3AKDA

Crystal structure of cmp kinase in complex with cdp from thermus thermophilus hb8
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
202
Chain Sequence
MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRARERPQAYEEVLRDLLRRDSAPAPDALVLDTGGMTLDEVVAWVLAHIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the tertiary complex of CMP kinase with a phosphoryl group acceptor and a donor from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Cytidylate kinase
total genus 70
structure length 202
sequence length 208
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akdA00
4OJQA 3TSOA 1MABA 3CRRA 3VR5A 2CCGA 1D2NA 3GLFE 1AGPA 1Z28A 4DCTA 4LV8B 3MFYA 4XVUA 1GILA 3GQBA 3CH4B 2ZJAA 4B3XA 4CEIB 3B5JA 4NYJR 3RRZA 1LFDB 3T61A 1CJKC 2WJIA 1II0A 5FUVA 1HE8B 2H17A 4PPQA 3TMKA 1OXTA 1WF3A 4CYMA 1JPJA 2GWHA 3AKEA 2GKSA 3K9NA 2IEZA 3TQCA 1VHTA 2ZTSA 1G7CA 1N6RA 2PZEA 2W2XA 4L5BA 4BFSA 4LJ6A 1HT1E 2B7CA 3WHKA 1CJVC 1G8HA 1S3GA 1Z6AA 3W34A 5AUNB 4S2EA 1VECA 5FUWA 3D31A 3EZ7A 1R5BA 2GEDA 2O8EA 1FX0B 4EQ6A 3CZPA 4Q4HB 1EFHA 2I3BA 2IYLD 2BEKA 2R6GA 4GZLA 4YMVA 2WOOA 3OEEA 2XZLA 3NDBB 1U90A 4PHHA 1QF9A 2J87A 1E96A 3IIMA 2QTVB 4XOIA 3OEHA 1KMQA 1E1QD 4US0R 1ETUA 3SNHA 5HZHA 2ODNA 4QRHA 1ZNWA 4TMZA 1PUJA 4LI0A 4URZR 3LVRE 3KL4A 3OE7A 3SJZA 4EFLA 2FA9A 1Q1BA 3FMOB 3K0EA 4PQRA 4DDTA 5EE3A 2GAAA 3TW4A 4F4JA 1S1MA 3OAAA 1YZUA 1N6PA 5CLLA 4V0KA 3ZZ0A 5CB8A 1W36B 2R6DA 1Z6TA 3KJIA 2EFCB 4PX9A 2JEOA 2ZRDA 3KKPA 3WMFA 1A4RA 3T12A 5G3YA 2JLYA 1YR9A 1KY2A 3N5CA 3RVBA 1Z08A 2IYZA 2B8TA 3K9LA 3PUXA 4RKFA 3THXA 4D0LB 3VR3A 2RGNC 3MWYW 2GXAA 4DT1A 2V8OA 1E9SA 2OFWA 3FKSA 4B2IA 2DFKB 2ZIAA 1E9FA 3TK1A 4PSAA 4DZZA 1SXJB 4B48A 4LJ5A 3QEOA 1ESNA 2CMKA 4KJZA 5JSZB 5K8LA 2FFBA 3A4MA 1AGRA 1Q22A 1I2MA 2KWIA 1Q3HA 4I1VA 4R2IA 3KDSE 3WMGA 4ERNA 3W5IA 2ZYWX 3GJ5A 3QBVA 5KNDA 3NXSA 5JSZA 5BXQC 2D3WA 3ND8A 2QM8A 3EARA 1E2IA 1HY3A 4BECA 4NDZA 2IYXA 2AKAB 1GZSA 1SXJA 3MJHA 1X3SA 1OKKA 1Q1QA 3CNLA 1R0WA 5CIWA 1DARA 1XD2A 3K8YA 1NKSA 1FTSA 2YZ2A 2IXGA 1DG3A 1XCMA 1SHZA 5JECA 2LWIA 4PO9A 2CK3D 2ZJ8A 2V55B 3KKQA 2HF9A 3NH6A 3ECCA 3ONWA 2QL6A 4AKHA 1FNMA 1WDTA 4EPWA 1NN5A 4Q02A 2GVZC 2WKPA 4F4IA 1MRNA 1GUAA 5BN4A 4RZXA 1E1RD 5TV2A 5CLQA 3PEYA 1D2EA 1ZBDA 4ZIRB 5FPKA 1SXJD 2AXNA 5IRCD 5FTMA 4ACAA 1R10A 4A8JA 4C4PA 4IRUB 1F6BA 2J46A 1NVXQ 1VPLA 4M21A 2CHGA 1XXHA 1MR3F 3LXXA 5HR5A 2QMOA 1R5NA 1KI9A 4LC1A 2W6JA 3BOSA 1C1YA 5SZJA 5JWHA 4B6EA 5KSZA 2QBYB 2EFEB 3IBYA 2DWPA 2IK8A 4NONA 4TMTA 5KNCA 1JPNA 1A5TA 1RJ9B 1VCIA 3BK7A 5ELXA 1G64A 2NIPA 4LHVA 3EPLA 1T91A 5CIQA 4B33A 1N6HA 1G7TA 2BKEA 1NLFA 1E94E 2BV3A 2QTFA 1XEWY 4JL8A 4MGYR 4PAMA 2ZRHA 4POAA 3T15A 1E32A 4RJLA 2ZI6A 3CNNA 3DEFA 4AKEA 2F1HA 421PA 4M1WA 1YHNA 4TLEA 3GFTA 4UNSA 1RYHA 4A0HA 1G3MA 4PC3A 3FMFA 3OFND 5B30A 1XD8A 4PC7A 3GLFB 2OHFA 1M74A 1SVMA 2F6RA 2QY9A 2ZITA 3P27A 4GNKA 3UG6A 3K0FA 4A92A 1RW4A 2ANCA 2G0NA 821PA 2ZR7A 3CRW1 2VP5A 2W6ID 4OI4A 5AJZA 3L82B 1YR6A 1GAJA 1E9AA 5EZ5A 4NYMR 1QHXA 2IYTA 3DKVA 2QAGB 5FPTA 2R6CA 1W46A 1CULC 2ZSAA 4DUGA 3EX7C 2ZUCA 5J4VA 1NF3A 1P61B 3BB3A 1P2UA 1Z6GA 4NCKA 4M53A 4WXRA 2NMVA 1QG4A 1XZQA 4M8NE 3E1SA 3QSYA 3LLMA 1FL9A 1G21E 3WY9A 4TMKA 1PV4A 1VG9B 2NO0A 1M7HA 1X86B 4RFSA 5J5CA 1LV7A 2C9OA 4OBEA 2BMDA 1SVWA 3ZIAD 4O0MA 3QXHA 4JLOA 3M0EA 3QKRB 3REFA 5F9HA 2YYZA 2H8KA 4YMUA 1ZM3A 1D2MA 2P6NA 2PCLA 4LJAA 3PITA 5IHPA 4V0OA 2QGNA 3U3MA 1W2HA 4JL5A 3SR0A 5CITA 4L15A 1KK0A 3U3OA 4OI2A 4IW3B 1M8PA 4EJSA 2OE2A 3BB1A 4TTPA 4UXIA 3U4QA 1XU4A 2IYRA 5LPNA 4NYMQ 2L0XA 1VYVA 2F9LA 2YWHA 5AJYA 4GFDA 2QG6A 1GNQA 1FZQA 3FKSD 4TLBA 1BOFA 1AN0A 3NH9A 4TMWA 1T0HB 3UWKA 3WP0A 1OIWA 4HSEA 1U0JA 3EC1A 1XTJA 2AX4A 1ZVQA 2YWFA 4K8OA 2G77B 4C7OA 3KFVA 4D25A 1US8A 3IIKA 2O8FA 2BCGY 2PX0A 2C8VA 1JEEA 2BCJQ 5EXXA 1NY6A 1GFIA 4I1UA 4UXHA 4BE7B 2RGNA 4B6FA 4Z54A 3T1VA 1G3UA 2RHMA 3E2IA 2CVHA 1GL7A 1A2KC 3IUYA 3KQUA 3LNCA 3LVQE 4DXAA 4GOJA 4BFVA 3CF0A 1E2FA 2FU5C 1RRFA 3QPVA 4IXNA 2WKQA 2ZPTX 4QHSA 5C46F 3C41J 3ICEA 1Z06A 4MGKR 4TMXA 3I5XA 1OFIA 3VR4A 1CU1A 3KQLA 3ZDQA 5DIFA 1Z3IX 2WM9B 1QG2A 3L0SA 2JLZA 1NVUQ 3EW9A 3OZXA 5EP4A 5HE8A 1RZ3A 5CM8B 1HA3A 1N5JA 3SEAA 2PLRA 4DWJA 2QMUA 4ASUD 4A2PA 4YXWA 2JJ2A 2ZE6A 2JIZA 3BFXA 3MWKA 4HZIA 3U3KA 4E03A 1G19A 1XXHB 1KSGA 4V0MA 2R6FA 3NBYC 4PO1A 4EPXA 2LCFA 1SVSA 2OV2A 2ZUBA 3PG5A 2A30A 1AIPA 3FHCB 1OT3A 4C30A 2P2LA 4IEIA 3FHOA 2GJSA 2F43B 2OBLA 2ZR9A 2KSQA 3KXIA 2DFNA 1UJ2A 2R65A 2UVQA 3MUFA 4US2R 4IOJA 3V00A 3U2QA 1KY3A 2V6IA 5JJKA 2WWWA 2XGJA 3U7FB 2D7CA 4MRPA 5FH9A 5HE9A 3HJNA 1UFQA 4OYHA 2WJGA 1KK3A 1N6KA 1UKVY 4NL4H 2RB4A 3L0IB 2BMJA 2DYKA 2JDID 3C4JA 3MJRA 1JJVA 2XITA 2Z0MA 4AIIA 4NCNA 5J47A 4L4UA 3DKPA 2P5SA 4YONB 2HT1A 4KVGA 5FOSA 3LW8A 1T5IA 2CNWD 5BN5A 5JHHB 2XJ9A 1G18A 2W0MA 1BYUA 1NVVR 1ZMXA 5K8TA 3P20A 3RS0A 1D8TA 2VHCA 2WMNB 5KYKA 3ZLJA 2ATVA 4Z8XA 2RH5A 2ZYVX 4JLKA 1CF4A 2FPKA 4LOAA 2WPDD 3D8BA 1E0SA 1JBKA 1R8QA 1CBUA 3QPWA 3ZQ6A 4A1FA 3ZQJA 1V5WA 2QPOA 5CJ2A 3WNDA 2OBMA 1SVLA 2FF7A 4LJ9A 1X8KA 2FZ4A 2GZDA 1F48A 2FJUA 3AKYA 3AP1A 3H86A 4E22A 3NEYA 1DEKA 2IXFA 3Q9LA 1ZU4A 4QGAA 2FNAA 3FOZA 1SXJE 4P33A 4WVFA 5FTJA 1BKDR 1Z22A 2XXAA 1WE2A 2EU8A 5HKKD 5FL7A 3H84A 3QQ5A 3Q85A 1E0AA 3U7HB 1A82A 4A4DA 3U6KA 2YOHA 1E2PA 4HLUA 3CH5A 3W6PA 2AK2A 1KO8A 2YJTD 2ZI3A 1Q12A 5DN6A 3BJIC 3EZ9A 4G0NA 1EWQA 1S1CA 2CLSA 3VU9B 4XH9B 3THWB 1JALA 1CEEA 2EFGA 3N2EA 2PJRA 2J0UA 1X1SA 3B78A 2ZRPA 1ZNYA 5M04A 2JLSA 1CJUC 3QI2A 5FUXA 5SZIA 4Q1DA 1B23P 2E9SA 4ZCIA 3QG1A 1KSHA 5GVSA 2ZJZA 4QNMA 3WRYC 4EQ6B 3BWDD 2O8EB 4H1VA 2ZI9A 1S4QA 3SN6A 2RGDA 5L3QB 1MH1A 5LD2B 3I3SR 1VYUA 3QF4A 3B9PA 3DPUA 4JKYA 1QHYA 1XB2A 2WSSD 2P6RA 1OV4A 2ZSDA 3GLHB 1K8RA 3LQRA 2H57A 1NL3A 5FBRB 1GRNA 4NCIA 2KE5A 1NP6A 3EZ2A 5JCPA 2GBLA 3EWSA 1GVNB 5LB2A 1RYFA 3LLUA 5EUMA 3CRMA 3DDCA 3GJ8A 1D5CA 3DOEA 3TNFA 3GPLA 5EJEA 3K0CC 5EP3A 5FI1B 4EPTA 2CL0X 1A2BA 3F5FA 4WZAE 4XWOA 1EFTA 4L8GA 4CT4B 2YKGA 2F7SA 2RMKA 1JR3A 4PSVA 4JLNA 3T1OA 1ONBA 3RSLA 3U6BA 2Z5FA 1HQYE 2FMXA 3AF1A 4GT1A 4BEJA 1G3QA 2GBLC 2YC4C 2PJZA 2E1RA 3OEED 4GMXA 3AVWA 1G1MA 1NN3A 2PMKA 4GL2A 1YE8A 1D6JA 3F8TA 3PEVA 4PAQA 1I4TD 3T5DA 2ZI5A 2IWRA 2VBCA 1VCNA 3X1XA 1UBEA 1Y3AA 1M1YE 1W48A 3ZVMA 3KJGA 1N6LA 2ZRCA 1N6IA 2VRWA 4PQFA 2A5JA 3BERA 4DHEA 3GMTA 1WBBA 3O8RA 1N6NA 1T3HA 3KTAB 1AM4D 4N0EA 3RLFA 1OSNA 4G5OA 4Q9KA 2GF9A 2OFXA 2WAYA 4LHZA 4MDEA 1FMJA 1XZPA 4Q1BA 4OK5A 1QHIA 4B3FX 2JLRA 2WAXA 2MMGA 2VTKA 3IKJA 4OL0A 3LD9A 2IL1A 4YMWA 3MWLA 3CX7A 5EE1A 4LYHA 3FHTA 1ZC4A 3N2IA 3EG5A 3R9WA 1VIYA 4B47A 4DLZA 3EPHA 1Z2CA 1Z6YA 1VDZA 1ZC3A 2NQ2C 1HH4A 3QKUA 2IS4A 4M4SA 1OF1A 2BBTA 3OFNA 4ILEA 3E5HA 4XD7A 3QF4B 2WWIA 3I62A 5K8UA 5E7IA 3CIOA 4EPVA 5DI9A 1EWRA 4G5RA 2QT1A 521PA 3AV0B 4KXFB 2ANBA 5CK5A 1YVDA 1Z83A 1TF2A 3I4LA 5FOVA 2WWGA 3AVOA 4CF7A 1OFHA 3ZD6A 1LVGA 2GCNA 4FWIB 4IXMA 4TT3D 4MGIR 4IEEA 2PZFA 1RRPA 4MYHA 4HZUB 3A6PC 3W90A 3R20A 4LX0A 3U44A 4MRNA 1NBME 4JJKA 5TB5A 4LHWA 1EFCA 1Q57A 2J7KA 2HYDA 5A0FA 3ETLA 2F1JA 4F7WA 2KI5A 4HZUA 1T3SA 4Q5IA 4OHZA 4MKIA 2IW3A 1CRQA 1G8FA 1YRBA 2OCAA 4I4LA 4B75A 1JNYA 1I4LD 1WA5A 1ZUHA 4PFSA 2CL6X 1G17A 1XCPA 2LKCA 4KFRA 3W8NA 3OHMA 3SYLA 4R71A 4DLVA 2WWHA 5P21A 3NHAA 2P3SA 1GWNA 1PLLA 1ZUNB 2C77A 4Q7JB 3RS7A 1KI8A 1P6XA 3IHLA 4MUBA 1E2NA 1OHHA 3LX5A 4HAWA 1F2UA 1SQ5A 2O0KA 3KJHA 4IOKA 5GJWC 1KDOA 3I1FA 2JJ2D 1Z47A 4LV6A 4WW0A 3GEEA 3EXAA 3K09A 4DBLC 4K46A 4JMPA 1G16A 4EKDA 3AB3A 1KOFA 2BIFA 3B2EA 2B92A 3L8YA 1VG0B 4LJ8A 4L16A 4DLXA 4JT4A 2ECKA 2VSXA 3UATA 4YMSA 2BC9A 4PO8A 1XFAA 3W8RA 1TADA 1QRAA 2FN4A 4TL7A 3IO3A 3A1SA 3T1QA 1EG7A 1Q3TA 3VAAA 4IVRA 4CVNA 4ZKEA 2PT7A 3B1WA 5E7MA 2QI9C 1XEFA 2Z43A 1FMLA 1YZLA 3FMIA 2EFDB 2DB3A 4RY2A 2PX3A 4GMDA 4GPTA 4PR0A 1II9A 2WOJA 1P3JA 1J99A 2HCBA 1CR0A 3CBQA 2OILA 2CLDX 2PZGA 3VHXA 2D74A 2ONJA 4G01B 4LY6A 2ZXUA 1HUQA 4IFBA 2ZS9A 2DWOA 2Q9BA 1ELOA 2ZI7A 1DAMA 1EX7A 3UK6A 4M22A 3AKCA 4CEHB 4QFMA 1GTVA 2XTMA 4HAXA 1WRBA 3LFUA 3U7GA 3HU1A 2GA8A 3BE4A 2XTZA 2WIBA 4M1KA 4HEJA 3WBKA 1E99A 2W0SA 2XSZD 4AWXA 2W00A 1CR4A 3PVSA 3KJEA 5GVRA 3B1XA 2FG5A 1LS6A 2GAOA 5BQ5A 5BWMA 2Y8EA 1TQDA 5DHFA 5A4JA 1F2TA 2QM7A 3W6OA 2GEVA 1KIMA 2IEYA 5HCNA 1SXJC 2ZUDA 1NIPA 2HLDA 2R44A 4UNQA 4BFUA 1RE0A 2GHIA 3D6TB 5AR1A 3CRQA 4HAYA 3UIEA 2REOA 4DUGD 3GLHE 4HLDA 4C0HA 1M7BA 1TUIA 1YJ5A 2CK3A 3LAWA 2CHVA 1GOTA 5H68A 4JLBA 5JS7A 1N6OA 3DO6A 4AKGA 3LQQA 1XTKA 3BC1A 2FH5B 2P65A 3CPJB 4DSOA 1COWD 1MT0A 1AQYA 2J59A 3ZIAA 5JS8A 2REBA 4QGGA 1SULA 4IKEA 4PPFA 2HV8A 4OK3A 4QGFA 5KSOA 2WZQA 4XD7D 3VNVA 2H7VA 5CDFE 2XEXA 4URVR 3RRMA 2ODBA 2QUZA 1EGAA 2ZSBA 3IGFA 4KHZA 1KDPA 1W5SA 4CEHA 1EX6A 3S1AA 5H1YA 2O8FB 1YKSA 3BBPA 3NC0C 4DSUA 4D0GA 1QHSA 5JRZA 2FZLA 2RAPA 3TSWA 5L3VA 5L3SB 2A9KA 2GF0A 1NN0A 4RD6A 1NG1A 1Z0KA 3SU8A 3OEHD 2QPAA 3A1TA 4GZMA 4R9UC 1COWA 1E9DA 2GESA 1Q0UA 1OJLA 2QZ4A 5JZVA 3ZH9B 4KBFA 2OUKA 2XX3A 1ZD9A 3JZMA 2PL3A 3NBFA 3BGWA 3KKOA 4MDFA 2AK3A 1N2CE 1SKQA 2BBOA 3BXZA 4QBHA 4AKIA 2Q0HA 4Z1MA 3CKLA 1C9KA 4KYIB 2QNRA 3EAQA 2PEZA 2C78A 4IVQA 2O0HA 4NU0A 2CJWA 2IBMA 4J0QA 2V6JA 4FIDA 4ACBA 2JLXA 3CPHA 2C2HA 2BMEA 1RVDA 3CZQA 1UKEA 1GDDA 4WZ6A 4IOLA 4C0QC 1ZIPA 4QBFA 2BJVA 2ZRFA 3NTUA 3GLIA 4QXAA 4MA4A 3QIAA 3K9GA 1IN6A 1XDBA 2QTHA 1XEXA 1GKUB 2IF2A 3B7GA 3PEWA 2FFQA 2PLFA 2FEMA 3A1WA 2J7PA 4OHXA 2CDNA 3LBHA 4RD2A 2Q6TA 1OH8A 1SKYE 1A1VA 2GEUA 4Q7LA 3TAHA 1AZTA 4CEJA 4MUAA 4DIEA 4PC2A 2FGKA 4OQFA 1LF5A 1XBTA 3C14C 4G5GA 1G6HA 3AVQA 5B2ZA 2NG1A 1KJZA 2ZYTX 3QXCA 3U5ZB 2GJ9A 3R9IA 4JYCA 1ZNXA 3C7KA 3FGNA 2ZVPX 4UJ5A 1XMSA 2JLVA 2AL7A 1AKEA 1OXVA 5JEDA 2IYVA 3LY5A 5FOWA 4HLQB 2DR3A 1LB1B 3PENA 3GLGE 1FTNA 3I61A 1G3RA 1YZGA 2QQEA 1TMKA 3RANA 4LJ4A 3RSOA 1LS1A 3FFBA 4D6PA 2GDJA 1U9IA 2FSFA 4MKGA 1RPZA 4N1AA 3NVAA 2DBYA 2GRJA 2F1IA 2CCJA 4RD4A 2GILA 3T35A 3TVTA 4CW7A 1G8GA 2Q3MA 5AUOB 2ORIA 4QBGB 1S96A 1NSFA 4M1OA 4Q9JA 4B3GA 5F9FA 1CIPA 4NPHA 8OHMA 2OXCA 2H16A 3AP3A 1SGWA 5IK2A 3QBTA 2IWHA 2BM0A 3QNUA 2WIAA 2ZM5A 3CM0A 1U99A 4JLVA 3B82A 3G0HA 2HLDD 1EFRD 1J7KA 4JS0A 2UZIR 1D9XA 1KI6A 1W0JD 1YZKA 5J4YA 1VHLA 5EE9A 3O8CA 2O8BB 1E1QA 3PUWA 2X2FA 1XCGB 2C9CA 1XJ0A 2HYIC 2IYQA 3P1JA 3WXMA 1V43A 3WYAA 3BAFA 4PZZA 2QEQA 1E2QA 1SKYB 1KDRA 2OT3B 1D9ZA 3LRPA 1UBGA 1AA9A 1E2LA 2H18A 4PHGA 2FPLA 1HURA 4KFUA 3KX2A 1IY1A 5EP2A 3RDPA 5JI3E 5DO9A 1KI2A 4AYTA 5LB4A 1HYQA 1W0KD 2JJ8A 2FSHA 2QE7D 1SHKA 1FP6A 1XMIA 2HJGA 2J1LA 5DI3B 2EFHB 3PUYA 1KK1A 3TUJC 3B1YA 1KJYA 2B8WA 4LDJA 4BLSA 2IT1A 1YZNA 3GJ7A 3SI7A 2O8CA 1GNPA 4DRZA 2N42A 2YVUA 3QVUA 3K1JA 4GSYA 4OK6A 4CDGA 1CJTC 4MKFA 1TF5A 1TAGA 4XJXA 5AUQA 2Z4RA 3EZFA 2AXPA 1WB9A 1UDXA 2UZ3A 3VKWA 2VP4A 4DEXA 2C98A 2BEJA 1L4YA 1ZCAA 4R98A 4Q1CA 1EK0A 1XNJA 2GK7A 2B7BA 4A0RA 1X6VA 4RFVA 4L9WA 1H8EA 2WICA 2ONKA 2ZRKA 4FMCB 4BUJA 4BWYA 1RFLA 3KXLA 3Q5DA 1UADA 3ZS9A 1G7SA 2HEIA 1IJFA 1IBRA 3AH8A 3A4LA 4PZLA 4C0BA 5KO2A 1DAEA 1KHTA 3K0AA 1W44A 4GI7A 4GOKA 4LUCA 2VQSA 3ZYCA 3H1TA 5HTKA 1N0VC 1P7CA 3PIRA 4QM6A 4C0KA 3GP8A 1M6NA 2GCOA 1P9NA 1U94A 1QHGA 2C9YA 2QAGA 4Q18A 4EIWA 5KUTA 1KGDA 4ZO4A 2G88A 4BZPA 1S2MA 1JXOA 5FTKA 5CM9C 4E07A 5CDFA 2J0UB 2OBNA 2XZPA 2ZRJA 5KSYA 3ASYA 4ESVA 1DAKA 2WPDA 3SFVA 1XD9A 3VX4A 5CK4A 1FX0A 1P5ZB 4RSGA 4UXJA 4UKDA 5FBWB 3TE6A 2BJWA 4BFZA 5UKDA 4HAVA 1E3MA 4NKRA 1XEXB 2GJKA 1N0WA 5L3QA 1IONA 3BS4A 5B58C 1U98A 3N70A 1JR3E 3NHBA 1VMAA 4GRAA 1T9HA 4P4SA 2GJAA 2VP9A 3B8HA 2VHUA 1KYIA 1NLZA 5FPSA 1IN7A 1W5TA 5D3QA 4JVLA 4LPSA 1UM8A 3CONA 4AURA 5IT5A 1PVOA 2O8BA 3I8XA 4IJMA 1KI1A 4LV5B 1DPFA 3OIUA 2GXUA 3AF0A 1DELA 1WXQA 1ZP6A 2QU8A 3UANA 2ZE7A 3U3RA 4JSTA 1WMSA 1B0UA 4LWZA 3KUDA 4N0DA 4W5HA 5J4HA 5JLJA 3OESA 3QENA 2ORWA 4NMMA 4IDPA 2OCYC 1E2GA 2JCSA 3MG9A 3TW8B 4TT3A 1DE0A 4ZV4A 2WMOB 4TSFD 3K70B 4WBSA 1R7RA 1ZIOA 2JLUA 3SYNA 4Q03A 4A0GA 1AS0A 5L8VA 2O5VA 2NZ8A 4JZKA 4ZDIA 4TZ6A 4TL9A 4U02A 1TQ6A 4NYIR 1F2UB 2VF7A 3IQWA 3B85A 5EUQB 4XIGS 3UWOA 1IY0A 3Q72A 4BLQA 2YHSA 1GNRA 1VCMA 4CIDA 4F38A 1T4GA 4EFMA 1ZM7A 1G4AE 1Z2AA 3BD9A 2BBWA 5KDDA 1R8SA 1T8TA 1L4UA 1OYWA 2GVDC 2WVJA 5EXSA 1FQJA 2NOAA 2Q9AA 3V9PA 4RFSB 4DCSA 4C0LA 4DCNA 5LDDC 4TTQA 4K81B 3QKSA 2FX3A 4LSGA 2R62A 1AKYA 3HPRA 2VSFA 4PQYA 2ZS7A 5G53C 4EUNA 2OM2A 4AYXA 2DPXA 1ESMA 4Q4HA 4A6PA 5DE3A 1EFUA 5L3SA 4RVCA 5JJIA 1W47A 1KK2A 3X1YA 1AS2A 3CNOA 2MSEB 3U44B 4II7A 1OH5A 1LW7A 2IYYA 1G9XA 4JLPA 3KQNA 3LW7A 2EW1A 5GJVC 5DGXA 3CW2A 1FFHA 1BS1A 3B13B 2W83A 4P4SB 4ZPXA 1DS6A 4I99A 3J81k 5IK2D 3P32A 2C5LA 3UMFA 4PC6A 1SZPA 1W4RA 1Z5ZA 1MO4A 1Z0JA 5KTYA 2ZI4A 3CF6R 2J0SA 3VQTA 3CX8A 4URWR 4Q48A 4XVRA 4G1UC 2AWNA 3LH5A 1NJFA 1UBCA 4PXAA 4MKHA 4BLOA 3I8SA 4KU4A 4M1YA 4DLRA 3NDPA 1KDTA 3KB1A 1KKLA 1IN5A 3REGA 3SBEA 2VP2A 3GEIA 4B73A 3QPUA 5K8IA 1NMYA 3LBNA 1O3YA 1Q44A 3ZVLA 4I81A 5BYKA 2RGGA 4B3DA 3NEJA 3RRNA 1P73A 2ZJOA 5LBIA 2AKYA 4ZI3A 3G82C 5FPHA 3BH7A 1N5LA 1FP7A 1YRAA 1VG1A 3A37A 3BH0A 1KAOA 4Q7KA 2OFOA 2OZEA 1I2DA 1R5OA 1XMJA 3GJ3A 4H1UA 2NPIA 2J7PD 1WBDA 2V9PA 4JBYA 1XX6A 2NO1A 3P4XA 1NJGA 2V7QD 4DEYA 4V0LA 2ZE5A 1R0XA 2FDCA 2WWXA 1DADA 1XPRA 2PMDA 2YV5A 4F91B 2QP3A 1AJEA 2UKDA 5AUPB 3PEUA 3EA0A 4R7ZA 1UPTA 2HUPA 4TQUS 4YQFA 5B64A 3FKQA 4XSHA 2ZR0A 5G40A 1H8ED 1TF7A 1X1RA 3T1TA 2JDIA 1OB2A 1MABB 1Q20A 1IY2A 3RS3A 3CO5A 5TARA 4JBWA 4TLCA 5FL7D 1T5LA 3K0SA 4GP6A 2CJWB 3LA6A 4URYR 4BZQA 5DYGA 1JB1A 1E9CA 2GJ8A 1UF9A 3GJ4A 3MGCA 2FEOA 3U60B 5L3RA 5HZKA 1W4AA 4H9GA 2PT5A 2G83A 4M9SA 3V4RA 1W36C 4DCUA 3WNCA 4M9ZA 4MYCA 4WIAA 3U3JA 2WHXA 4OI0A 4JVNA 1NIJA 4QHYA 1II8A 4XVQA 5E95A 1GKYA 4Q1FA 2OSBA 3QKTA 3MAAC 5EE5B 1J70A 1JQJC 1FUUA 2YWEA 3VHLB 1SVIA 3AP2A 3X1WA 4UNRA 1VYTA 1G6OA 4BEBA 3TRFA 4U00A 1EFRA 1NI3A 4D0NA 1F2TB 4ASUA 3RC8A 3IIJA 1UBFA 1TUEA 1W1WA 1Z8FA 2JIZD 3QY0A 4Q9LA 5C4MA 4Q19A 4JLDA 2D2EA 4D4JA 3M4YA 2ZREA 4QJ4A 1NKTA 2IHYA 3TIFA 3FDIA 3CRVA 4QJ5A 4BFXA 4Q21A 4ZDKA 4A15A 2LKDA 1Z63A 4BRUA 3QXJA 4KLNA 4QKQA 4V03A 2HT6A 2GXSA 4JL6A 4Q1EA 3WHLA 4X8OA 4OHYA 4E5UA 2AR7A 2ODWA 5KHOC 3BIFA 5FL3A 1FQKA 1QVAA 5EXPA 4RD0A 1VTKA 1N25A 2VPPA 3JVVA 3AQ4A 2G3YA 3K70C 3CX6A 1ZINA 3X2SA 3LDAA 4D80A 3VR2A 1U8YA 3AVPA 5FBLB 1RKBA 5FOUA 2B21A 1ZCBA 5F3WB 3K9HA 2V1XA 5SZKB 2CHQA 4LRWA 3LX8A 5IDVA 2YNMA 2Q3HA 5A5GA 2HF8A 3GJ0A 4OHWA 3VR1A 1KSFX 2OG2A 3H2YA 3IILA 1JEDA 4IVPA 4P0TA 1Z0DA 2PBRA 2QSZA 5J4KA 1GITA 4Q1AA 1JI0A 2ZEJA 3DHWC 1E0KA 3QKSB 3ASZA 4URXR 3AVUA 2XB2A 1IXRC 1GL6A 3VU9A 1KAGA 1NBMD 3EASA 2F1RA 4Q00A 1OFUX 1TL7C 1TU3A 121PA 2J0VA 3DMNA 3NKVA 4LGMA 3EC2A 4TWZA 2ZJYA 2OAQ1 2F55A 3BH6A 3GLIB 4G5SA 2WJVA 1OW3B 4IDNA 4NCHA 4P4TA 1LTQA 1Z07A 3HU2A 4IHQA 5TVKA 4B71A 3PQCA 4BLTA 4DLYA 3KUCA 3QE0A 4TMVA 4XWAA 3TJZA 2JATA 3W5JA 2YOFA 2IUUA 3THXB 2OEPA 4LYFA 2FV8A 3AKDA 5JWOA 4WZBE 2XNDD 4LYAA 3HWSA 2F3RA 1XF9A 5FFMA 2HXYA 2F43A 5JCZA 2P67A 3HR7A 2FGJA 4MGZR 1M34E 2ZSFA 1QDEA 4FMCF 3U61B 4LYJA 4WXPA 4AY2A 4WA7A 3CWZA 1DAGA 3KTAA 4HDOB 1KO5A 5TY0A 1UKZA 5HCIA 1CP2A 4LBVA 4TQAA 3RRYA 2AFIE 2EYQA 2J41A 4YDHB 1QHHA 3W3AA 3DL0A 4B2PA 1RC8A 1HEIA 1I4DD 1U0HC 4KAXA 1IOZA 1BMFA 2EYUA 4KITB 5SZHB 3Q5EA 2XOKA 4ZI2A 1X8JA 4C0AC 1YZQA 2GETA 4AG5A 1G20E 2A5GA 3AF4A 5H70A 4DLSA 2NO6A 2XXAB 4TN1A 1EXMA 3QXXA 3ICQB 3MLEA 1GSIA 2VYFA 3NC1C 3GCGA 1HQCA 2IHBA 3KQHA 5EE0A 3CF2A 4KI0A 3TLXA 1WCV1 4P31A 2OESA 2AN9A 2NGRA 2ZRMA 1E9EA 3OF5A 1US8B 4TLAA 2G6BA 1DO2A 2FSGA 1UEJA 4V02A 2FWRA 5TXGA 5FI0B 1N0UA 2IS6A 2VHJA 2GCPA 5CJPA 3L43A 4HB4A 4XTRA 4LK2A 5DLQC 2QROA 4B43A 5E4FA 1CR2A 4A8JB 4M2LA 2WSMA 4EJSC 2J5XA 4O25A 4MITA 2OCBA 2IUTA 2FFAA 4L9SA 3SDZA 2KJQA 2VHQA 5J4LA 3U4QB 5FTNA 1KO1A 4CEJB 1L8QA 3K0CA 3VTKA 4F92B 3K09C 3P4YA 4LPKA 2VP0A 1OXUA 2VP6A 2ZJ2A 4AC9A 1G3IA 4AG6A 3OE7D 4B74A 3KKMA 2QA5A 3TR0A 1NNEA 3NBZC 3AVVA 1XTSA 3LBIA 5IF9A 3B60A 5FBQB 5D3MA 2V3CC 2BWJA 1XJCA 2IC5A 1XD2B 3PJRA 1OHHD 221PA 3H0KA 2JASA 3QVVA 2IYWA 4Q4JB 2MMCA 4MRSA 5JWRA 3ADDA 2VHTA 3ZZTA 2GK6A 2A5DA 3IHWA 4OHVA 5FPYA 3R8FA 1E98A 1RRGA 4FINA 4TYNA 4KV9A 2NTYC 3ZS8A 1MO5A 3T5GA 4BRWA 4ESHA 4CT5A 3I32A 5EZ6B 4ZCLA 2C95A 4LBYA 4GBMA 2BBSA 3TSZA 2QRZA 2NO7A 1ZW6A 1MKYA 4YDSA 2RGBA 4PANA 1AS3A 1VIAA 1XTIA 4WAUA 5KPDA 4RZUA 2G0TA 4LZZA 4TQ9A 1Y63A 4IOMA 4Q7MB 4G3XA 3RHFA 1LF0A 3AGPA 5KNBA 4B76A 1LNZA 3WYFA 1IM2A 2W2VA 4RCYA 1OLOA 3AF2A 1KZGB 4PAOA 2IYSA 3HR8A 2QSYA 1OXXK 1XPUA 2H92A 1CRPA 2AFHE 5FUYA 3B6EA 5C18A 1NG9A 3TR5A 4NCJA 3GFOA 4FW9A 5AJXA 5FBVB 1OIXA 4UNNA 4M9XA 1XJQA 1KNXA 1IN4A 3H4MA 2PH1A 2ZRGA 1ZNZA 1U8ZA 4QC2A 2K5UA 1E2DA 2HJVA 4FN5A 1ZM4A 3A36A 2XZOA 5CB6A 1S3SA 1W36D 4HAUA 3FTQA 3WBJA 1VG8A 4FMDF 1TEXA 4PHTA 2ZAOA 4KFSA 3QEJA 3LWNA 2GZHA 5DI3A 3QG5A 5BW8A 1F60A 4LHXA 2EWVA 4AI6A 3GLGB 3KFXA 1OB5A 2D4HA 1DAFA 1TPZA 4HDQB 1L7VC 1QBKC 2AD5A 2V4ZA 1E2JA 3EIEA 4TYYA 2ERXA 4F4CA 3ADCA 4KFTA 2JA1A 5KU1A 1E9RA 1R4AA 4FI3C 5TDHA 2D62A 1JR6A 1TQ4A 3A58B 3LO5A 4P4UA 3AGQA 2Z4SA 2PEYA 3U7EB 1FPMA 4ON9A 2IA5A 4DC9A 2ZRIA 2CE2X 2X77A 5DISB 4CZ2A 4CEIA 5F98A 4HYYA 2AD1A 2G1KA 2OLKA 3T34A 2Q3FA 4KBGA 1DVRA 1KMHB 1NMXA 2QP9X 2V54A 4WOPA 3UG7A 5JFGA 2JLWA 5DYIA 1R6BX 3IPYA 3OIVA 4ZDWA 2FPMA 1L2TA 4JLMA 5G3ZA 4NE2A 4DDUA 4HAZA 3HDTA 2Z83A 4TZ0A 1PUIA 4W5JA 2E87A 1E9BA 1X8LA 1ZAKA 3A8TA 1KSJA 2DFLA 4DLUA 4UNPA 2KBFA 2RHDA 3CWQA 3RC3A 3MRSA 2AHOA 4KVAA 5C1BA 3ADKA 2JJ1A 4DT1B 2Q21A 1G4UR 5EXTA 3GLFA 4RZ3A 1S9HA 2ODEA 2N1BA 4DLWA 4M1MA 1P60A 1Z0IA 5DHAA 4PC1A 3UXMA 4D26A 3LXRA 4KCGA 4BASA 4MRVA 4BPBA 4RZ2A 5GADl 2A78A 3SJCA 4HDCA 2V1UA 1BIFA 1R2QA 2QE7A 1CJMA 2XNSA 4X8HA 5KDOA 3IO5A 1E4YA 1OFTA 3A4NA 4GP7A 2IXEA 4D4KA 6Q21A 4PZYA 2WWYA 2VF8A 2J9RA 3SZRA 4A2QA 3TGPA 2O52A 2CXXA 2FSIA 2WWFA 4LC0A 1QVRA 2QP4A 3DOFA 721PA 1J8MF 2ERYA 4Q66C 3D7MA 5FOXA 3THYB 4XWKA 2HDNB 3FVQA 3IEVA 2OO7A 4HB0A 4EJSB 2ZRAA 4BLPA 3D3QA 5GJBA 3L8ZA 1IXZA 1U2RA 2OXRA 4JLAA 3K0FB 5KOYA 3PFIA 4GOXA 2WBLC 3DMDA 4HLUC 1E6CA 2FE4A 4A2WA 1DG1G 4O3MA 2QRNA 2G9NA 3DM5A 1FW6A 4B3BA 1IQPA 1TQ2A 3AUXA 3O8BA 1S8FA 2CCKA 2FFHA 3VX3A 2J0QA 1OH7A 5HKKA 4TSFA 2KB0A 1IXSB 1BH2A 1MO3A 1Q21A 2A5YB 4G5QA 4BGDA 1IJEA 4US1R 4AYWA 1XRJA 4MQBA 3FFAA 4ZDJA 4DVGA 4KO8A 5FR1A 3UMRA 1N3BA 1PLKA 4DJTA 5DN6D 1GM5A 1T8UA 4Q47A 1DBSA 2SHKA 3SOPA 2IF0A 3M1IA 3AEZA 4JT2A 1WQ1R 4JVSB 2NPFA 2BMFA 3O47A 4FMBB 1XWIA 3QXSA 3WP1B 2A7QA 2ZANA 3KXKA 4D2IA 4A36A 2ORVA 3PUZA 4B44A 1O87A 3SHFA 2EQBA 1P4SA 5KDLA 3K0AB 1IHUA 4JJZA 1OH6A 3FYHA 3WNBA 3C5CA 3I72A 1J8YF 2WSSA 5EQTA 4JVMA 5F2EA 3W3ZB 1NN1A 2EVWX 2D7DA 3LV8A 1KTVA 1K5GA 1KKMA 1P2SA 5FR2A 2WJYA 4IFEA 4FMDB 2GNOA 4D81A 1GRQA 2QPTA 4A8JC 2QBYA 3MWJA 2ZSEA 4ITRC 3RS2A 4QJ3A 2YINC 1GL9B 4W9MC 2VIIA 4OJKA 2MSDB 1E2KA 1U9IC 1P62B 2WV9A 3V4FA 1KMHA 1P9WA 1Q1ZA 1W0KA 3L0PA 4YC7A 1KJWA 2I1VB 2P6UA 1Z29A 3GJ6A 3P26A 4PTLA 3ZJYA 1JR3D 1KI6B 1UKYA 2REXB 3HU3A 3ZGXA 3EPJA 4Y0AA 3B9QA 2P5TB 4DSTA 3EPKA 4DB2A 2A2ZA 1T3LA 1TNDA 2W6IA 1GG2A 5DH9A 4EPRA 1E79D 2MSCB 2X8AA 4YMTA 1CXZA 2Z6VA 1SVOA 4JIMA 3KZ1E 2IUSA 3I92A 1TU4A 4NH0A 1Q1EA 4D82A 5D3MB 3CB4A 2FOLA 4Q9HA 2ASEA 2YOGA 2J45A 3SQXA 2HXSA 5J40A 4LHYA 4B32A 5JJLA 1MOZA 1NRJB 4FCWA 1Z0AA 2IYUA 1OPXA 2X2EA 3AF3A 3EWAA 1DTSA 4Q4AA 2ZQ5A 4V0ME 1U81A 2D2FA 5JI2E 1P9RA 3GLHA 4NBSA 2A3RA 1RJ9A 2QAGC 1J2JA 2WKRA 3OIYA 2R6AA 3EZ6A 1G41A 4X8MA 2BKUA 4OQNA 4EAQA 2ZROA 1G291 5KSPA 4F93B 1N5KA 5AWFC 1E69A 4X8LA 1UAAA 1JQLB 4YXWD 5KPJA 3B1VA 3L0OA 4C3ZA 1OXSC 3EA5A 1W7AA 4V0NA 621PA 4OKSA 3EIQA 3SYKA 1QHHB 4QOSA 2I1QA 2C03A 3DM9B 5CYOA 4QHTA 4W7SA 2RGCA 1XPOA 4HI0E 3RYTC 2ZYUX 4O2RA 2YWGA 4EPYA 1MV5A 4IDQA 3SS8A 4A0FA 4M0LA 1KO4A 4B2LA 2GZAA 1FNNA 3TH5A 4DIDA 2VSOA 1LY1A 4DSNA 2VLIA 4IDHA 3MCAA 4Q01A 1W2GA 2RGEA 2V7QA 4FD2A 4NP6A 3TQFA 4BLRA 4C0SA 4EFNA 2ZE8A 1U8AA 1OE0A 3TBKA 4E09A 1GP2A 2XAUA 4TYPA 4DKXA 4C2UA 3O8DA 3DZ8A 1E2HA 4HUQA 1W49A 2QN6A 3SQWA 3AVTA 4HATA 4OI1A 1HV8A 2RGXA 4EDHA 3PXGA 3WRXC 5DNYB 1P72A 1PZNA 2YC2C 1JECA 3QJYA 5DSZA 3RNLA 4PSKA 1G7RA 3BB4A 3SC3A 1QHNA 3VMFA 3IDQA 1GIAA 2WTUA 1MO6A 3QF7A 3QOFA 4BQSA 2QMEA 2R9VA 2W6JD 5C2JB 4QG7A 1E0JA 1M2OB 1R0ZA 2N46A 1PLJA 3BRWD 1ZD1A 1Z6XA 3X1DA 3RWOA 4Z51A 5TMPA 3DZDA 2BDTA 4ZCMA 4CGZA 4MH0R 1NVWQ 1P75A 5LD2C 2C04A 1KO7A 1E1RA 2I4IA 2ZS8A 2CBZA 4QGHA 4RCZA 1RIFA 1HE1C 2O8DB 2NZJA 3S1AB 5HPYB 5ANRB 4HUTA 3PR1A 2QAJA 4I1SA 3ADBA 2C96A 1KZ7B 3VNUA 1ODFA 1II8B 3AVXA 3RS5A 1NY5A 1ZYUA 4DDWA 2G1JA 3CPEA 1U0LA 1K6MA 2WJJA 3GEHA 2RGAA 3M6AA 2F3TA 4NHOA 3RABA 4D4LA 3QKRA 2ZVQX 1TX4B 3AM1A 3VKHA 4M9QA 4BFTA 1VKJA 4URUR 1GKIA 4LJ7A 4RD1A 4TYQA 3L2OB 1TEVA 1WP9A 4TL8A 4PPNA 2CLCX 3NBXX 4Q4JA 1JXMA 4KLZA 4TL6A 4QM7A 3KQKA 4JKIA 3CR7A 4JBXA 3C15C 4MYTA 3GJXC 1NLYA 1R0YA 4DDVA 4BFYA 3TUZC 1E79A 3WMEA 5JEEA 3UPUA 3AVYA 4QBIA 1DO0A 1OKKD 1G8YA 4C2TA 3C5HA 4Y0VA 1S0UA 2QT0A 1HT2E 2JLQA 3Q7PA 3R7WA 1QZXA 3THOA 3BFVA 1ZM9A 1H65A 3NG1A 2B6HA 4N3NA 4BZXA 3HYTA 4P32A 4KSCA 1AZSC 3SBDA 4ARZA 2A5FA 3FPAA 5AJVB 4LBWA 3GLGA 3R9XA 3I73A 4B35A 3THWA 5BN3A 5EP1A 4UQOA 2BVNA 1JJ7A 2HCJB 2ZJBA 3UKDA 3E70C 2OAP1 4PHFA 4C0JA 1M7GA 4GDFA 3JVUA 5FOTA 2XB4A 1J90A 3W6NA 4ABYA 3THYA 2GCOB 1YR7A 1DOAA 4JSYA 1RRCA 4TLDA 1YR8A 4NZYA 1F5NA 1N5IA 1XMVA 2Q9CA 3MD0A 4HLCA 1ANKA 2X1VA 3GFPA 3IEUA 5H8WA 2CNWA 3KB2A 1E2MA 4ARZB 2ZRNA 1OYYA 2DHRA 2OCPA 4DLTA 1AK2A 4B34A 2VH5R 3HPQA 2BM1A 1IN8A 1P2TA 4XSGA 3VR6A 1C4OA 3C8UA 1SVKA 2OLJA 2RCNA 3G5UA 2KBEA 2P0EA 2DFTA 1H8HD 1BYIA 3FB4A 4ZKDA 3F3YA 1ZD8A 3ZZUA 2VEDA 4KSBA 1W0JA 3Q3JB 2O8DA 2W58A 2XTNA 4OQXA 3B1ZA 3BFKA 2WJHA 4JLJA 2H5EA 3K53A 3KKNA 3VKGA 4MRRA 1ZU5A 2J3EA 1G5PA 3RAPR 3OIWA 3FWYA 1G8PA 4CRWB 2O8CB 1P2VA 3TVDA 2VO1A 2ZU6A 3QUSA 4O2LA 5B57C 4LCBA 4U7DA 3WYGA 2CEAA 1JAIA 2QQ0A 3CR8A 5BYJA 4Q4LA 2ZRBA 1VCOA 5JRJA 5FTLA 5JHGB 3RWMB 3SJAA 3GLIE 1NBMA 4A6XA 4OQLA 1CKEA 3ZVRA 2BHRA 1YZTA 3A1VA 3IBGA 2DWQA 5CYPA 2W2TA 4D4MA 3AUYA 1KI7A 2O0JA 1XXHE 2GTPA 3PUVA 4PPGA 2IS2A 4Z8YA 2GXQA 4AD8A 3UMSA 4XTCS 3ZVNA 3SJBA 4HUQB 4KODA 4P3YA 5AJWA 3TKLA 2XJ4A 3NWJA 5G41A 3W9YA 2PCJA 1F3OA 2H1LA 5E7JA 3DVLA 1UEIA 1W4BA 1ZJ6A 3EIHA 1IAQA 4A9AA 2JGNA 1KI4A 3PCRB 4DB4A 2ATXA 1K5DA 2R8RA 2DCUA 1KNQA 2XNDA 1Z0FA 2TMKA 1XEWX 1YU9A 4HB2A 4RD3A 1CR1A 2JJ1D 3SE0A 3C16C 2ZAMA 3IPXA 1ZUIA 4C9BA 4W5WA 4TYWA 4UJ3A 4NYIQ 4U5XA 4AK9A 2R2AA 3OAAD 5JBQA 2IX3A 2ZETA 1OIVA 1MRSA 4TTRA 3VFDA 1AQUA 4I1OA 4Q4AB 3TAUA 2CE7A 4FCTA 1BMFD 1S9DA 3ZD7A 4DCVA 4ZIRA 1NSTA 2JAQA 3T06B 3K70D 3X1ZA 2BOVA 1CLUA 1A7JA 3F0TA 3FMPB 3SFZA 1DAIA 4LBZA 4B3CA 1E2EA 3Q7QA 2DY1A 3MMPA 3TUIC 3PV0A 3R7WB 1UDWA 5AK0A 3SHWA 3CLVA 3I5YA 2F9MA 3GD7A 4S35A 4FXPA 3R8CA 1EESA 3JZAA 3HP1A 3CUEF 3RS4A 1FUKA 3MSXA 1GRRA 3A1UA 3BORA 4C7OB 2ZJ5A 4JYBA 1BO6A 4QL3A 4KYUA 5JMTA 1XTQA 4RKEA 1FOEB 1E4VA 1CS4C 4M1TA 1TTTA 4IDOA 4Z1MD 4QNRA 2CVFA 4MYUA 4FCVA 4FWTA 5C4GB 2VA8A 2QORA 1KI3A 4NTZA 1T6NA 3FE2A 4NYJQ 2QMHA 1JAHA 1PJRA 2EWWA 5GJCA 3Q8XB 2ZU0C 2IS1A 5E3HA 4BFWA 1NVVQ 1DAHA 2RKOA 4Q9IA 3ND9A 1W4CA 4R2HA 2VL7A 1T0JB 1G5RA 1XTRA 1NMZA 4OQMA 2X19A 3NIBA 4HB3A 2XSZA 2C99A 2D06A 2QENA 3HYRA 4LJYA 2CL7X 4A82A 1XP8A 1ZRHA 2AWOA 2ZRLA 1ZM2A 4M1SA 1G5TA 2QGZA 2NO9A 4YLGA 1H8HA 3IQXA 1YQTA 1HTWA 2XOKD 1CTQA
chains in the Genus database with same CATH superfamily
3USCS 3TSOA 4ECAA 1U3UA 3AR2A 4TMYA 4HF7A 5HG0A 1ZRMA 3CRRA 3SWWA 4C6RA 1D2NA 1AGPA 4TXLA 1QVZA 3STWA 3DMFA 4X90A 4LV8B 3MFYA 4EG7A 2WPNA 1ECGA 1MP0A 3E7DA 4RWZA 5JOQA 2P9BA 3B5JA 4JUAA 1JW9B 4AP9A 4NYJR 1G8MA 2R4UA 3BDAA 3I6QA 5TQ2A 1MEOA 1VJGA 3BJEA 4KMOA 1ECCA 4A3SA 4EABA 3TMKA 1OREA 2XH8A 1I0IA 3D0KA 4LQDA 2QVBA 3DTNA 3PPYA 2I2FA 4G09A 4YO8A 5TIIA 1QP0A 1C7ZA 2GWHA 2NW6A 2OHXA 3NKFA 2I66A 4EO4A 3K9NA 2A5LA 2X9NA 1HE3A 2ZTSA 2Z6UA 4H31A 2D8AA 2PZEA 3KC2A 2W2XA 3N28A 4L5BA 4D57A 1CUGA 1T9GS 2DH6A 2G25A 4IGIA 2QLJA 4WZAB 3UHJA 3V3TA 1HE5A 4Z7OB 4NXNB 3I2YX 2X5NA 1NX9A 1CJVC 5CCDA 4CQMA 4EEXA 3W34A 3GHHA 5A4AA 1SU8A 2YV4A 2IPAB 3UT0A 2IQIA 1FX0B 1T36B 4HK4A 5FEMA 3OQ1A 2FQWA 1EK2A 4PGMA 2Z9BA 4Q4HB 1EFHA 2I3BA 4U3JA 2EHDA 4M7OA 1V96A 2F17A 2J87A 1A0OA 3IIMA 3OEHA 2OGTA 4MR8A 1EP9A 3IA2A 1K63A 4QQNA 4QRHA 2LUOA 3L7LA 1L1RA 1ZNWA 3ZCSA 1E2BA 3H5NA 4URZR 1SXHA 4ND2A 2FRVA 2I6TA 4BVLA 3TZKA 2HC9A 3FSEA 1JZSA 2AI2A 3SLGA 3DE0X 4WACA 1PJAA 4ZU6X 4EY7A 2FDXA 4LCJA 4C07A 1OWLA 1TMGE 4EFLA 1X15A 4DDTA 5EMLA 5MDHA 2GAAA 3TW4A 1WG8A 1AGXA 4RVOA 1RBYA 2VK2A 1MN6A 3HKEB 3PK0A 4UBNA 3ZZ0A 5BSVA 5CB8A 1Z6TA 3O4IA 5CNKA 1ZG3A 3OG9A 2JLUA 4GKVA 4D0SA 1A4RA 1S2LA 1W85A 1YJXA 1TAQA 2AC2A 4DBZA 3QWFA 5IF3A 4RTMA 1H9BA 3KV1A 4HADA 2BONA 1NAIA 2QI9F 3DHNA 3PC3A 3PUXA 3IL2A 3EFBA 4YO7A 3Q7EA 4COOA 3SKVA 3D8UA 2OENG 3AJEA 5E6RA 3VTZA 3G6WA 2RHGB 3M89A 1P1CA 4FLFA 4ND8A 3PXDA 4UAGA 5HW0A 5IWAB 1NUSA 5TLSA 2IOFA 4FPXA 3TTVA 2RHLA 5CMLA 2V8OA 4B1FA 3M4XA 5JJ5A 2GXAA 2OFWA 4TKVA 2GM9A 2BEVA 2DFKB 4PSAA 1J56A 4HBGA 4Q7EA 1AKMA 5G0TA 3W2IA 3OURA 4IGAA 3CCBA 4MVJM 1G9TA 1KH2A 1NUTA 5DXFA 4IDCA 2OQVA 2XDQA 2FFBA 4CQLA 2P6MA 2ALJA 2X0EA 1I2MA 2HRDA 1Q3HA 1NOJA 2KWIA 3KDSE 4AMZA 4BJHB 2ZYWX 3GJ5A 1NPYA 3NTVA 1M0WA 3QBVA 4Q3BA 2HUNA 5JCJA 1FMCA 5LDGA 5BXQC 2QM0A 5JS7A 2QM8A 3S8YA 3OD5A 3HCFA 3BMOB 3L5OA 5ULLA 2AKAB 4BECA 1GZSA 3L1VA 3CW9A 4PBSA 4YJFA 1Q1QA 3AI2A 1Z4LA 4D96A 2W6MA 2WJZB 1A5SB 2FSVC 1GGFA 1FTYA 1NKSA 3G9UA 3HDJA 1F6DA 3KJNA 1TB4A 1BWSA 2YZ2A 1DEHA 5JSYA 4UMVA 4KXQA 4C4OA 5LBUA 4ALIA 2Z8XA 3DNFA 2NU8A 3PLAE 3KKQA 4TRJA 3NH6A 2VPZA 4CN8A 3ECCA 3ONWA 1GAWA 2QL6A 5KOJA 4AKHA 1HC7A 4WY8A 1H2YA 4WKNA 2GVZC 4G4IA 1KMNA 4F4IA 4LECA 3ZV5A 4QDZA 5DT2A 2VRNA 1ZUNA 4OPMA 3K92A 1KE1A 1E1RD 5TV2A 1ADGA 5H9WA 3H2JA 4RDCA 4NCXA 3PEYA 1P4AA 1FU4A 1YC5A 2E49A 1K66A 2ETVA 2XCOA 3CNHA 2Q5EA 2AXNA 4YPFA 2QMZA 4ACAA 1O9HA 1OZ0A 1FLDA 1R10A 3BDIA 4IRUB 4XM1A 1NVXQ 2J46A 1E3SA 1RP7A 2HHCA 1YQEA 3A1CA 4FBLA 4BFLA 2FK7A 1MR3F 2JFNA 4IHJF 4Q4DA 2IYEA 1KAHA 3LZ6A 1QTNA 3A6LA 1R5NA 2NVWA 3S2UA 1T1GA 3JQCA 5JWHA 2QBYB 4J7UA 4JX9A 2PPVA 2PL9A 2DWPA 2C61A 2IK8A 3IBYA 4NONA 1JPNA 3GLQA 1THZA 5KKCA 1VCIA 2EQAA 4LHVA 2C5HA 3K0HA 3TEFA 4BAGA 7ABPA 1AU9A 1DRKA 5D01A 5HP4A 2CNKA 4F5EA 1NLFA 2YRFA 4PAMA 4R84A 3CF4G 3T15A 2ZRHA 3GDOA 2QN9A 3HN2A 4RJLA 1KQFA 2HLHA 4AROA 1MENA 4BAZA 1YF3A 2UAGA 5LQKA 3DR3A 4DPMA 1PR1A 2F1HA 1NM5C 1DXYA 4I3GA 3GFTA 4AUMA 4A0HA 2VAVA 4QJIA 1BC5A 5A06A 1E1LA 3KO8A 5B30A 2LR0A 2OHFA 4E5NA 1M74A 2AVDA 2F6RA 3P27A 4GNKA 4QPZA 5J43A 2GLTA 3EZGA 2X8JA 4BWFB 4BCDA 1FX1A 821PA 3HBFA 3RSGA 3N07A 3CRW1 4FFDA 5DHRA 5ENDA 2OYCA 3TIGA 4K2HA 1SCBA 2W6ID 2CUNA 2NZVG 4PZDA 1FFXB 2GNAA 4R69A 1NR1A 3L82B 4RPJA 4XAQA 3OLXA 1NMQA 4UTPA 5EZ5A 1XJWA 4NYMR 3LP5A 4N5DA 2HFJA 2E6UX 4G2NA 3DT8A 3DKVA 4NZZA 4JJEA 5FPTA 4UVDA 1DKLA 2HO5A 2CEKA 2V97A 2VCHA 3CNBA 5CB0A 5J4VA 2QZJA 2WZBA 1NF3A 1P61B 3BB3A 2I8CA 4TRRA 4WXRA 2GK3A 2JFVA 2WABA 3KR9A 3WK5A 1QG4A 1T6ZA 3IEMA 1Z4JA 1AKWA 2AZTA 4MO2A 4MWSA 3VI4B 4I6JA 4R40A 3WLTA 2QZPA 4R7GA 1G21E 1PV4A 3BE8A 1VG9B 5J5CA 1X86B 3UMJA 5DWDA 5B7GA 3M0EA 3VZBA 2YYZA 1T8YA 4YMUA 5I9IA 5F9HA 4H7HA 4Z4EA 1B42A 2F3UA 2P6NA 5J2TB 2EBFX 3C3MA 3E3NA 3I1YA 5ELLA 2YZ7A 1ZHOA 5IHPA 4MI1A 3Q98A 1W2HA 2ZTHA 1W5EA 4RHUA 5E1OA 5LP6B 4NOLA 1E5VA 2X9GA 1D8AA 4IIEA 3JWEA 3ORQA 4YQYA 3B6ZA 3TIIA 3O3MB 2OAGA 4KRYA 3ZZMA 3IQIX 2OE2A 3ESBA 4BO5A 2LTAA 1U0EA 1J00A 2AE1A 4JU8A 5A4MS 4PLVA 5JSUA 3STUA 4BO6A 1SUBA 3U4QA 5KYWB 4FZVA 4ZJUA 3ZHSA 1ZA1A 1ODSA 2YWHA 1W2WB 2ONYA 4J0FA 3SQOA 2SKEA 2UYQA 5BMOA 2QG6A 4NAHA 1GTMA 3PRHA 4NE7A 4QAQA 4BB6A 2VCEA 4GQIA 3ZU6A 4GH5A 3RAFC 1QH1A 5L95A 1OIWA 3W4IA 3I5AA 3EC1A 4CUZA 2G82A 2X41A 4YMLA 1QRRA 2JB9A 3OZGA 4QTUB 3QBJA 2G06A 4OUDB 3QWIA 5ELMA 3UMCA 5M29A 3KFVA 1US8A 3IIKA 3LGAA 4DSZA 4CDMA 3VR6H 1H69A 2PX0A 3RROA 3UBMA 3QBDA 2BCJQ 2G36A 4R9SA 5EXXA 1J7JA 2DPHA 3COJA 1GFIA 5DOVA 1TKAA 5E6SB 4UXHA 3S99A 1UH5A 3GJQA 3SKYA 1EVIA 2NXWA 3T1VA 3UT5B 4LNHA 4B6FA 1X9GA 1LZKA 1ONNA 1XROA 2OHJA 1A2QA 5F33A 1TKCA 1Z4MA 1I33A 3IEXA 4IZ6A 3KQUA 4HQFA 4I1IA 3WSWA 2FMIA 3A26A 3LVQE 3ROFA 4DXAA 3CF0A 4TV8A 4G0VA 1RRFA 3NAZA 3QPVA 1PFGA 2E18A 2WKQA 2RK4A 2ZPTX 4QHSA 4XA8A 5COQA 3UW3A 5C46F 3C41J 3UJPA 4ENSA 3O1HB 5A2QA 3LF2A 4MGKR 4ZOBA 1SG9A 3EIUA 1EZ4A 5ITZA 1CU1A 1OUMA 1AXGA 3L0SA 3C97A 1I3NA 2JLZA 1HNWB 4G0XA 1XRLA 3KS9A 5CEJA 3KZXA 2VH2A 4AUKA 2WF9A 3KBOA 3L0CA 1K7YA 1GTRA 1G20B 4CG0A 1QC5A 1VFPA 2QMUA 3C6BA 4J0IA 4ASUD 4D9GA 3ELUA 4GPIB 5C8YB 2JJ2A 2IOYA 3MWKA 3ONFA 3T4UA 3U3KA 4E03A 1I7PA 3VNQA 1ISRA 4DPKA 4V0MA 2R87A 3UK1A 3O8OA 4DRXA 2ZULA 4UDXX 5C1PA 2O5EA 4UD2A 1M1UA 1SVSA 2OV2A 2ZUBA 1JDSA 3TOVA 3DWGA 3OMLA 4W1QA 2A30A 1UM9B 1AIPA 3FHCB 4ZGBA 4C30A 3OKPA 4ZOLB 1GGHA 1DKUA 2HQOA 2CFIA 4YT2A 4J7XA 3ED1A 5KOIA 4RMHA 3NHJA 1M34B 4K9RA 3GLUA 4N7BA 4Y2QA 4BEWA 3MUFA 4URHA 2INGX 4US2R 2JA2A 3V00A 2D8MA 3BF7A 3ISTA 2BKXA 3N0WA 4KK4A 3FLMA 4F3CA 5CT9A 3U7FB 4N0MA 1H22A 3OCWA 2GJ4A 4MRPA 4LK3A 5MGBA 1IBCA 2W11A 3EJWA 1ONOA 1ZN9A 4Y1GA 2NSHA 3X2EA 4OBWA 5CFPA 4P0PB 4NFYA 2RB4A 1FP4A 2DYKA 1NXOA 3HFRA 3Q12A 2L82A 2B2NA 4EFDA 4DSAA 1XCOA 4OMDA 2O23A 3AEXA 5DGCA 5ALTA 2GOYA 1OPRA 3JQ6A 4NNPA 4O4IA 4BU1A 2P5SA 2HT1A 1U2GA 1DBQA 3LW8A 4FGWA 4OFXA 5B6PA 3BL5A 5LSAA 1U2PA 1T8RA 1NVVR 5K8TA 2PZJA 3VJLA 1D8TA 3ZE2B 3DEZA 3BEOA 3ZLJA 3RU7A 3KL2A 4R81A 2FPKA 1Q19A 4L4ZA 4LOAA 2JAXA 5EHQA 5C0OE 4AY6A 5JYDA 3QPWA 4C4TA 1CBUA 2W2LD 3ZQJA 1V5WA 3OPVA 1QF7A 3NTOA 3PU6A 5CJ2A 1JG7A 4JY7A 4JUFA 1MT3A 1Q74A 3OP1A 3KOXA 2HJWA 5GONB 3RU9A 3GEGA 1RLUA 1VQ1A 1ZUD1 1C9MA 1ZS9A 4QDOA 1H05A 3GU3A 1NZJA 1Z2NX 2IITA 1JLHA 2FNAA 2H85A 2CVPA 2XV1A 3DP9A 1JYEA 1Z22A 3FZQA 4JDPA 4MW0A 4P8RA 5FTJA 5K3FA 7AT1A 1RQRA 5HKKD 3GRAA 2XUHA 1DXOA 4V2UA 2ICAA 4CLOA 4YGXB 3BWXA 2XOEA 4P4NA 3DUWA 3FI0A 1KO8A 4L3OA 4CUKA 1NNUA 3IT3A 4XGRA 1GTG1 3IX7A 1V6SA 3EZ9A 1EWQA 3FOAA 3LZDA 4NSNA 4UREA 4XH9B 3THWB 2P4HX 4LNUA 1X1SA 2W2LA 5F5XA 5M04A 2AN3A 1EH5A 4MUKA 5A1TA 2VS1A 3QI2A 5SZIA 2B3DA 2NX2A 2B98A 2E2WA 2ZIVB 3VUFA 1E92A 1KSHA 2DU8A 4U7TB 1WAMA 1UP4A 1TCUA 2H00A 4P08A 4MQ5A 5C5EA 4IIJA 3HWRA 3QYAA 4G63A 4PW0A 3DCYA 3OZUA 4CDNA 5DBEX 4DIUA 3BWDD 1GPH1 2V7WA 2ZI9A 1Q7GA 4E32A 5CA0F 3PHLA 1MH1A 1UT5A 4FKMA 4U7HA 5LD2B 2OC9A 4TV9B 4JKYA 3C98A 4S2UA 5ALPA 4NECA 3NAGA 1LU9A 1XB2A 1KFBB 4JASB 1MCZA 1MZVA 1OV4A 1ULTA 2BHSA 2PGJA 1UBTS 2YJ4A 5KTMA 3LQRA 2H2GA 2DFVA 3R7DA 3WLQA 3L6DA 2MINB 1R4NA 1XOIA 2GBLA 2OCKA 1K7EB 1GVNB 3GAMA 3R24A 1FUIA 2N9UA 3AR5A 1EK1A 4BKOA 3FPLA 3O4FA 2O6LA 4B6PA 3DHVA 4KIFA 3PL5A 4EPTA 3ADPA 2CL0X 3CUSA 4IIFA 1A2BA 3F5FA 5IKMA 1BU8A 3P8ZA 5K7SA 4GKKB 1EFTA 2BEUA 6CHYA 4I5GA 2F7SA 1JR3A 3CKKA 1VKZA 3FPGA 3OLVA 3T1OA 1DMSA 1L4GA 3U9TA 3NIGB 3DBLA 1I2AA 3UO8B 3QV2A 3NRJA 1C0KA 1RM3A 5JZMA 2O7NA 4K6KA 3A3OA 1Z5GA 2RGRA 1TTQB 3FA2A 3HYLA 5DHTA 4W5QA 3OFSA 2FQQA 2PJZA 2E1RA 3P19A 5DCUA 1KAQA 1E5LA 3NTQA 1MQAA 5CGQB 2E6KA 3JTMA 3IUJA 3TZLA 3ZHRA 4L08A 3PC8A 4GXQA 2BP7A 1I6LA 1WCIA 2R5WA 3TSYA 4UBJA 2R25B 4KDCA 4EKYA 4OLAA 3PEVA 3OETA 1G2OA 2HWUA 3QP9A 4G0PA 3R5JA 4RK7A 5E0OA 4NX2A 1O0BA 1EUYA 5TEVA 3H17A 2MSNA 1W59A 3L1JA 2RC5A 3ZHZA 4LF8B 2C7VA 2BT4A 2Q6VA 1N5DA 2APJA 3IOMA 2PXXA 3ILSA 5E1BA 4EJ0A 4HWSA 2VRWA 1TCCA 1UDCA 3KR0A 4WUVA 3ER9A 2YASA 3C3KA 2FKAA 5FKJA 5M5BA 1UIRA 1WU8A 2L42A 3EYAA 1TK9A 4EB6A 1QORA 2BF4A 3O8RA 2RFLA 3BQNB 1T3HA 3U62A 5KVQA 3P7MA 4XR4A 4Q9KA 2IY8A 3RKRA 2WAYA 3ZHQA 2NV6A 4QQ8A 1V8FA 4N82A 1XVVA 4LDNA 4N3GA 3OCVA 4Q1BA 2OV1A 3GLSA 1QHIA 5GQSA 4PZEA 3NGXA 4LQLA 1TFRA 1ICIA 3SXJA 4FMPA 2W2MA 3PPVA 5JH7B 4CM3A 5DMXA 4P3PA 4YMWA 2HWXA 4D43A 2DKNA 2QLFA 2HK7A 5HXAA 5JNSA 3QVLA 4P98A 5ECGC 1ZC4A 1TRKA 3A1FA 4FW8A 5IJAA 4OVKA 1L0BA 1P6UA 3ESQA 4DLZA 2V7UA 2P1RA 3KOZA 1OX5A 4CM4B 4F5ZA 1DIAA 1ZC3A 1MA0A 4RMIA 5DGIA 1Z13A 2WIJA 3MOGA 1T4CA 4S1WA 1IZ9A 4M4SA 4LYYA 3REQA 4EW1A 4QUJA 2A6PA 1U9JA 2A14A 2NXNA 2VJOA 2ZYRA 2AOTB 3E5HA 4HEA6 4UDNA 5EERA 5F77A 3ZK9A 4BAUA 1TVEA 3SS7X 1XAJA 3QY9A 2Z08A 1WXGA 4G5RA 5DI9A 5EFZA 2QV0A 2OGUA 4G0QA 3DFUA 1AMOA 5AKKA 4YV0A 4UPDA 5FOVA 2WWGA 1OFHA 3DPIA 3DNMA 5B7PA 3ZD6A 4FWIB 5DN9A 3F6SA 2V9ZA 4B4UA 1XALA 3KHUA 3FDZA 1FLNA 3E22B 3H5OA 4MGIR 4TT3D 4IEEA 4LX0A 2CDBA 5ALRA 3U44A 4IMPA 1RM4A 1GCUA 1FVHA 2FTKE 1WIWA 3G5MA 1WW8A 2CJPA 1EFCA 2FWMX 3IA7A 5T4EA 3ETLA 3MJFA 1RM0A 2X4DA 1SQSA 5AI9A 1J9GA 1XZGA 2YY6A 1AGYA 3UAVA 1G8FA 1K3TA 3W5VA 3ERCA 3GPIA 1ZUHA 2C2ZA 1AD2A 1SQGA 3HEMA 3FYUA 3JARB 5BNTA 5K45A 4KFRA 4WZBA 2GRUA 3RVPA 3SYLA 4DLVA 5P21A 1GQRA 1RXSA 1DEXA 1PLLA 3BZUA 3RS7A 1KI8A 4N0PA 1V3TA 3IHLA 3IP1A 4C6TB 3C7AA 4UAVA 1Q5PA 1ICEA 1H1TA 3O74A 4AQDA 4CQMD 1C29B 1JR6A 2O0KA 3EVNA 4G9BA 2HWYA 2G72A 3PHBE 4L8WB 3JATA 2XR1A 3GEEA 4WW0A 3GDGA 2VBIA 3NC4A 4NABA 3DDWA 4K46A 5FFFA 3UJ9A 4MVWA 5JFTA 2BIFA 1S7GA 3B2EA 1RLIA 1GTL1 1KS2A 1P1HA 2FY8A 4WLOA 4DLXA 3O5AA 5C7IO 5IKXA 1TUBA 4PRKA 5IVKA 4JT4A 3OECA 2ECKA 1AZWA 5HQTA 4YMSA 5KOHA 1AY0A 2BC9A 1D0VA 4C3VA 1KFJB 1Z26A 3KR1A 1YGPA 1XZFA 3A3NA 1MG5A 1YB1A 3WKEA 1L5MA 1D1QA 1E5XA 3FR7A 3HE3A 2EGGA 4IF4A 3T95A 3W8RA 4TL7A 1J8QA 1G8AA 3T1QA 2ZBVA 1Q3TA 4KAJA 3IESA 4IVRA 3DZBA 4UVHA 1ULSA 2QI9C 5FLXA 4W8OA 1YZLA 1V0JA 4DNPA 4RY2A 4GMDA 5CDHA 3K7EA 3EXFB 4PR0A 3BSYA 4M0KA 3L8HA 1P3JA 5LA6F 2UZ0A 3RV3A 3D3JA 4JEMA 1QNLA 1CR0A 2A1TR 2DTDA 1P7ZA 1ULAA 2OILA 3CBQA 2CLDX 4KLCA 3KOYA 3CCFA 1CZHA 2H7YA 5E9AA 3VHXA 1U3DA 2C9DA 2Y4NA 5EQJB 4ES6A 1NQTA 1VMKA 4PSCA 4YK7A 4K1XA 4RHXA 4NR0A 2R3SA 1ELOA 3FBWA 4Y6SA 3RW9A 3P9QA 4C78A 2YHAA 1FB5A 3LHDA 4QFMA 4ZHQF 3WSTA 2XTMA 3QK7A 1VPTA 4HAXA 2PH7A 4ZOLA 3WE7A 3GIDA 2ZSHA 4CKYA 2XTZA 2VJMB 3VDXA 3QHQA 4JXKA 5T64A 2WDZA 1YT5A 1PV2A 4HWPA 1CR4A 1B0ZA 1M5TA 1YZHA 5GVRA 3WLAA 1K1EA 3HO8A 3X1JA 2AUNA 2C59A 5A4JA 1FEZA 2EAUA 5G1NA 3TRDA 2PBLA 3C3AA 3Q7RA 1O4WA 5K0TA 3T3OA 4FHDA 5HCNA 2ZUDA 4WK6A 4BFUA 2R1UA 1XZCA 2YJZA 5C3UA 3DTVA 3I39X 3MQ4A 3RODA 5AR1A 3I30X 1REQB 2QLLA 3FETA 2REOA 2GBCA 4DUGD 4YAOA 3ZI0A 4OP3A 4IGFA 1LKZA 1TUIA 2W8BA 1ZJWA 4H2DA 4DXHA 3TZEA 1P74A 2CHVA 5G0WA 1M75A 4JLBA 2PGLA 3FNRA 3SE7A 1BKYA 2HIAA 2OWEA 4A10A 4AKGA 3P9KA 1XTKA 1I7NA 2P65A 3CPJB 3EUWA 4YJ2B 5EIBC 1EDEA 2XQKA 2YDXA 4ISBA 1CJSA 3RUPA 4CL8A 1LPAB 3RK4A 4C5CA 2FN3A 2REBA 1SULA 3ZWWA 2W6NA 3MVEA 1X7YA 4EF6A 3HNOA 3VC1A 1DEAA 2WZQA 1WO8A 2Z5VA 4OU5A 2H7VA 4IMJB 1CQJA 2XEXA 2ZIEA 3ACCA 4PLZA 4BMPB 4CTOA 1XNRB 2QUZA 3TFQA 1PK7A 3H13A 3JALB 2D13A 4LY3A 4OEHA 4B7ZA 1KDPA 4PLTA 4RTLA 1C7JA 3ROZA 1EHIA 3OJXA 2PX4A 3VDNB 3HXQA 5HM6A 1YKSA 4RH1A 1J9EA 3BBPA 5KQGA 3NC0C 1Y48E 3FWKA 1QKIA 3OIDA 3HMKA 1DJLA 4D0GA 3VV2A 4B85A 3TSWA 3ER8A 4EJ2A 4RKRA 4Y2YA 1ZWLA 4RD6A 3FOFC 1NG1A 4MRMB 2FWBA 1FBNA 1KQ3A 2IRWA 3FAKA 3SU8A 3OZVA 1DO8A 4TWIA 3GBVA 4NDNE 1XU7A 5BSTA 3SSOA 4AVYA 3EVAA 1E9DA 2GESA 1RPAA 4HX9A 4KBFA 2VTDA 4QVKA 5ALSA 4A7PA 2QRKA 5KYWA 1ODKA 4MKRA 4LG1A 1JDTA 1JDZA 3NBFA 3NBUA 4YPOA 1H6DA 3KKOA 2QUAA 4LRXA 2BBOA 3BXZA 3K8ZA 1W75A 1FF9A 2CVQA 4QUBA 3GFSA 1X92A 2QNRA 4QX6A 1P8AA 3A31A 1GZ3A 1P91A 3Q1LA 4IVQA 4N0QA 4H6PA 5B3JA 2CJWA 3N0VA 3LPCA 1CE8B 3RJ9A 3NDIA 2BTEA 4L85A 4LXTA 3IODA 2BZGA 3CZQA 4Z3DA 4ACBA 5IHXA 3VXKA 4C0QC 2WLTA 1ZIPA 5K0ZA 3E3AA 2K2WA 3KQQA 4OHOA 4BVKA 4E15A 4MA4A 1KP2A 1CLEA 3C87A 1DBRA 3C74A 5K03A 2O54A 1ZKDA 4RORA 1LJ8A 4O4IB 2BKLA 4IR7A 4OHXA 5DMHA 4E7PA 3GFFA 2Q6TA 2CKMA 1SKYE 2HB6A 4P3OA 2E5WA 1CRLA 3T7AA 1YL5A 1Z62A 1VMIA 1W30A 3KJFA 1BX0A 3GUUA 4DIEA 4OQFA 1R37A 2O1SA 4G5GA 2Q3BA 3K6SA 3TPCA 1TK3A 1IBMB 3S3TA 2GJ9A 2H59A 4XW2A 2B3TA 1F38A 1ODJA 1WL8A 5DPMA 1IU9A 2CLLB 2HJ9A 2ILVA 2WE8A 2WP8J 2IYVA 3UMGA 1FJGB 4XXHA 3PVCA 5FOWA 3OQJA 5BOSB 2AEJA 2DR3A 4DGSA 3AF6A 2SECE 3I61A 2QQEA 1O95C 3PCTA 4GXTA 3MJTA 4OM7A 3B3QA 3RSOA 1LS1A 1WXEA 4D3ZA 4EGQA 4D6PA 3LP8A 2MSWA 3R77A 1NATA 4BX2A 3IAS1 4MKGA 2GRJA 2G4VA 2F1IA 2O5RA 4P7GA 2CCJA 2RCYA 5C37A 2GILA 1DX6A 4G5FA 4R05A 1YV9A 2R8YA 3OTOB 3EEFA 3T35A 2Q99A 3I5MA 5LP6C 4RK5A 2PLAA 4Y67A 2XUPA 3N3AC 4LW8A 5BV0A 4M1OA 4Q9JA 4DCCA 1T4CB 3K9WA 3BZWA 3WHIA 2HBZA 8OHMA 1JQEA 1VSQA 3N6VA 1CY2A 3NNDA 1EP1B 1IOLA 1E7SA 5F4BA 1SGWA 3NCTA 3QBTA 3UUFA 5IMSA 3QNUA 2WIAA 1ZR2A 1T35A 3L4EA 4AN4A 4JLVA 3WTBA 3TGLA 4YUWA 3G0HA 1JIQA 1OAKA 2I65A 1TVCA 4IV5A 1J7KA 4F2DA 3IBTA 2C4VA 1GQYA 3ABQB 2UZIR 1KI6A 2F64A 1W0JD 4JS0A 1T34A 4MQLA 3ICWA 4ZOCA 5J4YA 5EE9A 3GG2A 3DL2A 2EGHA 2GPBA 3HEAA 4GPZA 3PUWA 1UBOS 5FAXA 3DMGA 1ETHA 2UXBB 2C9CA 1QTIA 1V47A 3ZX4A 5ECWA 3C3WA 1TECE 4M0MA 1ENOA 4YRLA 2QTMA 1N8NA 1SCKA 1V43A 2HRBA 4LXUA 1RXUA 3BAFA 4XE5A 1MF7A 1SKYB 3PC4A 3JD3A 5JVDB 3ET5A 3KTDA 4ZVVA 2FPLA 4KFUA 5EP2A 3HBJA 2W37A 3CO0S 2RKBA 3GZNA 4QD3A 2ZQZA 5DO9A 3FTEA 1NDQA 3T0FA 1BAPA 3ROQA 2FWAA 1W0KD 3E35A 1MRZA 3GAAA 3JW8A 4KE6A 4PYJA 1O5OA 2AG5A 2FSHA 4XVCA 1ZRSA 2NPOA 3ENVA 1XMIA 4MVJE 5K3BA 3Q2KA 1BXZA 1N8KA 3LIIA 3PC8C 3WAGA 2C1XA 1KJYA 1F17A 2Y0BA 4LDJA 1R88A 2IT1A 4P4GA 4MA0A 1DCTA 3T54A 4EJFA 3QVUA 3K1JA 4OK6A 1Y3DE 4CDGA 4U6NA 3AFNA 2QTLA 4TTAA 1T0IA 1R0BA 2WD7B 3IOYA 4XJXA 4ZO6A 4ZD6A 2G7ZA 2DCMA 3OPNA 3T1NA 1WB9A 5IAAA 2IZ7A 2WFLA 2WHPA 4UCQA 5JXGA 1V95A 1PBTA 4QSMA 1Z12A 2B61A 2YMPA 1EAYA 1JE0A 2QY6A 1GG9A 1T2UA 1Q2XA 3OIFA 5B53A 1XNJA 1M2HA 2B7BA 3RQSA 1X6VA 3H5VA 4L9WA 1SBZA 3UJCA 1SPBS 2ZRKA 3ZE9A 4G1MB 3KXLA 3N05A 2V45A 3IPRA 5PGMA 4XQ0A 5K01A 4BEVA 1IJFA 5K8CA 3U16A 3AH8A 4PZLA 1V39A 2VEOA 3QXGA 5HS4A 4IICA 3V6LA 5HTKA 4U7GA 3OOJA 4C0KA 3HZHA 1XQ6A 5FI3A 2D1RA 1U94A 1QHGA 2GHTA 1RDFA 4H3HB 4X3OA 4MR7A 3HJAA 3E9DA 1G4HA 1JR4A 4ZO4A 1QIJA 5DNEA 2UUAB 1Q17A 4YQEA 3DBRB 1JXOA 2VP3A 4PLWA 1Q6YA 1NJSA 1CUWA 3ZBPA 4JC8A 2DLNA 4QULA 5CM9C 4G23A 5IXSA 5IU6A 3EGIA 3TZQA 1RBMA 3KD3A 2X1HA 3ASYA 1I7SB 1RWKA 3QLUA 4F6RB 4ESVA 3OQ6A 1T9AA 2M1XA 1RMQA 4MV0A 4D0RA 1P5ZB 2P69A 4RSGA 1ENZA 1U04A 2JI4A 3CVJA 3MA0A 4UKDA 4WUTA 4FLEA 4KQMA 1N2IA 4ND6A 3EGOA 1BCRA 4IO0A 1IBLB 5L3QA 5GPBA 1R0KA 2WJ6A 1V1JA 3ZKWB 2FUEA 4C29A 2JKZA 3EMKA 3NHBA 1ITZA 3U7RA 3F71A 2VHUA 1WDLA 3LWDA 3R5KA 1CQWA 5IT5A 1CETA 5AFSA 1UQRA 1PVOA 3I8XA 4PV7A 2WRZA 3OIUA 3O2SB 3AF0A 3S5JA 4KX3A 5BR4A 2F4NA 2QU8A 2ACKA 1X7WB 3ANXA 1C4WA 4MYSA 1V48A 1T9BA 4PYIA 4PX2A 4AZSA 4LWZA 3PBKA 1A69A 5HOQA 4N0DA 1CHNA 1KQPA 2PWYA 4LX8A 1Z16A 3O4HA 2FN7A 5AD1A 3HVUA 3HLTA 4LHSA 2KQUA 3QENA 4Q82A 2B9EA 2C4MA 4N41A 4DBLE 4NMMA 4CM6A 1Y1LA 2BLLA 4CL3A 2OAEA 2P3OA 1P4RA 1E2GA 1EUCA 1TE2A 2HGZA 3PQ5A 4Y2VA 2QKYA 3AHFA 3WISA 4E6EA 2IYFA 1F4VA 1ZN8A 5DGDA 5EQDA 1JV2B 4OTZA 4QGBA 3KKEA 5K0EA 1JT9A 2I62A 4G37A 3SYNA 5CX1A 3CVVA 3A11A 1VHJA 2O5VA 3O1LA 3QEKA 1EE1A 1TVKB 2IEDA 5AVYA 5ITSA 3N2NA 2RKWA 2YY5A 1VJ0A 1RHJA 3NZEA 1SBYA 1PQYA 1ZESA 3B85A 4XIGS 4QFCA 3UWOA 1IY0A 1ESDA 3MT7A 3SDBA 2H65A 1GNRA 3D4LA 4KIWA 1ONPA 1TCBA 1ORDA 1PX0A 1XHLA 3B6IA 4Y2SA 3BD9A 3JQGA 1XZKA 5EXSA 4YX9A 5IJ9A 4RFSB 4MIKA 1DRWA 1JKIA 1XVAA 4JK3A 4LSGA 3D5QA 1P45A 5CR9A 3EXEA 1SBCA 5B6JA 2VSFA 3IKLA 2DVMA 1UT6A 3IT0A 4EUNA 2OM2A 3LSYA 5FV7A 5HUQA 2RHOA 2ZYIA 3TAXA 1DJQA 5WRFA 2JH3A 1CC1S 2QOEA 4L5JA 4NV3A 4O33A 4RVCA 2XMRA 4CL0A 1AT1A 3W4JA 1ID1A 1KK2A 5HBRA 4H08A 3KQMA 2R1VB 3X1YA 3AFGA 4DLLA 2FQYA 2P7HA 4JP3A 3HB9A 2FPPA 5BN3B 1OBHA 5BORA 3D4NA 3JQAD 4UBIA 3STHA 3V8RA 5KOHB 2IYYA 4L5IA 2ZT7A 4D9NA 3R5XA 3LLCA 2ZKLA 1FTWA 4LQ4A 1KEZA 2EW1A 4MVJH 4X3PA 1GPLA 1T26A 3EVZA 3BK1A 1Q84A 4EENA 3AI1A 1BS1A 3O1IC 2Y1GA 3L7NA 3CXRA 1C41A 3BSWA 3I05A 4IH4A 2C5LA 2RAVA 4Z9FA 2YNMD 1W4RA 3GDFA 5CURA 1YI0A 1P4JA 1Y5RA 3QA9A 3ICVA 3CF6R 3CX8A 3B7PA 3T9FA 1IWBB 5BUCA 2QLBA 1OT5A 4XVRA 3FLBA 3LH5A 2HO4A 1KVQA 2PMWB 3DFMA 3SQLA 1SR8A 1ZIXA 5DRTA 5F3RA 1VL6A 2LV8A 3UWDA 1Y7TA 2PWAA 3MRTA 5JC8A 3K31A 4DLRA 1ZXBA 4JJFA 3B3JA 5CVCA 3MBKA 4X44A 3KB1A 5B3LA 5LVAA 3WK6A 4GVXA 1K08A 3JD1A 2JHFA 3VDRA 2GKOA 5K8IA 4JA2A 1KFCB 3M5PA 3MJEA 3DL4A 3IAXA 2F1KA 4I81A 4O02B 5BYKA 3AIOA 1EI9A 4WK0B 1MNQA 3RRNA 4C1BA 1UODA 2ZJOA 3C3XA 4EHFA 5HFJA 1QH9A 3IJEB 1W88A 3G82C 4G81A 3TZHA 4G85A 3ENWA 1XTTA 3HR4A 4PFKA 3ZWDA 1YRAA 1VG1A 4TXHA 3BH0A 2WSBA 4PO3X 1I2DA 1XMJA 1Q0SA 3IR6A 4MHOA 2NPIA 1WBDA 5E4TA 1O8BA 1BW9A 1ECFA 1MJHA 2L18A 3IHTA 2ZUVA 2PIAA 1NJGA 1P5RA 1D0IA 1MX5A 3FZGA 2ZE5A 3II6X 5JATA 3KUUA 2WWXA 3A6FA 3LUCA 1EHYA 1W94A 2VSNA 2C84A 2QP3A 2YV5A 3D02A 3DE3X 4R9VA 1EA7A 4YV7A 1NXSA 5JQGB 3D7RA 4MIYA 2FW6A 3ETHA 3SEFA 2BEWA 2I9PA 4TUYA 1UPTA 4AKTA 2PSSA 1A76A 3FKQA 2V74B 4I66A 1MJ5A 3TTSA 3RU3A 2M98A 3L0ZA 3QFFA 4BKMA 2V9CA 2OPHA 1OB2A 1U28C 4HX5A 1P1KA 1MABB 4INAA 1B76A 4C4XA 2O3QA 1EUDB 3MW8A 3RS3A 2O48X 5LL6P 4Y1RB 2BFCA 1F9EA 2C88A 3OLWA 3O95A 4JBWA 3K0SA 4UE2A 2CJWB 2GJ8A 3RUHA 4AWBA 5CD1A 3U60B 4LKOA 4V0QA 2JPDA 5L3RA 1UC9A 1W4AA 3H0EA 2XNJA 4RJTA 3I4CA 1W36C 2PJDA 2VQ6A 3I2IA 3ZLTA 4WK4B 4D8YA 4QTYA 2QB5A 3V4RA 3G79A 1U1DA 1JFFA 3DE4X 1NIJA 3AUFA 2JZOA 1PZHA 2IXTA 1EK6A 3HADA 3LX6A 4QHYA 4NENB 4Y1RA 4BN4A 1FRQA 5JUWA 5ARBA 1YCHA 1NVGA 2GPJA 2OO3A 1PS8A 5T57A 2OSBA 3QKTA 5EE5B 1EU1A 1LCIA 3M1YA 2ZDQA 3AP2A 3K5WA 5CXXA 3RC1A 4UNRA 2IV2X 5LQMA 1N57A 2A86A 2R4QA 3TCNA 1E3WB 3B6JA 1GZ6A 4W8GA 3G2QA 3IV7A 3BM5A 3UCFA 4DQUA 2H9YA 1JTFA 1UAYA 4OOFA 4HS9A 5T6BA 3HNPA 1KE2A 1F2TB 1KJJA 1UPAA 3IIJA 4D0NA 1TUEA 3C8HA 4NARA 2Q1WA 4EUHA 2XDAA 2VDUE 1O03A 4X7BA 2GK4A 3TLAA 3M4YA 4DQ0A 3DKRA 4QJ4A 2XYPA 3ROTA 3INGA 4QJ5A 2NTNA 1E3IA 3W5AA 4Q21A 3K6KA 1V8BA 2XA1A 2JD0A 3