3AKDA

Crystal structure of cmp kinase in complex with cdp from thermus thermophilus hb8
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
208
structure length
202
Chain Sequence
b'MRGIVTIDGPSASGKSSVARRVAAALGVPYLSSGLLYRAAAFLALRAGVDPGDEEGLLALLEGLGVRLLAQAEGNRVLADGEDLTSFLHTPEVDRVVSAVARLPGVRAWVNRRLKEVPPPFVAEGRDMGTAVFPEAAHKFYLTASPEVRAWRRARERPQAYEEVLRDLLRRDSAPAPDALVLDTGGMTLDEVVAWVLAHIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytidylate kinase
molecule tags Transferase
source organism Thermus thermophilus
publication title The crystal structure of the tertiary complex of CMP kinase with a phosphoryl group acceptor and a donor from Thermus thermophilus HB8
rcsb
total genus 70
structure length 202
sequence length 208
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2010-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3akdA00
1CXZA 2ECKA 4X8OA 1RPZA 3B7GA 2NO0A 1WBBA 5A4JA 4LYJA 3THWA 3T1OA 2B8TA 3U3JA 5FOSA 3BIFA 4RZ3A 2IUTA 1M8PA 3B1VA 1EXMA 1Z6XA 2ZR7A 5JWHA 2ZRJA 2BMJA 2OCPA 1OIXA 2ZRCA 4I4LA 2G1JA 4V0LA 1UDXA 3AVPA 5AJVB 1KHTA 1R2QA 2OCBA 3B9PA 3QBTA 5CB6A 4B6EA 2R6CA 3WHLA 3AVTA 4TYYA 1Q1EA 4NHOA 4Q1FA 4Q01A 4XVRA 1VTKA 1Z6GA 2KJQA 4PO9A 1T6NA 2ODWA 3K0AB 3VFDA 3KFXA 1KI6A 1NLFA 1VYVA 2WV9A 3A4MA 4KXFB 4HB4A 2GEUA 3KUCA 3EIHA 4DLTA 2QP9X 4TMTA 4AYWA 5M04A 3KZ1E 1E2DA 3PUZA 1GTVA 2AKAB 5FPYA 4B3DA 3QF4A 3HP1A 5G3YA 2MSDB 2V9PA 4CEIB 1T8UA 3Q9LA 2BJWA 4TMKA 4XVQA 3PJRA 4C0LA 3NC0C 1G7SA 4U02A 5KHOC 2KBEA 4JLDA 1E69A 4C9BA 5LD2B 1OH6A 4HLCA 1KDTA 1QDEA 4LHYA 1GFIA 1TQ4A 1OH8A 3WNDA 4QFMA 1JAHA 4ZCIA 2QGNA 2B6HA 4M0LA 3WP1B 1FNNA 1A4RA 3AKYA 2IUUA 2EFHB 4L5BA 1G3MA 3CX8A 3P4XA 2FMXA 4US0R 1NSTA 4BLTA 3B6EA 1U0JA 1EWQA 1KOFA 1E2GA 2JASA 5L3QA 5F9HA 3HR8A 1X6VA 2ZTSA 3TRFA 4AK9A 2Z43A 1GITA 3L82B 3IEUA 4EPVA 3SQXA 2WBLC 1D5CA 3GLHE 1TF7A 3CRW1 1KY2A 2G83A 3QXCA 3LVQE 2EW1A 3DZDA 3L8ZA 2CBZA 2ZYVX 2J3EA 1G7RA 5KO2A 2AN9A 3GLFE 2OLKA 3QKRB 4DIDA 4MRPA 4ZIRA 2HDNB 1DAHA 4B3BA 3I92A 1IY2A 5DI3A 3LRPA 4DUGA 4BE7B 1J99A 2QMEA 4IVPA 1VG0B 3UANA 3KQKA 3W90A 2OHFA 4N3NA 4DLRA 3HWSA 1XJ0A 3RSLA 3B1WA 1NLZA 1S2MA 3LX5A 3FE2A 4O3MA 1P2VA 1I2MA 2EFDB 2FX3A 2YNMA 3CUEF 3QG1A 3FDIA 5FTLA 5BWMA 3LW7A 2CL7X 2XXAA 1N5LA 1M7BA 3NWJA 4UXJA 4BUJA 3VR5A 1S9HA 5HR5A 1SXJA 1J8YF 1SXJE 1Z6YA 2E87A 5B58C 2VP0A 3T5GA 4A4DA 1HEIA 2ATXA 2FEMA 3KKMA 4R71A 4I1UA 1WDTA 3ASZA 4QBGB 1XB2A 2REBA 5C46F 1OIWA 4XD7A 3NEYA 3NG1A 2BBSA 1RE0A 2GXUA 3BD9A 2RGCA 1SVWA 1W2HA 5KYKA 2BM0A 3RC3A 4F92B 1P72A 5FOXA 4DCUA 3IEVA 1N3BA 1H8HD 1T3LA 3ADBA 2V7QD 2VP4A 2CJWB 3QBVA 2FSGA 3FKSA 1Z6TA 4JL6A 2P3SA 2FPKA 2ZI3A 3BH7A 1GL6A 1ZIOA 4ZDKA 1OSNA 5BN3A 3VR4A 2PZGA 1EG7A 2OG2A 3I73A 1SHKA 3X1ZA 4LJYA 2GCNA 3DZ8A 3IBGA 3CPHA 1E1RA 6Q21A 4D0NA 2WWIA 2WJIA 2F1HA 3N70A 4I81A 1U9IC 2JLWA 4E03A 1NSFA 4DEYA 3RS0A 3V4FA 5HZKA 1NY5A 3IIJA 2FFQA 2LWIA 1CRQA 2JJ2A 4P4SB 1OIVA 3CF0A 4P4SA 4PZYA 4Z1MA 2HYIC 1Z28A 1ZM3A 1ZINA 1RFLA 3R8FA 1XTJA 4HLUC 4UQOA 2ANCA 3RSOA 4DVGA 3ADCA 3T34A 3FMOB 1CJVC 4Z51A 1ZJ6A 1NIPA 1LNZA 1R0XA 2FJUA 4HB0A 3MWYW 3QIAA 2AL7A 3QSYA 1MRNA 1H8ED 2WWGA 4CIDA 3DEFA 4FCWA 1YQTA 3ZZTA 1Z29A 2GJKA 4LJ5A 2R62A 5CK4A 4AYXA 1Q1ZA 1U0LA 2CLCX 4NKRA 2C98A 4GP6A 3F0TA 3L0SA 5EZ5A 3TNFA 3CWZA 1QRAA 4RZUA 1TQ6A 3EPLA 1OB5A 1S8FA 1KO1A 1OJLA 1T5IA 3IHLA 2DWPA 4NCNA 1G9XA 3AKEA 1AS2A 1R5NA 1A82A 3H4MA 5DHFA 1CEEA 3SZRA 4Q4LA 2BCJQ 1TEXA 4B75A 1IN4A 4LJAA 3EIQA 2CEAA 3CBQA 2QSYA 2A9KA 1ZD1A 2XX3A 4ASUD 3D3QA 4GT1A 4L8GA 2RGGA 1OW3B 3QKRA 4OQLA 5TVKA 4DCVA 5DLQC 5DN6D 3P1JA 3AV0B 4AIIA 2VHJA 1GRNA 2XZOA 4JYBA 1CTQA 2RGDA 4TLBA 2WICA 1Z5ZA 5CITA 3ZS8A 3KQHA 2FOLA 1DOAA 5FBLB 2H8KA 1BYUA 4A0FA 1FUKA 3UG7A 3U7FB 2ZSAA 2XNSA 4PC2A 1OHHD 3JVVA 1JB1A 3BWDD 1KJYA 4ILEA 1ZNXA 4KSBA 1Q1QA 1YZLA 1U9IA 4Q19A 4QKQA 2O8EB 3VKHA 2ZJAA 4DDUA 2YWFA 4MH0R 1XEXB 1PVOA 1S3SA 4HLQB 2PMKA 1VHLA 4PC6A 2XB4A 3WRYC 3I1FA 4MKFA 1XD8A 2ZS7A 2NO7A 2W58A 2VLIA 4KLNA 1KK1A 2P6UA 5J4VA 1GL7A 1JECA 1JI0A 1Q21A 2CCJA 2GCOB 2VSOA 4BFXA 1E2KA 5FOUA 4WXPA 1AZTA 2WJHA 3NTUA 1KAGA 1UDWA 3WBJA 1YZNA 2FV8A 3LFUA 2FSFA 4ERNA 1OH5A 2O8BB 3W3ZB 5H1YA 1YZQA 4B71A 2O0JA 4TTPA 2ZQ5A 2W0MA 1E9EA 2HF9A 2PBRA 1VPLA 1Z0FA 2JLYA 1P61B 3H1TA 3TQCA 1VKJA 2JDIA 3CZPA 5DYGA 4BLPA 1GRRA 4MRVA 2NO6A 4ESVA 2ZJBA 2CHVA 1R0YA 3ZIAA 1I4DD 3S1AA 4CEIA 2QP4A 3U2QA 4TYWA 2ZAMA 3ETLA 4TQ9A 3GJ5A 3W34A 4JL5A 2NO1A 4B2LA 4L4UA 4G5SA 3K0SA 4LC1A 4NONA 3QJYA 3REFA 3UMRA 3TK1A 4ZI3A 1M74A 2QMHA 3CM0A 3TAHA 4QHTA 1VCOA 4DZZA 4IDNA 1YJ5A 2VQSA 2ZITA 4LPKA 3D8BA 2O5VA 3CH4B 1U90A 4QM7A 3I72A 2OILA 1AN0A 1NY6A 2OAP1 4WBSA 4CDGA 2FF7A 1G64A 1E3MA 4BZPA 2IYVA 3B82A 4U7DA 3NH6A 3OE7A 5HKKD 3U44B 3B78A 4CEHB 4BGDA 4M2LA 5DNYB 2GXQA 4V02A 3O8RA 3EASA 1F60A 1TUEA 3TSWA 1K5DA 3UIEA 3O8BA 4BFWA 1PLJA 1BS1A 1NG9A 2DR3A 5AK0A 2Z6VA 5E7JA 1KTVA 2ZIAA 4W5JA 1YHNA 3Q7QA 4KU4A 2I1QA 4FW9A 4MKGA 1UADA 4Q21A 5JWRA 4P31A 1T5LA 1K6MA 2RAPA 4NBSA 4IEEA 2H7VA 3KX2A 3WMEA 4DDWA 1PLLA 1SKYE 5CIWA 1H65A 4LDJA 3FMIA 2ATVA 2QE7A 1FX0A 2CE7A 2PT7A 3SHFA 4C0AC 5J47A 3TVTA 3AGPA 3B1ZA 1Z22A 4LGMA 3RS5A 5FUYA 3K53A 2RHDA 2YZ2A 3K9HA 2VTKA 2ZE7A 2WWYA 1NN5A 1WF3A 3QEJA 3U6BA 4OK6A 4M1TA 1HY3A 3AF0A 4TL8A 1CR4A 3EC2A 3KTAB 3N2IA 1ELOA 4EIWA 2FPLA 2F9MA 2OM2A 2XSZA 1A2KC 1XWIA 2ERYA 4NDZA 1N5JA 1XMJA 4EPXA 5DE3A 2ZE5A 5DSZA 4DWJA 5IHPA 4KJZA 5A0FA 2IYWA 4HDOB 3LWNA 1KZ7B 1DEKA 1SULA 4JJZA 4Q7KA 4AD8A 3U6KA 4L9WA 1W5SA 3LLUA 4Q9LA 2X2EA 4HZUA 4QM6A 4IDHA 1SZPA 2CL0X 3JZMA 4NE2A 1Q22A 1IN8A 4EQ6A 5C2JB 3MLEA 5FL7A 4NYJR 2GK6A 2J1LA 4RVCA 2IEYA 4RD6A 4RD0A 2D2EA 2QBYA 4WIAA 1NMZA 2L0XA 3AF1A 3DOEA 4MITA 2B7CA 5E7MA 1TMKA 2GCPA 3ZD6A 2F1RA 1W0JD 4FXPA 1EX7A 2X1VA 4ZI2A 1NVUQ 1W0KA 2QU8A 3PQCA 2C9CA 3NH9A 4RCYA 2IK8A 3K09C 3PV0A 4LYAA 3RS2A 4IHQA 3TW4A 1EWRA 3UWOA 1UBEA 3L2OB 5FBQB 4QG7A 1ZM9A 4FD2A 5L3VA 3SBDA 3GJ4A 4Z54A 1EFUA 4CYMA 4FMCB 3TUJC 1GWNA 1JR6A 2D74A 1NJGA 4KBGA 1GIAA 4QGHA 1XP8A 3THWB 4I1OA 1UKEA 2HV8A 1P4SA 2CCGA 2I3BA 3B60A 2FE4A 3C4JA 5DI9A 3WHKA 2ZM5A 2OESA 4DXAA 2JCSA 2QNRA 2R8RA 1ONBA 1FQKA 4DCSA 1FZQA 4DC9A 3BB4A 2LKDA 4D4LA 1TAGA 1KNQA 3ECCA 1G16A 4BPBA 3DL0A 4PC3A 4IOMA 3S1AB 2O52A 5FTKA 5LB4A 3BXZA 4JVNA 3R8CA 3IPXA 2J9RA 3TE6A 3ZD7A 3L43A 2YHSA 3DKVA 4I1SA 4B44A 1JJ7A 1SHZA 3A1SA 2RGBA 2QBYB 1MRSA 1EFHA 1FP7A 1LS6A 3IDQA 2F43A 4EPWA 4EUNA 5LD2C 3THYB 3FKSD 5EXPA 1SKYB 2ZSFA 2WAYA 3BRWD 3EC1A 4ABYA 4DLYA 1KO8A 5FPHA 3K9NA 4RSGA 1WBDA 2JJ8A 2ZPTX 1JPNA 2VHCA 4OI4A 1XD9A 4Q9IA 1G7TA 4HSEA 3F8TA 2Q9CA 3OHMA 2KWIA 4ZKEA 1ESNA 2WKQA 1QHIA 3QKSA 2VEDA 2OBMA 1J8MF 2R6GA 2O8DA 1KO7A 4PSKA 3NEJA 4QJ4A 1II0A 3I62A 1W0KD 4RKFA 2C99A 3IIMA 3T61A 1W0JA 3R9WA 3U7EB 2EYUA 2WOJA 1VMAA 4FMDB 3ZZUA 1AA9A 4LYHA 3I4LA 3GJ0A 3VHXA 2AXPA 2PH1A 1QHHB 2I1VB 2Q6TA 2O8CA 3TR0A 1ZCAA 2PJZA 2W2XA 4WA7A 5FL7D 5FR1A 2WSSD 1NVVR 4TYPA 3T5DA 4QNMA 5BW8A 1SGWA 2IYTA 1UFQA 1NN3A 1XU4A 1MV5A 1RKBA 1L4UA 2PX0A 2ZUBA 1D9ZA 3SR0A 4JVLA 2J0SA 4DEXA 1IBRA 1ZM7A 4OJQA 4KBFA 4JZKA 4KFSA 4F4IA 2XSZD 1J90A 2XEXA 3ZS9A 1R6BX 1FL9A 5GJCA 721PA 4KVAA 4BRWA 4PPNA 4PQRA 4B3FX 1PLKA 1L7VC 2WMOB 4JS0A 4RZ2A 1NVWQ 2OZEA 3KQNA 1VG9B 3KKNA 3EA5A 4G5RA 4HAZA 4OI1A 3TW8B 2MSCB 1Y63A 3D6TB 4IOLA 1GAJA 2AXNA 4DLXA 2ASEA 3RANA 1E0KA 1RVDA 3AUYA 2QRZA 2IXGA 4LJ7A 2HJGA 1LFDB 3NHBA 5FTJA 4B76A 1E9RA 1DPFA 4A6XA 1WXQA 1JXOA 4JBWA 3IO3A 4G01B 3SFZA 4FIDA 2D3WA 4NH0A 1EFRD 4IXNA 3GLGE 3SJBA 4TMXA 4G1UC 1FOEB 1G6OA 1XMVA 1ANKA 2BMEA 1SKQA 2CLSA 2J5XA 3LH5A 4PAQA 3GLFA 1D6JA 4JLKA 1Q12A 3RHFA 2ZS9A 3FHOA 1UBFA 3REGA 2H16A 5JFGA 1II9A 2ZYWX 3MGCA 2VHTA 1RJ9B 2ZUCA 2OV2A 1SXJC 3ADKA 4C0QC 4JLJA 2QQ0A 4Q1BA 5KPJA 1TF2A 4Y0VA 3GPLA 2V55B 2BEJA 4TLCA 1OXVA 3QEOA 2GZHA 1AIPA 4JYCA 1NG1A 2OBLA 4NYIQ 4BFVA 1KI1A 1QHNA 4RJLA 1GP2A 4P0TA 4QBIA 4TSFA 1UEIA 4NCIA 2P0EA 1U2RA 3LBHA 5GJBA 2QAGA 4G5GA 4TWZA 3CPJB 4CT4B 4JLVA 1S3GA 3Q8XB 4BRUA 2GXAA 2VH5R 2ANBA 5ELXA 3LQRA 4DT1B 5FBVB 4EAQA 1D2MA 3QXHA 2IYSA 1XTSA 4PTLA 2RHMA 3QI2A 4PPFA 4LZZA 1QF9A 1G5TA 1S96A 2GCOA 5EXTA 3KQLA 2A30A 3CF2A 3MWJA 2GHIA 4D81A 1OF1A 3BH6A 5F3WB 3TSZA 2YOHA 3W5IA 2ZSBA 3HJNA 4PQYA 3AEZA 1LS1A 1KI3A 3AGQA 1CP2A 1AZSC 1XTIA 2QZ4A 4M22A 1PZNA 3RWOA 1LV7A 3X1DA 2HEIA 1CR0A 1XZQA 2ZROA 3ZIAD 2TMKA 2JLZA 1AGPA 1YR9A 3I61A 2RCNA 4FINA 4LJ9A 3ZH9B 1JXMA 1S4QA 1AKYA 1OXTA 3K0FA 4OHVA 1QHXA 4C0BA 2QA5A 2JGNA 1VYUA 3MRSA 1QVAA 5L3SB 1KDOA 4GFDA 1E79A 2NG1A 4Q02A 2JLSA 2D2FA 2HT1A 1FMLA 1E2IA 4MKHA 2N1BA 5G3ZA 1HA3A 1Q3TA 2QPOA 3IO5A 5L3SA 2DWOA 4A8JA 1DAKA 4KO8A 1J2JA 1VG1A 1YR6A 1GKIA 3P32A 4OK3A 1YR8A 4ZV4A 2ZRMA 2F55A 1WP9A 2IS4A 1CULC 3KL4A 2QY9A 2C9YA 2ZJYA 4AKHA 1NL3A 4EDHA 4PC7A 2YC4C 4A9AA 4BASA 2AKYA 3B1YA 3VR1A 3PIRA 4UNRA 4Q00A 4XH9B 3U5ZB 4BFYA 1OHHA 3LXRA 2D7CA 1XCGB 2XZPA 2ZRDA 2ZRGA 2Q3MA 4URZR 5FL3A 2WPDD 4D80A 3W6PA 3K0FB 3ZVNA 4GBMA 3TIFA 1CU1A 1BOFA 2QQEA 5B30A 4F4CA 4LBZA 1BKDR 1HURA 3X1YA 1MO4A 3FGNA 1E99A 2GBLA 1W49A 2WKRA 4V0MA 3RNLA 1IY0A 1NP6A 5FBWB 1NMYA 3TKLA 5B57C 2YV5A 4JKIA 2CHQA 2IW3A 5F9FA 3CIOA 4FN5A 2XNDD 3SYLA 2HUPA 1E2NA 4QBHA 1UKYA 5SZHB 4GPTA 5EE5B 2NPIA 1E0JA 1RJ9A 2BOVA 2QTFA 1JALA 5FI1B 3QKTA 5HPYB 4FWIB 3C7KA 2H18A 2P5SA 3CRVA 5EE0A 2CHGA 3GEHA 1TF5A 2Z0MA 2AD5A 1KI6B 1E2PA 2DFNA 3NC1C 3ZYCA 3VMFA 4BQSA 1IAQA 1SVLA 2JIZA 4TTRA 3WMFA 2GXSA 4FCTA 3K0EA 3SDZA 4EKDA 4HUTA 4IW3B 2G77B 5KDLA 5JHHB 3MFYA 3PEWA 2HLDD 2SHKA 2ZRBA 3KDSE 5AJZA 5TB5A 3SC3A 4C0JA 1FUUA 1QZXA 5P21A 3VTKA 4OL0A 2RGEA 4B3XA 5HCNA 4Q4AA 4MYCA 1W36B 3AF3A 3GLHA 4DSNA 1KI8A 4WZBE 3A4LA 4F4JA 2WWXA 3OIUA 3CNNA 4HLUA 2VA8A 3SI7A 4JLPA 3GLGB 3VKGA 1R7RA 2WJJA 1KKLA 3C8UA 2KE5A 4TMZA 2P2LA 4JT4A 1DELA 2PZEA 1E1RD 2DPXA 4C7OA 4HB3A 5J4LA 2REOA 4BFZA 1CS4C 2WHXA 1U98A 1NMXA 1XFAA 4TQUS 4M9ZA 5DHAA 3J81k 4Z8XA 3QNUA 1R10A 2HCJB 1WE2A 2ZSEA 4ZDWA 1D9XA 2C8VA 2GK7A 2RGXA 1UBCA 5AJWA 2PT5A 1GOTA 1Z83A 3AVOA 4JBXA 2YC2C 2GVZC 4ZIRB 1GZSA 4BZXA 3T06B 4YXWD 1P5ZB 4EJSA 5DISB 1NKTA 2W6JA 3U7GA 1AM4D 3DM9B 1F5NA 5A5GA 1E9CA 2UKDA 2R44A 2ZAOA 2VSXA 1CLUA 1HQCA 1I4TD 4M1OA 5GJVC 4AY2A 1XTQA 3QVUA 2O8CB 1QHHA 4Q4HB 1ESMA 4N0EA 5IDVA 2MMGA 3WYAA 3DM5A 3K9LA 4BWYA 1Q44A 2VIIA 5EP2A 1SQ5A 3CRMA 3ZDQA 2CCKA 2F43B 2VYFA 4JMPA 4EFMA 2DCUA 3NBFA 1EX6A 3TGPA 1XCMA 1NN1A 2AK2A 4R2HA 4Q47A 1NJFA 3WRXC 4EPYA 3SNHA 4TYQA 2F1JA 2HXSA 2EVWX 1E9BA 3MG9A 1CJMA 3L0OA 3RYTC 3WNBA 2IHYA 2J7PD 4PR0A 4AI6A 1FTNA 1XEFA 2ODBA 2ZI4A 3RDPA 3KKPA 5EQTA 4HZIA 3THXA 1Z07A 1US8A 4E07A 2JLRA 1W47A 3Q5EA 5G40A 5FPTA 3FWYA 1II8A 3RS7A 1HYQA 3ZVMA 3UK6A 1S1CA 4G5OA 3GLIA 2AD1A 4B3CA 4TYNA 4M53A 2CK3D 2C95A 1KKMA 5AJXA 4Q1CA 1F2TB 1CRPA 2C04A 1E2QA 4MRRA 1KY3A 3ONWA 4E09A 5FPSA 2CL6X 1V43A 1N2CE 1UF9A 2DFTA 1ODFA 4HDCA 5IRCD 2JAQA 3OEHD 4BECA 4PHGA 3VX4A 4UNPA 3U7HB 1OFUX 1AJEA 3W8NA 1EGAA 1JPJA 2WWHA 4C2UA 5E7IA 2GETA 4WXRA 5GJWC 3VQTA 3FOZA 4QGGA 3EPHA 3K70D 3GLIB 3EWSA 1N0WA 1DAMA 2VO1A 3MSXA 3UMSA 1KNXA 4EQ6B 4HI0E 4IDQA 2BKEA 4HDQB 1AS0A 4HAWA 4XWAA 1ZD8A 1PUIA 5CJPA 1BYIA 4YMVA 1LF5A 1UAAA 1LW7A 1F6BA 5CDFE 4GNKA 1FMJA 3K70C 2G9NA 2GJ9A 3VNVA 4MYTA 4LYFA 1F2UA 2FSIA 5HE8A 4A0RA 1E0AA 1XD2A 3VU9B 2EU8A 4HATA 2IX3A 4ESHA 3K9GA 3LO5A 1KK2A 4B35A 3IILA 1RRCA 1N6PA 2QG6A 1XPRA 3R20A 2VP9A 5JRJA 2PLFA 4HZUB 1IOZA 4DSOA 4OHZA 2RGNA 4KV9A 4NP6A 3RWMB 2EWWA 1W4RA 3SOPA 4PX9A 2BIFA 1G4AE 1NBME 1I4LD 4TT3A 5CDFA 3SBEA 4TMVA 3ZVRA 1A5TA 2QN6A 3KTAA 5D3MA 2IXFA 5JI2E 1FP6A 2Z4SA 1NN0A 1IHUA 2A5GA 3QPUA 2GF0A 3ZJYA 1X8LA 1F3OA 3KJHA 2QM7A 5C4GB 2H5EA 1XD2B 3M6AA 4FMBB 3H2YA 3VU9A 4B6FA 2W00A 2ZJZA 2A5FA 5KTYA 1SVOA 3BFXA 5AUPB 1XMIA 4FMDF 4L15A 1F2UB 2QI9C 1LVGA 1KAOA 1ZIPA 2ZRPA 1G5RA 4Q7MB 3CNLA 2IF0A 2Z83A 3K0CC 2QSZA 1G21E 4ACBA 1GG2A 1JR3E 2QT1A 3ND9A 5FPKA 221PA 2I4IA 2X77A 3T1TA 1OXUA 4MYHA 1U8AA 1E1QD 2WAXA 2D62A 4MRNA 3CX7A 3OEEA 1W4AA 4ZO4A 5J5CA 3CPEA 1OFTA 1ZD9A 2HCBA 2ZI9A 3GD7A 5IF9A 2ZJ5A 2GJ8A 2GKSA 5KSOA 4YLGA 5EE1A 3AVVA 1S0UA 2QL6A 1W4CA 4CF7A 2IC5A 3FPAA 1OFIA 3U44A 4M1SA 1RYHA 4F93B 3QVVA 5IK2A 3B5JA 4D2IA 4P32A 2KBFA 4L9SA 2WTUA 3FFBA 1WRBA 1OE0A 5CYOA 1F2TA 3DVLA 1OKKA 1P2SA 3RLFA 4K8OA 2NPFA 2ZJOA 4Q4JA 1YU9A 1XCPA 4AKEA 3W5JA 5E4FA 1Z63A 3WYFA 2WPDA 3MAAC 5L3RA 4N0DA 1MT0A 3CLVA 4RD3A 1E2EA 1M34E 2PL3A 4QJ3A 2JLXA 1VHTA 3C5HA 1X1RA 1WA5A 3Q72A 1IN7A 1E1QA 3OESA 4JL8A 4KAXA 2CVFA 4M9XA 4MYUA 4PSVA 3P27A 5FTNA 4DDVA 2R6FA 1W7AA 3AF2A 3CRRA 4IOJA 2BC9A 2C9OA 5TY0A 3RRMA 1NRJB 4MRSA 4Q7JB 2ZRFA 2J0UB 1Z06A 2GF9A 3PUWA 3Q3JB 3TAUA 1W48A 1YRBA 2EFEB 1ZUNB 5CIQA 4HYYA 5JSZA 4Q18A 2QROA 1DADA 1KO4A 2DY1A 3BORA 1A2BA 2DYKA 2CNWA 1I2DA 1KGDA 5CB8A 3A58B 1T91A 1W4BA 4LPSA 4NPHA 4S2EA 2YWHA 1U94A 4EFNA 4NTZA 1KYIA 1XXHE 3K8YA 2BMDA 3UPUA 2WVJA 3QE0A 1L4YA 3LXXA 1CJTC 4CT5A 4GI7A 2KB0A 3CF6R 2J41A 1HE1C 2BV3A 4ON9A 1W36D 2J87A 3F5FA 4TT3D 3PVSA 3SU8A 3CZQA 1QG4A 1IONA 3HU3A 1E2JA 1XEXA 4KFTA 4TZ0A 1FTSA 1U81A 3QXJA 4KHZA 2O8EA 3QPVA 4V0KA 1G3RA 4RD2A 4Y0AA 3KJEA 2PJRA 3QUSA 1SVMA 4LJ4A 1ZNZA 3X2SA 4AC9A 1KI4A 2QPTA 2GAOA 3HDTA 1NBMA 2EFGA 2ZRIA 2QTVB 3GJ3A 4IDPA 5J40A 3GJ6A 4JLAA 1E9AA 2IHBA 3A37A 2GWHA 1IXSB 4CEJB 4IRUB 4NCHA 3AVWA 3DOFA 4CGZA 2E1RA 4HAXA 1E32A 2O8FB 1T0HB 2YWGA 3AKDA 1JQJC 3PEUA 4U5XA 4C7OB 1VECA 1AQUA 4IJMA 3R7WB 3RABA 4MGYR 4NZYA 1BH2A 1HQYE 3MCAA 2Q0HA 4RFSA 5CYPA 4I1VA 3ZLJA 4G0NA 4PC1A 1CIPA 2ZRAA 4B3GA 2ZRNA 5EXSA 3LX8A 4JJKA 4MKIA 4TSFD 3U4QA 1GKYA 4AG6A 4AG5A 3C16C 2FSHA 2YOGA 4RKEA 1W46A 2OFOA 4LBWA 5EP1A 4OQNA 2JLQA 2IWRA 1IXRC 4M8NE 1PUJA 4JIMA 4BLRA 5CM8B 2XTNA 4KODA 1NIJA 4PANA 3OEHA 2O0HA 1P75A 3BC1A 2V3CC 1M1YE 2OXRA 1LB1B 2XOKA 3PG5A 4A2QA 1E98A 1YZGA 1EFRA 1G1MA 1SVSA 4UNQA 4HAYA 1G17A 4D82A 3WBKA 2IXEA 4JBYA 1NKSA 4P4TA 4PO1A 1ZVQA 4DT1A 2IYQA 4IOKA 2CK3A 1HE8B 3VX3A 4ACAA 4GZMA 4MGZR 4LWZA 1COWD 2PX3A 4A6PA 1ZMXA 1WMSA 3RS4A 1RRGA 2IYZA 1T8TA 2CJWA 1GUAA 3OAAD 1R0WA 3QXSA 3WMGA 3FKQA 1P2UA 4LI0A 4WZAE 1N0VC 2IYLD 3CH5A 2XB2A 4V0ME 1YVDA 5H8WA 1FQJA 4JSTA 4W5WA 1G3IA 3PR1A 1G3QA 4XIGS 2J7PA 2HF8A 4WZ6A 2JA1A 2ZRKA 5CLLA 4F38A 1QVRA 3IUYA 3GLFB 3B8HA 4Q9JA 3LBNA 1WCV1 4B2IA 4S35A 2V1XA 1RYFA 1BIFA 2PCJA 4UKDA 5F2EA 1X3SA 2N42A 3GEEA 1G4UR 1JEDA 5FOTA 3AP1A 1G5PA 1G20E 3BFVA 3DDCA 3DKPA 3RVBA 3SJAA 3BERA 4YC7A 2C78A 5JI3E 4QC2A 1TEVA 2WOOA 2ZE6A 4TTQA 3SHWA 4ARZB 4RFVA 3B13B 4A8JC 1P6XA 4YQFA 1HT1E 4JLNA 4W9MC 4CEJA 3EAQA 3PUYA 3C41J 3KKQA 3NBXX 4MDEA 1XDBA 3GMTA 4LV8B 1E2LA 5JCPA 4YXWA 1SXJB 4M1YA 2VL7A 4M1WA 4A8JB 4FMCF 2IBMA 3PITA 2WIAA 5JJKA 3HPRA 1G8GA 1O87A 4X8HA 2A7QA 2YOFA 3BB3A 1HH4A 4OI0A 1TU4A 3KB1A 1IN5A 3B1XA 2GJAA 3Q85A 1OLOA 1OPXA 3IGFA 4GDFA 1MKYA 4NMMA 2O8FA 5JECA 3OIVA 1RC8A 2JJ1D 2Z5FA 3D31A 4QHYA 2Q3HA 3KJGA 5EUQB 1F48A 2BBTA 2VBCA 3W6NA 4AWXA 2J59A 2QORA 4KVGA 2QENA 3T12A 3BFKA 1W2GA 4Q7LA 5GVSA 4DB2A 4PHTA 1XNJA 2O0KA 3IQXA 5KNBA 4LCBA 4NYMR 4KLZA 2YINC 1TPZA 4GZLA 4D26A 4OQFA 3I32A 5JJLA 4PZLA 1W44A 1E2FA 2YJTD 1E2HA 1GKUB 1UKZA 1ZUHA 4LHXA 5AWFC 1YR7A 2GNOA 1E4YA 4KYUA 4WOPA 1R4AA 2JATA 4B74A 3FHCB 2C03A 3KFVA 3QF7A 5C18A 4U00A 4Q1EA 5KDOA 4AKGA 2V6JA 4CW7A 2B21A 3TMKA 2AFHE 1ZM2A 1T9HA 1X8KA 3RS3A 4OBEA 2OFWA 3AQ4A 3GJ8A 4TLDA 1C1YA 2FZ4A 1FFHA 1KI2A 2G3YA 2JIZD 5HE9A 4V03A 2FFHA 2GRJA 3K0AA 1JNYA 2A3RA 3Q7PA 4XWOA 2RGAA 4TZ6A 4GMXA 3C5CA 3GFPA 2IYUA 5TXGA 3VR6A 4TLAA 2AK3A 4Q4JB 2NZ8A 4ZKDA 3NBYC 1JR3D 2XITA 5AUQA 3AVQA 4PO8A 2RB4A 4GSYA 2EFCB 5CJ2A 3LQQA 1E94E 2AFIE 2NIPA 2YVUA 2BEKA 3CRQA 1TNDA 3SJCA 3CO5A 3K70B 3AM1A 1J7KA 2XNDA 4OHXA 3I8XA 3QKUA 5FH9A 1BMFD 1BMFA 2WJGA 4PFSA 4XTCS 1KIMA 2ZUDA 4MQBA 3X1XA 1UKVY 1MO5A 4B47A 4EFLA 1RRPA 2OUKA 1YRAA 2BM1A 4F91B 3HYRA 4NCJA 5GVRA 3EPKA 2ZR9A 1XTKA 1K8RA 1DAFA 1P9NA 2VRWA 2W6IA 2ONKA 3PFIA 1IY1A 2NZJA 3LBIA 2NGRA 2XTMA 3KKOA 3NVAA 3PUVA 3M0EA 2V4ZA 821PA 2R6DA 1GDDA 3H86A 3SE0A 2V1UA 4O25A 1ZNWA 4BFUA 3E1SA 3GFOA 3K0CA 5F98A 2IYRA 4JT2A 2CMKA 3IQWA 4JLBA 2P67A 4PSAA 3B85A 2C77A 4II7A 4OJKA 4QGFA 5AUOB 2NOAA 4A15A 3SEAA 4QRHA 5EE9A 1GM5A 1E9FA 4Z8YA 2ZSDA 1OT3A 2D06A 3A1VA 3N5CA 3TUZC 4TLEA 1T3SA 2UZIR 8OHMA 1N6RA 3VR3A 2FPMA 1NVXQ 2QE7D 4BEJA 3F3YA 4Q03A 2IA5A 3H0KA 1FNMA 2GILA 4C0KA 2BBWA 4M21A 3P20A 1TL7C 2IEZA 1UEJA 3MJRA 2Q3FA 3MUFA 421PA 3EXAA 2FH5B 1U8YA 4MGKR 5DIFA 1E79D 2VP5A 4JSYA 4HAUA 1A1VA 5FUWA 1GSIA 1P9RA 4PAMA 2GBLC 2XTZA 2OSBA 2YKGA 1Z0IA 2F3TA 2O8DB 1YZTA 2CXXA 5LDDC 1KZGB 5EE3A 2WWFA 2JJ1A 5HKKA 3OE7D 2FN4A 4LJ8A 4D25A 3CX6A 2G1KA 3HYTA 2C96A 3AP3A 3HPQA 2QGZA 1GNPA 4XJXA 2DBYA 2UVQA 1V5WA 5AUNB 2AR7A 1G6HA 5LPNA 1FX0B 1G7CA 2VP6A 4ZCLA 4MDFA 3T1VA 5L8VA 3LY5A 1NNEA 3VAAA 4XSHA 1KMHA 4HB2A 3KB2A 1S9DA 3SYNA 1TUIA 1E9SA 2OFXA 4P33A 2R2AA 4TN1A 1FPMA 1M6NA 3GJXC 1Q20A 3DHWC 4TMWA 5KNDA 4OQMA 4KCGA 3WNCA 2OE2A 5FR2A 2GEDA 2QMUA 4HLDA 5EZ6B 2AHOA 4LX0A 1R0ZA 3UWKA 4B73A 2GAAA 5K8IA 3EIEA 4IKEA 5KU1A 1N0UA 4ZDIA 3ICEA 4F7WA 1QHYA 3AVUA 1ZBDA 3RC8A 3T35A 2OAQ1 2P5TB 2J0VA 4O0MA 1CR1A 2JDID 5D3QA 3TSOA 3C15C 1ZUIA 4EJSC 1W1WA 3I5YA 4OHWA 4ZCMA 4DJTA 3IIKA 5ANRB 2QEQA 1NVVQ 4JLOA 2FA9A 3L0IB 3H84A 3NXSA 3CKLA 2VPPA 2OBNA 3OIWA 2BMFA 3A8TA 5B64A 3KXKA 3VNUA 1Z8FA 4Q1DA 4H9GA 4QOSA 1L8QA 1Z0JA 1HTWA 3LD9A 4UXHA 3TVDA 3G82C 2QP3A 1N25A 1IM2A 3BB1A 3QXXA 3A1TA 1QHGA 3THXB 3OAAA 1B0UA 3LAWA 4NYMQ 4A82A 1Q0UA 2ZEJA 4YMUA 5JWOA 4P4UA 4C30A 2ZS8A 5JEEA 4URWR 1COWA 3KJIA 1ZU4A 1N6OA 1XEWY 2DB3A 1KJZA 2ZVQX 1R8SA 1L2TA 3A4NA 4YMWA 1E9DA 5J4HA 4LBVA 521PA 5HZHA 5JJIA 4LOAA 4CRWB 4ZDJA 3OIYA 2VP2A 1NLYA 1II8B 2MSEB 4UNNA 2LKCA 2QUZA 4LUCA 1P2TA 5EJEA 1YKSA 1GRQA 5SZIA 2JLVA 1P62B 2XOKD 4K81B 4B34A 3GFTA 1U0HC 5AR1A 2E9SA 1KMHB 1VCIA 5TARA 3SJZA 4HEJA 3MWLA 4ITRC 5H68A 1OYWA 3JVUA 1OV4A 5H70A 5JZVA 2O8BA 1Z2CA 1UPTA 2ZYTX 3DMNA 3ND8A 3NBZC 4Q4HA 5DN6A 4CZ2A 1CF4A 4W7SA 4OQXA 1YE8A 2ZANA 3UKDA 4DLZA 4ASUA 2WIBA 4HAVA 1Z0DA 2GVDC 1XPOA 1AK2A 2WSSA 3MWKA 1R8QA 2ZRLA 2F7SA 4C2TA 4EJSB 4WVFA 4XOIA 1XEWX 2BWJA 2K5UA 2YWEA 4QBFA 4LSGA 2BBOA 1JJVA 1JEEA 2F3RA 4O2LA 2IS2A 3OF5A 4Q5IA 4A2PA 4A0GA 5KSYA 1KSHA 4PHFA 2OCAA 5GADl 3U3OA 1C4OA 5LBIA 3HR7A 4Q9KA 4DLUA 3DPUA 4XSGA 4DBLC 3E2IA 2ODEA 4H1UA 4BLOA 3QOFA 1XMSA 5KPDA 4BZQA 2PCLA 2F9LA 1OYYA 4LHWA 3BGWA 5FI0B 4MUBA 1NBMD 1TADA 2RGNC 1OFHA 3SQWA 2IS1A 1M7HA 2ZETA 4K46A 4IEIA 3CB4A 1KK3A 4Q9HA 1AS3A 2ZREA 4KSCA 4RD1A 4R98A 1HV8A 3V9PA 4XWKA 2XJ4A 5K8TA 1CJKC 3WP0A 1R5BA 3EA0A 5E95A 1GILA 3GQBA 4MA4A 1DO2A 1XRJA 2AWNA 2AX4A 4Z1MD 2ORWA 3GCGA 1OB2A 2GA8A 2H57A 5AJYA 3JZAA 1GNQA 3P26A 4YDSA 4HUQB 4DB4A 3V4RA 3O8DA 3SYKA 1PJRA 3WY9A 3LW8A 2JLUA 1C9KA 3A1UA 2FGJA 4IDOA 2QM8A 4PZZA 2RMKA 3R9XA 1LF0A 1P3JA 3EZFA 3AUXA 4KFUA 2ZYUX 2KI5A 2IYYA 4N1AA 4QGAA 3AF4A 3OZXA 1XZPA 4PQFA 1CBUA 1G291 4NL4H 4B48A 5JRZA 4DKXA 2REXB 2AWOA 3DO6A 1X1SA 1ZAKA 3Q5DA 4DLWA 4DCTA 5JLJA 2VF7A 3CNOA 4LHVA 2V7QA 1WQ1R 3GLHB 1H8HA 3AP2A 4Q66C 2IT1A 4Q4AB 5IT5A 2V8OA 2FDCA 1XXHB 1KSGA 1D8TA 3I3SR 3RRYA 3QPWA 2B92A 1Z0AA 4P3YA 1DG1G 4G5QA 4XD7D 1IQPA 1X86B 1YZUA 1KK0A 3BJIC 4IVQA 5EP3A 1MABA 3VKWA 5KUTA 4G3XA 2A5JA 5KDDA 1SXJD 2QT0A 1N6NA 2J45A 4JVMA 1OH7A 2CLDX 2WSMA 4LHZA 3X1WA 1E6CA 1XX6A 1VCMA 1QBKC 4R9UC 2W6ID 3FVQA 1G18A 4M4SA 1QHSA 1T0JB 1UBGA 1KDPA 5HCIA 3RAPR 4DSTA 3WYGA 2G0NA 2WZQA 3QQ5A 4PXAA 5IK2D 4OYHA 2P6NA 2Y8EA 1D2NA 4MUAA 2N46A 4GOXA 1N6HA 2BJVA 2GDJA 2Q21A 3PENA 3QENA 4A2WA 1DG3A 2QMOA 3EW9A 4C0SA 3ZVLA 5JEDA 1TTTA 1E96A 5BYKA 1G8PA 3IPYA 1DO0A 4BEBA 2GJSA 3GP8A 1VYTA 5BN5A 1EESA 4OK5A 3A1WA 3LA6A 1KI9A 1ETUA 4FI3C 4IVRA 3UATA 3E5HA 3AB3A 1JR3A 1Z3IX 1IXZA 2C2HA 1QG2A 2ORIA 1KMQA 2D4HA 2ZJ2A 4J0QA 1WB9A 1DAIA 3U4QB 1P73A 5BXQC 3EZ9A 3L0PA 2XGJA 3O47A 2A2ZA 5B2ZA 2VF8A 1MO6A 1CKEA 2GZAA 1UM8A 2R6AA 3ZZ0A 4C3ZA 2GEVA 4RFSB 5DGXA 4M9SA 1YZKA 3R7WA 2W2VA 3W3AA 1GNRA 3AVYA 2DHRA 4E22A 1Z6AA 4NU0A 4BLQA 4AYTA 3KXLA 1N6LA 2Z4RA 4H1VA 5KOYA 1M2OB 2H17A 2OO7A 2ZR0A 4PPQA 3CWQA 3TBKA 5JS8A 3NDBB 2IS6A 4QJ5A 3UMFA 1XPUA 3ICQB 3SN6A 2IL1A 3MMPA 4X8LA 1DAGA 3AVXA 4DDTA 1N6IA 4Q48A 5EXXA 1KJWA 2ZI6A 2WMNB 2FU5C 4US2R 5DI3B 4DRZA 4GP7A 2A5DA 2XJ9A 4M9QA 5C4MA 4ARZA 2HT6A 4CVNA 1SVIA 2J46A 4KYIB 3VR2A 4A92A 2H1LA 4JVSB 3KXIA 2VHQA 2YYZA 4EPRA 3O8CA 4AKIA 4QXAA 2ZXUA 1IJEA 1Z2AA 1O3YA 5FUXA 3G5UA 1MH1A 1VG8A 2QTHA 2ZU0C 2W2TA 4KITB 1N6KA 1RZ3A 4TQAA 3EARA 1E2MA 1XF9A 2MMCA 1KI7A 3EZ6A 3TQFA 1AQYA 1JBKA 1Z08A 4W5HA 3T1QA 4YMTA 2ZJ8A 2EQBA 1DBSA 3P4YA 2DFKB 1IN6A 4GMDA 2F1IA 2J0UA 1ZYUA 3BAFA 3D7MA 1P9WA 3M4YA 3NHAA 5BN4A 2P65A 5CM9C 3PEVA 1MR3F 3FHTA 4NYIR 4UXIA 2W83A 1TQDA 3QF4B 4LJ6A 1XXHA 2X8AA 5UKDA 3TR5A 4NCKA 4M1MA 3GEIA 3T15A 5JMTA 4QNRA 1N5KA 3OFNA 3K1JA 4URUR 4URYR 1E0SA 3ZQJA 2VHUA 2P6RA 4V0OA 3TJZA 2GZDA 2QAGB 4DLSA 5TMPA 1U99A 3TLXA 1MABB 4LV5B 5JHGB 2WWWA 1W5TA 5TDHA 4QL3A 4D0GA 2CVHA 3U3MA 3FTQA 2LCFA 1RIFA 3BOSA 1IJFA 4GRAA 2HYDA 2NTYC 4MGIR 1EFTA 4GOKA 2FZLA 1MO3A 2BKUA 4HUQA 4DLVA 3LVRE 3QY0A 4DSUA 1P7CA 3PUXA 1A7JA 2WM9B 1OXSC 1HT2E 3ASYA 3MD0A 4PHHA 1EK0A 1AKEA 1CR2A 1TX4B 3IHWA 4YMSA 4A1FA 1W36C 2H92A 5E3HA 3FMFA 1JAIA 3LDAA 4D0LB 2BHRA 4IXMA 5JS7A 1ZU5A 2J0QA 1XTRA 2QAJA 4PPGA 2DWQA 2XXAB 2OEPA 1T4GA 3BBPA 3U61B 1G8HA 5KSZA 5JCZA 2ONJA 2WJYA 4US1R 4LRWA 3EPJA 1E4VA 4E5UA 2FNAA 2IUSA 3BK7A 3BS4A 2R9VA 4OHYA 3BE4A 2QAGC 2FFBA 3PXGA 3U3KA 1KO5A 3NIBA 1PV4A 2QRNA 3AKCA 3LV8A 5K8LA 4D4JA 3G0HA 1S1MA 2OT3B 4C4PA 4EPTA 1R5OA 2IYXA 3W9YA 4FWTA 4O2RA 3EG5A 4KI0A 2DFLA 5LB2A 4C0HA 5SZJA 4GL2A 3KUDA 5D3MB 2PZFA 3U60B 1Q3HA 4PAOA 1Z47A 3B9QA 2W6JD 1U8ZA 4I99A 1TU3A 4RY2A 1EFCA 4D4KA 1GL9B 2Q9AA 621PA 3EZ2A 1FW6A 2B7BA 2G0TA 2RH5A 5L3QB 1VDZA 2X19A 2PMDA 4LC0A 4B2PA 4D4MA 1DS6A 2ZE8A 3DMDA 3THYA 2KSQA 4OI2A 4XTRA 4A0HA 5J4KA 5JSZB 5BQ5A 3K09A 4X8MA 121PA 3LLMA 1H8EA 4AURA 5EP4A 3B2EA 2NO9A 3QKSB 2PEYA 2WKPA 2ODNA 2UZ3A 5HTKA 5JBQA 4LBYA 4BFSA 5CK5A 1ZP6A 1OXXK 2D7DA 5C1BA 4RZXA 2ZU6A 3NKVA 2ZI5A 1AGRA 4POAA 2JJ2D 3UG6A 5J4YA 4UJ5A 2NMVA 2ORVA 3HU2A 1LTQA 3I5XA 2J7KA 5BYJA 4KFRA 1P60A 1G19A 1G8YA 2FWRA 3VHLB 3CW2A 4IFEA 4JKYA 2A5YB 1VCNA 1X8JA 2CNWD 2RKOA 2HLDA 4TL6A 2V6IA 3RRNA 2HXYA 2IWHA 3AH8A 4URXR 3SS8A 1XJCA 2G88A 4D6PA 4A36A 2C5LA 4DHEA 4B33A 4DCNA 1HUQA 4M1KA 1NF3A 4WAUA 1K5GA 1ZNYA 3MJHA 1G8FA 2X2FA 3LNCA 4BFTA 3N2EA 2A78A 3I8SA 3EX7C 1N5IA 2EWVA 5SZKB 2OCYC 3M1IA 3NDPA 3QG5A 2HJVA 4R7ZA 1B23P 2GTPA 2NQ2C 1DVRA 5CLQA 1US8B 1UJ2A 2PEZA 1DTSA 1MOZA 5G53C 2EYQA 4R2IA 4V0NA 5FOWA 3WXMA 1KSFX 3W6OA 2B8WA 5DH9A 2XZLA 1JQLB 5KNCA 1SVKA 2CDNA 2FG5A 5FFMA 1RW4A 1T3HA 2IF2A 3R9IA 1OKKD 1D2EA 3IKJA 3U3RA 3CR7A 4LV6A 2XAUA 1XJQA 3GJ7A 2BVNA 2ERXA 3IBYA 1G41A 2W0SA 4NYJQ 1ZC3A 4RD4A 1Y3AA 2F6RA 1DARA 4LY6A 4YDHB 2WJVA 2JEOA 2BCGY 2OLJA 3FMPB 3BH0A 3ZGXA 1CJUC 4DUGD 2BDTA 5EUMA 2ZRHA 1VIAA 3OEED 4FCVA 4JLMA 4Q1AA 4BLSA 1Z0KA 5K8UA 5FBRB 4B43A 1Q1BA 4IFBA 4DIEA 4GOJA 2ZVPX 3GLIE 1TQ2A 1KDRA 1NI3A 1ZCBA 4LK2A 1ZW6A 3C14C 5KSPA 3UXMA 3ZQ6A 1G3UA 1VIYA 5DYIA 1M7GA 4ZPXA 1GVNB 4WW0A 4UNSA 5FUVA 1ZC4A 3TH5A 4RCZA 4QHSA 1DE0A 2Q9BA 3FFAA 4L16A 3RRZA 3THOA 2R65A 5G41A 3FB4A 3PCRB 2FGKA 5FOVA 3KQUA 5FTMA 1Q57A 1RRFA 2VSFA 3HU1A 3V00A 4B32A 3L8YA 4CEHA 2G6BA 5TV2A 2V54A 4OKSA 4TL9A 3CONA 2FEOA 1DAEA 2PLRA 4YONB 1J70A 2QPAA 3EWAA 4XVUA 3E70C 1LY1A 2CE2X 3OFND 3EZ7A 3A36A 1BO6A 1KSJA 2FFAA 3PEYA 1XBTA 3SFVA 4UJ3A 2GESA 3ADDA 3CR8A 4URVR 1ZM4A 3GLGA 3FYHA 4TL7A 3A6PC 2OXCA 2ZI7A 3TUIC 1ZRHA 3W8RA 5DO9A
chains in the Genus database with same CATH superfamily
5AQ1A 1V8OA 4LJLA 2OKGA 1JIIA 2NO0A 3NAZA 1GU7A 2Y0PA 1M2NA 5TQVA 5A4JA 1BWSA 1RWBA 1P8AA 4LYJA 1YKGA 2VAPA 4R1SA 2QVBA 3ZI4A 3BIFA 1AX9A 1B7GO 1M8PA 1ZFNA 3HA3A 1Y9EA 1Z6XA 2XF8A 3KSUA 3PI7A 3T3EA 3WGUA 5C52B 2GF2A 2OCPA 4MROA 2XVMA 5JYCA 1T2EA 2UXDB 3ZDFA 2ZRCA 2G1JA 4V0LA 4DIBA 2APJA 3GARA 3NASA 3I01M 3C3XA 1Q0QA 4R7GA 3KUXA 1KHTA 3E6AA 3U4DA 4MV3A 3WHLA 1T9ZA 4Q01A 3VH3A 5JTUA 1VTKA 5TQ2A 1XI2A 3D9QX 4LY3A 3N6XA 2KJQA 4PO9A 3TIXB 4MB0A 4F9TA 1KI6A 1VYVA 3ND6A 2GN0A 1GPKA 2A58A 2GEUA 3EIHA 3IJPA 3STYA 4BKPA 5KX5B 4AYWA 2V03A 5M04A 4G8JA 2HWUA 1UH5A 4I9FA 1EFDN 4RVHA 1E2DA 4OH1A 5IBQA 2JD0A 5DKFA 5JD6A 1GTVA 4AZVA 2OGSA 1NZFA 3PQ7A 2VAWA 3QF4A 1E3TA 5LIPA 2QL5A 3Q9LA 1M8FA 2DTXA 2R1UA 3C8HA 5JXHA 4TMKA 3GNQA 4L0CA 4HYTA 2I6TA 2QTWB 1IPEA 2XVAA 1UK8A 3JQEA 4OV6B 4XVQA 1E69A 2OCGA 2E49A 4C9BA 2NT4A 5B3KA 1KDTA 4XVHA 5CFNA 1GFIA 4YUYA 1OH8A 4QICA 3WNDA 1DFIA 2P5UA 3ONNA 5DBHX 2NXJA 1A4RA 4QYTA 3SC2B 1G3MA 3CX8A 4CQJA 4ENPA 3LG2A 3OZGA 3J81A 4C76A 1Q77A 1P9LA 1PYDA 2JFQA 3B6EA 4HXFB 4B85A 3X2FA 2QJTA 4A73A 1X6VA 3I2IA 1M0TA 4MMYB 4IX1A 2IHUA 1ECPA 2OB2A 2W93A 5IWCA 1OI2A 3PC2A 3Q3EA 3DJYA 4FGKA 4S1NA 1ICIA 3EXFB 3ZV6A 5CXUA 1LRJA 1RZUA 2ZQZA 1D5CA 3B9RA 1FLDA 3ULKA 3WL6A 3GLHE 1PDOA 1SUFA 1PJAA 3JQBC 1XG5A 3LVQE 4K03A 4DQLA 1CFZA 3S70A 3M3PA 1G7RA 4DIOA 5HVNA 3TXXA 1FP1D 1VCHA 1V5FA 3QKRB 4EYKA 4MRPA 4PE5B 2QUBA 1O97D 1PV2A 4Y7DA 4QYIB 1DAHA 2MHCA 3FUCA 2F1OA 1QRDA 3I92A 3V8PA 4I50F 3LRPA 4D0SA 3VV3A 3UW3A 4RQAA 1FYVA 3HUUA 3QBJA 3TBHA 4U7FA 1T3GA 2PKWA 1WNFA 1MJFA 4BE7B 5L7TA 1E63A 2XWJI 1T1SA 3W90A 2BFBA 4PCLA 1Z17A 2AOUA 3C4VA 1S7CA 3CUVA 4N3NA 4QYXA 3T9EA 4AZ3A 4DLRA 2XHEA 3RSLA 1C81A 1D2CA 2ZIUB 4DNFA 1M72A 3IEXA 3LX5A 2DM6A 2DJIA 4V2UA 5J3JA 5CU7A 1P2VA 2EFDB 2PSJA 3BXPA 1UXIA 3SQNA 1REQB 3I1YA 4IFIA 2HM7A 1XIVA 3LW7A 1ORHA 4ZI7B 1N5LA 4V0SA 4U7GA 4UXJA 5IDYA 3HS3A 2ODPA 3L9XA 3LF2A 4OBXA 4AMVA 4D3FA 1Z6YA 4MA0A 1Y3HA 4MLCA 2VP0A 4X85A 5ALZA 4N5DA 3KKMA 3MC1A 3MGKA 5JZBA 3WQRA 1Z9BA 1WDTA 4QXRA 4GECA 1IY8A 3ASZA 4QBGB 4L02A 4YJHB 1XB2A 1Z82A 4PLWA 4LC9A 3FJOA 1XNQB 3NEYA 4Z2YA 3BD9A 4P8RA 1GLNA 1GPH1 3D5QA 4M6WA 4XD2A 1KZYC 4ZVLA 1GV1A 2G80A 1N3LA 3BWYA 5CVEA 4BL5A 5KYKA 3OURA 1WPGA 2Q5JA 5BMVB 4KXVA 4QPJC 1N3BA 1JFVA 1T3LA 3E58A 3LHIA 5TGTA 1FSPA 1P7VA 3KQPA 5KTMA 2PKYX 4FK8A 3BX1A 3D8TA 2C2GA 4YA6A 5F78A 2CD9A 3BH7A 4HDKA 3S2YA 4XWKA 1WQ4A 3R5TA 2PZGA 1EG7A 3I73A 5JAQA 1SHKA 3K1AB 1FX1A 1LPMA 2B36A 2GCNA 3AF5A 3CPHA 3K4QA 3O8OB 5ERGB 4XCQA 3U1VA 1BCSA 3NUGA 4D0NA 2WWIA 2PUDA 2HADA 1SU7A 1X7YB 2HSEA 1NJ6A 1ACJA 2HBZA 4NZ9A 3UXYA 3M82A 2ATEA 3NUZA 3A10A 4WV3A 4CM9D 1HPLA 5DNEA 3U3ZA 4ALNA 4OGWA 3C2QA 5BQXA 5ADUS 4JHXA 1NV9A 1L5HA 1G20A 2FFQA 2FZCA 2LWIA 2ZJ1A 4TWJA 2VP3A 2VPYA 4XCVA 2ZB4A 4L6CA 1K7SN 4E88A 4PZYA 2HYIC 1JDUA 5F5XA 2H00A 5BWNA 1TIBA 3EGEA 2WLTA 5CEJA 3KTOA 3CLHA 4HLUC 3NX4A 4KQMA 1R18A 4MB6A 4ZAXA 4Z0PA 2Z8YA 3RFUA 5TJHA 3SF8B 1RJGA 3ADCA 1B6RA 5DTRA 1ZJ6A 3KYCB 3CLRD 4QOEA 1LNZA 3BWVA 4KPEC 1V39A 2WAMA 3ENWA 2Q6IA 2X8JB 1L7BA 1P91A 2BFFB 4JDUA 3QSYA 4J8PA 1GXSA 1X7XA 1N2HA 4PICA 4RZIA 3DGFC 2AEJA 4CIDA 3ZDYB 2FI1A 4CJXA 5I7RA 2XEDA 2J9FA 4OAQA 5EUBA 3ROPA 2JI6A 1XSEA 5J2UB 1XU7A 3B1JA 4AICA 1DI0A 5FORA 5AFSA 4UE6A 4NKRA 2C98A 1VJGA 3L0SA 5EZ5A 2W70A 3RGGA 2IXAA 2C9MA 4N01A 3TNFA 2X0IA 1O95A 5AVUA 1R9JA 5KCZA 3O2NA 2XMDA 3QLVA 4OB8A 1YQDA 4CUKA 3OQBA 4FBLA 3ANYB 4AKSA 1H4QA 3H4MA 1A82A 1CEEA 5DHFA 4UMFA 4Q4LA 2BCJQ 1ENZA 1VIDA 3MGAA 3P9KA 4BN4A 2ZDHA 3ER9A 1G42A 3J7TA 4O8CA 3EIQA 3R77A 4YP5A 2RHJA 1AKVA 5LN1A 2QSYA 3O0TA 2MT9A 1ZD1A 2XX3A 1UC5B 4TTIA 5AKXA 4ASUD 4L8GA 2RGGA 1Q17A 3DQZA 1JWBB 3VBCA 3F3KA 1VHDA 3OC6A 4DCVA 3DDNA 3SVTA 1G2IA 1KVRA 4MB2A 1ZA1A 1ND6A 4JYBA 4MW7A 2P9JA 5AO9A 5CITA 2OL4A 3O26A 1S8AA 2VTDA 3A05A 4FLFA 2JFOA 4HBGA 1NYQA 3UG7A 1TEHA 5A3QA 3U7FB 1TLTA 3DYVA 4P22A 4QO8A 4S1WA 5I8ZA 1QFZA 2JBAA 3WAKA 3NYQA 1JB1A 3JQ6A 5BURA 4L4SA 2PMFA 2ZLBA 4FYWA 1YR1A 3B12A 4KSBA 5JD3A 4MQEA 2O8EB 3AR6A 3NUQA 1PJ3A 1YE5A 5EKTA 4RVSA 1JJAA 2P3QA 4B17A 2Y27A 1PVOA 1XEXB 1VHLA 1SVUA 2JFZA 2NYUA 3ACBA 3I1FA 3AMVA 3BRSA 3L07A 5FPQA 3ZU6A 3EODA 4DPKA 4I5EA 4KLNA 1EUQA 2QRHA 3PZBA 2AZDA 1J8FA 2HTEA 3FTPA 5K3OA 2QR2A 2GCOB 1JI0A 5AVOA 4KGZA 5A4MS 1Z33A 5AYVA 1AZTA 2NXEA 3A27A 3NTUA 2DHDA 1GTZA 1KAGA 4Y2XA 3EF1A 1ZWLA 4YAJA 4J4TA 3BE8A 2PZLA 2FV8A 2WUDA 2FSFA 3IKVA 3N87A 4WHMA 4ZU3A 5JMOA 1OH5A 1RWPA 1NULA 1LSJA 1PP4A 3INRA 5M3BA 1B26A 2Q4RA 2X86A 3VJLA 4AL4A 2VNSA 2WJ4A 4LOHA 2FPRA 3AHFA 2HF9A 2PBRA 3S4YA 1Z0FA 3H7AA 1P61B 3H1TA 4TV8F 4YUXA 3L6OO 2ECFA 4Y6SA 4AUMA 3V1NA 4BLPA 3COYA 5DX1A 3TQOA 1G2OA 4UULA 1IY9A 5ALKA 5I4IA 1VPWA 1GAXA 5B6IA 2YMQA 1FYFA 2D1TA 4NABA 4A7PA 3GWZA 4HWSA 3CURA 1E1LA 3EGWA 3GJ5A 3W34A 1HE3A 4FUTA 3IPCA 3GNLA 3EGVA 4EKGA 2TRSB 4HMPA 2DAPA 5HMLA 2HIAA 2ON6A 4LC1A 4NNOA 4N6NA 4ROSA 5B7PA 4EJ0A 2QMHA 2V7TA 3CM0A 1CDDA 4YAGA 2XMRA 4ZOLF 4OQDA 4XWYA 3R0VA 4QHTA 3BIWA 3LM8A 5CA1A 3IDAA 2E0IA 2YVKA 1Z88A 3JXEA 4IDNA 4LDQA 2Y0DA 1YJ5A 2XNKA 2NU6A 2ZITA 2R8XA 4LPKA 4CMEC 1FIUA 2OO5A 3IR5A 3EQ8A 2QAIA 3H3XA 4OMCA 3VZDA 3QW4B 3L7JA 1R0CA 1AN0A 1SKBA 1YI0A 2FF7A 1G64A 4FYPA 5LNK1 1UC4B 2IYVA 2IPMA 3EVNA 2RKWA 3QVMA 1G5FA 5HKKD 4CEHB 2F8TA 2KLBA 4Z99A 1OFUA 3VXKA 4M2LA 3DPSA 3HFSA 3ZY3A 1P17A 2GXQA 2Q1XA 3UAXA 1RI1A 2ZT6A 3A14A 3BTSA 4IG4A 1P4HA 3TSWA 3UIEA 3N58A 1TTHA 2AE2A 3E1GA 1HSOA 1WVGA 4BFWA 3O92A 1Y1PA 4CFYA 5CX1A 2FMTA 3H13A 3RE1A 2ZIAA 3G0IA 3INYA 3Q7QA 3KBBA 5JAZA 1SC9A 4Q21A 2O2ZA 4Y2VA 4XQ0A 1QO7A 4ZQEA 2IPAB 3QHQA 4JYPA 2H2GA 3U17A 4C6TA 3P9RA 4Y1RA 2HKIA 4DCCA 2IZ1A 5KTTA 1YGPA 3VPBA 2FW1A 2PK3A 1LU9A 4WFIA 3ZWNA 4RH1A 5CIWA 4DEVA 1KETA 4CN8A 4MYSA 2IY9A 3FMIA 3SHFA 2PT7A 5J47A 2I6QA 3V55A 4CLDA 3AGPA 4I7EA 3B1ZA 4M98A 4PINA 4YT4A 3QUTA 5JO0A 4FFOA 1XZGA 5KSWB 5FUYA 4CLRB 1A4UA 4RHYA 5EQJB 2EBFX 4CCAA 1MIHA 2EFYA 2YZ2A 3DV9A 3K9HA 4DAEA 2BTQA 2VTKA 2ZE7A 3CE6A 1NN5A 3H9QA 3HCNA 1XRNA 4Y6RA 5LKAA 1EB8A 1ONOA 2CJYA 4G2NA 1OZ0A 2GZRA 1I5EA 2WYVA 3AUKA 4M1TA 4F71A 4LZAA 4F2GA 4N9QA 1GYQA 1N2CB 3KTAB 2JGKA 4F4UA 3I83A 1XWIA 2BCEA 1O9HA 4NDZA 4X6LA 4MEAA 2IU3A 1DC4A 4DWJA 2IYWA 4HDOB 3RVQA 4TXMA 1CVIA 1DC8A 3QP9A 1M75A 4JJZA 2R1VA 1CQIA 2JIQA 4Q7KA 4RGYA 2IZZA 5A4KA 5HW0A 1E3QA 4RMNA 3GCDA 3IUMA 1H66A 1W5SA 3M6LA 3SAJA 3U6KA 4L74A 3INNA 5TPWA 2X2EA 1I9GA 3Q3HA 1GPMA 4NE2A 3BD6A 5IBCA 4M38A 1ZD5A 4DL9A 4E5MA 3JQ8B 4NYJR 2GK6A 4HGOA 4GSLA 3SR4A 4K1XA 1FZTA 2IEYA 3M3DA 2D2EA 2AXEA 3FW1A 1Z0ZA 1NMZA 3M9LA 2B2NA 3I9OA 3BTOA 4EEKA 4MUKA 2BI7A 3RJ9A 4WLEA 1WXIA 1QR6A 4E4TA 3W6ZA 4ZI2A 3EHDA 4GD3Q 1TC2A 4FS8A 1CFJA 1IMOA 4IUCS 5LMCA 3PQCA 1U5BA 2C9CA 3MINA 1LA2A 3TW4A 2I6XA 2WD9A 3FCCA 3HGMA 1JHVA 2ATCA 2PKCA 2RJOA 1YNOA 3PKJA 3ABSB 3UWOA 4F6LA 2WIFA 2RGWA 1T24A 4JLWA 1FRFS 1ZM9A 4MQLA 4TWRA 1Y1SA 4YDRA 2X0EA 1B76A 1EFUA 1I0ZA 3GBVA 3NNDA 4EHNA 5IG2A 2WP0A 1XA4A 3C3EA 4WZAB 3FZQA 2NAPA 2YHUA 2O50A 1TVKB 3MERA 3WHKA 2HV8A 3ZBUA 4K40A 1WCIB 4UQLA 2ZM5A 3GMDA 1V7PC 4NESA 4KIFA 1I2BA 4GZ5A 2WC1A 4KXLA 2WWVD 3EWNA 4KREA 2IGTA 2PSEA 3NHSA 3GVXA 1NBAA 3ECCA 5JJBA 5IZCC 5EJIA 3PQFA 1NU8A 1TGYA 1S89A 3S1AB 2HRRA 1JBEA 4UEQA 5FTKA 5KNBD 3PDCA 2AN4A 3Q10A 3QFSA 1K06A 3BCHA 3GJYA 1QGYA 3IPXA 2J9RA 4HNGA 3W05A 3GMSA 4DE5A 5LM3A 5H9VA 3GDGA 3NTOA 2YHSA 4G25A 4M8IA 3V2IA 2X0JA 1TKAA 2NUTB 4A23A 4PAWA 4XJSA 3PSAA 1U8CB 4UTXA 4FZJA 4ZRDA 3PHIA 1ZKMA 4CKZA 4EPWA 2WLSA 1LS6A 4TOIA 2VYVA 3THYB 4LSMA 3OETA 1GR0A 1POXA 1T36B 3KXPA 4LTDA 3ZQUA 5IEBA 2WD7B 4BGVA 5FPHA 3MF4A 1G4HA 6ADHA 2GK3A 3CLUC 5AIAA 1XN1A 5ALLA 2X4DA 4L6IA 1WBDA 4WFQA 1NBIA 2ZPTX 3VDNB 2VHCA 2VZLA 3C3CA 4Q9IA 5A3SA 2JHAA 4HSEA 4AUEA 3GUUA 1JJFA 1KL7A 1RMQA 3BDVA 5KOHB 4ISCA 1AG9A 2PUTA 2EJCA 4DDHA 2XI4A 3QKSA 4PRKA 2QX9A 1UWVA 2OBMA 2XCQA 1WM1A 2QV7A 2X14A 3BJEA 3FLMA 5KYUA 4BNVA 1L1FA 4LF8B 2QS9A 4O4HF 2PMBA 3ZHQA 1II0A 4FFMA 4WEQA 5E8RA 3U7QA 2C92A 3PC3A 4DN6A 3I62A 1PGJA 3JZIA 4NU8X 1U9CA 4N65A 3AHHA 4YO8A 3RFTA 3DBLB 2GPTA 1A7UA 1RQGA 1Y5RA 1GUBA 5TEWA 3U7EB 1IQRA 1VMAA 3BUSA 3MCUA 4E12A 1CV2A 4LYHA 3I4LA 5FLEX 3GJ0A 3MBOA 4DMMA 5AVYA 2I1VB 4E33A 1GG5A 2AXQA 4ZGGA 1JG6A 3TTTA 3UUEA 4WA7A 4ZAFA 4IIVA 4PLVA 5FL7D 5FR1A 4B3HA 2WSSD 5A7FA 3A4VA 2C4VA 4O29A 5GZ1A 3IT0A 1CUSA 5L6MB 2Q3EA 1B2LA 4EUEA 4QNMA 2Q1SA 3KOOA 5CVCA 5BW8A 3A70A 3GVHA 5D01A 4JKOA 1V8ZA 5B5SA 1XTVA 3LS2A 1L4UA 5T7BA 1D9ZA 2UVPA 4JVLA 4V1CB 1VE9A 1NFFA 4DEXA 3DZIA 1RBMA 4F4IA 1MGPA 2CMDA 2XSZD 5AK3A 1E3SA 4RFLA 3ZHXA 1A0OA 4K3VA 2C58A 3T38A 2G17A 3NRJA 2YFYA 4PPNA 5DNWA 1PLKA 1WVMA 3H5IA 4RZ2A 4JS0A 4RACA 1A9ZA 1TMOA 4AP5A 1UJ6A 3KKNA 4G5RA 1LGYA 4PGFA 1MD9A 4LZOA 3O5AA 4U8HA 4WKCA 5DVZA 3GBSA 2COUA 2AXNA 1V16B 4D9JA 3KDPA 2PG3A 4FILA 3KPVA 2E4WA 4IIJB 4NZPA 4RMIA 4KE6A 2HJGA 4L57A 4MP6A 4RV9A 4RNDB 4A6XA 2H7CA 5HXAA 4OLBA 2BMAA 4XEHA 5NULA 3K4PA 3IMGA 3DL2A 3GCZA 3TIGA 2Y2UA 4NH0A 4RELA 4IXNA 4XR4A 1XYYA 2IXBA 4D9FA 1F5SA 4TMXA 1J0DA 1JQAA 2BR5A 2BMEA 1H3NA 2A0UA 3OJXA 2J5XA 3AY7A 4N5MA 1XZEA 4YN3A 1F6WA 2EKQA 1D6JA 4PAQA 4JLKA 3RHFA 3TM5A 5HOEA 3FHOA 2LBPA 3BMNA 2HUNA 2VAMA 5BQ3A 1JEYA 4ARCA 2AV6A 3T5CA 2XYVA 3CH7A 1YONA 1VQ1A 2WHQA 2ZYWX 1QFSA 1VGQA 3HJBA 4UU1A 1DKNA 2OV2A 4MCJA 5B37A 1WMBA 3CG4A 3WWDA 1EUZA 1KZHA 2Z2JA 1CRLA 2MIIA 1OXVA 4TLCA 3TFQA 2E4VA 2R6R1 3M6UA 2JFFA 4OHMA 4FS3A 4E6EA 4NYIQ 4BFVA 1NTOA 5K3FB 1QHNA 1PUXA 2CFTA 2QT9A 3LXMA 1J2RA 2FPIB 1IHPA 4P0TA 4QBIA 1UEIA 5BSWA 3FN4A 4NCIA 5JO9A 1IB6A 1QANA 3D59A 2QAGA 3ICCA 3LBHA 3AEQB 4JEMA 4NOLA 1S3GA 3RF7A 5KKCA 4GR5A 2V74B 1X7YA 4KJXA 2ANBA 2NU8A 2WHPA 3QLUA 1D2MA 5GOTA 3QU7A 1XTSA 4XM1A 3JV7A 3H2BA 5ILGA 4RS4A 2IOQA 4LZZA 1G5TA 1KEEA 1EYZA 2VUIB 3CF2A 3IBFA 2YYYA 4KQJA 1V3TA 2CFOA 2ENUA 4L0MA 3SHOA 5F3WB 1GNSA 3W5IA 5CLJA 1TVMA 2ZSBA 4B0PA 5LWHA 4PQYA 4FFWA 1Z7WA 1W35A 1ZOSA 2O7NA 2PYZA 1Z8DA 5D6OA 1OAAA 3KVOA 3AYZB 1AZSC 1XTIA 2QZ4A 2X2PA 3X1DA 4JXXA 3ECSA 2NNLD 2HEIA 1CR0A 1XZQA 2ZROA 4GKBA 2JLZA 1AGPA 2XY4A 3I61A 1CNEA 4LJ9A 3ZH9B 4OGLA 2NP6A 1LDMA 3O9ZA 1XA0A 2QW1A 5HRCA 3DJFA 1QHXA 4L85A 4O4IA 2H7XA 4OHVA 3T9CA 2QA5A 2JGNA 2O7VA 1VYUA 3UH0A 4OLAA 3PK0A 4FN4A 2WW8A 5GONB 1BXRB 5L3SB 3AESB 3TG8A 1T8WA 1GDTA 1M2OA 4Z0TA 1PK9A 1X1DA 3UV6A 2NG1A 2OOSA 3HFJA 2H7YA 4Q02A 3WGHA 2FSUA 1XOIA 3JRNA 5I7UA 2HT1A 4DIFA 3KRTA 5G3ZA 1HA3A 3PGXA 5KHAA 5IJ0B 2CB0A 4B84A 2YCBA 2PQ0A 4QODA 4D97A 3D5EA 1QYCA 4NBUA 3G6KA 1GKIA 4IUBS 4CM7A 4OK3A 1EUDB 4HN9A 2Y71A 3D6MA 3NWOA 4BQQA 1T1GA 4ZV4A 1C1XA 1QIIA 2BFCB 4EARA 1CULC 2GNPA 2Q50A 1JA1A 3OIGA 4FYIA 3O83A 4QYIA 2P1ZA 1KYXA 5B2FA 3T41A 2YC4C 2A1UA 4TTJA 4WNAA 1PR1A 2H9YA 3UXEA 3PXEA 4JIGA 4A9AA 4BNLA 4UNRA 4W7IA 4LJRA 4J0JA 2O5RA 3DBRB 1M8KA 3QOYA 2C9BA 4YASA 2D7CA 3IXQA 1XCGB 1C3LA 2O3RA 1BHQ1 2WUEA 2ZRDA 3PI6A 2VPTA 2OB1A 4F86A 1QYVA 1BXRA 4D3SA 2JCGA 2R1TA 2WPDD 3W6PA 3SHQA 2IUYA 4PAGA 4EZIA 5IBRA 4GBMA 1AC5A 1CU1A 1BOFA 1XWFA 2A59A 2QQEA 2YN0A 4MVJP 4XGQA 4FKBA 1DKQA 2RHHA 1B41A 4UEWA 1NQXA 5ED0A 3X1YA 4MO9A 1UL1X 3ZE0B 4ZICA 3FGNA 4M99A 3PICA 4WNYA 1O0SA 2WKRA 3H9GA 4JQCA 3E22B 4PG6A 4V0MA 1RP7A 1RQXA 1NP6A 1U8EA 4IIHA 2CV1A 1NMYA 1O7JA 3NV7A 3TKLA 3TQIA 2YV5A 4DLBA 1C9EA 3NONA 4JCOA 1W0CA 5F1YA 5K3FA 1EFAA 5GGXA 1X1BA 1U5CA 1YRWA 1RHKA 1E2NA 4GC5A 1FYXA 4NIMA 5SZHB 4G0WA 1MFPA 4QREA 4RGVA 3A7DA 2BOVA 4Z6KA 5JOQA 2OENG 2UYHA 1JALA 4M0EA 3EVZA 4WLVA 1GGVA 4K9LA 4RTNA 4G84A 2Q07A 5EE0A 1NBWB 1WQ3A 4QUEA 2AD5A 4ZZ2A 1PGPA 2Q6LA 2QG4A 1KI6B 4RPKA 3RG8A 4AQ7A 4H3KB 1NX6A 1P18A 3M9WA 4CLXA 4G0MA 3VMFA 5BN3B 1KEKA 3FZYA 2A14A 1LLCA 3NHLA 1XZDA 3PFHA 3IFSA 5DTQA 1E7WA 5J5AA 5HRAA 2GXSA 3SDZA 2VT3A 1UZNA 1H85A 4BMDA 2B3DA 4WMLA 3DB2A 3DBIA 5JHHB 1ZD2P 1O6FA 2IHKA 2VJCA 5TB5A 3F9IA 3Q7TA 2GMWA 4J2OA 3KTFA 4OL0A 1JKFA 2RGEA 5CGQB 4Q4AA 1GGNA 3AV3A 2A9FA 4G0XA 4MYCA 3EFHA 1MBZA 2VSYA 3GLHA 3KD3A 1ABBA 1DJMA 1BGXT 2AG5A 4G0ZA 5JIBA 5IMBA 1QGED 4MJ7A 4F4JA 1HYGA 3CNNA 2QRGA 3G88A 4QPZA 3C7DB 4TKLA 5B1HA 3ROXA 4IJUA 4JLPA 3VKGA 1DCTA 2DJ5A 3ZHZA 4ER7A 4MUEA 1Y6QA 1MH9A 3C8UA 3F74A 2KE5A 3SSOA 5KTPA 5EXEA 1N7GA 1ZVJA 2DPXA 4C7OA 3FB1A 5EC8A 2OHIA 5J4LA 1PZFA 1GPBA 4EB8A 3OOSA 1ZUD1 4C6RA 1NMSA 1GTG1 1XFAA 2AMJA 4M9ZA 1LBSA 5CLGA 4ALJA 3QNUA 1H3FA 1RPNA 3A4TA 3SE7A 1MPTA 2FR0A 5I45A 1YRHA 4FJ1A 1ARZA 4NG5A 3LHSA 5A3JA 1UFVA 2RGXA 1GYRA 4HVAA 1E2BA 1E61A 2OWDA 1PJLA 5AJWA 5EAIA 3DW3X 4C43A 2EEPA 1NRXA 3DBLA 2XRYA 3FH0A 2C7VA 3H4VA 1JL3A 1VE3A 1XP5A 3N3AC 3T3HA 4OLJA 3T06B 4YXWD 1P5ZB 5I47A 3HB9A 4ZVUA 3TEMA 2HQBA 1BX0A 4FYKA 2BJHA 4PYOA 2W6JA 1FSZA 4MR7A 3U7GA 4WASA 1A9QA 3LP8A 3K32A 3DDSA 4W6ZA 4L3OA 3AEYA 1BDIA 3L04A 2VQEB 1MHPA 3A3OA 2VSXA 4GYWA 5GJVC 5TMBA 4AY2A 3C6ZA 1XVAA 3W1VA 1OXKB 3K9LA 4HDMA 5BSVA 1PG5A 2JFBA 2QQ5A 2VIIA 3Q3GE 2A8YA 4U7TB 4JR1A 3FWNA 5H59A 1V25A 2JCXA 1MNAA 6PFKA 1TZCA 2QI9F 3VKUA 1PFYA 1C9JA 2AYXA 2NUTA 2I8LA 1Z36A 3EEYA 2PVSA 3OE4A 3TLYA 2QVZX 3UOWA 1Z25A 3IAAA 5KYUB 2O2GA 3W8DA 2YNMC 2YJ5A 3NNSA 2WU8A 4GPIB 3WNBA 4V24A 5B4UA 2IHYA 2FHPA 1UBOS 4WN9B 2YRXA 4AI6A 1XEFA 1BEEA 2BR3A 2PX8A 5AJHA 2O3TA 3F4KA 3CMMA 2VJBA 2CBXA 3D3WB 3TW0A 1O4VA 3UICA 1O6CA 3KKPA 4E7PA 3CZ4A 4G2TA 5ALSA 5EQTA 1Y3FE 4HZIA 3BSYA 4H08A 4GVPA 2XR1A 4FQ7A 1I80A 2CN1A 5G40A 5FPTA 1GUFA 3TQTA 1II8A 1P2FA 2FUG6 2O1WA 4QIHA 1S1CA 3G8CA 3KOWA 4ZT3A 3R9KA 3UK6A 3UHOA 3WTBA 2WM2A 3ZDRA 4RULA 4M53A 2OCKA 2C95A 4X61A 1JSLA 4K86A 5AJXA 4Q1CA 1F2TB 3WKBA 2C04A 2FAXA 1YZ3A 2Q5FA 1JEQA 2ZOSA 2IIVA 3Q98A 4OY3A 2PUBA 1O95C 2VHWA 4E09A 2DUMA 5C5CA 3RSSA 1N2CE 3ABQB 2IE8A 2D0DA 1ODFA 4B45A 3IRVA 1TCBA 2VEOA 3O7WA 4P5PA 5AVSA 2JAQA 5IRCD 2W43A 2VSNA 3NLLA 3V3KA 4D8WA 2GEBA 1YT5A 1O6BA 1MB3A 2PPLA 5FBHA 3VX4A 1Q84A 2ADFA 1EGAA 2GD2A 1RVV1 2WWHA 2XQFA 3NHWA 3PD0A 4WXRA 3BIOA 3SF0A 1FMFA 3GNTA 1CUIA 3EWSA 4GZ3A 1XFDA 1EAMA 3G7NA 3AF6A 1YDMA 2RIRA 1D6MA 2X76A 3I45A 1KNXA 1TJPB 3QY9A 4EQ6B 2BKEA 4HDQB 4MQUA 3AFOA 1M2EA 1P29A 3L0YA 3I58A 3M2PA 5CJPA 2B7LA 2TMYA 4YMVA 3QVWA 4II3A 4U0JA 1LW7A 1NQOA 1KFJB 1UAAA 5CDFE 4DG5A 3TZBA 3VYRB 1OMOA 4Z7OB 2G36A 3VNVA 4MYTA 1R6UA 2HU8A 1K0FA 4N41A 3Q3VA 5TF4A 3WB9A 3B5IA 4ZREA 2HJHA 4A0RA 3HYCA 2GFIA 1WXEA 4XI9A 2EU8A 3QFRA 2AJLI 3OU7A 1PYOA 1ADCA 5FNZA 1VBFA 2O6LA 1FMCA 4NH4A 2FWBA 1CY2A 1TT7A 2I80A 2JFWA 4Y2YA 2DBQA 4H7DA 1J21A 1E1NA 3IILA 4B35A 4ENUA 1N6PA 1XPRA 2I99A 4MV1A 1JH9A 2PLFA 1BJRE 4JI1B 2VXYA 4OHZA 2H1IA 2W8BB 3LPDA 2OK8A 1CZHA 1H22A 2BEUB 2YUTA 1U7XA 5K3CA 1UK6A 4PX9A 3A9CA 3V1LA 4U63A 4D02A 4R1OA 4RF3A 1NBME 4JX8A 4IM7A 4N40A 2G5CA 4D42A 3EE6A 4FOLA 2QD2A 1J0BA 4TMVA 3ZY4A 3WQQA 5BNZA 2EBHX 5LXTA 3D0KA 3AW9A 4E51A 2QN6A 4HQRA 2V6GA 5D3MA 1RXSA 2PDAA 1DCFA 4NI5A 5U4QA 4S1VA 1A8HA 2P4HX 1NN0A 1IHUA 4GXRA 4ZAYA 2A5GA 3GMIA 5AVVA 5CX1B 1TXGA 4C7BA 2GYYA 3DMHA 5C4GB 1D1SA 2BHTA 2QJRA 1A9OA 3D6NB 3G8AA 3H2YA 4KRYA 4B6FA 2W00A 4JT8A 5AUPB 1N8SA 5HBRA 2WFAA 1KAOA 3KR9A 1ZIPA 3VPSA 3ZPXA 4F96A 1NASA 4OXKA 2ZRPA 1SQFA 2PGOA 1DRJA 4Z4QA 3IMCA 2FR8A 1E66A 3EXIB 3K73O 3UB4A 2IF0A 2X4GA 3SLKA 4P83A 2Z83A 5J1SB 1G21E 1UWLA 4ACBA 4XQGA 1GG2A 1JR3E 1MQ9A 2C5FA 3NHYA 3MFQA 2I4IA 3N8HA 4M0KA 2OMEA 2XF2A 3HY6A 3EYAA 3PDIB 4MYHA 4CM6A 5LKRA 1X0VA 4IPTA 3V8VA 1KS2A 3RASA 1E6KA 3HHEA 1OFVA 3UK2A 4KUGA 4QDZA 3CPEA 1OFTA 2HCFA 1ZD9A 5IF9A 3GD7A 2ZJ5A 2GJ8A 2NQTA 3TO5A 3AVVA 1KFBB 3EUWA 2QL6A 1W4CA 5I9LA 1E1KA 3ZD9A 4M1SA 4B82A 5JDIA 1Z3CA 1RXYA 3QVVA 3IV9A 3TLCA 2G04A 4UEOA 2AVNA 4BS9A 3B5JA 3O90A 2DY0A 5DK6A 4QUGA 3FFBA 3H0EA 2FWJA 3RLFA 1GPJA 2LD4A 5KNCD 4Q4JA 3RIXA 4K5QA 4HTFB 1SBHA 1XCPA 1YWGO 1IM8A 2CNDA 4N7RA 5EJMA 1WV0A 4PF1A 4EHHA 5CA1B 3HLTA 2RHCA 3A9UA 5K3SA 4AJ2A 4CKCB 1MT0A 2R85A 2P8JA 1WA5A 1E1QA 4B3IA 2CVFA 2ISQA 2R6FA 2O5CA 4FJ0A 3GFVA 3CHYA 3GLTA 1RACA 1DV1A 4MRSA 4Q7JB 3RRMA 3V33A 2ZRFA 2RH4A 2J0UB 2CVOA 2PU5A 2DBRA 2Z5LA 1RZRD 2X7HA 4OQZA 2PVCA 3TAUA 4O2AF 3OQIB 3ZY2A 1YRBA 5F7OA 1JKMA 1PR6A 5CIQA 4HYYA 4DZTA 5JSZA 2QROA 2DETA 1HO3A 4HJRA 1ST3A 2DYKA 2Z1DA 2CNWA 1HXHA 1ZSYA 3A58B 3BXXA 1J09A 4S2EA 1W8DA 1U94A 2YWHA 1KAHA 2H1VA 2W6ZA 4EFNA 4JV5B 3H8VA 4PW0A 4YT8A 1GN9A 3L9WA 1UC8A 2QYTA 3QE0A 4MKXA 1L4YA 1CJTC 3SBXA 1WB5A 2FN7A 2BUBA 3CF6R 2J41A 4AS2A 1HE1C 2A35A 1U8UA 2AEMA 3QMVA 4ON9A 3A1EA 4TT3D 4PHCA 5A6SB 4ER3A 5BSMA 3PQ2A 3NTQA 5I5EA 3BN3A 1F8GA 1JUDA 3OA2A 1IONA 1QMPA 4JC0A 1RI5A 2ZJ0A 4K9QA 4PTZA 5AJTA 3IR7A 1E6MA 1DOHA 3QXJA 2BRUC 5ER9A 3RC7A 5DWQA 2DFVA 2DH6A 4IIUA 4MQEB 4V0KA 2B9VA 5E6UB 3ZDBA 2O8EA 3LKBA 3K92A 4Y0AA 1LX6A 1LVUA 3RREA 3I3OA 3QUSA 1SVMA 2VNHA 1KIFA 1RXEA 2QN2A 1IFXA 3TE7A 4AC9A 1BMTA 3ZGYA 2QPTA 4IXTA 2GAOA 1P44A 2JGEA 5E6SA 3GJ6A 4DYDA 2GWHA 1KQNA 3RSZA 4IRUB 3DOFA 1IEWA 3ITKA 1UJMA 3FCUB 3M8KA 1E32A 5T8KC 1C7IA 1KZ9A 4P7JA 2O8FB 1KY5A 1ZRSA 1DIGA 4YAKA 3AKDA 4U3JB 1XAHA 1KBQA 5C5DA 3PEUA 1NI5A 4U5XA 1UPBA 4I4IA 4GPAA 3QH4A 2AFVA 4QARA 1R0SA 3R7WB 3RABA 4DW8A 1BH2A 3V8BA 1HQYE 3MCAA 1XVUA 3KCNA 5CYPA 2J9FB 1FMTA 1VKHA 4PC1A 1J07A 2EQ5A 2ZRNA 5ICMA 3ZJ5A 2BL4A 1G98A 2GM9A 2QN9A 4E1BA 3QJ5A 3C16C 2YOGA 4ND5A 4RKEA 3LP6A 3OQ6A 5H5JA 2C3UA 3VSAA 1RQLA 1V8PA 2IOYA 2JFXA 1WD5A 2JLQA 3AK4A 4HF7A 3V6LA 4DHWA 2IWRA 4FDTA 4XIFA 2H4FA 1LLUA 1T4CA 1OBHA 4PVDA 2DQ4A 3MT0A 4GMFA 5THXA 4GE0A 4KODA 1NIJA 1Q74A 2JB9A 4R8SA 4KQEA 4RYDA 3LBAA 4QYWA 5AOCA 3BC1A 4J0GA 4E4YA 2AMYA 1M1YE 1LD3A 1ONSA 3IB6A 1K08A 1LB1B 4P81A 1I7PA 1QWOA 3LQ4A 3PG5A 2HWWA 1C80A 2N1MA 5HQJA 3UEOA 1NONA 3ZLVA 5KREA 2G09A 2GVNA 5MF6A 4R05A 3OJFA 4OXXA 2OY0A 2ET6A 1SVSA 2E4YA 3NWPA 4QLOA 4D82A 4G4GA 1YBVA 4HVCA 4DT1A 3FBWA 3L8EA 1WMEA 1ZVQA 4P4TA 1B3RA 5GIOE 2PQ6A 3GEMA 3EWIA 3KD2A 4ACAA 5CFMA 4GZMA 5HWSA 4C7KA 4MGZR 4L3WA 4RKYA 4QFCA 1COWD 3GCXA 2AOXA 4HDKB 4A6PA 1ZMXA 3ZG6A 3OO1A 4I46A 4BC1A 4DWOA 5JAPA 1RRGA 2QRJA 1MMFB 4N54A 5FEMA 4MV7A 4R81A 5ECWA 4F8EA 2FP4B 2FX2A 2Z95A 4HWOA 3WMGA 4UPVA 2O07A 4LI0A 4V0ME 4BJHB 4NFYA 3ZE9A 5H8WA 1FQJA 2WHYA 4PLYA 4URFA 2NAFA 2HF8A 3OSZA 1FVXA 5HX7A 1CUBA 1VSUA