3NNSA

Bef3 activated drrb receiver domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
b'MMWKIAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEAFHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA BINDING RESPONSE REGULATOR B
molecule tags Dna binding protein
source organism Thermotoga maritima
publication title Regulation of response regulator autophosphorylation through interdomain contacts.
pubmed doi rcsb
total genus 42
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nnsA00
2YHBA 4EYOA 1F51E 1NATA 2FXIA 1FSPA 1QKKA 2I6FA 2QU7A 3H1FA 3CHYA 2KYRA 2H3HA 2JB9A 1ZDMA 4W5QA 4NCAA 3I45A 3A3KA 2PUEA 3OM0A 2FN9A 3N0WA 1USKA 1DP4A 3OMXA 3HJFA 4RK4A 1S8NA 3LUFA 4MS1A 5FWYB 4JASB 3LUHA 1QQAA 5KQGA 1PEAA 1Z18A 3KTOA 2FQYA 3TO5A 4E7OA 1ZITA 3R0JA 3MIZA 1P6QA 1JHZA 4MAAA 1QP4A 5KWSA 1AB6A 2FMFA 4FB4A 1VRVA 3OM1A 4MS3B 3IDOA 3EGCA 3N0RA 2FKAA 1FFGA 5IBQA 4W5RA 3LUKA 1VLZA 3C6QA 3K9CA 3K4HA 4YRZA 2E4UA 3VNBA 3RVRA 1ISRA 1JX6A 2PUDA 1DCMA 2TMYA 1DZ3A 5HQJA 3QLVC 4N03A 3OLYA 3CG4A 1EAYA 3LUAA 3UK0A 2RJOA 3EULA 2ID7A 3LUCA 3C97A 2WJAA 3LKVA 4JP1A 2WRZA 4G86A 5TQ2A 4LZLA 4O1IA 1VKRA 3H75A 5HM6A 1EWVA 2PJUA 2CHEA 4LX8A 4MLCA 4MYRA 5TPZA 4ZYLA 1EFAA 3H1GA 3QEMB 1RXIA 3LUJA 4PICA 1Z15A 1NTRA 2JBAA 4HNSA 3H5OA 3Q7RA 1ZY2A 2PE5A 3DLBA 2MSKA 5JNRA 2CHFA 3EODA 2JVKA 3HDVA 2MSWA 4Z9BA 4EYQA 4G0ZA 2H0AA 4LRQA 1DRJA 3FFXA 3FFWA 4MS4B 3BRQA 3BBLA 1USIA 3VNAA 4OG2A 3F6CA 1E6MA 3MM4A 3N75A 3GBVA 3HV2A 2MSLA 1SRRA 2AYXA 3H6HA 1YMVA 2NZVG 2MYTA 4P98A 4RWEA 2XDYA 1QO0D 3A0UA 4GPAA 4Z99A 1ZN2A 2PL9A 3KYJB 3OLWA 5KQMA 4KPYA 4ZMSA 4MQEA 3FDFA 1PUXA 1I3CA 1FQWA 2GKGA 3EQZA 2FLWA 3QLUC 2X7XA 4D6YA 1TLFA 3H5WA 3IP9A 1F4VA 4L85A 4JOQA 4FE4A 3RH0A 4Z4FA 4IGAA 4OTZA 3OLVA 3GBPA 4QPJC 1DCFA 2IKSA 4D6XA 1DCKA 1JL3A 2NZUG 5EWLB 3H5LA 1ZH2A 3EAFA 3HDGA 1TJYA 4KQ9A 3KJXA 2LP4Y 1GUDA 1H9CA 2PMCA 3CG0A 1NXXA 4Q6BA 5F64A 2JCGA 2NUBA 2QVCA 4MLDA 5B3JA 4KFCA 4W5OA 2E4WA 2FSPA 4D74A 2PUCA 2RGYA 3H5VA 2HPHA 4MR7A 1E6LA 1ZGGA 1W25A 3JVIA 3M6MD 3TD9A 4RKQA 1QNLA 4IMIB 3IP7A 3SNKA 4KREA 5FWXB 3HXMA 5FWYA 1OXBB 4H3HB 2PUFA 2FQWA 1U2PA 2JBAB 3KSMA 3LUGA 5KC8A 4S05A 5FBHA 4B09A 3L6UA 1B00A 1D5WA 5KQPA 1RXEA 1CYEA 4TLLB 3NNDA 1NXPA 5TQ0B 3HK2A 3IPCA 2JVIA 3H1EA 3Q41A 1JYFA 4MR8A 3QLTA 4LE1A 5ABPA 2LUOA 4MQFA 4QYMA 3SQNA 4IRXA 2ZAYA 4IF4A 2WMYA 1DG9A 4MPTA 3CZ5A 3JY6A 2B1JA 1MB3A 1LJLA 1BAPA 3I5AA 4WUTA 3HM9A 3O2JA 2VYCA 1U0SY 2WWVD 2OENG 3TB6A 1DBWA 3QLVA 4XAQA 2RDMA 2FMHA 1LK0A 2V0NA 4LE0A 1WETA 5CNIA 3BILA 3O1HB 4KZKA 3HZHA 5C5CA 4RZSA 4XASA 3OQMA 1QP0A 1TM2A 4M88A 3OQNA 1NXTA 1D1PA 2MYUA 1YK0A 4ZPJA 4MRMB 4F8JA 4RXMA 2PUBA 3CS3A 1W9HA 5CNKA 2HJ9A 1P2FA 1QPZA 3GV0A 3I42A 4HNQA 4EVQA 4YR7A 3OLXA 1BDHA 1RZRA 4KVFA 4OATA 1XHFA 3E61A 4W5TA 1Z2EA 4XLTA 4OLAA 5DTEA 3LUDA 4RKRA 5KI6A 1PEYA 1HEYA 3A10A 4PE5B 5TE9A 4N76A 3F6PA 4OLBA 1IIBA 3JPWA 1TVMA 3L49A 3BRSA 3CU5A 2JK1A 2M1ZA 1NXVA 2PKXA 5T7BA 1NXSA 3EQ2A 2QVGA 3H6GA 3JTEA 1Z25A 1DRKA 1JLKA 2IDMA 3QLUA 3GL9A 3GT7A 4RXTA 1JFSA 4MQFB 1M5UA 2FVYA 2VK2A 4Q7EA 1USGA 1DC8A 2FEWB 1RNLA 1URPA 4ML3A 3DLHA 6ABPA 3T6KA 4ETMA 2AYZA 4LE2A 4P1ZA 2R48A 4KQCA 4Q6WA 1JH9A 5BR1A 4F12A 3HVRA 2PAFA 1CEYA 3Q9SA 4F06A 3D02A 1SD5A 1YVUA 3D8UA 3BREA 4G0OA 3DGFC 3HO1A 1KRXA 3SM9A 4RK1A 3LKBA 3FFTA 1K66A 2R47A 1SXGA 1YIOA 3OLZA 3IP6A 1T34A 2WJWA 3GWGA 4MQEB 2WY2D 2VUIB 1ZESA 2LBPA 1DBPA 2FTKE 2E4ZA 5ED4A 3RVMA 4RK7A 3LTEA 2MYNA 5E3JA 1NXWA 2HQOA 3JVDA 1XHEA 3G1WA 5IC5A 1ZAYA 5EWLA 3O2SB 3URMA 3T38A 4DADA 1P8AA 2R4QA 1BA2A 5BQ3A 7ABPA 2IPAB 5TQ0A 2B4AA 1ABFA 1K68A 2QZJA 3S99A 1D2AA 4MS4A 4MS3A 4YS6A 4RY8A 1ABEA 2J48A 4HNRA 3KHTA 1RZRD 1NY5A 1L5ZA 2FW0A 4WXEA 5CHYA 1P6UA 5DLEA 2L2QA 3C3WA 2NT4A 2A9RA 2YHAA 3CRNA 5EWMA 4KNYA 1LJUA 3HEBA 3CNBA 3Q7TA 2W42A 4YP9A 1PNRA 1C4WA 1JWLA 1EWTA 1ZGZA 3GYBA 5D2CA 2LIVA 1R8JA 4NCBA 2BGGA 4MS1B 2FMIA 5BRAA 1CHNA 1M5TA 3QK7A 1JYEA 5EWJA 3QX8A 3NNNA 3CTPA 2FLKA 3E3MA 4KMRA 1JDNA 3M9WA 3CZCA 4QICA 5TQ2B 3RVJA 2QR3A 1JFVA 2GWRA 3O2QB 4KK4A 4Z4CA 4TLMB 4G0QA 3O21A 2DRIA 3C3MA 1GCAA 3N0XA 3O1IC 1MAVA 1D4ZA 4EY3A 1LBHA 2A9PA 1QQBA 3F7NA 1A0OA 1Z26A 3O74A 3QEKA 4LDZA 5B3JC 4F3TA 3MF4A 4PYRA 3FGZA 3JPYA 5DKFA 3LFTA 5IUKC 4WZZA 1TMYA 1JFTA 3M9XA 3HUTA 4JB0A 1A04A 1SXIA 4EUKA 2IPLA 1DBQA 3G85A 3KLNA 3KS9A 1M2FA 3NHMA 4MR9A 2NT3A 4NICA 3H5IA 1OXKB 4EGSA 4UHJA 1Z13A 2GX6A 1VPWA 2L17A 4JB2A 3OQOA 1U04A 3GRCA 2Q5CA 3O1JC 4YCSA 3KLOA 3UKJA 3KKEA 3DZDA 5C5EA 4N41A 4H60A 4L4UA 4KRFA 1GCGA 4EYGA 1FFSA 2QV0A 4Z9AA 3B2NA 5CNJA 1Y1LA 5HKOA 2PUAA 1GLGA 2ID9A 3NHZA 5IUJC 4Z4GA 4MRMA 5FBKA 5IX8A 1KMIY 3KCNA 4DQDA 3MYYA 4TMYA 5BRJA 4WXMA 1Z16A 1YS7A 4CBVA 2L19A 2A9OA 3NNSA 3QELA 3TMYA 1GUBA 3O75A 2PL1A 5KC9A 4RS3A 1E2BA 4W5NA 4G0XA 3N6VA 4XARA 4E7PA 4MR9B 5TQJA 3ILYA 4XXHA 3MA0A 4PEVA 5IULC 5EWMB 2RJNA 5FWXA 2R25B 3NBMA 4G0PA 5TPWA 2FQXA 1ZHHA 5DGCA 4Z4HA 1DJMA 8ABPA 4MR7B 1YTUA 2E4YA 3KG2A 2A9QA 3ROTA 5I4CA 4NQRA 4YGXB 1Z2DA 1D1QA 2E4XA 3RVNA 5IEJA 2E4VA 3N53A 4Z4EA 2F8TA 4RK6A 1RPJA 2FEKA 2GI4A 1MVOA 4MR8B 3HUUA 1E6KA 3MMNA 5IUNC 1M2EA 3DBIA 4PZ0A 4YV7A 4Y9TA 3SG0A 3RVPA 1DC7A 3LMKA 1Z17A 4LDAA 5CNMA 5PNTA 3RVQA 4ETIA 4JA2A 1BDJA 1AB5A 4UHKA 4YO7A 3RVSA 3SAJA 5JNTA 3N8IA 5KQLA 1BVHA 2GBPA 1YMUA 4OBBA 4EYKA 1J56A 3MQ4A 4EVSA 1NXOA 2F8SA 4RY0A 3IP5A 2QXYA 3KYIB 4GNRA 1Z12A 3HCWA 1APBA 2QW1A 3CLKA 5JS1A 1KRWA 4RY9A 3RVLA 1U8TA 4IMJB 4MGEA 3RVOA 1MB0A 1U2QA 3P9YA 2HQBA 2HSGA 1YK1A 1PNTA 3HSYA 4ETNA 2IPMA 2JRLA 2P4UA 5DCLA 4EVRA 4RU1A 1MIHA 1ISSA 4RXUA 4RK0A 3OMWA 4WWHA 1QMPA 1XWWA 1ZH4A 3GA5A 1A2OA 2HQRA 2PLNA 4KK3A 3QEMA 4YWHA 4N47A 5JNSA 3F73A 1C0EA 1LBIA 2IPNA 3JS5A 3RVKA 4DN6A 4F11A 1QP7A 4Z4IA 2FN8A 3FMVA 4FE7A 1L5YA 4XFKA 1KGSA 4O5AA 4G0YA 3EDCA 3Q15C 3T95A 2QSJA 3ILHA 3IPAA 1BDIA 5T3YA 3CFYA 3ROFA 4ZJPA 5JNWA 4NV3A 3H5TA 5GOTA 2WB4A 2LPMA 4YLEA 2PUGA 4N0QA 3UUGA 4IILA 4RV5A 3QX9A 2FMKA 3EJWA 4RDCA 4Z0NA 2JVJA 5IEBA 2P9HA 4N0PA 5TPWB 4JAVC 1FFWA 2OQRA 3T8YA 9ABPA 4G0MA 4RK5A 4H3KB 3CKMA 3A0RB 4WT7A 2IOYA 5EWJB 1QO0A 2VUHB 1JBEA 1YS6A 6CHYA 4KV7A 3C3KA 5TPZD 2FEPA 4O1HA 4TN5A 3W9SA 3DGEC 1UDRA 1ZVVA 1JDPA 2N9UA 5GQSA 2M98A 4RSMA 2IYNA 2L18A 1PHRA 2O20A 4HYEA 5JS2A 3RQIA 5HSGA 2CWDA 3I09A 5JNVA 4G97A 2MYPA 3SY8A 4S04A 4ZMRA 3LOPA 2ZWMA 3OO0A 3QELB 3Q7SA 1EHCA 4QYWA 3TX6A 5JNUA 1JF8A 2CD7A 1EWKA 1SXHA 3OO1A 3HS3A
chains in the Genus database with same CATH superfamily
1FYXA 3E7DA 2QENA 2CJFA 3I2GA 2VWQA 1Q7BA 1A4XA 1P9NA 2O4CA 1ODSA 3FCEA 3AUYA 3G9TA 4KIJA 4O63O 5DHSA 2NLOA 3RBVA 1HLFA 2O23A 4F2GA 1Z7EA 3A3KA 2I6UA 4FFRA 1E3JA 1F0NA 4ZJYA 1SD1A 2ZREA 2CF6A 5DYGA 4F5EA 1SVUA 4CR7A 1XYGA 1U3UA 1BJTA 1S8NA 1D9XA 5K3DA 1B23P 3UPTA 2E48A 1YRAA 1KEUA 4M7RA 4BTLA 4RTPA 2GK7A 4M1TA 1E8DA 2W11A 1X1AA 3PNPA 1NW4A 1J0XO 1AB6A 4D0LB 4LGMA 3VZRA 3AIKA 3LLVA 3MTJA 4QGFA 5DN6D 1AK2A 2W2MA 3PX2A 4CKCB 2XZOA 3N0RA 4XE5A 1ILEA 1LX6A 3BZUA 2C8VA 3D4OA 1QTQA 2WQZA 3K73O 3ELUA 3ENVA 3LUKA 4AJ1A 2O3SA 3B1WA 4V0KA 1QZZA 5EY5B 4Z7NB 4XR9A 3SZMA 2O06A 3QBJA 4HYYA 4NZZA 5EKSA 1G5TA 3TPZA 5CA1B 3PQ8A 2PPLA 1P18A 1ISRA 1QKJA 2VNJA 1DZ3A 4ISBA 4PSUA 4R2MA 1AKTA 4CI0B 4RA6B 1XZCA 2UVPA 2A9FA 3F46A 3LA8A 1TCCA 3TE7A 1W5AA 1PUJA 3MFYA 3OBBA 1T8UA 3DUFB 3C97A 3H0CA 3KPUA 2X9GA 4ILEA 4KODA 2V8OA 3WMFA 1MNQA 4R2XA 2VHXA 4EABA 4MVJG 2O3RA 4RHXA 2QQFA 4AL4A 1PFUA 1KMNA 3R77A 4DWVA 2ILVA 2JLSA 3FD8A 1M2VB 2QVYX 1IY1A 4F4HA 2R1ZA 3T5TA 4QFMA 1QCCA 1SHLA 1KFJB 3GUUA 1YO6A 1A4UA 1DJQA 2WUWE 4NK4A 2RH8A 4ZZ0A 2PZEA 2OPHA 1RKUA 1H0HA 1EVYA 2WD9A 3FXAA 2PDAA 4MITA 4UFPA 1CP2A 1O95C 3N2GB 5FD8A 3REFA 2P5YA 6GPBA 1O94C 2QUHA 1RWBA 2QZ4A 3QFFA 2YIJA 2C4KA 1E1CA 3OWXA 4KXNA 4XUGB 3RROA 4YMVA 4CE6A 3RBZA 4PNPA 1WDKA 4JUFA 1K63A 4WJLA 3AX6A 5AM4A 2OORA 1ULZA 3P32A 2OCIA 4PYQA 4RWEA 3CBQA 1LB1B 3BX1A 1XMPA 1ZFNA 1NNUA 3Q2OA 2QLTA 2Q6OA 4LDNA 5LZ5A 3S2GA 3HPQA 2FP4B 3C7TA 3IUPA 4N65A 4MQMA 5G0WA 2ETXA 1XTUA 1KSGA 4Z9XA 3W2GA 3EPJA 4JT2A 1YZHA 2BMFA 2VP5A 2YMPA 3H65A 3KWJA 4D79A 5EJ7A 5G2OA 1RAFA 4RHUA 5KJ6A 2ZRGA 3TXYA 3IP9A 4A27A 1QUFA 3D5QA 3W5DA 1IBCA 2YW9A 4HADA 4PLTA 1CR4A 4QODA 2XWBF 1X86B 3D7LA 2HWUA 3MJFA 4BZWA 2JGEA 1E6EA 3JX9A 3K30A 2G83A 2ETVA 4IH1A 4RZ3A 1OB2A 3G2LA 1F4PA 2RBKA 5LA6B 3KLPX 2XE4A 2JBHA 1BEZA 1ZJZA 3AHCA 5J59A 2OXIA 5I7OA 2BW0A 4H1HA 2ZRAA 1EESA 1P2BA 2XB2A 2EJVA 1B16A 1G5IA 1J2YA 1KP2A 1LX7A 4OH7A 2VT7A 4YRPA 5K3EA 1GPH1 3BKXA 2QVXX 3JZFA 4I3GA 2ZQYA 4N6NA 5ECWA 3FTEA 2W2KB 1WPXA 4Q9AA 3BGIA 3BD7A 3L04A 1WMBA 2V9PA 4G5RA 3CX7A 1U0JA 1H0RA 4MUBA 1RYHA 1DINA 2RHHA 2JBAB 1GTVA 2WV9A 2PBFA 2WSSA 3D6FA 2VF7A 3M1LA 5IAAA 4M8IA 3X2SA 4DM4A 4DMHA 9LDBA 3O84A 1JIIA 3QVLA 4G1CA 4Q3OA 1USUA 4JODA 1JA0A 2ZYSA 5LR6A 3HK2A 1OYOA 2EOAA 1E2HA 5F5NA 5IJZA 3ICCA 5BOVA 4JLAA 2JH3A 4A3SA 4L0DA 2R8YA 5I01A 2IZ0A 1TO1E 4F9GA 1F4LA 4JCCA 1A8PA 2AN5A 1BAPA 2FDRA 1K75A 2P5TB 2X5JO 1QE0A 5KX5B 3DCIA 3Q11A 4U7FA 3FCOA 3WKCA 4QGSA 2X4DA 4U2EA 4TL7A 1YOBA 1H2FA 1OI7A 2OENG 4PN3A 3ZBQA 1NASA 1YZ3A 3MTEA 1BDMA 4BKOA 3W1EA 3L7DA 4EHHA 1NUUA 4LZZA 4RQTA 4X95A 1P91A 2PUJA 1L4KA 2ZJBA 3V00A 2DHQA 3PC6A 3N2EA 4UM5A 1IBKB 1KO5A 4F0JA 2AMYA 4FN4A 4TXNA 5REQA 4BZQA 4Y6QA 5C4MA 4YX9A 3KHUA 1BH2A 3KQYA 3K9FC 1G7SA 2WM3A 2VF4X 3TZ6A 2CXSA 1QYDA 4X6UA 2QNBA 2BJHA 1XLVA 2PUBA 3AL2A 1ZIXA 3RSLA 5BP7A 2A9JA 5CNKA 2W83A 4ZI3A 2O5RA 2G09A 2C2WA 2H48A 2GK4A 3AUXA 2XQVA 1UBEA 1NF3A 5BSGA 1WUHS 3ZHXA 3BIOA 1PSDA 4L74A 3JVEA 3MT8A 1YC2A 2C9CA 2HNAA 3R6GA 4AJ9A 5EHZA 5B36A 5FUMA 5KNCH 1BN7A 2D5IA 1RQLA 4HNAB 2CGEA 3OLCX 3CEAA 2K7ZA 3OY2A 2JIBA 4BVBA 5GGYA 3IR7A 5T4BA 3EH2A 4CTOA 3F6PA 1T6BY 1KDOA 5K45A 1A7JA 3R6DA 4CF6A 1QHHB 1RBZA 3U7JA 1T35A 3O8QA 4CMGA 2A1TS 2ZS8A 3EC1A 3AOGA 5SYAA 1X1CA 3GT7A 3RAPR 1TVCA 4PZDA 1KMHA 3UF0A 3M81A 3T7JA 2VDJA 3ZR4B 4MAMA 1T3ZA 3ZWBA 3TGPA 4GM1A 2VYNA 3KVNA 3CVVA 4QFDA 4KQIA 2NUTB 1KERA 5K8LA 1N2OA 4HWKA 1EU1A 3T6KA 2ANCA 4LZOA 5C9ZA 3JQ8B 4REMA 4P1ZA 3ANMA 1GTMA 4F2DA 4KQCA 4ZHQA 3QX3A 1JP7A 2KHZA 2AB0A 3BWBA 5JHHB 2DPXA 4TTTS 2PS9A 3FMGA 4OI2A 5CH3A 3MEQA 4BQFA 3HVKA 1HR0B 1U28A 3OP4A 4LS3A 1H3NA 1XUOA 1MG5A 3OQIB 2Q7XA 4BO5A 4G23A 4RK1A 3A1UA 2DQZA 3LKBA 3VPXA 1ZOOA 3BA1A 2C3YA 1S2LA 2BHRA 3GWGA 3W77A 3WQSB 2OV6A 2KLHA 4EZEA 2ZW9A 3GNQA 1NSTA 1R6AA 4Y1GA 2CY0A 1K0UA 2JJ1A 3K5WA 3UCXA 5IKMA 4BFWA 3M9LA 1O6BA 3IAHA 5M34A 5H82A 5FBQB 3L84A 4NATA 4GP9A 3ZHTA 1C0KA 1DG1G 3O2SB 4F9TA 4ER5A 4NHOA 4AY5A 4DWWA 1PT6A 1U3TA 3N3AC 2DECA 3HFJA 3HDYA 1GZ3A 1G2PA 4LYHA 5HFNA 3WLFA 4RUKA 3COPA 3R7WA 3E9ZA 1GGMA 2YMQA 4RIEA 3A9TA 2E4AA 2I2BA 1IVYA 3QTLA 4GPD1 4Y2SA 3GRKA 4GRIA 4NJOA 2HU5A 2YHSA 3CMCO 4RAOA 4RD2A 5CHYA 2FSHA 5FLYA 1K86A 4FD3A 4WI1A 3OQPA 2FN3A 5EZ6B 5E9QA 1X9HA 3BMQA 5L3RA 4TTPA 3ZQ6A 1A5BB 1YCDA 4YP9A 5IVKA 4BN5A 3ZQKA 4FGKA 1EWTA 3OC6A 5D2CA 3TW0A 1RW4A 1VKNA 3IJEB 1XR3A 2PQMA 2ZR0A 2VBCA 3C5EA 3VPSA 2FMIA 4CF4A 1D3AA 1K3FA 4A0HA 1C8LA 2GEDA 2ZRJA 3CTPA 4KMRA 4MV0A 3BDVA 4K6CA 5EYPB 5SICE 4WNIA 2PJZA 5KO2A 4HCJA 4NMXB 2VYFA 4QJ3A 3GMIA 1AQLA 3UTDA 2DRIA 3KPJA 4RM2A 3KHSA 1MOPA 5F1OA 3S1AB 5FCDA 3UEOA 3WGOA 3AP1A 4HFNA 4H0FA 1A9YA 1IWOA 1Z4NA 4N3NA 1NZFA 2VYND 4MROA 4YK7A 3KJHA 1I32A 5KB3A 3ZHVA 2IYPA 1WY5A 4UE6A 3AIIA 3TD6A 4JC8A 4ZYYA 4EWLA 4WL0A 4F3TA 1P45A 1ND6A 3E5HA 1J2TA 2BZSA 3F7TA 5HVNA 1WZ2A 1C4OA 2XNSA 3GUVA 4MI1A 4NOKA 5AMXA 1U9IC 3PNBA 2GSDA 4INOA 4LWZA 3V5NA 3VR2A 4BQOA 1VRCA 2BFNA 4K40A 3ZIAA 5HNKA 4I50B 4WSOA 1WSAA 4QBKA 2GHQA 3KS9A 5B55A 4MEJA 4EJSB 1OFIA 4IDNA 3ZGYA 3FN4A 2I8CA 3GJTA 1D4FA 1Z13A 2AJLI 1SC6A 2MSNA 2OC4A 3ZG6A 1CFJA 4HMOA 4DG9A 1VMDA 3O1JC 4MDYA 2H8GA 5B58T 3MW8A 5CITA 3JWEA 4IFIA 4N41A 3PHJA 1GLVA 1GCGA 3DG9A 3FBWA 4P4NA 1MZVA 1FFEA 2ID9A 1VPDA 3NHZA 3IBGA 3U56A 4Z4GA 2Y3IA 5BW5A 3PGKA 2RFLA 1YQUA 5EOVA 5A2QA 3O8DA 4DCJA 1Y89A 4TMYA 4AU1A 4II7A 4NV1A 1FRFS 3BSFA 4G25A 3ZI7A 3OT5A 1EZ4A 5JSYA 4FFOA 3RFTA 4Q7JB 3O75A 3TW8B 4RS3A 4Z1OA 1AM4D 1NKTA 1VIVA 1R4ZA 3KKZA 2P1RA 3RRYA 4FIDA 4BP9A 4C20A 2PRSA 4RLHA 1SG0A 3GQVA 5T4HA 2H51A 3WP0A 2IXFA 1LQTA 2RJNA 4EJ2A 1OIVA 3RYIB 4V1CA 3WTCA 5JYBA 2OL4A 5CYOA 2CFTA 2VDQB 2G5CA 3R7BA 1EVEA 1UBHS 1MH9A 3D0OA 4L4ZA 1DIBA 4U7HA 1REQA 5FHQA 1A5TA 3IQFA 4LJ9A 4DTIA 3NDPA 4BECA 3W8RA 4ZC8A 4D82A 1LV8A 1R0BA 2DERA 4V0ME 1JRLA 4O2AA 1W6UA 2J9GA 4GOLD 1E1QA 3AHFA 4DGQA 1UOPA 5IARA 2PUWA 2A7QA 2D2VA 2IYRA 2PS0A 2I6XA 4MMZB 1D0VA 2BZGA 5ERXA 4Y9DA 3U17A 3MLAA 2RC5A 2O2HA 3R7SA 3SAJA 2I4MA 3IQIX 1KSJA 4WDRA 4RFSA 4WADA 1F8FA 3IQWA 1AKMA 3LI2A 4JU9A 2OUIA 4NJMB 4QHYA 1SOUA 1FE8A 1BCRB 3O4GA 4EEXA 5J4HA 5EMJA 1U7UA 4Z51A 4H1WA 1OX4A 4EY4A 1XWFA 1TEZA 3BXGA 1AN9A 3EPPA 4C0HA 2P30A 3TIIA 1U8TA 3I23A 3NYIA 1I0ZA 4CM7A 1W44A 3QE4A 1XDSA 3AB8A 1IJKA 2Q21A 1O9GA 1U2QA 1XQ9A 3WGUA 4W9NC 3LD9A 3P27A 2AWOA 4MVXA 3FR7A 3GARA 1LLDA 3BG5A 4WN9A 4B8YA 4ZGBA 1H5NA 1NRXA 2J5RA 2Y0EA 4LSWA 4RU1A 1AURA 4JEUA 4EVRA 3SEZA 2O0KA 1HZJA 1UJBA 2H1IA 2OCKA 3G2IA 3LQKA 5F77A 4F92B 2AFHB 3WQQA 1Y4SA 1DOAA 2HQRA 2JHCA 3ED1A 1E3QA 3C87A 4TL8A 4NFHA 3HLYA 3KZNA 3INNA 4B79A 2XPCA 4MPRA 1NVFA 2PKWA 4MNTA 2HU2A 5FWDA 5A4DA 3OZXA 1Q92A 3OQ6A 1YZVA 2XMCA 1U3WA 3BIWA 3D1LA 4N1AA 1L5YA 3DAOA 1XZHA 3QSGA 1KMMA 4MINA 1QS0A 3VHXB 1RYZA 1DTWA 4G0YA 2YFKA 2H8KA 2R8XA 5MN4A 3NCTA 1KYIA 2XBLA 1BS1A 1RXYA 4WAUA 5TF4A 4BXOB 4MQBA 1ZA1A 3EWIA 3V1TC 4EA7A 6ADHA 2QTCA 3N8HA 4G1EB 3N2KA 1L7XA 1NW6A 1XZJA 4MTCA 1SQ5A 3HDJA 1X7ZA 4MP8A 7YASA 4FDAA 2AXQA 1FSGA 1ZD8A 5T41A 2Q1UA 5FTWA 5HS4A 2GLUA 3GFFA 4XIYA 2EZ8A 1VL5A 1FFWA 3CB2A 4KYVA 4ENUA 3EQ8A 5DI3A 5ALLA 3RT9A 2JLUA 1XNGA 1ZJ6A 3FTCA 3ORYA 4YJ3A 5I9MA 3H3JA 2O2XA 3IA7A 3JYOA 4P7FA 4CIBA 2ONYA 4BFLA 1QRUA 1JSCA 1T9GS 2A94A 4BYMA 3TCNA 5TPZD 3DO8A 1XMOB 3GFPA 1KDRA 4CCYA 4E4RA 3QKWA 1CEQA 4OGGA 5HXAA 4R3WA 1RD4A 2J4DA 4MCJA 1E3TA 1VYTA 3RQIA 3A4TA 1HO3A 4S0ZA 5F3DA 2JFPA 5JNVA 2Q07A 4QG7A 1UBMS 3W5JA 1XN4A 2RHOA 5IKPA 1BN6A 5ICGA 2IYTA 2QX8A 1P2TA 3DE4X 4PHTA 4BJ6A 2X19A 4KO4S 2DFTA 5JANA 1XFAA 3K96A 3WQBA 4XPIB 5DGXA 1I2CA 1KYVA 3BZWA 3HS3A 5DNAA 2EERA 4D1YA 3JAMA 2QRVA 4UNQA 5FR1A 2OXEA 2PH7A 2Q8PA 1MAHA 2G07A 4GMKA 5DTJA 4OGFA 5TVKA 5C7OO 3QI2A 4XJSA 1BH6A 3Q0TA 3NVMB 4XPIA 2WJ3A 4O02B 3U1BA 1GZVA 4PXYA 3ETNA 4HFJA 2FZCA 2HLNA 1YCHA 2DQSA 1FNCA 3AIOA 1I6WA 1RAGA 3DP7A 1B8VA 1J23A 3JATA 4GRDA 1V0JA 3LHKA 3VH2A 4N01A 3ZNNA 1ZGBA 4IVRA 2QWXA 1VKOA 1M6VB 2A86A 4J4HA 4FUTA 4UASA 4G0VA 1QAOA 5JDCA 3U4QA 3PVZA 2QYOA 1GTL1 3U4GA 1IVNA 2SCUA 5EP4A 2AR0A 1KH2A 1K4KA 1XKQA 5B4UA 4DRXB 2FP3A 3PR2B 3QW4B 5BUQA 1J4AA 4WECA 1FX1A 2ZGVA 3L8ZA 3SHTA 1RRGA 3R3JA 4YRMA 3GJ0A 1E3MA 2IS6A 2DG2A 2WKWA 3KT0A 4QDJA 2Y1DA 2Q1TA 2PYZA 4QAJA 2D4HA 3O9ZA 1E2NA 2C84A 1OH5A 3OECA 3DC2A 3CLTD 1X92A 2PQ0A 3AERB 1HDXA 4KNWA 1ZJYA 2ZRMA 1DQNA 2X0EA 1F9AA 4CM9D 2AOXA 4F3RA 4Q7LA 1A8HA 1G0NA 4YO8A 2JGNA 1RXIA 3LLSA 3C3PA 3FGPA 2EFHB 5SY4A 2UYCA 2JFZA 4BGUA 2NYRA 2G9RA 5EQDA 2RGEA 4IIFA 3LT2A 5COQA 1V4VA 4MHSA 4O4IF 3EG9A 4L95C 1UMBA 3COSA 1L3CA 3H84A 3L0ZA 2HTEA 3IV6A 1I01A 2ZANA 5FTKA 2CDRA 2ZEJA 4JU8A 5I9NA 3CW2A 1UEJA 4CTNA 1C30A 1U2EA 1PZGA 3MJVA 1JSZA 5CLFA 1Y9ZA 3RU2A 4OPMA 1E6MA 3O0DA 2XCQA 4W8GA 5HZHA 1MAWA 1WDLA 2BTQA 5TX7A 3ZY3A 4D8UA 2V1UA 2VHCA 121PA 1JU3A 1RJGA 2WJYA 3TNYA 2WTXA 4M1EA 4V0RA 1ZLXA 4MV5A 5IXJA 2XDYA 5K8TA 5FFFA 2WVGA 2V45A 2CLDX 3KCQA 4GMDA 3DWGA 5FLKA 4DYVA 1V7CA 2GHTA 3AOEC 5LN1A 4BX0A 4V0SA 3AHHA 2IU6A 1R1DA 2XRMA 3QLUC 1ADCA 3MS7A 3BIFA 1OTYA 3H5WA 3MWFA 2W6JD 1QIIA 4YIHA 2CYCA 3NRBA 4RSRA 2YJTD 1RYDA 4JZKA 4ROTA 3LXUX 2YMMA 2YR0A 4LNAA 5B37A 2DAPA 1SURA 3IKTA 3FYTA 5KPDA 1N7IA 1Z4LA 5D6NA 2JFHA 2QTRA 4F84A 5H9VA 3V7YA 1PSZA 2GPJA 2E1PA 3BL8A 1UUFA 3CONA 3T3GA 4ZTZB 3P0JA 2PD4A 4O4HB 3T5GA 4L9WA 4MIEA 2PSDA 3GP8A 3DDNA 4OP3A 4X85A 1DBRA 1ST2A 1Z35A 4BBPA 3G8CA 4PGAA 1ZC3A 4HRXA 3OPMA 3SF8A 1C3OB 3WG9A 3DL2A 2FSPA 2HMTA 4L8FA 1E7SA 1T8YA 3I8OA 1WHTA 2I6SA 5IHPA 4RHFA 1JU4A 3EIWA 3WLOA 1Z56C 3ECAA 3M6MD 1KHHA 3ANLA 3MGBA 4OA5A 5J2UF 2BF4A 4ESEA 4JQZA 4JI0B 2PXCA 5C1OA 3NPAA 5L51A 1PZFA 5HGXA 2V6BA 1M2HA 5JSUA 1D2HA 1BQ3A 1PR6A 2P9EA 1BKSB 3TH5A 4EPTA 3WGNA 5JDIC 2NU8B 3UJ3X 2A7XA 1OWPA 2WYHA 1TEHA 3C7DB 5A05A 1Q1BA 1SHKA 5HF8A 3L8GA 3OKFA 4B73A 3LX5A 5D86A 1MRNA 1T9CA 4QVGA 1S3IA 1FNMA 4EG3A 1Q21A 3RS8A 3FMFA 2XUIA 4IF4A 5DZSA 2LCQA 1EA5A 2XVAA 4TN1A 5CDFA 4DZRA 2NMVA 1VPEA 4J0HA 1XLTA 5AP9A 2AMFA 4OSPA 1NJGA 1V8ZA 1UQUA 3JRNA 4FYJA 4ZCLA 3NONA 3TLYA 3QIVA 3F90A 3I9KA 1P4JA 1UT5A 5EJIA 2I99A 3V46A 1M33A 3EZ2A 3HRKA 3HO6A 4H7HA 1JKJA 3L9XA 4TRNA 4BBZA 3FPGA 3LC0A 5A4IS 5A7FA 2EG5A 1H69A 2NNLD 5J5VA 3AKCA 2W2KA 4C7BA 1CRPA 1WOMA 1KMCA 1LK0A 2RAFA 2B2NA 3NZEA 4RW0A 1PFQA 2IKQA 2ZSDA 3NAQA 4X6XA 2H85A 4DREA 4PAWA 1B73A 4AZ0B 4PV7A 3F1LA 2F3UA 4RZSA 1QP0A 5CMLA 4IMPA 3PNKA 2ILTA 5IPFA 1KFBB 5A9SB 3G02A 4Z8YA 1RVV1 2O57A 3C7KA 4OUDB 4MHTA 2YINC 2VQ6A 3EFHA 5G1OA 3IELA 1HE1C 3IJRA 4UBLA 5KYXB 4NL4H 5GM1A 1YA6A 1K2WA 2PV7A 5IVPA 3MBIA 1RYYA 2BLNA 3EGVA 3PP8A 2R7NA 3IHLA 3BICA 2GHRA 4HEA6 1KE2A 1C0PA 3K5PA 3T4PA 1HQCA 1NHWA 1P2FA 1SKYE 4D4IA 2B8NA 3CX8A 1T2DA 4EVQA 5A3JA 4IP0A 5KYYA 1NJFA 4OAPA 1RZRA 2NVUB 3L6OO 5I47A 1QO9A 2GESA 3LC1O 4Q3KA 4Y7DA 2WUGA 3QYPA 2ZRPA 3BFKA 2ERCA 4J6FA 4QFBA 3JZAA 4JYCA 4RKRA 3ZPXA 1PFKA 3AL0C 1H66A 1PEYA 3A10A 4AS2A 1T9AA 1I2ZA 3JU3A 2ZSHA 2H7CA 3GT0A 4GPZA 1QH8A 4XCQA 3WK4A 1VHLA 5LL6P 3A6KA 5JH7A 1ZD1A 4GKVA 2JGFA 3L4SO 4PQEA 2VHJA 4BQNA 4W1SA 3BMOB 4DVJA 4E4YA 4UMDA 1P7YA 1NN5A 4OHRA 5EUCA 1UDCA 3DZHA 4CMJA 2A3NA 3OVMA 4DCTA 9ATCA 2JLYA 1G66A 1RKBA 1Q0UA 1T26A 4DRXA 4BEWA 2H7YA 2EAUA 2W6PA 1SVIA 4J1TA 3SF0A 4AKTA 3MINA 3Q8LA 4B7AA 1GRQA 3NBKA 3MMSA 1F1JA 3ABIA 5U4QA 4IDBA 2REXB 3HVRA 4PQRA 4K9LA 4JP8A 4F06A 1QJCA 1KFCB 3BCRA 3SQMA 1VCNA 4U0JA 5CM2Z 3V7NA 1IZ8A 4E30A 4UXHA 2WSLA 2P2ZA 4RDIA 1BKDR 1RSZA 3NJRA 4OFXA 4CR6A 4H3SA 1U8AA 1MG0A 5KYGA 4FP9A 5J2TA 4OYLA 4EEZA 4S2UA 2PV0A 2R47A 1YIOA 1GG8A 1M34B 1ZSVA 4F5WA 3GR6A 2YHIA 1L9KA 2DYKA 4B5LA 1FUYB 1PJ8A 2BP7A 3GGSA 5AKYA 3MTDA 2GF0A 2XF2A 3VKUA 4BN4A 8ATCA 2G1AA 3DTTA 5AKEA 1SUPA 4K46A 1FSSA 1V9SA 2ATXA 3T38A 2R4QA 2UVDA 3PQ5A 3N74A 3UMCA 1GAJA 1QB7A 5ILQA 1FVOA 4MS4A 5T4FA 3W3ZB 4I5GA 3SJ7A 3OEEA 1S01A 5IM4A 2SCUB 2ISCA 1NM5C 1NY5A 3ONFA 1NVXQ 3BWMA 1UBSB 3GGGA 3P4XA 2XBUA 4GPEA 1U4NA 2YJ5A 3FZYA 4E5VA 1UFOA 3S7TA 5T8KA 4YXFA 4G3XA 1G60A 5DLEA 3U60B 4RVCA 4D4JA 1Q1GA 2HFJA 2YHAA 4CKZA 5ALZA 3JQAD 3H13A 1IOLA 4CKCA 5LKRA 5AI0A 1A9XA 3W9UA 1JT9A 2CBXA 2AK2A 2LIVA 2HZ7A 4MYTA 1CY1A 5IABA 3A2MA 4LSZA 3RNOA 1E2QA 3E3MA 3GVPA 4V2IA 4YMHA 4D0SA 3CZCA 1VIAA 5DB4A 4EFDA 3U9TA 4BFXA 4DA8A 5CEEA 4O0LA 2XLBA 2R65A 1HKUA 2ZSKA 3ZIUA 3A1FA 3S2FA 2WJZB 3M6AA 5FL7A 4EZBA 5ARBA 1M67A 3MWEB 3FZNA 1JA9A 1FS6A 2HPAA 3DONA 4B0OA 3DCNA 4GUDA 1Y8QA 3MWKA 7AT1A 5KNCD 2K5UA 5FA6A 2HT6A 5C46F 3FWYA 2ONCA 2FOXA 2QLNA 1V3UA 2ODAA 3EAGA 4WCFC 5DH9A 4PYOA 1D4AA 4KDFA 2AG6A 1VE9A 4GLFA 1W88A 3GVIA 1QS0B 3PS9A 3VHXA 4Q1FA 1EAMA 4WNAB 3PD7A 1ADGA 1XWIA 1KC1A 1DC4A 2IPLA 2VAMA 3IGFA 1SCKA 4R8VA 1YZGA 4TUYA 3PEWA 4WY5A 4WKGA 5A7HA 5E8JA 1BHO1 1QAMA 5THXA 1KEEA 1F7VA 3D3NA 1I14A 1OXKB 2OG1A 2OSVA 3VV2A 3R0ZA 4FZ3A 4UHJA 5CXXA 1TKRA 1VPWA 2BFMA 1LJ8A 5AYVA 3SR3A 2OFWA 4Q4AA 5MN5A 4YJ3B 2FYTA 5EPOA 2VQFB 1H6DA 4PN7A 3H9EO 2DHDA 4OD0A 2QV0A 3VJRA 5CNJA 5TDHA 1MAAA 1J97A 2OD9A 2PD3A 5ULLA 1CERA 1S6YA 3SLKA 3A32A 2B9EA 2QT1A 3HKEA 4J76A 1NVTA 1Y1PA 4DDVA 3G2PA 5JSZB 5IJXA 2XYGA 1TTQB 1YDMA 2ATEA 2Y4OA 3PE3A 5M5BA 3NNSA 3QELA 1E2BA 2PL1A 4MV8A 2BMVA 2WAAA 3DD5A 4FNMA 8AT1A 1POWA 2AN3A 4R8SA 1Z2OX 1T8PA 1V2GA 2QS9A 4P9NA 4FEGA 3UO8B 2QAJA 1GYQA 3AHJA 3Q7QA 4KN9S 5KHOC 2QRZA 4G0PA 1T9HA 2W7TA 2FFBA 2Y1OA 4QPZA 3RC9A 1V8DA 5CFMA 3SSOA 4X60A 1V48A 4NQRA 3AVXA 1UC9A 4ZCTA 3M5WA 1QVAA 4TROA 3I28A 4XLLA 3WYFA 3AM1A 2BEWA 1N75A 1SUDA 3THXA 5MFZA 5CCXA 4GSKA 3LQ1A 1ISHA 5GJBA 1ND5A 2ECFA 4ZYWA 2GCOB 5AW6A 2CXPA 2IXEA 1H23A 3JW8A 4F9FA 2UZ3A 1OPXA 4DDMA 1I10A 3NANA 3A06A 4E3WA 4LDAA 4RJKA 5EIHA 3RVQA 1RBYA 5LXTB 3B89A 4XYLA 5AWFC 2F6RA 4MKGA 3LO8A 3W8FA 3R5SA 4DKXA 2XDWA 3N8IA 4HV4A 4ZMBA 2CEKA 5FKJA 4L75A 3NMUF 1NXQA 3FETA 3AEYA 1BCRA 3V1KA 1OVMA 5IDWA 4LF9B 4EVSA 1J5PA 1ADBA 3MXTA 1KARA 3TW8A 3A1WA 2PKEA 3FDZB 4KQMA 2VWPA 5ITWA 1PEKE 1APBA 1CR0A 2HQ1A 1Y9JA 3WRVA 1SC3A 1FW6A 2JI7A 2AJ8A 3U0BA 4EJMA 2ZI4A 4JFAA 1ZC4A 4YHBA 3ZUGA 5JMTA 3SVLA 4KVAA 4MIOA 2NGRA 2ZAIA 4IXMA 4G2NA 1OFVA 3QHPA 4PG4A 4TXLA 5K4HA 3IVXA 5A9RA 3HU2A 2HSWA 3EJ6A 1YH3A 4PYMA 3IIKA 3AEUB 3RC3A 1Z83A 1U8UA 4ZCIA 2BEKA 3MT0A 1SKQA 2X9LA 3C15C 4NS4A 5DGHA 3STXA 1Z07A 2R87A 4PCAA 4D44A 1QLJA 1T6NA 1XWWA 3GA5A 2GKSA 2PLNA 1AOXA 2X7HA 1Z88A 2GNPA 1T1SA 5C52B 3CN7A 4N47A 5L4NA 3R0QA 3G0CA 3UTCA 5F7XA 1LBIA 1ZEMA 3PX7A 4ZC1A 2H2FA 1FFHA 2VSOA 5DOZA 3WLMA 4ALIA 1Y3CE 2W4IA 1PGNA 4NOJA 4XFKA 5EIBC 2ZIXA 1ZUIA 2Y9MB 3M89A 4O5AA 1P0MA 5A03A 3T95A 2QSJA 3ILHA 2YRWA 2Q5HA 4N0MA 5TC4A 2IOQA 1KSFX 2JIOA 4KO3S 3NHSA 4NV3A 1JT2A 3FWHA 4RO0A 3H8WA 4Y3UA 4X8LA 1RZVA 3SBEA 1QQ7A 3DEKA 5AI5A 4PU0A 3EVGA 2AW5A 2EDCA 2JLXA 4N0QA 3JAWA 1XRMA 1U28C 5EZSA 4NH0A 4W6ZA 5TPWB 2I5PO 1WM1A 2BDTA 3LA6A 3DLIA 3T3IA 2X4GA 4PZZA 4IV8A 4U2GA 3HKDA 1ISIA 3ONNA 4QNRA 4QGGA 1JAHA 4NULA 2YXBA 4G0NA 3LY8A 3HABA 5AK6A 4GBMA 2IEDA 2PMFA 3W9SA 3VZPA 3WK7A 2BGIA 2I2FA 3CJQA 4GEGA 3DDWA 3T7SA 1H3FA 5BSTA 4RF5A 2IUYA 1Z0FA 3VSBA 3T61A 4I2VA 1GUAA 1JEQA 1GFZA 3I2FA 1T2FA 2ZWMA 3P52A 3QWFA 5HF5A 1LI7A 3M6LA 5BURA 2P4SA 5IKEA 3SQLA 3L6DA 2QTNA 3NS7A 3REQA 4F6CA 3IT2A 1X8KA 3UW1A 3OKAA 4QOSA 4EY6A 2VP3A 4N5HX 1LBSA 5EXSA 2P8SA 2FRDC 4J91A 2CK3D 3D8TA 5H16A 2WILA 5JS8A 1CS4C 1IHPA 3HB5X 4B2LA 1QGYA 1TIBA 4MWCA 3HKDB 3QNMA 2I7TA 4FR5A 4LTNA 1T13A 2JC3A 1MC5A 4WFIA 2A84A 2AVNA 3PCRB 3PZBA 4F2HA 3ZJUA 2A4KA 1AKYA 2BN4A 3N0WA 4AXXA 5CIWA 2NXEA 3GGPA 5J2UA 1HRDA 4P7GA 1P0PA 2LD4A 3R3UA 4YACA 3L7MA 3UFXB 3ETHA 4GT1A 1WP4A 1ZITA 1UK7A 2XRFA 3IAXA 4N6GA 4RQAA 5DPMA 1WZEA 1OREA 1P6QA 2J8ZA 4NP6A 4P81A 2OP0A 4JHLA 1KYQA 3DBRB 5BNZA 2RGRA 1FTWA 4G5OA 3RSZA 1I7QB 3PC2A 1AGYA 4MS3B 4RA9B 5KYVA 1EVQA 1Q44A 1YVDA 1DHTA 3JQ8A 1ORRA 3WJ7A 1DQPA 1P74A 1JQAA 3W2TA 1QTNA 4W5RA 2JJMA 4LZNA 4KIFA 4M0FA 4OXRA 1OV6A 1TA9A 1XVLA 4QNNA 1E60A 1ZEJA 1NF9A 2P69A 3NWEA 1MB2A 3LPMA 4D81A 5AK5A 4CDMA 1V1RA 1VA4A 1VQ1A 3QLVC 2R5FA 3V8VA 4RWZA 1X94A 3E7FA 3L77A 3HKCA 3LUAA 3B53X 4NQZA 1P61B 1I0LA 2XUDA 3W6ZA 3H75A 3N2ZB 2FLVA 3N59A 4N3BA 1LF0A 5JCOA 4RF2A 3ZDFA 1OU4A 1SM4A 2GD1O 2VOEA 2ZE7A 2J6HA 4HB4A 3QEMB 5I8WA 3E23A 4DLLA 3FF4A 1I94B 2AD5A 3IMCA 4BVLA 1IHOA 1E9BA 2GO1A 3KZVA 3IT1A 4WNCA 3EVCA 3AT1A 2XI4A 1ODFA 3DL4A 2O0LA 3RREA 2YJGA 4WXRA 2O52A 3K09A 3EODA 1DJPA 1HRKA 3NHPA 4RVFA 1FEZA 2JCBA 1HH4A 4OOFA 4UM7A 1R10A 1YR7A 4BO9A 3PWTA 5BMVF 3EGWA 3VKHA 3ROKA 5A5EA 2HO4A 2AG5A 3BWVA 3RS9A 3I5YA 3OZBA 2XT9A 5AUNB 5L6MB 2NU9A 4WRRA 2YZMA 1P72A 1Y3AA 1T0PA 3L93A 4HB0A 3QKTA 2PM8A 3E9NA 3HL4A 4KE8A 4BNFA 3T1VA 4ZODA 3NT2A 3QM1A 4MWZA 2ZBGA 2AYXA 4LNHA 4YONB 4ZQHA 4UVGA 3PGA1 2N3ZA 2GM3A 4ARVA 1E7RA 5E4YA 3TE6A 5JBIA 3MCAA 1YGPA 3EYWA 3GFSA 1W85A 3A3PA 3OPYA 4R6WA 4AW9A 1U2ZA 3H16A 1TIPA 4O4HF 3WGHA 2O1XA 3BRWA 5HJ7A 1I3CA 1K8RA 4X8HA 3V8PA 1QH1A 3K1AB 3TNDA 3PXUA 3ZCSA 2I71A 4IRUB 1IIRA 5EIFA 4PLPA 3ZHRA 2P40A 3DCJA 1KA9H 2RHMA 3CXUA 3KALA 2EGGA 1UH5A 4QLAA 1ZCZA 2YS6A 1S4QA 3GEBA 5LQRA 4KYIB 1L7RA 5I4KA 1Y3DE 1N33B 4WOPA 2NZUG 1LZLA 3CJRA 4ZALA 3VJKA 3LV8A 3R5XA 2PMDA 1AY0A 3N3BC 4KQ9A 3SFZA 2JAQA 4B3BA 3D6VA 4Q6BA 1VJDA 4L0MA 3ZGVA 2AL7A 2WMNB 1PF7E 3U61B 1TJ3A 3OHSX 3T7CA 4AO8A 3NV9A 3AG5A 1IN6A 4ZVLA 1PLJA 1VG0B 1M76A 2GM9A 1Z5PA 1MGOA 3DE5X 2CVPA 3OPNA 2HDNB 3AJEA 4K3UA 4KXFB 3N5CA 1RVDA 3WRXA 2I4RA 2JHGA 4M22A 2ZRLA 3ZWCA 3JYQA 4F5DA 3GPLA 3TR5A 3KQSA 2PUFA 3A1EA 2FQWA 4YN3A 1R4MA 4LXUA 1UAYA 5SZIA 3J81k 1Z08A 4D0GA 3SOPA 2A14A 4L22A 5KSZA 3AMVA 4UMVA 3BAZA 2ZSAA 4ZT2A 2EP8A 3OPQA 1E9CA 3RUEA 4KH1A 4XD2A 2JVIA 3QJ5A 4TZ0A 4RGBA 3WBBA 1KI1A 2GZMA 3G5UA 4UU0A 2X5XA 3UCFA 3MS2A 4JYZA 1O5IA 1NOJA 3N5KA 5JSKA 5TEWA 3S68A 4WN9B 1KZ9A 1EA7A 1MV5A 4PZ9A 4Y2YA 1IXSB 3NDIA 4N8EA 3M1IA 3MLBA 4HN2A 3OCUA 4X0EA 5C35A 1Y5MA 4EA9A 2KX7A 2P9QA 3TFOA 1G18A 1QGUA 4F4JA 1ZOPA 4ZKEA 5HK9A 4DC1A 1OYWA 5B2FA 3WX0A 2I33A 1OH8A 1AN0A 1GVHA 2EQAA 3RRXA 3PUIA 3AUAA 4BL5A 5LP1A 1WU7A 4AJ4A 2GEVA 2CL7X 4KVGA 1DPGA 3GT4A 2DVMA 2H1WA 3W4IA 2H5LA 4BUZA 5L3VA 3SSAA 2O8BA 4C4ZA 1UPCA 4NBVA 2XUHA 4NMHA 5SY9A 1FYDA 1U1GA 1XDBA 2ZAMA 3DQZA 1OHHA 1QO7A 5DM4A 2IS4A 1B15A 2VA8A 1T1IA 4ARZA 4YRAA 4OL0A 8ADHA 1L8OA 2NPOA 2XKBA 5HRAA 3HL0A 3KB1A 4ZPJA 5E8RA 4URFA 3BSWA 4J4BA 3I3OA 1ANKA 4C06A 5FUYA 4F21A 1TL7C 2F64A 2QRUA 1YB4A 3AFIA 3FVWA 4TWZA 1IY9A 1Q5PA 1UMDA 4XSVA 5DIZA 1E6CA 4CIAA 1EXDA 2O8DA 2C9BA 2AKYA 2GXUA 2JF0A 4HUQA 4NBLA 5K4AA 3WB2A 3W4JA 5AVUA 3WL3A 3VRHA 5LNK1 1XNQB 1RHUA 1QGAA 4AKGA 4KVFA 1CPYA 4C0KA 1P7VA 1GRRA 1U2GA 2WF5A 2FA9A 5DTRA 3NQ41 2B99A 4XLTA 5LBUA 4Q24A 1XMQB 5COAA 3SBDA 1X70A 3KXKA 5K2MA 3HJTA 2YV1A 3HPRA 3SF8B 4YQYA 1PJRA 1GGHA 1RI5A 3RVBA 2NP6A 2QA5A 4OQXA 4RD6A 4DCSA 5ALXA 3ROMA 1TQ8A 4EGAA 2EFJA 1NAHA 1U7WA 4IYRA 5A3RA 1W2WB 2OY0A 4XFDA 3R74A 2J7PD 2Q3LA 3JTEA 2D3TA 1Z25A 3H9UA 5JCJA 3I6YA 4EG5A 3GL9A 1S3GA 3V8MA 1BJKA 1ZISA 2Z57A 4O1MA 4BP1A 1RDFA 3W2FA 2ZJ5A 3WWCA 1YD7A 3RIGA 4K26A 3F97A 2IYEA 4FGJA 4IVQA 5K7SA 1QJ4A 1N34B 1B74A 2YUIA 4G4GA 3LZ6A 1U3CA 4M54A 4NBTA 3R8CA 4F71A 3RS5A 4JENA 1II0A 2AYZA 5HTKA 5EIEA 2FMXA 1U8CB 1JJBA 2DC1A 5K4GA 3INYA 3L46A 3LQ2A 3ZVRA 1AGRA 4O4LF 3DJYA 4DUZB 1S7GA 5KTNA 1QCZA 3INGA 5IJ9A 3CV3A 3KXPA 4D96A 3TG2A 3QV2A 3O5AA 4CMIA 1ABBA 1MX3A 2YV2A 3JQRA 1SXGA 2OHJA 4FSHA 4UTOA 4YJHA 3RTBA 4RVNA 5T64A 1SZDA 4HI0E 4MB0A 5K8JB 3EPRA 1CDDA 1GU1A 2ODBA 3IX7A 4G01B 1LW7A 2WT8A 1LDMA 1U0GA 5B4TA 2C4UA 1CFZA 3PNLA 3V48A 2C2MA 1EE9A 4E0BA 3R40A 4AIRA 2JK0A 2CD9A 5TQ0A 13PKA 2LE0A 2MU1A 4MS3A 1GEGA 2AEEA 3THSA 3UUEA 4B44A 4ZGWA 1VOTA 2EARA 3IOYA 4JZYA 4HNGA 3NYRA 2AW3A 3ROPA 1XZKA 2KI5A 3B3JA 3ESQA 1YJXA 3BMXA 4PO8A 5TS3A 1X1EA 2IVZA 5CURA 2FW0A 2A0YA 5IJ9B 1FS4A 2FFJA 1YS9A 3O9MA 3RV4A 2GCNA 1PYGA 2YXLA 4J0KA 4KUHA 3VR1A 1HT0A 3KTFA 3KQUA 1EGHA 2BFCA 1JWLA 3P9IA 4FU0A 1JHYA 4RMGA 1L5LA 3WL6A 1EM8B 1LSJA 1TAHA 4BU0A 1M5TA 5KTTA 1FSFA 3GEPA 5BWBA 3HBNA 1P77A 2H31A 2YDXA 1N9GA 3LSYA 1Y5NA 4NDNE 4WD3A 2YIDA 3N86A 4RORA 3BWEA 3M34A 3HRHA 3HCCA 4FDMA 3U3XA 3X1JA 4CVNA 1U0LA 4OI4A 2RHBA 2NO5A 1XTIA 3T99A 1E20A 2W5UA 4NYJQ 3AR6A 1FUKA 1MQSA 4HLQB 4UDYX 3K0CA 3G8AA 2EEPA 4OMCA 1NJ1A 3HA2A 5H0IA 4A2QA 5AHRA 1TAGA 2W8BB 1IG3A 2HM7A 5DKFA 2D4AA 1JFLA 4HWOA 3H4TA 3G49A 3HR7A 2VRNA 1PGQA 4HRVA 5CT5A 3ZJYA 4J2TA 3TOZA 4LI0A 5AKXA 3DDUA 1P2SA 1Z8DA 1PX0A 1NFRA 1GN8A 3KJFA 4KR7A 4UPEA 1QBGA 3GEHA 4LXGA 4NCHA 4EJSA 5HKKD 2XT6A 3IHTA 1K4YA 5FB3A 3QEBZ 3D6UA 4DR5B 2XVMA 1Z5ZA 3GRAA 3HC7A 3LYUA 3IMGA 4NAHA 1NF8A 4WKBA 5H3CA 5K3BA 2ZYDA 4GDMA 5DCUA 2VJKA 1U1IA 3GFTA 1RJEA 1EK2A 4Z5XA 4TTJA 4X93A 3OG9A 1E79A 4M7PA 5AM5A 4AYTA 4RVOA 3NB0A 1JBQA 4J16C 3ZI4A 4RLSA 4R3NA 4WY8A 4MI6A 3ZY5A 4OBWA 2FPUA 3E84A 1N5IA 5DHAA 5HCIA 5BR7A 1AKUA 3WGJA 2L19A 1N8KA 3VDXA 5IWAB 4JELA 3L7JA 4G0XA 4Q39A 2DFDA 3ILYA 4M0DA 4XXHA 1RWWA 5K3FA 3FPBA 5CM9C 5FWXA 2JFFA 2PCJA 3DR3A 3HWSA 3QQPA 3IQGX 3T3PB 4C2BA 1JG1A 1NVBA 3IB3A 1HMPA 1G20A 1RI1A 2JFYA 2GHIA 4LXIA 3NLLA 4DMGA 2WFLA 2WJIA 3CINA 3EGXA 3HBAA 4I4TF 3U31A 3H2JA 1Z4KA 2X41A 3JQ7A 2KQUA 4BHTA 5C51B 3R4VA 4IHQA 4A0SA 2F8TA 3DB2A 1ZN8A 2SNIE 3I1IA 3MGCA 3WXMA 3AVTA 1DTEA 2FWRA 1RCFA 3HUUA 1X9GA 4OHWA 2NN3C 1P4SA 4CDNA 1U94A 3IJPA 2HFKA 4FILA 1HTBA 1PNVA 5CB4F 2ORVA 5JH7B 3WYAA 1UZUA 3DBLA 4B80A 4ZEMA 5C8YF 5HQTA 4RA9A 4W7HA 2FUKA 1THMA 1BDJA 3HCNA 4QSMA 3DDOA 3DBRA 3F49S 4Z0PA 3Q98A 1SK8A 4KE9A 4WOCA 1NT2A 3RGGA 2AOTA 3DMTA 4PLVA 4PZLA 4AJLA 4GNRA 1LD3A 1TCAA 3I9LA 3UJ9A 1VLVA 3EC2A 3HWRA 2FPGB 2ZIFA 3UK6A 1YVEI 3HCFA 4EITA 3BFJA 1N4AA 4OIFA 4M83A 2JL1A 5I51A 3V4LA 3MD0A 4Q7MB 3GLUA 3UW3A 1NURA 4OU4A 3KOOA 2V74B 1SULA 2GTPA 4Q9JA 2DTDA 4BGDA 1RRCA 1F2DA 1NVUQ 3PTAA 4WLFA 1CX9B 2C4TA 1QMPA 1XAJA 2FN7A 1BA3A 1EDOA 1H8ED 4JT4A 4KBGA 5A0FA 4EHDA 1TU0A 4H27A 4ZJZA 2UYOA 4CEJA 2AC7A 3E4CA 5AKJA 4DN6A 4Z4IA 1SCUA 1GQOA 2BI8A 2X77A 3FMVA 3IT3A 1RAHA 2YXEA 1WB5A 2WTAA 3PICA 5G0VA 2X8BA 1ZW1A 2XNKA 2IZOA 3GEDA 2P27A 5H7XA 3PLRA 1SN7A 2IHVA 4GVLA 2JIRA 1ENPA 4F8YA 1JR2A 1HQKA 2O07A 4XW2A 5IBCA 3DZBA 1BGWA 1SY7A 1HYBA 2J45A 3PC4A 1XZAA 3SC4A 4YJ2A 2H4FA 2MR5A 4GZLA 2VO1A 2NXJA 2PFGA 3H8JA 4H1TA 2QBYA 3QU5A 4MVJI 3PRHA 1I1QB 5DCYA 1ZGHA 3COZA 4MVJD 4P86A 1VGVA 4URVR 3P2KA 1CJSA 1NA5A 4H3KB 1MMFB 4BC0A 2QL5A 1R3UA 1GTSA 2ZTSA 1BXKA 1THTA 4UNPA 4Q7KA 1XOIA 4Q37A 1KVRA 3M5DA 4JXJA 3I6BA 5CT9A 1Y7TA 3PR1A 1M2GA 4J7AA 1DAIA 5KINB 5K8UA 4FKBA 4QUKA 1O0BA 1UIMA 2VSQA 4UUBA 4TV9F 2QD1A 4N5IX 1R6XA 5CA1F 1HX7A 3SY8A 4S04A 4ZMRA 2YQZA 1VL8A 4DJAA 1MO4A 1OAKA 1RE1A 3G13A 4KO1S 4B4UA 1VYUA 1CUFA 2PZLA 2CMDA 5LMNB 2V9CA 1P2VA 3MMPA 3QXCA 5DT9A 2R00C 2J7KA 1SC9A 3SS7X 3IOBA 5HGJA 2ROQA 1X14A 4FW9A 4O59O 4Y0AA 3C3CA 2OM2A 2W6ID 3U3RA 4DM3A 3FCAA 3O9VA 4V0QA 3DPSA 2QU7A 1SBIA 1RPTA 2D3WA 4RYLA 2KYRA 4WW0A 4FHZA 3X43A 4KPEC 5BO5A 3ZIDA 4RD0A 1X87A 4QUBA 1QAQA 3OM0A 1RIFA 2CLSA 2B4KA 1D7OA 2OLKA 3K92A 3WHIA 1JNXX 3I2KA 4DV1B 1K6IA 3ES9A 1EG7A 3LUFA 4R1MA 5TR9A 4K9PA 1I4LD 4ME6A 2QIOA 2F43B 4E7OA 2F8MA 2WJPA 4UEWA 3X1DA 3DV9A 1VCHA 5DP2A 3G17A 3KKOA 4OGLA 2ZIVB 3BRCA 4X24A 5K03A 1QCDA 1GM5A 1OZHA 3ZGLA 1X3SA 4IO1A 1VHQA 3N7UA 3LG2A 4QXRA 2V6JA 1LRLA 2VPYA 1EG2A 3O8OB 4JHXA 5KEIA 1UZNA 2BDUA 4B3RB 3SYNA 3W3AD 4JKIA 3VNBA 2RGCA 1VSBA 1NQTA 1Q7TA 1Z2NX 2IYUA 3FTQA 3OC0A 3B3AA 3U7HB 1F17A 1AE1A 5ALYA 3RJ5A 4RGYA 2QM0A 4ZHQF 5DLDA 4ZAXA 4CIDA 2PMWB 1HNZB 4IF6A 2P3OA 2X8WA 3Q6MA 3RC8A 4YRCA 1ODJA 3NHFA 1TM3E 3HWX1 3I37X 4G86A 2I62A 3PA6A 5DBHX 4OQYA 5EYPA 1PYDA 3DBVO 5F5LA 4F3CA 4MYRA 1ECLA 1Z0UA 5CIYA 3HXQA 4L72A 2QN8A 4HVCA 3F9IA 1EB9A 1ZICA 5HMMA 5B30A 3AGPA 1L7QA 3L8HA 4RELA 3SEAA 4UAJA 3UVEA 4BBAA 2BFDB 1P5ZB 2WNIA 1N6LA 5FUXA 1J0CA 4B3FX 4YRGA 4M1MA 3DTNA 2CHFA 4D3FA 1L8LA 3HDVA 2C03A 3FOBA 2FWAA 3AO0B 1KEPA 3VYVA 4C6SA 3GMSA 2H0AA 3Q12A 4JJ4A 4JR2A 3E22A 4YAUA 1Y6ZA 2P11A 4GS5A 1E3EA 4MPDA 1QVRA 2SKEA 4BQRA 3VHQA 1GD1O 2QM7A 5AVZA 3VI4B 3WP1B 1IEWA 4GXRA 1AX9A 1V3TA 1AQNA 2JH9A 1X7DA 2JGMA 4O2RA 3KUKA 4CUJA 2YWJA 3JWIA 4YASA 4TWIA 2JGRA 5DBIA 3P5SA 4D0NA 5KQMA 2XD9A 2A6PA 3CRQA 5F2OA 2UYYA 1T4BA 5FI5A 1YB2A 3NDBB 2ECOA 3NWOA 5ICFA 5GGXA 2C7QA 3VJLA 4WV3A 5L95A 3OQIA 2FLWA 1KEVA 1XJWA 3DW3X 3EB9A 1GPKA 3PQFA 4A2PA 1PJCA 3OJCA 3R41A 4LKRA 5K9ZA 3NEYA 3AFGA 2ZRFA 3KP1A 4P80A 3WISA 1JG7A 4RE6A 3A11A 2B4YA 2HA2A 3BTVA 3P9QA 4NAUA 4JMPA 4B6PA 5FEUA 4DPLA 4WCFB 3TLGB 4NZMA 2R8RA 2IEGA 2QROA 1UKVY 1Q0QA 1PTJA 2IPXA 1ML4A 5T67A 2BYTA 4OYYA 1P19A 3UC9A 1KDTA 3ZV5A 2OHHA 1G0OA 1ZWKA 1DKPA 3X1MA 1H9CA 1O58A 1RADA 3CG0A 3KUUA 4DPKA 1CRZA 2B5VA 3LHSA 4P34A 3H4MA 1GAWA 4KYTA 2P79A 1U3GA 4PAGA 5KSOA 3HYCA 4NE7A 3T54A 1W5SA 5D3MA 2VSYA 2HR1A 2GZHA 2FSSA 1HNNA 2WFLB 4JD5A 3T9CA 1WDWB 2FN4A 2I6TA 3FUUA 1ESZA 1COWA 4S24A 1P2GA 4YJHB 3WRWA 3DEJA 3E81A 1WXXA 4LK3A 2Q6VA 4CKEB 3BE5A 1LDYA 2X8LA 2C4NA 5DCWA 2OKGA 3T1HB 4ZQEA 3JATB 1A9RA 3SZUA 2BTOA 2WVAA 4RBNA 3VHLB 2C29D 1KWGA 2JFQA 4BO3A 1RXEA 2ZKLA 4G4IA 3WLTA 3NNDA 4EHLA 1ZIPA 4E1VA 3DFZA 1HDYA 1NNSA 4UVEA 2OV1A 1Q12A 3VR3A 3GPCA 1FFBA 4E5UA 3F6SA 4F1KA 1DG9A 1I2BA 1J39A 2QN9A 1KETA 3CZ5A 3V6LA 4R8RA 1AK9A 4PQGA 1TGYA 4K81B 1JBKA 1GYRA 3MCWA 4HUTA 2GNAA 5AOBA 4WFKA 5E0KB 3M4ZA 1U65A 4W1PA 2PGDA 5M3BA 1M0EA 3GEMA 3SJAA 3FNEA 1L1QA 2CB9A 1U0SY 3CF6R 1F1BA 1X7WB 3KOUA 4R4JA 3F5DA 3NIBA 3SZGA 1WRBA 1CDEA 2H2IA 1GZDA 3P9KA 2IUUA 1XMXA 4QTZA 4PSVA 5LU8A 4OREX 4HNTA 3FPLA 4FC7A 1RXVA 1N3IA 3CPHA 3IFSA 1FVHA 3AWDA 1F6DA 1S2GA 3OI7A 2V7VA 4K9KA 5LBTA 5P21A 3HKEB 1IZZA 1XEAA 4RLQA 3HB0A 1D1PA 1MU0A 2A59A 1CJTC 3GCWA 3LGSA 2I1QA 5JALA 3QBTA 1FVFA 1PIWA 3VOSA 2J6IA 1V8FA 1Q3KA 4HYTA 4LN1A 3U09A 5FQOA 1P44A 2JAHA 3PFNA 2QP4A 4QTTB 6REQB 5JHGB 4GQAA 2X7JA 4B6JA 3Q3GE 4L0QA 4AWXA 2O4UX 3O8NA 5THQA 3TOXA 1J2UA 1EBUA 4UE3S 1VE5A 1HC7A 2Z4RA 2JGIA 2V1XA 3N2KB 4MUMA 3M3PA 4RENA 4CLRA 2ACWA 3VAYA 2JATA 1XHFA 2FWMX 1E2JA 2V4MA 2VJOA 3E61A 3I92A 3OHPA 4IYJA 5DV9A 1N0WA 4MRSA 4GSLA 4BEJA 5JAPA 3N2LA 4YYZA 1X80A 3D3KA 1J9GA 3B1YA 4PE5B 2JFXA 3U37A 1D5CA 1DIOB 1U90A 2HZBA 4P08A 3ONWA 4D9MA 4DS3A 2X8AA 4OLBA 2ONKA 2HIAA 1EBBA 2QZPA 3AM5A 3CLUC 2BGKA 4LZAA 1Q95A 5CVTA 2RI1A 3X2FA 4D02A 2JJYA 1KH1A 3PPYA 4UCWA 3W5HA 3DDHA 4BKPA 5CX1B 2J59A 2JJ1D 3W34A 4BB0A 3SYRA 1KU6A 1BXZA 2HPZA 2K6GA 1VIMA 4TYQA 4NK5A 1TYEB 2QNRA 3QU4A 4I6JA 1HZZA 2WJJA 4DBLC 2DFKB 4C0SA 2OYCA 4FGWA 4WEOA 2WP8J 3WO1A 5CB4B 3STVA 1C7FA 2VPIA 3VUFA 2Z3ZA 3LBAA 3Q1LA 1FBTA 4LOIA 3MLEA 3ZX5A 4Q0MA 3GFVA 5BR1A 4NNOA 2WINI 4UDXX 1X38A 3KKLA 2WOOA 4RIFA 5U9CA 1CEYA 2FGKA 3UWMA 4HZUA 1QF9A 3U19A 3PJRA 1RXCA 3AXTA 3IKLA 1MW9X 1NE7A 2Y1GA 3SMVA 4R41A 1U3VA 1C8BA 2V4ZA 4CLXA 1HBJA 3Q7IA 1QIGA 4GMXA 2WSSD 1EK0A 1U3DA 2FE4A 3K0SA 1EK6A 3B13B 1R0CA 3CLRD 2JNWA 2IL1A 4I55A 3IP6A 3KU4A 3TZQA 4B31A 4Q4CA 3BEDA 1NVAA 2BRUA 2EBUA 3R3YA 3AL3A 3PKZA 4JLOA 4V0LA 4BKMA 1BGVA 1B3RA 2F48A 4RK7A 5FXMA 4L8YA 1O57A 2NO1A 1XZ8A 1HK7A 3A31A 3NWJA 3NYWA 4FYKA 1ATIA 3JVDA 4H3VA 4TTAA 1VA5A 4CT4B 4WKOA 4AFNA 3URMA 3D9QX 1CZUA 3THRA 4ENVA 3COJA 3TOVA 1TCBA 4KHZA 2TSYB 5I7RA 3F6RA 3EMVA 1A5ZA 1D2AA 1GZ7A 4RD4A 1VCIA 4CM1A 3ADBA 1WXQA 1ABEA 2K87A 4IKOA 3H1BA 2AHOA 3C1AA 2XCRB 2IHTA 3FI9A 1FXWF 3L5KA 1DJLA 4GVXA 4KU4A 5EUQB 5LP6A 3QWBA 1YKSA 3WIDA 3DA8A 3CRNA 1OQAA 1CKEA 4A0GA 2P65A 1T43A 2A9KA 2P1ZA 3NWPA 2GD6A 4LGCA 1FFAA 1DB3A 1YV9A 4Q4LA 2XCSB 4HAOA 1H4QA 1H1LB 2P4HX 3OOSA 1DX4A 2C58A 4CCAA 4RANA 4FCTA 3C5CA 2HO5A 2R79A 3E9EA 4WE3A 3W9BA 2R00A 1JYEA 4TT8A 2RB4A 1IN7A 4ZTBA 2QYHA 3E03A 3RVJA 1Q11A 4L9RA 4O29A 4UJ3A 4QPCA 2CW5A 4NCKA 1YUMA 3NHWA 4HGNA 1YHZA 3IQEA 2BKAA 4UHHA 1JVNA 2CKDA 5HE9A 5IJ0B 2EATA 2Y1CA 4XTCS 2ZDGA 1RHMA 4XLZA 4GW3A 4OUDA 3CZAA 4KQJA 3QG1A 1KMHB 2YASA 1B42A 5FUBA 2YHUA 3A04A 2IBTA 4YAJA 3AR4A 1J2EA 1MJNA 2DTEA 5ICEA 3KSAC 1H2ZA 1NRJB 4LDZA 1XU7A 1F06A 1DDOA 5JD4A 4A6PA 3O92A 2PSHA 3C45A 3USCS 4WLNA 1SXJE 1JVSA 1SOWA 2G8LA 5IUKC 3D6TB 1TMYA 4WZZA 5K3SA 3Q5DA 4IGEA 4KFRA 1A04A 2ZPTX 1BYIA 1J99A 2Y67A 4I2NA 2EC5A 4XDHA 3VTKA 4DV0B 2X9VA 3QOFA 2FCAA 2WFZA 2G82A 5I8PA 3P0HA 2R8ZA 4IX1A 4PNEA 5LIRA 1DKQA 1TTHA 4Y9UA 5FO0A 2WNHA 2C98A 3DKKA 5FEMA 1JAXA 3RIEA 3DV0A 2AI2A 3NAZA 4B2YA 4BO6A 2PMEA 1BE6A 3SJCA 5G0UA 4QU0A 4GX5A 3PQCA 4XM2A 4ZO6A 3FIUA 3NBFA 1ICEA 1HXHA 2BKUA 5GPBA 4HF7A 3AZQA 3V33A 4KO8A 4E33A 4G5GA 1G3MA 1XCOA 1F0PA 4A16A 3ROXA 5KVQA 4MGZR 3ED5A 1JU9A 5CJ2A 5JZBA 4DQDA 2C2ZA 3EARA 2VA9A 3CPSA 1ZPDA 4QNMA 2LKDA 2I4NA 2PA0A 4MKFA 3PDIB 1IUNA 4DQVA 4TWRA 3EIEA 3IHWA 3O4FA 3N6VA 4N8DA 4DKJA 1J2RA 2YN4A 4DXDA 4LOJA 5F9HA 1EXNA 4TS3A 3U1TA 4OXQA 1PL6A 2JJ2D 2K7FA 3IKMB 3IIJA 3NBMA 5EQJB 3NRCA 2QR5A 3PEEA 3EFOA 1DELA 2VNIA 2GUWA 5BMVB 1T2AA 2XAAA 1VB5A 4EF5A 4FLMA 5I4CA 2ZIUB 3CIOA 4N49A 3FDIA 4PC6A 3RVNA 5HK8A 4EHFA 1QH9A 1UQRA 2XIQA 1CIPA 2C94A 2WIKA 1N2BA 3H0KA 3LCCA 3M1AA 4OYHA 2PBRA 3MERA 1JKFA 2VLBA 2ZTLA 3PHCA 4MR8B 3ZYCA 4HQFA 3ZS8A 1CW2B 3BBPA 3SN6A 2R11A 1OI4A 4YV7A 1ZM3A 3IR5A 4Y6GB 3SG0A 4GEKA 2C92A 2VHVA 3FFAA 4GKAA 5DLQC 3SM3A 1JLMA 3I52A 4AZTA 5AW3A 4H7FA 4LUCA 2PRYA 3ZZUA 1CUDA 5CPBA 2D8AA 2FZ4A 3ZWXA 4I55F 1SA0A 3ZCTA 1NR7A 1IM5A 2PL5A 1SBQA 1V7ZA 2JPDA 2AOTB 1J56A 4KXLA 3Q5EA 5EG5A 4DA9A 4L8WB 4DLPA 1RP1A 1G1MA 3S2SA 2QXYA 3A4LA 4C4SA 1HA3A 1G21A 3WBKA 2QW1A 1BMDA 2JI6A 2X0NA 5GONA 3RVLA 5LOVB 1UXHA 4X9XA 5E38A 1M6EX 3QE3A 3LQRA 3TQSA 3PIIA 3DHNA 3UB3A 4ER3A 2VZ0A 3W5BA 2YWEA 1UBUS 2DJ5A 3HSYA 3O8LA 2IPMA 3KLBA 4RMNA 2IEAA 5L53A 4FNAA 2JA1A 3AHGA 3CX3A 2G70A 4DLXA 3IUYA 1D6NA 3ZY4A 4UM9D 1ZZEA 3WK6A 4D5GA 1V4NA 3WB1A 2K2QB 5BXYA 4AZ0A 3KELA 2IYFA 4C6TA 1HY3A 3PUZA 1QE5A 1GG9A 1MRSA 4FT4A 3EDMA 3WNQA 4BFZA 1SA0B 2Q0SA 3TKLA 4D92A 3CO5A 2X4LA 4HH4A 3GVHA 3BMNA 3CEHA 1KZGB 1ADJA 5AJXA 2YS7A 3C1OA 4Q47A 4E11A 5T57A 4QXAA 1L5KA 2ZRKA 1YDEA 4HHEA 3I0MA 2Z5FA 2ZRCA 1MC1A 3V7FA 4ERXA 4LCEA 4Y2GA 4F46A 2B6NA 1O95A 4HQNA 2NVWA 3CWCA 2YV3A 4AS3A 4CKXA 4K3VA 2V58A 1HFJA 1NMXA 2ASVA 1ESNA 4DLWA 2GH1A 2X2FA 1E92A 1Y4UA 1XQ6A 3QZUA 4EHJA 1MR3F 2VAXA 1DPFA 1EZZA 3T5MA 1W0JD 3GJ4A 2OQRA 3Q9LA 1JDBB 4L5AA 1YT5A 4OLJA 3EGXB 3MSXA 1ZMOA 4RK5A 3TWOA 3ZNQA 1B41A 1J24A 2OHFA 2JASA 2WM8A 2NX2A 2VUHB 1G5RA 1T0UA 3LZCA 4TYNA 3GJYA 3GRPA 2OTCA 1WS6A 1C4XA 3K0BA 3NC0C 3L7AA 4IX9A 4RH0A 3PQ3A 2CWDA 4I6EA 4P84A 4E32A 2J0SA 5F5XA 1ULSA 1OAOC 4WZAA 4C7KA 1K7EB 4F93B 1KO1A 2B2CA 3ZHZA 3UMJA 4B45A 1Z5WA 1M8JA 1B6SA 4UD2A 2Y6UA 3FKJA 4BEVA 1G2QA 2X2OA 4W9MC 4B74A 3PXAA 1XE3A 2HAEA 4GWKA 3M4JA 4G8CA 1FSPA 4ZT6A 4H7IA 3BXXA 4IS3A 3KFXA 1N2EA 4Q9HA 2QSZA 3A2NA 4D45A 5HUQA 4Y9RA 3IERA 3BAFA 1V4BA 3CEJA 3CEMA 1WX1A 3IAEA 1B1AA 4IVPA 2CUTA 4PYIA 3V9AA 3BULA 4UUAA 1EVLA 1MO3A 1YVRA 5LUAA 1GRNA 3THXB 4X61A 1YJ5A 3NKLA 2IY8A 4M2LA 5CVVA 3QUAA 3NUGA 4L02A 4X3PA 1SCAA 4R84A 1GSOA 3TO5A 1IHYA 2EIXA 4YEDA 3ONVA 1ONPA 1HYQA 1IY2A 1I3LA 2ATVA 4KQFA 1N2CA 4DAOA 2I0FA 2JFNA 4MUFA 4YFVA 1XGKA 3GB9A 5G3YA 5KWSA 2UXCB 1N6KA 4LTDA 1W73A 4HQRA 3U7QB 2CHVA 3RU3A 4XD7D 4DEYA 2FR0A 2VF5X 3EGCA 3VPCA 3BGOS 1FDSA 1MX1A 3QVGB 4HWTA 4BIMA 2Q3EA 1YQGA 4Q3EA 1G8JA 2GR9A 1JE0A 1M6HA 1U1CA 1JHUA 4IM7A 2WAOA 3SWWA 2A78A 3RVRA 5I9SA 2QN6A 1Z4JA 1WDTA 2C57A 4JP5A 4O8CA 4YAKA 2G6TA 1KZHA 4P35A 2BPOA 4FJ2A 4UC0A 4S2EA 1Z5OA 2BMDA 4KWTA 1DWPA 4PFQA 4FMCB 5JO9A 1H4VB 1XLWA 2XTZA 2GPTA 2ZJYA 3A25A 1E7MA 4HR7A 4MB6A 521PA 1W94A 4CV3A 5KTSA 2EG9A 3C6XA 3EHEA 3KL2A 3WAKA 4I8IA 2PK3A 4DC0A 5LMCA 1KJQA 1VHJA 1LBTA 1JLSA 4MICA 2WUVA 1GNTA 3EBLA 3TQFA 4DIOA 2H57A 4PPFA 3AV0B 2FHSA 1U1EA 2WWIA 1GGNA 1F2TB 1JQBA 5K8IA 2B94A 1R4NA 4OJTA 4JVOA 4PGMA 1ACJA 3CNNA 1FPQA 1GXSB 1RPAA 4DMKA 1ODKA 4ISCA 1USWA 3RS3A 3JQ9A 3ESBA 3FFXA 4AP6A 3G1UA 2HDHA 3IIEA 4NDZA 1QGOA 1PBTA 3RSQA 3VH1A 1RQNA 2QF7A 4PLWA 2JIQA 4E22A 1WE2A 1P80A 2Q45A 1JLRA 2P5SA 2PLRA 1Q57A 3PT5A 1Z6YA 3LRTA 5L3QA 3B1KA 1UKCA 3H05A 5J1TB 1QO0D 5K0JA 2I2XB 1DQYA 1Z28A 4J1TC 5FH9A 1XAHA 4I19A 1Q77A 1CUWA 2I8LA 4RPHA 5K3CA 3F0TA 1KPGA 3T5DA 5ADUS 4OY3A 2GETA 3R5JA 2V0GA 3LVQE 3W2EA 5HEKA 1ML3A 3E9DA 2HLDD 4XIGS 5A4MS 3DDZX 4OLHA 4B71A 1UANA 1Y6GA 3DKIA 1L6IA 2W2LD 4BLPA 1PZHA 3ACBA 4FX5A 3OZGA 5E7MA 4ECAA 1LPAB 3CF0A 1JDZA 4HUQB 1DAHA 2IKSA 4D6XA 5BW4A 4K6FA 4P4GA 3V34A 4QHSA 4NAVA 3HDGA 3VR5H 3E0QA 1G8GA 3TBKA 3LPNA 4GWLA 5IEJA 5E1OA 3VOTA 3EW9A 3ELYA 4MDEA 2ZXEA 2Y71A 3GROA 5F64A 4C21A 4CODB 2NUBA 2VF2A 3JQBA 4HL6A 2DWOA 2W4QA 1U98A 1G1AA 1XDZA 2G9ZA 3BH7A 2RGYA 4HZIA 3ECCA 4Q18A 3RYIA 4V1CB 2ZRDA 4JSTA 3UC5A 3BEOA 1NRWA 1W25A 1VLQA 1Z82A 5BPHA 1EWQA 4E5DA 2PLWA 2YNMA 4JLJA 4L6CA 4PAQA 4BB5A 3ZWNA 3V2HA 3UWKA 4FFVA 4QBGB 2PX3A 5JSHA 2DP4E 3GIDA 5DYIA 1U1FA 3L6UA 3CKKA 1OZGA 3EHDA 4QJBA 3HCAA 1T9GR 4EVIA 4CMBA 3I6QA 4IINA 5IM4F 2A88A 3RR2A 1WW8A 1DFGA 4Q15A 3VGPA 3QLTA 2QQ0A 4LIPD 1EJBA 4N7MA 4QYMA 3MRXA 4IRXA 1FFXA 1T0BA 2RGWA 2HXSA 3KR1A 4X41A 4E70A 5K0SA 3SVTA 2F4VB 3KOWA 1QVVA 3WRYC 1C3XA 1HYHA 3DFKA 2OVBA 1CQWA 2MJLA 3QMVA 1GA6A 3FKSD 3KT6A 5G40A 3RFFA 5A5FA 1HFEL 5DBGA 1TK9A 3BN3A 4DCNA 5HRCA 4DV4B 1E4OA 1RRVA 4MYCA 4TV8F 1N9KA 4JYPA 2FWJA 4UTVA 1KEEB 4M7WA 1B6GA 4MVJF 4OJYA 4RMIA 1GPBA 3I05A 3S8EA 2VTEA 2WSIA 4HDNA 2FSVC 4JLWA 4NZNA 1M2OA 3ITKA 1QTRA 3QBEA 4JI4B 3DBLB 2FEAA 3F67A 4KX3A 5EXTA 4EK9A 3OQMA 5EJFA 2BSQA 1I3NA 4EYSA 4DQLA 5ITZA 1MLDA 4N5NA 1T15A 5FBLB 1JE1A 4OM8A 5ENDA 1O0CA 2WKRA 3O4JA 1T2CA 4MRMB 4WLUA 4YJ2B 3UWPA 1OLUB 2HCJB 3UG7A 4C04A 3AVVA 4RTKA 5BWLA 4QJ5A 2P1DA 2XCLA 2NU9B 2JHPA 5KNCA 2C5BA 3REOA 3RSCA 3MTAA 1SHTX 3DEHA 2LV8A 5F7OA 1UDXA 2AK3A 2CDAA 2C3MA 2V6GA 3AR7A 1G20B 3R6WA 4HNQA 1AV6A 1BMFD 1JLLA 3VSEA 3ZOZA 4R7TA 5LP6B 1BDHA 4BFYA 1WABA 5AVSA 1CLEA 3OSZA 3HY6A 1Z2EA 3KQVA 4P4TA 5DTEA 3RTEA 2FR8C 3DXFA 4ENQA 1PGJA 4PZAA 1PTJC 4YDRA 2NTNA 2YOGA 4I6GA 1NV9A 1A4IA 1ZL2A 4R2KA 4JQCA 3OU6A 2VNSA 4PSDA 5IYZA 1EX1A 4MUYA 3DMGA 5MFPA 1VJTA 3RJ9A 4DCUA 3BGSA 1SCUB 4HLCA 1JFFA 1T10A 4AUEA 4EPRA 5BSFA 1Q22A 3O94A 4PFKA 4TLDA 5KOHA 1DRKA 1XPRA 2Y0PA 2PZFA 2ZJ4A 4FBLA 2P7IA 4P31A 1L8XA 3INTA 4NVRA 4BLUA 4AN4A 2IYAA 3BKWA 2CDBA 3HNRA 4MJLA 5AXDA 2YMLA 5C18A 4WUVA 2ZRBA 5FUVA 2G1UA 1X8XA 4FYIA 3SQOA 1PFVA 3DLHA 4EENA 3NTLA 1Z9BA 1CJKC 1NJ6A 3FMPB 4KFTA 3NBAA 4YP5A 2VCHA 3IIMA 1DMSA 3T4UA 1JDUA 1QXSA 3HB9A 3QVMA 3ZJ4A 1Z3IX 4DMUB 1P7WA 3K0EA 4GUAA 4HWSA 3F6EX 1VDZA 2G17A 2DBYA 5AK0A 4G07A 4KRXA 4C6TB 3GNLA 4YT5A 1SG9A 3SM9A 4AQ7A 1RLTA 2BWJA 3BZBA 3OX3A 3AJRA 4R8KA 4XD7A 5H3HA 3T0GA 2ZIGA 1RQRA 1AU9A 1U3FA 3WV4A 2ZM5A 3OFKA 3P2OA 4AY2A 3D4NA 4LJSA 4AJ2A 3MWGA 3GQBA 3H5NA 2V7UA 2FSVA 1TCUA 4H7DA 4IAOA 4IXDA 2QIPA 2ZPAA 2HUNA 3LTEA 4MV1A 5TXGA 3RSOA 4R8MA 1XKTA 2ACKA 1K3UB 1M6YA 1B7GO 1Y1KE 1W48A 1H4TA 2VH2A 3G1WA 3PXDA 4TX1A 1LRKA 1P9LA 1KWKA 4ZT7A 3H3FA 3SD7A 5KYUB 3RADC 1ZI9A