1J2YA

Crystal structure of the type ii 3-dehydroquinase
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
MKILVIQGPNLNMLGHRDPRLYGMVTLDQIHEIMQTFVKQGNLDVELEFFQTNFEGEIIDKIQESVGSDYEGIIINPGAFSHTSIAIADAIMLAGKPVIEVHLTNIQAREEFRKNSYTGAACGGVIMGFGPLGYNMALMAMVNILAEMKAFQEAQKNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 3-dehydroquinate dehydratase
publication title Crystal structure of the type II 3-dehydroquinase from Helicobacter pylori
pubmed doi rcsb
source organism Helicobacter pylori
total genus 46
structure length 158
sequence length 158
ec nomenclature ec 4.2.1.10: 3-dehydroquinate dehydratase.
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01220 DHquinase_II Dehydroquinase class II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.9100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dehydroquinase, class II 1j2yA00
4RC9A 1GU1A 2XD9A 4CKWB 4KIJA 2WKSA 3LWZA 5B6PA 3N8KA 2Y71A 3N7AA 5WRFA 2XB8A 2C57A 4KIWA 1GU0A 1J2YA 1H0RA 1V1JA 2C4WA 1H05A 2XB9A 3N76A 4CKXA 4CL0A 2BT4A 4KIUA 2Y76A 2Y77A 3N86A 4KI7A 4B6RA 3U80A 4B6SA 4CIVA 1D0IA 3N8NA 2XDAA 4V0SA 4B6QA 4RHCA 4B6OA 1H0SA 4B6PA 4ZC1A 1UQRA 3KIPA 4CKYA 2C4VA 3N59A 1GTZA 4CIXA 2CJFA 4L8LA 2DHQA 1GQOA 4CKWA 4CKZA 3N87A 4CIWA 4CIYA 2UYGA
chains in the Genus database with same CATH superfamily
2MYTA 3ONFA 3CJQA 3TGWA 1IN8A 4H4EA 5J1TB 1IN5A 3RBAA 2X5OA 2QVLA 2E87A 3TD6A 3T5MA 2O6HA 4AZTA 5FUMA 3L79A 4OB8A 3RYIA 4X7PA 2JDIA 2P7IA 5CM8B 4KOEC 2XMSA 2QPTA 2XKAA 2AI1A 1GEEA 4GI7A 1RVDA 2ON6A 4CV1A 1UZMA 2VJKA 3E9CA 3F78A 2FFAA 4M8LA 4IXWA 4S0XA 2YUTA 3GHHA 4H0NA 3ZH2A 3IAS1 4U7DA 4XQ0A 1GG5A 2C9CA 3Q85A 4UBOA 3IMGA 1TVEA 3RARA 3WA7A 5ICMA 4BNMA 3HWX1 3H6KA 1V8PA 4Y3UA 2X14A 4PYQA 2FMHA 1X0XA 2AJCA 2CD9A 3MJSA 3PEFA 3GAMA 5HZHA 4IF6A 3UG6A 2I03A 4H3HB 4C1NA 1G59A 2Q3BA 4BKQA 4FOPA 5KKCA 4P7GA 5J4KA 3RFCA 1FYFA 4MH0R 3LBIA 5F7OA 5IBPA 3N1UA 2NV6A 2W6IA 3RQSA 4Z4CA 3V8PA 3AM1A 1PQUA 1USGA 4LOHA 1YACA 3R9XB 1Y8AA 3EISA 3DXFA 3U3OA 2WF9A 2YL2A 4EEXA 4GZ5A 2GN0A 4ZA2A 2WWXA 2LZ0A 4YDRA 4ZCPA 4MQLA 4OYRA 4ZEXA 3T8YA 3LLVA 1ZH4A 4FR0A 5LA6F 1H23A 1DFGA 1N8SA 5ANRB 5IVIA 3ETHA 3DKIA 3QEKA 1GVHA 3SM3A 1DG9A 5KOJA 2V7XA 2AF4C 3RFXA 3AXTA 3OZDA 4POOA 1LW6E 1ODJA 1PT7A 1J24A 1YQQA 2O3SA 4DAEA 3ZCPA 2QTLA 1WOYA 4J2TA 1YKFA 3GARA 4E30A 2NUTA 4JQYA 4B7XA 1TW3A 1M1ZA 2WIAA 1MF7A 6ADHA 2WQ7A 1EUCA 5ER6A 1LLQA 2O1XA 3B7GA 3KT3A 4J7AA 2PUEA 2X8BA 4UFNA 1UXJA 2QM0A 3J7AC 1K4YA 1RLMA 3BB4A 3K73O 3ZEIA 2VFAA 1MFZA 3PTLA 4H7FA 2XOKD 1J42A 2HK9A 2OWEA 4DCNA 4DE5A 2YOHA 5FDFA 3I01M 1O8CA 3P2OA 4PYJA 2GM9A 2YTZA 4QU8A 2WSMA 3IFSA 1KVQA 1KOFA 1XU9A 3CLUC 4IL5A 3K4PA 4G5YA 3CUTA 1XBTA 3TW6A 4C6TA 1XD2A 1WL8A 2KJQA 3GC6A 1L4EA 4E33A 2WUWE 2O8EB 2VSFA 1K98A 3R0IA 4HJXA 2O8BA 1E3QA 3PVCA 4M9SA 3AI1A 1VL2A 4ARSA 1PSZA 2BI7A 4G0WA 5DI3B 1QIHA 4JGBA 5JJLA 4IJUA 3U44B 1U8YA 5ESXA 4FBGA 4LGVA 1HEYA 3OEED 2YWRA 3DT6A 3JQ6A 4J0FA 5FOWA 2V3CC 3IBCA 3JD1A 2QIOA 1NQWA 4F93B 3MT9A 4HG2A 1E58A 4LMPA 1ZWKA 4Z8YA 1NSYA 1O03A 1AUVA 3K15A 4WXPA 4RH3A 4BJ3A 4ZAYA 1GGMA 3OOWA 4JA0A 1JHVA 3WGJA 4N5LA 1EGMB 3GWZA 3TRJA 3SOPA 5IZ4A 4X44A 2JD0A 1J09A 3HJCA 1CUEA 2IZ6A 2RAPA 1ZQ1A 3JASB 3QYAA 3DVSX 2ERXA 4AX8A 4BKRA 1QTIA 2WA2A 5E7QA 1KZYC 1KR2A 2VJLA 2YXPX 4RLSA 3HBLA 3OOJA 4CF3A 4HDRA 1C7FA 2X3FA 1Z36A 5A5GA 1DAFA 4Q9IA 2BC9A 5JYEA 3N5KA 1EM6A 3UMBA 3LDGA 3NHJA 1J5XA 5JAUA 1CEQA 2VZ8A 5CX1A 1LW7A 5TEVA 4I14A 1B3BA 1CZNA 4FT2A 4I50A 1YIAA 4E31A 2HRRA 3O03A 4TLAA 5FA8A 4R2LA 4RD4A 2UV8A 4JIMA 2I4NA 4RXUA 3BGWA 5TVKA 1HRDA 1O7JA 5CMLA 5CVCA 4L28A 1QBKC 2LVBA 1DBRA 1MC5A 1WF6A 3MUNA 4UUAA 5AK6A 2V54A 3EPKA 2XH8A 4RIHA 2BE7A 2QR3A 3I2JA 4PYRA 2A9FA 3FJYA 5DTJA 5HF8A 1EFVA 1T9HA 2JCGA 2V0CA 1OAOC 4AYWA 5HP4A 1MQ9A 2AFHE 1UEXC 3GVIA 3TH5A 4OPMA 3TQHA 3NAQA 3CCFA 4ZAVA 3FOFC 3TW8B 1DGQA 3G9QA 1AHPA 5M2QA 1UBJS 4YUWA 2GXQA 3FMFA 1IZ7A 1NT2A 2QKYA 2VDKB 4IO0A 3VAZA 1SUPA 1DOZA 4DQXA 1MGOA 1Y33E 4K28A 3RSSA 1G4AE 2W2OA 3O73A 1CJVC 3CV3A 4GOOD 1KAGA 2CKDA 1GKKA 2WD9A 3GCXA 1W2HA 2W6OA 3L02A 4R05A 5ALRA 3SC4A 4PCUA 5CVUA 4C0WA 3AF3A 2GN2A 1TQ6A 3IGFA 3OOYA 1Z4PX 1P2VA 2ILVA 1OBHA 4TV9F 1BTOA 3T0GA 3VKUA 5EA2A 4KDEA 5F78A 1L5OA 1RXEA 4WCDA 3D9QX 1GLVA 1C8KA 2FZ4A 4NULA 2WWRA 3Q6MA 1R9GA 1J8DA 5EWMB 1W46A 1G3RA 2CLLB 1KMNA 3JQGA 3OTHA 1WSDA 1ZMBA 2VPTA 5AHKA 4V1CI 2QP4A 5CDFE 4JC5A 3OOEA 3WSVA 3UOWA 4IJVA 4CF4A 1WVIA 2EYQA 1BA3A 4ZTZB 1RYNA 2FEAA 2HMSA 2QT0A 2XQFA 3T7CA 3V42A 3V7FA 4BZQA 5B4TA 5L53A 3DZBA 1U99A 1XA0A 3GQBA 4HDMA 1N34B 1PN3A 5B55A 1L5FA 1JLLA 1ZI9A 2FPKA 2O2CA 4XUCA 2PQ0A 1TYEB 1IUPA 3A9TA 4YC7A 5KBYA 2GAJA 4LF7B 3GZJA 3GJ8A 3RJMA 4AJ2A 2DMRA 3AR4A 1UBGA 1ZISA 2A5LA 3P96A 3W8DA 4MS3A 1WHSB 1EUDB 1NRJB 4F3CA 2CHVA 3H9GA 2JI4A 4CCSA 1JQAA 3C85A 1I8TA 1RZUA 3AEYA 4IIGA 1ZEJA 2XWJI 5TMEA 4M6WA 4TXLA 4BKUA 3FPSA 1FUKA 4M9CA 2UZ1A 4YDHB 4CLEA 4LOAA 2XUOA 1NPTO 1N9ZA 2GTIA 4ZKEA 5T7BA 8ATCA 2AVDA 1ZUHA 4CBVA 3C15C 1J9EA 2ATEA 1JHZA 1HDCA 4JYCA 4RW0A 3WL6A 4DF3A 1PD0A 4D3DA 1N33B 4LQDA 1ISIA 5KJ1A 5LP6B 4KAFA 5H1YA 3KQUA 2IH5A 5D87A 3UPTA 1QIIA 3IS3A 3L8DA 3TPFA 4FGKA 4X91A 3VR6D 1N6RA 1ZX1A 3GDFA 2ALJA 2NZ8A 2QLNA 2Z1MA 2QVYX 1QO0A 4YCSA 4KN8A 4FUQA 4B34A 1M74A 5BNTA 2GZ1A 3P9ZA 4NMHA 4CTMA 4DDWA 1YMQA 3DQZA 4BFUA 4QJIA 2DT8A 1M2VB 2PSEA 1BMTA 3AYXB 3OM0A 1DAOA 3GUCA 1ISGA 2LKDA 4XJSA 2HK8A 4CLOB 2GX6A 4S12A 3KKQA 4P92A 1XNQB 3N2NA 4HVTA 1IXKA 3UWMA 4MVJI 2HA3A 4FYWA 3RF7A 4WZAB 1VYHA 3TCNA 2R8YA 3EGIA 3ROQA 1UMBA 1E5LA 1LUAA 5TV2A 5BP7A 2B1JA 2FSVC 2IQIA 3I9MA 4DA4A 1CRLA 3EDCA 4UXIA 5LN1A 1O5OA 4TKVA 5HKKA 1CZKA 1M1NB 2YWDA 1OFGA 3PDJA 3PGJA 5CIYA 3F7OA 4DT1B 4EB3A 1HLDA 2G7MC 2XY4A 3FDFA 3CG0A 2FA9A 2JFQA 1EXWA 5THXA 2ISQA 5H83A 4BIMA 5IYZF 4HVCA 2FPIB 3CX3A 2XT9A 4BHTA 4OQDA 4QNMA 4CL8A 2HPZA 2JIZA 4GRIA 4XVHA 5I7AA 4FNAA 3IVMA 2BRUA 3NANA 3D2LA 3Q8KA 2UZ0A 3DT9A 3IV7A 3KYDB 3DUFB 5L7YA 1YZTA 1TRHA 1LDBA 1U7ZA 4B3CA 3FTFA 1FDRA 1AK9A 3JXEA 3HJAA 5COQA 4KR3A 2R2GA 4JKIA 4GC9A 4LHVA 2PM8A 1D6SA 3R4VA 4B71A 2OBYA 3OZXA 3FCYA 2WYWA 4PSUA 4EY7A 2B4QA 1JQLB 5BQFA 4ZXFA 3EZNA 1T6ZA 5GONA 1U2PA 2PUWA 2PS3A 3EC2A 2IP2A 4KAJA 4ARIA 2UXDB 3JR7A 3LQ4A 2E89A 4E5YA 5IC4A 1YA8A 2R79A 3C8ZA 2ZTUA 2WFLA 1Z37A 4EO7A 3MINB 1ZNQO 4C0BA 3HO1A 4OUDB 1QRSA 2CXSA 2G76A 5KNDD 4IIUA 3N2LA 1EWQA 2ZJFA 1YZUA 2AOTB 2XMRA 3QUSA 5G0UA 2RGEA 4Y18A 4AZ3B 1SHKA 3KJQA 2WT4A 5SICE 1R9JA 4FS8A 4F2GA 4D9KA 1EXDA 1I32A 2R4QA 3AEQA 3DAPA 2PL3A 3OQ1A 1T24A 2MSCB 2XADA 2AMLA 3HJRA 3HHPA 1QHHB 3TMKA 3TOSA 2HQ1A 1GUYA 1Z2OX 3DUWA 3S6JA 3AF6A 2OBLA 2PX8A 3B3AA 3NUZA 1BVHA 3PHBE 4MPDA 4KYIB 4LVUA 1QPZA 1H4SA 1GYPA 1NUUA 1P0QA 1B1CA 2MSEB 3ABQB 5DMXA 1TADA 1CDEA 1HL3A 3IIEA 3LC1O 3ZHVA 4DHWA 3OIUA 1ZHOA 4GKAA 5TS3A 3AQIA 4HH0A 1TZ2A 1JA1A 1GZ4A 1IY9A 3KT8A 5E2IA 1DAEA 1SIOA 2OBBA 4YP0A 3EVEA 1P0MA 4IKOA 3TIXB 1FVHA 1SAYA 2P75A 2W2VA 2JEZA 3NT5A 4YRIA 4TYNA 3EXHB 2O2YA 4RM2A 5PNTA 4MB6A 4INPA 4KK4A 4FDLA 5DISB 4I19A 4L6IA 121PA 2INGX 4TTSA 5B2EA 3S99A 4V24A 3EYAA 4EPTA 2EG5A 5IBCA 1CEYA 2HBZA 3HVUA 3RT7A 3W6ZA 3TSYA 4B3IA 5ARCA 2XMBA 2PLRA 5EL0A 1QV7A 5GGYA 2FFBA 2DKNA 3N0WA 3OZBA 3IVAA 4X95A 1QS0B 5CIWA 4JJFA 5C2JB 3WAGA 2P69A 2WJZB 4K1XA 1GGNA 1XMVA 5AYVA 4J43A 4M3NA 3EDOA 2IU0A 2ACWA 3JQBA 3KDPA 1TL7C 4TZTA 3MM4A 1YS1X 4X0EA 5T8KC 3UJNA 1H6BA 2A9VA 1S4MA 3JAWB 4KQKA 1XIVA 1RM5A 1CEXA 4MUMA 3QKSB 4G9GA 4D96A 4XFKA 5GVRA 2B0CA 2HQRA 1U28A 1OPRA 5G3YA 2OT3B 2ZZKA 3CF2A 1NVBA 3T4EA 3R5KA 4GR4A 2RHWA 4K87A 4CMJA 5L40A 1GARA 3EQ8A 1SO8A 1EVYA 2GK4A 4DWOA 1XNHA 5JEDA 1F0KA 4X62B 3OLYA 2NV0A 3IEVA 3UEOA 2HJ9A 2P79A 1RJWA 4MQ6A 1Z3IX 4D8VA 3G0GA 2QGZA 4XARA 5ALNA 1VE5A 3RG8A 1KEVA 1SU7A 5EMHA 1OZFA 2HDWA 3ZD6A 1N0VC 2EG9A 3JQAA 1EDDA 3SJAA 3KQMA 3WMXA 2JD1A 4RMHA 5HTKA 4PX9A 3T3HA 2QJWA 2GBPA 1CUXA 4PZUA 1IONA 2XYPA 3AEUA 5FL3A 3NWJA 4B8WA 1SOMA 4XGQA 1CD5A 1WR8A 3DDOA 3DF7A 4JENA 4NFSA 5COAA 3V8VA 1WY7A 1PWHA 4CEIA 1XQ1A 3RWBA 1ZINA 3KSMA 1EVQA 2ATXA 4KBFA 4Q3BA 3T5GA 1U7WA 2Y9MB 1PVDA 4HB2A 4DVGA 1QKIA 2HPVA 1KJ9A 4IO1A 4Q5IA 4Y2UA 3RYTC 4DYDA 5AUQA 4E2FA 2VH5R 4AIIA 4WESB 4JLJA 1ISPA 1LJ8A 2M1XA 2PL9A 4EQZA 4HB0A 4RL4A 2IHKA 1Z6QA 1NQAO 1QFYA 1PNOA 4H6XA 1UJ4A 5LL6P 1G7TA 5CCBA 1G5HA 5AUNB 1D8AA 2WB4A 5C46F 1VXOA 3SQOA 3UOAB 2MDTA 1WLYA 4A0FA 5A9TA 3FNRA 4EFNA 4CV0A 2NZXA 4LZLA 2P2DA 1TA9A 1YRWA 2HUPA 3KFXA 5T4FA 1K9SA 1HETA 4NOLA 2VHVA 5GY7A 4A27A 2GJKA 4RNDB 4I81A 3FOZA 3SR4A 5CCDA 3C3BA 3H3XA 4RHFA 3EG9A 3O95A 3PCRB 3PWTA 4BATA 2CKMA 1Y4UA 2H9IA 2H2IA 2ZATA 2JCYA 2WF6A 3AZPA 2PX6A 3IOEA 4YAWA 5G1NA 5LSAA 4WE3A 3CVVA 1GEGA 1F0YA 4QQ8A 1WXFA 4LHXA 2ZYWX 4ZKDA 1X19A 3HDTA 3LUBA 3MNFA 3I4CA 4XDGA 5J23A 1PW7A 3HB5X 1Y81A 3IC5A 5TC4A 1HKUA 5J2UA 3IB6A 3CNQS 1XXLA 2Y77A 1RXCA 1K3FA 4M49A 3A2KA 4IIEA 3CRZA 4WBNB 1JNYA 2IVZA 1UT6A 2VPZA 4WOPA 4MYRA 3PQ3A 2X4GA 1QZUA 3ZUGA 2BBOA 1NBMD 2P62A 2ZSAA 1KJQA 4GKVA 3NM4A 4EVIA 2AKYA 1V1RA 2GN6A 3C7TA 3NT4A 5IAKA 3SEZA 3OU2A 2B8EA 2C58A 2GK7A 3OQPA 4TMKA 5A3VA 4YACA 3UAYA 4BMXA 1HYGA 2V7UA 1Q7EA 5WRFA 3ZVLA 5LKAA 1YQTA 1HT2E 1KF0A 5DXAA 1L5LA 4X7RA 4JJ6A 4EW1A 1VI5A 3RO7A 4R1UA 1XGKA 2CEKA 4G1UC 1LVHA 4OOFA 4H60A 1JL3A 1TT7A 4GF5A 4KI0A 4R51A 3NRBA 5GAJA 1FVOA 1O95C 2NPOA 3D3WB 1T8SA 3TINA 4BZZA 4G09A 2OC4A 1FA9A 2GQ0A 1GPUA 4MYDA 2C4VA 3DBRB 4Z51A 1QLJA 5HW0A 3QVGA 4IDHA 1NFQA 1Y4DE 1GGKA 2B30A 2Q07A 2XQJA 1A4UA 1XVVA 2EWVA 4XPZA 4YWJA 4DIKA 2OV1A 1QQTA 3U5TA 2GKOA 3VO9A 2O5EA 2I29A 5J5CA 2X19A 3H8JA 3Q9NA 3IEXA 2REBA 1X7WB 4XDHA 3HO6A 1ULHA 5JNUA 4WCVA 5K8JB 1PP4A 2EQBA 4Y2VA 1RQ2A 3GN2A 2P6NA 2WTEA 4V0KA 3L84A 1UFKA 1XQYA 3G8CA 1N2HA 3KR0A 3MCUA 2F4VB 3N5CA 3ELWA 4WEQA 4IRMA 3A1EA 4QXRA 5LIPA 1IG3A 2G36A 2GB4A 1R4ZA 4WOBA 2VDVE 5EESA 3VR2D 3TNYA 4C3ZA 1HZJA 1L4MA 3NB0A 4L0CA 2WZQA 2ZUBA 5LZ8A 3ZVNA 4M1MA 5FBRB 3D8BA 1SCQA 2VJPA 4JUCA 2P0EA 3CZRA 1I2CA 3QUAA 3SZMA 4UHKA 1ULUA 4E70A 4ZT5A 1XJ5A 2BHRA 1ORVA 3FNBA 1PAUA 2IDJA 2VK8A 1XHEA 5F21A 1X8JA 4IGEA 2H3EA 3SIWA 3HVJA 3F5DA 1KDRA 4C01A 5LZ5A 2QRUA 3EIQA 3MGAA 4HOYA 2BM1A 2VDUE 2ID7A 1JGTA 1R16A 1XG5A 1VLMA 4HQ0A 3BRQA 3TX6A 4Q00A 4EHFA 3D1JA 1AB6A 1TEVA 1U6IA 4HN4B 2DCUA 2PR2A 3ZDQA 3U7HB 3N6VA 3NWEA 4FHDA 2NADA 3G7SA 3VZQA 3WNVA 1DEKA 2RARA 4UARA 3EGDA 3RABA 5ALVA 4G23A 1W88A 2QRVB 1M5UA 3H4TA 1CT9A 1UBFA 4LC9A 3JD2A 3WLRA 2YWFA 4KB5A 4X5OA 1SGWA 3AH8A 4OLHA 4QLAA 3GP8A 2PXAA 1KFEB 5JAMA 1W85A 3AFGA 2GARA 4B75A 1R5JA 5IDXA 1WV1A 3TPCA 3E18A 1CQIA 4G89A 3TSCA 1T9KA 3MBIA 1JHUA 2ZWIA 3H04A 4HP8A 4QBTA 1CE8A 2ZIXB 3FF1A 4GPD1 3U80A 3UMCA 3HCEA 1LZKA 4EUFA 5HF6A 2FMTA 2QD5A 4ID9A 2V8OA 4KO3S 2BMWA 4RXTA 3W9SA 2LXNA 3NNNA 2WD8A 3R6LA 4PZZA 1T8PA 4JUFA 4OK5A 3D3NA 5E0KB 3T3GA 5KO2A 4C7OB 1Y7IA 1P1BA 1KQGA 3NIBA 3EFEA 1NIJA 2WU8A 5L51A 4E09A 4CU2A 5EXXA 1UIRA 1MH9A 3PLRA 2OD7A 2MTBA 4RA6A 2FPUA 2A3RA 3TZKA 4QOIA 2NP6A 5JSYA 1HQCA 2XVZA 2C7GA 1C9EA 1ZKMA 2J6CA 1N2OA 1SPBS 1AF4A 4BO8A 1GLNA 1YNOA 1XWIA 1UFVA 5DYWA 2EXXA 3H5WA 3OPYB 3T1VA 3INTA 5H70A 2AYXA 3IDFA 2J0QA 2RGDA 3BIFA 1AKQA 4OJTA 3SLGA 1AKEA 2R96A 1P1IA 1AGNA 3GDOA 5FR2A 3TZBA 1JJFA 3N9IA 4QSMA 5LZ7A 2FEPA 4CTKA 5BUZA 1QB8A 2F3QA 1E2DA 4CM6A 1X38A 2BEVA 3L8FA 1WEHA 1XYGA 2Z5GA 3VKFA 3ESYA 3WGVA 1QQ5A 1O08A 4TS1A 3ZDFA 4M1ZA 3LFHA 2IUYA 4ZAXA 2Q9BA 3F71A 4C0QC 2X8LA 1UJ2A 4HDQB 3TQQA 1NY5A 3UMJA 4IWXA 3L6OO 4BPBA 3WK7A 3MGGA 4DCUA 2CYBA 3PJGA 3WKAA 3A0RB 3ZD7A 1AS2A 1GV1A 3FSGA 3HCBA 4NENA 2YJ5A 4KN6A 4MINA 4CKBA 5DWQA 1DIOB 1LH0A 1AT1A 2E1RA 2L17A 2VEDA 2WJ3A 3HSYA 4C3VA 1NPYA 2F48A 3EEOA 2A58A 3EOZA 2B4AA 3GFTA 3RTGA 3WGZA 4XSHA 1LC0A 3W1VA 3DJYA 4BMYA 2X4IA 2OM6A 4F86A 2GUGA 1E66A 5IPFA 4EVRA 1H1DA 1HXHA 3MFYA 4W1SA 5THQA 4BGVA 4KVZA 3IILA 1WTAA 3IQXA 4MLPA 3AOEC 5BSHA 1ZLYA 3UV6A 2H1CA 2WWYA 2XQGA 2V8BA 2Q1TA 3NASA 5FI0B 3X2SA 4FE3A 3SDZA 3T1YB 4OAOA 3W6OA 3L8HA 2F8SA 4MVJG 3VH1A 4PZ0A 3FYUC 2W6JD 3OKPA 1XDBA 4NPCA 4O02B 1J4AA 3NHPA 4RKQA 1X2EA 2DSTA 5L7WA 1JHXA 1WS6A 3S2GA 1H0RA 1EGHA 2F43B 2O5RA 1WW2A 2X76A 1BJTA 4TPKA 4HBZA 5K1ZA 3SM9A 5KREA 1BE0A 3Q9LA 4JJZA 1GAQA 3CX7A 5DSXA 4XJTA 4LEIA 3STUA 4IH4A 4I4TB 3TLXA 1NQXA 3BWYA 4LNUB 4NAVA 4FFLA 4Y67A 1QP7A 1WD5A 2C5EA 5ADHA 4MKXA 2ZRFA 2ZSUA 5CEEA 2PRKA 1NJ5A 2CFRA 1DEHA 3BHMA 4GWKA 3UOGA 3EEFA 2W83A 4I7EA 4WI1A 2ZYIA 3LRTA 2XXAA 2GK3A 5G40A 4PQFA 1CQJB 5IDYA 3COVA 5YASA 2NU8B 1JG3A 5FNVA 1E6MA 2QNRA 1C8BA 2X1VA 5IDQA 1FFYA 3HDYA 4A0RA 2XQIA 3ZXSA 2XNKA 2PUBA 3BGSA 3BTVA 1JE0A 1XTTA 4WEOA 1BEUB 3ND6A 2DZDA 1YBFA 2VR1A 2Z09A 3E1GA 2PIDA 5FFFA 2XJ4A 3E61A 1QZTA 3EXFA 1T4BA 4LXHA 2HJGA 2YC4C 2WSSD 1WETA 1XDZA 1N7IA 4O25A 1CULC 1SUWA 3KR9A 1BNCA 1E9VA 2I1VB 3BRWD 1UKZA 2IGTA 1PJRA 2B37A 2O3JA 4MR9A 3FGZA 4NS4A 1PD1A 5I5GA 4YRAA 5JD4A 2NUBA 3FCOA 1V9LA 4PZAA 1DT5A 3DVAB 2YHSA 3H2SA 3PIDA 2PBFA 4GWGA 1T5BA 4KMRA 5D51S 4S1WA 4E12A 1OHHD 4KO4S 4ETNA 1DC4A 1UM8A 1RYZA 2D0DA 2Q28A 2YYYA 2GJSA 2Y76A 2HCFA 3ZYCA 3G2PA 3LG2A 2Q3CA 2F59A 2VPWA 5KYWA 2EKQA 3MSXA 1F51E 2WM8A 1QQBA 4QECA 3I30X 4U2KA 3HDQA 3OIDA 3KIPA 3L7CA 4XOIA 3PC2A 1X0VA 4YP1A 1XDUA 3V32A 2OWDA 1LF0A 2XAUA 4R2MA 4B47A 4DY4A 4MQFA 5FXMA 3S2SA 1KI9A 3OESA 2WYIA 1XEXA 3IUBA 2YV1A 5C5DA 3RFFA 5HBRA 5ALDA 1IB6A 5SV2A 2ZJ5A 2JA2A 4LY3A 4N9WA 2E4XA 2EKPA 4A8JB 2H7CA 4X1KA 5H5JA 4R83A 4DDKA 3KQVA 5C0OE 4UTNA 4TL8A 5KKNB 5CCXA 3UH0A 4UXHA 3BGIA 3OEYA 4X64B 2RIPA 3IT2A 5JMPA 5JCXA 3QIAA 3MGCA 3BEOA 1M6VB 2AWOA 1L4FA 1KS9A 1DAMA 1CNEA 4ABYA 5IT4A 4DV0B 3KXDA 5E9WA 1BGXT 3Q41A 4WKOA 3TLBA 2GZHA 1VL0A 1QTQA 1UBTS 2PZMA 1V8BA 2PPVA 2WFZA 4DIMA 1IN4A 1ZK4A 5DNUA 2VVTA 3C4JA 3M5DA 3MJEA 3HXOA 1WB9A 2WIDA 4KC0A 2Z3WA 3UG7A 4O8ZA 3W1EA 5JOQA 1XTKA 1W59A 3PFCA 5EP2A 3ZQUA 5LYJF 3CUKA 3DR3A 3KYIB 4FHEA 5KNCA 2BISA 2C07A 4BO6A 2OE2A 4NU6A 5D2CA 4S3MA 3ZBQA 1RYYA 4EUNA 3RGWS 2VH1A 5JZOA 5KTRA 1VBFA 4ZOQI 1XJWA 5FBQB 3T9DA 1C41A 1RWBA 4LJSA 3RG2A 1EE2A 4UHEA 4G4SP 5IAJA 1VJTA 4B4DA 5CFPA 3ZZ0A 1FS6A 1TEHA 3BTUA 2X0IA 1N6KA 4RJJA 1XLTA 3QG5A 1ISFA 4LWQA 3SK0A 3UAWA 1WP9A 2BBWA 4JR2A 1A4IA 2ZWOA 4J07A 4UBIA 3AFOA 2Z3VA 1Y8QA 3UNXA 2AUMA 2A5GA 3MQ2A 4L2IA 2JH9A 4LZJA 1EZ1A 4QYTA 4WA8A 4YT8A 2ZE8A 5BXQC 2KQUA 2GXAA 4X45A 1NVKA 1T3HA 4MUHA 3GVHA 1E0KA 2IX9A 1Z5NA 1C9DB 1NXXA 3MBOA 3EF1A 3KZXA 5FBWB 4JGIA 5REQB 1USIA 3SLRA 4RF3A 1SC4A 3VKHA 2HKIA 3ILSA 2R1TA 2W93A 5K01A 1NRWA 4X71A 4OQFA 4Q1CA 1R4MB 5EIAA 1A71A 3V1TC 4N49A 3NRCA 2C2HA 2G4LA 4DS3A 5H59A 1L5HA 3AHIA 3BD8A 3INNA 4EB8A 3C6MA 1UPAA 2VJNA 3DOHA 3B1XA 3ZHCA 3IHLA 1XRLA 2DPHA 2XKBA 4KXNA 4NCHA 1E1QD 4R2IA 4EGCB 3IULA 1HDZA 3BWXA 4HB4A 2DQSA 3CNNA 2QRZA 2YJNA 4RVOA 4YRCA 3W3AA 3DFUA 3NCTA 3ASVA 1YUNA 5ECGC 4JKYA 3DV0A 1H05A 3U4MA 3EPPA 4R3UC 4JIGA 5LOVB 5T5QA 3QMPA 3K5PA 1YR7A 3O4IA 4CIVA 2I3GA 5MFZA 3OTQA 1Q0RA 3E0QA 2QRMA 1K8ZB 1F48A 2A0UA 1EKXA 2DFDA 3CLRC 3TDKA 1D6JA 4KYTA 1TYAE 4RMNA 3ZWAA 1J1IA 2B34A 1SVOA 5DLPA 4DSNA 1ECGA 1LDEA 3L7KA 1ZBDA 2JHPA 4H08A 3TM4A 2CF5A 5TR9A 3FNEA 3GRZA 2Q6VA 2FZLA 3MA0A 2Y1XA 1OBVA 1VDMA 4H0CA 3VH3A 4LWZA 3BQ9A 1C7JA 1QWSA 3L6CA 4FCCA 4JUAA 3GFPA 5KNBD 4Q0MA 1E3MA 2PVSA 5F2EA 1AGPA 1XPJA 1YDMA 3F8TA 4JUIA 4Q7MB 1JHRA 5DBOA 4Y0AA 4C2AA 4BU0A 1T8YA 4CI0B 1AKYA 3LCMA 4DNXA 2JH3A 2P9TA 4AWAA 4BVKA 3UMVA 4FCTA 2V9ZA 2FJUA 2PRJA 5BW8A 1YOVB 4J0GA 3U0VA 4ROSA 4XX0B 2GCOA 5LMUB 4Y2TA 2I1LA 4O5OA 1X2BA 3SIXA 1ADFA 3LFTA 4BNUA 3RVDA 2JK0A 5FPYA 5HZGA 4YRZA 1OYVA 1G16A 3AU9A 2DPLA 2NVUB 4Z1MD 2WUVA 1I24A 4IW3B 2EJWA 5BSWA 1WBBA 4QATA 3ZDEA 4QTZA 4UAGA 4DLAA 2CNWA 2BMJA 4M9UA 1R0SA 2XXBA 4EENA 3EJ6A 5AOCA 4CR7A 3GBPA 4M21A 5JNWA 4HQ6A 1DKQA 3JVUA 3Q12A 2GN8A 5CD9A 3GGGA 1BCSA 3O7MA 3R2JA 1PFKA 1NAIA 1YMUA 4CQMB 3MSCA 2E4ZA 3A6PC 1XEAA 2FEWB 4HNQA 2WIBA 1X7XB 3W2EA 2EEZA 1E4EA 1FMJA 3AMVA 1JPVA 2JAOA 3PJEA 1A27A 2BHTA 4NNOA 1Z17A 5HFNA 3GZNB 5GJVC 1KTVA 1U7DA 3WYGA 1YE5A 2D7JA 4HQRA 4L8YA 4RH0A 5JWHA 2FSIA 1D4FA 1X7DA 4HHEA 1XZ8A 3I52A 2XBLA 1NR5A 3ZZTA 5AI8A 2VHZA 1UMDB 1G291 4AMGA 3WIUA 4IJWA 5BSMA 4G86A 5IVDA 2C61A 3H4IA 1RKUA 3QPUA 3DEHA 1C7QA 1DIHA 3PL1A 4KVGA 4YAIA 3KYBA 1MOQA 3KR2A 1ZOIA 2B1QA 2IOHA 1UWLA 5BR4A 4ZC1A 3ZOZA 4PR3A 2ORYA 1ZUNA 4B85A 1ND5A 4FMCF 4Z7JA 4YIHA 3B9PA 2QLBA 3G9TA 3MUOA 4B6EA 5D3ZA 2OBFA 2VTVA 4WGGA 1NW6A 3DZFA 4HEQA 5E4FA 3LNTA 5DYTA 2FP4B 1C9JA 1UK8A 1K68A 1MOSA 1Z6ZA 1SQ6A 2H4YA 2BR5A 2VZEA 2Z9CA 3F1KA 4OKIA 1JFFB 1GXSB 1J22A 1GNQA 1A5TA 1P1CA 2QMUA 4ZQFA 1FFAA 3T06B 4J7UA 3OAAD 4S1NA 2O2EA 1D0VA 1XHFA 1XQXA 3N0RA 4QKQA 1WXQA 2AOUA 4O8CA 1CUFA 3OCYA 5E38A 4Q9AA 3M5CA 1VG9B 2H59A 1CS4C 3MWYW 2GTPA 4GXTA 1IXSB 4HGQA 2JPDA 4IXTA 4OGFA 4EL5A 2UVQA 1WD7A 1CUGA 4BMPB 1DINA 1P74A 3AKEA 3VAAA 4BQEA 3DBIA 3QM1A 4ENRA 3VVBA 3KU4A 4Q3KA 3WGKA 4Y7CA 3RRMA 2PNJA 2H1IA 1VQ1A 1Z4MA 3GEMA 1QYWA 3F4LA 3PIIA 4RZIA 4TWZA 3DHYA 5HMMA 1V47A 1DIGA 2ZAGA 2NUPB 3FKSD 1A4XA 2CHGA 3BK7A 1DKLA 3KVOA 2PRSA 3KQTA 4GYWA 1RCTE 3LPCA 1M34A 3G85A 1E3EA 1B4DA 1CRZA 3GUZA 4RDCA 4X65B 2UZ4A 1ZR4A 4EKEA 1C30B 4B6FA 3O4HA 2C57A 2FQ1A 4MUXA 3HB7A 5AK0A 4D41A 4GMGA 1RHMA 1TUIA 1LQTA 4OGKA 3W5SA 5KSPA 3PX2A 3GJQA 4AJOA 3TQFA 3M4ZA 2AI2A 1CQZA 1U2QA 1GPNA 4EJ0A 1ZVVA 1PFGA 4F9FA 3CUWA 4OLJA 3QELA 5KU1A 3M6FA 2I62A 2WF8A 1QH8A 3C3KA 1QCCA 3GMIA 4U9HS 3WG9A 3PUKA 3PX7A 4S35A 1A97A 4KRGA 1XT6A 3EGWA 3M4YA 5A7HA 2P6UA 1T26A 2BJVA 1NPDA 2QTFA 3NG1A 4REOA 3SHFA 5JDCA 2E82A 3IKTA 5A02A 1VHDA 5G0SA 1KXJA 2H08A 4M0MA 2O2SA 2IYEA 1JQ3A 3TVDA 3NW9A 1YE8A 2A5DA 4X20B 1GA1A 2DPMA 2ISSD 2C2MA 2PY6A 4RZSA 2GCEA 3CVOA 4YRGA 3KWFA 4K9SA 5JS7A 3G82C 5KX5B 1EHIA 3QZUA 1KS2A 2LPMA 3KOUA 1LS6A 4J9VA 4QXQA 5A7GA 5K8TA 4PLWA 5BVGA 5EE5B 2WSBA 4UNQA 4RWZA 4Q3AA 4P5PA 3VR5A 1RM0A 4JP2A 3E5MA 4OLFA 1W19A 3EXEA 3U4GA 3W9YA 1FSPA 2G9UA 1NJFA 1JLRA 3A05A 1VE3A 4LHWA 1CRPA 4Q4JA 5JAOA 1ORTA 3X3HA 4QYIA 1JKFA 1U3UA 1YHYA 3L7BA 1XTSA 4G4JA 1DC5A 5AM1A 4JEUA 2JGDB 2XGJA 5IAAA 3AJ8A 4BCBA 4DDMA 2P0AA 3OTWA 2ZYVX 2HA6A 3VR3D 2MMGA 2PWPA 1FDOA 2GJ8A 4K81B 2H52A 4QYSA 2ZE7A 2ZBPA 3LUJA 4B7CA 2V9PA 2Q5EA 4U2EA 3IX7A 3P0RA 4PHHA 3UYKA 3ZJ5A 1VGRA 2EJUA 4BTLA 1KQ3A 5CT5A 4C9BA 1QNFA 1PF7E 1V4VA 2Y1CA 4G0VA 4FMDB 3U4AA 2FZCA 1Q91A 2JKVA 1PG2A 4NG5A 1JI3A 3R6TA 1KDTA 1Y3HA 1MNAA 2X1HA 1XK6A 2V7TA 3F47A 3KJFA 4DR1B 3RTDA 4A4DA 1X1QA 4EMSA 2Y66A 4IMIB 3DOCA 2Q2QA 2N46A 2WD7B 3M7IA 4LPSA 2IWRA 3O2SB 1QRAA 4YLEA 3SQWA 3VISA 1GR1A 1KMCA 3PA8A 1W4BA 3VU0A 2KWIA 4MVCA 3RVLA 1VLLA 1TM7E 1QM5A 4RLHA 3GQVA 3MYRA 1O96A 2VP5A 3UW1A 1QG0A 4TGLA 1PJQA 2PQMA 1VGVA 2PRYA 4DSTA 4ZV4A 1SULA 1YB4A 1YWGO 2H63A 3KD2A 4Q6BA 2PJDA 2O19A 3D2AA 4Z54A 1XQWA 1U7UA 3IJ5A 2BTOA 5CGZA 1QLHA 2ZIUB 3GEHA 5J59A 3PQDA 4BFXA 1NJ2A 3FD8A 1SEVA 1QP0A 1HEIA 4MIEA 5CFNA 4JYPA 4IWNA 2KW5A 2MSKA 4ZI7F 5JYBA 1FFBA 1KIMA 4C6RA 2A35A 2O8CA 3R41A 4G4IA 2ZVQX 1Q57A 1ZIPA 3ANTA 4I6GA 4GZ3A 1PJSA 2QN3A 3AERB 5CGQB 2FOLA 1YQDA 2J9FA 2OD9A 3LM8A 3Q9SA 1V8OA 5DPMA 3UB2A 1WB4A 2EZ9A 4N76A 4OBBA 3UFBA 2F62A 2R84A 4UATA 3DC2A 2GPNA 1SKAA 2VF2A 4YJ3B 4M9ZA 4XOUA 3ZJYA 2LP4Y 2P4UA 3B60A 1BHQ1 1JH8A 2XTAA 3FY4A 4TMVA 5C18A 5ADWA 3HYRA 4GQIA 1JG1A 3AFIA 5ES4B 1EDOA 4P35A 1WDKA 3EVFA 5LCXA 1WPQA 1EFRD 1Y6RA 4I08A 4MIYA 2VRWA 2YASA 4AY3A 1IWBB 2V7WA 1YL7A 1WQ4A 2Z30A 2QL7A 1SMKA 1VXRA 2CYCA 5JD3A 3OPXA 2PZBA 4NYJR 4WNCA 3QEMA 2ZGVA 1FFHA 1CV2A 3PZBA 1JHPA 1YRQA 2O14A 4MVJH 1GPLA 2AJDA 4IVPA 3AFMA 4PLFA 5KOHA 1GYQA 2ZU0C 2VWPA 5H68A 1IOLA 3RAJA 3PXBA 2H92A 1CZLA 5FBHA 3TAXA 1C8LA 4JB0A 1CY7A 2NSYA 5IC5A 2W2XA 4Y6RA 2B3TA 5I3CA 2HHHB 1DIAA 1R7RA 3HPRA 6AT1A 5LLTA 2HT1A 1C1DA 5AOVA 2WKQA 4MQ5A 3RW9A 2G8LA 2XCLA 3GOHA 2Q4TA 5CVEA 4JLVA 3RSFA 2NU9A 2A5YB 2EFYA 4NTZA 4R2HA 3GFGA 2FZGA 2HIMA 4JELA 1ULBA 3B7WA 4WL0A 4RBNA 2IS2A 3KOXA 5LDHA 1Z8FA 4WKNA 1XDDA 3CF4A 1THMA 1UM9B 1J20A 4HH1A 2OQ2A 2FEMA 1KE2A 4BE9A 4Z9FA 2IV7A 2VKQA 2VBCA 3OFNA 4CM1A 1NF9A 3EF3A 3WMFA 2Q8NA 4URUR 1EK6A 4I5GA 4L5YA 2E4UA 4HWKA 5ALFA 5H3CA 2XBUA 1CS0A 4C89A 4CNBA 1UFRA 2FRDA 3NV7A 5CP8A 2QZJA 2DJ5A 2WKRA 4LCBA 4QGHA 3U4DA 5HJ7A 5DGHA 4O4IF 3EVCA 4OGGA 3FVWA 3ZKWA 2GBFA 3WWYA 5DLQC 3LOPA 1JPJA 3UK7A 2UXCB 3KU1A 1S2MA 3ABIA 1BMFA 3DYIA 2ZYGA 1K4KA 3NNSA 3M4JA 1SOUA 4EUHA 4ZEVA 3DLIA 4JJ8A 2G8NA 1KERA 3H5VA 4ARZA 2AX4A 4NHOA 4JVOA 1AE1A 4X93A 1NKTA 1ATIA 4TV9A 5KTTA 2CJFA 1ZSNA 3UMMA 4WFJA 1JVBA 2Z2KA 4EF6A 3V48A 4YYEA 1GCUA 2HPHA 1ACJA 5BVHB 4BBJA 2BL4A 5BWBA 3GCGA 3OSUA 1QIDA 3PQ7A 3T34A 2HSWA 1JWLA 1CVRA 4MTCA 2Q4OA 3FOBA 3JQEA 4RCYA 4MNTA 5AQEA 2ZE6A 4NL4H 1RLOA 4JLNA 5KQPA 4HZUB 5GWXA 1KFCB 3RCBA 2V5UA 4X1IB 4BQPA 3GFSA 3WWPA 3D8UA 5HOEA 2PZGA 1NQVA 4BX9A 4N8EA 7YASA 2X86A 2C5HA 4F5EA 5BUCA 5JZBA 5JWOA 3LLCA 3GEDA 5IKXA 3IKVA 5D8DA 1GWNA 1FMLA 1CIPA 3EIUA 5IVHA 3ZCRA 3EVDA 3FZYA 4W4TA 4XM1A 3SJUA 3H5IA 4CQJA 3L3BA 2ATCA 4KVFA 4CF7A 1DJNA 1O94D 1IM5A 2VG8A 3SX0A 3SS9X 4RWEA 3ORQA 3C45A 3T99A 1M8GA 4AUMA 2C5FA 2UU9B 3TLJA 4D6YA 3HHEA 2Q3EA 5KNDH 1N78A 2X4LA 1C3OA 3JALB 4ZV9A 2QGFA 2WWVD 1F8XA 3L41A 4FQ5A 4LZAA 1GTL1 2D5BA 4BFZA 3SZRA 1EBUA 2CLHB 5FOTA 3WGHA 1NWHA 4O4HF 3S5JA 2HCBA 3EPHA 3CNLA 4MV0A 4LDQA 5LZ2A 4KODA 4N48A 3B6JA 4QVGA 1DCFA 3WLTA 2QE7D 4TT8A 4UNNA 5B1IA 1O2DA 4IIYA 4PBSA 1RPTA 1Z56C 3AB8A 3GZ4A 1T9GS 2L0XA 4FCVA 1OVGA 3UMRA 1TD9A 3VM6A 3VNBA 2YRXA 3DEJA 5FOUA 3NVKI 3HXMA 1E3DA 4GI5A 1MVOA 3OM1A 3PKJA 1KEKA 1U04A 5ALIA 4IV0A 2B1IA 2Y05A 3RUAA 1ZMTA 4DIFA 1H3EA 2JARA 4BLVA 4C7KA 1L4KA 2R11A 1HNWB 3A8TA 4RHTA 2ODTX 3G3EA 1K8YB 1W9HA 3JATA 2OECA 3QY0A 1NQUA 2D3TA 2HV9A 1H85A 2XNSA 3DYBA 1TW2A 4LXGA 1DJMA 1WXIA 1Y5RA 3PE3A 1U6KA 4FYIA 2QS9A 5KAPA 4DCCA 3WIEA 2PD6A 2I6FA 2GF9A 3LQRA 4UUMA 2AYYA 5BMVB 5JBQA 1U9IA 1OPXA 3MJFA 4D8UA 2CBZA 2J0UA 4K46A 3RIXA 4C88A 5IYZA 5KYNA 3CJTA 2I80A 2H0RA 4A2CA 1KP3A 4QRDA 1P4AA 1Z88A 3DMNA 2YV2A 3OCCA 4MARA 5DX8A 4PN7A 2WTNA 2WAYA 2G63A 5ABPA 1FS5A 5IN5A 1ODCA 1ZNWA 3DM9B 3R3HA 4RPHA 4LECA 2LKCA 2XECA 2DULA 2JIMA 3GI1A 2G80A 1H2AS 4UM7A 2DXIA 1IU9A 3WX0A 1CJUC 2OBMA 2W6PA 3DAGA 3AGPA 1FTGA 1PZNA 1EK2A 1SG0A 2BMVA 2JRLA 2QJOA 4P32A 2FW8A 3PQ4A 3LUGA 1ONOA 5AK4A 3ZDZB 2ZULA 2ZJ7A 4ZVMA 4MIKA 4R01A 2ASEA 4QULA 4KMMA 5G41A 3UJAA 3GFQA 2R47A 1OXKB 5CB4B 2YHIB 4M22A 3SYTA 3HWSA 1AD2A 2R00A 4HQFA 1BCRA 3J81k 2C59A 3LQYA 3K2BA 4GD3Q 4MS1A 1RC8A 3UGTA 3SQXA 1B3RA 3BMCB 3O83A 2Z5LA 4IQFA 1D6MA 3B3FA 4PANA 1VRVA 1E5VA 3Q3JB 1G6KA 5ECDA 1L7OA 5ITZB 5J58A 3HN2A 4QBFA 1FYXA 4G5SA 4KR9A 1JYFA 3V4PB 3ZE1B 3NYIA 2HMUA 5AKIA 1L8OA 4KUGA 4XQEA 4FB4A 1QHYA 1CEEA 2LCFA 5DBFA 2VUHB 1MAHA 4RFSA 2FPWA 4X84A 5KVQA 4BBPA 2OSVA 4UCQA 3FOCA 2BOVA 3O3MB 1HA3A 4LCJA 3IPCA 5HWSA 4Z7NB 1UZAA 2VDMB 1F7UA 2YXNA 3KQSA 3R0XA 4UHBA 1DX9A 1RAIA 3OTIA 3DZDA 4AKGA 4A8HA 2UZAA 3DKRA 3ZGLA 2FWMX 2P35A 3HP7A 2BP7A 4ZGBA 4YRQA 4FYVA 2CVHA 3KJGA 4FKZA 4EY4A 3GJRA 4RQBA 3AUJB 1T2DA 3GJZA 4O2BF 4PXYA 2E55A 2I55A 1SQFA 4FFMA 3ORRA 5AR1A 4QQFA 1GZUA 1S6YA 5K0NA 4C22A 2PX0A 3S2ZA 1JBKA 2WIFA 3W2HA 4DLLA 1YB6A 1XTRA 2BFAA 3ORFA 2GVZC 2EDCA 3QVTA 2XBMA 1W4ZA 4G5QA 5AXDA 5KINB 2YHBA 1V6SA 4JR1A 3PWZA 5C8DA 2KS6A 2F3RA 1K2VN 3KVNA 1VHLA 5ICCA 3MILA 2O0JA 2WJAA 3BCUA 4N54A 2DQKA 2VYVA 3MRSA 4RYLA 2PSJA 3KD3A 4LW8A 4PRKA 4IZHA 4YRLA 4KG7A 1SUSA 5J40A 4MHOA 4TTVA 4PZCA 2DLDA 5BW5A 3EZ2A 3JTMA 5FR1A 3KJEA 2R68A 4DPLA 3VPCA 5E6RB 3L7AA 1M7BA 2ZJ3A 4LS3A 2P8JA 1M2FA 1XMJA 3M6VA 4MW5A 4WXEA 5BYKA 3V4RA 2O2IA 4E5SA 3R44A 2Y0EA 3O8OB 1VYTA 4J0CA 1I7DA 2H0AA 1EIWA 1FJXA 1RDFA 2YRWA 3RRJA 2E37A 2UYCA 4BCCA 1XWFA 1WUTA 1JECA 1KYVA 4JLWA 3CKLA 4R1PA 5I7EA 1UADA 1B16A 2X2OA 4LMRA 3EBPA 2JBAA 4MGEA 4NYIR 3JQQA 4OH1A 1P80A 1VPEA 2XTZA 3NH9A 4RTRA 2VJCA 4II3A 2COUA 4L8WB 5TF4A 1Z4KA 5FLXA 4XLZA 4X97A 2JZOA 3G13A 2OUIA 1A5SB 2CBXA 5HILA 4K6OA 3KHSA 5A3QA 2ZAOA 3PZRA 3R3VA 4IEFB 3C6KA 4RU1A 1T25A 5CA0B 1BYUA 2HMWA 2X4DA 3B36A 3OZRA 2AC7A 5D3QA 3QVJA 4D8TA 2GLXA 3KTOA 3G6WA 3QIVA 5H4GA 3G5UA 4UNPA 2XUHA 1FYVA 1P5JA 1QDEA 3TOZA 3HCFA 4BNNA 4E3ZA 4ABTA 1NXQA 2CNNA 2IWHA 2J9YB 2NXWA 3KZ1E 1F17A 4FI3C 4BWVA 5K03A 2GXSA 4NDAA 5IEBA 5ALUA 2QZSA 3HN7A 3L8GA 3L93A 1HR0B 2REQA 1Z34A 5FV4A 2HLDD 4PGAA 5T4BA 3J80A 1OXTA 3OT1A 3CKKA 3HVHA 4JODA 2C1EA 2QRGA 5SYMA 2Y1DA 3QK7A 4RYDA 1I6WA 2WWWA 4ND6A 3IE2A 5EJFA 1CLEA 2QF7A 4PLCA 2CVPA 2PMFA 1GDHA 4MB2A 4YXWD 1SCUB 2I2FA 1HL7A 3KTDA 2DH6A 4BAGA 2XA9A 3VU8A 1N8NA 1YR9A 2AC4A 2V6FA 4DPMA 3MMNA 1R6UA 1ZN8A 2CDRA 2J33A 3AI3A 1E0DA 3WO0A 4TYMA 3Q3GE 5DNDA 4GGMX 3FNGA 3RT9A 3T52A 3LRXA 2G67A 4MKGA 1JXOA 1MDFA 3GR6A 4HFMA 3ZHUA 3ZXYA 2RGBA 1TK9A 3PK0A 1YCFA 1VZ3A 1OMOA 2OY0A 1C5KA 2V6JA 1ODIA 3TD2A 3VO8A 3GRVA 4BKMA 2VDWB 4ND7A 4Q9JA 4NJOA 1DG3A 3RUHA 1JUDA 2EV9A 2X9VA 4CIWA 3PPWA 3DB1A 5A4AA 4ZT3A 2PGXA 3QOFA 1EX7A 1C7IA 1D6NA 3MD9A 4YV1A 4BP8A 4NBTA 3DW1X 1SUDA 2F1JA 2PYIA 2WJVA 3SLKA 2APJA 1MHTA 4R1QA 1X3SA 2FR8A 2ZCVA 1NN3A 3AW8A 1I4TD 1CUDA 1Z6XA 1IOZA 2A1TR 2GD2A 3H83A 1NP3A 2D1SA 3CCBA 4Q4HA 4BVBA 3HBNA 4B3GA 4TTRA 1KBOA 4TV8F 4EZEA 3E2MA 4WXYB 5F12A 4C04A 3C7AA 1RHKA 3KWMA 3LPAA 5ERYA 3QTTA 5JALA 3EIOA 4HN2A 3K0HA 2X23A 2UYQA 3ACCA 4V0SA 5C1BA 2I7TA 1GHTA 4XASA 5KWEA 4FFVA 1MN6A 4C4TA 3PITA 4DUYB 2BFEA 3IDQA 4J90A 4LXIA 5F5NA 3JWHA 1L9XA 4DZTA 3N0VA 3FYSA 3G68A 1YC5A 4AJ9A 3Q0EA 1E7SA 1VLQA 2J30A 3GLHB 4L7VA 2XT6A 4UEWA 1KDVA 1Z0AA 1ADYA 4YI5A 5C1OA 4E3WA 5KVCA 4KPUB 3AB3A 4QG7A 5EKXA 1RJEA 3D02A 1YR6A 5C9ZA 1T6BY 2BPOA 1J8FA 4E46A 3S55A 3BZWA 4URVR 3PEEA 5E0OA 3QA9A 4M2LA 1N2EA 2I9PA 2Q4RA 1SXGA 2BRUC 2OCLA 1HURA 4Y1EA 5CK5A 5HCNA 4BX8A 1W4LA 1GFIA 1JQJC 1U1FA 2VQDA 3BHJA 4NMLA 4W1QA 4DADA 4DXHA 4DCOA 4BWGA 2EZ8A 1Y5IA 4DDTA 3HDVA 3U0BA 1PEAA 1JIIA 4XVCA 1D2GA 3RQIA 3RI3A 5D3MA 1QDLB 4ZAWA 2W2NA 1Q2UA 3NHUA 1SUEA 2R62A 4WOCA 4NF2A 1C0EA 4DJFC 1TAGA 3Q6NA 4P7BA 1LV8A 3E15A 5EJ5A 3FOEC 5BN3B 1U81A 1SQGA 4QNRA 3AR3A 1GM5A 2Y0BA 5CNKA 1RI1A 5EZYB 3V9AA 1W0CA 4K5QA 4B31A 2TRSB 3AJDA 1NW5A 1WXDA 3AFHA 4RD1A 1LX6A 1OR8A 4P98A 2JCSA 1JDBC 1KMHA 2R8BA 3KHKA 3C14C 1G21A 4ASUD 4PSDA 2GI4A 5COBA 2VKTA 1IUKA 3B1VA 3TFWA 4KDCA 1K63A 1LQUA 2GNOA 3UHPA 3O4GA 4EY6A 1MIHA 1YD7A 1Y42X 2XVAA 4LDRA 3GUVA 2JZCA 1TZJA 3VYSB 2ZRIA 1CUSA 2IC5A 2QW8A 1ZK1A 1Q1NA 3A9CA 5DT2A 2ATIA 2ZYTX 4CG2A 5MN5A 5F9HA 1MQSA 1ZI8A 3GLFB 4INZA 3BN3A 1REQA 1VJRA 1RBYA 1G20E 1E1CA 2AS0A 2P27A 3ICCA 2TMDA 1OXSC 1ZD9A 4N5MA 2QDXA 3OCVA 3H2YA 4KRYA 4BEWA 4GX1A 4HNVA 1UPTA 1TDJA 1CC1S 4RABA 2A0YA 4B3MB 3VHXB 4US1R 2YZMA 3B5IA 1TKBA 1NBME 2I8LA 5KNLA 2QHXA 4P4GA 1ISSA 4OXXA 1XZKA 5FADA 2C42A 1KY3A 5G0WA 3H87A 5DASA 5DHAA 3RHZA 5HUJA 1IN1A 3S3TA 1SOVA 3TN7A 2C4MA 3GGDA 4CG0A 2WHPB 4O3MA 2J3QA 2HTFA 4S1TA 2HGZA 5IT0A 2ZI9A 3AK4A 1GL9B 1K66A 2AXEA 4ADSG 5CHEA 2IYRA 2PRZA 1CETA 1JHQA 4KMOA 1YI8A 4WJZA 5EERA 5AQ1A 1I14A 3PJDA 3UCEA 5I9NA 3C6XA 3B8EA 1MENA 4DV7B 1E9AA 1BWPA 2I2WA 2I6UA 3IP7A 4JVMA 4MRSA 3ZWVA 1BX0A 1QKKA 1W1IA 1UJCA 1JEDA 2C96A 4OHYA 3TR5A 4WTOA 1DMRA 1E2BA 1Q2XA 3M0EA 2AI3A 2JNWA 1E98A 4KV9A 2R6GA 3FYUB 5AUOB 1JKJB 4PYOA 2FPXA 1MZVA 1YQWA 2BMFA 4NPAA 1MB3A 2Z58A 1VE6A 3VDQA 3V3KA 5DN9A 1U28C 2FXVA 4EJSC 4GZMA 2O2DA 3P52A 3ZTWA 4XB2A 2C9YA 2GEVA 1BVYF 2DEUA 1G4HA 3DONA 4P4LA 2EBHX 3K9CA 4TMZA 1HFWA 3O1IC 3OE5A 2BGRA 2HT6A 3QW4B 3T9BA 4B43A 3C6QA 1T0HB 5CBPA 4V1CB 3P2KA 2ZUEA 3H97A 1UXHA 4BJ5A 4HUQA 5BWMA 4S05A 1ECFA 3KNZA 4K9DA 2H2WA 1IIBA 1PO7A 1QE5A 2Z8XA 2ZT5A 3A2MA 3N74A 2WE8A 3N8KA 2AX3A 4DREA 2ZYUX 1N5MA 3KOMA 4FSHA 3PUIA 4YIKA 2I87A 1XZFA 1CUCA 2FN9A 4KBGA 2IHTA 1KAEA 4DA8A 4NPHA 1FRFS 2PK3A 5EIXA 1W1WA 2XGOA 5BO5A 1BD4A 3QLVA 1MIOB 4M83A 4OHMA 4HNUA 1IRIA 5I9IA 1XFDA 2OCKA 3VC7A 1ARZA 3VDRA 1YIOA 2M6KA 1ZU5A 2WA1A 3IQWA 3JTEA 3GA0A 3L0PA 1TMOA 1VMKA 3O8BA 1TRKA 2FK7A 1DAHA 1M2EA 4IHJB 4XDZA 5IKMA 3RC1A 1MJGM 4P53A 5TSDA 4IFIA 1EFLA 2AQHA 3Q7IA 2AW5A 4TLMB 2B99A 3P9PA 2F9LA 3ND7A 4P3YA 5AK5A 3A14A 4V2IA 5C35A 4B76A 5B58T 3WZ2A 1G5PA 1G6HA 1L5ZA 4JC8A 4L5AA 3GJ3A 2WW8A 4M9XA 4MDYA 3L01A 3ZGOA 3KYCB 5CURA 1JRLA 2AA3A 2AEJA 3QHQA 2XDYA 3Q5DA 3LQFA 1TEXA 1JR3A 1T6XA 2QD3A 1GQFA 1SXJA 1XYVA 3I6IA 1M83A 5EWLB 2PCLA 4V2UA 3AKDA 3MTBA 4EKGA 5A6VA 2JVJA 5GPBA 5JSZA 2XOEA 1DAPA 1VJ1A 2AZDA 3DMPA 5E8RA 1XZGA 4Z6KA 3M82A 5KJEA 3C5VA 4D3SA 5I7OA 2OHIA 1AQLA 1SC6A 4KEAA 2WP8J 2B7BA 4I55F 4Q48A 3GFVA 3R7AA 3T5TA 4BWFB 3HDGA 2J4FA 1NYLA 4FYYA 5DV9A 3M6XA 1FMFA 1A8HA 2X3YA 3H5TA 1XNGA 3OZCA 2ZIEA 1G19A 1WMSA 5EEHA 4G1VA 1Z22A 1PSWA 1RRKA 5EIHA 2C00A 3BGOS 2G3YA 1TCVA 2QSYA 3I9FA 3PLNA 4OLBA 1QU3A 3DDUA 2VJMB 3NO4A 1FJ2A 2NO1A 4CCYB 3AU8A 4WX2B 4WFQA 3WRYA 4ZJZA 5KUTA 1QZ3A 3KZKA 1XAIA 4B35A 4N0MA 1E1DA 3V8RA 3D8TA 4DLBA 1PV1A 1MABB 5LIRA 5AICA 4UU1A 1OFIA 4DMKA 4Z3DA 4URXR 1RZRD 1Q7BA 5ALWA 4KRFA 2NT3A 1JAXA 3NEJA 1GSHA 4TYWA 1RCUA 2QN1A 3HCPA 1JG7A 5EKDA 1JB1A 3QE3A 5DXJA 1CHNA 1JG6A 1R0RE 5EC8A 1NUQA 2CLEB 3VC2A 3WZMA 2I54A 1UKCA 4OFBA 4BV3A 4ECEA 1LVGA 4ARAA 1GFWA 1P4HA 3HU5A 5LQRA 1LI5A 1D03A 2EW2A 3DBLA 2C9ZA 3HCNA 4JI1B 3LO8A 3BDVA 4HFNA 2ZUFA 4M0KA 5JS8A 3MWLA 1QOQB 1WY5A 1JEYB 2W2LD 5C8YB 1SC3A 5I7UA 1Q77A 1PKXA 3GD5A 2RHRA 4J0EA 1LCIA 2X40A 3TW0A 1QYXA 2AOVA 2PGLA 4U6NA 2IOQA 1R5OA 1XHLA 2I3AA 5D7NA 2PSDA 1Y5LA 4FCWA 1VCHA 2KSQA 3P2MA 2DQZA 1Y3BE 2JJ2D 4OLAA 2GAIA 2R4TA 4A2WA 1ENYA 4L50A 5FBKA 1JSZA 2A3NA 4KSYA 1EG7A 1LK5A 2DKFA 4IDNA 3TLGA 2N47A 3VSDA 2OFFA 3PXCX 3CN7A 1Z2EA 1FNNA 3THXB 5E1DA 5KVVA 2XZTA 3EPJA 3UICA 2FR0A 3UA4A 5BV1A 4HTAA 2CLOB 4UD6A 1HNXB 1I30A 1WM1A 2R8PA 2VRCA 2ZBFA 2JI7A 1XV5A 2VLIA 2LBPA 4PC6A 1OYYA 3FRJA 4BMVA 2IYOA 3ED1A 4Q7KA 5FPSA 1B0UA 4G0ZA 4CCWA 1TQ4A 3WYDA 2X0KA 4ZDKA 4RA9B 1DUVG 3RBXA 4CKEB 5BSTA 3VV3A 3IT0A 2PDAA 4ISCA 4KUHA 3U3ZA 3K05A 2DFPA 3FMIA 3PB3A 3REGA 4EUSA 4JI7B 1X15A 3UF0A 1MJFA 1MDBA 3O8LA 3I2IA 5ESWA 3WB1A 1QOPB 1SHTX 4XQGA 3G02A 2ETVA 5AOBA 4BOYA 1FOEB 4ED9A 3VPFA 2QTWB 3PXDA 1X77A 1I1HA 2NVOA 4LA4A 4ZODA 3N07A 2XQVA 4I8IA 3PFHA 3VDNB 3DEAA 3GG2A 1N2SA 3QXCA 3K8QA 4MI3A 1O94C 1XCLA 3OJWA 5K8LA 1PGOA 1QK4A 3CR7A 4NCNA 1OC4A 4P8RA 5LYJA 1EINA 4AVYA 1FC0A 3S1AB 7MDHA 1KK3A 2F67A 3IBTA 3O1JC 3QJYA 5LFAA 1YBHA 3RJ9A 2RHHA 1IHYA 1XTJA 4Y1RA 1FL9A 4HR7A 4O5AA 2FPPA 4IV5A 4PPFA 4Q3CA 5CA1B 4OD0A 4YMVA 2HRDA 5C4GB 4K86A 4W9MC 3RGGA 1QVAA 4KH0A 2CNKA 3IXMA 3WYCA 1K7EB 2NTJA 2O05A 1AS3A 1NVEA 1M2OA 2RB5A 3MK31 2WJ4A 3NTQA 3U26A 5KNBH 2ZCUA 2GKGA 2Z2ZA 5KVAA 1NRXA 3DDZX 1EQUA 3TDMA 3MJHA 4HD8A 4YQZA 2C92A 2OO5C 3GYBA 2PSSA 4NBNA 3VAYA 4MLCA 2GRJA 3ZLUA 3SFZA 3ITDA 1KBQA 2YRFA 1USWA 4L5CA 1ZBQA 1YC2A 1TD1A 3U31A 1ZW6A 2AMFA 2AHOA 1XNRB 3LK7A 2CDAA 1GTG1 3G1TA 3BJEA 1CIVA 4FFNA 5AVSA 2PUCA 2ZQZA 4K40A 4OHPA 4R8VA 1P5RA 1STOA 1YGPA 4RDXA 2VHXA 2JG3A 3ZHSA 5K0SA 1Z9BA 4UMDA 3EODA 2YCLA 1LBIA 3GJTA 5J2TF 3V80A 4KFCA 1GU1A 1WUIS 2WYHA 5F1PA 4F4IA 1N3BA 2R5FA 4I1PA 1SCNE 3EH1A 2P6OA 2NTYC 4NEHB 2NWQA 2Q6IA 3K94A 5FORA 3K6SB 3KB6A 4N03A 5A05A 2BW0A 3V00A 4BRZA 5JG7A 4C03A 3KKNA 4BKOA 3AUTA 1LPMA 2WTXA 3PWSA 3OOHA 3U09A 4UEOA 3SQNA 5GM2A 1I51A 1GGEA 2LGJA 3V6LA 4XJXA 4F3NA 2BFNA 3NTUA 3ORHA 1CUWA 4ZU1X 3ZWQA 2ZSKA 1Z4QA 4F8JA 3S4YA 1EP3B 5IEJA 2DUUA 1GTMA 4H2DA 1GITA 2HFJA 4UNSA 2JFWA 5P21A 3W77A 1Z6AA 1B14A 5BNFA 1TK3A 3EFBA 3TLCA 2H51A 4O0LA 3MWEB 5EHNA 4YCCA 1SELA 3ZDXB 1E7YA 5FULA 1Z47A 3T9CA 1QF6A 1AX9A 4DA7A 2C78A 4ZVNA 1C4WA 1DMSA 3LP6A 3T9AA 2FWAA 3N75A 3TF5A 1RMQA 1SBTA 5TQ0A 1F06A 1MVLA 1P31A 2JA1A 2UZIR 3GRRA 3R9IA 4W7IA 3RBZA 1OWPA 1K3UB 3O94A 3O9VA 4FINA 3LUFA 3TBKA 3ZV5A 3ISTA 3CXRA 5I4IA 3EJWA 1A7KA 1YJ5A 3OMXA 4L9AA 3QU9A 3N8NA 4YAEA 5CNJA 1FMCA 1L4BA 3M9WA 3THWB 3PGMA 3BCHA 4WK0B 1KSJA 2F8TA 4UBLA 5FLKA 1IEQA 5AXBA 4Y2JA 5IBRA 3ZDBA 3WHIA 3T54A 1W9MA 2ODBA 4P86A 4BO3A 3TTXA 2DF8A 2CXNA 5LMCA 3TTWA 3KOYA 4J8PA 3NAZA 1GCIA 5TPZA 2BGWA 1XVAA 3E58A 1NXOA 3EA5A 2ZI4A 3JD3A 1O8BA 4GPIB 3O4JA 1VLVA 3VTAA 1C50A 1KP9A 3FDJA 1E20A 2X2PA 4EVQA 1KZHA 4EL0A 5U4QA 4UZFA 2VS1A 2XZPA 1KI8A 3QFSA 1C9YA 1E2PA 1M73E 2AD5A 2WJ6A 3GNSA 1HWYA 1UKYA 3Q7TA 4ITRC 4CUZA 1X7ZA 1GZ3A 5M34A 3TTTA 2JLVA 4KK3A 4BCDA 5LMZA 2JFYA 2ZJ8A 2GK6A 3F0TA 4FFSA 1KA9H 1G18A 3JY6A 3NYRA 4K9NA 4Z9AA 4WNIA 1E62A 3ZWCA 4GBJA 3M3HA 3F67A 3RH0A 4QELA 1JYSA 3BMNB 3M1AA 2GNAA 1HF3A 4OXKA 5DHQA 4KDRA 2AN4A 1KP2A 1JAZA 4Y98A 4K0RA 1O6FA 4LBYA 1QG2A 4M53A 1FP6A 4R16A 4RY0A 5CH5A 4ZVQA 1RJFA 4JK3A 5B1HA 5AVZA 1DKOA 2WPDA 1OYWA 3DDWA 3GVCA 1Q1EA 1JR4A 2BDUA 4G24A 4P31A 3OPVA 1MOPA 721PA 3K72B 2BUAA 1BU5A 3R3XA 4E13A 1RACA 3ESRA 4RVDA 1E59A 2AG6A 3WP1B 3ZQJA 3ZE2B 3ENKA 1JDUA 3TEMA 3X0DA 3GGSA 3OZUA 5EWJA 4ENQA 2OCDA 3IEPA 4E1AA 5JADA 1JA9A 2ONYA 3OZVA 3KLNA 2QV7A 1J5PA 2VBIA 3E5HA 1W8IA 5AHWA 1W96A 1JLKA 1RPNA 4F6RB 2O8DA 1OXUA 3NBZC 1TM5E 4FEAA 4U7GA 2JGEA 1YFLA 2JLBA 3BF8A 1M67A 1UDWA 2AZTA 4CLRA 4QM7A 1U0RA 1RJ9B 2GT1A 3L0YA 1FDSA 3EIHA 3MRVA 1QYRA 1SVNA 2AXQA 4NH0A 4RJTA 1C7ZA 4X61A 4RPJA 3WWEA 3DFZA 1F0PA 2JAHA 1WDMA 1Z29A 1E4OA 3RVOA 1RI2A 4WCFA 4FZRA 4WLUA 1QBGA 3RC8A 1X7YA 1I3OA 4IQ8A 3P27A 4MAFA 2I3ZA 4MUFA 4A6XA 2H1OA 3SZLA 4ZU3A 1U7TA 2SHKA 2PE5A 4P2GA 1I13A 1ABBA 2ZUTA 1KJWA 3AEKB 3BSYA 4HC4A 5IULC 4NKRA 4NZNA 2JJ1A 3K9FC 3IV6A 2OHJA 5GM1A 1QRRA 1H3NA 4UEKA 1TF7A 2E5FA 2R2AA 2Z95A 4A5SA 4BFCA 4DARA 4YS6A 1AO0A 2PL1A 3D8HA 2QL5A 4KQ1A 1X74A 4B6RA 4PSKA 4CM3A 3LPNA 4OYYA 5C3MA 3ZWMA 4C3UA 5KQSA 1Z8DA 1HOTA 3MPUA 2B8WA 2BI4A 4JZKA 3UXHA 2OHOA 3VZCA 4BFSA 3ZVKA 2GFHA 3EIXA 1Z83A 2EGGA 3GJYA 1PR9A 3N2ZB 4KITB 3S27A 4CKZA 1ZL2A 2RK4A 1C3VA 4HRXA 4YJFB 3UT5A 5A3RA 4FPXA 3K9BA 1Y1SA 2X77A 2XCRB 3MJ4A 1ZGAA 4RTPA 2QX7A 4R1LA 1GLGA 1ONSA 1P1FA 2XD4A 2VSQA 3EXG1 3N3AC 3PQEA 1P1RA 1SKQA 3QA3E 4I5IA 5AJUA 5TVGA 5BUQA 4CIDA 4GOND 5EJ7A 2IHVA 3IVRA 1PJTA 5I9MA 3U3XA 4ZGWA 2AN9A 2FKAA 3X1WA 5JXWA 3GV0A 4DHEA 3O5AA 4IUDS 1XLTC 3DE5X 1CFZA 4L72A 2R5WA 3CXUA 1ODFA 2CVZA 2O0KA 2YV3A 3RLIA 2WT8A 4XZ3A 1J2EA 4JDPA 3WHKA 4B74A 3KE9A 1AQNA 4XWYA 2NSJA 3IOBA 2ZBQA 5A9SB 2A7QA 1JLHA 1TJ4A 3IEIA 1RBQA 1DFHA 2B6NA 4LXUA 3U3MA 1V3QE 4AMZA 4CHGA 2CJPA 3L07A 3O4RA 1IXYA 1E61A 1ZJYA 5EXTA 4C0LA 3H2ZA 3I34X 4DTCA 1PWYE 2IYUA 3GN1A 3A4YA 3IA2A 2VP2A 3IBSA 4ZZIA 1ZGHA 2WU3A 2WNHA 3AHGA 3SAJA 4X8MA 3NR2A 3FUWA 2IS6A 3KXIA 3D7MA 5KYVA 2OHVA 1XZJA 3ASYA 5L95A 1U2DA 1UH5A 13PKA 1E6LA 4ZZ1A 4P3KA 4WIAA 5A9RA 3KSBC 2Q4BA 2WMDA 4KQJA 1M3SA 2CE2X 4L4SA 2FQYA 2QTVB 3IJPA 3KJZA 4J3FA 4MJXA 4Q47A 4RF4A 3UUEA 2QRHA 4N7MA 4CT0A 1IXZA 3G8YA 4G2NA 4LZWA 1QP8A 3A11A 5I8PA 5AI9A 3TMAA 4E6EA 1V16A 1X94A 5EZ6B 3EY4A 1Q12A 1UL1X 4KL8S 3PBKA 3LX4A 2PT9A 4WUVA 2F1HA 3P2JA 4UCWA 1QH1B 5FQNA 4ACBA 1NVAA 1W7AA 2A9RA 3ZCQA 4NK4A 4R7ZA 3R23A 4G26A 5EJIA 3VKWA 4TT3D 3LYUA 4JBIA 3QXGA 4UTOA 3C2QA 1Z2DA 4OXIA 3LF2A 2IYYA 3IIKA 3ZWBA 1DKPA 1FFXB 2TYSB 1DHTA 2PGOA 1JHAA 2HO5A 2J31A 3BWDD 2FG7C 2VCYA 3GT3A 3H13A 5F64A 4CQLB 2QQGA 1C29B 2HR1A 2KPOA 1QMPA 4D74A 2ID4A 3D6FA 1E5QA 2BONA 5FTKA 5BSRA 2PZEA 4HMPA 3WK8A 3ETCA 1U6JA 2YYZA 4TLBA 3QP9A 3L7LA 3TLYA 4F1JA 2TS1A 1BQ3A 1CUBA 3MS2A 4H7IA 5IAGA 3MWDB 3SEFA 3NAMA 4RFLA 4FDUA 3ZHBA 1J21A 1EJ0A 2XYHA 1UOPA 1LI7A 1TMGE 3ANNA 4E4RA 4ZI7A 1ZU4A 4DC9A 3DJFA 3AF2A 2EFEB 2FFJA 4IEEA 3BXPA 2QY9A 4WLVA 3VNRA 4PG6A 1P0PA 4JBGA 2FK8A 3P5BA 4O2AB 3NDBB 1XD8A 3ONDA 2W4MA 4B09A 3GIDA 3L77A 5D86A 1UINA 4ZOAA 4EHLA 2J09A 4AJ4A 2ZUUA 3C97A 3F6YA 3M6WA 5FIUA 3UJ6A 3QEBZ 4YB8A 5THKA 4AJLA 2ZM5A 1NN0A 1JJVA 2OORA 2DU8A 4G36A 4WZBE 2ABWA 3I6MA 1FK8A 4RPLA 3F4KA 3FWYA 1V95A 1N7GA 1Q5PA 4M1TA 4QOSA 3HXKA 3OBIA 2FTKE 3KDAA 3EUAA 4I2VA 3PTAA 2OO7A 3RUCA 3WWZA 3HKCA 3EQ2A 4WLFA 4BBAA 4QDOA 5JBNA 2KYRA 3G2OA 3L6RA 3E8XA 4MPRA 4UDXX 5DNCA 2WSIA 1A9QA 1VCMA 1NMQA 1SA0B 3BMOB 4CFSA 3LDHA 5U1PA 1JDZA 1XCJA 1L7AA 3GBVA 3UHFA 1COWD 4OXQA 1PJBA 4N6NA 5KMGB 1OI2A 3D3QA 1P3DA 3ILYA 3R7DA 3UB4A 2F3UA 1ZHHA 1X92A 1AK2A 2B1GA 1Z8NA 2O7VA 3PT5A 3REQB 2PQ2A 1WE2A 3OX4A 4PC2A 3W6UA 1SIUA 1LRJA 3VR0A 4AX4A 3OZ7A 4CLXA 3P9YA 4W5TA 1M1YE 2QE6A 4XSVA 5K6RA 4Q9DA 2JBHA 4I99A 4A6PA 4BNXA 2OVFA 2YS7A 1COZA 1F6DA 2B2XA 3C5HA 2ZS8A 3FOWA 3AR6A 3U4IA 4FGSA 4IWYA 2YZNA 4JXKA 4LK3A 4MCHA 5EYPB 5H82A 4D9HA 3WWCA 3ROMA 1Y8RA 2CL7X 1QP4A 3THRA 3LECA 1PV2A 3OG9A 1VKRA 3QTBA 2EFJA 5IFKA 4GXQA 5ADVA 2CC2A 4QNNA 5EFZA 2JKYA 2Q62A 1E92A 1TI7A 4DR5B 2ZYRA 1RAEA 2ODNA 3JS5A 2CUKA 4WNAB 2BJHA 1NNUA 3HY6A 3KUDA 3TB4A 3VRHA 5KTYA 3U19A 1GGFA 2CY0A 1EM8A 2PWYA 3IQFA 2YMPA 2P2ZA 4JHXA 3KBOA 3O9ZA 1A98A 2Q7XA 5FV7A 3PIRA 2PAAA 3NONA 5CLQA 1IZ0A 1RIIA 3SC6A 3D4BA 4AKSA 3I1IA 4AMUA 4X3OA 3LYLA 2H4HA 4EMBA 4GIBA 1ZMRA 3CH7A 3D5EA 2BH2A 4MAAA 2GJ9A 5DLYA 3MYYA 1T2FA 5BQ3A 5CTJA 1V6CA 5HS6A 1CKEA 1CY4A 5FKJA 1UK6A 1PCXA 1GCOA 3C3WA 1YQ9A 3GX1A 521PA 3PEWA 1R0KA 2QG9A 2C88A 2FMIA 1Y1LA 3HUDA 5AXCA 2HU8A 3KZVA 2W4QA 3PUWA 3QLJA 1VKZA 5JY1A 2XRMA 4PS0A 2C7BA 1SK8A 2JASA 4K3VA 4DFDA 5A5DA 2ZTLA 4ZCLA 1X1CA 4NONA 5AK3A 2ZTVA 1VP9A 1TM2A 1TIPA 1ES9A 1HZZA 3RHFA 5C52B 2NYUA 2RHLA 4QAQA 1SXJE 3DE6X 3TTVA 1SVUA 3DDNA 4IXMA 2OK7A 4YHHB 1KO8A 3F5SA 2FLVA 4UE2A 5JZMA 3WGQA 1LPAB 1GSIA 4Z49A 4XEUA 1SZPA 1AH2A 4PHFA 3WL7A 3VU3A 1DJLA 4YJ2F 5BT9A 5I7FA 3OU6A 1JQ5A 2LDXA 5H81A 4EDHA 3MLBA 1EGVB 4UUQA 1JIVA 4HWOA 1R0LA 1QHFA 4BDTA 5BV2P 1J2JA 1FYDA 1Y3AA 5K20A 2Q8PA 3GA5A 3LD9A 1DOAA 4I46A 1X80A 4LYFA 4Q15A 3OX3A 4R31A 3BXFA 5JDCC 3W06A 4W63A 1NXTA 4ND4A 3CWCA 4NOKA 1APBA 4X8LA 4DA0A 4DQ0A 5KOJB 3DV9A 3ZDAA 3TAHA 1RMTA 4TQGA 1DRWA 4ZAFA 1YTLA 4WPGA 4L22A 4YRJA 4MMXB 2QWXA 3RIHA 1MHPA 3WB2A 1P73A 1JQKA 2NUTB 2YWHA 4FOOA 2QMOA 4XB6B 1IBLB 3IMFA 3KELA 1AZWA 1ZD3A 3ME5A 2VP6A 2YFKA 4FDTA 2NPFA 3H42B 1UC9A 4X41A 4WXRA 1OVMA 3WYEA 4ZCQA 4H27A 4L3VA 3EX7C 1BDHA 3ZH9B 4H17A 1J90A 1SM4A 2W0SA 3GZTB 5SZJA 3VPAA 1P72A 2V97A 1S2IA 4R1NA 4TMXA 4EY5A 5JVDF 1E9CA 1MG0A 2GBCA 1L1QA 3L5OA 4TVKA 2PJUA 2D1QA 4C5BA 1EFCA 3IMKA 3HCRA 3OUUA 3T7IA 4DV1B 2EZTA 3B51X 4C6TB 1U9CA 1BFUA 2FWRA 16PKA 1XD2B 1I6KA 1Q7GA 4I50F 4IXDA 4O4HA 4CF6A 4P4SA 4XLLA 4L4UA 4CMIB 4NXNB 3NBMA 1QHIA 4CM4A 4XM2A 3MQFA 3UXEA 1B23P 1II9A 1Z5PA 3HH8A 3BBLA 4NV1A 1ULAA 2MINA 1C7EA 1PDOA 2YWEA 3T94A 1WU7A 5DN6D 5F5XA 3GCZA 4FKMA 1NKVA 2I1WA 1FDTA 3E48A 1MW9X 2WOJA 1CRWG 3LUHA 3NXSA 3PDWA 3MB8A 3SBXA 3SR3A 4CMGA 3EXIA 4F5WA 4DCJA 4JROA 1PEDA 4EYOA 4QOGA 1Y7LA 5FJIA 4GM0A 5IJWA 1N6IA 4DJ5X 1YDEA 5CVVA 4BEJA 1LDMA 2HF2A 1ZM3A 5FCDA 2XODA 3BIOA 3HBMA 4DNPA 2O8EA 1MRSA 4LYGA 3I8XA 3A32A 4KGVA 5T3YA 3ADOA 1VLJA 1K6XA 2GEDA 4RADA 5FWDA 3BAZA 1T2UA 1YUMA 3FAKA 2ZK7A 4AIRA 2AYZA 3CIOA 4HAWA 5BR7A 3MGBA 3NEYA 3DBHA 3AGQA 2JKZA 5AKEA 5FL7A 1OH8A 5JSUA 3IR6A 1GADO 3D54D 3UTDA 2L82A 3ER6A 3LE8A 3AO0B 4UHJA 4H3KB 4R0MA 1FFDA 2V96A 2XIQA 1E18A 1M8PA 4G0NA 3CF4G 1NSFA 4PEVA 3MMZA 3OKAA 4ZQCB 1OWLA 1GSAA 1UQRA 3GMSA 1GVNB 2WJJA 4IH9A 4N12A 5CX1B 3LT1A 5F1OA 1G9XA 3EGOA 2QAGA 3M6LA 1M2KA 4K9RA 4F11A 2Q3FA 4FYXA 4DWWA 5C7IO 4JU8A 2PZAA 3E3MA 1U3VA 3RF6A 4NYJQ 1HFJA 1E3TA 1W6UA 4IVQA 1FSFA 4KTTE 4NQRA 5BWNA 2UUBB 1EFVB 1B0AA 1ODSA 2FZ5A 2XYQA 5JHHB 2QM8A 1QE3A 1PVOA 1QFSA 3QYFA 4MV4A 1GZVA 4E03A 4FLMA 1LVUA 1OWOA 1ZGBA 3L40A 4OO3A 3O47A 3ZU4A 2CLCX 5JO0A 4BO7A 2GOYA 3B6KA 4F6CA 4QOHA 4UTXA 4YDSA 1DTWA 1Q0QA 1WQ1R 3ML1A 4QDJA 2XF8A 5FOSA 1KJYA 4J0DA 4KWHA 2BTQA 1UWKA 4R1OA 3OCXA 2WHYA 3TIFA 4BFVA 1TXGA 1DT3A 3EOBI 1ZP6A 1WZ2A 5HJ5A 4O63O 4ZZ0A 4IVRA 1IZ9A 4EIWA 1CX9B 2BHSA 3ENNA 4NCKA 1C0LA 1HO3A 3UMYA 5DGDA 1D1PA 4F4CA 5KWSA 2GHQA 1OUMA 4A0SA 1YFJA 1YB2A 2CFCA 5D6NA 4OCZA 1I2BA 1RRGA 3DNPA 4OXNA 4MYHA 4PO8A 3AVYA 3LFUA 1YCDA 4H59A 2CSXA 3IPRA 3JQGB 5F7XA 1A76A 1P9LA 5LP1A 1C7RA 2UYOA 1E5TA 2QYSA 2YIJA 4JI4B 5FBLB 4MV6A 2G07A 1F4LA 2ORWA 2P8SA 1NY6A 2XHEA 3D2BA 3GQBB 3IQIX 1IHPA 4HDMB 5E4TA 1E2IA 3DZCA 3EPRA 1JLLB 4J7CA 2XUIA 1UZUA 3KWLA 1QYVA 1D9ZA 1F38A 1E1MA 2C7OA 4DMLA 2B78A 5GV8A 4D82A 1SBQA 2YFYA 1WIWA 2FI1A 3RROA 1R9NA 4CUKA 3K20A 4F12A 1J2YA 2QN9A 2V6BA 3VO1A 2XE8A 4MS3B 3K0EA 5EWMA 3MD0A 1DC6A 5KNCH 1SCKA 1TC2A 2Q6TA 3TWOA 2HX1A 3E84A 1O5IA 3R0QA 5FPPA 1IQPA 4M6WB 4M0EA 2UZ1B 3M5WA 2Z6AA 2BFCB 1KFBB 2F55A 1HLFA 1VBNA 1Z33A 2W2MA 4MW1A 5BORA 3IDZA 4MHTA 2FRDC 4RKEA 2JC3A 2PT7A 4OK3A 4MI1A 4S1OA 5DZSA 2WMOB 5EJAA 1ZUIA 2BGJA 1NV8A 2OD2A 3P0HA 4MW0A 2HAEA 3L9WA 3SIRA 4OTZA 2WTBA 4Z9BA 3WIOA 2OLEA 2NNWB 3P20A 2C7VA 3EQ6A 3NHSA 2FUEA 4ALIA 5IDWA 3KVVA 3PPVA 1EUDA 5CYPA 2WDPA 1ZS9A 4A91A 1EESA 5GONF 4XVQA 4G1EB 2ACEA 2DBRA 3WGGA 5BOSA 1N8TA 4M7WA 1IUOA 1BE6A 1NQOA 1THGA 4NP6A 5DIFA 5F7JA 2BFPA 1BSVA 4EWLA 1OLXB 1UZNA 3USES 2OHXA 3T9EA 2OPBA 3FM9A 1U0EA 4LDZA 5K8CA 4TVOA 2EX1A 4DIOA 2UDPA 2LWIA 3CUVA 4JT8A 2QTRA 1ESCA 3MW8A 3ZE7A 2DM6A 2JANA 4GLBA 1UMBB 1HTTA 3E9YA 1IG0A 2VTBA 2PX2A 4TKVB 4UUNA 1NJ8A 4M98A 2NX2A 5EQJB 4FZ5A 4XJVA 2Y9PB 4AJEA 3ICVA 4BNVA 1GTSA 1YVPA 2I5PO 2YXBA 1XVIA 3JARA 3PR1A 1LWOA 2YR0A 2HU5A 1JJIA 4G1BA 5CVJA 4H31A 4IINA 4RZXA 2IU3A 3MFQA 1BROA 3OPMA 3I04M 4YMUA 1RJDA 2CMKA 4Q1FA 3F8SA 1U8ZA 3RTEA 3KB1A 4TZ0A 2GCNA 2VUIB 3IR7A 2X1MA 4X24A 3WBKA 4KRXA 4MIOA 1ESEA 1Q0HA 1G64A 1B73A 3P9QA 4MGZR 4YWHA 1T3TA 2GASA 3E05A 1J49A 2DUJA 2PSHA 2VEOA 3FPGA 4IDEA 4DG5A 1GG8A 3U9LA 4MDFA 1R10A 3CYFA 5GOTA 5C34B 3Q2KA 4QEZA 1GJRA 3FPFA 5LUAA 2WNIA 1BWRA 1I7PA 1LI4A 1PW5A 5FRDA 2XCSB 2WTUA 4YO8A 2VZ9A 3OT4A 2WFLB 3OF2A 5JD5A 3X2EA 4HDCA 4YRKA 1W52X 3PTZA 4FGZA 4RGVA 3KYDA 4ZT2A 3DUFA 1JFTA 4E6PA 1JDBB 1N1GA 1IJEA 2IPAB 1XEFA 2C0QA 2ZANA 4RESA 1JZSA 5EHXA 2UVDA 2B9VA 3RSQA 4EM6A 4RTQA 4OXRA 4K2AA 3LHKA 1W4RA 2AEMA 4MQEA 4XD7D 5FUWA 3TX2A 4URHA 5KHLB 1H9AA 4EPXA 2RC6A 3DDCA 1V7CA 3NDPA