3AKDA

Crystal structure of cmp kinase in complex with cdp from thermus thermophilus hb8
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
202
Chain Sequence
MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRARERPQAYEEVLRDLLRRDSAPAPDALVLDTGGMTLDEVVAWVLAHIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cytidylate kinase
publication title The crystal structure of the tertiary complex of CMP kinase with a phosphoryl group acceptor and a donor from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
total genus 70
structure length 202
sequence length 208
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akdA00
4C7OA 1E99A 3B5JA 1G8YA 4B74A 1PLJA 3W8RA 3DMDA 3BXZA 3RRYA 3SEAA 1T6NA 3PUVA 5J4KA 1DAEA 4M4SA 3U3RA 1WDTA 3U4QB 1ETUA 2ZJ8A 1XD9A 5IRCD 1VIYA 4JVSB 3VKGA 1II8A 2UVQA 5CM9C 1T9HA 4OHVA 3H1TA 4ZKDA 2VHCA 3LNCA 1M8PA 2ZJ2A 1CR4A 4DSOA 2CLSA 3D7MA 1F48A 2ZM5A 2R6FA 1R6BX 5GVSA 2YV5A 1MRSA 2IXFA 1XPRA 4CYMA 4EUNA 5DI9A 1A2KC 2DB3A 1CXZA 4P4SA 3K9NA 4Q9IA 2PT7A 1N6IA 3QKRA 3GJ0A 4US1R 4IEIA 2VHTA 3QXJA 1EFUA 4GOKA 3MG9A 1TUEA 3EWSA 2BBOA 1NVWQ 4NBSA 3U3MA 1XXHB 2ZR7A 1E9CA 3L82B 3KX2A 1KO8A 5JBQA 3U7HB 3BIFA 5LPNA 3A58B 3FMFA 3C14C 3KTAB 4Q03A 2TMKA 4LCBA 1M6NA 2XOKD 2ZRBA 2WIBA 4DHEA 1IN8A 3FB4A 4Q4HA 4O25A 4TLBA 3GD7A 3DDCA 1E1QA 4Q4AA 2A9KA 2PX3A 5C18A 3GLGE 1JAIA 4M2LA 2EWWA 2W2XA 4AKEA 2VH5R 1S1MA 1GL9B 1RFLA 5CIWA 2GF9A 3IEVA 1JAHA 4OQXA 1XD8A 1G3QA 1AZTA 3SHWA 4B76A 2NPIA 3NDBB 4V02A 2FSHA 5KNBA 2A3RA 3PIRA 1KOFA 4URUR 4DDVA 3PFIA 3GJ8A 4MH0R 2JLXA 2ANBA 4CEIB 1Q22A 4BFYA 2YZ2A 2JLZA 1EX6A 4BZQA 3UANA 3TW8B 4B3CA 2BC9A 4XH9B 1S1CA 2HF8A 1IQPA 2OAP1 1UJ2A 1U98A 1KI8A 4AG5A 3B8HA 3RRMA 1E2EA 3T34A 2XB4A 3QF7A 2ZU6A 4FCVA 2RGXA 2W00A 4F38A 2NMVA 4NCKA 3FHTA 3VR1A 5FTJA 1XEWX 2V4ZA 4URYR 1U8ZA 2EFHB 2ZRFA 1I4TD 1W0JA 2RGNC 5H70A 2ZUDA 2BEJA 5KDLA 5LB2A 2QP3A 2DFKB 4TWZA 1FMLA 1G6HA 2BMJA 5C46F 1SGWA 1WMSA 4PZZA 2WAXA 3RVBA 4AKGA 4JSTA 4PSAA 3MFYA 1UBCA 1XNJA 2A5GA 4HUQA 4M1YA 5FUXA 1AKEA 2A78A 4IJMA 3ASYA 4V0ME 1OT3A 4K81B 3KL4A 1E2JA 1P2SA 1YRBA 2H7VA 2LKDA 1SHZA 2K5UA 2G77B 4CIDA 1ZM2A 1OYYA 2BJVA 4F93B 2LKCA 1HH4A 3BORA 2Q3FA 1F2TB 1IAQA 1F5NA 1RVDA 4A9AA 4PO1A 2OLJA 1W44A 2CHGA 3FDIA 2FGKA 2ZETA 5A4JA 5M04A 2IHYA 1XPOA 4URVR 3NBZC 1R5NA 2O0HA 1E9BA 4B73A 1E2GA 2XTNA 4IOKA 3EZ9A 1GITA 4LPKA 3IDQA 3U7GA 3GJ4A 3QXSA 4Q47A 3FFBA 3NBYC 3TBKA 1XXHE 4TYPA 1LF0A 2A5DA 4QBGB 2RB4A 2HJVA 4LPSA 2J7PA 5GVRA 1KJZA 4W9MC 1XJ0A 2IEZA 3DL0A 1N5JA 1W4CA 4U00A 1FFHA 2BMEA 4QGHA 2FFHA 2IHBA 4BEBA 4RZ3A 3IHWA 1KMHB 2QSYA 2NOAA 4FXPA 2XXAB 2W83A 2OE2A 4GDFA 2WKPA 2Z5FA 2VHJA 3UG7A 4MYUA 3OEHD 2J1LA 4TL8A 1IN7A 4HEJA 2GEDA 4KFRA 1T3SA 5FR1A 4RVCA 5FUVA 3I1FA 4JLPA 2HXSA 2N46A 2QY9A 3SHFA 1Z0AA 4DLVA 4TMXA 3J81k 1TF2A 3AUYA 1NN1A 4ZCIA 3QXCA 1JR3E 2RGEA 3EIEA 3RRNA 5KOYA 2FOLA 2QMEA 5FOTA 4Q00A 3SN6A 1GRNA 4UNNA 1G3RA 4TL9A 1JBKA 1EWRA 4Q7KA 4G1UC 1E94E 2V6JA 4RFSB 4YMVA 1E2KA 3EWAA 3R9XA 1TU3A 4IHQA 1VTKA 4TSFA 2ZPTX 1KJWA 3TE6A 3GLHA 4TQAA 1G7TA 3BB3A 4MGZR 1OXTA 3UMRA 3PVSA 4D4LA 1Q1ZA 3IO3A 3WY9A 5BXQC 1Z28A 4GZLA 1NLFA 1YRAA 3QQ5A 4RCYA 4OYHA 1CJUC 1NKTA 1MABA 3CRW1 1UEIA 3WP0A 2R2AA 2CBZA 2QP4A 5BN4A 4KYIB 1YU9A 4MA4A 2GJ9A 1OYWA 2C9YA 2ZAOA 3P4YA 4EJSC 1XMIA 3QY0A 3IQXA 1CIPA 2B7CA 3W34A 1UFQA 1M7HA 4I81A 5CJPA 4MRPA 4MUAA 2J0SA 4KLNA 2BCJQ 2GILA 4YMUA 4AK9A 2V6IA 2ZANA 1AQYA 4WXRA 3ZIAA 4PX9A 3ONWA 1VHTA 3VTKA 1II0A 1YVDA 4ZCMA 2A30A 4IFEA 1ZC3A 4LYFA 2QP9X 4F4JA 2FDCA 2JDID 4ZDJA 2GZAA 4A8JC 3VHLB 3LQQA 5DLQC 4PC6A 3CZPA 1W0KD 3VU9B 2ZSEA 4DEXA 2FE4A 5G53C 3BFVA 4M1SA 2O8EB 2ZJAA 4Q02A 3WBKA 2QAGC 2IX3A 3O8RA 1XBTA 4MYHA 4R2IA 4RZXA 1AGPA 5FTLA 1QHSA 5AUPB 4KLZA 3S1AB 2BCGY 2ZJYA 2R6CA 2GVZC 3DM5A 2BMDA 2VP2A 4C2TA 4ASUD 1TAGA 4B47A 3BBPA 2FSFA 3FPAA 4YMSA 3SJZA 1GZSA 3K0FB 4ESHA 1G41A 2GXSA 1DS6A 4O2RA 1OHHA 3B7GA 1XFAA 5FI0B 5DH9A 3B13B 1CRQA 5GJCA 1N5KA 1SXJA 1GAJA 621PA 4UNRA 5CYOA 4PHTA 2FV8A 5FL7A 1KO7A 1XDBA 1D9ZA 2WPDA 4L9SA 2FWRA 2V55B 4M1TA 2IS2A 1DE0A 5TXGA 1L4YA 4BLTA 4S35A 3BOSA 2JLWA 4MGIR 2R6GA 2ZE7A 1VCOA 4FIDA 2ZVQX 4DKXA 3QKTA 2AX4A 4GP7A 4A2WA 1H8EA 1XCPA 3PUZA 2QE7D 1X3SA 2KJQA 4RY2A 3FTQA 3LXXA 1KNXA 3OAAD 4LBWA 1TQDA 3FMIA 4LYJA 3C4JA 1KI9A 3O8DA 3X1WA 5JFGA 4LJ8A 3LWNA 1XCMA 2H1LA 3LAWA 3I5YA 1IONA 3FOZA 2PJRA 4UKDA 5D3QA 4TYNA 4QFMA 3G5UA 2EVWX 3SYKA 4HZUA 1BKDR 4DBLC 5EP4A 3AEZA 2LWIA 5AK0A 1AZSC 1W7AA 1N2CE 1ZU4A 3CLVA 3QXHA 1W46A 4B43A 3AUXA 2FX3A 4LBVA 2PBRA 1XCGB 1OH6A 2ONKA 4R71A 2VYFA 1G8PA 1NVUQ 4A36A 5JEEA 3LLUA 3M1IA 1Z0DA 4GL2A 4NDZA 4HUTA 4CT4B 1Z0KA 3K1JA 1E79D 3EA5A 4D25A 1H65A 4G5OA 3QG1A 3RSOA 4FMCB 1P9RA 4X8OA 1G7RA 1R0ZA 2WWFA 4DT1A 3CB4A 5JI3E 5KO2A 4QM6A 2O8CA 2DBYA 5JJKA 1P7CA 1YZQA 4V0KA 3K09A 4NH0A 4JLMA 2CVHA 4I4LA 5TB5A 1NMYA 3L0SA 2J87A 2W6JA 2OZEA 3TH5A 1IN4A 4TMZA 4QJ4A 1FUUA 2I1QA 2ZS9A 3AQ4A 4UQOA 1EFCA 3T12A 3KZ1E 5AJZA 2R62A 4M1OA 4WZAE 4JBXA 2IW3A 4BASA 1DARA 5HPYB 1JPJA 1TPZA 2OG2A 3L8YA 3Q72A 3PEYA 2NZ8A 1J7KA 2PMDA 1US8A 2GEUA 1N3BA 3BGWA 5DIFA 5F9HA 5BYKA 4C0LA 2BEKA 3LV8A 521PA 2QENA 4Z1MD 5L3VA 4BLPA 1HE8B 5FUYA 3BFKA 1OE0A 2F3RA 3M4YA 2QPTA 3KXKA 3IGFA 4LWZA 4OI0A 1R0YA 5E3HA 2VIIA 4YONB 1I4DD 1KSFX 5GJBA 2ZRMA 2ZYUX 5G41A 3ZGXA 5JWRA 3WRYC 2Q9AA 4EPWA 5H1YA 2FNAA 4Q7JB 1DVRA 1VPLA 4JVNA 2XSZD 2JLVA 3EIQA 5HCIA 5KDDA 2GJSA 2YHSA 4P3YA 5FL3A 1NVVQ 1R0XA 1FX0B 1K5GA 1X86B 2JLSA 2W58A 3TUJC 1YZLA 4PO9A 1OXVA 4NYIQ 4Q21A 5EE1A 4NCIA 3UKDA 4ZI2A 3PEVA 1W5SA 2A5FA 5D3MA 1QZXA 2WWWA 2WAYA 2Z83A 2CLDX 2CMKA 1GVNB 3L43A 2PLRA 2X19A 3KKQA 1VG9B 2GCPA 4ACAA 4P32A 4UXIA 5GADl 4TTPA 4GP6A 5E7JA 3ZVLA 3KKNA 5EXXA 2RGGA 3X2SA 3CM0A 4YXWA 2GCNA 4JS0A 1B23P 2O8BA 1KKLA 4OI4A 2AR7A 1YZKA 1JQLB 3ETLA 4M1KA 2ORVA 3VR3A 1HURA 3ECCA 4Z8YA 4IOMA 4P31A 3OFND 1XX6A 1LB1B 1TQ2A 4XD7A 2ZSDA 3U3OA 4OK6A 2J3EA 1ZIPA 3IQWA 2I1VB 4QC2A 4C7OB 1ZINA 1CKEA 1YKSA 1N6OA 3QXXA 3TSOA 5DHFA 2IYUA 4I1OA 3ZYCA 4AI6A 4P0TA 4JVLA 2QBYA 4JL8A 1IBRA 3CPJB 5E7IA 5L3QA 3WRXC 1Z6TA 3OE7D 4RKEA 4LJ4A 1II8B 1ZP6A 4IKEA 1LV7A 4B3DA 3RLFA 4LGMA 3RWMB 1DAKA 1ZNYA 1LVGA 1NI3A 5AUNB 2XNDD 1SVWA 2B8TA 1AGRA 4H9GA 1F2UA 2ZQ5A 4LHZA 4F4IA 1GKYA 4ZDIA 2VQSA 1FNNA 3HU3A 1KJYA 1TNDA 1OKKD 1XMVA 3B1WA 3B6EA 3P26A 3ZS9A 3FHOA 4BRWA 3K0AA 1OH7A 2GJKA 2JASA 1BH2A 3QKRB 1LTQA 5EP1A 3OIVA 1R4AA 4KJZA 3CNLA 1UEJA 3ND9A 4CEJA 1HV8A 1UF9A 2BBWA 1SKYB 1IY0A 4FMDF 1OLOA 1KHTA 2X8AA 2VO1A 1KK2A 3IPXA 3JVUA 4X8LA 1TQ6A 4XJXA 4YQFA 4JT4A 2NO1A 4NHOA 4MKIA 5AUQA 3CF0A 4MYTA 5CDFA 4OI2A 3VFDA 4Q4HB 5AJVB 1Q1EA 1E4VA 3U7EB 1N25A 1NL3A 3KJGA 4Q4AB 2VP6A 1OXXK 4ILEA 2C98A 3B1VA 2IYXA 3TUZC 1J8MF 2GCOA 2VEDA 3AVVA 2H8KA 1YZGA 5SZIA 2IF2A 3QOFA 5EZ6B 4W5WA 1W5TA 1EFTA 3PITA 1OJLA 5KUTA 3CKLA 1UDXA 2MMGA 1LFDB 1W4BA 5JRZA 1JR3D 2MMCA 1G20E 2C95A 3GLIA 5EJEA 1IY2A 1B0UA 2PEZA 4G0NA 5FOWA 2GTPA 4RD0A 2ZE5A 4Q66C 2AK2A 2REBA 4LOAA 2GJ8A 2EYQA 2PH1A 3A4LA 2PZGA 1RIFA 4G5GA 2BV3A 4NZYA 5KSOA 1VG1A 4JJKA 4GRAA 3B1XA 2GNOA 2BKEA 4KU4A 3UXMA 3BE4A 2D2EA 3MWYW 1KYIA 2WBLC 5F2EA 2PJZA 1H8HD 3P1JA 2GVDC 1ESNA 2BKUA 1WRBA 5AR1A 1AS0A 2C5LA 1TTTA 3KB2A 2VA8A 2FSIA 3DOEA 2KBEA 3AKCA 1G5TA 1AQUA 3SBEA 2OBNA 2ZTSA 1TADA 4FI3C 3QEJA 2XTMA 4QKQA 3ZLJA 5ELXA 1Z6YA 221PA 3NXSA 4HUQB 2OXRA 2ZIAA 4NCHA 1Z47A 2VLIA 3GLGB 4BLSA 1Q0UA 5FBWB 4DSNA 4Q7MB 5DYGA 2OESA 2E9SA 5IDVA 2JLQA 1GNPA 1P3JA 3GPLA 2GK6A 3AKDA 3PG5A 3JZMA 3C5CA 2DYKA 1N6NA 2WICA 2FF7A 3AH8A 4AYWA 1M2OB 1CU1A 2QGNA 2XTZA 3ASZA 3TNFA 3DKPA 1COWD 3NDPA 4JBWA 4D0NA 3GEEA 4LJ7A 4D4JA 1P60A 3TJZA 2V9PA 4WIAA 4TMKA 2HT1A 2IEYA 3L0OA 1CP2A 4B2PA 5BN3A 5JS8A 3T1QA 1T4GA 1BIFA 4LC0A 4M53A 1SKYE 3HR8A 1GL6A 5JJIA 2VSOA 2G9NA 3M0EA 3DMNA 5JHGB 4LK2A 2QGZA 3NG1A 2CL7X 2JAQA 1QRAA 5DE3A 1XZQA 2FA9A 1HT1E 4F92B 5E4FA 1RJ9B 1ZW6A 1HY3A 4MITA 4NKRA 1RYFA 5JS7A 2ZSFA 1ZM7A 2Y8EA 5FBRB 4LY6A 4D0LB 4GNKA 2RGNA 2GXAA 1Z8FA 5J40A 2ERXA 3TRFA 4P4TA 3WMEA 2C77A 4NYJR 3JVVA 5HZHA 3PV0A 3A4NA 4O2LA 2NQ2C 2IYSA 1QHHA 3AF2A 4QJ3A 4LJYA 1VCNA 4D0GA 4TZ6A 4DZZA 4ESVA 2VL7A 1P73A 3EXAA 5IK2D 4JKIA 5JSZA 2HT6A 1QHIA 2JIZA 2G3YA 4IXMA 4JLNA 4N0EA 3AF4A 4DB4A 3RRZA 2FEOA 3E70C 4YC7A 4OJQA 5FPYA 3TR5A 4B3XA 4E09A 2J46A 2HXYA 3H84A 5CIQA 1M34E 3QBTA 2CL6X 4JLOA 4NPHA 4EDHA 1KO5A 2J0QA 1J2JA 1JEDA 1GNQA 1T5LA 1L2TA 4DCVA 4DLRA 4JLKA 3X1XA 3MSXA 1KMQA 4XTRA 2XB2A 4LV5B 1QG4A 1E2IA 1TU4A 4RKFA 3B60A 3HDTA 4M1WA 5CM8B 1MABB 2ZJOA 2J45A 2X2EA 3BB4A 3LBIA 4FINA 4OQLA 1W49A 1DADA 1U94A 1GUAA 5DGXA 2Z6VA 2FPMA 2OCBA 2DFNA 2ZE8A 4ZI3A 1A7JA 5JEDA 2P2LA 2A5JA 3LY5A 1G17A 1R0WA 4DLSA 4AD8A 2P65A 3B85A 2DHRA 2JJ8A 1E1RA 4DCTA 2ZRIA 4EQ6A 4CZ2A 3PUXA 5KU1A 1E2NA 1E69A 3ND8A 3QNUA 4P4UA 4A1FA 1TQ4A 2ASEA 4D4MA 1MT0A 4E5UA 2FFBA 5E95A 1FTNA 4DDWA 1JI0A 5HKKA 2JLYA 1MO4A 2VP9A 4Q1EA 2KE5A 3CF6R 2CLCX 4CRWB 3CNOA 4CEHA 1ZCAA 2D74A 5GJWC 1TX4B 1SVLA 3F8TA 3UATA 1L8QA 3KFVA 1C9KA 3BAFA 1CS4C 2AHOA 5J4HA 1YR8A 2HLDA 3L2OB 1YZNA 1PLLA 4I1UA 3BRWD 3WXMA 3MLEA 1P9WA 1QHYA 2Q0HA 4OK5A 4GPTA 2FMXA 3D31A 3BERA 3OIUA 3NKVA 3Q3JB 4LJ5A 3GLFA 2GZDA 5EE0A 4HAXA 5A5GA 4DLTA 3K9GA 3NH9A 2EFEB 2CJWA 3OEED 5J5CA 4A2QA 2D3WA 2QUZA 1E2HA 4MQBA 3T35A 4EJSA 2NO7A 1MRNA 1SZPA 1Q21A 1KDRA 2Q21A 1GOTA 1R5BA 1XU4A 1RYHA 3AGQA 1WCV1 2OAQ1 4Q18A 1W36B 3KQLA 1CR1A 4Q4JA 1MO3A 3BFXA 3GEHA 3NH6A 3SDZA 3U44B 2VP4A 1L4UA 3LLMA 4TMWA 2WWHA 4ITRC 2R9VA 2REXB 1ZMXA 2VTKA 4DEYA 1NIJA 3Q5EA 4DCSA 2YC2C 4TT3A 4A8JA 5EXTA 4U02A 1RW4A 1VECA 3UK6A 1KI6A 2ODWA 5IHPA 2IBMA 2A2ZA 3SQXA 1N6LA 2PCLA 1E9SA 1JNYA 3DO6A 4RD6A 3GLHE 3ZJYA 2QAGA 4YMWA 3HPRA 1G21E 4KYUA 1FUKA 5B2ZA 1XP8A 4NYMR 4BFTA 4F7WA 2BIFA 1YZTA 3A8TA 4PTLA 3R20A 4DC9A 5DI3A 4FD2A 3JZAA 4EFMA 3I72A 3EPJA 2O8DB 2P67A 4D26A 3UMSA 2GBLC 1OSNA 2ZR9A 3K9HA 4JL5A 5J4LA 3P20A 4PFSA 3CPHA 1KNQA 5DHAA 1YE8A 2OBLA 3GCGA 3KDSE 1RRPA 2IUUA 4C0HA 4EPRA 3QF4A 5TY0A 3MWLA 2KWIA 4WXPA 3AVYA 4KO8A 2IYRA 2IYTA 2D06A 2F9MA 3UWOA 1DAMA 4FWTA 1GDDA 2WJVA 5CYPA 4ZPXA 2JLRA 4CT5A 5JMTA 3NC1C 4WZ6A 2BBSA 4Q1FA 4RZ2A 1DO0A 2ORWA 1NLYA 4DT1B 4AY2A 3U2QA 3O8CA 1ZNZA 2O8CB 1IXRC 2ZAMA 5G3YA 1KK3A 1LF5A 5F98A 2PCJA 4OI1A 2ZYTX 3KQNA 2JATA 4RD4A 2W0MA 2OCPA 3IILA 1BYUA 3C15C 4M9XA 4BLQA 3L8ZA 5AWFC 1N5IA 1T91A 1N5LA 2W0SA 4LUCA 3VR2A 4DUGA 2O52A 3DM9B 2I3BA 5HZKA 2W6IA 1NVXQ 4ABYA 5LB4A 4B44A 1M7BA 1US8B 4DLUA 2IWHA 4A6PA 1DEKA 3E5HA 2FEMA 4HAZA 4ON9A 3RC8A 3KQUA 3T1VA 1YZUA 5FPTA 2WZQA 3WYGA 2X1VA 2QPOA 4FCWA 2OCYC 1I2MA 5B58C 3FMOB 3A1TA 3W8NA 2ZXUA 3GFOA 3LQRA 4QNRA 3VR6A 2CE7A 4MKGA 2JCSA 1U0LA 3QPUA 1TEVA 5FR2A 1UAAA 2CNWA 5CLQA 5HE8A 2JJ1A 4WBSA 1ZNXA 4WAUA 1XMJA 3DKVA 4B71A 1ZUNB 2F1RA 4QOSA 2YKGA 1PVOA 4D81A 2NO9A 5LD2B 4A82A 1KAGA 4PSKA 2KB0A 2P6UA 3DZ8A 2GXQA 2JEOA 1Z0IA 4J0QA 2YOHA 4NE2A 2D2FA 1OB5A 1XJCA 4LI0A 4JVMA 4Q9KA 4EPVA 4QBFA 4Z8XA 4IXNA 1DAFA 4YDSA 1P5ZB 4PAQA 5TMPA 3Q9LA 1WQ1R 1GFIA 5D3MB 5EE5B 2GF0A 2ZI4A 1F3OA 4BFUA 4DLWA 1ZVQA 3LXRA 3TR0A 3BH6A 3TGPA 4PAMA 1JXOA 3KKPA 1Q1BA 1NY5A 3FKSD 2CL0X 3EX7C 5IT5A 4BFZA 3AVXA 3HU1A 5ANRB 1E0JA 2OXCA 2O8BB 1QHNA 2NO6A 1TEXA 1A5TA 4QXAA 2PX0A 3NIBA 1NG1A 4BFXA 4C0JA 5JRJA 2JJ2D 2AL7A 2UKDA 2WSSA 4NMMA 3VR5A 3L0PA 2FJUA 4YMTA 4QNMA 3U60B 5FTKA 5AUOB 3KXLA 4M9ZA 4MUBA 2OV2A 2V7QD 1J99A 721PA 1RC8A 3CX7A 1GRQA 1ZIOA 4PAOA 2P6RA 2QA5A 1VIAA 1NSFA 2V1XA 2R44A 3PCRB 3SBDA 4PC1A 2D62A 3GFPA 3L0IB 4FMDB 3A37A 3ZVMA 2W2VA 2HCBA 5C1BA 1IXSB 2J0UA 1NN5A 2Q9CA 4RJLA 2CK3A 5FBVB 4MDEA 3NWJA 1P62B 1YJ5A 2EW1A 3SNHA 3U3KA 3GEIA 3EA0A 1C1YA 4OHXA 1Z83A 1VYUA 1R8SA 1Z29A 1PZNA 1KSHA 2OHFA 1MKYA 3KFXA 4PSVA 4OJKA 4ARZB 1W2GA 1QHGA 5DN6A 3U7FB 3EZ7A 4MRSA 1OW3B 5FBLB 4PANA 2XJ4A 3I3SR 3AVOA 3CF2A 1AS2A 3R9WA 2DCUA 1KAOA 2BBTA 4JKYA 2CCKA 5J4VA 3LRPA 1F2TA 4UNSA 2DY1A 1X6VA 4BE7B 1KY3A 1S3SA 3K0EA 1NKSA 3P27A 2FG5A 4M9SA 3RWOA 5L3SA 4CEJB 1KIMA 3LO5A 1KTVA 1ZBDA 2CVFA 2BM1A 5G3ZA 3CW2A 3TW4A 1X8LA 4UJ5A 3R9IA 3SU8A 3GP8A 1JJVA 2XZPA 1G8FA 3X1DA 1XMSA 1E1QD 6Q21A 1NBMA 2DR3A 1VYTA 5FPKA 4JMPA 2VRWA 2VF7A 4D6PA 1KZ7B 2F7SA 4HDQB 5J4YA 1WB9A 3LX5A 4EPXA 1KMHA 5SZHB 4QL3A 5HTKA 1GIAA 2C8VA 3PUYA 4HDCA 2CE2X 2QT1A 4IFBA 5B30A 1CJVC 1OFHA 3HP1A 3VHXA 3GJ7A 2OFXA 3LH5A 3GLIB 4M22A 1G4UR 2HCJB 2GHIA 3BC1A 2RH5A 2D4HA 1Z6XA 3EASA 4B2IA 3BK7A 2VBCA 3H0KA 4RD2A 4TYYA 1D2NA 1R2QA 2SHKA 4JJZA 4DCUA 5A0FA 3QVVA 5KTYA 1UKVY 2WOJA 3SJAA 1DAIA 1DOAA 1KK0A 4H1VA 3REFA 4AURA 2X77A 2RGBA 2HYDA 2GA8A 1JECA 3F3YA 4IVQA 4JLVA 2EU8A 4Q1DA 3BS4A 2IS1A 3MAAC 4BUJA 121PA 4C9BA 2FN4A 1WA5A 1A1VA 5KDOA 1G64A 4ZIRA 1AS3A 1T3LA 4DXAA 3MWKA 3EG5A 1A82A 3IO5A 1KI1A 3THXB 4JT2A 3W3ZB 5KHOC 4BRUA 1XWIA 4JLDA 2HYIC 2JLUA 3D8BA 1W36C 2D7CA 5HE9A 1E9EA 1SQ5A 3NHAA 4PPQA 3RS7A 2O8FA 2XOKA 3GMTA 4LYAA 1VMAA 1Z08A 2WV9A 2ORIA 3W6NA 5FBQB 2FSGA 4L8GA 5BQ5A 3THOA 4RD3A 3F0TA 2FZ4A 1UBGA 1ZYUA 2B7BA 1W4RA 4R2HA 3EC2A 1E0AA 4HAVA 1HQCA 3BD9A 3K70D 3AVPA 1DAHA 1DBSA 2O0KA 3R8FA 2BWJA 2J9RA 3SC3A 4FWIB 3EZFA 2KBFA 2AXPA 2QQEA 2WSMA 5FPHA 1ZJ6A 3IKJA 4HAYA 4R9UC 2J7PD 4KFTA 3THWB 5K8IA 1IN6A 5CDFE 2CHQA 3RS4A 2G88A 4NYJQ 3CNNA 4LSGA 5UKDA 2QMHA 2C04A 2WWGA 1KZGB 5SZKB 4XIGS 2WWYA 1DAGA 2KI5A 5LDDC 1KKMA 1T8TA 1WXQA 1QHHB 1VYVA 2NG1A 1X8KA 2PZFA 4AKIA 3LW7A 3SI7A 3K0FA 4TLAA 5JI2E 2MSCB 1KI4A 2IYZA 3GQBA 3B82A 5JSZB 2CXXA 3MMPA 4Q9JA 4M9QA 4MDFA 1EFHA 3GLIE 3R8CA 4KBFA 2ZITA 5TV2A 4JL6A 2IS4A 1G19A 4TSFD 3RNLA 2N42A 4KODA 3TSWA 2ZJZA 4IDQA 4PC7A 3ZDQA 1NF3A 2AWOA 4MRNA 4P4SB 1EFRD 3K09C 4NONA 2OFWA 2EFGA 2RHMA 2IXGA 4QJ5A 1LW7A 4HZIA 3UPUA 3R7WA 2QRZA 4PPNA 2IYLD 2ZSBA 2H16A 4Q4LA 1JXMA 1P2UA 1EK0A 1ONBA 4PHFA 4HDOB 4B6FA 3I62A 3GJXC 1S96A 1KY2A 3U5ZB 1MV5A 1O3YA 2RMKA 5KPJA 1VDZA 5H68A 2QL6A 5BYJA 3RYTC 1DG1G 1YR6A 2YOGA 3MJHA 1LS1A 4K46A 1Q12A 5JCPA 1U9IC 2GK7A 1LY1A 2V8OA 3SJCA 3ZIAD 4DVGA 1L7VC 4AC9A 4LDJA 1G291 2IUSA 4EQ6B 1KK1A 2G1JA 2I4IA 4Y0VA 3IIJA 1HQYE 1VKJA 1AIPA 4QG7A 3PQCA 3LBNA 2NPFA 1RRFA 2QM8A 3AVUA 4B2LA 4CEHB 4IW3B 3T5GA 3CH5A 1QDEA 5LD2C 1G18A 2KSQA 2NZJA 2IA5A 3M6AA 3OEHA 3F5FA 4PPGA 1OH5A 3LVRE 4P33A 2QNRA 1T0JB 3MUFA 2C96A 1OFIA 4NP6A 4GMDA 2G83A 3CH4B 4PC3A 3UIEA 1N6HA 2C2HA 2OO7A 2V54A 3CWQA 4ZV4A 3GLFB 3AB3A 5F9FA 3PEUA 1WBBA 4S2EA 1AA9A 2ZJBA 4W5JA 4F91B 3H86A 4DLZA 1S9HA 2CJWB 1TF5A 2ZU0C 2ZROA 1GM5A 3I4LA 2R8RA 1G9XA 1NN0A 1RRGA 1OHHD 1ZC4A 2ZRNA 3P4XA 1OPXA 2AK3A 3SE0A 4EJSB 4DIEA 5CK4A 3DOFA 4EPYA 3WYFA 4TLCA 1W36D 4HLUC 1GNRA 1SXJD 4G3XA 1UADA 5G40A 4C0AC 2G1KA 4Q9HA 3ZH9B 3AVTA 4TLEA 3OESA 5EUMA 2XGJA 5FL7D 3AGPA 2WPDD 4Q5IA 2QI9C 4M21A 1XRJA 4GZMA 1U90A 1KSGA 4GSYA 2CCJA 3VNUA 3ICEA 5FPSA 2XEXA 1XEXA 4D82A 1O87A 1IN5A 1M1YE 1W48A 3K8YA 4RZUA 4HSEA 4OHZA 4KI0A 4A4DA 4A8JB 3TAUA 3TMKA 5IF9A 1H8ED 1KI6B 1FL9A 2QROA 2ZREA 3MRSA 3SJBA 4TN1A 4IEEA 2BM0A 1T8UA 3TAHA 3IHLA 4A2PA 4URXR 3NBFA 1NY6A 1KI3A 4NYMQ 2IC5A 2X2FA 2QAGB 5EXPA 1PLKA 1E0KA 4M0LA 1ZM4A 3T15A 1XEFA 1CRPA 5FOSA 2WJIA 2GAOA 2YWHA 2JDIA 3K70B 3OZXA 4KV9A 4KSCA 1A4RA 4Q01A 4G01B 2F43A 5DI3B 5JHHB 5KNCA 2VPPA 1CLUA 1BO6A 1G7SA 1NVVR 1OV4A 1W0KA 2B21A 3BB1A 4HB4A 3IBGA 3TKLA 4NU0A 1P2VA 4NYIR 4OQFA 2ODNA 2FZLA 3NEYA 1LS6A 3RANA 3VQTA 3IEUA 3QKSA 4TYQA 3QUSA 1OXUA 3IIMA 3QKUA 4DLXA 1Q44A 4RSGA 2EFDB 1P75A 2GKSA 4EIWA 2ZRJA 1J70A 1Q1QA 1SVMA 3TLXA 4L15A 4WW0A 3WMFA 5J47A 2J7KA 2ZVPX 4ASUA 4MRRA 4A92A 4FMBB 3RABA 3FGNA 5DSZA 3UG6A 4I1VA 3Q7PA 3BJIC 3FYHA 4NCNA 1HYQA 3TVTA 4RCZA 4OK3A 4LX0A 1S9DA 4PZLA 1FTSA 1W2HA 4IOLA 4MYCA 1HE1C 4AIIA 3G82C 2A5YB 2B6HA 3K0SA 3GJ5A 4B32A 1K5DA 2W6JD 1G6OA 4YDHB 4QRHA 1SULA 4GI7A 2Z4RA 1G3MA 3W6OA 2ATVA 3OIWA 4H1UA 3CO5A 1CEEA 1GL7A 4HLDA 4CGZA 2OILA 3TK1A 2Q9BA 2OBMA 2BHRA 4V03A 2WJYA 4K8OA 2PZEA 3GLFE 3GLHB 4LBYA 5BWMA 1D2MA 2ZRDA 2EQBA 3DPUA 4KFUA 2ONJA 3HWSA 1BYIA 4HAUA 4L5BA 4QBIA 1UBEA 2P5SA 3C7KA 4GBMA 1Q20A 1D2EA 1AK2A 3I92A 2QE7A 3HYRA 3A6PC 4GT1A 3N2EA 1OIWA 2GBLA 3OAAA 2GESA 4PHHA 1N0WA 4CW7A 3T61A 4KAXA 2EWVA 1E3MA 2YC4C 1ZNWA 3B9QA 2PL3A 5F3WB 1BMFD 5CK5A 3RS3A 4E07A 1EX7A 2RCNA 3AVWA 1U0JA 2QQ0A 2P0EA 2QN6A 3H4MA 1E6CA 5LBIA 1Z0FA 4E03A 4B75A 1GRRA 1S0UA 3TVDA 3THYA 1JR6A 1JJ7A 2NTYC 1G8HA 1UBFA 2ZI9A 3CX6A 2BDTA 5TDHA 4JSYA 4PQYA 5KSZA 1KDPA 2WIAA 2R6DA 1ODFA 1TMKA 2QTVB 2Z0MA 5EUQB 2AKAB 1CTQA 3Q85A 2QM7A 1E79A 4HI0E 1WE2A 4JBYA 4BPBA 3B9PA 4IDNA 4LHWA 4OQMA 3U61B 4QHSA 4LJ9A 5FTNA 2R6AA 3BH7A 4XWAA 3QIAA 1Z2CA 1F6BA 3AF1A 4XWOA 2XJ9A 1Q57A 2OSBA 3C5HA 3X1YA 1M7GA 2VSFA 4CDGA 4DCNA 3DEFA 3KJEA 1NN3A 2HUPA 4YXWD 5HR5A 4TQUS 2H17A 2E87A 3SQWA 2QTHA 2F1IA 4Q9LA 2AFIE 4V0LA 1XTRA 2QAJA 1P4SA 1NP6A 1N0UA 1XD2A 1Z06A 3FMPB 5JZVA 4KFSA 4U7DA 3K0CC 4WA7A 3REGA 1Y63A 2WJGA 1FP6A 3ZD7A 4TLDA 2JA1A 3SOPA 1SXJB 4XD7D 3SS8A 3VX3A 3TQCA 4A0FA 5B64A 4M1MA 2ZRGA 2VSXA 4KVAA 1YR7A 4Z1MA 4BEJA 3CX8A 1QF9A 4BFSA 3H2YA 3RS0A 3SR0A 4DDUA 1P61B 3PJRA 1CR2A 1J8YF 2J0UB 2H92A 3HJNA 4M8NE 1NLZA 3MWJA 4W7SA 5FUWA 3WBJA 3CUEF 4AYXA 4D80A 3EPLA 821PA 2ZRCA 4URZR 3ZS8A 3WNBA 1FNMA 1NMZA 1U0HC 1V5WA 4UNPA 3RAPR 3Q7QA 4WOPA 2XSZA 1RPZA 2FPKA 1ZD9A 2YOFA 2GAAA 1N6KA 3DZDA 4O0MA 3KQKA 3KJIA 2E1RA 2C9CA 1HT2E 4F4CA 1WBDA 2G6BA 1DG3A 4B3BA 1EWQA 1Z2AA 3KQHA 5KYKA 4ERNA 3MD0A 4BLRA 2ZRKA 2FU5C 4LV8B 4BLOA 3QPWA 1MO6A 4HZUB 4IVRA 3ADBA 3GLGA 4LYHA 1IJEA 2DWQA 2EFCB 4UJ3A 4V0OA 3FFAA 4LBZA 4JLAA 3WP1B 2W2TA 3O47A 5DISB 4E22A 2F55A 2PLFA 4IOJA 4HB2A 5L3SB 4I99A 1E96A 2H57A 1E2PA 4TZ0A 421PA 3I32A 5JJLA 4IRUB 4R7ZA 2LCFA 3ZZUA 1MH1A 5EQTA 3RHFA 4BFVA 2QU8A 4LZZA 3B1ZA 3EAQA 4TMTA 1I2DA 1MO5A 1E32A 3OFNA 4X8MA 4UXJA 1JQJC 2PMKA 4N1AA 1KSJA 2C9OA 1RJ9A 5TVKA 2MSDB 2QMOA 1W4AA 1X8JA 3NC0C 3NEJA 2AD5A 2AKYA 5JCZA 4ZDWA 2IYYA 3UWKA 2VF8A 5CITA 3AV0B 2GETA 3CRQA 3OF5A 4OQNA 3Q8XB 2DWOA 3O8BA 4POAA 2ZSAA 1XJQA 1XF9A 2RHDA 3U4QA 4KVGA 3KJHA 4PQFA 3V00A 3OE7A 2AFHE 3SYLA 3WYAA 2G0NA 2RAPA 2RGDA 2WOOA 1ZD8A 2ZJ5A 1IM2A 1GP2A 4V0MA 4RD1A 4W5HA 3IIKA 2XNDA 1FW6A 2V3CC 4QHYA 1SVOA 1SXJE 2V1UA 2VP0A 2WM9B 5B57C 1D6JA 2VHUA 4DSTA 3CR8A 1II9A 2WKRA 4C2UA 1KI2A 1U81A 3SFVA 1OKKA 2QZ4A 1EFRA 2Z43A 1G7CA 2FPLA 1VG8A 1UKZA 3MGCA 1E2MA 1SVIA 3K53A 4ZIRB 4AG6A 3QSYA 4B34A 4MKHA 2Q3MA 2WMOB 3RS2A 3VKHA 3NTUA 2DWPA 4BWYA 2ANCA 3QI2A 5EXSA 5DO9A 3VAAA 4GOJA 1XXHA 1AN0A 3KUDA 3W5JA 1M74A 1RE0A 4C4PA 4C0KA 2YYZA 3U6BA 3ADCA 5L3RA 5H8WA 1E9RA 4TTRA 4URWR 2YWFA 3KTAA 1E2DA 2O0JA 1EXMA 1TL7C 2C99A 2O8FB 2ZR0A 3FVQA 4G5SA 5FTMA 4PZYA 5C4MA 1RZ3A 1S2MA 4C0SA 3NVAA 2CCGA 3LVQE 4TMVA 2BMFA 4GFDA 1UKYA 1XPUA 4LRWA 4JLBA 1G8GA 5L8VA 1XEWY 2GJAA 1CJTC 2YJTD 3GFTA 2OFOA 2XZOA 1GILA 4TQ9A 1WP9A 2ZRHA 4OHWA 3EC1A 2HF9A 3AM1A 1TUIA 1ANKA 2F9LA 2O5VA 4EFLA 1CR0A 2OUKA 3A1UA 2GEVA 1ELOA 1JR3A 1R8QA 1QBKC 3D6TB 4TL7A 1HA3A 1NG9A 1KO1A 1AJEA 4CEIA 4OL0A 4PPFA 1FMJA 4BECA 3LW8A 1LNZA 3K70C 1Z5ZA 2IF0A 3SZRA 2OM2A 2QTFA 1UM8A 2A7QA 3AP2A 1NBME 5K8TA 2B92A 1AM4D 2QRNA 4IDOA 1Z6GA 4Q19A 5DYIA 2QBYB 4LHVA 3CPEA 4Z54A 1JPNA 1P6XA 1NSTA 4Q1CA 5L3QB 1H8HA 3HR7A 4V0NA 1UPTA 1N0VC 2H18A 2ZRLA 1T0HB 1X1SA 2JIZD 3NHBA 2R65A 3I73A 3KXIA 2XX3A 1CJKC 4FW9A 4ZKEA 1ESMA 1F2UB 3CRMA 3AF0A 3U44A 4LJ6A 4HLCA 2XITA 3BH0A 2WJHA 2FFAA 2IWRA 4O3MA 1E4YA 1JEEA 4B6EA 3GJ6A 4C0QC 3SFZA 2PEYA 3K0AB 1ZCBA 3WHKA 1KGDA 3A1VA 3VX4A 5CLLA 3R7WB 3EW9A 4B33A 1U99A 4OKSA 1PUJA 3QG5A 1D5CA 1Y3AA 1C4OA 1SHKA 2MSEB 4DB2A 4JLJA 4C30A 1Q3HA 3UMFA 2RGAA 5AJXA 1COWA 1VCIA 2Q6TA 4MRVA 5TARA 2IUTA 4IDHA 4IVPA 2IYWA 2IK8A 3T1TA 3I5XA 1G5PA 2Q3HA 1VG0B 1K8RA 3TQFA 4KBGA 3WMGA 5JLJA 2F1JA 2ZYWX 1E1RD 3LX8A 2O8DA 3KKMA 4B35A 2J41A 4GMXA 1MOZA 5P21A 4EKDA 2ZUCA 2IS6A 3KUCA 2GCOB 2AWNA 5FOVA 1GKUB 5GJVC 3RSLA 1E2FA 5HKKD 4I1SA 4AYTA 3VKWA 2XXAA 3ICQB 3A1SA 4TYWA 1XTJA 3ADDA 1S4QA 2JGNA 4XOIA 2ZE6A 3T06B 3ZQJA 1GKIA 2ZRAA 5DNYB 4X8HA 3TIFA 1OFUX 1XTIA 3GJ3A 3C41J 3I8XA 2HLDD 3AVQA 4OHYA 4UNQA 4CF7A 2OCAA 3CRRA 1U2RA 2QORA 2ZI3A 1PUIA 1P2TA 3HYTA 1CF4A 3U3JA 3FKQA 5EP3A 5IK2A 3E1SA 4AWXA 1KO4A 3AP1A 4HATA 2QG6A 2ZS7A 3IPYA 2CEAA 5JWHA 5C2JB 5KSYA 1CJMA 5EP2A 1E9DA 2YNMA 1OH8A 2B8WA 4NTZA 1G4AE 1NJFA 1I4LD 1IXZA 2F3TA 4RFSA 3B1YA 4D4KA 3VMFA 2QT0A 3QVUA 1UDWA 4QGGA 2P6NA 1G1MA 3EZ6A 4QM7A 3AF3A 2HDNB 2UZIR 5KNDA 1W0JD 2WMNB 4UXHA 1TF7A 5AJWA 3W5IA 2WKQA 1U9IA 2GWHA 4KSBA 4R98A 2ODBA 4BQSA 4DSUA 4WZBE 1D8TA 1BOFA 2OT3B 4BZXA 4DDTA 5JECA 2IYVA 4DIDA 4L16A 1X1RA 1Z07A 1XEXB 3EIHA 4HB0A 1NMXA 4KITB 4FCTA 4EPTA 3FWYA 3TSZA 5BN5A 4TT3D 1SXJC 2RKOA 1BMFA 3W9YA 2IL1A 1Q3TA 3C16C 1QG2A 4L4UA 4N0DA 2ZEJA 1AKYA 1R5OA 3RDPA 3WNDA 4XVQA 3V4RA 3EPHA 4HLQB 1HEIA 2CDNA 3LA6A 3LFUA 1GG2A 1V43A 4L9WA 1ZRHA 3DVLA 5CB8A 3EZ2A 2WVJA 3LBHA 1OIXA 1DTSA 2F43B 5FFMA 5E7MA 4BGDA 4DLYA 4US0R 4Q7LA 1QVRA 3VU9A 5FOUA 1XB2A 2WWIA 1S8FA 3MJRA 2DPXA 2IT1A 4Q1BA 2OEPA 4NL4H 2O8EA 4BFWA 3HPQA 1N6PA 1SVKA 4DJTA 3QKSB 2XZLA 1F60A 5C4GB 4CVNA 1RRCA 3N2IA 2IXEA 4Q48A 4HLUA 1KI7A 3AKYA 4TL6A 3S1AA 3LDAA 2YVUA 3T5DA 1T5IA 2H5EA 2HEIA 4AKHA 3RC3A 2XNSA 4A0RA 1CULC 4N3NA 3DHWC 3IBYA 3D3QA 3OEEA 1U8YA 1Z6AA 2WWXA 3QBVA 1G3UA 4DWJA 2L0XA 1XZPA 1VHLA 3Q5DA 4FN5A 2GZHA 4ACBA 3W3AA 5FOXA 5CB6A 3BWDD 1D9XA 4PQRA 5KPDA 1RKBA 4U5XA 4MGYR 3FE2A 5EZ5A 5K8LA 4LHYA 4HYYA 3QE0A 2ZS8A 1NRJB 1OFTA 4DUGD 3ZVRA 2WHXA 2ZUBA 4LJAA 2W6ID 1T3HA 3X1ZA 2ECKA 3I8SA 1J90A 4G5QA 4RFVA 1E9FA 1QHXA 3P32A 2GRJA 3PENA 3PR1A 1YHNA 3QPVA 4EFNA 2F6RA 3A4MA 1EG7A 1E9AA 2AD1A 2QPAA 3PUWA 4ZDKA 3V9PA 1SKQA 1XTSA 2HV8A 3QJYA 1IHUA 5K8UA 1Z63A 1FQKA 2F1HA 2FFQA 4ARZA 3HU2A 4NCJA 3KB1A 2CNWD 1ZU5A 2JJ1D 2BVNA 2J59A 2P5TB 1FP7A 5JWOA 2QMUA 3N5CA 1OB2A 1G16A 3K9LA 3ZZTA 5EE9A 1SVSA 4JIMA 2FH5B 4D2IA 2D7DA 5EE3A 3THYB 2AXNA 1GSIA 1R7RA 5CJ2A 2YWGA 4PXAA 1Z3IX 4B3FX 2NIPA 2WJJA 2ZI7A 3EARA 1NNEA 1U8AA 4XSHA 3A1WA 1S3GA 5AJYA 3PXGA 1FOEB 2VHQA 1KDTA 1GWNA 2G0TA 2GDJA 3T1OA 1YQTA 2ERYA 3W6PA 1HTWA 2C03A 3CIOA 2J5XA 1MR3F 4G5RA 1FZQA 3ADKA 3CBQA 4XTCS 1OIVA 4A15A 2DFTA 3N70A 1DELA 4Q1AA 2XAUA 1K6MA 2ATXA 2RGCA 4LC1A 3ZD6A 2WSSD 2ZI6A 3CZQA 2YWEA 1PV4A 2NO0A 1XD2B 1KDOA 4QGFA 4TTQA 2HJGA 1GTVA 1WF3A 3QEOA 2EYUA 3IUYA 1E0SA 3CRVA 3AKEA 1IOZA 3KKOA 3RS5A 3ZZ0A 2DFLA 2FGJA 4Q4JB 4EAQA 4B3GA 4GOXA 4HB3A 1ZUIA 4QBHA 1QVAA 4HAWA 1JB1A 3C8UA 1VCMA 1DPFA 2J0VA 4Y0AA 2ZYVX 2QEQA 1ZUHA 4PO8A 4JYCA 4XVUA 1UKEA 2QSZA 2AN9A 2OLKA 2CK3D 4LV6A 4KHZA 3V4FA 1EESA 1E2LA 2C78A 4FMCF 1XTQA 1JALA 1W1WA 4BZPA 3VNVA 4JZKA 5HCNA 3PEWA 5KSPA 1NJGA 4XVRA 3SYNA 5BW8A 1FPMA 2N1BA 3ZVNA 4PC2A 2BOVA 3WNCA 4XWKA 3MCAA 4IDPA 1Z22A 4ZO4A 1IJFA 4OBEA 4XSGA 5DN6D 4LHXA 1EGAA 4C0BA 3B2EA 1FX0A 3THXA 1P72A 1DO2A 4MGKR 4YLGA 3CWZA 2ODEA 1ZM9A 4JYBA 2ZRPA 4PR0A 3TUIC 4US2R 3NBXX 1ZAKA 1N6RA 3OIYA 3ZQ6A 2CHVA 3G0HA 1OF1A 1CBUA 3OHMA 3W90A 4A0HA 5FH9A 1YR9A 4PHGA 3U6KA 2Z4SA 3FKSA 2VP5A 3K0CA 1XTKA 3QF4B 4II7A 2NGRA 1IY1A 3I61A 2IYQA 8OHMA 2REOA 1Z0JA 2UZ3A 2WTUA 1W47A 2PT5A 3VR4A 4C3ZA 4Z51A 1E98A 2BJWA 4B48A 3LD9A 2ZI5A 3B78A 3EPKA 4A6XA 1G3IA 3A36A 1BS1A 2JJ2A 3CONA 1ZD1A 3QENA 4A0GA 2P3SA 4DRZA 4KCGA 1R10A 1NBMD 3E2IA 2V7QA 1OXSC 1E2QA 1G5RA 4KXFB 1ZM3A 1P9NA 3THWA 4QGAA 1NIPA 2GXUA 3WHLA 4MKFA 4QHTA 4WVFA 1FQJA 1HUQA 3FHCB 3AP3A 4ZCLA 5SZJA 1PJRA 2YINC 3CR7A 5FI1B 1A2BA
chains in the Genus database with same CATH superfamily
4C7OA 4QQ8A 1CJSA 2H1FA 3OJEA 3RM3A 4YJ2A 1U6IA 4XIFA 2Y1KA 1DAPA 4QOJA 3AETA 5A4AA 4ZQGA 2OXEA 3ICPA 2QVXX 1ETUA 2ZJ8A 5B58T 1XD9A 1UPCA 3BXFA 4JVSB 1IWBB 3VKGA 2D59A 3RQIA 4UPVA 4OHVA 3H1TA 2IZ0A 5ECYA 2PJUA 5IUNC 2H63A 4DYDA 3DBLB 1X1EA 3EEIA 3OZRA 4MVJD 3GVPA 1HYGA 3AHIA 5H81A 1FDIA 1CIJA 3DD1A 3QUAA 4MUHA 1SQFA 1JIVA 2R60A 2RHLA 3ANSA 3K8OE 2YV5A 2IXFA 1K4MA 4CYMA 1SRQA 3IJRA 1CXZA 2C00A 3E48A 3ICVA 3L40A 3MEQA 1QAMA 4C0XA 5E2AA 3GJ0A 5CDSA 1P7WA 1JWAB 5CAEB 2VHTA 5JDIA 3CZCA 4GOKA 4YRTA 1TUEA 3LWDA 3MTJA 5CX4A 2IODA 1AHNA 2P9JA 4NBSA 4C78A 3AEKA 3KX2A 1KO8A 5ALVA 4R8KA 2VXCA 2NLOA 3QVGB 4D43A 3QX8A 3B2QA 5LPNA 3DOUA 4ZEOA 3EEFA 1I7PA 4GPIB 1WP4A 4ZU1X 1D7AA 2NQ8A 4E2ZA 1AUQA 4LCBA 1UPFA 4R2XA 2VSNA 1EA7A 3PHLA 4YJ2F 1M6NA 1Y3DE 3E0QA 2XOKD 3PGJA 4BQNA 4DHEA 2JAPA 3EH1A 4C07A 2EOAA 1J5EB 4O25A 2FPIA 2VYVA 1IU9A 1JSZA 1KPIA 3MT9A 4N7JA 2PX3A 1Y6FA 3KU1A 2X6TA 1OZGA 2I29A 2WTNA 2XRMA 4M2LA 2EWWA 2P7HA 1LPBB 1A8PA 2VH5R 1HE3A 1N8SA 1PTKA 3BMCB 3EMDA 4I1YA 1GGEA 1A97A 1RFLA 2DBVO 4CR6A 3A31A 1AZTA 4UHDA 4KXWA 4B76A 5I7FA 1E66A 2H1RA 3MS7A 4X5OA 5EAIA 1ZDMA 3D3WA 2I7DA 1STOA 4IMIB 4K9RA 1VMKA 1U7TA 4V02A 3T3MB 3WB0A 4B6QA 1ZIDA 1AMNA 3ZJ4A 1XAIA 4CMGA 2Y3IA 1RQ7A 1BE0A 3PFIA 1QH1B 3ZIDA 1UZLA 5JCJD 1JKJA 4BFYA 5JYCA 5B1HA 3DD5A 2JLZA 1P80A 1M34A 1Q16A 2WNHA 1HDRA 5DK6A 1JHPA 4FGKA 1RLIA 4ZT4A 1PBTA 4D5GA 1F8GA 4IKPA 4B3IA 1I94B 3TW8B 4GW3A 1BAPA 2BC9A 1N33B 1NHGA 3HB5X 4XH9B 1JHZA 2VJAA 3PLRA 3O2QB 4B4KA 4AG5A 1QTNA 4G0MA 4NU5A 1G59A 5IN5A 1DIHA 3BMNA 1E2EA 2PWBA 4EARA 2XB4A 2ZWMA 3C8ZA 3QTTA 3IV6A 3D8RA 1QORA 3BIWA 4MIYA 3OO0A 3C3XA 4L4SA 4M86A 2ZRFA 1W0JA 1DKLA 1W76A 2ZUDA 4TPKA 3FZGA 3A1NA 1FMLA 4B4DA 3E9RA 1GKLA 1HR0B 2VRCD 2FPSA 3E05A 3MHPA 2B1GA 3QXGA 1WW2A 3MFYA 1PJQA 4WJLA 4HUQA 1MJGA 3OJCA 4RF5A 2IPMA 4DE5A 1AKEA 1U6JA 4N39A 4IJMA 1SXGA 4V0ME 1MJ5A 3F9RA 5HM6A 3KL4A 1P2SA 3BQ9A 1F0PA 5DBEX 3ET5A 3G7SA 1ZM2A 4MR8A 3HNRA 3RUEA 4R3NA 1RABA 3OU6A 2VCHA 1C3EA 4M3NA 4BNHA 4BO4A 1IYZA 2FR0A 3AIKA 2OLJA 1W44A 4UOZA 1CW2B 3NR2A 4UU7A 5M3BA 2FGKA 5C1DA 4RS4A 3ZHBA 2IHYA 2I6GA 1M2OA 1XPOA 2HRQA 2F3SA 5DF1A 5A7HA 2POQX 5I51A 3EZ9A 2R79A 3ND6A 1TUBB 1WXEA 2VT2A 2I03A 3GT7A 1P2DA 3QXSA 4L5AA 5HQJA 1RM4A 3FFBA 1V3VA 2JLBA 3NBYC 4DA8A 1ULTA 1XXHE 2GTHA 5EIWA 1XL1A 4KRXA 4WNCA 3S7TA 3RU7A 1X8XA 2WFLB 1MQ9A 3QWBA 5C7OO 3ELWA 5E1DA 2FJ0A 5DYYA 4W9MC 1ML4A 3O2NA 3WADA 2PKYX 2GAFA 1FFHA 1ZI6A 2HSJA 2ZR8A 3NHFA 3AR6A 3Q9UA 4JBNA 4RZ3A 4AUNA 1JIIA 4N7BA 4PG4A 4KQ1A 1M9NA 2NOAA 1TM5E 4FXPA 5HW0A 2XXAB 2OE2A 3DV2A 3W5DA 3VBEA 2P0YA 4DQ0A 4GDFA 1TLLA 2WKPA 2PAAA 2Z5FA 5TPWA 1VE3A 2VHJA 1LWNA 2OKGA 3SYRA 4DL9A 2R8OA 2WWRA 5EMHA 5T3UA 2XWQA 2YZNA 3DLCA 1ESZA 4PXYA 4BXOA 2D1YA 5LA6A 1OROA 3I1FA 4JLPA 2WD9A 2N46A 4A6EA 5DYTA 2R7KA 3QMVA 4NAHA 5C5CA 5LQMA 2FN7A 3RRNA 3GLSA 3UVEA 5E6RA 2QMEA 5FOTA 2YJ4A 3SN6A 1Q0PA 1UQRA 5BQXA 3TJRA 1GYQA 2QRMA 2XNHA 2GJ4A 4N18A 2P2CA 2GNAA 2R2GA 2V6JA 2JH9A 4G1UC 5D6OA 4W9RA 1EXVA 1TU3A 2EX0A 2I62A 4O2AA 2ZBVA 2ZPTX 3TE6A 1KAQA 1MQ8B 1UANA 4TQAA 3AEUA 4RORA 3BB3A 3S44A 3I9JA 3IO3A 3WGMA 1Z28A 3RC7A 2I4NA 4CLHA 1I3CA 4GRIA 1U3VA 4K86A 1YDWA 2R2AA 2QP4A 1LH0A 3VC2A 1YU9A 4MA4A 2Z5LA 1OYWA 2C9YA 3P4YA 4GAEA 3A06A 1A5ZA 4M6WB 4X1KB 1CIPA 2YS7A 1C8KA 4XJVA 4EUSA 1M2VA 4MRPA 1QWOA 4WD3A 2YRXA 4MUAA 2J0SA 4GLOA 2BCJQ 2GILA 4OH1A 4YMUA 4ITVA 3JALB 4CM9D 1AQYA 3PU6A 3ZIAA 5LA6F 1R16A 3ONWA 1Z12A 2OB2A 1II0A 2PSJA 3NYRA 5KB3A 2QRKA 1ZO8A 5KQPA 1C3VA 5M5BA 1GTSA 1TEHA 3TEFA 2WZDA 2ZWIA 3JQRA 1CF9A 1X2EA 2V96A 3QE4A 4JJIA 4NY1A 4HQFA 2CMDA 1R0RE 3ILHA 2FDCA 1GA6A 2QRPA 1YJBA 1UP4A 2RKBA 4A8JC 1NXTA 1PI3A 2V7PA 3LQQA 2XE4A 2C07A 4PC6A 3CZPA 4X54A 1FSFA 4DEXA 2K2QB 1ZI8A 5G53C 1XHFA 4PNHA 3UW3A 3WA6A 2O8EB 1ADGA 1WV1A 4Q02A 4P1ZA 1W75A 1ZWLA 4HDSA 4HJXA 5KYWA 4R0VA 4CF3A 4R2IA 5I7AA 4RZXA 4P4GA 1AGPA 2WUVA 4M8SA 1FXWA 3MLAA 5AUPB 5CVJA 2AH5A 4NZOA 1ILWA 1D7OA 1OI4A 1Y48E 1OTHA 3KZOA 3B52X 2JI4A 3LC1O 1D4ZA 4PBSA 2BR5A 3DM5A 4ZO7A 2VP2A 1IBCA 1NW8A 4B47A 1DUVG 4EKGA 5ICCA 1MRZA 3SJZA 4M0EA 2X9VA 5TT0A 4AJIA 3DC2A 2R68A 2J9XB 1G41A 3K0FB 5TMPA 2GXSA 1V9SA 4O2RA 1OHHA 2Y27A 5FI0B 1GGHA 4CL2A 2FSSA 1E5XA 3LIIA 4FFVA 4OM7A 4ETNA 4YCNA 3IFSA 1SXJA 4IDEA 4E1BA 2JK0A 4PHTA 1JP7A 3SBOA 3L92A 5KC8A 4CBVA 4YRJA 1XDBA 3RYFB 3RC2A 3VZQA 4KIGA 3ZR4B 3GY0A 3A9WA 1E18A 2ODQA 3VA7A 3S2EA 2GX6A 4M1TA 3SLRA 5IVPA 3UGQA 4BB9A 3GD5A 1WLSA 2G1AA 5DN9A 5TXGA 4ALJA 1S3IA 2JLWA 2LCQA 1DQPA 4RNCA 2YDYA 3ZJVA 3TIIA 2FZEA 4UREA 3FX2A 4O4LB 4OYYA 4MX8A 2F9FA 2QTLA 2AX4A 4RACA 4DKXA 4PN3A 5F23A 3E3LA 1QIMA 1TK9A 2GM4A 3CE9A 3OOYA 3GPIA 4RY2A 1FXWF 1KNXA 3L1VA 1P18A 4UCWA 3FMIA 3IE0A 4LYJA 4AULA 3AESA 5E8JA 5BSKA 3LHFA 3X1WA 1P7PA 3LLCA 2OBXA 1W87A 1DQYA 1XCMA 2N0SA 2SCUB 3LAWA 3PGA1 1E5VA 1KQNA 2PBLA 2QX6A 2PKRA 3JD2A 4QXOA 4L5IA 5EKXA 4WOKA 1C8BA 1PJ8A 5G0UA 4QUIA 4J3NA 1CUEA 3G5UA 2EVWX 3GRFA 4HZUA 3EF3A 2PRIA 5EP4A 1YTLA 2HHCA 2DH5A 5AK0A 5LUAA 3ZWOA 3LVFO 1E0DA 4E4YA 2E4UA 1GU0A 1D0SA 4ZMSA 4AF8A 4GKBA 4JVOA 5KQLA 2FX3A 4LBVA 1GZ6A 2ONKA 5AM1A 1PR2A 2Q2WA 3ZNPA 4PZCA 4FFWA 4RTJA 1KZ9A 1C0IA 3NTOA 4G07A 2PQMA 3ZW7A 5CFOA 1U63A 4HUTA 3WO0A 4FN4A 5IJAA 4R1SA 5CXSA 5AO9A 2AC2A 3TXXA 3EA5A 4D25A 1DQZA 4TTTS 3EISA 4OH7A 4G5OA 4CLRA 2DPYA 4AMBA 3V80A 1NQUA 3RSOA 3ZWDA 2XQKA 1P9RA 3PHBE 3CSUA 2W8BB 3T8YA 2VF2A 4Q3AA 2FKAA 4CODB 4QM6A 2WY2D 1CJCA 1V1MA 1BEUB 3TAXA 4IIEA 4HGRA 3PR3A 3IQDB 1ICIA 2CVHA 4I4LA 4G4SO 1F6DA 4YVFA 4Q05A 4OOEA 1Z38A 4HT3B 1BEZA 3MF4A 5IS2A 4BKUA 1EX1A 3SX2A 1YI1A 2EJWA 5IT9A 1IZ0A 4WZAE 2VYNA 3EPPA 3PUKA 2WMYA 4RE6A 2VF4X 3L8YA 5ALXA 4MV1A 1J7KA 5EL0A 1OFGA 2W11A 1MVOA 2C5EA 1AMUA 5KYUB 5DIFA 5F9HA 3LV8A 521PA 3IR6A 3T7CA 2HM7A 2W93A 4H7DA 5EKTA 2PUWA 3RTBA 4BLPA 1CY4A 2QG4A 1E3LA 3INNA 4C5BA 1DT3A 2QPTA 4ARBA 4BAZA 5HS6A 4AJ2A 4B3JA 3B7PA 4XR4A 1DIGA 1IHYA 1YBAA 1QONA 1O6CA 4NMLA 5DX1A 1DQSA 2ZYUX 2VXYA 4X44A 4G0XA 3SYMA 1UPAA 3D0OA 1Q83A 2CXUA 4EPWA 1K88A 5BR4A 3QEKA 4Q7JB 2XSZD 5CW2A 4OIFA 1QC5A 1QP8A 4BQRA 4Q4DA 1V8ZA 3JQ7A 3WGGA 5BNTA 5E1BA 2O2XA 1C0LA 1DFGA 2YHSA 1JVSA 3CLUC 3M6IA 2AQKA 1K8ZB 1REQB 1HKHA 4P3YA 1BVRA 1H3NA 2DBQA 4BEWA 1X86B 1EU1A 2JLSA 2W58A 1QYDA 2O23A 3C24A 4Q21A 3D8UA 1F51E 1A5SB 1BRTA 5IVDA 3PEVA 1J0DA 2A5FA 3D6MA 1QZXA 2R86A 2WWWA 3IEPA 4RTPA 2WAYA 4MV7A 3D8HA 4KO4S 2WK1A 3R6WA 2CLDX 4JHXA 1AV7A 3V55A 2ODTX 1BA3A 3M6LA 1IAVA 1AE1A 1EUCB 5GZ6A 1LBQA 5IMBA 5JALA 5GY7A 1C9NA 4J0EA 4PSDA 4MDYA 1QP4A 1C7IA 2FZ5A 3WKBA 2A9OA 2E4WA 3BN3A 4CIAA 5LNK1 1CQJB 5PNTA 5AP9A 1TC2A 1ACJA 4HZGA 4XW2A 1P1HA 4ZU6X 1YZKA 1EZ1A 3BXGA 4M1KA 4OU4A 3AO0B 1EA5A 3LP8A 2VK4A 5A9TA 3UV7A 3PGKA 3ROGA 3TZCA 1M6VB 4P31A 4DA4A 2D7JA 3OFND 5ILQA 1X7ZA 3H05A 4UU8A 4AN1A 5FBHA 4Y6RA 4E2YA 1LB1B 4D6XA 1LPOA 4GOOD 5AI4A 4IJWA 1R37A 2TSYB 4J0KA 3BX1A 1JBQA 2WNSA 1CKEA 1YKSA 1N6OA 1NP3A 1ULBA 4YRDA 4AI6A 4I1OA 3FTFA 1EYZA 2B20A 1ZK4A 2ZYIA 4JVLA 1YRQA 1U0GA 1NM5C 2QYHA 3AY7A 3IPRA 4YDRA 2DZDA 4JL8A 1CHNA 1HGXA 1AT1A 1IBRA 4XGKA 2W37A 4CHTA 4S1VA 4U2EA 5IN4A 3VZPA 3WRXC 1PT6A 4YJDA 3OE7D 3O9VA 2ZBGA 1TVKB 4DILA 2OO5A 2P1DA 1NJ8A 2F8SA 1E4EB 3KVRA 3M3HA 1VB3A 1NI3A 2P9HA 3GIDA 4KIUA 3SMQA 3HHEA 1KAMA 1NOIA 1Z5NA 4N5IX 2JGMA 3FJYA 4H9GA 2VRCA 1F2UA 1E8DA 4F4IA 1HTTA 3W4JA 4ZZ1A 3GCWA 1FNNA 2MT9A 3HKDB 3JARB 3STHA 1J39A 4HNSA 5U1PA 3HU3A 4BBAA 2FWNA 3DT9A 1TNDA 2IYOA 2CSUA 4GYKA 1XMVA 3P26A 1CYEA 3N87A 4ENRA 3SZGA 1OH7A 2GJKA 2JGRA 4F06A 2ZYAA 3Q3CA 1PV1A 1LTQA 2E55A 2E6KA 3JQPA 4PW0A 5DGIA 3TZHA 4JR0A 3V1KA 4YMHA 4KJZA 4CCYA 5DT9A 5GWXA 2WD7A 5C80A 4N8DA 3X1JA 1P29A 3DHYA 1ZXLA 1D04A 2B98A 2Y1OA 4JEMA 3H2ZA 3F5DA 3VPFA 3VISA 1B14A 4XJXA 3EEYA 1GPMA 4MKIA 2FX5A 5CDFA 1MV8A 1O95A 5I7SA 4EVQA 4OI2A 2Z6QA 3N6RA 3AM3A 1Z75A 4Q4HB 3VGPA 1OC2A 4D0SA 1NL3A 3KJGA 2VP6A 3K2IA 5BR7A 1B73A 4HGOA 3H87A 2G1UA 4EL5A 1JQKA 3AVVA 2H8KA 3R6TA 1YZGA 3MBKA 3BYZA 4CG1A 1RHQA 4KIFA 5SZIA 1P31A 1L7XA 4F2WA 1EFTA 4B8YA 2FE1A 1PZXA 1RQGA 2G76A 4WVLA 3SK0A 4BUCA 1I2BA 1OJLA 3PVCA 1YJCA 3PTLA 1UDXA 3NI2A 2CMFA 2VDVE 4JJEA 5K0TA 1W4BA 2FEXA 2H9YA 3ZWYA 1G20E 2QTGA 3GLKA 2IE8A 3I76A 2SKCA 4OXKA 4RH0A 2PBZA 1IY2A 1B0UA 2W2PA 1DUSA 4W5QA 1XKQA 1IUKA 2YFQA 3K16A 4COOA 4Q66C 1KQGA 2MHCA 5FWXB 3K30A 1OILA 1E6MA 3R3XA 2AEJA 4KE9A 1RIFA 2OK8A 1RM0A 3KZKA 3DQPA 3IT1A 4LVNA 2Y4OA 2FAXA 4QBTA 4JJKA 4JQOA 4XB6B 4FNMA 3LSTA 3BSYA 1J33A 2VYCA 4KU4A 2PXCA 3BE4A 3UXMA 2VAWA 1KYIA 3GBVA 3WDSA 1VSQA 3ZPXA 1H8HD 3RYIA 3WJ1A 5KU7A 1B3RA 4FT2A 1PWXA 2XADA 1TTTA 4A26A 2NZUG 1XZCA 2IYAA 3DOEA 4AX8A 3UPTA 1G5TA 3ROXA 3SBEA 2ZTSA 3O4HA 1TZMA 2G25A 2QB5A 3O4IA 3ENKA 1JKFA 3LGAA 2XTMA 3QEJA 4FI3C 4HVLA 2Y6UA 3HCDA 3KLOA 4QKQA 3OOEA 1AMOA 1P2GA 1V4VA 4FFRA 4ZWNA 4EG6A 3CZRA 1NRWA 3H5VA 2OXRA 1W6UA 4NK5A 2EP7A 3ON5A 2D0DA 2NSDA 4UMFA 2ZTHA 1V6AA 3RCBA 5LZ2A 2QD1A 4KPUB 2GEFA 1J9GA 1NWCA 3BPSA 2WVAA 5C35A 3DEIA 2HL6A 3PB3A 5FWYB 3H6HA 4JQCA 5IDVA 4RPKA 1GR0A 1P3JA 3FOCA 2GK6A 4DHWA 3L4KA 4FKZA 3V4VB 2MOKA 3EJWA 1QIDA 3VPCA 3NB0A 5KQGA 3IEIA 4G97A 2IEGA 3PX2A 3COZA 3IB3A 4ROTA 3TNFA 4D0NA 3PXUA 4GI3A 4QECA 1IZZA 2SBTA 4B6OA 4JGGA 2GBFA 4WLOA 5D01A 5LQKA 2GPJA 3HM9A 1XLWA 4B2PA 4EUFA 4BMOB 4I4CA 2WHPB 4K5QA 1JSCA 2RC5A 1QAOA 4N9WA 5JPCA 4M53A 4REQB 2HK8A 3HR8A 3LOUA 4D46A 4EZIA 1GFWA 4BC0A 4LK2A 3NG1A 2CL7X 2XUFA 3MNFA 4MZXA 5DE3A 2H1SA 5L4NA 3WKDA 2Q2NA 4NEGA 2QTMA 2ABWA 1I3OA 5IMSA 5LKRA 1HY3A 4XFJA 4U2CA 5E0KB 3ZK9A 2ZBPA 2QYOA 2BD0A 1R00A 3BTOA 1ZM7A 1IZ9A 4PRYA 2XA9A 1XZBA 5AK5A 5FBRB 5ESDA 4JHLA 1I32A 3S2IA 4EW1A 3D7RA 1R6UA 4B17A 1HDYA 3IUNA 4BEVA 4GZ5A 3BRCA 4H59A 3AY6A 3U0BA 4HGYA 4NBNA 4S04A 2O1XA 2ZWAA 1POWA 5KHAA 3UBMA 1RJDA 2INGX 3N8KA 2IYSA 5AVQA 3M1YA 1UT8A 2EFJA 2JPDA 3DZJA 3RJMA 3D54D 4C7MA 4LJYA 2C84A 3ACBA 1R4ZA 3F7MA 4ZJUA 2G7MC 3CN7A 1UWLA 1H42A 1YR2A 2VL7A 4Q9NA 4TVKA 2I2FA 3ABOB 3RUHA 1T15A 4GL4A 5DTEA 3VHQA 3NS7A 2VF5X 3GF4A 4JLNA 4N0EA 1S7GA 4Q24A 3AF4A 3WAKA 4IZHA 3E70C 1CETA 3N86A 3MCZA 2IPAB 3LCJA 2PQ0A 4YCSA 3QVMA 3DVSX 1D2RA 1Y8QB 3IP9A 2AGVA 2EG5A 2I4RA 2PT9A 2CXTA 3PZBA 1XF1A 3DAYA 5H5JA 4LV5B 5K0CA 5K20A 2P7IA 4S24A 2PFGA 5I8ZA 5BV2P 2QRVA 1E2IA 1TU4A 4BKOA 5C7LO 2EGHA 3GHHA 5CM8B 4BCDA 2ENUA 2ZJOA 2YV1A 2J45A 4EI8A 3PIDA 2MYTA 2X2EA 3MRXA 2R1UA 4G25A 2G7ZA 4OQLA 3I83A 1R0KA 2PVCA 4TKLA 4RKRA 3S6JA 1TM1E 1Z8HA 4OXQA 3Q6NA 2Z6VA 3DYIA 3GVIA 4FT4A 2XPCA 2OCBA 2FMUA 2AKEA 1X80B 3PGVA 1ZSVA 4YRNA 1NQXA 4E30A 5JEDA 4DCUA 2GHRA 1SFRA 4KPFC 2X9NA 3LY5A 1KRHA 3L02A 4AD8A 3G8DA 4FEAA 1UAYA 4A1OA 4X1IA 3ND7A 3OZBA 3IT0A 5D5QA 3D5QA 2FQQA 3PQ6A 4PIMA 5JT1A 2ZRIA 4EQ6A 2R6R1 3HXQA 1YRHA 1KOLA 2PIDA 2QXUA 2RI1A 3BXEA 3ND8A 4A1FA 1Y9AA 1JJFA 3PF8A 5JS6A 1A2OA 4PZAA 2FFBA 4TS3A 1P1IA 1FTNA 2JLYA 4Q1EA 4RJ2A 5EZYB 3VO9A 1H6CA 1GTRA 1SELA 2IXAA 3SVTA 1FDWA 3TZKA 3LRTA 1JVNA 2CFTA 2NYRA 4TMYA 1ZCAA 2R97A 2D74A 4WXHA 2XMRA 3SNKA 3V1UA 4DPMA 1BFDA 1FNDA 3F8TA 3UATA 1OLXA 3DF9A 1MDFA 5J4HA 3QOYA 2VN8A 4JZYA 3QMMA 1PLLA 3G5MA 1RLMA 2BFFB 1B6TA 2FCAA 3DF7A 4I1UA 1UKBA 3DMTC 3MLEA 4PZPA 3UKJA 3WXMA 1N9KA 1QHYA 1FU8A 1SOVA 3OIUA 2YJNA 3LPNA 4LJ5A 3A27A 1QV9A 2NAPA 3AFGA 4ALIA 1FLAA 4O8ZA 5A5GA 5KJCA 3K9GA 5B37A 4ETWA 1G8JA 2NUTB 4UZEA 4A2QA 4DRXB 4INZA 3GUCA 5F1YA 3T35A 2KS6A 1KOGA 4EJSA 2NO7A 5CT4A 4G85A 4ANFA 4K6GA 1DU4A 1UT6A 4WKNA 1KDRA 2FLVA 1XU4A 2W2MA 3W3AD 2FK8A 3VNQA 5IEBA 1BXKA 3A2MA 3T4UA 1QZZA 4KQWA 3M9WA 1MO3A 4M0CA 3NH6A 5I47A 1X3LA 2MIIA 3W8FA 3RVJA 3U44B 4FE4A 3NMUF 1L4UA 4F71A 2ZIXB 1WMDA 5A1TA 5IXYA 1XL0A 3ZYZA 1NUQA 1OLSB 3IDAA 4RJJA 5KNDH 2MYPA 2YX1A 2VTKA 2PPLA 3BSWA 4ND1A 3ZXIA 4Z99A 1NIJA 5IAOA 2PKCA 2ISQA 5T8KC 3AFOA 2A59A 4U02A 4WWHA 1KKUA 4GVLA 4IUCS 2IBMA 1PT8A 3DJYA 3WYDA 2G82A 3SX0A 1XZEA 2F4NA 2ZSUA 3HS3A 3Q0EA 1N6LA 1PJLA 2MCFA 5JTUA 2PCLA 1GARA 4J0JA 1JNYA 3TCNA 3RAFC 1SHJA 4MW4A 3VNRA 3ZJYA 5ICMA 1I7QB 3HPRA 3L8FA 1Y4ZA 4IXWA 1G5FA 1G21E 4QG3A 1KEUA 4ZTBA 1FUKA 1XP8A 4F7WA 1SR8A 2XE6A 5TVGA 5E6UB 2HLPA 1O58A 1T9GR 3DFIA 4FUTA 3Q5GA 4IXDA 4D1YA 1VLZA 4EHKA 4RA9B 5DM0A 2CUTA 3Q3IA 2P67A 4D26A 3F98A 3GLVA 4RV5A 5CCEA 1Y4DE 5J4LA 1PEYA 2AFIA 1OAOA 4PLTA 3I2FA 1WD5A 1YE8A 3BA1A 3MCVA 1WVMA 3GCGA 5DHAA 3RSCA 5JXJA 2ZT5A 5JU6A 3RVQA 4XB1A 2O0MA 4MA5A 4ARUA 1FDOA 1PT5A 2BZSA 5FWNA 1UXJA 3WBBA 2X0DA 2IYTA 3G85A 3LZDA 1HL3A 3D81A 3UWOA 1K06A 1HEYA 2OOKA 2XWBF 5CYPA 5ALEA 1HKUA 1VHJA 2JLRA 1SCUB 3N8IA 4CT5A 4LF4B 1Z16A 1PR4A 4RZ2A 2ORWA 1BVHA 2P2GA 1NLYA 2PZBA 3L8MA 3N6XA 3NM5A 4FX5A 5EINA 1M0EA 1IXRC 4UBOA 2Q1TA 2O8CB 5LL6P 2EEPA 2FZVA 2ZYTX 3KQNA 2FW1A 3KE8A 4M76B 3UTCA 3ACCA 3IILA 1BYUA 1WUHS 2F48A 1QH9A 2HCRA 3IMFA 4DCOA 4RIGA 1DQRA 1HRKA 2OPBA 4UBLA 4M9XA 3L8ZA 5AWFC 4CMEA 1T91A 1N5LA 4LUCA 2JHGA 1UUFA 2ZUSA 4JR1A 2OFPA 5K6RA 3QA3E 4I8XA 5HZKA 4ABYA 1NVXQ 2PV0A 3TQRA 2DFVA 3WSVA 4DXHA 2XOXA 1GCIA 4A6PA 2IWHA 4OKIA 5KIAA 2FEMA 5DTJA 5AJTA 3TLGA 1JZTA 4YN3A 1YZUA 3K6SB 1ADJA 1BHQ1 4JB0A 4MV4A 4ZI7B 1E5QA 4ZYXA 1O0CA 2ZIZA 1XTBA 4ZEVA 3GUYA 1O97C 4XLTA 5IFLA 4BO8A 1BN6A 2VCEA 3FNGA 3NWPA 1KE1A 3W8NA 2ZXUA 4MV3A 1WDKA 3AI1A 2JFPA 3HVIA 3QY9A 3IP5A 1EVJA 5BN5B 4MKGA 3ESRA 1U0LA 5DNDA 2Y77A 5FWDA 1SCAA 3AEQB 3MGGA 3ZY2A 4MVJP 2FUEA 5DM70 3LT5A 1ZCFA 3ZDEA 1ZRMA 4DJAA 4B71A 4CKXA 1W8IA 2O4UX 5C51B 2F1RA 5KCZA 2WUEA 1ONSA 3CTMA 4A82A 5CD9A 1A9QA 2WABA 5F73A 5AW5A 3SSAA 5JO0A 2GH1A 3DZ8A 1CT9A 2JEOA 2OA0A 4CU5A 2YOHA 5C7YA 2PUGA 3COJA 3VH4A 4UTOA 1EBUA 1Y1PA 4TXJA 1XJCA 2IUYA 4B2YA 4Q3BA 4Q9KA 5K6AA 2GBIA 1QNFA 2A84A 4Z8XA 1HFWA 4IXNA 1YULA 3QVGA 2J9FA 1L1QA 1GVHA 3GEDA 4PAQA 1MOSA 4Z49A 4Y2XA 2E85A 3N76A 4BFUA 1DZ3A 3P5BA 2CN1A 2OCGA 5A7FA 3UB3A 3TR0A 3BH6A 4IHKA 3TGPA 1RVV1 1Q1BA 5LLDA 1QE0A 3KLNA 3CJTA 3ZCRA 2XVYA 1DI0A 1U0EA 2CLFB 3QRWA 2PE5A 2O2HA 2RAFA 3H5AA 5F64A 2ILVA 2IP2A 3G13A 1IXKA 4RXTA 1MAHA 1RWPA 5ANRB 3SEFA 1Q7BA 3VR4D 4QXAA 1A5TA 3NIBA 1R64A 1NG1A 2Q4RA 3PDIA 3WWEA 3X0DA 2AYZA 3A6ZA 1BSVA 4B85A 2UKDA 3LXMA 1K2VN 2GBCA 3CMMA 5KYWB 2FJUA 1V3UA 1HETA 3U60B 3A6LA 2PHZA 5FTKA 4JI3B 1CVIA 4FNAA 3KXLA 3S55A 4M9ZA 1LQUA 3T7AA 2V7QD 4DCCA 2Q1XA 2WKSA 1XOIA 1YR3A 2P6PA 3CX7A 1ZIOA 2ZUWA 2AS0A 1U0RA 1V1RB 1QS0B 3A3YA 4U7JA 3E5RA 3SKXA 3CEHA 3K05A 1RKQA 3T7DA 1RPTA 2W2KB 3WBFA 3NANA 1BTOA 2D62A 4MWZA 4GH5A 2FMTA 3L0IB 4BKRA 1YS7A 1FBTA 1Z73A 2V7VA 2D1RA 3MZ0A 4BX9A 4DLAA 3ZVMA 3DOIA 3CZAA 5JV5A 3OE1A 2J0UA 1LCIA 2AMFA 2V3WA 3M9XA 3NWJA 2DBRA 5JARA 4XYGA 1YJ5A 4UHKA 1JHXA 1QYVA 3GEIA 3EA0A 3SC4A 4GXQA 3K4HA 2XLBA 1Y7TA 3CO0S 1DEXA 3CG4A 1UOEA 2OHFA 1NOJA 3CCFA 4KDFA 1GZ5A 2YN2A 3CPSA 5LYYA 2DB3A 2VNAA 2E6UX 4PSVA 4UDYX 1V6SA 2VDNB 3A3PA 3NEAA 3ADOA 1JJIA 1W2GA 3BTUA 4IDBA 4P80A 1FDSA 1RM3A 5ALGA 3W4IA 4MRSA 1UJBA 3DT6A 5DBGA 2VQEB 1T3GA 3CB2A 3O8QB 3I3SR 1E3WB 1A8QA 5HQ3A 1I4OA 3OKFA 4F5ZA 2GN6A 2AI3A 4PG6A 1P17A 3YASA 1KAOA 2IDKA 1ECGA 1V11B 3CEJA 1SJ9A 4Y2YA 2A92A 2HJWA 4K0RA 4F9FA 3I58A 2B9EA 1N7GA 1X6VA 4OQPA 1S5PA 5KYNA 3U1BA 4M9SA 4HDAA 2REQB 3G3EA 5EJGA 5LZ4A 3UAZA 5CNJA 4I36A 1UEXC 1HQKA 4BX2A 3UENA 4Y1GA 3TW4A 4EF6A 4UJ5A 1R6VA 3SU8A 1ODSA 4RIHA 2XCRB 1XJ5A 1Y4AE 1XV5A 1X87A 3VO2A 2Q3EA 4MMXB 4FR2A 2JF0A 3PJGA 4I8IA 2PGNA 4WMLA 4Q93A 3VDMA 4JMPA 4IIYA 3A4IA 2VRWA 4U6NA 4EYKA 4XIYA 1T34A 2H4FA 1B6RA 3QUCA 4HDQB 5E38A 1T4MA 4OBWA 2E1PA 3TRDA 4EPXA 1XNRB 1T36B 4QL3A 4FVTA 4EATA 5JSHA 2QZ9A 3PUYA 3WV4A 1C9YA 2G4LA 4ENQA 3JYOA 5HRUA 4MB2A 3PFCA 1JLLA 2IZOA 1H9BA 2DGDA 3H9BA 2BGIA 3FUTA 3HP1A 4OHFA 4TTIA 5NLLA 3U26A 4AQ7A 2VH2A 4R6XA 3QE9Y 3GPDG 1QE3A 2CLHB 1ZRSA 1MH9A 2X22A 4WEOA 1TZBA 1ZAYA 3D2LA 2PL1A 4G9BA 1RQPA 1Z6XA 3EASA 2M6LA 4PZ9A 1VJGA 2FSUA 1MDBA 3GDHA 4B2IA 3MTQA 5CD1A 1IPEA 1RI2A 2J9GA 9MHTA 1JXQA 1D2NA 1PDWA 2SHKA 3PTZA 3DKIA 5KTYA 1UKVY 1L7AA 4KMMA 4QYSA 4EKIA 4ZHQF 1KK0A 1UL1X 1DWUA 4EBBA 1JECA 3P2JA 1JIKA 3HXTA 1AQIA 1CZHA 4Q1DA 2IS1A 1F9AA 4EK9A 3TLCA 3MMSA 1MJGM 1XLTA 1Z13A 3FRJA 4IG9A 1EFPB 1EG2A 4PIVA 5AOVA 3TZQA 5IJWA 3FPCA 5IAGA 3CH6A 3NCHA 4WHMA 4G1MB 2QM0A 1VHDA 1PNQA 1T3LA 4X6YA 3WOVA 4K6CA 2IGTA 5A3QA 3EG5A 3EXHA 1Y9DA 1SEVA 1MHPA 3STUA 3G1TA 4WCFC 3K9FC 1GNSA 4JT2A 3THXB 4BRUA 1XWIA 2O20A 3O9ZA 3X44A 5IKXA 4QDTA 4M6WA 3WRVA 1E1MA 4OP2A 1CRZA 1M5UA 4ZPJA 4EX6A 1LDMA 1W36C 2D7CA 5HE9A 3TO5A 1UJ4A 4NC9A 3RG2A 4KDEA 4PPQA 2CV2A 2FMIA 2O8FA 3GMTA 2A33A 1PV2A 3N39C 4LYAA 5AQEA 4BLWA 2C94A 3FCOA 3LP6A 1Z08A 5LIPA 2ORIA 3W6NA 2XGSA 1DEHA 1PW5A 1FYWA 5KZMB 3TINA 4RD3A 2FX2A 3F0TA 3JQFC 3EFHA 2FZ4A 2HIMA 1UBGA 2IYPA 2ADOA 2EGUA 3PS9A 3EC2A 4HOYA 4OHXA 5DNAA 3DZHA 3NYQA 3O74A 4D3YA 2ZBFA 4EY8A 4B3MB 3K9BA 1H4VB 3RUPA 1L7MA 3CCBA 1N2IA 3M4NA 1KMCA 5TJHA 1SUBA 1DB3A 1ZOIA 3EZFA 3JQDA 4UBJA 4PLZA 1Z18A 3JWEA 4LJLA 1KBOA 3FJOA 1THGA 4HTFB 3RVKA 4EF4A 1ZCZA 5K8IA 1IN6A 2R66A 4DR4B 4FGWA 4LQDA 1TW3A 1IOLA 1IHXA 1RAGA 3HQ4O 3P2MA 2E5FA 2G9VA 1O6ZA 1GUFA 3C4QA 3N5KA 4O0LA 1KZGB 5DEIA 3KSUA 2Y66A 2I71A 3LK7A 4ER7A 2Q41A 4WLUA 3IJPA 1JHQA 4BJHB 1WXQA 1QHHB 2XUHA 3D6FA 3RIMA 4DWWA 3CN9A 3K0FA 4QTYA 4ALLA 4FFPA 5JI2E 2MSCB 3AUTA 4P6VF 4Y9RA 3TB6A 2QL9A 4J16A 3TDMA 1QOQB 1SUWA 5I9SA 4I2NA 2CXXA 3JAKA 3MMPA 4L51A 4M9QA 4Q9JA 3U3DA 2DRIA 4WRRA 1M1YB 1EFHA 4ZA2A 3MHTA 3GLIE 3OX1A 5CXUA 1CUVA 3DB1A 3OPYB 3W04A 4A23A 4OLBA 4MR9B 4MWEA 5EMJA 1E1LA 4JL6A 2BFOA 1BX3A 2PAFA 5AMXA 4DMFA 4UFOA 1LZKA 3RYHA 1U0BB 2XKKA 4PRLA 3PCTA 2ZJZA 4Q9DA 4FMPA 1GDHA 4DSOA 1ND6A 4P4SB 3RKRA 1EFRD 1PEDA 4M55A 4NONA 2EFGA 1JDBC 4HGZA 4AS3A 3U4MA 1PJSA 3T99A 1T1JA 4QD3A 2Q4OA 3FI9A 4MPRA 2QRZA 1WL8A 3BVPA 1JS1X 2IYLD 3R7WA 2ZSBA 4Q4LA 1NR7A 3PP8A 1MAUA 3GJXC 1SG6A 3O3NB 3EYWA 3HZHA 5IC4A 1D0IA 1KY2A 2MR5A 2COUA 3HP4A 3R40A 4AJJA 3T1HB 3U5ZB 1NUPA 2RMKA 4U3JA 5KPJA 4DIUA 1FSZA 4DNOA 2IU3A 2QL6A 5BYJA 3RYTC 1DG1G 5ENDA 1QKIA 1MTOA 5JCPA 3K4PA 5DHRA 4FSXA 2V8OA 5BQ3A 1B6SA 3PNLA 4CL8A 1QMPA 4BL5A 5HRAA 4DVGA 1L7VC 3JVDA 2QD3A 5A5FA 4LKRA 2B7LA 1CCWA 1CZLA 1XQXA 2F8MA 3K20A 1T0UA 4FYWA 1QO9A 3T0GA 1LKZA 3H99A 3WXBA