV5B 5H68A 3A2MA 4XIFA 1YI0A 4RD2A 4FGKA 1XVAA 2RBEA 3HNPA 1RJDA 4N3NA 2LP4Y 5REQA 1NI4A 1U98A 1ZD9A 2W4QA 5BV2P 1GQQA 2QTNA 4IHJA 4I36A 2QGFA 3LPMA 3SEZA 4E5NA 4MX8A 4OL9A 4UVDA 5ALFA 1AQLA 1DJQA 1O3YA 1O4WA 2BFBB 3FIJA 4PBRA 2Y4NA 1C7FA 2JGEA 4QBHA 2WWFA 3OIVA 3WA6A 4QPJC 1ZXLA 5DPMA 3PPIA 3P2OA 1XZMA 1VIYA 3HVJA 1E2QA 4OTZA 1K0FA 4RHFA 3PNKA 1R5JA 1I1QB 4P4GA 5CB4A 2QRGA 3BK2A 3RS3A 1G5FA 1LQTA 5C8DA 4XIJA 1OBVA 3FZEA 3EAQA 2NW6A 3GJSA 1KR5A 4UKDA 3SSMA 1HFJA 1XI2A 4EHIA 3NB0A 1E3MA 3Q6NA 1Y1SA 3B13B 1ISSA 3Q0TA 3TQHA 3VR6H 1R88A 4XYBA 1N5LA 2E85A 5J5AA 2B34A 3UBTA 1HFKA 2XCUA 1PQ4A 2GASA 2H7XA 3I72A 2XCIA 3O8LA 4IIJA 5TARA 4DIMA 1AGPA 2BHNA 2YHSA 3HYRA 3RBXA 1O0BA 5F98A 1HQDA 3G8CA 1ZBQA 1LLCA 1G0NA 1P0QA 1UFOA 4RVDA 3T8YA 2LD4A 3Q9NA 4QOIA 3GLRA 1USWA 3F3YA 2DLCX 1SEVA 3VBCA 1FX0A 2VWGA 4E46A 3D7MA 2IYWA 4Y0NA 3G6WA 1FQKA 2YXLA 4WVLA 5GOZA 3U7QB 2ODBA 3ST7A 1GAJA 2WIGA 1OXVA 4ITRC 4KO2S 5EJ2A 5JDCC 1QFYA 1N2OA 2Z95A 3I34X 1BA3A 2C83A 2MSNA 1NDHA 1U7TA 1K4YA 4QJ4A 1QK3A 1LPSA 2PZEA 3RK4A 1NF9A 1C0PA 2X1HA 3N8GA 4RMHA 3NM6B 1WOMA 1FW6A 3ZWAA 1NXVA 4DDKA 1F2UA 1FRNA 4MKIA 1NBHA 2PGOA 2FZCA 4WN9A 2ZZNA 1DOAA 1KYYA 3QUTA 2PGDA 5IUJC 3GMTA 5ED4A 1GUDA 1T24A 1G4UR 1XKTA 2RCNA 2CNWA 4KLNA 2WHPB 4I1YA 4NWIA 4Q9LA 4WY2A 3ZE1B 1UEIA 1ACMA 3OX2A 5C9ZA 4J7UA 4YUVA 3C3KA 2M6RA 3IP5A 1Z2PX 2XE8A 3CW2A 4ENRA 4IDOA 3VKVA 1PGPA 3CONA 5L4LA 1L8LA 1GG5A 3FKQA 3CNLA 4P8RA 1X3LA 1OT3A 4B71A 4QEKA 4KXVA 1QK4A 5MGBA 3EXHA 1MFZA 3AJEA 4N5IX 4XQ9A 4W99A 4W1PA 1H9BA 1NE7A 2GAIA 3HCBA 1J6UA 3HSSA 3IAHA 4JCOA 3H2BA 1RRKA 3EXIB 2VEOA 1ISRA 4H4DA 4ZQCB 3WGZA 4A2CA 1OROA 3WLIA 2Y2VA 3D6NB 3NWPA 2WKWA 4ISCA 4FOTA 2DFLA 2VLBA 4CCSA 4D45A 2QNIA 3IE2A 2R65A 4MV3A 3DT6A 4PCLA 2ACKA 1DAEA 1MJHA 2INGX 4YK7A 3WK4A 4OFXA 3AETA 4RY0A 2IPXA 4BO4A 2FSHA 3N07A 1IPHA 3EOBI 2FMIA 1KBZA 1H3NA 1K5PA 3JAWB 1X1BA 5ARCA 4TOIA 5BVHA 3BXGA 1AKNA 1MX1A 2WMOB 2XWJI 3BXXA 3NHFA 4NBLA 1R1DA 3IBTA 3MMXA 3QBDA 4RA9A 3DB1A 1OGJA 1YS1X 1FRQA 1D2GA 3UM9A 4QWMA 1Z3IX 3HSYA 3K4QA 2XRMA 2WYVA 1NN3A 2VHZA 2QVCA 2FMKA 4RNCA 4XDYA 4S2UA 5TJ9A 4KBGA 4U6QA 3V4VB 5LWQA 5E6SB 1ULHA 2G5PA 5BN5B 2ZFUA 2BAGA 2WB4A 2E1PA 3AVOA 1UMCA 5JI3E 1XJ0A 4OATA 1J7KA 2B4YA 4HGOA 4AECA 4D2IA 2KE5A 5HQTA 2J9YB 4D3DA 1TLLA 3UMYA 5CPFA 2AN1A 3FVQA 3LHFA 3O0DA 3KQTA 1G20A 3G0OA 2FKNA 1A2OA 1YAJA 3DBRA 3KQYA 3VMMA 4FN5A 5EMMA 4D97A 1L2TA 3NDBB 1RRVA 1V8FA 5BNIA 4W9MC 3LKVA 4B80A 4UHJA 1P9LA 4FSHA 3WQSB 4D44A 5JXJA 1J06A 5FOSA 5BWCA 5DT9A 1Q0HA 4ZZ3A 1M75A 1IHDA 5AI6A 2O54A 3VO2A 3HPQA 3QBJA 2Q6VA 3I5UA 4NESA 3NHRA 3C70A 4NATA 4YWJA 4X8MA 4NU6A 1JQJC 1LZLA 1FYFA 2CDCA 2CY0A 4B32A 5KZMB 3HUTA 1NP3A 5AKGA 1KYIA 3GNQA 5I9BA 3RODA 4BV9A 1L7MA 5MFPA 5FUWA 2C57A 3FGZA 1FUIA 5JS2A 3UW1A 5BWNA 1CP3A 1YSCA 2I1QA 2OHXA 2ZTUA 4DF3A 3ICEA 2XCLA 4HWGA 1X1RA 2C7PA 2W8BB 2AC7A 4R5HA 4RPLA 3GRCA 2GKSA 3SS7X 4EA7A 4JI3B 5K4GA 1K3TA 2A1TR 4DQVA 1E0AA 2FP3A 5BSTA 2CXTA 1SKYB 2ZYRA 5HHTA 1FXSA 1TYBE 3RC1A 3ZV7A 2QRVB 1C3OB 2QRQA 4IRMA 1JHDA 4ND3A 2OCBA 4F6RA 4RVCA 2VP5A 4JY7A 3GBPA 1QDEA 5LP6B 3GYGA 2BMWA 3K0AA 4NCNA 3HK2A 4D56A 4TKVB 3K92A 5EWMB 5ED0A 3HM2A 4BJHB 3KZXA 1RJFA 3SR0A 4MDEA 5A3QA 2AK2A 1ADBA 2AXEA 1JWAB 4IAOA 3L7OA 5CFLA 5KWEA 2PAFA 3GDGA 4C0HA 4EZIA 2IYAA 1JJFA 3B2QA 3M2TA 3QFSA 4GPD1 1IJKA 2ZE5A 3RVDA 2PZBA 2BFFB 3BE5A 3TTVA 1I7SB 1GR1A 2ZATA 4BO3A 5BWBA 3ZV6A 1YKSA 5LWHA 5B1DA 1W46A 2VA8A 3P32A 3ZU6A 5AK5A 2V7EA 3D1VA 1CSEE 1HE5A 2IUSA 3TEFA 2W00A 1QRAA 3PUVA 3NHZA 4Z9FA 4B8YA 1UKBA 2YR0A 5CB0A 1G38A 4ZVPA 5IF9A 2BBOA 3F6PA 5EJ8A 4HLUA 1GQSA 2GN6A 1LD3A 1J23A 4N12A 4G37A 4WW0A 3WK5A 1R10A 1MJFA 3HY4A 1XFDA 3GFVA 2P90A 4E30A 1UK6A 4LOIA 3LPAA 3V42A 4GM1A 4OJNA 2AW3A 1DIAA 4P7GA 1F8YA 3FDJA 4D82A 1E3IA 2E6UX 3RRFA 2BJVA 3IIIA 4IWNA 5HRCA 4FYPA 3U5TA 1OZGA 3LGXA 2CLEB 2OQRA 4YWHA 3GUZA 4POOA 3ADDA 1PD0A 3JYPA 3E7XA 4UHCA 5C5EA 3EW9A 4IDEA 4PYMA 4MGIR 4QNMA 4E5DA 3FNGA 5IXSA 3ZW9A 3KS9A 4ZOCA 5FWYB 1ZAKA 2YVAA 3M49A 3EFBA 1B23P 4G5GA 3FCEA 3AKEA 3GRYA 4TMYA 3W7AA 2P4QA 3BRWA 4BPBA 1QV6A 3DT8A 4JX8A 1G9XA 1HXHA 3FH0A 1VKZA 4KUGA 5LLSA 2JD1A 2RGUA 2VJPA 1U9IC 2J5QA 4OOFA 3Q9SA 4LXHA 2MMCA 3E7DA 3LIPA 1DCMA 3BWBA 1MRNA 1GTZA 1WHTB 3HKBB 1FYXA 3KPJA 3O95A 3WGLA 2CYBA 2FX5A 3UMRA 3WTCA 3PGLA 5IJ9A 4EG0A 1C30B 4IVQA 1U99A 3EVNA 4IYJA 2IYUA 2IYVA 4CMKA 1AURA 1F4VA 4JBXA 2G9RA 2HZBA 5IKMA 4O29A 1Y1RA 1T36A 2QZSA 5EJEA 3VA7A 3Q8LA 1IN6A 2B7CA 3F6BX 3LF2A 1M1YE 3PNPA 4L0MA 2PUCA 1E9FA 4US2R 4Q1CA 2IHKA 4Q7JB 3EFOA 1DGQA 2ZRIA 2I2FA 1F2TB 4BVAA 2QA5A 4ZZIA 2RBGA 3GJ6A 2FWMX 1Z5NA 2XUQA 3AGQA 3RCBA 4YO7A 5JHHB 5ECWA 2I6TA 2H57A 1BGVA 3UGKA 2QN2A 1NBWB 4QOFA 4DDWA 1RIIA 3P9CA 2OXFA 3UJDA 1YK1A 2XTZA 3B8EA 1A2BA 1JQKA 2QMQA 3EOZA 3I23A 1FU8A 3L7DA 3MILA 5A7HA 4FCTA 4CXMA 1XHEA 1M72A 2RKOA 2WICA 3AUAA 1Y4SA 5I5EA 4YJHB 2PLWA 3H97A 3AMVA 3P4XA 1V16B 5JYDA 2JFBA 2WP8J 4TMVA 2J3MA 2F90A 5K6TA 1ZP6A 4HFRA 4LCBA 3L6RA 2KLBA 3CPHA 1YULA 4D0RA 1VBKA 1KIMA 4MKHA 1REQA 5GM2A 1T1GA 1PLJA 3NS7A 4EHKA 5IDQA 3QEKA 3C4QA 4B5LA 2QZZA 4YUAA 2RGYA 4AIRA 5FEUA 3MN1A 3ELWA 3KTOA 5F77A 1ES9A 5IJ0B 2FG7C 4DBZA 2WYIA 4P32A 4CIBA 1MB4A 1QUEA 3R5XA 3G2KA 1T3LA 2GKGA 2J5KA 3EEOA 3L0DA 4RAQA 4RYLA 3GVXA 2I55A 4JGBA 5EWJA 3LPDA 1E6KA 3OZSA 2Y0DA 4EECA 2OO5C 1TJYA 2ZTLA 5AW2A 1WD5A 4G5FA 3DHYA 1L7XA 1SVKA 1JHZA 4HWRA 1JX6A 3T7CA 5JRZA 3LT0A 1NOKA 2J3HA 2BSXA 4GS5A 1BOOA 1T2EA 1WSAA 2FZVA 4HYEA 1AMUA 2QK4A 1BS9A 3BBLA 3DQPA 2YH2A 1DJOA 2C9MA 3D6MA 2IU6A 3GFFA 3KL2A 3L43A 4MS1B 4OA8A 4PXAA 4R54A 3U7IA 4NCAA 3PGJA 4U0JA 3WP0A 2XOEA 3G2NA 1E1KA 4TYQA 4H7IA 4BTEA 1IRXA 4LW8A 1GGJA 3HY3A 1LLUA 2X2PA 2X8WA 4TMKA 1EP1B 3R7BA 3WMGA 2DSTA 1HSOA 2IODA 3AHEA 1P80A 4A73A 5TEWA 3NUQA 5G0TA 3P9YA 3TRDA 5EUBA 4G5XA 2W2PA 1G41A 3OLYA 5ES4B 5DBHX 1XZDA 3GWGA 1KEPA 1R9JA 3HJRA 4O25A 4TTIA 2Q5IA 3SYKA 4F38A 4MQFA 4RU1A 1IH8A 3KQUA 3C14C 1XZLA 3QM1A 4FBGA 4KE6A 1V41E 3A4NA 4R68A 4O4LA 5DM2A 5I9SA 3GD5A 3EPPA 3ER6A 3TZQA 1L4GA 4OX9Y 3A70A 2XXAA 4D9CA 1M6HA 3ABZA 3B5EA 4RZHA 1ZUNB 2ZT7A 1R6DA 2VBCA 2O2DA 1UEJA 3MNFA 421PA 1HOTA 2O8CB 4TS3A 4ARZA 1IQPA 4EUNA 3I04A 2KSQA 3DZIA 4MHTA 4NHEA 4B09A 2JGDB 2CLHB 4BDTA 2C9YA 4HUQA 1OQAA 2F48A 1EVJA 2QF7A 2WHYA 4DM3A 4GRDA 1CR4A 1E7YA 4OUKX 4C7BA 4IJKA 5AJYA 5L4NA 2X1LA 4HCJA 1EZZA 4O4JA 1PZXA 3IP6A 4JENA 1BXRB 1M67A 4P0PB 3CCBA 4JJFA 2FSPA 3GRKA 1BMDA 5JAZA 3IEXA 5HQJA 4LYYA 1QIIA 4TVBA 3ZK9A 3NVAA 2NQ2C 1RU3A 2A0KA 2O3JA 1YCGA 3SWWA 3R3JA 1M34E 3B9PA 1R6AA 5KWJA 2OQ2A 2ORVA 3ED1A 2JGAA 4U3JB 4XQGA 4MYCA 2H9AA 4M8SA 1GARA 4FYXA 2OZVA 1K86A 5GGXA 4NL4H 1UQTA 5C37A 5B2FA 1L3IA 3LECA 5FA8A 4DR3B 4BFLA 1X7WB 4IGKA 2QZPA 3SLGA 3UCFA 3ZNNA 4CQMB 1H4VB 1UFVA 3G68A 4KE7A 3LO8A 1B42A 4CDMA 4DILA 4ZQIA 3TEJA 1QHHB 2EP7A 4DCTA 5CLLA 2AEEA 2X0RA 2BKLA 3EN0A 5DWQA 4HGZA 4BNGA 1B6TA 1TMGE 1Z4OA 2OWEA 3BWVA 4RO0A 5A7GA 5ICSA 4JLPA 3AF6A 3DE1X 2DYKA 3EVDA 1N5DA 4RD3A 4FU0A 5FPPA 2HK7A 4A2QA 4CQJA 4XPZA 5A2GA 5BWOA 3BE6A 3NT5A 5CFQA 5HZHA 3WNQA 4PQGA 1O0SA 3AEUB 3AG5A 1O03A 2XODA 3THXB 4G9EA 1ZL2A 2Q5EA 1GXSB 2VYND 3B3JA 1ARZA 3I4LA 1NXWA 4QICA 5H8WA 4RY9A 4GC9A 3O9ZA 1G291 2Z2KA 5DOZA 5C7OO 4CKZA 2LCQA 4JI2B 5I4CA 1V9CA 3LI2A 3KTFA 3H75A 3O5AA 4Q1VA 3RGWS 3ZK7A 3MC1A 4RF2A 3D8SA 1P4SA 1E7MA 1FXWF 2EF0A 2PMFA 1JR3D 3DO5A 4HNGA 4NR0A 1PR1A 2MYNA 1QCCA 2CLFB 2HQOA 1KJJA 2FW6A 4KDEA 5IAEA 4EKEA 1OT5A 2ZTHA 2A5DA 3JQBC 5LFAA 1OTXA 1N6KA 2R1TA 3BREA 2YZMA 1NLFA 4OEHA 3OHSX 1GADO 2E7ZA 3MHPA 1OTYA 3PX2A 4BBAA 1SU8A 3ZY4A 1NQOA 2AG5A 3LCUA 2J0QA 1XU4A 2P0YA 3CUKA 3HVHA 5CM9C 4I55B 4DM7A 1NVGA 4YI3A 4H7JA 2YIDA 3KPWA 1V2GA 1PTJA 4Q16A 5KSWB 1QG0A 3KBBA 5GIPE 3QU5A 2V4MA 3KSAC 3CLTC 1BC5A 1W8DA 3GW8A 1RZUA 3F4LA 3HJHA 1N7HA 2Z83A 5M29A 3UAXA 1DVRA 3OP4A 4CIVA 1KHHA 3RNLA 1IZZA 4B9AA 5LQRA 5BQXA 1FLNA 3TVDA 1MA0A 4FP9A 4RE5A 2OP0A 4CM8A 4YQFA 3QH4A 4R51A 4F12A 4JC4A 3EGDA 3RE1A 1T3SA 2A0YA 4X94A 3DTTA 3KHTA 2IL1A 2AD5A 4POAA 3BFPA 4RGQA 1X0VA 2WF6A 4YJ2F 3OFJA 3T9AA 2VHYA 4Q3KA 1JHMA 1XEWY 3WGQA 2R60A 2OVFA 1RM5A 2WM9B 3E05A 1T4CA 1GPBA 4AZ3A 4HDKB 4DDHA 4B0PA 3CIFA 3GCGA 4JLVA 1NW8A 1WXDA 2DC1A 2SCUB 2ID8A 4B6PA 3U09A 3DULA 4DC0A 1OI7A 2AFHB 5DZSA 4OXKA 4C88A 4ZK6A 3DE2X 2WJ4A 4UBKA 5C1BA 2BM1A 2QX6A 4CMIA 4A6EA 1GZDA 3FOEC 1GLVA 1T6NA 5TQ0A 2ZWMA 1XPRA 5CW2A 1G5TA 2FMFA 1N78A 3HE3A 5F21A 1N0HA 1ACLA 3WLQA 2O14A 2ZYAA 3MJSA 1YMQA 3ZEAA 3MMPA 4EB8A 4Q4HA 5LUAA 2SKDA 4PY2A 3WJAA 4PM4A 3VM6A 1UPCA 4YROA 4M0FA 1E2UA 5L3SB 4UAJA 3M6VA 2QSYA 1BFKA 1P7YA 4Q03A 1YVDA 4N0EA 3JS5A 4M9SA 4W5HA 2G09A 5T8KC 5K0BA 5GONA 1Y1QA 2CXRA 1V3QE 4PYOA 2J48A 1NJGA 4AVYA 3U3ZA 5JEDA 3QVJA 2H29A 3FIUA 2BMEA 2NO4A 3GRFA 4OQFA 1IN8A 1N2EA 3ABSB 2VJMA 4UBOA 1E1MA 3UHPA 4HLUC 3BJRA 4RZQA 1POXA 5L4SA 4RBNA 4MUHA 2XWPA 4EF5A 1SXJA 5BXYA 3TB6A 1DAMA 4PS0A 1A4IA 3H9QA 5ALHA 1TAUA 3ZVKA 2CL0X 1U2EA 5EXXA 3ZV5A 3ZZ1A 2JCXA 3ENKA 4PZUA 4BJ6A 5AUOB 1EFPB 4JIGA 5D86A 5DLEA 1JS1X 3LYUA 4ZICA 1RBQA 4YACA 3KVRA 3R0QA 3B3AA 4KLRA 3A1NA 1G21E 1RI5A 3X1YA 3CS3A 3IAM6 4WESA 2NU8B 1IAVA 4CM4A 2PHZA 2C2XA 1B16A 1H2HA 3TAXA 4RYDA 4YP0A 4QPNA 2O05A 3V9PA 2P11A 4A5OA 5HKBA 1UDXA 4US1R 1FMJA 3G5AA 2FPGA 3ROKA 3AHIA 1X1EA 3EC1A 1FIUA 1XF9A 1H9CA 4YCSA 1CEEA 5PNTA 4DLWA 4OH1A 2ZREA 3RJ9A 1C7JA 4NOJA 4Q4LA 5EIXA 3G5TA 1CQIB 3BORA 1P2DA 1RI2A 2NZVG 3HWRA 4JJ4A 4KH0A 1YVUA 2QY6A 4TRRA 4YCDA 3LLSA 5ALXA 4AKTA 1F2DA 3WVNA 4B3TB 1N75A 5IYZA 4HN2A 4MW1A 4DW8A 2I71A 1H65A 3VVCA 4B34A 2CV0A 3BFXA 2PDAA 5FOTA 5C2JB 3QXHA 4HSGA 4N7RA 5G41A 1T91A 4DZRA 4M6WB 1NQAO 2C9OA 3QVGA 3NMUF 1SVLA 2JH8A 5EIBD 1H5QA 4EL0A 2GWHA 4MA5A 1J9ZA 2ZT6A 1JPUA 3AKDA 1KWGA 3UCXA 3BRSA 4XVHA 1RLTA 1VRCA 3IT1A 5EKUA 5KHOC 2YS7A 3JQ7B 1EG2A 3OAAD 4J9VA 4EKYA 3KAPA 1B6GA 3LP5A 1DX6A 3QNUA 4LSMA 4EG6A 4LRUA 3A37A 1JLHA 4F92B 1AY0A 1PNOA 4K9OA 3B6KA 5E4YA 1OFVA 1U0FA 2LCIA 3GDHA 4DRZA 1NATA 3QVUA 4IF6A 1AH2A 5DM0A 1VPVA 3BN3A 1LC3A 1H2RS 4R71A 2BFCB 2Z04A 3KZCA 4CEIB 4HH0A 3OZVA 4LY6A 4PNHA 4WK2B 1QNLA 2QPAA 3CVUA 1S02A 1IN5A 4P7KA 2AF4C 2QN7A 2C7GA 3M6IA 4AK9A 2UVQA 3KHKA 1KNXA 1J2TA 3SLRA 3TDMA 3W6UA 5J4YA 4QJ3A 5DBGA 3H6KA 4Y2HA 5D1HA 3SLKA 2ZJFA 3G7UA 4CVNA 1ZJYA 3NVKI 1KR2A 3V6LA 1DFHA 1WTAA 2C29D 1T43A 2QPOA 2PYIA 2Y76A 3TQQA 3OF3A 1BCSB 3NHYA 3OEWA 4A9AA 1C0LA 1A8UA 1DJNA 1O5IA 3GP5A 1ADCA 3U3OA 4J0KA 3LU1A 1XROA 3T3EA 4IJQA 4JT9A 4OYHA 2OMEA 1QWSA 1ZI6A 2GAJA 4YS6A 3E22A 5FA6A 4GECA 3FCAA 4KGZA 4U2KA 1O89A 4ZO9A 2IPAB 1RAIA 2BI7A 3DEYX 2RKWA 4HAXA 4KXNA 5ALYA 3I53A 5FBZA 1FP4B 3IGFA 1ZUIA 3NEPX 1JFRA 1NR7A 2AG8A 4B17A 1Z0DA 2CF5A 3AL3A 4KN8A 5AJHA 1OBOA 3F3SA 4RCVA 2PZAA 2RONA 4JB8A 1V8DA 1VTKA 3JQ6A 4WDQA 1LU9A 2Q3HA 5H3LA 3RKUA 1PUJA 2JLSA 4IHAA 4PXYA 3ZQJA 1FJGB 4UJ5A 5IK2D 4NARA 5IUKC 3GT7A 1OZAA 2RJOA 5AW5A 3L40A 2H52A 2R87A 1J99A 4LISA 1RS0A 1WABA 3RTAA 3I2IA 4L78A 1CCWA 4UU0A 4B8ZA 2PYZA 1ISIA 1W2HA 2I6FA 4P1ZA 2WAXA 3NBFA 3TW8A 5D00A 3WOHA 3DE0X 1A9SA 5K0NA 2X22A 3MS7A 1E1LA 4C2UA 4EJSC 1XDWA 3WY9A 1VI5A 3AVUA 3Q2IA 5DLYA 2EFDB 2VG8A 1URPA 3IXLA 3JASB 3L0OA 3N2GA 3OLXA 3LZCA 1GRRA 1ENPA 1SA0B 2OTCA 3FPGA 3KKNA 3LX6A 3MTQA 4FK8A 4CL2A 3RIGA 3TUIC 3N0XA 3FOCA 1WB6A 3LOQA 2OGTA 3M4JA 5EUMA 4P84A 4AF8A 4E22A 3OM0A 2GWRA 4IJ5A 4YONB 1SUFA 2FX2A 2X13A 3CF6R 4RPHA 4X84A 3F73A 4ER6A 1CS0B 2CXPA 4MVJD 3O4HA 4RAOA 1IWOA 4DQLA 3N0TA 2EJUA 2QE7D 3R0JA 3DMYA 3KVOA 3AEKB 2GSDA 2X2EA 2OFXA 2R3SA 2PXAA 2RG7A 4R8KA 4ZQEA 3K05A 4LX0A 4R2IA 4KVGA 3IAAA 1FPQA 1CLUA 3JWHA 3QMWA 1WO8A 2QX9A 1U80A 2ZRDA 3EH2A 4ZKEA 4AJEA 4FOOA 3VSDA 3EPJA 4KR6A 2G72A 2OLKA 1PCXA 5K3SA 3G8AA 3FFTA 5K3AA 4B6GA 4DYHA 3BD6A 3L9WA 5A3RA 2PS3A 3AH8A 3ESZA 3N3BC 4DLRA 3R8FA 5AI9A 1HDCA 3JSAA 3KV3O 4XD7A 3ILYA 1XLTC 2QJOA 2HIHA 3D6JA 3FFAA 1E6UA 3JYNA 5JRJA 4D8WA 2YY5A 4FC7A 2IHTA 4DBLE 3V8BA 1WSWA 3EIEA 3LP8A 2WSYB 4BIMA 2RH9B 1IWBB 2CT8A 1IIRA 3HWSA 5D84A 2B1JA 2ZBDA 4JFRA 2QP4A 1L9XA 4HYQA 2IZ5A 1K8YB 1XALA 1UBFA 3ZC3A 3T9EA 1CJCA 1ZSYA 4YRTA 3MJEA 7MHTA 3AGPA 4MTLA 3MTIA 1NASA 4KIFA 5KNCA 4KIGA 1GWNA 3G1TA 4NJEA 1XZIA 1N4DA 2P7HA 3I39X 1VMKA 4UQOA 2G1AA 3WO1A 2R1VB 4RCYA 3FOAA 5LLDA 2GF2A 4JNKA 3OJXA 4UOQA 1QQ5A 4ENWA 5TVGA 1OF1A 2CVHA 1DKNA 3LC7O 2P9CA 4FE7A 5A4JA 4MCHA 1YR6A 2ZJZA 3L0SA 3KR1A 3X0DA 4ZGBA 1IYZA 3RASA 3GVIA 4RJJA 3DWGA 1EUQA 4D9IA 2OO7A 3EYWA 3T3HA 1NWHA 3GN2A 4JBGA 4PV7A 5FBWB 2BFEA 3EUEA 2ZE6A 4ENQA 4UHHA 5J2UA 4TYYA 2GK3A 4NG5A 1YE3A 1MDFA 1K7CA 4M87A 1KDYA 1T5DX 4DQXA 1YZTA 1SB8A 1NMEA 1XPUA 3QPBA 1Z0ZA 3F7NA 1K7XB 1U2DC 4HYTA 3MT8A 1RYYA 2GK6A 5CNMA 5AVKA 5BSRA 3PFHA 3QEJA 2BCEA 4RK6A 4YRGA 5IULC 1TO6A 1RXIA 2R4UA 5T64A 4I4NA 5BN3B 1W47A 2J9ZB 1TM3E 5TMBA 3W5VA 4LBYA 3AF5A 4PG8A 2IU3A 1AE1A 1YDMA 2IE8A 1UDBA 3R3YA 4IOKA 4KXMA 3VH2A 1K88A 1SXJC 1Y4AE 4Q34A 1M10A 5GVRA 1Y6GA 3M4XA 3RU2A 1QTIA 1ORIA 1G4AE 1PP4A 5KNBD 3KL4A 3NWOA 1V4BA 1SCUB 3HB0A 3I1FA 1RPNA 4WASA 1CUCA 3VR3D 4PWZA 4QELA 5FI0B 1YTUA 2AD1A 2J6IA 3EARA 5BOVA 1S5PA 3UN1A 4KLAA 3TLXA 3LLVA 2VXCA 4WN3A 2HSWA 3AUKA 2QVXX 1SHUX 3OZEA 4XSVA 3JR7A 1QKKA 4YFVA 2A86A 1JHUA 2HTFA 4ZAGA 4K1XA 5T8KA 4QT0A 3RTGA 4ZGWA 4WKCA 3WYGA 4ZI7F 2OBBA 3G6KA 3S70A 5KO2A 1RTTA 2GPSA 4V0KA 6ABPA 2ZR8A 3ZDZB 4FM9A 5JD3A 4EY7A 3DLAA 4XUCA 5DI3B 3CFYA 4C14A 4PO1A 1LSSA 1E9EA 1JR2A 3CBGA 1UKCA 1J0CA 2HHAA 1LBIA 2BVNA 1B43A 1J0DA 1PUXA 2O2GA 3AEXA 2HLDA 5KJ1A 3G5UA 3HCPA 5FTNA 4CUKA 1WF6A 5DCWA 1QIGA 2R44A 3VZSA 4YJ3B 5F35A 4UARA 3QWFA 4TKUA 2RD2A 1BE0A 1FFEA 3F47A 3QU7A 3PXEA 2ZBQA 3R6GA 2EJBA 3PUKA 2E5LB 4C3ZA 2VYNA 1Q20A 4BUZA 5BMOA 1G2OA 2IP1A 2IEIA 3PE3A 3WB0A 4R16A 3HU3A 1VCNA 4LTNA 3RYTC 3L49A 3IUSA 2UUBB 1U9ZA 2YUTA 4ZQBA 1Y9JA 2QRUA 2QR3A 3DXZA 1SKUA 2O2SA 4XTRA 4H7EA 3WKEA 1JFVA 3BPSA 5GJBA 1JR3A 4JT4A 1E5DA 2X42A 3FBGA 4PZ9A 4PZEA 4R84A 2DWUA 4FZJA 5C8ZA 1ABFA 5LZ5A 1EXVA 2ZJYA 3TNJA 3GLHB 2A9FA 5KNBA 5BYAA 3VOTA 1BKSB 3LVRE 1K4KA 1NX9A 2GAFA 2RI6A 2P68A 2E55A 3FVWA 3NZEA 1UT6A 5JBIA 4ILEA 1OX4B 5JZMA 2H1HA 4REOA 1QHYA 3M4ZA 3QELA 3SXJA 2OYSA 5JAOA 5AKZA 1RCTE 1GRVA 1JAXA 4JWKA 2E4YA 5KX5B 3JY6A 2KBEA 2N75A 5A9TA 3G88A 2XXBA 3D2BA 4RABA 1P5ZB 5BT9A 3B89A 3AU8A 3HBAA 1R8JA 4PGFA 1T4GA 3FSRA 3VVLA 2JIZD 3CZRA 4DADA 2BV3A 1IBKB 3C3EA 3L02A 4F56A 5LIRA 3T9CA 4ASUD 2WA2A 3L7AA 2GZ3A 1OAKA 2ACEA 4PCAA 3A11A 3LZDA 3WGUA 1NRIA 1U3VA 2Q1TA 1QO0D 2QQEA 1JA0A 1JP7A 2G4VA 2X1VA 1QHGA 4H31A 4LMPA 4QBIA 4QO8A 4XUGB 1KQFA 3GJ7A 3PITA 4R5MA 1V71A 4YRLA 2VRNA 1KFBB 3CCCA 5HBRA 3UMMA 1YJ5A 5THQA 3U2QA 4LJSA 4W9NC 3HRHA 3A25A 2XTJA 3TSOA 3KDSE 3WL3A 4BB9A 4TLBA 4BGEA 3VZDA 4OQ4A 4K46A 1RM4A 3C6YA 1RWWA 2YV5A 5DULA 4AKGA 4NAVA 3A04A 2IZ6A 4RVSA 2C88A 2QJFA 4KFSA 3SE7A 1RJ9A 3L46A 2I8LA 3ASZA 5EY5B 4ARSA 4S0ZA 2R2GA 3M6LA 4MGHA 2VK1A 3EGXB 3A9RA 3K09C 3LBNA 4R0NA 5DN6D 5JMOA 1V5WA 2KYRA 5ALKA 3TSCA 2FRDA 4Y2PA 1P2VA 1VKJA 3NXKA 4XWYA 5D3QA 4B4UA 4WNYA 2OENG 3VJRA 1YS9A 4CLEA 1QB7A 2F9MA 2ZIAA 2RBKA 3AHJA 3C3DA 3LHIA 3NC0C 1CE8A 1N57A 3O31A 3P0FA 3QOFA 4HNRA 5LUBA 3TFOA 2J3JA 1I7LA 2CBZA 1KKUA 2X0JA 3LUFA 3QU4A 1KRWA 1V3VA 3UAVA 2FMTA 1GT91 2W71A 3QVGB 4LK2A 4I1RA 1AU9A 2ZPUA 3C1UA 3V1MA 5EA2A 1NW4A 1SMKA 4ZOLA 3TLBA 4G24A 4DR7B 1XAGA 3T7DA 4RF5A 2VUHB 3LCCA 4ZTUB 3FTQA 3U80A 1VMIA 4PONA 3PFFA 2PQ2A 4KPUA 4F4DA 1UJ5A 1WDMA 2QAGA 2WD7B 2P5UA 1DC5A 3JRWA 1QAQA 4Y0AA 2Y05A 3ZBQA 2C5FA 1DARA 3QJGA 2D7CA 3PP8A 2R5WA 4YRIA 1XMPA 3NV7A 2X15A 1P74A 1NRXA 2XDQA 1SXIA 3GFRA 2QBYB 1HDEA 1OAOC 4QXMA 5TPWB 1MKYA 2KX7A 1S4MA 1FLDA 2NZ2A 4FIZA 4LXIA 4YMIA 3INGA 1E2JA 3REQA 5LDDC 4QXRA 3HP1A 4WBNB 3QKRB 2HXGA 4X1KA 4BV3A 5M3BA 5GOTA 4BCCA 2PX4A 3ZNPA 5HKOA 1MTOA 1PV4A 1B8UA 2AVNA 2ONCA 5G53C 4ALMA 1KS9A 3DCNA 5KMGB 1HKUA 2FUKA 1PZMA 4X1YA 3E3NA 1SK9A 2C98A 4GL4A 2GBLA 3E5RA 4PZDA 3HS3A 4KBYA 1Z5ZA 2H48A 3HFGA 3KXDA 3N0VA 1G21A 3C15C 4WX2B 1HM5A 2GS9A 2HCJB 4JL8A 4BQFA 4E51A 1W36B 2VHEA 4BX0A 2GK7A 5AW7A 4DR6B 5AFSA 2MINB 3CIOA 4FLFA 3R09A 3G7SA 4NMHA 3PRYA 3PTLA 4MDYA 3IKJA 4WINA 4EA9A 4BVHA 10MHA 4IY1A 1D1SA 4MK4A 4YAKA 1F06A 2V9PA 4A91A 4B31A 1M2VA 3ADCA 4IDPA 3G49A 2GD0A 4OU5A 1QAOA 1ZSVA 4X92A 1MV5A 1ZQ1A 2XW6A 1WF3A 4BNJA 4TLAA 5IKEA 3Q3JB 4B45A 2GAAA 4EUSA 4OAPA 5EFOA 4HNTA 3DDHA 2H6EA 1Y7IA 2X8BA 3FNHA 1RXCA 1R0KA 4M86A 1CZLA 2ZLBA 3QPAA 3E7FA 4I55F 5DB4A 5KQGA 1VCHA 2R6ZA 1U9YA 1WE2A 1WPQA 3KPYA 4OXNA 1QLHA 4QATA 1D04A 5LB2A 4W8HA 4DLNA 3PC3A 2RHRA 1IN4A 2Y2UA 2AKYA 3V4LA 1ZC4A 5A4AA 1P2FA 1KI4A 1NURA 2EHJA 2FOXA 2J85A 2KJQA 3DDZX 4HDOB 3UMVA 4D4KA 2PWYA 4D81A 1GVNB 4BQPA 1Y8QA 2XYQA 4OV6B 5M2QA 1FX0B 4UMDA 2PU5A 2VJAA 1WOYA 1NE2A 4IKOA 4OBXA 4HGNA 3ASUA 2HLPA 3O84A 4AJ1A 2ZSUA 3OQIA 3L92A 3OQ1A 2ECKA 3TI9A 3WK8A 4QX6A 1MJGA 1TM4E 4RK0A 3C2QA 1E61A 4Z1OA 3FA2A 1ECFA 1K5GA 4ZRDA 2UXCB 2N0SA 1GA1A 2N46A 1OXMA 5DW0A 4ZCQA 5SV2A 3S1AB 5KNCH 3ZJUA 2WWIA 2PXHA 4RIEA 3ZWBA 4LXUA 3SX0A 4DYVA 4F11A 3E9NA 2NUPA 2QMEA 1EVIA 1HTWA 1YUBA 3DWFA 3TIVA 2E2WA 4D1YA 4K3VA 2YJ5A 3OQVA 5KREA 4AKHA 1G5RA 5TE9A 3ZD8A 3DD1A 3DEJA 4H4EA 1P5HA 1CQWA 1G64A 1MO4A 2Y6UA 3UWKA 4IFEA 4O4HB 3SQOA 3BYZA 3FSGA 1KC1A 3OPYA 2XTNA 2MSEB 2PJZA 2WHPA 3A0RB 5CYGA 3CF4G 4EP1A 1W6UA 3ONFA 2WT4A 2I54A 2VAWA 5EI5A 1CQXA 5CHEA 4Y9SA 1HKHA 4BAZA 1YQGA 1QFMA 5H3HA 2EW1A 2IY8A 4DC1A 4CTNA 2ADMA 3IC5A 4IIXA 4IXTA 5CIYA 2IH5A 5IWCA 3CVXA 1GV1A 3NM4A 1V9LA 5CIQA 5B64A 2B8WA 2O1WA 1DCTA 3PDJA 3MQ2A 1GHTA 3EXHB 4LQ4A 4F6LA 4JOCA 5E6UB 2B9EA 3GLGE 4GQIA 1ECJA 3GIWA 2V97A 3ANTA 3A8TA 1WXHA 1QAMA 1OH8A 1KO4A 5AVUA 1ND5A 1W4ZA 4PC7A 4KMMA 1DJMA 2G36A 3URMA 2V0GA 1Y3FE 3M2PA 3DEZA 7ABPA 2R5FA 1JEDA 5F33A 3L5OA 4CNQA 3NIGB 3CZ9A 1HPLA 4XB6B 1F1JA 3FYTA 2IX9A 5HDBB 1Z6GA 2J9RA 2X77A 3JAWA 4NU5A 1DPFA 3K30A 3B3FA 1NF8A 1ZIOA 2IPNA 4KO8A 4MUKA 5B2ZA 4DXAA 2QD4A 5BP7A 4GX1A 1O87A 3VR5D 1T34A 1IBCA 1JE1A 4WLUA 2W6MA 2FSFA 1GUBA 3KVYA 1RDFA 1WZCA 3QBEA 1NT4A 2Y66A 4EYSA 3U4QB 1T9ZA 2WNSA 2R7NA 3AEQB 1H8ED 3O4VA 4Y1RA 1V9SA 3DEAA 3HUEA 4I50B 3KOYA 1YRAA 2B5OA 1G8AA 1L5NA 1FTQA 3TRIA 3BWYA 3UFBA 1YBHA 1TJ4A 2NPIA 4O08A 4I4CA 3UJCA 4DCGA 5INTA 1AKMA 1QQBA 1GAXA 2EYUA 1GKKA 5K9ZA 2D5AA 3O4IA 1JZTA 2Z57A 1JDBB 4EYQA 5E38A 3V8EA 2J0EA 1E3SA 4I9NA 3WJ2A 1T6BY 2CBXA 4X8HA 2FLVA 1JT2A 5CM8B 1FP2A 1S3SA 3AB7A 2YWCA 2IQIA 5HF9A 3EGEA 3D5QA 3CF4A 3S2UA 1B15A 1BWSA 5EJ4A 1JVSA 3D7LA 3QRWA 4GZMA 4LSWA 1DC6A 4CQLA 1H5UA 1NN1A 2OV2A 2OYRA 3K70B 2M6SA 2YQZA 1J9GA 2MYUA 4Y2GA 3BWCA 3RIEA 5JVDA 1M8FA 1HOXA 1IBRA 2QR5A 1QZZA 1KL7A 1T8SA 2YIVX 1BU8A 1MLDA 1W49A 3KQPA 4KJZA 4B75A 4U39A 4R3UC 3ZVMA 3KFLA 5CBPA 1UZUA 2FEXA 2FW7A 4HH1A 4IZIA 4FW9A 3FCCA 2IYPA 2YN4A 1ISFA 1SD5A 2X4IA 2ZTSA 2QVGA 3UGQA 4MVCA 3K9LA 1T8TA 5T41A 5MN6A 5FOVA 5D6OA 2D5LA 1JEOA 2QE6A 3ADPA 4URFA 4M0LA 5EXDA 3VR5A 1JH9A 1HORA 4R1UA 3HI4A 4ZODA 4FDLA 3E1KA 2M2IA 1GLGA 3IP3A 1QP4A 3OE4A 1GFIA 2RMKA 2ZYGA 3RVQA 1KTIA 2Z5FA 4ZOAA 3JQAB 1ZGZA 1V26A 4B43A 4MVJM 3G2HA 4N3BA 1V8ZA 3OCYA 3QE0A 5L7TA 1YZ3A 1OBCA 2SNIE 5DF1A 3C3MA 5EWMA 1N5MA 4TTQA 5LU8A 4U7TB 1EA5A 2NT3A 2GZ1A 4TVOA 5GVSA 4NBVA 2HA6A 4RX1A 4KXLA 3UJ3X 2DPXA 2RGNA 1QH0A 2XT0A 3FPFA 4OA5A 4AWBA 1R0CA 4QODA 4EL5A 1T0JB 1LB1B 1KF0A 3AVYA 2A9PA 3MOSA 3NH6A 3PQFA 1MXHA 3LUCA 3WOVA 3MINA 3TPCA 2NMVA 2NU7A 4JNCA 4EYEA 4EHDA 3CX8A 3I8SA 4J0HA 3SHTA 2B30A 3HCCA 2YJ4A 3ZD9A 1U2PA 4QUIA 1I4OA 1YQUA 1NUPA 1MC8A 3P4UA 1Y9ZA 1Z6ZA 3JYQA 2P4SA 5KINB 4IDBA