3AKDA

Crystal structure of cmp kinase in complex with cdp from thermus thermophilus hb8
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
202
Chain Sequence
MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRARERPQAYEEVLRDLLRRDSAPAPDALVLDTGGMTLDEVVAWVLAHIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the tertiary complex of CMP kinase with a phosphoryl group acceptor and a donor from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Cytidylate kinase
total genus 70
structure length 202
sequence length 208
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akdA00
2V4ZA 4DLRA 5L8VA 3CRVA 2OM2A 3UG7A 4ABYA 1N6LA 5IK2A 3EC2A 2YNMA 5J5CA 1W7AA 2EVWX 1Z06A 2CHGA 1LFDB 4L4UA 4FW9A 4NKRA 4EPWA 1RYHA 1E2HA 1FP7A 3U3OA 4DB2A 1RFLA 1T8UA 3K9LA 1E32A 1KDTA 1XXHE 4EFNA 3HU2A 1D2NA 2IF2A 3AGQA 1E79A 4TMWA 2B8TA 1AA9A 1W0KA 3AVQA 3C15C 4GI7A 2DPXA 3RS4A 3X1ZA 2ZU0C 2EFCB 2QAGA 3JZMA 1KSJA 1YRAA 3RS3A 3EZFA 3TAHA 3SQXA 4DLVA 1Q20A 1JALA 4FMDF 3W5JA 3V4FA 4D80A 1A2BA 1G41A 1OPXA 4QJ4A 2FF7A 4B76A 3AKEA 2QGZA 2O52A 3GJ6A 4PC3A 1EWQA 1VYUA 3RC3A 1XX6A 1IOZA 2PLRA 4MRPA 4UXIA 3W6NA 3BC1A 2ZR9A 4YXWA 3UPUA 4PC2A 5BYKA 1CXZA 2VHTA 4ZDIA 3D31A 2DWOA 1YVDA 3K1JA 1R2QA 4N3NA 1MKYA 3TW4A 2JLUA 3WXMA 2N42A 4GZMA 4DEXA 1W0KD 3M1IA 1L8QA 4M9ZA 2YC2C 4JBXA 3HR8A 4FXPA 3IQXA 1ZM7A 3QF4B 4B3DA 2RMKA 3F0TA 1T4GA 1R0WA 3BBPA 3TQCA 2QQEA 2EWWA 2CVFA 3AQ4A 2OILA 4Q9JA 3S1AB 2OO7A 4IDPA 4LOAA 5DI3B 4QHTA 3RYTC 2IBMA 2XNSA 1SVWA 3CONA 3KB2A 3NBXX 3LXXA 3OFND 3PEVA 3B1WA 2G0NA 1PVOA 1S9HA 4BLSA 3WNDA 5DN6D 1NIPA 4MRSA 1CP2A 1ZD1A 4ZDJA 2P0EA 5A4JA 4ZO4A 5KDLA 1GRRA 2RCNA 2V7QA 5E95A 5CM8B 1XP8A 5D3MA 5DN6A 2JAQA 5EP1A 1R4AA 2J5XA 3VR3A 4DCTA 3VTKA 5BN5A 821PA 3V00A 1N5JA 3K0FB 2CMKA 3SJCA 4O25A 5KYKA 3PEWA 4TYWA 2QL6A 1TF5A 3LD9A 3IKJA 4ZIRA 4ZKDA 2OLKA 1G3RA 2RKOA 1IM2A 1D6JA 2AR7A 4OQLA 4AG5A 4FMDB 2J1LA 4NCNA 5BYJA 2DFTA 2QTFA 3H0KA 3Q8XB 4U00A 3T5GA 3VR5A 1AS2A 1M1YE 2JJ2D 2Z83A 3BWDD 2CJWA 4DSTA 3AF0A 3LVQE 3G82C 4A15A 2JGNA 1Z0JA 4NH0A 5FUWA 3VX3A 2X2FA 1H8HD 4H1VA 4EUNA 2IYVA 5KTYA 1FOEB 1M7GA 1SXJA 2JEOA 4HB0A 3IPXA 2ZREA 1F2UA 2YOGA 4CEJB 1D8TA 4FMCF 2PZGA 2C9OA 3CRQA 2GEDA 1K6MA 1KO4A 4MH0R 4A92A 5E3HA 1GL6A 1TUEA 4PX9A 2XJ9A 4WZAE 3ZQJA 2WIBA 3QJYA 3U3KA 1LB1B 3SQWA 1TQDA 4JLBA 4A0GA 3W9YA 1OXTA 3O8RA 3L0IB 4J0QA 4O2RA 1T91A 4DDWA 2R62A 2R2AA 3GMTA 2F1JA 2XZOA 2E9SA 2GCOA 5C46F 1AJEA 5HCIA 4BRWA 3ND8A 5B57C 4IVRA 3TSWA 4HUQB 5FL7A 5TARA 4WA7A 2GNOA 5FBLB 2XB4A 4US1R 1BYUA 2QUZA 1HEIA 3QKRA 3TUJC 2B7CA 3QXCA 2HF9A 5FTKA 1ZUNB 2GCNA 4A2WA 1M6NA 4GP7A 3NTUA 4GL2A 3T1QA 1JR3A 3OIYA 3RRNA 5JBQA 5L3RA 2FEMA 3MWJA 4PXAA 3EIHA 1Z2CA 4URVR 2WOOA 2IEZA 3NC1C 4HAXA 2VHJA 3AVWA 1BIFA 4TN1A 1W47A 2VF7A 3M4YA 5CK5A 4YC7A 4HZUB 5AUNB 2NQ2C 3LVRE 4CW7A 1FL9A 4M1SA 4EJSB 4TL9A 1U99A 2QU8A 3VKHA 1VCIA 2GEUA 2NG1A 1E1QA 1G5TA 1NVXQ 1KY2A 4UXJA 2WHXA 1H8ED 3K0AB 1E69A 2C8VA 1Q3TA 4IFEA 5KSZA 2A9KA 2W2XA 5CDFE 1D5CA 3AVTA 4YMUA 1B0UA 1NVVR 1G6HA 2BJVA 5GJVC 3WY9A 3FFBA 4KFUA 3PJRA 1YRBA 1OYYA 3IBGA 1KZ7B 2V54A 3EIEA 3BFVA 3AVOA 2EQBA 3ZVNA 5JRJA 3HU3A 2G88A 3ECCA 2XZLA 1IXZA 5EE5B 1JEEA 3U61B 3M0EA 4HZIA 5JS7A 4BFSA 5IHPA 3ZD7A 4JVMA 3VKGA 2O8CB 3KQLA 1NVVQ 1G18A 4TLCA 2ZJYA 2QE7A 1G19A 5EQTA 1FX0A 4B3FX 4C7OA 3GEHA 3I72A 4K46A 4IKEA 2H7VA 2EYUA 3RWOA 4US0R 3PV0A 4RFSA 4BLOA 5KUTA 1OH7A 4PO8A 2QE7D 2EFHB 1MABB 1ODFA 4D81A 4LV8B 3SYLA 3B1VA 1LTQA 2RB4A 2J0SA 4IJMA 4HDOB 4ZCIA 1U8YA 5FTNA 5EXTA 2FWRA 4DHEA 5FOTA 1MOZA 4CEHA 3A1TA 1YZUA 1ZP6A 1Z28A 4LHXA 3GJ4A 3CIOA 1DO2A 4OHZA 3CR8A 3FKSD 3PIRA 2FZ4A 1R6BX 1OYWA 4AK9A 2WJHA 2Z0MA 2W0SA 2FEOA 1W48A 1LF5A 3C5HA 4JJKA 2ONKA 1IHUA 1RE0A 3K8YA 1ANKA 5LB2A 1OFTA 1CJMA 2VIIA 2WWHA 3K09C 4NYJR 4OI0A 1TUIA 3TSOA 2F3RA 2VRWA 1Z0DA 1RC8A 4PANA 4BEBA 3W6OA 5FUYA 1G3MA 3DMDA 5IT5A 1QBKC 4TMTA 1HT1E 3ZH9B 4ZI3A 2QAGC 1W1WA 4KVGA 2IS4A 1G8FA 1CEEA 1IXSB 3KFXA 5L3QB 3VNUA 721PA 2ZE7A 4DDTA 2Q3FA 1OFHA 2XTMA 4V0KA 1W4BA 1DAEA 1I4DD 5J4KA 1J2JA 2VO1A 3MWLA 4PZZA 3U2QA 4Q19A 2RGNC 4HB3A 2Z4SA 2C77A 4JKIA 1D2EA 4YONB 2Q0HA 2QM7A 1FTNA 1RJ9A 4LWZA 4JBWA 3GJXC 1W4AA 4FCWA 3TVTA 1I4LD 4DIDA 4DSUA 4QJ5A 2QPAA 4NPHA 2IYLD 4DCSA 1U8ZA 3W8RA 2XXAA 3A37A 2WKPA 2WJVA 3SI7A 1XD8A 4KU4A 1GRQA 4KSCA 1NNEA 4G5SA 3SE0A 3FPAA 1JR6A 1CBUA 2OFOA 3MUFA 4TT3D 4AG6A 5EUQB 1GKIA 2JLWA 1VYTA 2QPTA 4M1WA 3TE6A 1P6XA 2ZU6A 4IXNA 2R65A 1BH2A 1GWNA 3GJ3A 3LLUA 4OQXA 4C3ZA 2EFEB 4GZLA 1DG3A 2O0KA 4B3GA 3EG5A 3QXSA 4Q7JB 3RS7A 2V8OA 1P2VA 4MKHA 4R98A 3EARA 3GLIB 2WWGA 2UZIR 2IC5A 4LBYA 1KY3A 4XVQA 1BMFD 5CITA 4M8NE 2ZSEA 1DVRA 1XEXA 2KBFA 4AYWA 1KO1A 2HCBA 2OFWA 2QA5A 4NYJQ 2CE7A 3KKOA 1AGPA 1U0JA 4MYUA 1EG7A 1TPZA 1SVOA 2V9PA 3VHXA 4EPTA 5FL3A 2IS1A 4KFTA 1P75A 2GEVA 3MMPA 3LLMA 1QHYA 4PSAA 2HF8A 3ZZTA 4DUGA 2KJQA 4KJZA 4G5GA 4GSYA 2VP4A 1YU9A 2LKDA 2O5VA 1YKSA 2TMKA 2V55B 5HTKA 4B2LA 4TMKA 1W36C 4BFXA 2PEYA 4HZUA 4W9MC 3KJGA 4V02A 1IBRA 3WNBA 3LXRA 4PO9A 3SJZA 4BFWA 3U7HB 1II0A 5LBIA 3CKLA 2B7BA 4F4CA 1W44A 3GPLA 4KVAA 2ONJA 1T5LA 3L8YA 3BB1A 3ZGXA 2X19A 4KODA 1A2KC 3LNCA 1VIYA 2AD5A 1NBME 4LZZA 4JSTA 4D4JA 2AN9A 3QKRB 4MQBA 2BHRA 4R9UC 1JAIA 3GFTA 2O8BB 1CJVC 4JS0A 3T35A 1EFCA 1TX4B 3KUCA 1AIPA 2C99A 1E94E 1GZSA 2WTUA 3NH6A 4Q5IA 1X3SA 3GLHB 2P6UA 4MYCA 1VIAA 3A4LA 1CR0A 5FL7D 3LW8A 1X8LA 4LPSA 4M1YA 2LWIA 1HURA 4OHVA 5CDFA 2R6CA 4AWXA 3ETLA 5EZ6B 2ZJ2A 5F2EA 4C0HA 1WQ1R 1HYQA 1FFHA 4JLAA 4WIAA 5JWRA 1E2PA 1E2FA 3VKWA 3IIKA 4A6XA 3AP1A 1II9A 2FG5A 2C03A 2XTZA 3A6PC 1JNYA 2JIZD 4CEJA 2GVZC 4D0GA 3H84A 4QXAA 5GJCA 4MKGA 1OXVA 4V0ME 1BKDR 1Z5ZA 2NTYC 2CHQA 5K8IA 5E7JA 3NG1A 4TYPA 3EPHA 3C14C 2CJWB 2J0UA 1P61B 2GAAA 3HPQA 4GFDA 1A4RA 2XSZD 3NBZC 4BLQA 1XPRA 1LF0A 2R6GA 4ITRC 2BWJA 2SHKA 4QHSA 4TWZA 5SZHB 2IYYA 1HTWA 5FOSA 3QIAA 4PHGA 1XF9A 1WBBA 2ZVQX 4P4SB 1NF3A 1OV4A 1Z6GA 2HJGA 2HT6A 2WOJA 2YWGA 1W2GA 3T5DA 1PV4A 3W3AA 1R5BA 3EW9A 3TQFA 2AXNA 3DPUA 1UKZA 5KDDA 3TR5A 1K8RA 1N6HA 4MUBA 2XTNA 4CDGA 1KK3A 1KAGA 4C0LA 5CM9C 2GXAA 2PEZA 2VYFA 5FI0B 2WAYA 5EXXA 5L3SB 4MGZR 2HJVA 1CIPA 1II8B 4IDNA 4N1AA 5AK0A 4YLGA 2OCYC 2BDTA 1KO7A 3NXSA 5FPKA 2J46A 1WXQA 3K53A 4ZV4A 1AS3A 1E2JA 4NCHA 5J4YA 1NY5A 3EA5A 3B7GA 5FR1A 2IUUA 2HLDD 3WNCA 1SGWA 4LBWA 4NYMQ 2AHOA 2V3CC 2EW1A 1A82A 3AVYA 4IDOA 1AZTA 2FDCA 3BXZA 2JLZA 4XWOA 3GD7A 3KDSE 4F4IA 3B1ZA 1IY1A 3CRW1 4P3YA 2V6JA 2ZRGA 4DSNA 1GRNA 1N3BA 2AK2A 3FDIA 1E0JA 3SFVA 4D4KA 4AD8A 1AKEA 3C16C 4IRUB 5FUXA 4GDFA 4JJZA 1G6OA 2VF8A 2IYQA 2QEQA 1W49A 2D4HA 3KX2A 5FUVA 5JI3E 1ZD9A 1G3QA 4DLUA 3THWA 5J4VA 2R44A 1SVIA 3P1JA 2Q3MA 2YWFA 4OK5A 3KJHA 2F1RA 2YC4C 2J9RA 4V03A 3T15A 2ZRHA 3ONWA 2REBA 2WVJA 3BE4A 3D6TB 1SXJD 1T0JB 4LYAA 2D7CA 4ZKEA 4CIDA 4IFBA 1GG2A 1UF9A 1NMXA 1L4UA 5EZ5A 3BH0A 1SVKA 1DAKA 2WV9A 3UKDA 3QPWA 5JCPA 3UWOA 1XMVA 2OXCA 2F1HA 2BIFA 2H57A 4TMVA 1IXRC 1XD9A 4R2HA 4PPFA 4DLZA 3U60B 2G1JA 4ZDWA 5SZJA 2E1RA 4ACBA 3GEEA 3EWSA 4QM6A 3NBYC 5EJEA 2GXQA 2HUPA 3AF1A 5KU1A 3ZIAD 3RS2A 1P4SA 4OK6A 5FTJA 1TU4A 4G5QA 4B3CA 1T8TA 3BERA 1Z08A 1P9WA 1ZC4A 4M0LA 4A82A 1Y63A 3ND9A 5H1YA 1ZNZA 4TYNA 1C1YA 4DLTA 4OHWA 1OXXK 4UJ5A 5HKKD 2B8WA 3VR4A 1J8YF 1NBMD 4XWAA 1Z6YA 2EU8A 2W0MA 2RGEA 4JLNA 4NYIQ 2GA8A 4BZQA 4YQFA 3TIFA 4PZYA 5IF9A 1YZKA 4C0KA 3MCAA 3Q85A 4HUQA 3D7MA 4G1UC 1G291 2WPDD 4KHZA 4MA4A 5KDOA 1N25A 4Z51A 4UXHA 4RY2A 4ASUD 5H68A 4HI0E 3QEOA 3K0SA 1G5PA 3LDAA 4B2IA 1ZNXA 3OIVA 2ATVA 4Q9IA 3R9WA 2PJRA 4XVRA 1G8YA 4CZ2A 2ZJ5A 2Q9CA 2UKDA 2BBWA 2IXGA 1NG1A 2GKSA 2FU5C 3PXGA 3AP3A 2DCUA 5G3ZA 4EPXA 3QNUA 3CPEA 2QMEA 4A2PA 2J0UB 5P21A 3KQNA 1F2UB 2ZJOA 4Z8XA 3KQUA 3PUWA 3LFUA 3ZD6A 5JS8A 1BOFA 1SXJB 1XWIA 2C9YA 2OAQ1 1WB9A 4EQ6B 1HH4A 2FMXA 5TV2A 2DY1A 2V6IA 3GLGA 1T5IA 3B5JA 2V1UA 2A3RA 2GF9A 3LQRA 4D4MA 3GJ7A 4DSOA 3RS5A 4OBEA 2C95A 3U3JA 2G77B 3GQBA 3MWYW 5JEDA 3JZAA 2GHIA 1ZD8A 1UKEA 1S4QA 2G6BA 1UDXA 1YZGA 4LCBA 2DYKA 2B6HA 4GT1A 2BMEA 4L9WA 3ADCA 4W5WA 2BM0A 4E09A 1XPOA 2HLDA 1GNQA 1NKSA 2GK6A 2F9LA 3IBYA 2VP9A 2VTKA 3CM0A 3EZ6A 3SBEA 3NHAA 4RVCA 5GADl 4TTPA 3R8FA 1DAGA 5GVRA 4O0MA 3SZRA 2VP2A 4FWTA 3NHBA 3QBTA 4LV5B 1JI0A 3BRWD 3W8NA 1G3IA 4UNSA 4L9SA 1QVRA 3CRRA 4O2LA 2FFBA 5DI3A 1HT2E 4QKQA 4JLPA 4FMCB 4NCJA 3C7KA 3TRFA 1XU4A 3VMFA 3F3YA 2JJ1D 4KO8A 4EFLA 1AS0A 3CWQA 3NWJA 4YMSA 2AD1A 1N6NA 2ZRFA 1ZYUA 4TQUS 3TR0A 2J7PA 1E99A 1G16A 4O3MA 2PX0A 2OSBA 4MRRA 4KFRA 1ZNYA 3SU8A 1W0JA 2ATXA 4UJ3A 1TF7A 1TF2A 5C4GB 1T6NA 3QBVA 5TXGA 2QI9C 5FBQB 2JASA 1NSFA 3K70B 5ELXA 2ZE5A 4A8JC 1N6PA 4YXWD 3PITA 5B30A 1DBSA 2PCLA 4XD7A 4JBYA 4LSGA 4JLMA 1MO4A 2EWVA 3I1FA 4KAXA 4Q1AA 5DHFA 1W36D 4MGKR 3DEFA 4Q1EA 4R71A 1IAQA 4QGFA 3B8HA 1AQYA 2RGBA 3EASA 2REXB 1G7SA 4B74A 3AB3A 3VU9A 2FGKA 3SNHA 1OLOA 4DC9A 2PZEA 1UKVY 2R8RA 3N70A 4WOPA 2ZJ8A 2Q9AA 3Q7QA 2G83A 2J41A 2WMOB 4F38A 1KJWA 4YDSA 5GJWC 2BC9A 2QMUA 1Q3HA 1VG0B 2F6RA 4XH9B 3FMFA 3LWNA 1N5LA 1COWA 4TSFD 4Q9LA 2A7QA 4FMBB 2AKYA 221PA 5CYPA 3TSZA 2WWFA 4NHOA 4WAUA 1ZVQA 1MH1A 5F9HA 5FBVB 2NO7A 2OBLA 3QOFA 3SDZA 4EIWA 1I2DA 3J81k 3GLFA 5G41A 3CNNA 3P32A 4JSYA 4MKFA 1U0HC 1QHHA 3OEED 4TLBA 1Z63A 3OIWA 1TNDA 2R9VA 4FD2A 1WP9A 3U3MA 1LVGA 3EZ2A 3OE7D 1S96A 2ZRJA 1J90A 1S0UA 4IEIA 2ZAMA 1VG1A 1CKEA 3Q5EA 3QVVA 2O8DA 3LRPA 5EP4A 1SXJC 2ZE8A 4MRNA 4D2IA 2IYXA 2VP5A 1KI4A 1XEWY 4QGHA 5FOVA 4EQ6A 4Q18A 2WKRA 4G5RA 1X86B 2IHBA 3RSLA 2IWRA 421PA 1VYVA 1OFUX 2YOHA 4FN5A 2YZ2A 1E2IA 5AUPB 4BLTA 5C1BA 4OI2A 5JZVA 2J59A 2ZI9A 3X1WA 2FSHA 3RRMA 3RC8A 1TQ4A 2HXSA 4JLKA 2IYTA 1W2HA 4OQNA 4PQRA 1ZINA 3PUXA 3GLGE 4P4UA 3A8TA 1X6VA 3FOZA 4N0EA 5BN4A 2ZE6A 2IT1A 5JECA 3FVQA 4HLUC 5CK4A 4AC9A 5FFMA 1W4CA 2D62A 1R10A 1RPZA 3FE2A 4BZPA 4G5OA 4C2TA 3AF3A 1MABA 2PH1A 4B3BA 1NLZA 3AM1A 1KK1A 4BLPA 1I2MA 3DDCA 3L2OB 2JLYA 1OIWA 1ZC3A 3LY5A 1XCGB 1OB5A 4M53A 1JQJC 2WSSA 4TL8A 2CXXA 2BEKA 3OAAD 2RGCA 4H1UA 4BUJA 1AN0A 1Z0FA 1U81A 4QBFA 2ZYVX 2A5YB 1N0VC 2QT1A 4OI1A 5BWMA 3GJ8A 3BH6A 4GP6A 2FNAA 1QHHB 3HP1A 2AX4A 1Z6XA 1CS4C 4LRWA 1WCV1 2JJ8A 3PENA 2G0TA 2ODWA 4KFSA 3LBNA 4KV9A 3ADDA 4AY2A 4JVLA 2W2TA 1PLJA 4PHFA 2YJTD 5AJWA 4L8GA 5B2ZA 1U2RA 3EC1A 4PSKA 2V1XA 1F48A 3QPUA 3H86A 1KSFX 1KTVA 3CNLA 3MWKA 2N46A 1J8MF 3B85A 3K9GA 1YZQA 2AFHE 2NZJA 2DB3A 2CL0X 5TVKA 3OESA 3TAUA 4RD3A 4JLJA 4ZDKA 2MMGA 2VQSA 1J99A 2NO9A 2HT1A 3WP0A 1GP2A 4M9SA 5K8LA 2QTHA 2QM8A 4FI3C 1KZGB 2P5TB 4JKYA 2W6JD 2DHRA 4E07A 2PT7A 3I8SA 2H16A 4NCIA 3EIQA 2GXSA 2X8AA 2IYZA 4UNPA 3TBKA 2CDNA 4OJKA 1T3LA 3DHWC 4YMWA 5EP2A 4CT5A 1XJQA 4RJLA 5JRZA 3I62A 1J7KA 4LYHA 4A2QA 1E2QA 4HB2A 2WWWA 3TNFA 3AKYA 4NTZA 5G40A 4Q03A 1D9XA 3ZLJA 3FMPB 1JPNA 5DYGA 1NL3A 1XEXB 3X2SA 3CW2A 4DZZA 2ZVPX 5GVSA 4G0NA 1TL7C 3QKSA 2D7DA 3QXJA 4L16A 4DLWA 2A78A 2ZUDA 3R9IA 4BECA 1VCNA 4TLEA 2W2VA 2FPMA 1GILA 3K09A 1QHIA 1L7VC 4D26A 2OBMA 1W4RA 4DKXA 1G8HA 1V43A 1ZUHA 4KBGA 4C9BA 1RKBA 2VP0A 2BV3A 4ZCLA 1KO5A 4PC1A 2VA8A 1GVNB 2A5DA 4US2R 4QJ3A 2IK8A 2QRZA 4IVPA 4NCKA 4NL4H 2GBLA 4ZI2A 3AVVA 4DB4A 3IIMA 5JWHA 2YV5A 3MLEA 3VFDA 2B21A 1CJUC 2QP9X 3KTAB 4ESHA 4CEIA 1XFAA 1GOTA 5HZKA 5EE3A 3BIFA 5BN3A 5K8UA 5DSZA 4OK3A 5KNCA 3THYA 3VNVA 3R20A 4P4SA 2J0VA 2D06A 1KI7A 3H2YA 1EK0A 1FUKA 5B58C 5CLQA 2YOFA 4F4JA 5JSZA 1OH8A 3QVUA 4A8JB 5FTMA 2IS2A 4EKDA 2E87A 2Q9BA 2PX3A 4Q4JB 1C4OA 3K0FA 2AL7A 4WZBE 1UKYA 1MRSA 1SULA 4M1MA 3RRZA 4HYYA 3GLGB 4Q7KA 1JXOA 4BRUA 5LPNA 2MMCA 1BO6A 1ESMA 1VTKA 4WVFA 4DUGD 1RRFA 2XB2A 4D4LA 2VSOA 5FOXA 3GLIE 1JR3D 2OUKA 4MKIA 4C2UA 4QM7A 1N2CE 1V5WA 2JLVA 1ZAKA 5LDDC 2ZRKA 1E9BA 4QNRA 1PJRA 3REFA 5JFGA 2ZM5A 2A5GA 2RGDA 1SKYB 1R7RA 4LHVA 4WXRA 3QUSA 5D3QA 4D0NA 1YZTA 2L0XA 3C8UA 3AKCA 1QG4A 1RIFA 2D3WA 4HLCA 5CYOA 3ADBA 4FCTA 2JCSA 1BMFA 4DJTA 1SVMA 2GK7A 5TDHA 3I5YA 4IW3B 3LBHA 3Q72A 4TT3A 4MGYR 2QZ4A 3KKNA 4IDQA 5AJXA 1KMHA 1ONBA 5KOYA 2QENA 5L3VA 3D3QA 1KOFA 5FPYA 2O8BA 4LJ5A 3D8BA 4GOXA 4YMTA 4DWJA 2PBRA 2XJ4A 2FSIA 1XEWX 3CX7A 2JLXA 4C7OB 1BS1A 1G21E 4LJ4A 4CGZA 4AKGA 3IHLA 4RKEA 1KKMA 3FGNA 3FHOA 3JVVA 2RGGA 3CF6R 5KO2A 2O8EB 5KSOA 4AKIA 3X1DA 2ZI5A 4XTCS 4FIDA 3TH5A 4BLRA 2FPKA 3K0EA 2NPIA 3AKDA 5HCNA 4LGMA 1U8AA 3WMGA 4BGDA 2FA9A 2NMVA 1XD2B 4KI0A 2ZPTX 5SZKB 1CJKC 1W0JD 4B43A 2CNWD 4HLDA 4XSGA 1GSIA 1E2MA 2I3BA 3PQCA 4M2LA 1UBGA 4DLXA 4Q21A 3KKQA 1XCPA 4M1KA 1EFRD 5KSPA 1HA3A 3EXAA 2BVNA 4GMDA 3TJZA 4OL0A 4PZLA 4PAOA 2GF0A 4Q4HB 1UM8A 3EAQA 4B6EA 3W3ZB 1P73A 2ZETA 5IRCD 3AP2A 1Z83A 1RZ3A 2P67A 1KAOA 1ZIPA 3QKUA 5TMPA 1OF1A 2OT3B 3IO3A 4RZXA 1CU1A 2GTPA 1VG8A 2CHVA 4Y0AA 2YHSA 2ERXA 1P60A 2YWEA 3PR1A 3A4NA 4IDHA 4JL8A 1KSGA 1SXJE 2WBLC 1IQPA 3GLIA 1GITA 3WYAA 4A36A 1OE0A 1D2MA 1E2EA 4KYIB 1NN1A 3DZ8A 4R7ZA 1P2TA 5FTLA 4JIMA 2W6ID 1GTVA 4P4TA 2QRNA 4E03A 2XOKD 1ZU4A 3LX5A 2KE5A 4LK2A 4URWR 4NMMA 1YE8A 1KI6A 1N0UA 3MRSA 2AK3A 3QF7A 3QXHA 3NEJA 3PCRB 3EZ9A 3FTQA 2BOVA 2PT5A 5BQ5A 2A5FA 1E9CA 2IF0A 3AVXA 1XXHB 3OHMA 4MDEA 3IHWA 4ARZA 1M74A 3CO5A 4Q1BA 3AEZA 4DLSA 1TQ2A 1Z29A 1R8QA 4ZPXA 1R5OA 2C2HA 4ZCMA 3EPJA 2AXPA 2ZS7A 3BK7A 3KJEA 5DYIA 2P6NA 4Q9HA 5L3SA 1E9EA 4PAQA 3ASZA 4PO1A 1R0XA 2IX3A 2IXFA 2IYSA 3HU1A 5EXSA 3L8ZA 2JATA 5FR2A 4E5UA 1E79D 2Q3HA 4B75A 3C4JA 1XTJA 3L0SA 3ASYA 2VHQA 1GFIA 3GEIA 1HE8B 1S2MA 4GOJA 3R7WB 2ZR0A 4Q4JA 1ZUIA 3FHTA 4ZIRB 4RKFA 1KI3A 1NBMA 1OKKD 1E9RA 4A8JA 2OXRA 3O47A 3N2IA 4LPKA 3GCGA 1E1RD 2XEXA 2ZI4A 4BFVA 5J40A 2GJAA 2ZJBA 3BB4A 4C0QC 5DNYB 5FPSA 5TB5A 4MDFA 4EAQA 2NPFA 2A2ZA 4FINA 2BM1A 3A36A 4I81A 5EP3A 2OBNA 3MJHA 2I4IA 2ODNA 4CEHB 4OJQA 4TYYA 1Z0KA 1VDZA 1P2SA 4GOKA 2FH5B 3WBKA 2MSCB 1IN5A 1E4YA 1QHXA 3EPKA 4RFSB 3P4YA 1RRGA 1Z0IA 2F43B 2QSYA 1NN3A 1N6IA 1F6BA 1EFUA 2HYDA 1FX0B 3F8TA 4LBVA 3S1AA 4DRZA 2H17A 1G8PA 1S9DA 1IY0A 2JA1A 1ZM4A 3HJNA 4JT4A 3CZQA 2O8CA 1SVSA 3QF4A 1O87A 4I1OA 4CRWB 2IA5A 2BBOA 4Q4LA 1GNRA 2DR3A 4GRAA 1CTQA 3VU9B 4Q48A 3W90A 1S3GA 4IOKA 2HEIA 3UANA 3ZVRA 1E2GA 2GZHA 3W34A 4BFUA 2PL3A 1XEFA 1CJTC 2QNRA 4WW0A 2QP4A 1OIVA 1I4TD 4PPNA 4RD1A 2RAPA 2Z43A 1Z2AA 1PUJA 3TUIC 4BFYA 4UKDA 4V0NA 3TW8B 1XTQA 3K9HA 4WZ6A 3P4XA 4HDQB 2IUTA 3BJIC 4PSVA 1PLLA 5E4FA 4XD7D 1LY1A 3DKPA 1H8HA 4W5JA 2OCBA 4Q4AA 1VHLA 2ZQ5A 3Q3JB 1NIJA 2O0JA 1FP6A 3GJ0A 3I73A 3SN6A 2QAGB 2JJ1A 3RDPA 4PTLA 3EWAA 1NVUQ 3RLFA 1G8GA 1KHTA 3Q5DA 1KK2A 4JL5A 3AUYA 3ZZUA 2GJ9A 5J4LA 1DAIA 1E96A 3RANA 4CT4B 2FFHA 2BMDA 1OB2A 3E5HA 4IEEA 3ZS8A 3WRYC 3B9PA 1XBTA 2OHFA 3WHKA 3CNOA 3QENA 1XPUA 1NY6A 3X1YA 1GUAA 3W6PA 1XCMA 2BBTA 1G7RA 1OW3B 1NN0A 4IVQA 4F93B 5JJIA 3FFAA 4B3XA 6Q21A 1FW6A 4L15A 2JLRA 2VLIA 4EPVA 1IN7A 3SOPA 1Q1BA 3OAAA 4QFMA 3RWMB 1KI2A 3UATA 1VHTA 2FSGA 4UNNA 2IHYA 2VH5R 1F60A 4TSFA 4QNMA 1ZRHA 1TADA 4NYIR 4MUAA 2ZJZA 4QGAA 1ESNA 3CH5A 4W7SA 4AURA 4TYQA 2FJUA 4HUTA 3B82A 3DM5A 3MD0A 3BAFA 4PFSA 2XXAB 2XSZA 2RGXA 1RRPA 2XNDD 2C9CA 3K70D 4U5XA 4Q1CA 1KI9A 2WAXA 1IONA 2DWQA 2ERYA 2X1VA 3PUVA 4IXMA 4ON9A 2C78A 5F3WB 3T06B 5FOWA 1JPJA 2IEYA 4GBMA 5E7IA 1SVLA 4A1FA 2FX3A 4C4PA 2ZAOA 1S3SA 2FE4A 2WWIA 4XJXA 3WP1B 2GETA 3HYRA 2DFKB 3SBDA 2JIZA 2OESA 4LHWA 4TQAA 3VAAA 1MO6A 2GZAA 4TZ6A 3EPLA 5G3YA 1M7HA 4B35A 3CLVA 4ASUA 2BKEA 5E7MA 2IYUA 3IILA 2QPOA 3DKVA 4X8HA 2XZPA 2WM9B 4DT1B 1TU3A 5JHGB 1FNNA 4RD0A 4MITA 1X1SA 1VCOA 1OSNA 2HV8A 621PA 1XJ0A 1QZXA 4TTRA 4RCYA 2GAOA 4P33A 5D3MB 1DOAA 1ZIOA 1UJ2A 2PJZA 4RD2A 2OFXA 5HKKA 1WBDA 5IK2D 4RZUA 2VEDA 4TL7A 3PEYA 4PHHA 1DG1G 1AKYA 1XTKA 3OEHD 2KBEA 1N0WA 2CCJA 3GLHE 1E1RA 5JWOA 1CR2A 3B6EA 1G17A 1KDPA 4TLAA 3ICEA 3ZIAA 3K9NA 2QSZA 4NBSA 1XTRA 1UBFA 1FZQA 2CLSA 1F2TA 2XX3A 4X8LA 5C4MA 4UQOA 2PLFA 5K8TA 2GJSA 2N1BA 2EFGA 1P62B 1U9IA 1N6KA 2OZEA 4LY6A 3QEJA 3K0CA 1P7CA 4FCVA 4I1SA 4Q4AB 4M1TA 1RYFA 3DOFA 2QROA 3P26A 4I4LA 2WSSD 1KKLA 3HR7A 1GKYA 2YWHA 3QQ5A 2QQ0A 3I3SR 2RHDA 3NH9A 1EGAA 2AWOA 4D25A 1J70A 2QG6A 1FUUA 1S1CA 4LJYA 4S2EA 3HYTA 2RH5A 3KJIA 5DH9A 5HE9A 2C5LA 2QP3A 1TMKA 4LJAA 2ZSBA 1QHNA 3BB3A 3QG1A 5AJVB 2ECKA 1WA5A 3ICQB 4D6PA 5JJLA 3LAWA 1GL9B 2D74A 1US8B 2YINC 2EFDB 2H18A 5J47A 1F5NA 3C5CA 3THXA 1XTSA 1Z22A 1XJCA 1HQCA 1LW7A 3FKQA 1XRJA 1CR4A 2Y8EA 3P27A 4K8OA 3DO6A 2OCAA 5CJ2A 1IJFA 2F43A 4RCZA 2LCFA 4BZXA 2XOKA 4HAVA 5AUQA 4PPQA 3K0AA 5BXQC 1N6RA 3KXLA 2WPDA 3O8BA 4II7A 1VKJA 4TL6A 2LKCA 1OHHA 2J87A 1P72A 2HCJB 5DIFA 1CULC 2BCJQ 4EJSA 2WWXA 2WKQA 3I32A 1F2TB 3PUYA 3I8XA 3VR6A 1M2OB 2QMOA 4HAWA 1NRJB 1MRNA 1VG9B 2ZSAA 1KNXA 2B92A 1NMYA 1Q1QA 1E2KA 4WBSA 4JLVA 1W46A 4Q9KA 3VR1A 2F3TA 2ORIA 3U4QA 1II8A 5J4HA 5EXPA 3CZPA 3UK6A 4DCVA 1N5IA 3OEEA 5TY0A 1EFRA 2ZYWX 2VBCA 4NP6A 3UWKA 4RD6A 1MV5A 3WYFA 3QKTA 2F55A 3Q9LA 1IN6A 4CVNA 2WWYA 5JCZA 2CNWA 1DS6A 4BEJA 1IN4A 4Z1MD 5HE8A 2BJWA 1R5NA 3E70C 2OAP1 1G5RA 5DO9A 3OZXA 4K81B 4JMPA 4Z8YA 4KLZA 2ZRAA 1N6OA 2HXYA 4DT1A 3AF4A 4B48A 4LC1A 1JBKA 3ZDQA 4BE7B 2ZRLA 2DFNA 3RHFA 3WMEA 4OQFA 3PVSA 2G3YA 3MFYA 2G9NA 1KO8A 3KL4A 2J3EA 1ZM3A 2GRJA 1E9AA 3AH8A 1G7TA 1FQJA 3IPYA 1Z6AA 3LO5A 3U3RA 2XGJA 1MO5A 1NJGA 4QBGB 1VCMA 4ESVA 3SYNA 4DDVA 3TK1A 3N2EA 3ZYCA 3MAAC 1JECA 2K5UA 4P31A 2QMHA 1Z3IX 5A5GA 4DCNA 1DE0A 2X77A 1YZNA 2QBYA 521PA 1KI6B 4JL6A 1QF9A 1G20E 1U90A 2IYRA 5DISB 3U44B 3P20A 4LDJA 3AV0B 3MJRA 4I1VA 3A4MA 4C0JA 5KSYA 4U7DA 3FHCB 4JT2A 3B9QA 4AKHA 2GZDA 3BGWA 5M04A 1UDWA 3RAPR 1SHZA 3C41J 1CRQA 1X8KA 1NMZA 2G1KA 2ZS8A 2KWIA 3L0PA 2ODBA 5DI9A 3GLHA 4GNKA 1Q22A 2J7PD 1QRAA 4KCGA 2IUSA 3SFZA 1ZBDA 4XOIA 4HB4A 4XWKA 4Q47A 3VHLB 2O0HA 1Z07A 4Q4HA 2ZUBA 4RZ2A 3QE0A 1ZM2A 1R0ZA 3FB4A 2KB0A 1L2TA 4L5BA 1NVWQ 4V0LA 4MRVA 2ZITA 1E0AA 1NG9A 1XMJA 2IL1A 1OXUA 4M21A 2NO1A 3O8CA 2YVUA 1LS1A 1XD2A 1JAHA 2F1IA 1FMJA 3QXXA 4G01B 1CLUA 4OHXA 1ELOA 1FTSA 1ZJ6A 5EE1A 5JMTA 3CBQA 4S35A 1QHGA 3GLFE 4PQFA 4F91B 2KSQA 3MSXA 1Z8FA 2ODEA 4A0FA 2VPPA 3CB4A 3CPHA 4B44A 2O8EA 2QGNA 4IOJA 3T61A 1W36B 3O8DA 2H1LA 3B78A 2FGJA 3SEAA 2KI5A 2FFAA 2ZTSA 2QT0A 3T1OA 3LA6A 3CRMA 5EUMA 2GVDC 2VL7A 4Q1FA 4LX0A 2R6DA 1SKQA 3UG6A 4BASA 3CUEF 3DOEA 3T1TA 1DEKA 2FOLA 5EE0A 3RABA 4AYTA 1FPMA 4MYHA 3V4RA 3EZ7A 3TUZC 3H1TA 4QOSA 4POAA 3OF5A 3LBIA 1P9NA 1ZNWA 1PLKA 2UVQA 3CWZA 3U7EB 2IWHA 3THWB 1LS6A 1AQUA 2C96A 3F5FA 4QHYA 1K5DA 5LB4A 1XMIA 1G9XA 4XSHA 2ZS9A 4F92B 4QBHA 3I5XA 1G3UA 3PFIA 4LUCA 1A1VA 3ZJYA 4DEYA 1NLFA 3IQWA 4LHZA 2WICA 1VMAA 2EYQA 4C0SA 4RD4A 2JDID 1U98A 1A7JA 2OCPA 4LHYA 3TLXA 4XVUA 2BKUA 1FMLA 2VSFA 5GJBA 1TEVA 4P32A 1M34E 2ZANA 3MG9A 1CR1A 4HAUA 3VQTA 2RHMA 1RJ9B 3QI2A 1A5TA 2AWNA 2IS6A 1GKUB 2J45A 4KXFB 1QHSA 4JLDA 3V9PA 2ANBA 1DAHA 4TMZA 1TQ6A 3GP8A 2JJ2A 5H70A 5CB8A 4N0DA 1XNJA 1KMQA 3NC0C 1NLYA 1N5KA 4WXPA 5AR1A 1AK2A 3M6AA 5L3QA 3THYB 1EXMA 3EX7C 1R0YA 2CVHA 2ZSFA 1OXSC 2ZJAA 1EESA 4ACAA 1AGRA 3A1SA 4QRHA 2ANCA 3H4MA 3KTAA 3ZQ6A 4OHYA 3BS4A 3OIUA 2PZFA 1GM5A 2DWPA 1L4YA 1Q1ZA 3AGPA 3U7GA 1UBEA 5DE3A 4B73A 1VECA 1SZPA 5FI1B 3IEVA 1E2DA 1T3SA 2PCJA 3SYKA 4LV6A 1Z6TA 1G7CA 4HLUA 2CEAA 3A1UA 2IW3A 4V0MA 2BEJA 2I1QA 4V0OA 1Z47A 5B64A 1ZCBA 2QTVB 4B71A 1EFTA 5KPJA 4PHTA 8OHMA 3TVDA 2NZ8A 2DBYA 4LJ6A 4Q7LA 4TLDA 3FKSA 2XNDA 3NEYA 1P9RA 3SS8A 3TKLA 4HATA 2DFLA 4KSBA 2RGNA 3B60A 3FYHA 2VP6A 4EDHA 1XDBA 1WRBA 1ZMXA 4W5HA 4BWYA 3IUYA 3E2IA 5F98A 1E98A 1Y3AA 1YR8A 1YR7A 2I1VB 2NGRA 2C04A 2OEPA 5DHAA 1GNPA 1TTTA 4QC2A 4DDUA 4M22A 1ZW6A 3DL0A 1KK0A 3BH7A 1ZCAA 2QY9A 2ZROA 1Q57A 3DZDA 1DADA 1DAFA 3IO5A 3SC3A 4A0RA 1KIMA 1OFIA 2CL7X 3CR7A 4B6FA 1FQKA 3BFXA 5C2JB 4Q1DA 3THXB 1E9SA 2H8KA 4URXR 2W6IA 4Q00A 3IDQA 3UXMA 4X8OA 2HYIC 1CF4A 1W5TA 3A1WA 4JVNA 4LC0A 4MGIR 1E9FA 3B13B 5UKDA 4PQYA 4GPTA 5FBRB 4AIIA 3L43A 3VX4A 3HPRA 5KNBA 3FMOB 5CLLA 1U0LA 3NBFA 1XZPA 2FN4A 4LYFA 4F7WA 1U9IC 1DO0A 2GJKA 4DCUA 2R6FA 3G0HA 1AM4D 1KJZA 1GL7A 2ASEA 4LJ8A 4P0TA 3K70C 3A1VA 4HEJA 4PC6A 2VHCA 4D82A 3U6BA 3BFKA 3FWYA 1JXMA 3WYGA 5FH9A 2WJGA 2X2EA 1OH6A 4A9AA 1RVDA 2BBSA 1YHNA 4DIEA 3SR0A 1SHKA 1C9KA 3ZVMA 2ZI7A 5H8WA 3KFVA 3T34A 3PG5A 3QSYA 1KI1A 2ZEJA 4H9GA 5DGXA 3T1VA 2W00A 3WHLA 5JJKA 1ZU5A 4NYMR 1F3OA 1HV8A 1NSTA 2WZQA 2ZYTX 3VR2A 2GDJA 2C98A 3B1YA 1WE2A 4LI0A 1VPLA 3EA0A 2P65A 1P2UA 2VHUA 4B2PA 1OH5A 4HSEA 1E6CA 5FBWB 1RRCA 3DM9B 2OLJA 4LJ7A 2FPLA 4Q7MB 4KYUA 1DELA 1E9DA 2ZRIA 1WDTA 3RSOA 1H65A 5FOUA 4Q66C 1YJ5A 3E1SA 1HY3A 2P3SA 2ZI3A 3MGCA 1KMHB 2ZYUX 4KLNA 1UEJA 4ERNA 3I92A 3TGPA 3G5UA 3SHFA 3W5IA 2WJJA 2MSEB 3KXKA 5CJPA 2PMKA 1LNZA 1T0HB 5HR5A 1SKYE 1DAMA 2WJIA 1TAGA 5HPYB 4XTRA 4TTQA 1HQYE 4Y0VA 5AJYA 4C0AC 4DXAA 5JLJA 1T3HA 2HDNB 3N5CA 2GBLC 4PAMA 2NOAA 2F7SA 2GWHA 4OYHA 2CCKA 3UMFA 4A4DA 1IY2A 2W83A 3U44A 3LH5A 4LJ9A 4XIGS 4PR0A 1UADA 4R2IA 2ZI6A 2CLCX 1M7BA 4IHQA 4Q02A 2QBYB 1Q44A 2FSFA 1E3MA 5IDVA 1Q21A 2P2LA 1S1MA 1G4AE 4KITB 2OV2A 2NIPA 1DPFA 3WRXC 4EPYA 4QBIA 1NN5A 4HAZA 3RNLA 1JEDA 1P3JA 2A30A 5AUOB 2CL6X 2Q21A 2O8DB 1OKKA 4C30A 3DMNA 5JI2E 1UBCA 1KYIA 1W5SA 3KUDA 4G3XA 1G4UR 2ZRPA 5JSZB 1D9ZA 1H8EA 2P5SA 3LQQA 3NKVA 2CBZA 3X1XA 4BQSA 1KSHA 2BCGY 5KHOC 1KDRA 4NE2A 1E2NA 4B34A 1ETUA 4RZ3A 3RVBA 3U7FB 1JB1A 1P5ZB 3GLFB 3KXIA 2GESA 4CEIB 4HDCA 1GAJA 2VSXA 3WBJA 4BFZA 2AKAB 3SJBA 2YKGA 5FPTA 5ANRB 2H5EA 3PEUA 3ZVLA 4B47A 4DVGA 1CRPA 1PZNA 1XMSA 2WMNB 1E0KA 2YYZA 3T12A 4MYTA 4U02A 3A58B 2Q6TA 2ZUCA 3CPJB 1FNMA 3GJ5A 4JYBA 4QGGA 1EX7A 1MT0A 3FMIA 3IEUA 3GFOA 2OE2A 5FPHA 2IYWA 1JJ7A 1Z0AA 3OFNA 4OKSA 5HZHA 1YQTA 3BORA 1QVAA 2XITA 4OQMA 3AF2A 1PUIA 1QDEA 4YMVA 1EWRA 4X8MA 1GIAA 1MO3A 3JVUA 1UAAA 3ADKA 3QKSB 4RSGA 4C0BA 4TZ0A 3QY0A 2D2EA 2D2FA 3CX6A 2FZLA 2WJYA 3THOA 1NKTA 1DTSA 2OG2A 3HDTA 2WIAA 2MSDB 4TMXA 1E4VA 3U6KA 3REGA 4JVSB 2Z5FA 4JLOA 1NJFA 5JHHB 3NVAA 4KBFA 1JQLB 3AVUA 3TMKA 2J0QA 1YR9A 4URYR 3ZS9A 2ZR7A 4OI4A 3R9XA 2W6JA 2IXEA 2ZRCA 4JZKA 3KZ1E 1E2LA 4QG7A 1X8JA 3B1XA 3U5ZB 4CYMA 2FV8A 1X1RA 1QG2A 1G1MA 1US8A 3GFPA 1WF3A 2CCGA 2BMJA 3HWSA 2P6RA 3LW7A 1M8PA 4M9QA 5KNDA 1RW4A 3KQHA 4Z1MA 2F9MA 1EFHA 4NZYA 4B32A 4CF7A 4I99A 4URUR 3Q7PA 4A0HA 4PPGA 1KDOA 4QL3A 2CLDX 4NDZA 2NO0A 1XZQA 1YR6A 1NP6A 2V7QD 3DVLA 4FWIB 3IIJA 4YDHB 4NU0A 1T9HA 3NDBB 2WSMA 1AZSC 2RGAA 5LD2C 4HAYA 2ZRBA 1Q1EA 1S8FA 2W58A 4AI6A 5CIQA 2BMFA 2H92A 2J7KA 2QORA 2XAUA 1OIXA 1OJLA 5A0FA 2A5JA 1UPTA 1OHHD 4BFTA 4D0LB 1E0SA 2Z6VA 4BPBA 3CF0A 2JDIA 1LV7A 4DLYA 2PMDA 4UNQA 3BOSA 2UZ3A 3KKPA 4TQ9A 3RS0A 1COWD 4LYJA 3R7WA 1Q0UA 3NDPA 3WMFA 3CF2A 3ZZ0A 4E22A 3KB1A 5SZIA 1KJYA 3SJAA 4EPRA 4M9XA 3UIEA 2QN6A 3CH4B 4AYXA 4Q01A 4M1OA 1Q12A 4B33A 4Z54A 3UMRA 1KGDA 1JJVA 3L0OA 1HE1C 2CK3A 2GCOB 4UNRA 5EE9A 2NO6A 5CB6A 3AUXA 1MR3F 4LBZA 3KQKA 2O8FB 4IOLA 3LX8A 2ZSDA 5LD2B 3I4LA 2FFQA 2JLSA 5BW8A 1ZM9A 3I61A 5CIWA 1YZLA 3IGFA 3QPVA 3R8CA 4PC7A 2GILA 1TEXA 121PA 1XTIA 3AVPA 1HUQA 4JYCA 4ARZB 3UMSA 4IOMA 1JR3E 2ZRNA 4EJSC 1XXHA 2JLQA 3B2EA 5F9FA 2ZXUA 1OT3A 2O8FA 1O3YA 3RRYA 4A6PA 4EFMA 5JEEA 3NIBA 2GJ8A 2Z4RA 3LV8A 4URZR 5AWFC 1NI3A 4AKEA 4DBLC 2CK3D 5DLQC 1IJEA 2ZRDA 4HLQB 1KI8A 1KNQA 3L82B 5KPDA 5C18A 1R8SA 1UFQA 1SQ5A 2GXUA 3PUZA 4GMXA 1XB2A 4RFVA 1U94A 1BYIA 2ORVA 2ZIAA 3BD9A 4M4SA 3QG5A 1WMSA 1GDDA 2ZRMA 3KKMA 2ORWA 1IN8A 2AFIE 3U4QB 2QAJA 3SHWA 1K5GA 2R6AA 1EX6A 1E1QD 2REOA 4I1UA 4ILEA 1UEIA 3K0CC 2GCPA 5G53C 1G64A 3CX8A 3OE7A 1B23P 3OEHA 5AJZA 1DARA 4NONA 2CE2X
chains in the Genus database with same CATH superfamily
4AMBA 4M99A 4LMPA 3RGGA 4F04A 3T1YB 1JB9A 3CRVA 3ZQKA 2IXBA 3MWEA 4ID3A 1N6LA 4QUDA 4KMMA 1USVA 4X7MA 3YASA 4PX5A 1Y8QA 4RH1A 3LFHA 5FAXA 2CYCA 2PUEA 4MV4A 3PQ8A 2EKBA 1LFDB 3GV0A 4G89A 4XRRA 1C7ZA 2I4RA 2HJSA 3IV7A 2JGKA 1J20A 1E4EB 3HDHA 1RXWA 3AL0C 3E1GA 4X24A 3FYUA 1RFLA 1T8UA 4F45A 3I9MA 4GIBA 4FSDA 4TKLA 3H2SA 1XXHE 4UASA 3VO8A 2E49A 2I2XB 3CF4A 1DT5A 4RF5A 4U8HA 3WZLA 3ZHCA 1IHPA 1TVEA 5AIAA 4TMWA 4BYGA 4DMMA 4ENUA 2J9FA 3EXEB 1EP9A 4QXQA 4TV8A 5ED0A 1V95A 3C15C 4GI7A 4EW1A 4ZMBA 3VKVA 1R4NA 1E5QA 1KSJA 1N57A 1XTUA 3A2LA 4MV1A 2PZLA 4A0SA 1HZZA 2A6PA 1QIMA 2II6A 3TAHA 4DLVA 1RHQA 1Q20A 4OXYA 2PQ0A 3FPLA 1KP3A 5JXIA 1NW9B 2YXPX 2VLBA 4MV0A 1TKAA 4DWOA 3KKEA 3AKEA 5DXAA 4QDJA 4CWAA 3GJ6A 3V1MA 5A71A 2Q4EA 1JP7A 3Q6NA 1XX6A 3TW8A 3OOEA 3R0JA 1D03A 2DBQA 2PPLA 4Z0HO 4GX2A 4BVFA 4C78A 1GTRA 4LRUA 4WUVA 1I0IA 4YXWA 3ILXA 4YFVA 4JQCA 2H31A 1ZK4A 1CXZA 2QGFA 3ENQA 4HSGA 3RM3A 3RVNA 4ZDIA 2RK4A 1CDEA 3QVXA 1JU4A 4I9NA 2DWOA 3EGEA 4IGAA 1EM8A 1B0PA 3E5NA 3K1JA 3K4PA 4AF6A 5ALXA 1MKYA 3TW4A 5A3JA 5T4HA 1J5XA 4Q4CA 1PZMA 1IWOA 2W2NA 5I8WA 2EKPA 3M1IA 4M9ZA 1CZLA 2YC2C 5JS6A 3ETNA 1NRWA 3IQXA 4KEAA 1UDRA 3IJPA 3KLBA 3RWBA 2LDBA 2NTJA 3F0TA 4JCCA 4V2UA 4M0UA 4DQ0A 1R66A 3VDMA 1GCGA 2CVFA 1KJQA 4D3XA 3D0RA 4Q9JA 3HXTA 3IP5A 3VPBA 1IJBA 5HKOA 2WUWE 5DI3B 3PDCA 3MGAA 4JXJA 4D96A 1J56A 1PEAA 1SVWA 1GGNA 1TEHA 2JBWA 3CEPB 3CONA 3LXXA 4FT4A 2VK2A 3VZPA 1PE0A 4KR2A 1HE2A 1THGA 1N9GB 2QF7A 3TW0A 1H2FA 3BSFA 2AF4C 2QD1A 2G0NA 3B1WA 1T3ZA 4P7GA 2XTAA 3WNDA 1Z5WA 4MI9A 2BLLA 5JQWA 1ZD1A 2P0EA 2R7NA 4ZO4A 2I22A 2GN1A 2VPYA 4IIJA 2ZIVB 2XVAA 3VDXA 4ZALA 1IK6A 2J5XA 3VR3A 5AW9A 2O3JA 4B9EA 821PA 1WW8A 5DTRA 4D0SA 3UQYS 1XN1A 3A9UA 4XDZA 2P4SA 3HJGA 4HEHA 3R3HA 5BWBA 3EJ6A 1QVWA 4PCLA 5A3SA 2BEVB 4ES6A 4MP6A 2QMYA 3LD9A 4GLFA 5DTQA 4ZIRA 1O6ZA 4J7AA 4ZOLB 1G3RA 2AUMA 3EAFA 3OFVA 1IM2A 1WPQA 2JVIA 3UV6A 4AG5A 1AXEA 1PU2A 4FMDB 1RABA 2DFTA 3T5GA 3Q8XB 4RFLA 1YQUA 1AS2A 3AUSA 3FNBA 3KZVA 1QCCA 3LK7A 4CKXA 1JFTA 4B3RB 1ARZA 4RS4A 5JROA 1X80A 2JGNA 1Z0JA 4I4TA 4KXVA 3SY8A 3VISA 4A15A 4EUNA 2IYVA 3NHKA 1CY1A 2IYAA 5I9TA 3CKKA 3F6BX 2X8JB 3HO6A 3QFRA 4OH7A 1M2NA 1QFZA 1F2UA 2BGNA 2JL1A 2ZREA 4RF2A 3UAWA 1R88A 3WTCA 3ZWWA 2VJYA 2PZGA 1YJ8A 1D1PA 1GGHA 2IHJA 1GKLA 1K6MA 2QJFA 3IB6A 2SICE 1TVMA 2G1AA 1SUWA 2FHSA 2IU4A 4WZAE 2ZIFA 2J3KA 3U3KA 2JRCA 2ZM6B 4A0GA 5EKDA 3W9YA 1OXTA 2IE0A 1N3YA 1T10A 1C9JA 4MMXB 1HK7A 3U4AA 5JU6A 1PUXA 1YGYA 4IJVA 3QVLA 1CS0A 4QQFA 3PA8A 2MJLA 1V6SA 3PHCA 1UZAA 3SSAA 2AHRA 3GUHA 5B57C 2Y1CA 2R87A 1QLJA 2VOJA 3Q98A 3D1LA 2VNKA 3I9JA 2XB4A 3MINB 3T5CA 1B6GA 1PIWA 4CKBA 5JUWA 1IJKA 2HTFA 2JD2A 1P80A 4H4CA 4EK9A 3C8DA 4KYTA 3QXCA 1PS0A 1PGJA 1QKJA 2HF9A 1Z4JA 2PX2A 4QOEA 5FTKA 4F60A 1ZUNB 2GCNA 3G23A 2C8JA 3L7BA 4OM7A 4GP7A 4BVJA 3NTUA 4O4JF 5KQLA 4GL2A 3M1AA 4GM0A 4HWTA 1K3TA 3OIYA 5L3RA 3AG5A 4O0LA 3EIHA 1Z2CA 3NC1C 4G56A 1FLNA 5KAPA 2VHJA 3WFJA 2O7VA 4TN1A 1T4DA 2ZVDA 1SBIA 2HZBA 3DW1X 3DR3A 4PGGA 4M1SA 1CEYA 4EUHA 2QU8A 3VZQA 5TR9A 1KZ9A 1VCIA 2NG1A 3QW4B 4HNQA 3ROFA 5DN9A 5BP7A 4KLAA 4UXJA 3UT6A 1FVXA 2WSBA 2HTEA 1JYFA 1E69A 3K0AB 1WNFA 1W1IA 4E33A 5G4KA 2AG0A 3AVTA 1C7EA 3EEQA 4O02B 1YO6A 4EECA 5IVDA 3NNDA 3L46A 4OP2A 5B2EA 5KNBD 2YS7A 3WWEA 3RAFC 1T1EA 3FBTA 3T38A 4GE0A 2ZBEA 1IY9A 3OLQA 3ZVNA 3BFVA 1FP4B 1FXWA 2EQBA 2I87A 3GXBA 4YB8A 3K1AB 3HU3A 1Z33A 4P82A 3ZY5A 3N59A 2XZLA 5AVVA 4L22A 1KVQA 3TRDA 1N9ZA 2Q5HA 2GCGA 1FTQA 3C45A 3ET4A 1PQ4A 3QPCA 4Q3KA 3DUWA 4RDHA 3TS1A 4CHGA 5CDHA 5IZCC 5LVAA 5IHPA 4X94A 2HGZA 1KF0A 3MMZA 4WD3A 2PZMA 2PMEA 1I3LA 2JFGA 4YBRA 3RTCA 3ZD7A 4RTPA 1NVVQ 2AMYA 3E9MA 1J49A 3H8JA 5KTTA 2D5CA 3LL4A 1O6FA 4HTAA 4WCFC 1IWPB 2ZJYA 1G19A 4XASA 4BKQA 4CTJA 4KNVA 1FX0A 1NBWB 2J3JA 4B3FX 3GLQA 4PEVA 4TVBA 2EC5A 4X85A 4K46A 4Z4HA 1H1LA 1Q1GA 1Y5LA 4KI7A 2WIGA 2G80A 1PJ4A 1LJUA 3WNZA 5EKUA 4PO8A 3LMKA 3IP3A 3U48A 1TYAE 4LV8B 1LTQA 1HNNA 2PG3A 1FDRA 1X7HA 4ECEA 4IJMA 5FQNA 2OHHA 2ZT8A 1U8YA 1RQRA 3OECA 5FTNA 4ZCIA 1C7IA 2J9XB 3LT5A 2P2DA 1ZSYA 1PWYE 1QFYA 2I7XA 5CW2A 2RKBA 1DIOB 5FOTA 3A1TA 4ZI7A 4CEHA 1EIWA 1YZUA 2D0PB 2PUJA 4LHXA 3GJ4A 1YBVA 3DMTC 2ZIXB 5L3ZA 3G5LA 1D07A 3PIRA 3ABOB 3KOYA 3EEIA 3QYAA 4BIMA 3R8XA 2HPZA 3ND5A 4K0KB 1QIEA 2WJHA 4MZDA 2Q7OE 2FEOA 2ZJ4A 1LF5A 4MJ7A 5KQPA 3O73A 1CJMA 4M8SA 1E61A 4XWTA 3TSOA 2F3RA 2VRWA 1Z0DA 1ZLXA 2X3UA 2YQ4A 4PANA 5SYMA 3X44A 3BSYA 3IJEB 1EQAA 4BEBA 3BVPA 1XRPA 3IJRA 5FUYA 1B15A 1G3MA 3NZEA 4I0WB 1L7QA 3X2EA 5IT5A 3H8WA 4V38A 2J3QA 4TMTA 4P38A 1JIUA 5E6RA 5ALYA 2UZ4A 1T5HX 2OZKA 2QAGC 3IUMA 3PJFA 1BE6A 4P8RA 1IXSB 3S3TA 2G09A 1N1MA 2XTMA 1OFHA 2W98A 1R37A 3QMWA 2O19A 1W4BA 5AKKA 5BNWA 2Y27A 3GJZA 1I4DD 5J4KA 2VO1A 1RZVA 1S02A 4MVJP 3V1NA 3A6EA 1A71A 2Z4SA 1T36A 4HDRA 5KTOA 1I7QB 3OWOA 4TM8A 2Q0HA 2X3FA 1RJ9A 1I6MA 2P2ZA 2ZJ3A 1BCRB 3CCBA 4Z3DA 5ESXA 4DG8A 1FPQA 3N1UA 1P0PA 2DRIA 1I4LD 4WT7A 1ZRMA 3TVTA 4C5CA 5DCLA 2QPAA 3QEBZ 3OQJA 4WA8A 3VC7A 2QIPA 1XKTA 1YK0A 4DAOA 2FSVA 1RLIA 1P4RA 2OB1A 1SKMA 3SI7A 5IJ0B 1KOGA 2XXAA 1ZEMA 4G5SA 2GK4A 2AOWA 2I66A 4TT3D 1S8OA 4AG6A 5EUQB 3B6MA 3EXHB 4I2VA 1GKIA 2QL9A 5DM60 3T94A 1VYTA 5IXJA 1JR4A 1P6XA 4IXNA 3TFQA 4DRZA 3W2HA 3WLEA 4C3ZA 3DFUA 5HGXA 5JAIA 4GZLA 1Y37A 1DG3A 2F64A 3U1BA 4O8CA 2P4UA 4B3MB 4IQFA 3B38A 3WLJA 1Y9DA 3GLIB 2UZIR 4L08A 4KGDA 1BDHA 3GBPA 3T52A 1JWAB 1KY3A 1T6BY 1Y33E 3F3MA 3GRCA 1XEXA 2VPIA 3QWBA 2KBFA 4AYWA 4XUEA 2QTWB 5IMBA 1GPDG 2UXCB 3VR4D 4NYJQ 2CE7A 3UJBA 4QNNA 1AGPA 3RLIA 4E7OA 1U0JA 4TVSA 1T5SA 4LWQA 1CDZA 5EIWA 3VJRA 1EG7A 4W8OA 4KWCA 1KVTA 2X76A 2FR1A 1GN8A 1XTVA 3LY9A 5FL3A 3EAGA 2RH4A 1P75A 1M1NA 2GEVA 3ANYB 2Q07A 4ARVA 4D9EA 2KJQA 4HAIA 2OCIA 3WR5A 4RPKA 2OCLA 4G5GA 4KJZA 5F3RA 5TLSA 2QYHA 4LJRA 1W36C 4B2LA 1GPMA 1HM5A 4PZDA 2AJBA 2AR9A 2J5KA 1YA6A 1SPBS 4BFXA 2EW8A 3KJGA 3ML1A 1IBRA 1U02A 4HFJA 3AZPA 4MVJH 4WZBB 1OLUA 3LXRA 5BY2A 1CUWA 1SIBE 3A2NA 3GGOA 1AX9A 2QX4A 2YJ6A 2PUVA 4TSKA 1JHMA 1W44A 4BNHA 3GPLA 4HX9A 4KVAA 1LU9A 1T5LA 1UDBA 3ZGXA 2X19A 3GGSA 3SJUA 1A2KC 3BX1A 2BKXA 4MWCA 1MZPA 1BWSA 1G60A 3L05A 5HUJA 2N47A 2E6KA 1NBME 4LZZA 1U0OC 1EE2A 3IVGA 4OGLA 2AN9A 3QKRB 1KGSA 1V39A 3RU3A 1JBQA 1JAIA 1L3IA 2QHXA 3PF9A 4EA7A 3KQSA 3Q5GA 4Y2QA 2C99A 1E94E 1GZSA 4RE6A 3JZFA 3NH6A 3T0GA 4D9IA 2BFDA 4EVQA 1XVIA 4KXMA 2H4JA 3QLTA 1VIAA 3A4LA 4MYCA 5FL7D 4KWHA 4S0XA 2ADOA 1LGYA 4LPSA 1PAUA 2X23A 1IOVA 1HURA 1K4MA 4P80A 5CDFA 2PE5A 1ZGBA 2NXWA 2ZWPA 4BRZA 1CRWG 1YJQA 4R3WA 1UT8A 4G41A 2HBRA 2C2OA 2ZJ2A 2ZRQA 4C0HA 1WQ1R 1HYQA 4JLAA 2ZSHA 4WIAA 4EEKA 1E2PA 4K9LA 4J0IA 1PJLA 3D6NB 5EPUA 1ZN8A 1I7LA 1GNSA 3OTHA 3AP1A 1II9A 4UREA 2P0YA 1PFKA 1SNYA 4TX1A 3PFNA 4CEJA 4YVFA 5ALRA 4ZRNA 3H84A 2BW0A 2XNKA 5GJCA 4JP1A 4LYDA 5AMXA 1A95A 2BUBA 4IV5A 1F7UA 1CY8A 5JNLA 1E3TA 1U4OA 1DMSA 1GA1A 1ECPA 3LM8A 1Z5ZA 4TXLA 2OVBA 4DTIA 3OFKA 3EPHA 4TYPA 1IG0A 2OCDA 4HDMA 4BFCA 5KB3A 2GAAA 2WM2A 2XDWA 3HPQA 4HYQA 4QFCA 2C31A 4BLQA 3MFQA 2PBZA 1JVSA 1LF0A 3AR9A 4FP9A 1G0NA 1ZD3A 4GWLA 3N75A 2CHEA 3IERA 4QEKA 4RJ2A 3RTDA 3ZE6A 2Z58A 3BZUA 3ZVRA 2X6QA 1WCXA 4QHSA 4F4UA 5SZHB 2DVMA 3FUXA 4RV9A 5AW2A 1HTWA 2RHJA 3C4VA 3IEIA 4A8PA 4CGYA 4X90A 3SM3A 4UEQA 4YAIA 1NOJA 1XF9A 1H6DA 1YR2A 3GA0A 3O4JA 4P4SB 1OV4A 1Z6GA 2HJGA 1BDBA 1EGMB 2HT6A 2PH3A 1RWPA 2Q1XA 2WOJA 2I6XA 4OUKX 5BN5B 1CJSA 2WU8A 3EW9A 5KCMA 3TQFA 4WH0A 4DDMA 2HDOA 5KDDA 3ZDBA 3G0CA 3DAPA 2G7MC 2R1VB 4FZJA 4CKZA 3O6VA 3GLTA 4NQZA 1QZTA 1KK3A 2WQ7A 2V7UA 1EHYA 2ZUVA 4JJAA 2JIMA 3LRXA 1R16A 3UWPA 1HNWB 3VR4H 2Z3ZA 2WAYA 3D4PA 5L3SB 5J23A 1WQ3A 4Y1RA 2HJVA 4R69A 1CIPA 4AMYA 1Y81A 2GCIA 1GPJA 2UUOA 2ZQYA 4J75A 1AH2A 4YLGA 2I62A 1VPDA 1QYCA 1UXHA 2BDTA 2DJIA 2HQBA 3NXSA 4QPDA 5FCDA 5FPKA 3G79A 1AS3A 1E2JA 1DJPA 4ZGWA 4MB0A 3D2AA 2XNCA 3NWPA 1GDTA 3EA5A 4MCJA 4I66A 2IUUA 1CEQA 2ZBPA 4HX2A 4CN9A 3M33A 3VKUA 3QX3A 2H9AA 1LPNA 5B12A 2AA3A 1CVIA 4JVOA 3CR3C 2K2QB 1QFMA 3BXZA 2IXTA 4NK5A 2JLZA 4W6QA 1RYDA 2W4MA 3B3AA 1PWEA 3H16A 3CRW1 4XZ3A 1FFEA 1R6DA 4DSNA 1E0JA 1YR1A 1V26A 4D4KA 2VDUE 1OC4A 3PHIA 1AKEA 3ULKA 3K70C 2QN3A 3CJRA 4IRUB 2ECOA 3HKCB 2HWUA 2IYQA 2QEQA 1DBPA 2W43A 3EK2A 3O3CA 4DLUA 2VQDA 4XM1A 4NQRA 4KXNA 3WJ2A 3PNKA 2AF3C 3WFZA 3NBKA 4QPZA 2DX7A 1SVIA 4G97A 2YWFA 1OFUA 3GY0A 5DHQA 3RVJA 1IAVA 3T15A 2F1RA 5ALPA 3SK0A 2ZRHA 4D3SA 3M1YA 1WXIA 2REBA 3ONWA 3BE4A 3HUDA 3IUPA 3V2HA 1T0JB 2F59A 1Q6ZA 4ZKEA 3OIDA 4CIDA 3L4BA 4IFBA 3MAJA 3R5KA 3V7YA 2HHHB 2XBUA 3ZCVA 5MN6A 2CZQA 1SVKA 3V48A 1DAKA 3G2HA 4LZNA 3QPWA 2W42A 4MCHA 3UWOA 3OZCA 4P2BA 4F21A 2J4FA 2F1HA 3A10A 3S28A 1AURA 1IXRC 3DG9A 2NX2A 4PPFA 3U60B 3HBMA 1HG1A 2ZZKA 3EGIA 4GGMX 1TTHA 1A5ZA 3PI6A 3WKDA 3GEEA 4A03A 1VE3A 4ACBA 2AC4A 4BNUA 3G1WA 1F0PA 3NBYC 1AD2A 2O2GA 2HIHA 1DINA 3BXGA 3FSJX 2IVFA 2HSGA 3ETGA 4RQTA 1K98A 4OK6A 5KWSA 4D57A 3HLKA 5FTJA 2Q1WA 4LZOA 3IUJA 1LCIA 2BGLA 3D0QA 3ORYA 1I94B 4WPGA 1MW9X 2B9VA 2DH6A 3BERA 3AFNA 5BWOA 4L0QA 2D1SA 3V1UA 4M0LA 5BV1A 1ZUNA 1HFWA 1SG0A 4MEAA 4YAOA 1ZJ4A 2IUYA 4DLTA 5HK9A 4NCBA 4K9QA 2B8WA 2PUTA 3VR4A 3NOQA 1Q2XA 3HZRA 1F9AA 4IZ6A 1NBMD 2EU8A 1L0BA 2W0MA 3NDRA 4JLNA 3ANXA 5B7PA 3G6WA 1H5QA 5FA5A 1SQSA 4WOCA 1M9NA 3MCAA 3Q85A 4XW2A 2Q46A 3FF4A 4NOJA 4O4IF 5IJAA 2H2FA 1V35A 1YRLA 4M0PA 1G291 1V3TA 4MA4A 5AM2A 3RBXA 3PF8A 4G2TA 2DGDA 4RY2A 4FYHA 1OU4A 1ZCFA 1JQDA 2BZSA 4OPMA 3K0SA 2CFIA 3OETA 4CLEA 1EFVB 3OIVA 4N48A 4ALNA 2PUAA 2PJRA 5D5HA 3UCEA 3OKFA 4XVRA 4Y6RA 3RG2A 2F17A 4AG3A 1SC1A 2CYBA 4CZ2A 2OHVA 4E5KA 1Q91A 3AM3A 1EWVA 5AKZA 3GR6A 4HTFB 3AP3A 4O2AA 4P4LA 4EF5A 3QNUA 3CPEA 4MR7B 4PZ0A 1Z56C 4H3HB 4GBED 3WHIA 1ZHOA 2ETVA 3JPWA 1P74A 4MW1A 4B7CA 2O2HA 1F2UB 2Y67A 3GEMA 4RTOA 3KQNA 3LFUA 2FWJA 3ZD6A 4EY8A 3VC2A 1BOFA 2ZTMA 1XWIA 3C7CB 3QSGA 4FOTA 1XA3A 1V3UA 2DT8A 3DMPA 3HNPA 3OMLA 5K6AC 2FOXA 9LDBA 1I5EA 1T5IA 3AR8A 4JLSA 1PJAA 2A3RA 4LNAA 3DFIA 4PCUA 3GPDG 1QQTA 1D0IA 1U6KA 3JQDA 3EVEA 2FQQA 2C95A 1ORTA 3LHIA 3RIXA 2HL6A 3LI2A 3N2GB 3MWYW 5JEDA 5JARA 5C5CA 5L4SA 3O9ZA 3E15A 3ADDA 4CV3A 4X1OA 1ZD8A 4PZEA 3NHRA 1C0KA 3K9QO 3ZU6A 4R1MA 1YZGA 1P5HA 1PZHA 2LNDA 3JQ8A 3LDHA 3PDHA 4JBNA 5JAUA 2EQ5A 1SVNA 1FJHA 4EI2A 1XUOA 2CVPA 5GIPE 4MROA 3TLZA 1D2CA 2EZ9A 1X39A 4BO8A 2P68A 3JALA 1GNQA 1KZYC 1NKSA 4QA9A 1U0GA 1A0OA 2QAIA 2W2KB 5ILOA 1LQUA 2F9LA 3NTXA 1UXKA 2X0NA 1LV8A 2CLIB 1U3UA 1OBFO 2VTKA 3QYJA 4K88A 5HW0A 3ZHQA 3R8FA 1DAGA 1JKJB 2R00A 1THTA 3PC8A 1KS9A 3SZRA 3VRHA 4G85A 1YFJA 2MYNA 4RW0A 1JI0A 3BRWD 4BO1A 1OXBB 1YS4A 3B1FA 2JLAA 4M0FA 3V42A 4L9SA 2EGUA 3CRRA 3G88A 4UZEA 4QKQA 1SWWA 4FMCB 1JLRA 3OQVA 4JELA 3C7KA 1IQUA 4JLPA 1FQOA 4AN1A 5LIRA 1N7IA 3SG0A 4E4YA 4QPCA 1J23A 1AS0A 1ZYUA 2VTBA 1AKQA 3LLCA 1M2OA 2OSBA 3I1JA 3UJPA 3AYZB 3KXDA 4BMNA 2VYVA 1FUIA 2C1EA 2QD5A 1LK7A 3RYIA 1NATA 1OBCA 1VSQA 1T6NA 3JWJA 2KS6A 2QMZA 1FLDA 3A06A 4MI1A 1Q0TA 3K70B 2FB9A 2ZE5A 4CPDA 4RTRA 3WAJA 1FYDA 2OY0A 4CI9A 3CX4A 4YXWD 1M1NB 3FIJA 3MGBA 3ETEA 3PQ3A 4CQMB 2HD4A 3OLZA 5FWDA 1ZJ5A 4JBYA 4WSOA 3DOCA 4PNPA 3MIZA 4IMPA 4DPKA 5DHFA 3SSNA 4GZ5A 4ND5A 4MGKR 1QE0A 4ZU6X 3ZWMA 3N3AC 4LYGA 4RX1A 1EFDN 2X58A 3I5UA 3TMYA 5ILGA 2FWMX 2RGBA 4RQUA 2OA0A 3DYBA 4AS3A 2REXB 1KRXA 2NM0A 2X0RA 3WV4A 2W6CX 3VU9A 1KIAA 1RQPA 3WB9A 3FNHA 3NEPX 4JYPA 5JAPA 2TMYA 4WOPA 3L7DA 2R47A 4IMJB 2Q9AA 4TV8B 4KKXB 2J9FB 3EXEA 2Q3DA 2EQAA 3QQPA 4RWZA 1KJWA 4ZI5A 2FLVA 3RB8A 4DIMA 1LX6A 3MUNA 1Q3HA 1VG0B 5EVJA 2XWQA 1ZR2A 2O4CA 5AW6A 1JEJA 1Q7RA 3Q3VA 1TVKA 1JTEA 1IMJA 1DEXA 3UAGA 2A7QA 2JCVA 1U80A 2MYPA 3F67A 1UIRA 3COWA 4JGBA 5CYPA 3TSZA 5IH3A 5LP1A 2D5LA 2RAUA 5KQMA 2C57A 1X7GA 3MUOA 4WAUA 5KTNA 1CSEE 1OWOA 3NVDA 2QVZX 4V0QA 2Z98A 3ZV5A 4ZJYA 1GQOA 2PD4A 4NPAA 3TX2A 1YIOA 2NO7A 4BQQA 3MIIA 1YBHA 2YXBA 1JG2A 2HQSA 2W2KA 2XMRA 3QOFA 5TPWB 4MKFA 4KK3A 4NOKA 1QRTA 1GA6A 3NC4A 2DZDA 4JA2A 3OEED 3H9BA 3L8DA 5BV0A 1TNDA 1H3FA 1DC8A 1F8FA 1XLWA 3HI4A 3IT1A 1NXQA 2I4MA 2YWRA 3P9IA 4MCIA 4TVKA 3MD9A 2EJWA 3U3MA 3FY4A 1U2GC 3EZ2A 2O3TA 3ZCPA 1EVLA 1S96A 2Y6UA 5EA2A 3O2QB 1VG1A 1CKEA 1ZI8A 4BP3A 5CT9A 4N03A 2IYNA 4X20B 3QVVA 3WL8A 1FQWA 5BPFA 3DB1A 5EP4A 1SXJC 2Q3CA 3LOUA 3P9NA 2IYXA 1XZ8A 2VP5A 2CC2A 1MVOA 3VH1A 1GR0A 1XEWY 3RS4A 1V7PC 1REQB 3I6BA 4JP5A 4QGHA 2Y4OA 4WACA 5FOVA 3O4IA 1A9RA 4YAFA 5A2GA 4G5RA 4GE3A 4W5QA 1VYVA 1ISFA 1M0WA 4AF7A 4F2HA 2G5TA 4E2ZA 1XLTA 1LRKA 1KQOA 1PJ2A 4S3MA 1OAAA 4ZAZA 1WUHS 4ALMA 5JDIA 1TQ4A 4P98A 1FFCA 4OQNA 3RC8A 4CFYA 2XODA 3L92A 5BSEA 2V9ZA 1BAPA 2GLUA 3GCWA 2YXDA 1Y5IA 1CQWA 3PUXA 2L42A 1O03A 2HRCA 3PHHA 2H54A 4P4UA 3OTOB 4UEKA 5BQFA 4H7KA 3ZH2A 3HVIA 3U31A 4ZZ0A 2V7XA 3KSBC 2IT1A 4BQRA 3PD1A 1A5SB 4C4AA 2GJ4A 1C81A 2C4TA 3K0BA 4I55B 1QTNA 3O82A 1SHTX 1NVGA 4AC9A 4HGNA 4CU5A 4MVCA 3T9DA 1G8SA 1I24A 3FZEA 3UV7A 5TEVA 2PXHA 4C2TA 4JQYA 2Y1DA 1GG9A 1DHTA 2PH1A 1U1CA 4BLPA 4OHUA 1I2MA 1J2TA 2HWYA 2R11A 1W4ZA 2VT6A 4JH0A 3DDCA 3KVVA 3PQ6A 1MDFA 3DA8A 3HFJA 1ZC3A 4L6AA 4QBTA 5TC4A 3U09A 1D2HA 4Y6LA 2ISCA 5LNK6 4DNOA 1JQJC 4TL8A 2CDRA 5LP6A 2EDAA 5DNAA 1H3EA 2ZYIA 4H1UA 5F76A 2CB0A 2GPTA 3CFYA 3HWRA 3MVEA 2TSYB 3CY6A 4JN6B 4OQ4A 2A5YB 2QT1A 4OI1A 1RTKA 4KPYA 4V24A 2O3RA 1N4AA 3BH6A 5TMBA 1H9BA 2W2LA 1QHHB 3SD7A 2OD7A 2G70A 3LVFO 1GZUA 3HABA 3KIPA 3PENA 2G0TA 4KFSA 5CXSA 3T6KA 3PP8A 3OUZA 4AY2A 1PEDA 4RSRA 2W2TA 3EEFA 5ABPA 1FMFA 3HA2A 3GMDA 9LDTA 3WGKA 2AE2A 4PSKA 2O7NA 3ZU3A 4F8EA 4YAGA 5JTUA 2J67A 3B52X 3MBOA 1WOYA 2GZRA 3ZY2A 3HB9A 1FLAA 4X00A 2N46A 2NUTA 3K9GA 1YF3A 2XMQA 2B7LA 3FCSB 3OQPA 3A27A 4MKXA 4EJ6A 2CUZA 2CL0X 1SCJA 3R76A 2FMHA 2E1PA 5TVKA 4KUEA 3RC2A 2G4VA 2XWBF 4ZDKA 4OB7A 4CF5A 2NO9A 3PC2A 3AFOA 1GP2A 3HI6A 2NVBA 5K8LA 1BC5A 4R6XA 5BOSB 1IVSA 2GM3A 1Y4UA 4FI3C 2P5TB 2DHRA 5IYZF 2DHCA 2J9YB 3AO0B 4KN9S 5DU2A 1BRMA 1Z15A 4NCIA 4ZO9A 5LA6F 5IJZA 2X8AA 2IYZA 1ODSA 1PD0A 1X2BA 2CDNA 2ODTX 3A3NA 3AFIA 3DHWC 3HJRA 4FFBA 4I4NA 5EP2A 5GAJA 3K8OE 16PKA 1ZL0A 4G2NA 4CT5A 5K0CA 2V7WA 1Q16A 5JRZA 1FDWA 4IIJF 3DFZA 5ESWA 1NQUA 4CLOA 5KYXA 5DGHA 1R6TA 2Q6KA 1F8GA 4HB2A 3RIMA 2IHNA 4JGIA 1QGED 1S2DA 4NTZA 2QIOA 5HP4A 2F48A 1L7MA 2QVXX 3JVDA 3JU3A 5JZ9A 3ZLJA 3EOZA 4K03A 1V5EA 1H94A 1NL3A 1XEXB 2XLCA 4A6DA 3SXUA 3X2SA 2ZVPX 4G0NA 4J7UA 5CVTA 2FPOA 3MZ0A 3NMUF 4E14A 1FTWA 1VL1A 4BECA 3KKKA 2ZJ1A 4XCVA 3BE8A 2CFRA 4NZNA 2G1PA 1PV2A 3IMFA 4OX9Y 3WGYA 4HWSA 3FN4A 1DHRA 3DF9A 1QIGA 3E2PA 3RODA 3FTNA 1G8HA 2ACVA 1L1QA 3G2MA 1KPHA 3A31A 2CBXA 4R1PA 3ZE1B 4PC1A 4WBXC 3HBLA 2H2DA 3OJEA 2JFQA 1GYPA 2IK8A 2K7FA 4MJLA 4MPRA 4ZI2A 4WNAB 4BB5A 1T2AA 3IIMA 4N0MA 1RXYA 3NNNA 1LD3A 5IDQA 3UW1A 4RQBA 2ZJ0A 3TLGA 1GTZA 4G9GA 4TTTS 3VPFA 1X80B 4PX3A 3BIFA 4L6IA 1TO6A 2PMBA 5BQ3A 4OK3A 5K8UA 4ZQCB 5EN4A 3G5AA 3REOA 3VNVA 3G9TA 2W2MA 2D06A 5ICMA 3H5NA 3H4IA 4AZVA 3KLPX 2H0RA 1FUKA 2RIRA 4MR9A 5CLQA 2YOFA 5AKHA 5B58C 1DKQA 3VNAA 4DMHA 3MT0A 4I5EA 5IAAA 1VFNA 4I8XA 2BUAA 4IPTA 3ZCQA 1DRWA 2AJTA 2EJVA 2QRQA 2J6CA 2G71A 5IS2A 3EGXB 3AIMA 4LFAB 5E6RB 5ALVA 2RCYA 4WTOA 5JQGF 1MRSA 1PFYA 3KPVA 2FLWA 2V0CA 4ICIA 4Q7KA 4KWTA 5ALDA 3EEBA 3UUGA 4MWOA 1YB4A 1AKTA 1VTKA 1U9YA 1RRFA 2FDRA 4AZWA 2VSOA 1VLZA 2M98A 3MCUA 4M8IA 1W75A 1BJRE 2M32A 2VJQA 1AKUA 4H6WA 1DLJA 1N2CE 3RV3A 3T4PA 3WLQA 5ALTA 3SBXA 1J2YA 5BPHA 2JLVA 5LDDC 4RMIA 1PL8A 2J85A 2ZRKA 5G4LA 2WE7A 2YWXA 4JJFA 4UPEA 4GYWA 3N6VA 1X94A 2A5GA 1SKYB 2HN9A 2X9VA 3AMVA 4TWJA 3A9CA 4YO7A 1SHLA 3AERA 3CLKA 4CQLA 1UC9A 1YZTA 2QTMA 4HLCA 1RIFA 4Y18A 1EAYA 5EWJA 4HX5A 4FCTA 3ROTA 1FE8A 3FCYA 5F64A 3I5YA 3LBHA 2Y1OA 4MGYR 2QZ4A 5JCXA 1QRSA 4IDQA 2GTHA 5AJXA 1MRZA 1KMHA 1U7OA 4N47A 5EJ5A 3LC2O 1U9JA 4DGQA 4KRYA 2IITA 1PZXA 1RJWA 2QENA 3FF1A 3D3QA 1RZUA 4LJ5A 5GONF 1SR8A 1U4NA 3HDVA 3TM4A 4GOXA 5I7RA 4U8GA 5E2IA 4YMTA 4UMVA 4DWJA 2FSIA 2JLXA 3CX7A 4C7OB 1L5MA 4B6OA 1BGWA 2OOSA 3D6AA 3FGNA 3JVVA 5IKPA 1AKMA 1VSTA 3D7SA 3KKZA 3C6YA 1MG0A 3X1DA 2ZI5A 3T7JA 2Q50A 2A3NA 3SGLA 4YAWA 2HWKA 1YFKA 3FLBA 1VJ0A 3CLSC 4YJ3F 1D6MA 3QE9Y 5KJCA 2WNIA 1UZUA 3CUYA 3KDPA 5LBUA 1P1JA 1AMUA 3VHQA 3IQEA 3HCCA 1H1DA 1Z2NX 3HGQA 3M49A 2R8YA 3WKCA 1UKBA 2XNJA 3EDOA 4PYKA 1TQHA 5TQ2A 2VK8A 4D25A 1W0JD 4IXDA 2R86A 4HLDA 1E2MA 1QNLA 3PQCA 2CNBA 4M2LA 4M6WB 4Q21A 3C43A 3R40A 4RTNA 4FVTA 2GAFA 1HA3A 3RKRA 3WLNA 4GMDA 4KE7A 4ZCRA 3TJZA 1HL3A 4PAOA 4Y1GA 1M67A 1UM8A 4MCAA 3U56A 4NBVA 4Q9NA 4L0CA 2O1XA 2ZETA 4F06A 2JD0A 3Q8LA 1KU0A 4D43A 1T43A 2JVJA 3BRSA 5FJJA 2GTPA 1VG8A 2Z8YM 4POOA 2CHVA 4DJAA 5DNCA 2YHSA 2ERXA 1P60A 1GEEA 2BELA 1OREA 3PR1A 3RK1A 2J08A 4GL4A 2PZKA 5F4ZA 1IQPA 3GLIA 5L53A 1GITA 2FVYA 2ISSD 4NU6A 4KYIB 3LUKA 5BR1A 1NN1A 2EP8A 2VWGA 4RPCA 5DCWA 2YQ5A 5EOVA 1YVUA 3R4VA 5AVXA 2IVZA 2GVNA 3LX5A 2A1IA 4Q82A 1AN9A 1YE8A 2PR7A 2DUNA 3D2BA 4FMPA 4EA8A 1N0UA 5K0NA 3MRSA 2FUKA 2AK3A 3QF7A 4J0HA 5LZ8A 1JKMA 3NEJA 1TK9A 2HXGA 2R84A 3EZ9A 1CF9A 4ZVTA 5T57A 3FTQA 8ADHA 1MC5A 4JJEA 3KAPA 2UVPB 5DYNA 3H2IA 5BQ5A 3EVZA 4PBTA 1E9CA 5PGMA 2IF0A 5B37A 3RAJA 3AVXA 1XXHB 1ECJA 1HDYA 3OHMA 1GA4A 2G9ZA 3QVGB 2A1UA 4MIEA 4DLSA 4ZEWA 3ZX5A 5EZQA 5BV7A 5CVDA 1SEPA 2Z9DA 1EXNA 2C59A 4ZCMA 3EPJA 4Y8VA 2AXPA 3HCWA 3BK7A 2JEZA 2I3DA 1IUOA 2P6NA 5DGCA 2JPDA 2VDNB 4HJRA 4V0SA 4Q9HA 4AJ2A 1Y7TA 5E3IA 3CT4A 5C8YB 3ASZA 1R0XA 3PQFA 2IU3A 3K94A 4WCFB 3LPAA 5ADWA 5ES4B 4JUAA 3CEJA 5G02A 4P7KA 4YO8A 4PHCA 4ZEVA 1FC0A 3DAYA 1XTJA 1EM6A 3RJ5A 3W3AH 3ASYA 3IBCA 3W78A 1S2MA 3IHTA 5KTSA 1U04A 2ZR0A 4K8RB 4Q4JA 1ZUIA 2H1VA 2A8YA 2WHEA 3IKTA 2GBFA 4ZIRB 2B99A 1CK4A 1KI3A 1NBMA 4WJZA 1E9RA 3OVMA 1RHUA 2YNMD 1T9DA 2Y68A 3IKMB 5FI3A 3N2IA 4LPKA 3GCGA 5DHRA 4L85A 5FPPA 1WR8A 1WU7A 2XEXA 3GIDA 3QVKA 3P7MA 2VOEA 5FRDA 3AEXA 5J40A 2ZJBA 2CL5A 3HKEB 3BB4A 4NBRA 2CXSA 1K68A 5K6RA 2ZATA 5IC6A 2A2ZA 2FEWB 1Y9AA 2ALJA 2BM1A 4FR2A 4I81A 5EP3A 5D6NA 1WUYA 2WW8A 3UJ6A 2DBRA 3SHOA 2D59A 1HSZA 1T2DA 3R7LA 1E3DA 1EWKA 3OF3A 2DKFA 3A28A 1U5BA 3D1VA 3L6UA 4QBKA 4COOA 4Q12A 4F9EA 3WBKA 5H3LA 3PJGA 3UK0A 2G6TA 3CZRA 1N0HA 3QUAA 5A03A 5HX7A 3C3AA 3GUCA 5EVCA 3TM5A 3G89A 1RRGA 1