3AKDA

Crystal structure of cmp kinase in complex with cdp from thermus thermophilus hb8
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
202
Chain Sequence
MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRARERPQAYEEVLRDLLRRDSAPAPDALVLDTGGMTLDEVVAWVLAHIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
publication title The crystal structure of the tertiary complex of CMP kinase with a phosphoryl group acceptor and a donor from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
total genus 70
structure length 202
sequence length 208
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akdA00
4JT2A 4U5XA 5LB2A 1N6LA 3G0HA 1GRRA 3AVUA 4HEJA 3IGFA 2QRZA 2D06A 2X2EA 3KFVA 2WICA 4GSYA 2PT7A 1UF9A 5DHFA 3EIEA 1W0JD 1W46A 2GRJA 3F8TA 3GJ0A 3DKVA 1OIWA 5AJZA 4BFZA 1EFCA 3QKUA 1N5LA 4CZ2A 4JLBA 1NVWQ 3DOFA 4MRVA 4AKEA 2HXYA 3PUWA 2GNOA 4GBMA 3OESA 3TVTA 4Z54A 2H57A 3GLIE 4RZUA 1HQYE 3K9LA 2B7BA 4O2RA 1R8QA 1M7GA 3CH5A 1YZQA 2CL7X 4FW9A 1K8RA 2XAUA 4DLWA 3K70B 1Q1ZA 4UXIA 3KB1A 5FR2A 4ILEA 3TH5A 5EE0A 2FSGA 3CRVA 3W6NA 3PUYA 5L3QB 4JVMA 4NCKA 1XB2A 2J5XA 3QVUA 1G18A 2J45A 3VKGA 4P33A 2C8VA 1E2EA 3VNUA 1FUKA 1GKUB 2Q3MA 3IO3A 2D74A 2R62A 3K9GA 1R2QA 2ZUDA 3NBFA 4B34A 1R10A 3KFXA 2XTZA 4G5QA 2GF9A 3PEUA 1LS1A 2JLUA 4HSEA 1Z28A 2CBZA 3CIOA 3PENA 4DKXA 2VP6A 4IDQA 1II8A 3B13B 1XD2A 1KK3A 1NN3A 1OXUA 4G5OA 2KBEA 2ZI5A 3CWZA 2L0XA 3GEIA 3DOEA 4LDJA 4IDHA 1AZTA 5FOWA 2X1VA 3KJEA 1U81A 2CLDX 1UEIA 1YKSA 1IY1A 5K8TA 3D6TB 1EFHA 1QRAA 2NO6A 3B8HA 3NXSA 4DIEA 5JJLA 4DJTA 1L7VC 1G4UR 4B3CA 3X1WA 3I32A 4UNRA 1AN0A 4L9WA 1JB1A 2G6BA 4ZCLA 4DCUA 1SXJB 2QT0A 4CEHA 4PAOA 1TF7A 1J8YF 1KDTA 3UIEA 3THOA 1T4GA 3WNCA 4C7OA 1TL7C 3EG5A 4HYYA 3VR1A 1DO0A 1OFUX 4BFSA 2IC5A 3EASA 5AJXA 4A82A 2QPAA 4XOIA 5SZKB 4OQFA 3B1ZA 1NVXQ 4JLPA 4GFDA 2HEIA 5JEDA 4AYTA 4FCVA 4LHXA 821PA 2XB2A 1CS4C 5DIFA 4DEYA 1OYYA 4HDCA 3T61A 1XEXA 2NZJA 4WIAA 4BUJA 3A4MA 3KJHA 4DSUA 2FFQA 1ZNYA 3ADDA 3OAAA 1DAKA 3DMNA 3FKSD 5EP1A 4D26A 2FH5B 4AIIA 1SHZA 2OLJA 1P7CA 1IAQA 4BLPA 1E69A 5J4HA 3QVVA 2FEMA 2REBA 4CYMA 2FWRA 1NI3A 2GETA 1W7AA 3HP1A 4PO1A 1KI9A 3PXGA 3NHBA 3T1TA 2C98A 2N42A 1NKSA 2A30A 1KI6A 3DKPA 2GA8A 1TEVA 2HDNB 1KSHA 3QG5A 2N46A 3IPYA 2KWIA 3TQCA 4FI3C 1XPUA 3KTAA 5DO9A 2OCYC 3TAUA 3B9PA 3CX8A 1E0SA 3SHFA 1NG1A 1FUUA 1PUJA 3WNDA 3KQKA 5FUVA 3K0AA 1ZNXA 3A1TA 4E03A 2QQ0A 4Q1FA 1GIAA 4OI0A 4LCBA 5AUPB 1CJMA 1W4BA 2QRNA 3X1DA 4GT1A 1I4LD 2XNDA 4K8OA 3GLIB 3CNNA 3NH6A 1Q0UA 3T5DA 1VG0B 3U4QA 1MABB 3R9IA 2EFCB 3KZ1E 4D4MA 5FOSA 1PZNA 2B7CA 4HAZA 3VU9A 5JI2E 3OE7A 5EXPA 4H1VA 2ZJ2A 4JYBA 3NWJA 3IIKA 3TW8B 2GVZC 1CJUC 2H17A 1TF2A 2F1HA 3ND8A 1AS2A 4II7A 1M8PA 4RJLA 4X8MA 3AF3A 1OLOA 2X19A 1K6MA 4PFSA 1Q22A 1X8JA 4BLQA 2XB4A 4EUNA 1ZD1A 5EZ6B 4DVGA 3A6PC 5EE5B 4QBHA 2J0SA 5DYIA 2ZI6A 4P0TA 1GNPA 2HT6A 4QGGA 3GLGA 1OB5A 4TMZA 4L4UA 3RYTC 4M1KA 1E9DA 4NHOA 1TQ2A 1R0ZA 1TADA 3TMKA 1KJZA 1ZP6A 2BJWA 2ZI3A 3WMFA 3TE6A 3B1WA 1CTQA 3ZVMA 2ZJ5A 3MMPA 2NPIA 1W2GA 3REGA 4BLOA 1TF5A 3RC8A 4URWR 2RHMA 1GKYA 4IDOA 2O8EB 3QPUA 2PL3A 2FZLA 3VR4A 1FQKA 1N5IA 4BGDA 4R2HA 1NRJB 1II8B 1S9HA 3QBTA 2K5UA 5G3ZA 1E9EA 1TMKA 1XD2B 2F3TA 4OK3A 4DLZA 5C4MA 5DN6A 4B3GA 4M9XA 2WMOB 2IX3A 3BB1A 1QVRA 4ABYA 3UWOA 3CZPA 1KMQA 5K8IA 1Z29A 5M04A 3RABA 2XTMA 5KSYA 2ZJZA 2J59A 1ZM9A 2H1LA 2GEDA 2ORWA 2QAJA 3T35A 4NCJA 1CJVC 3X2SA 3GLFE 1Z3IX 2G9NA 4OQMA 4W5JA 1EXMA 2ZSAA 3GFPA 2QBYA 2BMFA 4IOMA 4CEHB 5TVKA 2GJ9A 2QTVB 2FX3A 1BOFA 2WIBA 4Q1CA 4V0MA 4XH9B 3QKRA 3Q7QA 1O87A 4JZKA 5JEEA 4V02A 1UKVY 4R9UC 5H70A 4I1SA 2CCGA 2Q6TA 4C7OB 5DE3A 1G8FA 1S1CA 1SVIA 3BFXA 3G5UA 1KO5A 4LJ7A 2EW1A 5K8LA 3FVQA 4Q1DA 1T6NA 1IQPA 4XVQA 1P2TA 2RGXA 4EKDA 4GP7A 1W4RA 1N0UA 1JXOA 2CK3A 1FPMA 4LC1A 3WNBA 2RGDA 4Q21A 4I1VA 3TR5A 1JJ7A 1KI4A 5HZKA 4URZR 3TUIC 4F92B 4A0FA 2BMJA 1D8TA 1XEXB 4F4IA 5CITA 1LW7A 5B30A 3F5FA 1SHKA 1XCMA 3RDPA 2H5EA 2D2EA 4R71A 3C5CA 3KXKA 3K8YA 2O0KA 2EFEB 3QBVA 1E3MA 4BECA 3ZS8A 1H8HA 5A4JA 5KDDA 1AS0A 1IHUA 5J4YA 3CF6R 4B3DA 2ZRMA 3LBHA 1R0XA 2IUUA 2XSZA 2VBCA 3LO5A 1D6JA 1OF1A 1GRNA 4D4KA 2ZAMA 4ZDIA 2WHXA 1Z0FA 2VO1A 3AUYA 4JLDA 1KI6B 5SZIA 1Z2CA 3AVQA 3OIVA 1AQYA 1IJFA 1SULA 3FMIA 3I4LA 1N25A 4N1AA 1E0AA 3C4JA 1TQDA 1F2UA 1I4DD 5FH9A 1CXZA 4WBSA 3QPVA 1IN5A 4JLVA 3UG7A 3SFVA 2RAPA 3SR0A 3TBKA 3K0AB 3LV8A 3THYB 1GSIA 4TL6A 3SC3A 2CJWA 1Q21A 2OO7A 2B21A 4I4LA 4A15A 2OILA 3PCRB 4WZAE 3G82C 4PTLA 5B57C 3OAAD 5DISB 3LW7A 2ODBA 2EWVA 2QA5A 2ZRJA 4PHTA 1D9XA 3AKEA 4DLRA 4TYWA 3U4QB 4PAQA 2ZE7A 3WYGA 1N6RA 4BPBA 5EXSA 1SZPA 4Q7LA 1CULC 3D3QA 4M2LA 3QIAA 3VU9B 3PEWA 4GI7A 2JJ1D 4E07A 5E7IA 4KU4A 1RRFA 1UBEA 2NGRA 1W36D 2XITA 3QF4A 4GPTA 4IVQA 3FMOB 3PQCA 4ACBA 2VEDA 1FP6A 4QC2A 4GDFA 2PZFA 3CPEA 4LHYA 5DSZA 2IEYA 4GOXA 4W7SA 2QGZA 4URYR 2NQ2C 1WCV1 3DHWC 3CH4B 4J0QA 3RWMB 3GLGB 1A1VA 3BB3A 5FBQB 2GCOA 2DFLA 1P5ZB 2Q9CA 1X1RA 1H8ED 4XIGS 2YWGA 1KKMA 2ZSFA 3M0EA 1XU4A 5FUWA 1S2MA 2IXFA 1CR2A 3RWOA 5SZJA 1F3OA 4K81B 2HF8A 4RD0A 4IFEA 1ZRHA 2AKAB 8OHMA 3HPRA 1NMZA 4KFTA 3U2QA 2P6NA 2X8AA 2P65A 1RC8A 2PCJA 3A1SA 4BFTA 4F91B 2PBRA 1DOAA 3CRQA 2CE7A 3GLFB 1ZJ6A 1E2QA 1OH8A 3WRYC 3HU2A 2W6ID 3LD9A 1Q1EA 4QGFA 2ZI4A 1N6HA 2AKYA 4B44A 1IY2A 3GFTA 4M9SA 4H1UA 2A7QA 1XPOA 4TL8A 4LJ9A 1GP2A 4NYJQ 1E2DA 3ZLJA 4Q4LA 3OF5A 1Z63A 3R9WA 2GTPA 2VSFA 3QKTA 3DVLA 3WP1B 4B35A 5FI0B 3UPUA 1Q3TA 1U0LA 1AS3A 1RW4A 4XVRA 4PZZA 4LZZA 3ZQJA 1DG1G 2EQBA 2RGAA 4IOLA 2ZUCA 3MRSA 4PHFA 4Q4JA 1CU1A 4C0JA 2QNRA 2JIZD 2WV9A 1CP2A 1MO4A 2R65A 5IT5A 2XEXA 1R4AA 4LBZA 1KDOA 3W90A 1TTTA 3JVVA 1OSNA 2G83A 4MH0R 2H8KA 4P4SA 1OFHA 2YVUA 4KBGA 3QKRB 5DYGA 2SHKA 5C4GB 5CB8A 1OE0A 1T5IA 4O2LA 5IK2D 4M0LA 4KSBA 4FWTA 1PLJA 2GZDA 3E5HA 2VPPA 3ECCA 4D81A 2ONJA 4LBWA 2VF7A 3U7HB 2DWOA 2GZHA 2WWGA 4LJYA 3W6OA 1NLYA 2ZIAA 1AJEA 2J7PA 3C16C 4S35A 2VP2A 3QXCA 5TV2A 3ADKA 2FPKA 2A9KA 2I1QA 4EFLA 2ZTSA 3P27A 4IOKA 1XMIA 5LB4A 4TMTA 2V6IA 3NC0C 2ZM5A 3GLHE 2WPDA 4ZCIA 4XWKA 3EXAA 4PQFA 4TYNA 1YZNA 3Q3JB 2ZU0C 2ZYTX 3ZZTA 5JI3E 4AYXA 2RCNA 5CK5A 3RHFA 2HXSA 3BS4A 3AF1A 3AM1A 3W5JA 2B8TA 4DCTA 4LPKA 1XX6A 2CLSA 3K0SA 4OI2A 4LWZA 4NYIQ 4JJKA 5TARA 4NCNA 3U7GA 1IN8A 4DSTA 1QHIA 2YWHA 1T3LA 1ZU5A 4PC6A 1F2UB 2P6RA 3LX5A 1VYVA 1VDZA 1IXRC 2OZEA 3K70C 1XJ0A 1CR0A 5GVSA 5EZ5A 3EZ2A 3E70C 2CJWB 4Z8XA 1FMJA 3A4LA 5KSZA 2ZRNA 4URXR 2PLFA 1NKTA 4JKIA 3TKLA 4EPTA 2ATVA 4D82A 3WMEA 1G8PA 4WXPA 1R0YA 1RVDA 2XGJA 2WOJA 3KKPA 1ZYUA 1FMLA 3HWSA 3KUCA 4G5GA 3EWAA 1VPLA 4C4PA 1IM2A 4BRWA 3WHKA 1TNDA 3SS8A 1KNQA 2NO7A 5EUMA 5FPHA 3IPXA 2H7VA 4Q7JB 4RSGA 4OQXA 2WWWA 5LD2C 1XZPA 5K8UA 3QF4B 4DRZA 2HYIC 3VHLB 1U98A 4URUR 4Q1AA 4TLDA 5JWRA 1W5TA 521PA 2C9YA 1J70A 4JBYA 4C9BA 4CRWB 1XJQA 4E09A 1LVGA 1RKBA 2WWHA 2FDCA 3UG6A 3FHCB 3AVYA 2GCOB 1IBRA 1U8ZA 2XOKA 4HUTA 1SVOA 2RH5A 4TQAA 4QG7A 1FZQA 2VL7A 4RCZA 1XD9A 3QOFA 4WZBE 1SVWA 5F2EA 4JLOA 4BRUA 4BLSA 4P4TA 3OIUA 2F1JA 3UMFA 1IY0A 1OH7A 3SQXA 2O8FA 5LPNA 2J9RA 2ZITA 1G21E 5KDLA 2DYKA 3MSXA 2PEYA 5KNBA 2OAP1 4FMCB 4A0GA 3SBEA 4CVNA 2FV8A 1KOFA 1E9BA 4QBFA 1AIPA 1YR7A 2AD5A 5CLLA 4NE2A 1XXHA 1DAFA 2ECKA 4QGHA 2YKGA 4CT4B 3EIHA 2ZI7A 4LBVA 1Z6YA 2B6HA 3BAFA 1GZSA 3A1WA 3MCAA 1Z6XA 3NBYC 1WRBA 4LJ5A 3TR0A 4IEEA 4MQBA 1W4CA 5JRZA 2Z6VA 1XEWY 1W44A 3THWB 4QGAA 3EA5A 2F1IA 2FFAA 1IJEA 2PT5A 2VTKA 5DI9A 5E7JA 1UBFA 4ZKEA 1OFTA 2UZ3A 1NSTA 4BASA 1AK2A 4DDWA 3GJ7A 3T1VA 3SEAA 4NP6A 1P60A 2WWFA 1XXHE 4Q4JB 4LGMA 4TSFD 2NO1A 1IONA 1QHYA 1JEDA 4XTCS 4HAXA 2WJJA 4NZYA 5A5GA 1AM4D 4N3NA 4P4SB 1NG9A 2AXPA 3QI2A 1ZM4A 2QTHA 3CB4A 3QEJA 5FTJA 1UDXA 4RZ2A 4E5UA 4FWIB 4KSCA 1BMFD 2AK2A 1E2KA 4HUQA 1G7TA 1ZC3A 4W5HA 2ASEA 2AR7A 4Y0AA 1XMSA 1J7KA 2GXQA 1W48A 2YZ2A 3SNHA 3JZAA 1N5KA 1HT2E 4B33A 3JZMA 2AN9A 4HZUA 1LB1B 2GAAA 4JMPA 2BM0A 3KKMA 1E2IA 1UPTA 3CNOA 3H84A 3RS4A 3I3SR 1T0JB 3V4FA 3VQTA 1E1QD 1UFQA 2ZRLA 5HR5A 2Q3FA 2NTYC 2ZYWX 1TQ4A 3EPJA 2CEAA 4A8JC 4ZKDA 1Q57A 1T9HA 2HF9A 2O0JA 2ORVA 2ZJBA 5EXTA 1ZC4A 4LYFA 1TQ6A 3ONWA 5CJ2A 4FD2A 4JLJA 4A8JA 4MGYR 4Q03A 4WOPA 2XZPA 3U3OA 1E1RA 4GMDA 3SU8A 3KKNA 5FTKA 2ZE5A 1N6PA 2FPMA 2J87A 4DSOA 3THXB 5TMPA 1BYIA 3CRW1 2IYLD 2J7PD 4AKGA 2CVHA 2AWNA 2WWXA 2F9LA 2XNSA 4YLGA 2CHQA 3AP2A 5CIWA 2ZE6A 4B2IA 3RS3A 3C7KA 3PEVA 2F9MA 1PUIA 3K0CC 5G53C 2KI5A 2KB0A 3ZVNA 1KSGA 2W2VA 4JBWA 2WPDD 1J99A 1E2JA 1Z47A 3K0CA 3ZQ6A 2IS4A 2QROA 1A5TA 5KNDA 3H4MA 1VG8A 4CW7A 4NYMQ 4M22A 4B71A 2QZ4A 1YQTA 1FX0B 1Z6TA 2BVNA 2O8EA 2ZRGA 3J81k 3VNVA 2JLYA 1TAGA 3K0FA 1N6NA 1MH1A 1XTRA 3M4YA 4GOJA 3WP0A 4MRSA 1DO2A 4KYIB 1Z08A 4LUCA 1FTSA 4RZXA 4ESHA 1JR3D 5LD2B 3FTQA 3U3RA 4M53A 5KYKA 2EFGA 2IT1A 2CMKA 3LQRA 2FNAA 1KIMA 3K70D 2FEOA 2DFNA 1KAGA 1G19A 1TPZA 4KAXA 3ZIAA 5IRCD 2ZRIA 3ZJYA 2O8DA 4UQOA 1FQJA 3BERA 3BGWA 2DCUA 2NG1A 2PJRA 2BKUA 1NMXA 1YZGA 3ICQB 2EFHB 1E9AA 4O3MA 2O8FB 1N6OA 2C9CA 3LH5A 5UKDA 4DCSA 1TU3A 4QBGB 4EFMA 3DO6A 1VKJA 4PX9A 4QNMA 3IO5A 4Z51A 2QTFA 3GFOA 4LHWA 3ZZ0A 1Z0JA 4M4SA 2QUZA 2F6RA 3P4XA 1A2BA 1XXHB 4G01B 2DFKB 4KJZA 2D4HA 3B82A 3H0KA 3DZ8A 4MYCA 4O0MA 1GKIA 4TN1A 2OAQ1 4JSYA 4C30A 5JRJA 4IDPA 1GOTA 3SN6A 1IN6A 2IUSA 2ONKA 2P2LA 4Q66C 2KBFA 4MRNA 5FR1A 2PX0A 3IDQA 2XOKD 3IBYA 4NU0A 1E2MA 1OW3B 2FE4A 4DUGD 2ZVQX 4WAUA 5FBRB 1T8UA 3QQ5A 4ASUD 5TDHA 1CR4A 3RANA 3VMFA 1DELA 1W2HA 2IHYA 4IKEA 4FCWA 3FYHA 1SXJD 2PH1A 4C3ZA 4KLZA 4LV6A 4PHGA 1T3SA 1YU9A 2JDID 1ESMA 2JJ2D 2ZAOA 5D3QA 2W0MA 2XJ4A 2NO0A 3SE0A 1XTIA 4Q4AA 1E79A 1JEEA 5JBQA 5A0FA 1VG1A 1COWD 2VHCA 1P75A 4JS0A 1G5PA 1AA9A 2GEUA 1D5CA 1L4UA 1NN0A 1VHLA 2OXCA 2ZRFA 1G7SA 4MGKR 4RFVA 4DT1A 5JFGA 3GP8A 1K5DA 2REXB 3EWSA 2A78A 2LKDA 2X77A 3F3YA 3O47A 3B60A 3QUSA 4HUQB 2XX3A 3THYA 1IXSB 1XTQA 1SVLA 3AF4A 1T8TA 2P5TB 2RGNA 4P31A 4BFXA 4BLTA 1Y63A 2LWIA 1R8SA 4P32A 4OQNA 2OFOA 1PLKA 4HZUB 5E95A 1ZINA 3RRZA 3IKJA 3KDSE 2MMGA 3LLMA 3I61A 2AXNA 4ESVA 3R7WA 1P9RA 3Q72A 5EQTA 3RLFA 1OKKD 2UVQA 5CB6A 3U61B 4KI0A 1P4SA 5KSOA 2RB4A 2LCFA 3TIFA 4US2R 3GEEA 3PIRA 3QKSB 4FMCF 3ZZUA 5FOXA 2YINC 4MDFA 3Q7PA 2JLSA 2VSXA 3OEHA 2CNWA 4TT3A 5FBWB 4G1UC 4I81A 4YXWA 4A8JB 1OXVA 1X6VA 1LF0A 1F2TA 1FP7A 2FGJA 1P62B 2GJAA 4S2EA 4PO8A 1NVUQ 3MUFA 2GAOA 2V7QD 3OEEA 2ZJAA 2CL0X 2UKDA 2A5FA 1I4TD 4D2IA 1LTQA 1ZM7A 4AD8A 4TLCA 3BFVA 3X1YA 4CGZA 2C2HA 2W6JD 1DAMA 2E9SA 3MWLA 4MKIA 3PEYA 3ZD6A 3AKYA 1PV4A 4HLCA 3X1ZA 3UK6A 1NN5A 4X8OA 1XTSA 2P6UA 5SZHB 4EPRA 2JLVA 1C4OA 2ZS8A 1OHHA 3KX2A 4Q7MB 3PJRA 4CEJA 1NL3A 2ANBA 1KK1A 1H65A 2YOHA 3U3MA 1XMJA 2WM9B 2HLDA 2WSSA 4PC7A 4CT5A 4PC2A 5HE8A 3LQQA 5D3MA 4Q02A 4KVGA 2EVWX 1W5SA 1UKZA 3K0FB 3GLFA 1SKYE 3NIBA 2B8WA 2OM2A 2DBYA 4LV5B 4HB2A 4UNQA 2ZPTX 3SFZA 1ZD9A 4OYHA 2AK3A 3WYFA 4A0HA 3SJZA 1HT1E 4KBFA 2WKQA 1ELOA 2IHBA 1E98A 1E2HA 2BC9A 4JL5A 2ERXA 4TMKA 1XCPA 1FW6A 3NTUA 1DAIA 2O8DB 2R6FA 3H2YA 1TUIA 3L82B 4PPQA 3QF7A 4FCTA 1KHTA 2RGEA 3T12A 2QM8A 4A6PA 1L4YA 1OFIA 1RYHA 2GKSA 3CO5A 2IYTA 3U60B 2GJKA 1KZ7B 3I92A 4WZ6A 4V0KA 4LYHA 4A2QA 1DE0A 4OJKA 4ITRC 1WF3A 3L8ZA 5JHGB 4ON9A 1NJGA 1XFAA 2WKPA 4BEJA 4GOKA 5L3RA 2CVFA 3RS7A 3MWJA 2YNMA 5E3HA 3C14C 1VECA 5H1YA 2VP9A 5JS7A 2QAGC 1DAHA 4C0AC 4QJ5A 2P67A 3U3JA 1JR6A 2OV2A 1M7BA 1T5LA 3I62A 4AY2A 3SYNA 1A4RA 2QAGA 4UNNA 1BKDR 1LNZA 5FBVB 3B1YA 4JJZA 4IOJA 4JVLA 1E9CA 1XTKA 3P26A 2BMEA 4FINA 421PA 4JLAA 2H16A 4DHEA 1XD8A 2IYQA 3A8TA 2QENA 4L9SA 4TL7A 2OXRA 4MGIR 4A6XA 1GM5A 2VQSA 1AQUA 1XJCA 4PZLA 3AV0B 2ANCA 5P21A 4BE7B 3R8FA 1CF4A 4WVFA 3UANA 2QE7A 221PA 2WIAA 2QY9A 3ZVRA 1MO3A 3TAHA 1RRPA 4Q4AB 5GJBA 3VHXA 2W83A 3SI7A 1XDBA 3R20A 1RE0A 4DT1B 3OFNA 1E32A 3EZ9A 3HR7A 2DR3A 3IQWA 4GMXA 1V43A 3LRPA 4ZDJA 5HPYB 1HYQA 2RMKA 5GJCA 1II9A 3SBDA 5KU1A 621PA 2WMNB 1XEFA 1G5TA 3RS2A 4AI6A 1J90A 4A36A 3R7WB 2BJVA 1YZKA 1GL9B 1M74A 3FE2A 5JHHB 1MV5A 1RYFA 5ELXA 2PZEA 1F5NA 2RGGA 2WJVA 3CR8A 4Q48A 1XP8A 2Z43A 3B7GA 2A5GA 3RAPR 4Q5IA 4AG5A 3LW8A 3MG9A 1F2TB 1GL6A 2QP9X 3H1TA 1G20E 1OT3A 4G5SA 3P1JA 4KHZA 4XSHA 4TZ6A 3NC1C 2MMCA 1XMVA 2FFHA 3CPJB 2FF7A 3A58B 2FPLA 1CRPA 1AKEA 3H86A 1MRSA 3PR1A 4NCIA 4B6FA 1Q12A 2ZI9A 5DLQC 2BBSA 2ZE8A 3ND9A 4V0OA 4RD4A 4POAA 2O8CA 3GJ3A 5TXGA 5BN5A 3DZDA 2XNDD 4U7DA 1Y3AA 3DM9B 4LPSA 2FFBA 3PUVA 3IEUA 1KJYA 1PLLA 3F0TA 5JCPA 3NBZC 3A1VA 4CEJB 3IUYA 4RFSA 3HDTA 3CRRA 2G1KA 3AH8A 3VFDA 1HE8B 5L3SB 4D4LA 3OE7D 4LYAA 1KDRA 4HLUC 2VRWA 2FSHA 1EFRA 5FFMA 1Q1QA 2CNWD 4Q00A 4US1R 1P9NA 2CXXA 1QG4A 5D3MB 4HLUA 3FFBA 3T06B 1NBME 1N6KA 3B2EA 4Q9JA 5G41A 4PPFA 2QP4A 4TLBA 5KTYA 1R0WA 1VIYA 2KE5A 2NOAA 2RGCA 3OEED 2DHRA 4QM6A 1I2MA 4RD3A 2D3WA 4OHWA 2O0HA 3GJ8A 4P4UA 4V0LA 2G3YA 3MFYA 4C2UA 4KV9A 3O8DA 2XZOA 3Q9LA 2ORIA 1ESNA 1N6IA 4ACAA 3THWA 2GEVA 1ZCBA 2GK7A 2ZROA 1ZAKA 3WMGA 2GZAA 1CJKC 3ZH9B 1X8LA 1AGRA 4DSNA 4B47A 5B2ZA 1ETUA 3W8RA 3ZVLA 5HKKA 4Q1EA 2VA8A 3EZ6A 3GJ6A 4W5WA 3R9XA 1VIAA 4RY2A 3VR5A 4HB0A 1Q3HA 1S3GA 2BBTA 4ZDWA 3K9NA 4Q7KA 3AP1A 4C0HA 2ODNA 4O25A 1Z83A 2ZRKA 3GLHA 3TRFA 2IF0A 1A2KC 4KITB 1PVOA 1QF9A 1II0A 4QXAA 5BWMA 2ERYA 4LYJA 2PMDA 5FTNA 2W58A 5J4KA 2IWHA 1B0UA 2NMVA 2ZRBA 3IIMA 2O8BA 5JWHA 2Z4RA 5DN6D 3VR6A 4MYHA 4HAVA 1Z06A 1U2RA 4Q9HA 2ZANA 2QN6A 4ZPXA 4JLKA 4LV8B 4YDSA 2QGNA 4I99A 4PPNA 2IA5A 4F38A 2QAGB 1KK2A 1XEWX 6Q21A 1Z8FA 1CRQA 1HE1C 4TYPA 1P2VA 2V55B 3T1OA 2OFWA 4Y0VA 1T0HB 5L8VA 4JVNA 2Z5FA 3AEZA 2WWIA 5E7MA 3C5HA 4BFVA 3TSWA 1ZCAA 1ZM2A 4TL9A 1YZLA 4JT4A 4EAQA 3L2OB 2ZEJA 1FNNA 3LY5A 1P2UA 3TGPA 1RIFA 1EWQA 1BYUA 2C03A 4LJAA 3QXJA 4PZYA 5FPTA 2IS2A 5JCZA 3WYAA 2V6JA 2GILA 2W2TA 3MJRA 4TTPA 4FXPA 4BQSA 3KL4A 2A5YB 4F93B 1Z5ZA 4Q01A 3THXA 1G7RA 2CK3D 3WXMA 2Z83A 1M34E 2IK8A 4MRRA 1E2FA 4QJ4A 4LJ6A 1QG2A 2HCBA 2ZSDA 4MA4A 1RPZA 2A2ZA 5JS8A 1C9KA 2IUTA 1CJTC 3BRWD 2BMDA 5EP4A 2KJQA 3AF2A 5EE9A 5GVRA 4EPWA 5EUQB 1H8HD 3DMDA 3LDAA 3DM5A 2ATXA 3M1IA 3SJCA 2XSZD 1TUEA 5KOYA 1FX0A 1QHGA 3V9PA 2QI9C 4PSKA 4QHSA 2W00A 2D7DA 2IS6A 1G3MA 2I3BA 5IDVA 3EPLA 1E4VA 2VYFA 3T1QA 1OH5A 2ZJ8A 4NL4H 2CHGA 4MRPA 1Z0DA 3K1JA 4EJSC 1CBUA 2FOLA 1E2GA 5CLQA 1GAJA 1N2CE 3EZFA 5F3WB 4EJSA 5BW8A 4LJ8A 2OESA 3U6BA 1Q20A 3WY9A 3KJGA 3E1SA 2JA1A 1OIVA 2D7CA 2QMOA 2WVJA 5CM8B 2AX4A 3D8BA 1UEJA 1ZNZA 3WBKA 2O8CB 5CYOA 1JR3E 2ZSBA 3L0IB 5AJYA 1QBKC 2JASA 4PO9A 4C0QC 1SKQA 2JATA 4IXNA 1D2MA 2OLKA 4A4DA 3CONA 5AJWA 3E2IA 4KO8A 3B6EA 2OFXA 5BQ5A 4RFSB 4A2PA 2UZIR 5CDFA 1S1MA 3RRNA 5AR1A 2Q0HA 3IIJA 1DAEA 4A9AA 2VSOA 4MUAA 3QXSA 2VP4A 3RRYA 2OHFA 2ZR7A 2R6GA 5KNCA 4XD7A 2OUKA 1U90A 3Q85A 1YR8A 1US8A 2RHDA 5AJVB 1OXSC 5FPYA 4IRUB 1E99A 4OK5A 4D0LB 4MGZR 1E4YA 1MKYA 1P6XA 2C78A 3FKSA 4MYUA 5DI3A 4NKRA 3AVVA 3CKLA 2IS1A 1AZSC 3C15C 5LBIA 1VCNA 2ZRHA 1ONBA 4QHTA 3U7EB 1XZQA 1G3RA 2LKCA 1NSFA 1ZUHA 4XVUA 5CDFE 2J0QA 1DG3A 3C41J 4V0NA 2IW3A 3FMFA 5J4VA 3ASYA 2R2AA 4PQYA 2QL6A 2EYQA 5EJEA 1YR9A 2WSMA 2EU8A 1E9SA 3LBNA 3QXXA 1G41A 2JLRA 4YMTA 4IXMA 5FOVA 2P0EA 4IEIA 4BFYA 4OK6A 1CKEA 4P3YA 1YZTA 1KMHA 3IEVA 1R7RA 4NONA 3GLHB 2YV5A 4YMVA 3ICEA 4EQ6A 3EW9A 4ZDKA 2QP3A 3RS0A 3GD7A 3C8UA 4TZ0A 2G77B 2WJYA 3L0SA 3EA0A 1SVSA 2VHTA 5IHPA 2O8BB 1SGWA 4M1OA 1Z0AA 3NG1A 4KXFB 4US0R 5HCNA 4B3FX 3P4YA 1NNEA 1KI1A 2GWHA 1KGDA 2WTUA 4Q47A 1HEIA 1P9WA 4Q9KA 3TSOA 4BZPA 4DLUA 3K0EA 2ODWA 4BFUA 3NEJA 1KY3A 2WBLC 3QEOA 5CM9C 1G8GA 3BK7A 2JAQA 4OQLA 5C46F 2HV8A 4NYMR 1Z2AA 3ZS9A 3LA6A 4NMMA 3QKSA 1E0JA 2DPXA 3I73A 4I1OA 3M6AA 3NBXX 4B2PA 4JYCA 1EG7A 1A7JA 1DBSA 2OEPA 1HH4A 3CWQA 4UXHA 3A1UA 2R6AA 2J0VA 3N2IA 4LHVA 3AVWA 1KNXA 4GRAA 4NTZA 1HA3A 4OJQA 3OZXA 2AD1A 1G6HA 5FUXA 4JSTA 1KDPA 1M1YE 4JIMA 1V5WA 1PJRA 1G4AE 1D2NA 4D80A 2GJ8A 2BOVA 1VG9B 5HE9A 4ZV4A 2ZRCA 4RD2A 4AKHA 3LFUA 2AWOA 1P73A 3I8XA 2BKEA 1NVVQ 4FMBB 2QU8A 4A1FA 2E1RA 2V9PA 3CRMA 3U3KA 3K09C 3WRXC 3KQLA 3D31A 4LSGA 4BEBA 5FUYA 1YJ5A 3AQ4A 5J40A 1HY3A 3K09A 4U00A 2A5DA 3RRMA 1IN4A 1GWNA 3GEHA 1FNMA 3MLEA 2JGNA 4YC7A 3AVTA 4BZXA 4AURA 2W2XA 4MKGA 3CM0A 3W8NA 2R6DA 4MUBA 1N0VC 2V1XA 5L3VA 2QORA 4GP6A 1X3SA 3WBJA 4G3XA 4KYUA 2WKRA 3TQFA 4GZMA 1NLFA 1JNYA 2AL7A 4EJSB 1R5OA 1BS1A 2GXAA 5BN3A 1VMAA 3FMPB 2F1RA 2ZSEA 3B78A 4RKFA 3B1VA 3L8YA 3KB2A 2ZS7A 4QL3A 2ZRAA 3LVQE 4HI0E 1ZUIA 2PZGA 3MD0A 2FZ4A 2F55A 1ZU4A 1FFHA 1S9DA 4PSAA 3KXLA 3KJIA 2PX3A 3SHWA 1ZUNB 3T15A 3T34A 2OG2A 4HAWA 4ZCMA 2JLZA 1US8B 1NY5A 1Z0IA 3DEFA 1JPNA 2R8RA 4H9GA 2G0NA 2H92A 2HJVA 3NVAA 1VCMA 2DWQA 2JEOA 5DI3B 2IYZA 4YMSA 5GADl 1CLUA 1HQCA 4YMWA 1OJLA 4LK2A 3RC3A 2XXAA 4LBYA 1OH6A 4UNSA 2KSQA 2BEJA 2C5LA 4OHZA 3UMSA 1A82A 4DCVA 5BYJA 4KFUA 1KI8A 1Z6GA 1GNQA 4PSVA 4ZI2A 4HLDA 4OL0A 4B2LA 2V8OA 2C95A 4HAUA 4CEIA 3O8RA 4DZZA 4UNPA 2IYWA 5BN4A 1VYTA 2ODEA 3VX4A 1T3HA 4RD6A 1KY2A 1WDTA 1LV7A 3CUEF 4XD7D 1L8QA 5JECA 3KQNA 3CX7A 1KMHB 1U0HC 1GL7A 3LWNA 4EQ6B 4AWXA 4IDNA 2VIIA 2WOOA 5G40A 3BXZA 3R8CA 2RGNC 1WXQA 3IILA 4FN5A 1NLZA 2O5VA 2OBMA 4A92A 1XF9A 4OHYA 1SVKA 2G1JA 2MSEB 3RSLA 4QRHA 1W36C 2ZYUX 1W4AA 1K5GA 4UXJA 3W6PA 4ERNA 2JJ1A 1HUQA 2CL6X 5FL3A 4Z1MA 5B58C 2F7SA 2JLXA 4D25A 3RS5A 4M8NE 3U7FB 1VYUA 2DWPA 2CCKA 2OSBA 5EE1A 2WAYA 3X1XA 1GITA 2FN4A 1C1YA 4R2IA 4DIDA 1TU4A 1YVDA 4JL8A 3KUDA 3T5GA 2YYZA 4GL2A 3S1AB 121PA 5JMTA 2R6CA 4PC1A 2OCAA 3RVBA 5F98A 3ZDQA 5EXXA 2FSFA 2QMEA 2VH5R 4C0LA 1YR6A 3AGPA 1KAOA 4DEXA 2QQEA 2O52A 1H8EA 3FB4A 4TLEA 3PUZA 1R5BA 4KFSA 4L8GA 3EIQA 3B5JA 1G64A 1JQLB 3HYTA 4M9QA 5AUOB 4EIWA 4AYWA 2EWWA 4OBEA 4DLYA 1RZ3A 4TMWA 3SDZA 5JWOA 3U44A 3BFKA 2ZR9A 1G5RA 1UM8A 2IYYA 1RRGA 1G17A 3B85A 1U9IC 4LX0A 4OI4A 1MT0A 3IBGA 4KFRA 1TEXA 4WW0A 4Q9LA 4QKQA 1Z0KA 1GVNB 1BIFA 1VHTA 3NHAA 1MO6A 4R7ZA 4ZI3A 1U9IA 5L3SA 1G8HA 1ZVQA 1U8YA 2W6IA 1NIJA 3MWKA 4XTRA 2OCPA 3FGNA 2CDNA 4X8LA 5HTKA 1OXTA 2QEQA 3PUXA 3PVSA 1E94E 1O3YA 3NKVA 4LRWA 2NPFA 1HTWA 1OV4A 2Z0MA 1Q1BA 3ADCA 1QHNA 3GJXC 3TK1A 1NN1A 1R6BX 1E1RD 2DB3A 3EARA 4G5RA 3KKQA 3BWDD 4HB3A 5KHOC 5C18A 1P61B 2YOGA 4LOAA 4LHZA 4BFWA 4B3BA 2IF2A 4DDVA 3NDBB 3OIYA 4OKSA 1UAAA 4PPGA 1S8FA 2GXUA 3QNUA 1D2EA 2JIZA 1X8KA 2NZ8A 4D0NA 2BM1A 3HU3A 4DLTA 4UKDA 2J0UA 2GJSA 1DAGA 1LFDB 2WZQA 3GLGE 4C2TA 3LBIA 3A37A 3CF2A 3FDIA 1LF5A 4RVCA 1G8YA 4QOSA 5IK2A 3HPQA 3V00A 4URVR 1KI3A 3AVXA 1W0KA 5J4LA 3AP3A 4L16A 2HJGA 1VCIA 3W34A 2PEZA 3GPLA 1EK0A 4PXAA 1P3JA 1GILA 1LS6A 2JCSA 3Q5EA 1HV8A 4PR0A 5CIQA 3O8CA 5DGXA 4D0GA 1OXXK 1WBBA 4AKIA 2Q21A 4LJ4A 1WB9A 1UBGA 2J46A 5FOUA 3TJZA 4PANA 5LDDC 3HR8A 4B32A 1J2JA 3L0OA 1MOZA 3MJHA 1E0KA 4Q18A 2XXAB 3W3AA 2Z4SA 5KUTA 2VP0A 3QE0A 3VKWA 5DHAA 2AFHE 1YZUA 3ZIAD 4ZIRA 5JSZA 2I1VB 2FJUA 4L5BA 1G7CA 1Z6AA 4NDZA 5AK0A 4B74A 2R9VA 4R98A 3TSZA 2IYSA 3LX8A 3CNLA 1IXZA 1B23P 1UKEA 1OPXA 2V3CC 3LNCA 4QM7A 2FA9A 1P2SA 2WAXA 3RNLA 3I8SA 1G1MA 1S0UA 4JLMA 2ZREA 4CEIB 2IXEA 3PFIA 5CK4A 1G6OA 1KJWA 1M7HA 2GF0A 4HLQB 1CIPA 1JPJA 2GHIA 3IQXA 2I4IA 2P5SA 2BDTA 1NP6A 3EC2A 3LLUA 3QXHA 3A36A 4B6EA 1DTSA 1BH2A 2BHRA 2IYRA 4YMUA 2YC4C 4IW3B 4V0ME 1QHXA 1N5JA 3TW4A 1QVAA 1IN7A 2YJTD 3SYLA 2GK6A 4DLXA 2V1UA 5FTMA 3L43A 4MKFA 3SOPA 2H18A 1X1SA 2VHJA 4RKEA 3SQWA 2GBLC 2AHOA 1YE8A 4Q4HA 4RD1A 4XWOA 2D62A 3W3ZB 5EP3A 1E9FA 2V4ZA 5JLJA 5AWFC 1ZIPA 2C04A 5GJVC 4YDHB 2GBLA 3FKQA 3KTAB 1W36B 1RJ9A 1Z22A 4K46A 1N3BA 1UJ2A 2C96A 3GJ4A 3W5IA 1I2DA 4ARZA 4X8HA 1EESA 4TYQA 3B1XA 1DVRA 1FTNA 3QY0A 1VTKA 5DNYB 4C0KA 1EGAA 2C99A 4AG6A 1E79D 4N0DA 1G3IA 4B3XA 1AGPA 3P32A 1QHHA 3AKCA 3DPUA 4LY6A 2J1LA 1KYIA 4M1TA 3LAWA 4TQUS 1Z07A 1U8AA 4YONB 1W1WA 4NYJR 3RSOA 1ZMXA 4DLSA 4EDHA 1QDEA 1WMSA 4D4JA 1G9XA 1NBMA 4JKYA 1SQ5A 3UXMA 5JZVA 2EFDB 3SJBA 3U44B 1UADA 1SKYB 5H8WA 3NDPA 1WA5A 4HB4A 3IHLA 2C77A 4Z1MD 2ZS9A 3VR2A 3N2EA 2ZRDA 2YWFA 3EX7C 1OIXA 2RKOA 1DARA 3LVRE 4I1UA 2Y8EA 4AK9A 2VHUA 2OBNA 2R44A 1M6NA 1D9ZA 2CE2X 1JI0A 4TTQA 4IVPA 5E4FA 4IFBA 1QHSA 2ZVPX 4QFMA 3OEHD 1KK0A 1F48A 2IWRA 3U6KA 1Q44A 4TT3D 1M2OB 2F43A 3NH9A 4DLVA 1F6BA 1YRBA 4M1SA 1N0WA 2G88A 4YXWD 2J41A 3FHOA 1S3SA 5TY0A 4A2WA 4FMDB 2WWYA 4F4CA 5FPKA 3TUJC 2ZU6A 3TNFA 5JJKA 1FOEB 3AGQA 4IJMA 4EPYA 2FSIA 1KO8A 2ZQ5A 1LY1A 2IXGA 3Q5DA 1NMYA 3FPAA 3UMRA 3VAAA 3CF0A 4TSFA 1JAIA 2A3RA 1JAHA 4JLNA 3SJAA 5F9FA 4L15A 3QENA 3EZ7A 4V03A 721PA 1JECA 1XTJA 3I5XA 2CHVA 2Q3HA 4FIDA 1P72A 1HURA 2J0UB 3BH6A 4B73A 4DCNA 1OHHD 2IYVA 1G3UA 4NPHA 2DFTA 5FL7A 2ZYVX 5GJWC 2CCJA 3PG5A 1GNRA 1BMFA 3AUXA 4HZIA 4EPXA 2HLDD 2WSSD 4A0RA 5KSPA 4DBLC 3KXIA 5IF9A 4NYIR 1KO1A 4OI1A 3BD9A 3CZQA 2VLIA 5DH9A 4EFNA 1F60A 1MR3F 3VTKA 2FU5C 3ZD7A 4PC3A 2B92A 3HJNA 3AVOA 1WBDA 3TLXA 2C9OA 1UDWA 3MAAC 3NEYA 1UBCA 3I5YA 2QPTA 4TQ9A 4HDQB 1CR1A 1E1QA 4D6PA 1YHNA 3PV0A 3D7MA 4RZ3A 2IYUA 4NBSA 3ADBA 4AC9A 1T91A 2E87A 3MWYW 2P3SA 4ZIRB 2QBYB 1EX6A 5JSZB 1EFUA 1XBTA 1JALA 1R5NA 4GNKA 1XWIA 1ANKA 4BWYA 1DPFA 5BYKA 1W0JA 2WJIA 1EX7A 4TYYA 2HT1A 3PITA 1W0KD 5C1BA 4KVAA 2BWJA 4XWAA 4MYTA 2X2FA 4UJ5A 2GXSA 2ZRPA 1E2LA 2QMHA 3DDCA 2OBLA 2GDJA 2IL1A 2OT3B 1ZIOA 2MSDB 4NH0A 1KSJA 5TB5A 5EP2A 1BO6A 4Q1BA 3CLVA 4DDUA 3N70A 3EAQA 4W9MC 1W49A 5HZHA 2JLWA 3AB3A 1XNJA 3CBQA 3I72A 3UWKA 2CLCX 5J47A 4IHQA 2W0SA 2YC2C 1GUAA 4DB4A 2OE2A 1U0JA 2Q9AA 4F7WA 3KQUA 1UKYA 1WE2A 2QT1A 2FMXA 3A4NA 2ZXUA 3AKDA 3SYKA 4HDOB 2RGBA 2QSYA 4BZQA 4MKHA 3JVUA 2HUPA 5J5CA 2TMKA 4DXAA 1S96A 4Q4HB 2BBOA 2G0TA 3ZGXA 3BORA 2FGKA 5ANRB 4TMVA 4E22A 1KI7A 4KLNA 3KQHA 2EYUA 1DEKA 2BV3A 2ZUBA 4BLRA 4WXRA 4B76A 1RJ9B 3ASZA 1U94A 2QE7D 5BXQC 4ARZB 3LXXA 2QSZA 1GTVA 5HCIA 1JJVA 1JR3A 3SZRA 3VR3A 3VKHA 2PCLA 1KO4A 4M1YA 4B43A 1GFIA 2AFIE 3CPHA 4PQRA 1RFLA 1ZW6A 1NY6A 2QPOA 3K9HA 1KKLA 3ETLA 4PAMA 4JBXA 2VP5A 2PJZA 1E6CA 3HU1A 1DS6A 4CIDA 1KZGB 1QHHB 2REOA 3BH7A 4M21A 3TUZC 3MGCA 1JQJC 2XJ9A 3OFND 4IVRA 5L3QA 1RRCA 2WJHA 3OHMA 5H68A 3BBPA 1ZM3A 3HYRA 4NCHA 1KTVA 2BEKA 4C0SA 1KSFX 2BCJQ 3AF0A 4B75A 3CR7A 3QG1A 4M1WA 4GZLA 2ZJYA 3O8BA 4KCGA 4TLAA 3EC1A 1XPRA 4JL6A 2JJ8A 4MDEA 4RCYA 1NF3A 3BC1A 2ZR0A 4MITA 1ODFA 3B9QA 3GJ5A 2YHSA 3P20A 5KPJA 2F43B 1E9RA 1KI2A 1ZNWA 1G291 3UATA 3ZYCA 3BH0A 2D2FA 2OCBA 3BJIC 4XJXA 3K53A 4OHXA 4DUGA 5F9HA 1OB2A 1G3QA 1SXJC 4ASUA 1AKYA 2V54A 2GCNA 3DL0A 3GCGA 1IOZA 2VHQA 4WA7A 1NBMD 3REFA 1SXJA 3GQBA 1U99A 1EFTA 5FTLA 1NJFA 3FHTA 4LC0A 2JDIA 5KPDA 2JJ2A 3N5CA 4QHYA 4F4JA 1G16A 3VX3A 1FL9A 4HATA 3U5ZB 1NIPA 1X86B 3Q8XB 4DC9A 1QZXA 1COWA 2Q9BA 3QJYA 2BIFA 4Q19A 4Q9IA 2WJGA 3IHWA 4TTRA 2GCPA 2PLRA 2BBWA 2DY1A 2MSCB 4YQFA 2QM7A 1EFRD 1MRNA 3UKDA 3CX6A 5C2JB 5B64A 3CW2A 4PHHA 2QMUA 5KDOA 2IEZA 3LXRA 1SXJE 3L0PA 2HCJB 5CYPA 2XZLA 5AUQA 3GMTA 5CJPA 3I1FA 4EPVA 3FOZA 1E2NA 2ZETA 4QNRA 3W9YA 3WHLA 3QPWA 2ZJOA 2J3EA 1KO7A 4KODA 4QBIA 4TWZA 4CDGA 1OKKA 4M1MA 5FOTA 3BB4A 1S4QA 4N0EA 2F3RA 1NVVR 3TVDA 1WP9A 4B48A 4U02A 2NO9A 5FBLB 4XSGA 2YWEA 3AVPA 4TMXA 3V4RA 1E2PA 4OHVA 5HKKD 1XRJA 3KKOA 2IYXA 4LI0A 3OIWA 1OYWA 5EE3A 5FL7D 1SVMA 3FFAA 4QJ3A 4CF7A 2GESA 4G0NA 1XCGB 3S1AA 2QG6A 2V7QA 2BCGY 4JVSB 2FG5A 1DADA 4Z8YA 4C0BA 1GDDA 1GG2A 1E96A 2PMKA 5G3YA 2A5JA 3FWYA 1J8MF 3BOSA 2N1BA 1WQ1R 2J7KA 1ZBDA 2W6JA 4M9ZA 5KO2A 2JLQA 4DDTA 4FMDF 1JBKA 1JXMA 2IBMA 2XTNA 1YRAA 4HAYA 3GLIA 4DWJA 1TX4B 3EPKA 1MABA 1W47A 1ZD8A 2GVDC 3BIFA 4UJ3A 5JJIA 5FPSA 5AUNB 4ZO4A 1GRQA 1VCOA 2YOFA 1L2TA 2HYDA 4DB2A 3EPHA 2VF8A 5FI1B 1CEEA 3BE4A 1EWRA 3QSYA 1MO5A 2NIPA
chains in the Genus database with same CATH superfamily
4UBLA 5KYYA 3TW8A 3WLTA 5K2OA 5KVQA 1GRRA 3QU2A 3HRKA 3LHFA 2ID8A 2X2EA 3RYHA 4F4FA 2WICA 5K7SA 2AC2A 2XDQB 1N2CB 1LSUA 2QN7A 1UF9A 3GXOA 4G25A 2EIXA 5DHFA 5FBZA 1W46A 1C41A 2GRJA 1GKLA 3BL6A 5EEGA 2YVQA 4A7PA 4AKTA 3WIBA 1NMQA 4I46A 1GPLA 4ENQA 4CZ2A 1NVWQ 3BHJA 1A8HA 1FFWA 2HXYA 3PUWA 4GBMA 4GWLA 1FFDA 3GGPA 1N77A 3BZUA 3TVTA 1E7WA 3GLIE 2NTNA 1HQYE 4PG8A 3G8CA 3K9LA 4BO3A 3T9BA 3I9NA 3DXFA 2AKEA 1F3LA 4EG5A 1ZD5A 3EVAA 4JFRA 3U48A 1ARZA 4N76A 3O9MA 2GKGA 3GZTB 3O4JA 3HKEA 2F1KA 2UDPA 4LNUA 3H2KA 4V1CI 3KB1A 2V98A 1QGZA 4PFQA 1I4OA 2FSGA 1AT1A 2Q4EA 3PUYA 1PZEA 4LN1A 4Y1RB 2QX9A 4P7FA 4C4AA 5JAHA 4CXMA 3WTBA 2J45A 2OO5C 5C5EA 1XPJA 4BNGA 2QG4A 1E2EA 4QREA 2IODA 5EMKA 4P5PA 4QQ8A 1FUKA 1GKUB 1VCHA 2RONA 3UXYA 3VNUA 3OFJA 4B34A 4RPCA 1R10A 3DHEA 4Y2GA 1O9BA 5B3JA 3VO9A 2YHIA 1FSGA 5LQMA 2GPYA 3DC2A 1M5TA 2IZ6A 3Q9NA 3GGCA 1SOWA 4E2WA 1IIRA 5DMXA 3A2NA 3R8XA 1RHKA 1S3IA 1A9OA 1XD2A 5KWEA 3WAKA 1RP1A 3ECSA 1PW7A 2KBEA 1WLSA 3HXTA 3CWZA 4KVZA 4UUPA 4B6RA 4UHBA 3QMPA 4OHPA 4QFCA 5FOWA 3BE5A 2YXLA 3R5SA 3T7DA 3TMAA 5JAQA 1G55A 1YKSA 3BKXA 4JBNA 1YB6A 3TTYA 4L5CA 1SC9A 3OCVA 2WJ3A 2I4OA 3VTAA 4BJHB 5K8TA 1XVVA 1CVLA 5AOAA 4GG1A 5J2UF 2R6JA 3B8HA 4CM3A 5IVDA 5JJLA 4D57A 2IZOA 2X6RA 3ABQB 2WY2D 1PFYA 4C03A 1BMQA 2G6BA 4DCUA 3GQBB 2QT0A 5EI5A 2A5LA 3P19A 3WLNA 1CZKA 1YV9A 5TQVA 2ZT7A 1RWBA 4YRCA 5FPPA 5C53B 4EHHA 2JEYA 3UIEA 5GGYA 1MX5A 2QLJA 3DE1X 2D0OB 4NMWA 5BWNA 3MJEA 4HYYA 3EG5A 5B55A 4EG8A 5KVVA 5LP6F 3R3HA 4BFSA 4E5YA 3CVWA 2APJA 3EASA 3KSMA 2PRJA 1U0OC 4HKTA 4A82A 2QPAA 1J33A 4PIPA 2X1HA 1U7TA 4L0QA 3U17A 2JD2A 1XZIA 3B1ZA 2I7DA 3GAFA 3G0GA 4I66A 5U1PA 821PA 2QV7A 3E03A 4I6GA 5AI6A 1CS4C 4IH4A 5DIFA 3A3KA 3T61A 2H54A 3BFJA 4PZDA 1OFGA 1X94A 3F5MA 5AM2A 2JAXA 4JYAB 4FUQA 1ISMA 2VJQA 4GLFA 1KAQA 4KQ6A 1KDVA 4OHKA 4LG1A 5BMVB 1VGRA 4QYIA 2FH5B 2XKBA 2OLJA 3A4YA 4C4XA 4FONA 2VNIA 1IAQA 3FBTA 2CT8A 4NBWA 1E69A 3TPFA 5J4HA 2A8YA 2F3UA 1JQ3A 1T9CA 1G98A 3QM1A 3TTUA 1AQJA 3JARA 4OHCA 1OOEA 1DCMA 1JILA 3PXGA 4BO9A 1CZNA 4ML3A 4NFHA 2AUMA 1U3WA 3JQGA 4U8GA 2NU9A 4FYMA 4PINA 1RJEA 2QB5A 4FI3C 4IKPA 5FA8A 2OYCA 4MS4A 2JBHA 3L7MA 4GP9A 4HFNA 5JH7A 2X0IA 3CX8A 2NQ8A 1E0SA 4OYYA 2Q29A 2V5AA 3D8TA 5AHRA 4POOA 1E4OA 4V1CB 1MJGM 2IELA 1BWQA 1KERA 4D92A 3I01M 3L8CA 1R0KA 1HO3A 2J3MA 4UOQA 3RK4A 2QQ0A 4QYXA 4DARA 4U7GA 3DKIA 2FX5A 4LTMA 4G8DA 1HSZA 4LCBA 1W4BA 2WYHA 3IBFA 5EXEA 2Y99A 1E1MA 2X2OA 1CUGA 1TC1A 3HRIA 3KOUA 2R60A 4GT1A 1D0SA 2Q5EA 4UBOA 2QYHA 5HHTA 2XNDA 3KVYA 3H6HA 2C00A 3HN6A 3KEMA 4MVXA 4ZODA 3DLHA 3CBGA 1C4XA 1X7YA 1T1IA 4IJ5A 2EFCB 4BCCA 5A5FA 2VSNA 5ITVA 2YRWA 4D4MA 1DC7A 4HAZA 2W9XA 1SNYA 1USGA 4JGIA 4R1OA 5EXPA 3WGYA 1CEYA 2AMVA 1PR0A 1GDHA 3A1CA 3AO0B 1TF2A 3MYYA 1HRKA 3ICOA 1R6VA 2BFFA 2IV2X 3IMKA 5F5XA 1Y98A 4D9EA 2XB4A 4ZZ2A 1N0IA 3DAFA 2HPZA 2BI8A 3WISA 2O3JA 4QBHA 5D3ZA 5DYIA 3ZCTA 1ECLA 4L4RA 2NM0A 2QX4A 1GNPA 3M8KA 1MIOA 4QGGA 4WH0A 3GLGA 1RYEA 4L4UA 3RYTC 1T9GR 2GCIA 2IHUA 4C01A 4NENA 2CDAA 2ZTHA 1E9DA 4Y6GB 1WTAA 1TADA 4PYQA 1Q0RA 1W2WB 5JSUA 3E9CA 1ZP6A 2AZ4A 3W9BA 1XZKA 3HL4A 4BVGA 3OF3A 4Z7NB 1L5FA 3NYIA 4DNPA 2XUHA 3AUFA 5H0IA 2QRPA 3EQ2A 2DBVO 3GEBA 1SQ0A 3MMPA 1DIAA 3TTWA 1QAOA 1B6TA 4WOCA 1ZL2A 4NZ9A 1QFZA 4OQQA 5CT9A 1C9DB 1ETHA 4PAGA 2X40A 5CU7A 5T4BA 4BLOA 3RC8A 1SBTA 1CJBA 4URWR 2RHMA 5K3AA 2BPOA 3QUBA 3JRXA 4UU8A 2X6TA 3QLUA 3CNBA 5B4TA 2PL3A 3VR4A 2P4HX 3IUBA 5TPWB 3DXZA 3FSGA 1U3GA 3I6YA 1WDLA 1LZLA 4IIUA 3VZQA 3IE0A 4M1EA 2N1MA 3HJGA 4R2HA 3HWX1 5KWVA 4K1XA 5MHTA 1LCIA 2R1TB 4MV7A 2AFHA 1XK6A 3HH8A 4NBRA 5G3ZA 4L4YA 4FIZA 4X91A 1PJCA 3UJ8A 1CR6A 2W71A 1WX1A 4Z9YA 4M9XA 3TRDA 3ZHSA 5EIBC 1CS0B 4BB5A 3OE1A 3GRVA 1A4XA 1YB4A 3O3CA 2PV0A 2J3QA 4JYZA 2YZGA 4B80A 3TCXB 1AA6A 5DRTA 4N18A 4X85A 1IDN1 2RG1A 3QWBA 4P83A 5M04A 5KSYA 4L3OA 1EWTA 1SBZA 2ZJZA 3TLJA 3K05A 3FR7A 1OLUA 2FPPB 1Q14A 1KA9H 1AOXA 1NUQA 4W8HA 1ZR4A 3X2SA 4KRGA 5AKEA 3OETA 1Z3IX 2WAAA 5LQKA 3KKLA 2G9NA 3WWPA 4UTNA 5NLLA 3GFPA 1L1RA 4UHFA 1UDBA 2BMFA 1HETA 2GJ9A 2QTVB 3CWCA 4V0MA 3KWJA 1EINA 1ESCA 4DBVO 2VF5X 4JZKA 4Q1VA 5JEEA 5H70A 4MJ7A 4I1SA 2CCGA 2Q6TA 1ZKMA 1G8FA 1AK9A 1Z26A 3C3KA 3PU6A 4JB2A 1S1CA 1GCGA 3FFTA 4MINA 4TZKA 3NRJA 4AY6A 4IQGA 1ID8A 1GGJA 1FMFA 4N7MA 3P2MA 4CKZA 1P2TA 2RGXA 3BF7A 4IUDS 1MA0A 4GP7A 3ZY6A 3K6SB 1N0UA 4KNYA 3HO8A 3VAZA 3EXHB 2B98A 4Q21A 2OPHA 4AZVA 2DPLA 5HX7A 2NO5A 5HZKA 3TUIC 2BMJA 3BWMA 1XEXB 3INNA 3NTVA 1KEKA 3HXMA 4P0QB 4P3OA 5B30A 1WKCA 5HG0A 3HKDB 4G24A 1SHKA 2PMFA 1JP7A 3D5TA 1E1CA 3SM9A 3F6CA 1NVKA 3QBVA 3KYCB 4NMLA 4UVDA 3W4JA 3IVCA 1X92A 3EXEA 5LL6P 3AI7A 1VKNA 1R3UA 3CF6R 1OBVA 3HP4A 3JVEA 1POXA 1NWCA 2IUUA 2C58A 4CKCB 1MDFA 2ATEA 3EZNA 3C6ZA 1TLTA 3M5WA 2VO1A 3EDOA 3OCYA 1EGHA 2YV3A 3AVQA 4HGQA 4JJIA 4ZCQA 4II2A 1SULA 2DX7A 3I4LA 1JG4A 1E6EA 1OAOA 2K2WA 3C4JA 2EQAA 1KFEB 1H2FA 1CXZA 1X7DA 5FH9A 3ZXSA 2RAPA 1CRZA 4Y9DA 3K0AB 3ZOKA 2ZW9A 3V97A 3V8MA 2CJWA 3O3MB 4G1FA 8LDHA 2OILA 2FZWA 2C1EA 2RJOA 4JMLA 5GZ3A 4YACA 3OQOA 3HO1A 4MHTA 1IU9A 3O2QB 3LF2A 3OAAD 1YS7A 3HHEA 4TT8A 3ZCUA 3R9KA 5JOQA 2ODBA 1Z5NA 1RRMA 1EAYA 1RWPA 5JS6A 3U4QB 2ZE7A 3VZSA 3F98A 2ZWAA 4HWKA 5GM2A 3K2IA 5ADWA 2OQ2A 3OOHA 4GUDA 3ODGA 1PFKA 3PEWA 5LOVF 2JJ1D 4JJ6A 4Y67A 4IHKA 2Z6UA 2NN3C 4GD3Q 1RRFA 4YRFA 3GUVA 2HUNA 3Q10A 4F5ZA 5EHGA 3C4QA 3PPVA 3QF4A 4O33A 4GPTA 3U4DA 1TT7A 4P2BA 1NNUA 2VDUE 1NXWA 4RENA 3G9TA 4QC2A 4QVKA 4TRRA 4OJMX 2NTVA 4GDFA 1WXIA 2FLVA 3CPEA 3LU1A 1YQ9A 2FZKA 3KZNA 4GOXA 2NQ2C 1DKLA 2PUCA 3KU1A 2M6SA 4GBGA 3I2IA 3KLMX 5A9RA 4IICA 5BMVF 3BB3A 5IT0A 2GCOA 5B1YA 4HEA6 1Z2EA 4BEVA 2WNSA 1PAUA 1PYDA 1F2DA 2I6FA 3D3WB 6GPBA 3DZHA 1XCBA 1XU4A 3K1TA 1S2MA 3KPWA 2HA3A 4KQMA 1CR2A 1MHPA 5SYNA 4BO0A 1PFWA 3BDVA 5SZJA 4L85A 1CFJA 2AJLI 2HF8A 3DO8A 3WGGA 5BV8A 5IG2A 2IVFA 2C3YA 2ZYIA 3D2LA 2IOFK 3JQFC 1X7WB 3NWBA 4KFTA 3EQ6A 4WMLA 5JUWA 4H7JA 1M6EX 2P6NA 2X8AA 3BZWA 4XIJA 4ZD6A 3MTIA 2P65A 3DQPA 3PC4A 4KDFA 1RC8A 2J4CA 4LQLA 4F91B 4OIFA 3CRQA 5EL0A 2CB0A 3EEOA 1GEGA 3GFBA 4NE9A 4EABA 3A3PA 2CE7A 4ES6A 3GLFB 3H9BA 3HU2A 1DDOA 2W6ID 5CT4A 2HMAA 1Q1EA 3M5CA 2O3SA 2AKYA 3ZU2A 5EIFA 1Z25A 3GFTA 2ZWOA 4H1UA 5TF4A 3TI9A 3KL2A 1XPOA 5A71A 2FPWA 3H87A 4LJ9A 4P84A 3BSWA 4TL8A 1MP0A 1E2DA 4MQFA 4TM7A 5A4MS 5TLSA 1JS1X 1L5VA 1IOWA 1ULSA 2VDWB 4C1BA 4LRYA 2WB2A 1Z63A 2VSFA 3Q3HA 3QKTA 1TD9A 4YRQA 4B4VA 3WP1B 1GV0A 3PQEA 3UPUA 5HF6A 2HSWA 2RHJA 1FLDA 4MGEA 2R96A 2IPLA 3AHIA 1KDZA 1UZLA 1DG1G 2EQBA 2ST1A 2Y9PB 3HDYA 1XQXA 4UAGA 5EQFA 1NYRA 2HHHB 4CHTA 1EG2A 2QNRA 2WV9A 5IT5A 1P91A 2XEXA 1H2HA 2VDVE 4XX0B 5EZQA 4HPXB 4F46A 5JISA 1BKYA 2PNJA 1OSNA 1OWOA 3BCHA 4LECA 1Y8RA 3DOJA 5KWSA 2HIMA 2OZVA 3BDIA 3QKRB 2ZIXA 4IDGA 4KBGA 2OZLB 4UTXA 4LRXA 3OSZA 1BDHA 5IK2D 3DF9A 4N03A 3D6FA 4FWTA 1YJAA 3JWIA 2JGDA 3EIXA 1AH2A 2HQRA 2VPPA 3OQHA 4D81A 2CNDA 2ONJA 4CM5A 4ESEA 4YUAA 4LBWA 1LGYA 1SUEA 1G2PA 2FR0A 1VM6A 2H4ZA 2HZ7A 1NNSA 3MTGA 3P0JA 1JA1A 2X1LA 2ZIAA 4KUEA 4MHSA 1N2JA 2J7PA 2NSLA 2CVZA 1WSBA 4QX6A 3UJ6A 2VP2A 1IHXA 4PNZA 3ZJ4A 1SHLA 1TEHA 2OGUA 4Z49A 2WHQA 1Q7GA 5JAZA 3HJFA 1X7HA 3WKDA 1NDHA 4TSRA 5HBGA 5KNBH 1N9GA 3G2PA 1PJ3A 3OZUA 3L7AA 1K9VF 4L08A 3NC0C 2O2GA 4I50A 4TMTA 2ZM5A 3RIEA 4ZCIA 2AFIA 3KTOA 4XWKA 3R3VA 1P2GA 3HCOA 4TYNA 2FX2A 3TTXA 3W3AD 1MEEA 3G9QA 5IM4F 1HDOA 1VL5A 3ZZTA 2FFRA 3BG5A 5KJCA 2BKLA 3AF1A 3FTDA 1BNCA 2B8TA 3JQPA 2ATIA 4H3KB 3TRHA 3K0SA 1W5FA 2J5KA 5B1DA 3RSCA 4NCNA 1G8MA 1SRQA 3ZX4A 3PLAE 4RVHA 1HYBA 4DR3B 1T0UA 3CLTD 2DBZA 4PC6A 1VYVA 5K3OA 3K70C 2I8CA 5GVSA 5JE8A 1PFGA 2BEVB 2BUCA 4X1YB 4LXXA 5IBCA 4KPGA 2AZMA 3UMCA 5KSZA 1GXSB 1KL7A 4URXR 2BLNA 3BTSA 3L84A 3TKLA 3VU0A 2W6NA 3URMA 4EPTA 1I51A 5KKNB 1V1MB 3WMEA 1JTVA 3A4IA 3QWHA 4HZGA 4KYVA 3SLRA 4E88A 2XGJA 1DAOA 1NNLA 3KUCA 5CDHA 4G5GA 4XQCA 1M0WA 4Z4IA 2OSVA 5I9LA 3WSVA 3LHIA 4BRWA 4OB7A 1X1EA 1H2BA 1Q17A 4YJGB 4JUFA 4EARA 3NBMA 1L5MA 2QSJA 4RM3A 1T2NA 2NV6A 3IX7A 4ARCA 1A2OA 1F8GA 2YZMA 1NVDA 4P7JA 4Q7JB 4OQXA 3N2LA 2LZ0A 3H13A 3GG9A 4BAGA 4DV2B 5KQSA 5CA0B 1SKUA 4MVCA 1U98A 5LMNB 4O59O 4TLDA 1V25A 5J2TA 1W5TA 2ONYA 4FZVA 4MUHA 4WESB 5ETJA 4EH1A 4KNWA 4HC4A 4OL9A 4C9BA 1TD1A 2E5LB 8GPBA 1P80A 3O8LA 3UBTA 3N1UA 1LVGA 1PVDA 4DG5A 1QGUA 5AJTA 5B1HA 1GQSA 1IBRA 1TU0A 3R41A 4P98A 3OZBA 5IAEA 4BO4A 2RH5A 4RCZA 2PRZA 2C1ZA 1XD9A 1JL3A 4UZEA 5DPMA 3C5EA 2QVYX 1Q0SA 2C7BA 4REOA 5CG1A 4REQB 2YVAA 3FRJA 2F1JA 5PGMA 1E3DA 2GUWA 4U4AA 3SYTA 4LZOA 5LPNA 3NDRA 4OA8A 3MCTA 5HRUA 1G21E 3TNLA 1CE8B 5ALTA 4HVAA 4V0QA 2VAMA 5F12A 3HCWA 3BTVA 5EJ8A 1F12A 1X7ZA 2AG5A 3ICPA 1ODSA 2QRGA 3VR2D 1H42A 3NDJA 1HDRA 4UBNA 1JJIA 4P34A 4CVNA 5ADVA 4EKYA 2XODA 1G1AA 1AIPA 2BF4A 1E3EA 3L9WA 4FZ3A 4MK4A 1FJXA 2O2YA 4QGHA 1U5BB 3RASA 3RJ9A 4CT4B 4LBVA 4UMFA 3P71T 4U1RA 4DMGA 4RTKA 3BAFA 1I4WA 2C5BA 1C7QA 3BWCA 5FFFA 1Y9DA 2ID9A 3H6KA 4AY5A 4QT4A 1I6WA 4OUKX 3O4VA 4EBBA 2J9FA 2E6KA 2RI6A 4MQBA 1I2ZA 3WK5A 1HM5A 2Z6VA 1XEWY 2WB4A 4WJZA 1W44A 4KN9S 5A06A 3EA5A 1B41A 1I9GA 3FNQA 3X2EA 2FFAA 2GHQA 2PT5A 2ZYHA 5DI9A 5GY7A 4GHWA 2P9EA 1JFVA 2UZ3A 4FR2A 5I7SA 1H0SA 2NXCA 1AK2A 4ND3A 4DDWA 3E9MA 1AF4A 3F47A 3KOWA 4KMOA 4R7TA 3ZZ1A 1BFUA 5ALDA 3V42A 7REQB 2GS9A 1JZTA 2NO1A 2WF5A 3GZJA 1FU7A 1K6IA 3HP7A 3I1YA 5JSHA 1JEDA 4LSMA 4HAXA 1QORA 1YFKA 2G70A 4QWMA 4W99A 4QXPA 2W2NA 4P4SB 4OREX 3VKUA 1NG9A 2R4UA 1RI2A 4GU5A 4JEMA 4MRMB 3W5BA 3V1TC 1MGOA 1UP7A 1T24A 1YMQA 2XMPA 2QT9A 4JJ7A 3GF4A 1T0BA 2AK2A 3H1BA 3NTOA 5D1NA 1A76A 1G7TA 3UGJA 4Y0AA 1LPSA 5F51A 1NUPA 3ZCSA 3FPJA 2GXQA 1N5KA 3DCNA 4HEQA 2PH5A 2GEFA 3GFQA 3JZMA 4ZVLA 1TKCA 2GAAA 2VF4X 3PWZA 2GN1A 1W0CA 5HDBB 2PZKA 1IPFA 2WQZA 2QKYA 3I5MA 3KKMA 3QEMA 4JODA 4YCLA 3T4EA 1E1YA 4MW2A 3RS4A 1GTSA 3C8DA 3OPYA 2Y1KA 2QR5A 3V4FA 4EYGA 4Y2SA 5K8JB 4C2BA 3OIFA 1RC1A 3I9V6 3I04M 4N5LA 2NTYC 2ZYWX 2JVJA 3M1AA 5ESDA 5ILGA 4FC6A 3VSAA 4BTEA 1BMTA 1K68A 3RARA 3KWMA 4TKVA 4ZKDA 2HF9A 3P9CA 3TQRA 2OXFA 5EXTA 3BRCA 4ARSA 2I2CA 3FYDA 2BMWA 2Q5QA 3ONWA 4FD2A 1U5CA 2C2KA 2JRCA 3ZCPA 4EZBA 5K45A 2XZPA 4JIGA 1Z2OX 4XEUA 3WXBA 4C7XA 4DIKA 1CQJA 4UC0A 4GR4A 3SU8A 3T7SA 4YLYA 4XM0A 1XNQB 1LKZA 2J87A 4XJTA 1U6IA 4YMHA 4HFMA 3I6IA 1MENA 2PKEA 4J0GA 4GGMX 1NAHA 1BYIA 1NBEA 2X4DA 3IESA 4J2OA 4RKYA 4LGCA 3TD2A 4I8DA 3VRHA 2FUEA 3VSDA 1XQVA 3MBOA 4EP1A 4CL8A 2DRIA 2HWXA 1MJGA 5IN4A 2F9MA 1JU3A 1PUIA 3W7BA 4CE6A 3QLJA 3I01A 4I5IA 5K0BA 3ZVNA 1ICIA 3AF6A 4JBWA 2WPDD 2ZLBA 3W1EA 1U6KA 1Z47A 2AOUB 4NNOA 2HLNA 2PVSA 3R5HA 5KNDA 4YV7A 1VG8A 2BF7A 3KJQA 2PU5A 4YR7A 3EIUA 3U4GA 1J1ZA 2QZ4A 3EWIA 4FDLA 5DTEA 5THXA 2ZRGA 2B4AA 2FUCA 3J81k 1JSZA 2J9XB 2JLYA 4H3HB 2QTAA 5DKFA 1QLHA 3DPIA 4HHEA 1DO2A 3BL8A 2A9FA 5AVYA 2QV0A 5L7TA 1FTSA 1QE5A 3O0DA 1E7YA 3OIDA 1BOOA 4C4YA 3GLFA 1N34B 3KVRA 4AZ0B 4LXQA 4BO8A 1KP2A 4ESHA 3ZWNA 3RYFB 2D4AA 3C6YA 3ZHOA 5CCBA 1CS0A 2Q62A 3DV0A 1KYWA 3UFXB 3NCTA 1OWNA 3MUEA 2G4VA 3ONDA 4NV3A 4YWHA 1SZCA 1U0BB 4LJKA 2H9AA 4Q4CA 2WLTA 2FEOA 3IT3A 1KAGA 1T34A 2XUOA 4KAXA 3ZIAA 2YFKA 5HKBA 2O8DA 4UQOA 4JASB 3QQPA 1D0VA 2DCUA 2HRRA 3KVOA 4MI9A 2FG7C 4FYIA 4ZOLA 4ADSG 4DDMA 1XVIA 3ICQB 3AFNA 2WPNA 1C0PA 2XRMA 3ESCA 1JKJB 3HWRA 5EC8A 3RU2A 1H2WA 5LMUB 4G0YA 3F5DA 3K9QO 3EVEA 1WUHS 5UKDA 4DCSA 3X1MA 4MV1A 3P9SA 1WV0A 4UREA 3S8YA 1YXMA 3L8EA 4M49A 3SZOA 3DZCA 1VKJA 2HTFA 3W0LB 1IBLB 3ZZ0A 3PF9A 5KOJA 1AK1A 4UOZA 1Y5LA 1A2BA 4PGHA 1P1KA 2Q5IA 1XXHB 2IEGA 1JNXX 2DFKB 2W4QA 4MVJG 3B82A 4WUTA 2OFFA 3VC7A 3R0QA 4G81A 5JZMA 3G0DA 3OCJA 2XNKA 3GGGA 4TN1A 3EXHA 3QWIA 2XVZA 1K27A 1U7ZA 1O4WA 1IN6A 5AHOA 3SN6A 5D7BA 3OU2A 2DH6A 5ILQA 3WIEA 3L1JA 3RJMA 2VJMA 4OD0A 3QZUA 2XOKD 4J43A 1Q0QA 5K4GA 2JFGA 4L7VA 4WAUA 3M6UA 1N7IA 3R23A 5CDSA 2C4NA 3MTEA 3TRKA 1T8UA 4JI8B 4KXYA 1CR4A 3RANA 1YJQA 1JT9A 2A1TS 3SVLA 2YWCA 4ZTZB 1EUCB 2BUBA 3FYHA 1KDYA 1R9NA 1SXJD 2PH1A 2G5TA 2NUPA 4KLZA 4RLFA 4GNRA 1ZWLA 3OZIA 1T3SA 4CKCA 5F2NA 1YU9A 4EY8A 2QTTA 2JDID 4XCXA 1ZDMA 4M0MA 2WIJA 1SCAA 1NT4A 2HGSA 3UF0A 5CA0F 1IB0A 2G04A 3H1EA 1RWOA 4OSPA 4X71A 3C85A 2VHCA 4K87A 4BMPB 3PNBA 4ZT6A 2IOFA 1AA9A 1JXQA 1L4UA 2GEUA 5D3QA 3ADCA 4DT1A 2LIVA 3N2GB 1EFVB 1K5DA 1FUIA 2A78A 2REXB 3O47A 5IANA 1TMYA 3PTLA 4B7UA 2VNAA 4DM3A 4UDYX 4P31A 2DUJA 5FHQA 2PT6A 4JHXA 5HS6A 4HDMB 1TT5B 3WIVA 2I66A 2PU7A 3QV2A 2NU6A 2OD2A 1U3TA 4TMYA 5E95A 4HWOA 5EMMA 3GFVA 5E6UA 1FMTA 3RRZA 1KH3A 1BX1A 2MMGA 1TB4A 2OB1A 1P74A 1WMEA 1R12A 2DPHA 1I6MA 4YB8A 2UVQA 1QU3A 1IQUA 1W34A 2B9EA 3G7NA 3IQEA 2F3QA 1EB9A 2RB4A 1FNCA 3QKSB 5TX7A 1C8LA 3AFHA 1SELA 4QAJA 3ZZUA 5E9AA 1RXVA 4Y1EA 3FRIA 4DMUB 5FOXA 1DC8A 3D54D 2HFKA 2FRDA 5FBWB 2ECOA 3F1KA 1YA8A 4O0LA 2OD9A 4S2EA 1JWAB 1UWCA 4IXWA 3D1JA 2FGJA 2P90A 5K4HA 2AG0A 3IRVA 2GAOA 2V7QD 4CMHA 2ZJAA 2CL0X 1MDBA 2A5FA 2R1VB 1QOPB 2XUQA 4B4UA 2PN1A 3EDMA 2QDKA 3AX6A 4E2YA 5KX5A 3AI2A 3EVBA 3KPUA 5ALIA 4UTRA 1DAMA 4CQMB 1PV4A 3X1ZA 3PDIB 1KU6A 1MD9A 4HGOA 4J2HA 4RCVA 5JDCA 1NRXA 4QTTB 1JJAA 4X8OA 4D4IA 5LQCA 4EPRA 4EGCB 2EZ8A 5FI3A 3WADA 4HNTA 1C4OA 3GGDA 2ZS8A 5FYQA 1VLJA 1CZLA 2H3EA 2Q7XA 2YOHA 2B5OA 2R00A 4U6QA 4F06A 1XMJA 4CQNA 4QDZA 5KJ1A 1J39A 2EP8A 2HLDA 4UU7A 3WWOA 4JBGA 3UUWA 3UHAA 5AVJA 3FNIA 2C97A 4RELA 5P8WA 4Q02A 4JCCA 1NI4B 4KVGA 1W5SA 3CT6A 1YHYA 1Z3CA 1SKYE 3OOJA 4GZ5A 5DEIA 4NI5A 3CG4A 3NIBA 3CIFA 2OM2A 5ERXA 3SHOA 4R3NA 3IIEA 5ELMA 4YV1A 2FEWB 3NMUF 3WYDA 2C7RA 3U16A 2ZSJA 4KRXA 2VZEA 2FK7A 3VVMA 2GAFA 3WYFA 2AA3A 1KEWA 3N05A 2ECQA 3HM9A 2OQVA 1AV7A 2WKQA 5IBRA 1V48A 5TT0A 3L0BA 4MQUA 2A7XA 1U9CA 4W9RA 3WRWA 1RXWA 1C3OA 1XCPA 5FRDA 3NTUA 4HV4A 1FW6A 5B5SA 2W6ZA 5C8YB 3RVRA 1DRUA 4E70A 4Y2UA 2RHRA 3L82B 4PPQA 3OD5A 1TA0A 4IDAA 1XDDA 5AVOA 3C98A 4LA4A 2GFHA 1MJ5A 2RGEA 4HMOA 1U1GA 2QM8A 1TZKA 2POQX 1L4YA 4MJXA 4DHWA 4FSHA 1XDWA 2GKSA 3GDHA 4ZCSA 8ABPA 3I92A 4WZ6A 2WHRA 3R0XA 1EQUA 3UVEA 3FJOA 4DVJA 2Z5GA 4CL2A 1RHJA 1QIKA 3IYLW 3MRTA 4TVOA 4EW6A 3QU5A 2SKDA 2X0RA 3LX4A 2WKPA 3QU9A 4PS0A 5E3HA 3C14C 3DBHA 1DLIA 5H3LA 4EJ0A 2PZJA 5AW1A 1H6AA 3UFBA 1Z5OA 1LLUA 2EJBA 4PLVA 4IRXA 3WOHA 4WWHA 3MB5A 3QIVA 3I62A 3ZPXA 5C4IA 3SYNA 3KDPA 3KLPX 5KYXA 3HCPA 5F4BA 3EQ7A 1BKDR 1NZFA 3B1YA 4IOJA 4JJZA 1MQ8B 4AROA 3DMGA 3OX2A 2GFIA 2HU8A 2GEJA 2V5VA 2VUHB 3EMBA 3ITNA 4PO3X 3T5CA 3ZI0A 3FDZA 1SKBA 4LVNA 2XZDA 1ADBA 1UXGA 10MHA 4UATA 3A8TA 4ZHSA 3LZCA 3G49A 4EVSA 4Z4FA 3LQKA 4PZLA 1GCUA 3HN2A 5LZ7A 1I32A 4EHIA 3R8FA 5FKJA 2QE7A 2CUZA 2BCEA 2FWBA 3EVGA 2DTDA 3LL7A 2AJTA 5KAPA 2JH9A 1L1EA 1DXHA 4L5AA 3SKXA 3CSSA 1FFXB 3FAKA 4NCAA 1HPLA 1RM3A 4BNZA 5B2FA 1OLSB 2AR9A 3GI1A 4YAFA 2VDLB 1SG0A 5GJBA 5AOVA 1V1RB 3NV9A 2CMGA 3S2GA 1E62A 4O29A 1XDBA 1BXGB 2RK3A 4JT9A 5I4CA 1E32A 3EZ9A 1EDZA 3KAKA 3P9YA 3HR7A 2H1HA 3UOGA 2Z6AA 3NAQA 5JR3A 4OU4A 3NYRA 3VR5H 2YVLA 2OBYA 3SLGA 4ROTA 1O6BA 2RMKA 2L17A 3GVPA 1VIDA 3QE9Y 2BZGA 3DBLB 3VDRA 1G20A 621PA 4L0CA 4L76A 1O5TA 1G5TA 1K8QA 3JAWA 1TAQA 2XT9A 3RS2A 3CZ9A 4YI3A 5C80A 4AI6A 3W78A 3QWAA 1MLDA 5DBIA 3ZNPA 4S04A 4ZI5A 3R7WB 3UAXA 3O03A 4MPDA 3UWSA 5C7OO 1K5HA 2IXAA 2X86A 1ZKDA 2AE1A 2BZ0A 3HGTA 1M74A 3PXDA 1FDWA 5JHHB 1MV5A 1M2JA 3EGCA 4N41A 4ZJZA 4ZHQB 1F5NA 4OCZA 2WJVA 4M7RA 4BMDA 5I7WA 1E61A 4X0EA 1P81A 2Z43A 4EMTA 3B7GA 4XYGA 4I5FA 3N2KB 2A5GA 3RAPR 4Q5IA 1L8OA 4O4JA 1ZA2A 4HYQA 2HZBA 4XSHA 4DS3A 4YRGA 4TZ6A 2GYVA 3G3EA 5ITZA 2Z2YA 1A69A 3NC1C 1L7RA 3CPJB 3DQQA 3A58B 1CRPA 3UZUA 4UVIA 2GPWA 1AKEA 2FOXA 4BBPA 3PR1A 4TKUA 4B6FA 2BBSA 2ZB4A 2ZE8A 2GERA 4Q3DA 3TS1A 3DLIA 3O83A 3QX9A 4XUDA 5J1TB 1A5BB 1NFRA 3GJ3A 3KYIB 4M76B 5JXIA 2WJPA 3W8DA 2B69A 3PNQA 2OG1A 4U7DA 1KQOA 1ZEMA 3L1HA 3PUVA 3IEUA 1PLLA 2IHJA 4DLAA 4E5KA 2VAWA 5EWMB 2HSEA 5DBGA 4JX8A 4CEJB 1MORA 4EGAA 3IUYA 3JQRA 1HE8B 3HJUA 2RGYA 2BFPA 2PQ2A 3OE7D 4J4BA 1Z4OA 3ZU3A 5TQ2B 4EI8A 1TCAA 4IH9A 2XQFA 4GPZA 3W1VA 4D9JA 2MSKA 2VRWA 5ALGA 3O2JA 3UENA 3S1SA 1ZFNA 4ITVA 5DGHA 2H0QA 1Q1QA 5G0TA 2QX8A 2WZCA 3K1AB 1BN7A 4US1R 5AFSA 1N3LA 1D04A 4HLUA 4CLEA 1NBME 1HX7A 5KYUA 1N6KA 3Q3EA 5EMJA 5G41A 3NEAA 3QE4A 5KTYA 3OEED 3M6MD 1BE0A 1QCCA 1RQLA 1O94D 2JFHA 2NOAA 1BG6A 2FI1A 5BSWA 4QM6A 1CIVA 4ZZ1A 3IB3A 3H8JA 1LLQA 3AK4A 3EXIA 3GARA 3HEMA 1LRJA 5EWJA 2O48X 3UKJA 2BH2A 1NJ5A 2Y0BA 4JEHA 2HSGA 2GEVA 1ZCBA 4KIJA 5CDTA 1S2DA 2PVCA 1WG8A 1M2FA 1A7AA 2C3MA 2XVYA 5F7ZA 2WHEA 3WMGA 3ZCQA 1YBFA 4RJIA 1TW2A 2YXBA 1CJKC 3ZH9B 1X8LA 3CXRA 1AGRA 2OBBA 4G56A 3WG9A 4MYSA 4B47A 3EYAA 3K5IA 3UGQA 3HS3A 4Q1EA 1ISGA 3ESAA 3QVTA 1FTGA 1Y4ZA 4RY2A 2OCXA 3C6MA 2BBTA 3MYRA 3RD5A 2I65A 5CXUA 2P9BA 7REQA 4Q7KA 2VK4A 3AP1A 1T1JA 4C0HA 4YR9A 5CFQA 2UUCB 2FPIB 3LS2A 2X9GA 4NBVA 3OQNA 4YAOA 3KZKA 4X20B 4DA6A 3TRFA 3ICWA 2IF0A 2Z30A 4G84A 4UTZA 1BS9A 2D1RA 3OOWA 4JOCA 4ODIA 1W85B 1RLOA 1N8TA 2PMDA 5JNSA 5FTNA 3D7SA 5J4KA 4HX5A 1UK7A 2NMVA 3IIMA 5JWHA 3EDCA 1DC5A 1YJ8A 1ZBQA 1USKA 4HAVA 2QN6A 4ZPXA 3QXGA 4P1ZA 1QQAA 5LSAA 2A6PA 2QGNA 4PPNA 3WYEA 4F38A 3U1BA 1CRQA 3CQ9A 5THQA 4E13A 4F6RA 1SIOA 1HSOA 2PX5A 1EUDB 1IMOA 2Y1GA 2Z5FA 2CXQA 3AEZA 3AY6A 4JVNA 4ZVOA 3SZGA 3M5PA 2PYZA 2ASVA 2DHCA 3C5HA 1CUAA 2BDEA 4N8SA 4BFVA 4JUAA 3TSWA 5KYNA 1EE1A 1ZM2A 1EVKA 1NBAA 5I7AA 3V1UA 2C54A 4JNKA 3L2OB 1CP3A 1RDFA 2PKWA 4UBJA 1KMMA 2Q41A 3U31A 3FNBA 3O8QB 4WOJA 2FPOA 3L5OA 4I9HA 4ZXFA 2YYYA 3U7QA 4QODA 5SY4A 4B8YA 4C76A 3TXAA 1EVEA 1KS9A 2PRIA 2OP1A 2XQVA 5J5AA 5LA6B 4LJAA 4BKPA 1QGOA 2MT9A 1ATZA 3QLVA 1M8KA 2YY5A 4YJHB 2W2TA 3MJRA 4TTPA 1H4VB 1XR3A 1WUTA 5JMWA 4JEUA 2FQXA 1SIBE 2VYVA 4MCAA 5CB0A 2X9VA 5ARDA 3WXMA 4YUYA 1OBOA 1RABA 3UC5A 1VI5A 2YZKA 1OBHA 4MRRA 2VWQA 2G63A 1E2FA 1M73E 3HHPA 1RLMA 1SHTX 3KJFA 4EGSA 5C8YF 3SX0A 5D3KA 4OQ4A 4B31A 4YLEA 2KLHA 1YRQA 2ZSDA 1E7MA 1YAJA 3M9LA 3A6LA 4E5SA 3BRWD 3OURA 2BMDA 3SSAA 5GVRA 1FLNA 2ZIEA 3LQ2A 5EUQB 4L6CA 3DMDA 2AOUA 3JPYA 3B3AA 3LRXA 4Y98A 5ALJA 4X44A 3UBMA 2YCLA 1VSQA 2J3LA 3B52X 3E9QA 3E9YA 1HDZA 2ATXA 4IJQA 1PL6A 3BXHA 2ZTUA 4YRJA 3E9RA 1ADGA 1ZD4A 1MX1A 2H06A 3BEDA 4LWOA 3V9PA 1EK5A 1N92A 3E3LA 4HN2A 5ICCA 2H1OA 1KEEB 3I04A 1JZQA