2QLLA

Human liver glycogen phosphorylase- gl complex
Total Genus 291
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
291
sequence length
835
structure length
805
Chain Sequence
LTDQEKRRQIIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTVRDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDIEELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYFNQKIRDGWQVEEADDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVNTMRLWSARAPNVLDRNLAENISRVLYPFEGKELRLKQEYFVVAATLQDIIRRFKASKFGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKLPWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFPKDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFVPRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPATDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Glycogen phosphorylase, liver form
publication title Molecular recognition of the protein phosphatase 1 glycogen targeting subunit by glycogen phosphorylase.
pubmed doi rcsb
source organism Homo sapiens
total genus 291
structure length 805
sequence length 835
ec nomenclature ec 2.4.1.1: Glycogen phosphorylase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00343 Phosphorylase Carbohydrate phosphorylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2qllA02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2qllA01
1GFZA 3MTBA 5D01A 1XC7A 2XGMA 2SKDA 3ZCQA 4AY5A 3UYLA 3DD1A 1XL0A 2PQ6A 1EM6A 4Z5XA 1NOKA 4AN4A 4GPBA 6GPBA 3L7DA 3L7AA 3NPAA 2XCUA 4N3CA 2GEJA 2ACWA 4X7PA 5IKOA 4EKYA 4YI5A 1WW2A 2C9ZA 3NAZA 2H1FA 4F96A 1KTIA 3MTAA 4MHOA 2QN1A 3DDWA 3OKCA 4GZ3A 2AZDA 3TSAA 1XOIA 3C4VA 4XIFA 2F3UA 4RIHA 2GT1A 3CUWA 3L79A 4N3AA 1C8LA 4F97A 2BGUA 2R4UA 3WC4A 1HLFA 3G2JA 2VCEA 3H4IA 3E3NA 2H1HA 4KQMA 3TOVA 1L5QA 1GZ5A 3ZCTA 3DZCA 4HLNA 2G9RA 2QRPA 2C4MA 3T3DA 3NP7A 1NLMA 3IA7A 2GPBA 4NC9A 5TMDA 2XA9A 5ENZA 3C4QA 1F0KA 1YA6A 3G2KA 1PNVA 5HXAA 4EL5A 3NCHA 3CEJA 3Q3HA 4WHMA 2C1ZA 1E4OA 2VCHA 1P4HA 3GUHA 2XMPA 3L7CA 2GM9A 4RBNA 2F3QA 2OFFA 3VUFA 2GJ4A 2KS6A 3E3OA 4REMA 3PE4A 3T3EA 3TAXA 4LDPA 5DXFA 1RZVA 2QLLA 1WV0A 1JG7A 1JIVA 3CEHA 4GYYA 1C50A 1BX3A 3BEOA 4BQEA 3MS7A 3OTIA 1GPBA 1FA9A 5JTUA 1NZDA 2VG8A 3S29A 3MRVA 1SXPA 2VSYA 2IUYA 1P29A 2PYIA 4GYWA 2ZB2A 3D0QA 3ZCVA 3G2NA 1XL1A 1Z62A 1RZUA 3NP9A 3UYKA 3CUUA 4YI3A 9GPBA 5GPBA 3QHPA 1FU8A 2GPAA 4RENA 1LWNA 1Z6PA 3Q3EA 3GPBA 1PN3A 3QKWA 4MHSA 1Z6QA 3BCRA 1IIRA 1JIXA 4GZ5A 3IAAA 3OY2A 4AMGA 3ZCSA 4HWGA 2BGTA 3HBNA 3COPA 2FF5A 1IXYA 3CUYA 4XI9A 4N3BA 2QLMA 2XGSA 1J39A 1O6CA 2JLBA 1XKXA 2BISA 3RSZA 1P4JA 1M5RA 1GPAA 4RIFA 2ATIA 1NOJA 4LEIA 3WAGA 2X0FA 1UQUA 4MICA 4X7MA 1AXRA 4CDRA 1C8KA 2PRJA 3H4TA 1EXVA 4NESA 2QNBA 2R60A 5IKPA 4M7PA 1NZFA 3MS2A 1JEJA 1L5WA 3OTHA 4QLBA 3CX4A 1WUYA 1FC0A 3MT7A 8GPBA 5I45A 1PYGA 3PE3A 1AHPA 1P2DA 1FTYA 2SKCA 2P6PA 1WV1A 3EBPA 2O6LA 4EL0A 3RHZA 4AY6A 1JIUA 3OTGA 1E1YA 3S0JA 4EJ2A 4X7RA 1ABBA 2QZSA 1WW3A 4G2TA 1FS4A 2QLNA 3VDNB 1WUTA 3S2UA 3T3IA 2G9QA 1FU4A 1QKJA 3MQFA 1L5VA 3HBJA 2QRHA 2QN3A 1L6IA 3T7DA 2QN8A 3Q3IA 2IV7A 1NOIA 4L22A 4F9FA 2XA1A 3L01A 5LQDA 3MRTA 2IV3A 1K08A 2WTXA 1H5UA 4BQFA 3CEMA 2VSNA 2YJNA 2ASVA 3RSCA 1L5SA 2HY7A 3G2IA 1YGPA 1Y8ZA 5DU2A 3MSCA 1PSWA 1XV5A 3ZCUA 3CV3A 3SYRA 3C48A 2QRMA 2JZCA 2Q6VA 1FTQA 1GG8A 5JTTA 3BDAA 4YUAA 3G2LA 1RRVA 2F3SA 3D1JA 1P2GA 4RIGA 3MS4A 1L7XA 3AMVA 3WADA 3SYMA 1C3JA 3NB0A 4BFCA 3EBOA 4AMBA 1F6DA 4X6LA 2R66A 4PQGA 2G9VA 4FKZA 4WADA 2QRQA 1P4GA 4RIIA 3RT1A 4NEQA 3BD8A 3CUTA 3L7BA 2BFWA 2X6RA 3T3HA 3OT5A 1JG6A 3BCSA 2AV6A 4EKEA 2FFRA 1VGVA 2AMVA 1B4DA 3MBOA 3NC4A 5DLDA 1Y6GA 2XA2A 4KQ1A 2IYAA 2JJMA 4GZ6A 3VUEA 3ZCPA 4MI9A 3G2HA 3E3LA 2F9FA 3T3GA 4W6QA 3MT8A 3ZCRA 2XGOA 2XCIA 3OY7A 2R4TA 3OKPA 2GPNA 2AW3A 4WACA 1GGNA 2G9UA 4BQIA 2QN7A 7GPBA 3DDSA 4KQ2A 4RIEA 3S28A 3VDMA 1Y6FA 2FETA 2PRIA 4CTMA 3MTDA 2ACVA 1P2BA 1L5RA 3D0RA 4MI3A 2X6QA 2IEGA 5TVGA 1V4VA 2GEKA 2X0DA 3HBFA 5D00A 2R68A 3BD6A 1LWOA 4RELA 3MT9A 2PYDA 4N39A 3OKAA 3MRXA 5BNWA 2C1XA 2QRGA 4MI6A 3BCUA 5C1DA 4MRAA 1SXQA 1QM5A 2F3PA 4CTNA 2QN2A 4M60A 5TMBA 5TMEA 4N9WA 3BD7A 1K06A 1NVKA 2X0EA 1A8IA 1UZUA 2SKEA 3FROA 4FZRA 4CTOA 2QN9A 1FTWA 2IYFA 3HBMA 3S27A 3T5TA 4M83A 1GPYA 1Z8DA 1FU7A 2ECPA 1UQTA 2IEIA 3O3CA 2IW1A 3CUVA
chains in the Genus database with same CATH superfamily
5D01A 1CJBA 2NU7A 4IS2A 1KSGA 1UJ5A 2GHRA 1C7IA 1EHYA 1W30A 5T3YA 3FTCA 1R0ZA 3DO5A 3RS9A 3PJEA 3UMYA 1QFYA 1UEXC 5AJXA 1APBA 1TVKB 4UMDA 2QRKA 4MR7A 4NPHA 5D84A 1WCIB 1HQYE 2OYSA 3GAFA 2WV7A 2Q49A 4RMNA 3UXHA 1N5LA 4BCCA 1JLKA 1H4QA 2AGVA 2WIAA 2A14A 2W6QA 3A3PA 3KEOA 7REQB 1Y81A 3T1TA 1GGEA 4ID3A 2IS2A 2OV1A 1VLHA 2QTLA 3H18A 4YV0A 1A72A 5J5CA 2R8EA 4W5HA 4S1NA 3BM5A 4FGKA 2GZAA 2WI8A 2PX2A 2WIJA 3NRCA 1JALA 1Y3IA 2OE2A 2WMOB 3PRYA 5DN9A 1UXGA 2Y1KA 2GCOA 2V1XA 2YQ5A 3NJRA 4DRZA 2KE5A 3SXJA 3KE9A 3PSAA 1SCDA 1EVZA 5ESXA 3T0FA 1PZEA 2D2XA 4OUDA 3WICA 3CW8X 1F3LA 2FZGA 1DJPA 4YECA 3RFVA 3EF1A 1ZXBA 4DSAA 1E98A 3KYCB 3R7LA 1ZS9A 1T35A 4JVNA 5AI5A 2G63A 3TSAA 2PZMA 2V7WA 1M6YA 1XVTA 2O52A 2OBBA 2Y9MB 4X1KB 3TLAA 3G0IA 4RIHA 1E7MA 1GQRA 4PANA 2J09A 2KWIA 2ZPUA 2EWMA 1Q2UA 2XEDA 2J08A 1P9LA 2WSMA 2ZXUA 4HZUA 3BFXA 3NR2A 5CFMA 1RI4A 4GU5A 2BF4A 2ZS8A 4UD6A 3EDOA 2BBTA 1C9JA 2CDAA 2EGUA 5DHQA 3NH9A 3SEFA 4PZ0A 3KOUA 3WK6A 5A9SA 1ONBA 3QVJA 5EXPA 3BMQB 3BB3A 1HLFA 1XALA 5CFZA 1OX6A 2YICA 1PZXA 1M1YE 4D3YA 3KR9A 5E2AA 3SOZA 1POWA 3O73A 4YDHB 4P53A 4D6PA 1UMCA 3OICA 3O8BA 2NO4A 3ZWWA 4XRGA 3TOVA 3A14A 3EHDA 3CB2A 2FQXA 2JAQA 3W04A 5FLXA 3U5ZB 2I54A 4E2XA 1GZ5A 2QXTA 1UP7A 4N12A 1ODFA 2ZIVB 3A1TA 3ICWA 2Y67A 3MJEA 4A8JA 2GAOA 3USCS 2QKYA 1TC2A 1H9CA 3K0EA 1H1LA 3QF7A 4RVUA 4WBNB 3LXRA 1EGAA 5AKEA 2CHUA 1XAJA 4B3RB 3IUPA 3PCTA 1JNXX 2HMVA 4R1NA 1MJ5A 1B76A 2WQZA 3O3NB 2P3QA 4V02A 3ZG6A 1ZMBA 2QGFA 1KJIA 2IUEA 2V6MA 5JS7A 3SU8A 1ONSA 4BP9A 2BAGA 1X7ZB 3OU6A 1HZZA 1LEHA 3L8EA 1UEIA 4IXWA 3VPDA 5AVXA 1BXGA 2J41A 1A9YA 2I2AA 1SCBA 5GV8A 2ZIEA 1XZHA 4OIFA 1L5KA 1PZHA 1RVDA 3E81A 4DV7B 1W88B 4BC1A 3SICE 4EPYA 3QX9A 4W5QA 2ZR0A 1BXKA 5E1MA 1RLUA 3DWIA 5GVRA 2DWCA 3L7CA 3E70C 5C7LO 4NNOA 2IY8A 2JLAA 1YZVA 4D3DA 2FXVA 1XMXA 4RBNA 4UFNA 5H68A 4YJHA 1PNQA 1AKNA 5ERGB 2FQYA 4KC0A 3VUFA 4C2AA 4ML3A 1JYEA 4O0LA 1UR5A 2JJ2A 4R2HA 4EYQA 5I4IA 5IDXA 2QYHA 1FDVA 3H8VA 1QZUA 1TM4E 2I7VA 3D8TA 3FYUC 3IO3A 3TZLA 1T2CA 2WWTA 3DC7A 4ZEWA 1T8WA 3C14C 1V43A 2BUCA 1RZVA 2E4AA 3DFMA 3G3EA 1EGMB 1X80A 4FE4A 2VBCA 2R4QA 1BD3A 2CLLB 3NBFA 4X64B 1JLSA 3VPBA 1NYRA 3EOBI 5FH9A 3CEHA 1GZDA 1TD9A 4V0NA 1O0CA 1YOVA 4D26A 4B8YA 1VTKA 4V0QA 5F51A 1XRQA 1QCDA 5AQEA 4AMUA 1ATZA 2HW8A 4BB6A 3TD6A 3W5HA 3K5PA 3ZBQA 3OTIA 1J0AA 1G1AA 1QFSA 4RDCA 1FA9A 4U9HS 5F2OA 3SR3A 5JCOC 3NPMA 4YUVA 2B92A 1Q15A 3ZOKA 2VQ3A 4EGJA 1E2BA 1HRDA 1QE3A 1ZMOA 1XJ0A 3HABA 3NBKA 4DLUA 4QUBA 4BX0A 5AUPB 2BCGY 3MRVA 1NVBA 2BN4A 2OFOA 1G6Q1 4X0EA 1ZSNA 2H63A 1UZMA 1Z73A 3ZHQA 2PYIA 2Y71A 4CMIA 3A1NA 4TL6A 2HTEA 1X9HA 4CT0A 3MVEA 1LK7A 5K0ZA 4RM3A 1N78A 2LZ0A 3L7NA 1N7HA 4GL4A 4JT2A 4O1MA 4TVSA 3HSYA 5I7SA 4C2UA 3TPZA 2C7BA 2P6MA 3M4ZA 3V7YA 2JGMA 2NPOA 5H0IA 2IQIA 3SNHA 2C98A 4X92A 3RK4A 3RWBA 4MVXA 4OQXA 4RVNA 4L4XA 5EKDA 5DM70 2B5VA 4RC9A 9GPBA 1WPQA 2R65A 1GL3A 2CLSA 4OHBA 3LA6A 2NVUA 4Y1GA 3HLKA 4BLSA 2GK3A 3D0OA 4B3DA 3KP1A 2P9HA 4Y2XA 3D8UA 1OX4B 1FLNA 3KJZA 2CVOA 2Q9BA 1QO7A 2HIMA 3EVNA 4E5NA 5B3KA 4C2TA 5FNVB 5I8ZA 3M5DA 3HXOA 1RNLA 1GTJ1 1WMSA 1D1TA 1UPXA 2DJ5A 2QAJA 2WMYA 3KNZA 1O0BA 3IEMA 2QX6A 4B3MB 4AMGA 4BGUA 3D4IA 4CM1A 3VVLA 1A9TA 4UHDA 5DBFA 2NPFA 1NXXA 4BX2A 1JU3A 1P7WA 2WJIA 4P0QB 1O96A 1IPEA 3K5IA 4I50F 3DKRA 4EKIA 2J9FA 3MA0A 3PL1A 4IEIA 3RVQA 1QRTA 2WU1A 2O8EB 1DKLA 2BEVB 3I34X 1XZMA 3TI7A 3FLBA 5HIMA 4XI9A 1Q57A 4GKAA 2GN4A 4U02A 3OQHA 1XLTC 3PEVA 3A6DA 3OJ0A 4LG1A 3REQA 2RGDA 2ZBQA 1VFNA 4FYJA 3DNPA 5FWXA 4R1UA 3AESB 5CA1F 3LUAA 1OLXB 4GFDA 3MGAA 4FQ8A 4IKOA 1GPAA 5D85A 4K81B 4XSVA 3GLFA 2CFOA 3B9RA 1YZ3A 1UPBA 1MGOA 2VP3A 3DL7A 3ODPA 2H48A 5FI3A 2XX3A 3B36A 3D4NA 5T4BA 5HK8A 4BFLA 3G79A 4F3KA 1H4SA 3AYXB 1XX6A 4K86A 1PD1A 2PMBA 3Q2KA 5ECGC 4BMOB 4YRGA 5C3MA 5JD3A 3ZVKA 1KEKA 1VMEA 2ZAMA 5LA6B 3MWYW 2OK7A 1JB1A 1UAYA 3B1YA 3AEYA 4O4HB 1OZGA 2P9GA 4FNOA 3OTHA 4NENB 4AX8A 4DJAA 4UTOA 4F3YA 2ZWVA 3IP7A 3RBZA 4DF3A 4QECA 1U0EA 2C2HA 4D79A 2CF5A 1A5AB 2MSNA 3WJAA 1L1EA 4ZCIA 2CNOA 3JD1A 2WF8A 4YT2A 1FNCA 3TZCA 1FBTA 1H6DA 4O2AF 5CJJA 2XLCA 1YR8A 3R5JA 1P3Y1 4NG5A 3S2FA 5C52B 3SSAA 4L4YA 3Q12A 4HQRA 3TLXA 1QLWA 2YW9A 3AG5A 5JWRA 5JS2A 4P31A 4C87A 3LXUX 1Z4MA 5BNIA 4WN9B 5FCDA 1ZW1A 4QUJA 3ONWA 1T1GA 2NM0A 1XTJA 2G1PA 2RHOA 1W94A 2BIFA 1DJNA 4KLNA 3S2EA 4Z6KA 1EVQA 5DN6D 2RARA 5KTNA 4OFBA 1QKIA 4TTAA 5CX1A 1E8NA 4B8ZA 1G21A 4X7RA 3QVTA 2CW5A 4A03A 1NLUA 3N75A 2A5YB 1G20B 4JC0A 2JFPA 2QPTA 1FUYB 1VJ1A 1X7XB 3UWOA 1IXSB 2D54A 1Y1RA 5DI9A 1GSHA 4XJXA 4WFIA 1DAHA 3F5QA 1KDPA 1RJ9A 1T9KA 4OHZA 2YMMA 1E1CB 4YXFA 5B4UA 5JBNA 1DMRA 4Q1VA 5DNAA 5JNTA 2HQSA 2PBFA 3VMFA 1X1TA 4JI7B 4YONB 4TKUB 1V2HE 4LC0A 4P3KA 1L5VA 2H7CA 4UCFA 4AS3A 4NFYA 3CW2A 5DI3B 1SUWA 2DLCX 1FFGA 2PBLA 2DUMA 5H5JA 4KN6A 2CFIA 2DG2A 4ZCRA 1D2EA 2FQQA 2ISQA 1XVAA 4DM3A 1F60A 3RVKA 1R12A 3ENKA 3HP7A 4KO4S 1RCUA 4WTOA 3IELA 2J5XA 3AUAA 3RSFA 3JQ8B 4KUGA 5SY6A 1WXDA 2VK1A 3Q6MA 4RXUA 4JVOA 4LZLA 3BE6A 3CO0S 3ESRA 5KHOC 5E9JA 5JW6A 5FPQA 4PLGA 3U81A 3MGGA 3UFXB 3RAFC 3AERA 1M0SA 1N0IA 2IYUA 3Q9SA 5A3JA 3GGOA 2G7MC 4GNKA 2XCSB 1L5SA 1QOPB 3V6MA 1EUZA 2I4RA 3PC7A 1GN9A 3LVBA 2ZTHA 3OX1A 2QX9A 1TA9A 4ZVNA 4YWHA 1C0EA 4FOPA 4G0XA 1B6SA 1Y7HA 3FUCA 3HV2A 2QORA 2IYPA 1V25A 2NUAA 2QAGC 2DPHA 3LCCA 1SHLA 3I9LA 2ZTSA 4DMRA 1GVHA 2R7AA 4NBVA 3M7IA 1H3FA 3PLRA 3U4CA 3PLAE 1SHJA 2WG0A 2F3SA 3VO2A 2WIFA 5H80A 4LFCB 3VM6A 3T4EA 2W71A 3PIIA 2XSZA 3K1AA 3O1IC 1OWMA 3PITA 3ZDCA 2JGIA 4ESEA 4V39A 1DBRA 1CRLA 1G5RA 4OMDA 1KS9A 2R8YA 1VKHA 4RE6A 2IYLD 2A3NA 1C3JA 2BE9A 2G6BA 4MWCA 3GMSA 3HDYA 1BNCA 2PZFA 4UMVA 4ZYWA 1YDWA 2AYXA 3M5WA 4PW0A 4O6VA 1I6LA 7YASA 2ZI7A 2MHCA 4KXVA 1QIIA 3EGCA 4YCLA 1ILEA 1WSAA 4AJOA 3LDGA 4C06A 1VBNA 3OQIB 4KDEA 5LC1A 4Q4AA 1ORWA 3W1WA 2C4VA 1DWOA 1WETA 4B5LA 2E5WA 3D3NA 3ESZA 1NRJB 2IHTA 1JLMA 1K6JA 1RPZA 1Z4QA 3VPAA 2VHQA 4OHYA 2GZRA 4K03A 4BVHA 3R6DA 4MHTA 2BV3A 1ILWA 4CV2A 2SNIE 3WIVA 4M99A 4QICA 5JPDA 1OLSA 2OFPA 2VAWA 1OIVA 3NBAA 2FGJA 2XHEA 3AEZA 3PF9A 3HYCA 2OVFA 5F21A 5E9QA 3HFJA 2C9OA 1CNMA 1ORTA 2X0NA 3LUGA 3O84A 2D06A 4PYLA 1CJCA 3WZLA 4BMSA 1K4KA 3TKLA 2D3WA 3NC4A 5BYJA 3HNOA 5K45A 4B46A 2JFUA 1KH1A 1X7YB 3IPCA 3A9WA 4A0RA 4C01A 3BHIA 3G2HA 5FADA 2AN1A 3F3MA 4N82A 1WCWA 2BYTA 2HK7A 3VR6A 3SJAA 5B7QA 4QBKA 1R5NA 1DHTA 2EZTA 4E2ZA 4OYYA 2ZDQA 5G0WA 3I9NA 1RI2A 1O9HA 3LY5A 4W9NC 4K8OA 2I6FA 5ADVA 5JROA 3AP1A 3ZZUA 3GRPA 3N1UA 4Q3LA 2JIRA 1GTL1 4N6NA 3ENVA 4EG5A 2BFMA 4P83A 4RIEA 1I13A 3ZY5A 2BEWB 1P0IA 1DKOA 2DPYA 3DUWA 2I80A 2X0JA 3LGSA 4R1SA 2AJTA 4D0LB 4W8GA 4XCVA 1O54A 2FPUA 4JAVC 1CTQA 1RMQA 4NWIA 4WA7A 3L1KA 4ADSG 3F9RA 3BZWA 1NJ1A 1PJSA 4KL8S 4MPPA 5ENVA 4MQEB 1CQPA 3OX2A 4FDMA 2Z04A 2Q5FA 3GJ4A 4RESA 4E13A 2JBAA 5GZ6A 5BQ5A 2Q6KA 3DE6X 3RVNA 3M83A 2ZRBA 4ZVLA 2Z6AA 1BCSA 3L8ZA 3HXTA 4JQYA 1FMFA 4AUNA 1GL7A 4ND5A 1IJBA 5JSQA 2GYYA 2A4MA 5G53C 1DEXA 1L8LA 4EVRA 1LS6A 2Y0CA 2Y77A 3H1PA 4GBJA 3H19A 3PBKA 3PG5A 5EE3A 2XITA 1VKZA 3DE4X 3ODGA 2VA9A 3TE6A 5AFSA 5IRCD 4O2BB 4X90A 5A4MS 5L6MB 2CLIB 5C53B 5I3CA 6Q21A 3BCUA 4FNAA 1JG2A 1VI5A 4FYYA 3ZY4A 2DEUA 2E49A 2FSFA 3H8SA 4P6VF 5ALGA 5TQJA 3MJTA 5C8YB 5IN4A 2WP8J 2IU3A 3U4IA 4YP0A 3RUDA 1EM8B 3GRKA 4WNCA 2ODNA 2AXNA 4EMBA 3DVRX 3U3ZA 1L3IA 1O8CA 3HXQA 5LM3A 3KJIA 3P94A 2FN9A 4O02B 1K06A 5HE9A 2J9ZB 4GICA 1PR4A 1RRPA 2FSIA 4JKOA 5LJLA 4HGZA 4INPA 4B4UA 1W36D 1CDEA 1W96A 3RVMA 4LHVA 5K05A 1NQOA 3MCZA 1CUUA 1VI2A 4GGOA 4TMTA 2DFKB 3BE4A 1GZHB 2QM0A 1Z36A 4MPDA 3RTGA 4H0NA 1X3SA 2GZSA 4BUZA 2AVNA 2N9UA 5YASA 4D9NA 3BH0A 2IEIA 3WRYA 1DQYA 1SUEA 5I7WA 5HBRA 4RQAA 4RJJA 5HTKA 3TDNA 4E3WA 1YS9A 1TF7A 5TXGA 2AHRA 1B6RA 1TT5A 2FZCA 2JLCA 3OIYA 3ZDXB 4BLUA 4YRIA 1W73A 2QD4A 3KBOA 1XC7A 1FF9A 2C3MA 3WGUA 1MC4A 3DYBA 3RIMA 5E4FA 1J2RA 3VSDA 4J0IA 4X5OA 3G5LA 4GKVA 1WQ3A 3DLBA 4GMFA 4D43A 1OQAA 1PSZA 3B6KA 1HDCA 1ODJA 2A5GA 4Z5XA 3U7EB 4PONA 1U9ZA 1B6GA 3IBYA 1G7TA 1V7QA 2HMWA 2BGWA 2BTEA 1U0TA 4QTYA 4RZUA 2IK8A 1VE1A 3NIBA 3T1VA 3ISTA 1SK9A 1G5QA 3HYRA 4JU9A 4PG7A 1OHHD 1VECA 4EG1A 3I76A 1ZSYA 3AW8A 3GR6A 3BGIA 4JC4A 4DA4A 4E5YA 2A88A 1LSUA 4HSEA 4RHCA 3JASA 1AN9A 1BJRE 1GRRA 3ZU3A 5IYZA 2CCGA 2BTQA 3H2SA 4IGAA 3DBRA 4OK5A 2Q5LA 2IE8A 4JI4B 2POQX 1J25A 1FSSA 2NXEA 3MN1A 1R15A 3P0HA 4KXUA 4IFEA 5CM8B 1XPJA 3EVEA 1NLFA 4ARZA 4YAGA 3A9UA 3CIOA 3CWQA 3HJNA 3PFIA 4I5FA 1UC8A 4B7XA 4EEZA 4HH0A 1TJ3A 1YS1X 1WVMA 4L02A 4YBRA 1KMMA 2ONYA 1MLDA 3EG9A 3H3XA 1UEJA 1JG3A 1NNI1 2OM6A 3I28A 4PLZA 4QRHA 4ALIA 5IDVA 1ZA1A 2PYZA 4UEOA 5EJFA 1UC9A 4YJ2B 2WNIA 1XTTA 5L53A 2HXSA 3VHQA 1I1QB 3O7WA 2ZJ3A 1Q74A 2C2ZA 4TZTA 4EOGA 3B6IA 5JMWA 2OQVA 3HRKA 1SCUA 4NVRA 1E60A 4HAVA 4U5QA 2IOYA 1T0BA 3VR4H 4CLHA 5J2TA 3V2IA 4FMCF 1NJFA 2HFKA 3A37A 2IXFA 1GCUA 2Q3EA 3B5IA 3TTYA 1TMYA 5KSWB 3HM9A 2VCEA 5D3QA 4BN0A 3O4VA 2G09A 4K0RA 4BU0A 2VQFB 3OSUA 2PWPA 2QR2A 4C3OB 1OE0A 1LTKA 1ZI9A 3ANXA 3IHTA 4NU6A 3TNFA 4PHHA 4KK3A 4DUYB 1YC5A 2EFJA 5AYVA 2O19A 3C3WA 2JHCA 1FK8A 1IYZA 3ACCA 2FPLA 3QFSA 3ZIAA 4B2YA 4FGLA 1FNMA 3K9NA 2I22A 4RD1A 1I2CA 2K2WA 3IA7A 4IP0A 4X62B 1XTQA 1TM2A 2WF5A 4N7BA 2YOFA 1QTRA 4KGZA 3RTBA 2XAUA 2XA9A 4FNGA 3WRXC 4DMGA 3EX7C 4RF3A 4JEMA 4PNZA 3I09A 4ND7A 5DIFA 1SEVA 1QFJA 1AV6A 3N2EA 2ZSAA 4QGAA 4LOIA 2OXEA 2RJOA 4Y6SA 4POOA 1PNVA 1AO0A 3IUJA 5J4KA 5F2EA 1QE5A 2A9FA 1WXXA 2OORC 4I1VA 2PM8A 3M70A 3M34A 3VU3A 4EPWA 5U4XA 4DCUA 4EL5A 3OP1A 2QDKA 3QEKA 5JAQA 3CEJA 3K8YA 3OOWA 1YFKA 3KYDA 2ORED 4TL8A 2Q0SA 5KJEA 3WIEA 5EJ7A 1YE3A 1E4OA 4JITA 5BW5A 3LU1A 1BQ3A 4V1CA 1SBTA 1K8RA 4BO1A 1G3QA 2W11A 1ZD5A 3AETB 4HWKA 2WTNA 5A4IS 1TYCA 4HNTA 5KX5B 1SXJB 1Z06A 1VKOA 4M6WB 4UM8B 5DCWA 5H3LA 4MKFA 4RADA 4F4FA 1X39A 1LV8A 3OF2A 1GG5A 2GF0A 2BE7A 3DDCA 4KSCA 4HWTA 5AP9A 4XH9B 1NF2A 3WB0A 2WWIA 1Z5OA 3DW3X 2Q9AA 3MOSA 4A15A 1UWVA 4K9MA 4UASA 1R9GA 3AKDA 3P19A 3MMXA 2H00A 2ZRQA 3D3QA 4ESOA 4Z4EA 3LC2O 2GXSA 2FJUA 2ZRIA 1UXKA 4NDZA 1J0XO 4NPCA 2JD2A 2ZETA 4K05A 2V6FA 3UXEA 2FP4B 4D97A 3C45A 1NVDA 1NZJA 1RAIA 4D0GA 1A71A 2Z9BA 4QPPA 4PNEA 2YJ3A 3CURA 2CDBA 3KWFA 5BRNA 1A9QA 3R3HA 4JP2A 3TEJA 5FBWB 4IJ6A 1G5IA 1JKFA 1Z83A 2ZRKA 5LXTF 1JILA 2IDMA 3EXHB 5CVUA 3UK0A 1D2RA 2NACA 5DCUA 3O6VA 2VDVE 3MWGA 3UMSA 3NUGA 1MQ9A 2O5VA 3MLBA 2AX4A 3DZDA 4ZU6X 4UNIA 2J6CA 3ORFA 5HHTA 2VSYA 2HK6A 1NN5A 3CVOA 4JX8A 1T8YA 4GEGA 4KPUA 2PMKA 1H9BA 1ZCFA 3M4XA 3QPBA 4NATA 3FH0A 3D0QA 3ZJ5A 4MQBA 3OQMA 1YCGA 2OV2A 2CLEB 1WXQA 3A11A 3DCIA 1KVUA 4ZTBA 2VH5R 1RZUA 3T12A 2VNJA 3S7TA 4DIUA 1JR4A 1XQWA 2BGKA 3E5RA 2DUNA 3KWMA 3LVFO 1NBHA 2AX3A 3CT4A 4F06A 4KXYA 4HUQA 5TGDA 1FU8A 2O3TA 2OBNA 4P08A 1BRMA 1EXMA 1NVEA 3RU3A 4NQZA 1EJ2A 1NVTA 3VSBA 1W46A 4FGWA 2Z2IA 1WA5A 1RM5A 1YJBA 1E66A 4YN3A 3EH2A 3OCXA 2WDPA 2IP2A 3QKWA 3RYCA 1KQPA 3NXSA 3SVLA 1ZA2A 2F4NA 4WOCA 4Y1EA 4KYIB 3B53X 2H1VA 3FYHA 3JQFC 3F7OA 4CZ2A 2R5FA 2NO0A 5K0TA 1WE2A 2A6PA 3E1GA 3QJGA 4FD2A 2QV7A 4HWGA 3X2SA 4ETMA 2I7DA 4G1FA 2II6A 2R96A 1P2TA 5EXSA 3RS7A 1U2RA 1KYWA 3M9XA 4Y9RA 3W90A 4PYRA 3HV0A 2KW5A 1XQVA 4WFQA 5K8JB 4ZGWA 5WRFA 3WLPA 3PCRB 3PHBE 4BMZA 5B2ZA 1ZUHA 3H2JA 3IQXA 1KZ1A 2YNMC 1S4MA 3M3DA 1AKWA 4TVKA 5KOJB 2ZSIA 4N3BA 4G5QA 3PVZA 3ST7A 4C2BA 4GRAA 2GDZA 2YS6A 3EUWA 3OM0A 2ZLBA 1UP6A 2BISA 4YRPA 2JCSA 2QHXA 1EYZA 2Y0EA 5C31A 1G5PA 4RIFA 1KL7A 4OXYA 1N9KA 1ODKA 1RWOA 2GHIA 4Z8XA 1OZAA 4A16A 1Z4JA 4YJFB 4QYWA 1AXRA 2GMWA 7AT1A 3I6QA 3MXOA 2WVHA 2FA9A 4ZXPA 1UK8A 2QMUA 2Z43A 1HG0A 3LQRA 3UJBA 3QVOA 1FTGA 4LGCA 1T3ZA 2VVTA 3DZJA 4O4LA 3SR0A 3GJ6A 1MOSA 4WERA 2AJ8A 1V39A 3E03A 3K6SA 3O2SB 1HYBA 2YHUA 1W47A 2AJLI 4L16A 4CMKA 3PU6A 4PYKA 3VX3A 1U8AA 2IYVA 4DMLA 1IU9A 3T7EA 3PFWO 3ZS9A 3LY8A 4DLTA 4LOAA 3P2KA 2N47A 1K3UB 3IO5A 4QPNA 2UYOA 3MUFA 2IU4A 2R1UA 5EYPA 1HEIA 3KD2A 3WQRA 1NATA 4JASB 3IAXA 1BDIA 2COEA 1BU8A 3ZWXA 2JLVA 4WLFA 1RTKA 3TGPA 1VMDA 1O95C 4P58A 3SM9A 1LDMA 3KT6A 3ASUA 1CV2A 3SHTA 1KERA 3B52X 3OEEA 3CN9A 3A4NA 3ASVA 1WMDA 1RXYA 3L8YA 1MO4A 4X20A 1G7RA 2YOHA 3GVXA 5EE9A 2J9YB 1BO6A 4X54A 4AQ7A 2WPNA 3OQBA 4PRKA 4G0YA 4DCJA 4HBZA 1U8FO 1GQYA 4NYJR 5DNVA 1YONA 3FPLA 3COSA 2VNAA 3L49A 5LN1A 5IVKA 1U04A 1PGJA 1M1UA 4MTCA 3UJ3X 2HHHB 4P22A 4ZI7A 3LPNA 1NXVA 4WCDA 3TRJA 4JV5B 4A5SA 2VYCA 2GKGA 2Q3LA 1OSNA 2VJAA 2AI3A 4AUEA 1AY0A 4DV5B 1AO3A 2AR9A 1VJTA 3KLNA 1HT0A 2FTKE 3O93A 4HQ0A 3DZKA 4PLPA 5LP6C 4ZN6A 5EJ4A 1VG8A 3VJMA 3P2EA 3EG5A 3T5CA 4BTLA 4Z3KA 4LQ4A 4KVFA 3I2GA 3CZAA 2IV7A 1YUMA 3SDBA 3DZ8A 2ZJAA 5A5DA 2WYVA 1NRXA 1ZH2A 3EZXA 3BFPA 5HJ2A 3P0EA 2O9JA 4KQ6A 3O3OB 4X00A 1E58A 1R0CA 3Q88A 2WTXA 4XUGB 2PNJA 4J7AA 5HIKA 5IU6A 4MDFA 1QIGA 4BQFA 3ONEA 2A9OA 3OLYA 4MO2A 2I1VB 4HL6A 2YWGA 1GXSB 2ASVA 1HTTA 2WTMA 3DXFA 5I9SA 4BV2A 1DPFA 1BGVA 5EIOA 1SIBE 1BCRB 3DDOA 3HCEA 4N3NA 3H5TA 1P5ZB 3LAWA 3NASA 2AG5A 5L4NA 2PA0A 1DMSA 3ZCUA 2J5QA 1SWVA 3HZOA 3K0CA 4ZMSA 4D74A 5KYKA 5LFAA 1CC1S 3I2FA 2E1PA 3AHHA 4K1XA 1KIMA 1L4MA 3FWYA 4P2GA 4CKXA 1K5HA 4UZEA 3KBBA 1T2UA 1YFJA 1FP6A 1FRVA 3BDAA 3G5UA 1USVA 4IDQA 5JTTA 3RC9A 1C3OA 3TQOA 4CKBA 1JF8A 2CJWA 3P9PA 1RU3A 4NY1A 5IT5A 5KNBH 4XAQA 1F6BA 1I4TD 1JWAB 4Y3UA 4BNNA 4JCOA 4TUYF 4R41A 4G4SO 3P9ZA 1N2ZA 1WUIS 5T5QA 3F8TA 5B6JA 1IIBA 4M0PA 3ID6C 1Y1SA 3K35A 2ANCA 3N6VA 4YQZA 3TQFA 4KR3A 3KV1A 2O8BB 1F6DA 5KQPA 4PHGA 4E88A 1F8XA 3FPAA 2OFXA 1LNZA 5CH8A 4RV4A 1NW9B 5BUQA 5FWDA 1J0DA 1YOBA 1CSEE 1ULUA 4D3ZA 1DTWB 3LRTA 1AMOA 5J4YA 5LMUB 3AFIA 3QY0A 5F5NA 3QG5A 4RD3A 5JANA 5AVTA 5JC1A 4HB2A 5TSDA 1DEHA 1XKQA 2Z8ZA 2AE1A 2X6RA 3KFXA 4OHVA 3K8QA 4ZPJA 2FKAA 4ZD6A 4F4JA 4ZANA 1ECCA 4Q3BA 1QHYA 2J0EA 3B3QA 1M7HA 2FPGA 1ENOA 4LV5B 2O8FA 1EBUA 2FWBA 3MILA 4E5SA 1SC9A 5DSXA 2M9MA 3OCWA 4CG0A 4BEBA 1K9VF 3CRNA 4AJHA 1B41A 2GPTA 4OI4A 4UUAA 1CY7A 3Q98A 2X58A 4CLXA 3A7DA 3G1UA 4FYPA 3ICQB 2NSHA 2PSSA 2PVPA 4HTFB 4JJAA 4KQHA 5F3DA 1M0TA 1Q7EA 2A30A 4DUZB 2AKAB 1B73A 1WG8A 2P6UA 1FFCA 1M8KA 3I1YA 2Q1XA 3VZQA 1VSUA 5IM4F 3KALA 1SU8A 3PJGA 3KYIB 2IU6A 3DE7X 3OIVA 2V6JA 3UKOA 5JRDS 5JSHA 5I47A 1ZVJA 1PT9A 1YR3A 2RHCA 1NL3A 1CDOA 2VPQA 2XDQB 3K1YA 5SYMA 1KDZA 2FPRA 2PKCA 2OHJA 2XWPA 5IK2D 4RYDA 3I0MA 3ZE1B 3WGZA 1P0CA 1RZRA 2AG8A 2RC6A 3INRA 5I7UA 3VHLB 4J1NA 1A1SA 1SHUX 2I7CA 1O57A 2P8SA 1C2YA 4GI2A 3UGJA 4B3GA 1X7HA 3BORA 2I1LA 3ZV6A 1ZNYA 2ZYTX 3OJCA 3EC2A 3GFTA 2Q3HA 2ZITA 3GJYA 3ACDA 1JXOA 2PWBA 1Z5PA 1I01A 1OLOA 1EP9A 2EG5A 2ET6A 1USWA 1M8JA 2ZB4A 3M6FA 3LTNC 2FZLA 4PC7A 2IEGA 2JIPA 2GZ3A 3SYTA 2DXIA 1E1RA 4YWJA 1SD2A 3R6LA 4N03A 1GV1A 1MQ8B 4H7KA 4L3VA 2O7VA 3N8NA 3CWZA 3LNTA 3SP1A 3VTKA 1KVQA 2GNAA 4A2PA 5B1HA 2PYDA 3A9RA 4N39A 4D3SA 1GY8A 2FPIA 3M0EA 4MRVA 4HXFB 3HWSA 2WTAA 3KC2A 3CM0A 3MJCA 3TQTA 4P4GA 5B3LA 3ZD9A 3LSYA 1UKCA 1P1HA 2Y0PA 4RLQA 3W1VA 9ATCA 5KTSA 3I23A 1V3QE 4CT5A 2D2FA 2JIDA 1ZH4A 5CVEA 2HH9A 1GPDG 3JQPA 1W0JA 4QFCA 2ONJA 3ZGYA 2XAAA 1EVLA 2FPPA 1NM5A 4MV7A 5CCDA 2WYIA 1ZQ1A 4JR0A 1QG6A 2J9GA 4LZZA 4LA4A 3P26A 3AVQA 5CYPA 1SC4A 3ICEA 4N9WA 4DPLA 5DYGA 3QBJA 3NYQA 2FI1A 1N2CB 2YJGA 3KOOA 5JNSA 2YOGA 2VDLB 3GJXC 4WJKB 1JQBA 1NJ6A 1KAQA 1AGRA 5D5QA 5JXJA 2HZ7A 2XYQA 3GRAA 4R7ZA 4E5UA 4H60A 4TXMA 2JFNA 2EFGA 3KXLA 3KYBA 1MXFA 4UJ5A 3GRYA 3LDUA 4RY0A 1A8PA 1RQ7A 2DBZA 3X0DA 2NO1A 1J07A 3C97A 1JQKA 2D2VA 2N46A 4XWTA 3AR7A 3RRJA 3E2PA 3K73O 1WCV1 1J7KA 4EF6A 1JEQA 4E32A 4AVYA 1N0VC 2PGIA 1A82A 4MVJA 1VJGA 3T7CA 2F59A 3ZU6A 3NTXA 2O8NA 1M6WA 1N57A 5E4JA 1KMNA 3OEHA 2FLKA 2C3YA 2BKXA 1S2GA 1KHHA 3JALB 5D3MA 3VOTA 1BDMA 4MH0R 3A25A 3VAZA 4IBOA 1HFKA 1Y1PA 1DJMA 2PQ6A 1U8ZA 1EM6A 1Q0UA 2IGBA 1FNSA 3UXMA 1XVUA 2PX3A 2JANA 1K7EB 3IDQA 2YUIA 4ZC8A 5BRAA 4D41A 4CU5A 2Q21A 2G5CA 2QB5A 2ZQZA 3RK1A 5CM9C 5L3SB 3ANTA 4ZI2A 1NYQA 4AMZA 3NEYA 3JQ7B 1REQB 1M34B 2H7YA 4Z3DA 5LLDA 3BERA 2BGNA 3KJEA 2GBLC 4Q93A 2C9ZA 3AEQB 1FMJA 3HGMA 3PC8C 1YB6A 2BFCB 3QYPA 4C29A 3HY3A 3JWGA 3QELA 2VN8A 2J32A 1GRNA 8ATCA 4GX5A 1DRVA 4CG3A 2GR9A 4FCCA 4UNPA 1T9HA 1I4WA 4B31A 3H2ZA 4FFBA 1XOIA 4QXQA 5ADWA 2NUBA 1OA0A 4XIFA 4RQTA 4XGRA 3LLMA 4CCWA 2HV9A 5KHAA 3CUSA 3C87A 1PJ2A 1K88A 1PHRA 2JFXA 5C7OO 5K3EA 1SHZA 2VZ9A 4WSOA 1J2YA 3I5UA 5AM2A 5BN4B 3PHIA 4ZJPA 2BGUA 1S8NA 2QE7D 2VHEA 4QELA 1ZDMA 2ZVPX 3BIJA 2H2WA 4IICA 4Y2QA 1YHYA 5DK6A 3CBGA 2QNRA 1GAEO 5T64A 1RR6A 1YZGA 5CNIA 1H6CA 2HJVA 3AGPA 2X2FA 1NT4A 3U61B 2MR6A 1RIFA 1MT0A 3LPMA 3SHVA 5D8DA 2C3UA 2H3HA 4MA4A 1Z16A 4I66A 1AQNA 1F38A 1T6YA 3F3SA 3DBLB 3M9LA 3K9GA 2QRPA 1XLWA 3OLCX 3KKKA 4LKRA 1Z3IX 2C4MA 1BFDA 4I46A 2CMGA 4RF5A 3I6IA 4TXNA 4L4SA 3PQFA 5ERXA 5DYWA 5DT9A 5AXDA 2AFIB 5AK3A 4PG4A 4L8LA 2VPPA 4KQFA 4MVJM 1QBKC 2G70A 4DV0B 4ASUA 5B57C 3GLKA 1BOOA 3TLZA 3N87A 2IRWA 2FXIA 2ZSJA 4MV4A 4WOBA 5EINA 3V4PB 4JR1A 4BJ6A 3OLQA 4YX9A 4M54A 5TVKA 4JMLA 4DKJA 2GQ0A 4GC9A 1GDDA 5BR1A 3DEZA 3RTDA 1ESNA 2FW7A 4HGYA 4NBRA 5LYJA 3U3OA 2I2CA 3UUWA 3GFFA 3I9V6 4DJTA 5K8LA 3TECE 2FE4A 3PPXA 3CCBA 1KAOA 2P9YA 1TI7A 4JT9A 3QWFA 4IIBA 4ALLA 2VSXA 2C1ZA 1OBOA 1RPJA 2FUG6 4R2WA 3SN6A 3JTMA 4ZCMA 1KAHA 1D2NA 1QYCA 3VKVA 1YD7A 5SY9A 3TG2A 4F71A 2VK2A 3BQMB 1J23A 2FPXA 2GBGA 5HCIA 5CDFA 3T38A 4EJFA 3ZHCA 2EQ5A 2MSDB 4OHWA 1QGZA 1MPXA 1QIJA 4KMMA 1NVVQ 3BIWA 4RGVA 3Q2IA 2ODQA 4M0CA 1GKUB 1C1XB 1VC2A 1XZGA 3WQQA 3DBHB 5AM3A 2W22A 1VA4A 2HDHA 3Q6NA 4F9GA 2D13A 1GL9B 2IITA 2J45A 2YHSA 1CY8A 1PU2A 2WIDA 3OLXA 2IXEA 4MR8A 4ZOQI 4ME6A 4HO1X 1OTYA 3E7PA 1S8OA 3BXZA 5CEFA 2JJYA 3FOFC 3QI7A 1RAFA 1C50A 4B3BA 1QX4A 2ECQA 1V16B 3HN6A 4JLPA 3QE0A 5H3CA 4AC9A 5MGBA 1A7UA 1BHO1 2OBYA 1ANKA 4HLCA 1P4SA 2PGNA 1XYVA 5HEKA 2HD4A 4AZVA 4OAOA 4AWBA 4FLEA 1PL6A 2E5FA 3N9IA 4KIUA 1KZ9A 2GF9A 5G3YA 2HR1A 3P32A 2J5KA 4ZOCA 1T8TA 1YVRA 2P5SA 3AF4A 3GCWA 3X44A 4FW9A 2GCPA 3HGQA 5H7XA 4KO3S 4V0KA 3ZNPA 3W5BA 1QGYA 1U8CB 2D5AA 1XCPA 1L5FA 2QJWA 3QIVA 3QMMA 4GI7A 1E6UA 4H27A 3UJAA 3UWKA 1A4IA 2YIVX 4LYFA 3ZY3A 4B4VA 3ZKWB 4D4IA 1HL7A 1FBNA 3ZZMA 2ZRGA 1I0IA 4OQZA 4YBZA 4O4IA 3G85A 2Q27A 4F2WA 3MMPA 4Q1BA 5B6IA 5KYTA 1OBFO 1ZKMA 4B5KA 5CG2A 3PD1A 4O1IA 1NDHA 4OH7A 3OSZA 3ROMA 3SS7X 3EPKA 3OO1A 2WVJA 2CUNA 1LX6A 1MABA 5L7YA 1XL1A 2QU7A 1UM8A 4CMAA 3BMCB 4KTVE 1QHHA 4LXIA 3RAGA 3VJLA 4YI3A 4NHEA 1U3VA 3BC1A 3AJRA 3GEEA 3OZWA 4LVNA 4HFMA 1JPJA 1SC3A 1JDZA 1K98A 3GEMA 4DR5B 4JLKA 1LLCA 1DDIA 3F47A 4F2DA 1CE8A 1EZ1A 5LIRA 1NQUA 4HNVA 1A9OA 3IOEA 4LJYA 1LWNA 1TCBA 4EG3A 3S1SA 4PZ9A 4QHSA 5GZ3A 4TRRA 5KIAA 4TLEA 1SB9A 3TF5A 3WZMA 2IHYA 3BHMA 4A7PA 5A4DA 3I1FA 4CWAA 3LF1A 1LW6E 1XMJA 2JKYA 1TC1A 1FYDA 1UK9A 2PS9A 1S1CA 3D43A 4L3OA 4ER5A 5J2UF 4OLAA 2B36A 4TTVA 1UJ6A 3L4SO 3MAJA 1ODTC 2JGRA 3T9CA 121PA 2XUZA 3LRXA 3OCZA 3EXFB 1XRPA 1F4PA 3AEKB 3K8ZA 4Y1RA 4OI1A 3AM4A 2ZTLA 3RV3A 3OFKA 2AMJA 3IMKA 3N8HA 3EEQA 4XQCA 5BN5B 4OCZA 4RW0A 4BMDA 4WXRA 1C30B 1H2RS 3OURA 1HT2E 2H18A 4TSFD 4JI3B 5JQGF 5L51A 3TVTA 1LPOA 2QTTA 4H3VA 3PJRA 1QVRA 2XDAA 3JXEA 3L41A 1QRAA 1X87A 1V8OA 2BM0A 3NGXA 5K09A 1FIUA 4F6RB 2WFLA 1U90A 3O1HB 4HRXA 3ZGXA 2X0FA 5DBIA 4IIXA 2P5UA 4DZTA 1VA5A 3GARA 3JZMA 3N0RA 3U7GA 4A10A 2F64A 3AWIA 1XELA 3JPYA 2WF9A 3HHEA 1RTTA 1S7CA 2QA5A 3IQEA 4TM8A 3TR6A 3DHVA 3ZKAA 4LZNA 4YCMA 3OOEA 2O1WA 1I30A 3CVVA 4MS3B 4EPVA 1GM5A 2B1GA 2C3PA 4OQLA 3FJ1A 2PPLA 5BSKA 4G9EA 5CXSA 4REQB 1L5WA 3QOWA 3X1ZA 2CSXA 3ROKA 3NHZA 5TNXA 1E9RA 5KDDA 1XZNA 2FMFA 4EY4A 3SFVA 5ADUS 2ZB3A 4URXR 1E0JA 2UUCB 2ECFA 3CT6A 2DERA 2QROA 2YFQA 3PZRA 2UZAA 2TMYA 2P4EA 4JI2B 4ZV9A 4R0MA 4ZZ3A 2V54A 4GX2A 3W6NA 4YJ2A 1L7MA 2B4TO 3PPIA 2UZ0A 3L7OA 5HGJA 1PEYA 3RG8A 1LPPA 4KV7A 2UXCB 4L2IB 3STTA 4AY6A 4EI9A 1RYZA 2CXSA 1MO6A 2GJ8A 2XH8A 3SQXA 1Y82A 4TSRA 1TGVA 3ZWQA 5EFOA 1VKNA 4ZMRA 4GYJA 4XUCA 4AIIA 1BHJA 3LY7A 2I4IA 2QSYA 1ZITA 2VT6A 3CH5A 3GHYA 1EINA 3AY6A 1WW3A 2NTYC 5B1SA 1P0FA 2I3AA 3KKEA 3WQSB 4ETWA 2W4MA 2E2WA 2JFYA 4F8JA 1AF4A 1E2NA 5SV2A 2XQKA 1WZIA 4WEQA 2PUJA 4DWJA 3O91A 1O8BA 3Q1LA 3EY4A 5K3CA 1WKVA 1MA3A 2QGNA 5EVJA 2Z2KA 3OPXA 1A04A 1R9MA 221PA 2RHRA 2IBTA 2WKWA 1F9AA 2H5JA 2J3DA 5FV7A 1IB6A 1R00A 4GPIB 1J0BA 1GTVA 2MDTA 2WG2A 2XUGA 3C41J 2XCOA 3DV0B 4G8DA 1QPGA 3O47A 4L22A 1TVMA 1TAQA 2X42A 3HE3A 3P5BA 5HKLA 4ZYLA 4L0QA 5AVYA 4E09A 5HIAA 4UXHA 1KPIA 3A1WA 3CFYA 4HYEA 2H8GA 2DAPA 1ULHA 5LP6F 1G4HA 2AW5A 4G4GA 4TQGA 4YRTA 2WTUA 3ITNA 4ZJUA 3OOJA 5ARDA 4D46A 2X76A 5K6TA 1CU1A 3B8HA 4DTIA 2V5UA 3WIOA 1JQDA 3R76A 1GQ2A 1RP1A 2PIDA 1B0UA 3O8OB 4JK3A 2PRZA 3LKVA 2J3KA 1P7ZA 4H1VA 3TQCA 4G89A 4B33A 4D45A 5FTMA 1SBCA 5KQSA 3KPUA 1IZ7A 2AFHA 1UJMA 3PXCX 1E1MA 1N77A 3U37A 2JH3A 5GADl 1U65A 1BVRA 2X40A 4XEUA 5KYVA 3DW1X 3GUVA 4BLPA 2R6AA 3NW9A 2XXJA 2H2IA 4HFRA 2VNKA 2LP4Y 1N6NA 3EGXB 2EKLA 1A2BA 1RABA 3EWNA 3FRIA 3L1HA 3N6RA 4J94A 5JDCC 4CNBA 3W7BA 3VH3A 4UQLA 1KIAA 3EVTA 5DTRA 3IUEA 4ESHA 3V3KA 4LYDA 4O4JB 3WKCA 4D9HA 3OVMA 4RQBA 4R8VA 3PI6A 2D4HA 2BF7A 1MIOA 3WLJA 4EIWA 3OM8A 2X8LA 4OG2A 1JEYA 3K09A 3TNDA 4ZK2A 1DX4A 1JH8A 4IHJF 4G8JA 1C14A 5ALHA 3KZXA 4BWYA 1SU4A 5KPJA 4OSEA 3OH8A 4LK3A 4M0DA 3BJMA 3AHCA 3LUFA 5K7SA 1U98A 3GAMA 3MGCA 1H8ED 1AC5A 1HURA 4TMKA 1U6JA 3PGVA 1PR2A 2PUDA 5C8XA 4OB8A 1QJCA 4TGLA 2PTHA 3NNNA 4G9BA 4B4KA 3U1TA 1K7FB 1ZN2A 2CGEA 3VFDA 1QUFA 4J4HA 4G9GA 3HMKA 5JOQA 3ZR4B 2YCBA 1WP4A 2XBLA 1NNLA 4D5GA 3WK4A 2PUGA 1KOJA 4X1YA 3TTTA 2FEPA 4WNAA 3HVKA 2ZCUA 2ZRLA 1VXRA 3ITDA 4FOOA 4JKIA 1CKEA 1ESMA 2C5EA 2HPAA 1BE0A 3FNRA 2JGDA 1RPTA 2A86A 2FMXA 2LKCA 1A5TA 3GU3A 3UBMA 4BFYA 3K6KA 3O8RA 1NW3A 1A9ZA 1SBIA 1WDKA 5EHNA 1Y8CA 1C7JA 4JLWA 1FDWA 4LNUA 5ER9A 3ZY2A 2YWBA 3VVBA 3WNZA 3N7TA 3P8ZA 3IL2A 4L07A 1KU6A 1YQXA 4WZZA 2Y1FA 3DUFA 1YDMA 4TWIA 2P4SA 3HYNA 4JJ4A 4Y0VA 5DWQA 2IZ6A 4BFVA 2HOQA 2IUTA 3F6YA 3CR7A 3WRWA 3QTTA 4B6QA 5LZ5A 4MLZA 1JW9B 1Z08A 2YWFA 4LHEA 5IJWA 1IY9A 3S5JA 2WWHA 2ZEJA 1GYPA 2J48A 4I36A 4TV8F 1JG4A 3D0KA 4RTLA 1FP4B 3OKPA 3AL0C 4FMPA 4I3GA 3L2OB 1MJFA 1NPYA 4M1EA 1Q83A 3WRVA 2AYYA 3WL7A 1J56A 1A9XB 2BFNA 3B9BA 3I12A 3KEMA 3OZGA 1YIDA 4ZODA 4ZT5A 5SZIA 2FSGA 1U9IA 1V5EA 3ZDBA 3CJTA 1U2QA 2IDJA 4NBUA 1EVEA 4D0NA 5DNYB 2FW9A 3BMNA 4OHRA 1FX0A 3T1OA 1LSOA 1B2LA 1IUKA 1XTKA 3BSSA 4JH0A 2IBSA 3MGKA 4GVPA 3KT3A 2V6IA 4G67A 4UKDA 4WE3A 1RAGA 4DRYA 4ZIRA 4F93B 1ICEA 2YMLA 2WDZA 2ZRMA 3U4AA 3NEJA 4FZ3A 3UY4A 3WMRA 1HE1C 1A9RA 4BMCA 4B6SA 2DSTA 3QVXA 3W79A 4QTZA 2QD2A 4Y2TA 3HBFA 1GUYA 4RHUA 2UUOA 5D00A 5TEVA 2HWWA 3GZNA 3QKRA 3UAZA 2FSVC 5E7QA 3RYFB 1WZUA 2O6HA 5CAEA 1D9ZA 1SKQA 2V6BA 1OFHA 3WBFA 3U7QB 1QP7A 3GUCA 4GP7A 1D9XA 5B2FA 4QYMA 2B61A 3C8ZA 3LBFA 4JOBA 4BWGA 2Y0DA 2YJZA 1PCXA 1QWSA 3PUWA 3MWFA 5K8UA 4BBZA 4TTPA 1XQ9A 4M87A 1O0SA 2PUCA 4X45A 2AN9A 2CLFB 1KMCA 5IBCA 3B6EA 2FKNA 3I6MA 3SC4A 3EIUA 1L9KA 4ZYXA 5CT6A 4RD2A 3II6X 4X91A 1MPTA 5H81A 4G5HA 3QLUC 3EXEA 2QK4A 2QNIA 1OZHA 1WSBA 2VJYA 4ZA2A 2E85A 4ABYA 2F4VB 5EIWA 2ZVJA 4MB0A 4RY9A 3IUNA 4QKQA 2G5GX 2VBFA 3ZHUA 3DM9B 4IJVA 4LW8A 3FROA 3UAVA 1RJEA 5H59A 2ZI5A 2AE2A 2HCJB 2RONA 3NHSA 4U9UA 4JA2A 5CDTA 5C4IA 4OFXA 5LOVA 1K8QA 1M7GA 5JVDB 3OZVA 4R1TA 4CVNA 2EOAA 4YLEA 3WNVA 4RPCA 4ZALA 1MA0A 3I2JA 5HW0A 5GOTA 2F00A 1WUJS 1FW8A 5ED4A 2P8JA 2M6KA 3VR3A 1OGIA 4YASA 3U56A 2VTBA 4DA7A 4PSVA 5L6LB 1G6HA 2YNMD 5GONF 5JY1A 5EJ2A 3T5GA 1JL3A 1NJ5A 1AD2A 1MB9A 2OCBA 4AZWA 5KYYA 2OCIA 3N2GA 4AN1A 3N2KA 3BN3A 1XL0A 1X38A 2PZKA 2QIOA 4NZZA 4OIMA 4UCXA 5ALSA 3X1XA 5FV4A 2YVAA 1MIHA 4ROTA 4F5YA 1DIGA 2X8JB 4QBFA 3UJ9A 1CIPA 5FOSA 5AJHA 5A7GA 3UWSA 3UT6A 5HVNA 4XCQA 4AB1A 1V37A 1QHFA 4J43A 2GEJA 2PH1A 3KAKA 5P8WA 3EULA 5CCBA 4EARA 3U1VA 2PSJA 3H0CA 3O2QB 1RHQA 3GI1A 5TPWB 3SLGA 5CYGA 4RAQA 1RXUA 1C80A 1KFKB 4ZT3A 2IYYA 1YTUA 2DJIA 3G82C 3CRW1 4H4EA 2RIRA 2CK3D 5ALPA 4ZVQA 2Q1YA 2FZEA 1GGHA 2R8OA 1A7AA 3VOBA 1B23P 2IOFK 3PE6A 4ZZ1A 2P78A 4F4CA 2P7IA 1O94C 4U8HA 1Z38A 3CHYA 5H3HA 5FBKA 2WT8A 3GLTA 4GSKA 4RJ2A 4MVJG 2OR3A 3WYGA 1O95D 2GK4A 3ETHA 5IFLA 4KW7A 4DIDA 5AVRA 1EA5A 1X1CA 3JWJA 3HDGA 3OMXA 4DWVA 3HR7A 3QJ5A 4KN9S 1F8FA 3FPGA 4TTQA 4PN3A 2F43B 4PFJA 3CCFA 1RYDA 3FMFA 4EZBA 4HY3A 4OO3A 3WHPA 3QHAA 2DOKA 1KI1A 1NRIA 1PBNA 4OGLA 3H13A 1Z82A 4RK4A 2Y1OA 5ULLA 3U7HB 1CJSA 1R2QA 2DKOA 3DM5A 5EHZA 2O5RA 1ICIA 3M8KA 5CHEA 5I9IA 4HDRA 4C6TA 4KQMA 3O90A 5B5SA 4NLLA 5M7EA 1KXJA 4UVEA 3E53A 1F8GA 1N6OA 3MTEA 5AI0A 3VDXA 3KJGA 4DCMA 3I9V1 1T10A 5J9FA 3ZNQA 1TA0A 2K5UA 2VT2A 2X3FA 2NO5A 3ABSB 4YQYA 3REGA 3ZCTA 4F21A 1SUFA 1YFZA 2GN1A 2FUG1 2G80A 1RRGA 4AICA 1N3LA 1J2TA 2F48A 1NXWA 1QNFA 2OMEA 3FXAA 3K2QA 1DUSA 2QTZA 2RGCA 1DC7A 1GNTA 3H4VA 3HKEA 3FZQA 1PT5A 3MOGA 1T5LA 2RHHA 1CW2B 3UW3A 3FAZA 4XDZA 4LHWA 3E6AA 3S3TA 4BZWA 2O2EA 1XU4A 2UAGA 1R1DA 4ZICA 5JNWA 4I4LA 3OP4A 2WA2A 3RUAA 1NDUA 4D81A 4J76A 2ZR7A 3EC7A 4J2TA 5EQTA 1UDCA 4CT4B 2DHRA 2GAFA 3AYZB 2PL5A 5AIAA 3TIFA 3D8BA 1G98A 1ZIPA 2VCHA 3RVLA 3GIWA 3E7FA 3H42B 1NGSA 1JHPA 5HDQA 1SC6A 5ALRA 2FX3A 3M82A 2X0RA 2WKPA 1M1NA 4UVIA 3RIHA 1YGYA 2VXCA 4IQ4A 4YREA 5A5GA 2IOQA 1S2LA 3H86A 4TZKA 1LDGA 3GN1A 1G59A 4E4RA 2GJ4A 4BFSA 1FDIA 3GGSA 3AUKA 5AVWA 4GSLA 4G41A 5HQJA 2CC2A 4C5AA 3ER6A 2GX6A 2WLSA 4Q3AA 3V33A 2OCPA 1K3TA 3CZCA 4OU5A 4Q82A 1E7RA 1NSYA 3K0AA 1EH5A 1JG7A 2A1TR 3M6WA 3VZPA 1DKPA 5BW8A 5ITVA 5JFOA 3F8WA 1WVIA 4ARSA 3QWBA 4PIMA 4OI2A 2H06A 2OK8A 4ER7A 1XAGA 4Q4JB 3DT8A 4RHXA 3TG8A 3RUCA 4ABTA 4Q15A 1W5EA 3BF8A 2H08A 2WWFA 5EXEA 2VI5A 3G8BA 2PT5A 3K5HA 1DAFA 4KFUA 2JZNA 2VYFA 4XWAA 1GTRA 3ZHZA 1M1XB 2J87A 1GPBA 2HBRA 2PGXA 4I08A 3RUEA 1MAHA 3AF1A 4M49A 3L5OA 5DK4A 1C9DB 1J8DA 4ZFNA 3OZ7A 4KXQA 2C03A 3CG0A 1F2VA 4NCHA 3QMPA 4NE9A 5A6SA 4P7FA 1SA0A 3ESCA 1MBZA 3ZBTA 1VPLA 5E38A 1AKTA 1RE0A 3RLIA 4AK9A 4C0SA 1GYRA 1V0JA 3QK7A 5AKXA 3C7AA 4ILEA 3KL4A 1ESCA 3F2IA 1ZM7A 2EBHX 1D03A 4WRRA 4ZRMA 5CD9A 2JFWA 2EJUA 1WB9A 1WABA 1GNVA 3DTVB 3FCAA 3I73A 2HCFA 4DCOA 3C3KA 4H7HA 1R27A 2VP2A 4A8HA 3G2NA 3WLRA 1FXWF 4KGVA 5HKOA 2FYTA 2B4QA 2LCQA 1DCKA 3FLEA 1JKJA 4O59O 5E4TA 4NXNB 1L3BA 4BRUA 1K86A 2HUPA 2IWHA 5CFOA 1XZKA 3QHPA 3GO4A 4G5GA 1XXHE 4IJMA 2ZJZA 5LD2C 4M7WA 2CLCX 2X9NA 3TLGA 4AROA 1CERA 2ZVQX 4HB4A 4M0UA 1M5TA 4RF4A 4BJHB 5AW1A 5IUJC 1EFRD 4Q4HB 5KX5A 3Q7QA 3Q3EA 2MSWA 1SKAA 1N5IA 1Z2OX 3GPBA 5KKAA 1KVRA 4B2PA 1ISPA 2PT7A 4MHSA 4HAXA 3RYIA 5CFQA 2EF1A 3F6EX 1F5NA 5KOYA 2WD7A 2AD5A 2XRFA 2ZUDA 3QOYA 4XVHA 4KAFA 1DWQA 1I2ZA 3C24A 2GARA 2BSAA 2WMDA 2YH2A 1AUXA 4IJUA 4OHXA 5D2CA 2PKQP 4A6EA 4BWVA 4BVFA 2FV8A 4CKEB 2HN9A 2XOXA 2ZATA 2ZROA 2ZZKA 2JGNA 3CKMA 1UZLA 3AILA 3EODA 4KTTE 4RMIA 4C22A 3I37X 1OJLA 1ZD8A 1NMSA 3QBTA 2CB9A 4GD3Q 1KI2A 3PTAA 4GKKB 3VDRA 3KR2A 5C37A 1PV4A 3QNMA 1JFTA 2XGSA 4KWTA 3F7NA 3GL9A 4PSKA 3EXIB 3PNVA 3SOPA 1Y33E 5F2NA 5JXWA 4M9XA 4FT2A 1KJ8A 2ATIA 1Q3TA 4TX1A 4N54A 1ZC4A 2ZJ8A 3A3NA 4BYMA 1T0UA 4OKIA 3TZHA 4P7BA 1UQUA 5LQNA 1XRMA 4RABA 5AXCA 3O9MA 4F3RA 2CL5A 1T8SA 3WR5A 3ACBA 4EGCB 3G9ZA 3L04A 2IYTA 2B35A 3H4TA 3LXXA 4QD3A 4FZ5A 5HF6A 4E1AA 1FPMA 3CVYA 1NX6A 1Z6YA 4NESA 4LXXA 1EVYA 2QG6A 3GNLA 2XODA 4GGPA 1E5XA 4YAIA 1JEJA 2J46A 3RKUA 3SGLA 1JA0A 1L4NA 1WUYA 3WLSA 1JU4A 1RC1A 4RLHA 3RYHB 4RJKA 3LHIA 5FTLA 1EFVA 2ECOA 2OHVA 4B71A 4A2QA 4TLMB 1G291 1GR0A 5DHPA 1PYGA 5HCUA 5CX4A 1S7GA 5FIUA 2DHDA 3D59A 2ZJ6A 1ORHA 3H75A 4OATA 1E89A 2YASA 3BIOA 4RKYA 4IGKA 4YRDA 4RH1A 3WGHA 5C5DA 1SKMA 1YVPA 2J3JA 1WNTA 4I7EA 3T41A 5BMVB 1YXMA 4MS4A 4XW2A 3IBSA 2DUWA 2B78A 1Y9JA 1J33A 2BWJA 3MWDA 1VBKA 4PLVA 5CMLA 5KAMA 4JYBA 2ZB8A 3PGKA 3LNCA 3WA6A 4Z7OB 4PPQA 4N47A 3FCUB 4M0EA 2FUKA 1PJTA 4XARA 1IM5A 4MV1A 2XVAA 3SJCA 2X7XA 5EMKA 4C6HA 4DCCA 3LGXA 3C1OA 3IDZA 2PR2A 3DVLA 1EFCA 2X13A 3L92A 3PC4A 5FHQA 5EJ8A 3P1JA 2OZEA 1J8FA 2QRUA 3QLJA 4MEBA 4WXYB 1QG0A 4V1CI 2WHQA 4LHSA 3T06B 1TM7E 4YRBA 5DN6A 5IBQA 3QNUA 2AUMA 5KOJA 4ZU1X 2VDWB 2JBHA 3KKZA 3RVRA 4QGBA 4LZJA 4WQMA 4D6XA 3ZNOA 1E2QA 3HBJA 3P97A 4NYMR 4B6EA 3UFBA 2FRDA 2QN3A 4CF6A 2LKDA 3W2TA 3ZH9B 2GPYA 4QU8A 4BRSA 5FUQA 2QQ5A 3QU4A 1M2WA 3QA9A 4Q3OA 4RHFA 4Z7JA 3PGA1 1E4YA 3CE6A 2XB2A 1M2FA 1HKUA 1R64A 1U0RA 5K1ZA 4B82A 2VPWA 1G8MA 2AWOA 2D8MA 1P33A 2ZPTX 3OJXA 3M6IA 1Q16A 5AI8A 3N0XA 1ADJA 2IKQA 1T8RA 1G16A 2DFDA 3ABRB 2I8AA 3O95A 1EG7A 1PNRA 3ZW8A 1VIAA 2J3QA 3PEFA 3DV2A 5ILQA 3VNQA 4XVQA 3WJ1A 1IAQA 3I9JA 1OBVA 5BN3B 1GWNA 1SPXA 1XLUA 1USGA 5A05A 4UM9B 2RHDA 3KELA 3PD7A 5F7ZA 5CB4B 3C16C 5IAKA 3N28A 1CUIA 1J0EA 2H9IA 4IF6A 1VLJA 4GMGA 4CM8B 4OK3A 1FB5A 3N0WA 3MSCA 1PSWA 4N6OA 3S2SA 3WJ7A 4P4TA 1YR1A 2PSEA 2ODAA 3CRRA 5COBA 4BNWA 1WMBA 4Q9HA 1PJRA 4CGYA 4MA0A 4KPEC 1DBVO 2QXUA 2QS9A 4JQOA 1SFRA 3IALA 5D86A 3HK2A 4G8BA 3DEJA 2I66A 4PEVA 2C8JA 1PVOA 4EKDA 1ZM3A 2NAFA 2XXAB 1YCDA 2OC4A 2R8PA 4LX0A 1RLJA 5LVAA 3WLIA 4UHHA 3LKZA 1GUBA 3D1JA 4RZXA 2HYIC 1E1LA 3R0XA 3QXHA 2AC7A 1QC5B 2CLOB 3AI7A 3MS4A 4KG7A 3RPEA 1W0KD 3WADA 3VRHA 4TQ9A 2BR5A 4GVXA 1KC1A 2UZ1A 2LIVA 2B83A 3KFLA 3ROTA 4B1FA 2CN1A 4BFCA 4D4JA 2HIHA 3KG2A 3HCDA 4HZIA 2G40A 2IY7A 4KP7A 4HDNB 1WWKA 2CLDX 3KL2A 2BD0A 3RGGA 2V1UA 2R66A 4DT1B 4DGSA 1J22A 1WL8A 4RFVA 2F1IA 2EVWX 2YUTA 4MGIR 2PMWB 1XYYA 1LSJA 1T0JB 5DASA 2HT6A 2I33A 1QIMA 1S01A 5FYQA 3RT1A 3UHOA 4FGUA 4GLJA 3IV9A 3HJAA 3IS3A 1EXWA 3AIMA 4OOFA 4JBHA 1NWCA 4FW8A 1L8QA 3Q3GE 4P3YA 1CR0A 1JHAA 4AJ1A 4RKFA 3NRBA 1JEAA 4RCZA 3I58A 5EWMB 1B14A 3BCSA 1HYQA 3FNQA 4S0ZA 2Z2ZA 2I7TA 4GOLD 3KTAB 1N6LA 3H7AA 4XR9A 1I9GA 1RXWA 4AO8A 1ZNZA 2GGSA 5COAA 2I4LA 2MOKA 2NQTA 1L7QA 4C4OA 1C9EA 3BULA 3C7DB 4O2RA 5U9CA 1WUHS 4NAUA 1B0ZA 1RKVA 3AWDA 5DHFA 4RHEA 4US1R 3H2IA 3CZMA 4UM7A 1EBBA 4Y2YA 4J03A 2ESRA 3SBDA 4KI7A 3PP8A 2AG1A 2GH1A 1YWGO 3E3LA 4PLHA 3T9BA 2HRBA 2MSEB 3K8OE 1VKJA 4B3JA 7MDHA 1WNFA 1BXRA 5CFNA 3T3OA 1G8FA 3ZGZA 2FW8A 4Z9FA 2C2MA 1Y7IA 3W06A 1IJFA 3V2HA 1NU8A 1WTCA 4RTQA 2WPDD 3ZWYA 1VGRA 2WRZA 1PV2A 3KKPA 4Q00A 4RTSA 4KAJA 5BV1A 3OLZA 3CUEF 4JJ6A 2VJLA 4K6KA 2V7GA 5C5CA 4V0ME 4NARA 4B48A 3IQWA 3BAZA 3AVYA 2WUFA 5ALZA 4MRMA 1DCTA 1HYGA 3D7RA 1MEEA 2EZ8A 1LLFA 3DC2A 3ZBUA 1HOTA 4ECAA 1JT9A 2PRIA 1PGOA 2ONZA 3R23A 2PXCA 2VOJA 2A9QA 2ZR8A 4TL9A 4CIYA 1MX9A 2PCJA 1POXA 1OXTA 3S70A 4LE0A 1E1NA 2OGTA 3ADKA 3PVCA 3V55A 3BMOA 2X2PA 5CPFA 4X24A 4R83A 3K70C 1X7DA 2O4UX 1V4VA 4FTWA 1NE2A 1RIIA 3OESA 5BT8A 2JJQA 2F17A 2IYRA 3ELBA 4KN5A 5F12A 3RWOA 4BU1A 4EPRA 5JNLA 2GPSA 3GYGA 3EEBA 4KLRA 5IKEA 5LQUA 4Q39A 4QQ8A 2FPMA 3FHLA 1G5TA 4JC8A 1FP1D 3K9WA 1RSZA 2M1XA 4NK4A 2QW0X 4BQSA 2G8LA 4E7OA 4FFDA 1J6UA 2OD7A 1U94A 3LPDA 1NW8A 4XCXA 2DH5A 2GYUA 3GJ5A 4HQFA 1VJDA 3HXMA 4NI5A 1EJ0A 3ETLA 4R9SA 2DYKA 1YIOA 3BWVA 2XQVA 2PTGA 3M5PA 4YP6A 3UJ8A 4CN8A 2NP6A 2V3VA 1BW9A 2IHJA 1ZHHA 3DA8A 1SXQA 1Y8RB 2ZP1A 3L6DA 3TB4A 1VCMA 4XRRA 1T6ZA 5BYBA 4EJSC 2AMFA 2QN2A 1FTSA 5TMBA 2HB6A 2XZDA 1FNDA 1YMUA 2X41A 1Y7LA 1QSGA 1ZC3A 4K6HA 1X1SA 3GRFA 2W2TA 3N7UA 5CBPB 1QGUA 4BNZA 3O3MB 2X0EA 4L57A 2OC9A 5DRYA 3VU9B 3EB9A 2HMAA 4FMDB 2ATCA 3ZGLA 3HA5A 4XASA 4OI0A 4FOLA 1KY2A 4BNFA 4ZYZA 2Q0XA 2C42A 2IE0A 1FTWA 1ES9A 2YQZA 1OF1A 2ZIWB 2J7KA 4M0KA 2WYWA 3T6KA 3AB3A 2RH5A 3E22A 4UPDA 1YA8A 3OF5A 2BFDA 4IRMA 1WPGA 4L4RA 1IDN1 3NWOA 9LDTA 4MWZA 1U5BA 1TQDA 3RDPA 1XZLA 4I50A 3W8EA 4EQ6B 1QZ3A 3KD3A 1JDBB 3EW9A 4FHGA 1R37A 2D2IA 3NORA 4K7JA 4MWEA 5CNMA 3BB4A 1OASA 2A1UB 2OAEA 4D8XA 4AS1A 4OL9A 1UPCA 1KY5A 4IIEA 3TJRA 4IOJA 5TB5A 4PZDA 3PIRA 5FOVA 3P0JA 4IX1A 5FJIA 4IS3A 2FLWA 4GQIA 3ND7A 1ZCBA 2B82A 1AKMA 4A0QA 5EE5B 2HSGA 3VKHA 3RBXA 3SY8A 2HSJA 1D4ZA 1M2VB 3UPUA 1OAOC 3OT4A 1SQ5A 4JLNA 1BEEA 4IW3B 3R7DA 4RH0A 3RRNA 4BFZA 3UCXA 2GKOA 3RFCA 2XDYA 2PLFA 4GM1A 1O03A 4DEYA 3KHTA 4ECEA 5LBTA 5F7OA 3N8DA 4EHIA 2JI6A 4XX1A 1L8AA 4KAAA 1DXOA 1GUZA 3EDCA 5H8WA 4RWZA 5ITZB 5NLLA 4I55A 5C8VA 4E70A 1NRWA 3CTPA 3TO5A 1OHHA 5IMSA 1LTHR 4LJ7A 4MKZA 1BS9A 3BEDA 4O2AA 4WCFB 1D6NA 4Q48A 4FHDA 4JP8A 3R4VA 1E99A 1KMHB 1HC7A 3JAKA 3KB6A 3UC5A 4O3MA 3MJRA 4YJGB 2I6QA 4EYSA 3AVUA 1PR9A 3P9QA 1V4BA 5C4MA 5K99A 2PS1A 1YZTA 3N2LA 4PC6A 5DBEX 3S99A 4RDIA 1E2PA 1K7CA 3AV0B 3HUEA 2I4NA 4TKLA 5LCXA 2FFJA 3F5MA 4MULA 5LYYA 4F5ZA 5CDYA 1H2BA 1K89A 1NG9A 1FFSA 1TJYA 2DX7A 2G83A 5I9TA 4DLXA 1QRUA 4LF5B 4KIFA 1V5FA 2CDNA 4P7GA 4DPKA 5IXYA 1V1RB 3A7EA 2IOHA 3ABZA 2C3OA 3LUPA 3LWBA 1DLJA 4U63A 5FRDA 4XZ3A 2R751 1ACLA 2W43A 2XMSA 4IQ8A 4WK2B 4Q05A 4MEAA 2K7ZA 5AJYA 3TRFA 4KU4A 1Y42X 4QJ5A 3T0IA 1D1SA 1BQEA 3E27A 4U2CA 4BV8A 3K72B 1EE9A 1LSSA 3QFRA 5FPSA 3ZZ1A 2GPBA 1E4EB 3UMMA 3GXOA 1WP9A 4NOLA 3P96A 4X7BA 4Q7EA 2AEEA 5KYNA 1EK2A 1IK6A 5FPHA 5IYZF 4B85A 1WB6A 3ZDAA 3ZLJA 5GJBA 1A2KC 1KSJA 3HYTA 4J7UA 4XB6B 3F0TA 1C7FA 3JD0A 2HAEA 1GV0A 4HC4A 4W7HA 1L7VC 1MOPA 3QVSA 5KYUA 3W6OA 1RYEA 2IA5A 4C3ZA 3DPIA 2BGRA 1CB0A 3V32A 4D8WA 2WZDA 5LKAA 5I7FA 1YB1A 1LPBB 2Q4OA 3AP2A 1QAQA 3L0CA 3I8XA 4MNTA 3OMWA 3TLJA 4EA7A 2OCLA 3U4GA 3TUIC 3UHFA 3C7TA 2AC4A 4AY4A 2IPMA 1SCIA 3IOMA 5B7NA 1T3HA 2P7HA 1TJ5A 2Z83A 2O1EA 3PEWA 2O8CA 1QV7A 1COZA 2G9ZA 2IEZA 1RYYA 3HDQA 2R8BA 4GOXA 1EQAA 5IC6A 3WLHA 5JSZB 3GLHA 1GA6A 2OO5C 1QLHA 3GNSA 1PJQA 3I72A 4QEZA 4NJOA 1N5MA 4C08A 3PCXA 1Q92A 2A5JA 3H9EO 3TOZA 5LKRA 2G3YA 5JWOA 3GEGA 2YXNA 4M1TA 4XDGA 3LYUA 1T2VA 4IMPA 2YXDA 1FE8A 1N8SA 3BK1A 3IJRA 1DKUA 3QPWA 4OMCA 3CNNA 2W6OA 3RJTA 1P9WA 4K8RB 1XB2A 5IJ0A 2PUWA 5C9ZA 4MGZR 5H16A 3RFXA 1T3SA 2E82A 4AYXA 4BNDA 1RRMA 4EHAA 3AJDA 3LX4A 1G20E 5FAKA 4LGMA 3VZSA 1ORDA 2MMGA 5BSMA 1EX6A 2ZYIA 1EUYA 3HTXA 4D4KA 1B8VA 2GZDA 1KWKA 2VHZA 1DTSA 1Z45A 1HYHA 3ORYA 4NFHA 4Q6WA 4R2KA 2JNWA 4URZR 3R7WB 3T94A 1N2IA 5E6RA 1XJ5A 3V7FA 3S8EA 1I7PA 4JI8B 5EWLB 1E3LA 2CXNA 3N70A 1JPVA 5HZMA 1YO6A 5JYCA 2AFIA 2R8XA 3HA7A 4LMRA 1IVYA 1DS6A 2IUYA 2Q1WA 1JAHA 4GYWA 1X7GA 2IEAA 3PV0A 2WU8A 1JA1A 3TIXB 1O89A 2XB4A 5AJWA 8OHMA 5EPUA 3TOSA 3LY9A 2DSNA 5BVHB 2P6NA 4OYHA 2AB0A 3GJQA 4N7MA 4U3JB 2TS1A 4IAOA 1Q0ZA 1RAHA 1WTAA 1X9IA 3ANLA 3UEOA 4MVJI 1X70A 1Z25A 2W6ZA 3HLTA 4K9PA 3I01A 5B12A 4RTMA 4DR7B 3E9MA 3GZJA 5GPBA 4HPWA 1IHYA 5TJHA 4MR9A 1WEKA 1NHWA 3NOOA 2GPAA 3KQOA 1PX0A 3O4RA 4IR7A 3OZFA 1JHXA 4RENA 5HWSA 2ODEA 3L3BA 2A7QA 4EPXA 3TMKA 3QXJA 1CY0A 3STWA 3I6BA 1FQKA 1HDYA 3H5OA 2TRSB 4KIJA 5DRTA 1FJ2A 1R4MB 1ADGA 1NURA 2XIQA 3BAFA 3TVDA 2PZLA 4L4UA 2A84A 4FILA 1IIRA 5AD1A 4IDOA 3A6PC 1DI0A 1QIFA 1KZHA 3IAAA 1ESEA 2G36A 1JPUA 3FI0A 3LP8A 4MVCA 3AOGA 3J7AC 5KQGA 5IWAB 2IYOA 3GN2A 2DPLA 2H4HA 2EKZA 2MYUA 3GBSA 3H97A 1XNJA 3IUSA 4LRWA 3RS4A 3OC0A 3SF8A 2JFVA 1G3RA 1BYUA 4J16A 4MX8A 1XTRA 3DOCA 1KZGB 5G4LA 2E6KA 1LDNA 2F7SA 3HKBA 2GCNA 3WGJA 1YVUA 3DCYA 5JZ9A 3MZ0A 2XKKA 4WMLA 1PZNA 1U2GC 2PJDA 1T4GA 1M54A 2BUAA 1VE9A 4N0QA 3ENNA 4QDXA 2I55A 3FFAA 4YJ3F 4RPKA 3IVMA 4NJEB 3AW9A 4JGBA 2C9MA 5BPHA 5BXQC 4I81A 3E7DA 2HLPA 1P9OA 1GUDA 1EX1A 2HXGA 3IPRA 5KWVA 5EAIA 2O8DA 4UD2A 2WFMA 1OMOA 4TWJA 3LQ2A 2YZ2A 4IO1A 2B1JA 4FXPA 4ODIA 1I3MA 3ECSA 4MMXB 4M9QA 3Q9UA 4HUJA 4LJ9A 5LU9A 5DOZA 1KOLA 1JQAA 2EX4A 1A2QA 1L2TA 4EYOA 4I19A 2AQHA 3DT6A 4EG8A 3QWIA 4DB2A 3FF4A 5A62A 3THXA 5LWHA 2HSZA 1MOZA 3TBKA 4B2LA 2CL7X 1CUEA 1J9EA 4YMUA 4WKOA 5FWAA 1RDFA 1Q22A 4I4TB 3RKRA 1UKZA 2MYPA 4ZT2A 2ZRNA 5EJIA 3K0SA 1QHEA 2BZGA 4ZOEA 1N36B 3HDVA 3EIXA 1VIYA 4G1BA 3U7IA 5J43A 5CA1B 1KO5A 1TA4A 1DCMA 1JHDA 2IT1A 3A1VA 3DV9A 4MQFB 1YUBA 3PE3A 2VZ8A 1P2DA 1FTYA 2H4XA 1TECE 2SKCA 1T36B 1ZOOA 3ADDA 2P6PA 1T0HB 1W0CA 1Z07A 4ETNA 4G0NA 2PUEA 2ACKA 4PAMA 4QDTA 2QXYA 1VL6A 4PR3A 1A88A 3NKFA 5BV2P 1ND6A 2HHJA 1O1YA 1CHNA 3RVJA 3ND5A 3F8SA 3FFBA 3ZDYB 1J8QA 2WEKA 4ENUA 3HCRA 3R3UA 1J49A 1XHLA 2NZ2A 4HNGA 3ZLUA 2QW8A 3M3HA 3TTXA 3AUXA 3KT8A 1Z18A 1FS4A 2PZBA 1ZK4A 2O0MA 3FMGA 3PQDA 4PC3A 4CLRA 3COZA 1ZYUA 1TF2A 3RC3A 4RS3A 2F55A 1GZUA 2QRLA 2SCUA 4DYHA 5LQKA 1PUXA 3FYDA 4RSMA 4OSOA 5AK0A 1YAJA 1VBFA 2WNHA 2XCLA 3LCRA 1WO8A 4HDQB 3SD7A 3U80A 4CM9D 2HMTA 4C76A 4Z4HA 3MB5A 4G09A 4ZDJA 4E31A 4G36A 4Z0TA 5BVGA 5LQJA 1XNGA 5HS4A 4X3CA 1P8JA 2QSUA 3L8FA 3MRSA 3KUKA 1R5BA 1EQUA 3E8MA 5DXJA 4MA5A 5FQOA 2JG3A 1LB1B 1T4CA 2HJ9A 4P36A 3CVJA 4G37A 3HA3A 1NF8A 3AFOA 3IRUA 1J97A 1UP4A 1Z8HA 1NTRA 2EU8A 2QMHA 4NDNE 3LUJA 1J20A 4N0MA 1UPTA 3SFTA 3VJRA 3A1CA 3AF0A 3AM3A 1H5UA 4OPMA 3P9SA 4O0MA 4MS3A 5D3KA 1GZVA 2J33A 4AJ4A 1L5NA 5ICEA 3X1WA 1F2UA 3MK31 2YJNA 3LDFA 4N41A 2EL9A 4QPJC 3NO4A 4IKEA 1DC8A 2HJRA 1U1FA 2ZDHA 3G2IA 1Y7PA 1Q84A 1Y8ZA 1FZQA 3KFVA 4CQLB 1S9DA 1SUAA 2P9JA 2Y1XA 1O94D 3NTUA 2Z0MA 3WL4A 4AECA 2AG0A 2OD2A 2QF7A 1G41A 3L8MA 3NDJA 3EIWA 4ZAXA 5TQ2B 3L1JA 1I4OA 2JZCA 3DFUA 3W3AD 3ZQ6A 4AQDA 2VQEB 3P20A 2QRZA 1FTQA 1L5HB 3TI9A 3MWKA 4XWWA 3SIPA 5EZYB 1RJGA 2I76A 2PRKA 4YDQA 3VYVA 4DBVO 1E3IA 1I8TA 1Z47A 4KB5A 4D9FA 3VKGA 2BY4A 2OCAA 4IV5A 1PGQA 2QM8A 2H1IA 5IJZA 4DRXA 4Z8YA 4KX5A 3TSYA 4Q4DA 1Y4AE 3AMVA 2HI0A 3M6AA 2DKNA 1CETA 4LI3X 5FOWA 3HKCA 4K9KA 1PBTA 2BZ1A 4IV8A 2WM8A 4J3NA 5HQ3A 3TKYA 5KTRA 4MW0A 1KH2A 3SF0A 1UADA 1JLLA 3VMMA 3RJ5A 1JEDA 2NTNA 2Q41A 2R7KA 4L9SA 2J6HA 2XCRB 5J4LA 1DC6A 1UIRA 4EKGA 4O5AA 1I2DA 2Z58A 4U9IS 1JJBA 4Y2VA 2YVUA 4LSZA 4E15A 4IJQA 4YLGA 3OPMA 4RIIA 5KYXB 5B1YA 3F9IA 1EUDA 2CHQA 3NM5A 4K9RA 4DUPA 1K6XA 3GRVA 5LBIA 1KDVA 1UBJS 4CKCA 1Z6TA 2X5OA 4Z2YA 1HL3A 4KYTA 2OOSA 4C43A 1E9AA 1JG6A 3G6KA 4I6GA 3R5HA 4KDRA 3DP9A 4C7XA 4URFA 2MT9A 3TNLA 3GT4A 1X7WA 3GDOA 3HB4X 1GPUA 1C4WA 5EJAA 2IEBA 3LF2A 1HE3A 2Y0BA 3P9RA 1GPH1 2R87A 5ES4B 1ONOA 4UEKA 5E6SB 5IJAA 1DJOA 3OOSA 2XA2A 3GDGA 3I2IA 3V3TA 3VISA 3COWA 4BHTA 3FLAA 1TUIA 1CYEA 3D3WA 4X1OA 3GVIA 3ZVLA 1JEEA 2FFQA 2H4YA 2W98A 1SIWA 3JWIA 5KWEA 3C3JA 2Z2YA 4EFMA 4O2LA 3GT3A 1E5DA 1U7XA 5FTWA 4YRSA 1YQDA 1E6KA 4OGFA 3SC2A 1YE5A 2QY6A 3K31A 4XFDA 1I3LA 5CR9A 1NQVA 2JHAA 2SICE 4FFLA 4DMMA 4FMBB 2TMDA 2R4TA 5E4YA 4WACA 2AW3A 4Y8VA 3E61A 4AM8A 1JMKC 3JQDA 4BQIA 3FDZA 4FHFA 4INOA 1JFRA 2PV0A 3BT7A 1N2OA 1KZYC 1RQ2A 4G86A 3FYUA 3VV3A 3BL8A 1KZ6A 3VHRA 2IKSA 3PEYA 2YWCA 3KEGA 3VU1A 4CFSA 4EY6A