3NNSA

Bef3 activated drrb receiver domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
MMWKIAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEAFHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA BINDING RESPONSE REGULATOR B
publication title Regulation of response regulator autophosphorylation through interdomain contacts.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 42
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nnsA00
2QR3A 1JF8A 3K9CA 1RXEA 3CHYA 5TE9A 3I5AA 5IUNC 1AB5A 3BBLA 3ILHA 1H9CA 3VNAA 3O2SB 1PEAA 3HCWA 2R25B 4N0PA 2GBPA 2H3HA 3GBPA 5TQ2B 1ZAYA 1YK1A 1NXOA 3JTEA 3H6GA 1LBIA 3C6QA 3HS3A 3NBMA 4FE7A 5KQLA 3R0JA 3RVLA 3I09A 4RK0A 3LKBA 4WZZA 4NCBA 1MB3A 3A3KA 2A9PA 2WWVD 4EYKA 3LOPA 4N41A 4OLBA 3MIZA 1JWLA 3E3MA 1TVMA 2QU7A 1ZVVA 3EODA 1ABEA 3SNKA 2A9QA 2OQRA 3SAJA 1F51E 3KLNA 1YS6A 4F3TA 1YMUA 5ABPA 1NATA 4IGAA 4Q6WA 1DC8A 4YCSA 3GA5A 4JP1A 4YR7A 1JLKA 2N9UA 3N6VA 5FWXA 4IILA 1Z13A 1NXVA 2NT4A 2R4QA 4S04A 3H5VA 5EWJB 3N0XA 3OM0A 3H1GA 2RJNA 3H75A 4WXMA 1NY5A 2PLNA 3CG0A 3HSYA 1ISSA 4Y9TA 4F12A 3HK2A 1PHRA 4MR8A 4RXMA 4Z99A 1QO0A 3RVRA 3DLHA 1U2PA 2WRZA 5CNJA 4MAAA 2QSJA 4TLLB 1NTRA 2MYPA 5KQPA 2IOYA 1NXSA 4KFCA 4L85A 1E6MA 1XHFA 1U2QA 1D4ZA 4OATA 1E2BA 3E61A 3RVSA 3KSMA 4JB0A 2ID9A 2PUAA 2MSKA 4MQFA 4MGEA 1D5WA 1YK0A 3FFWA 3EGCA 3OO1A 5DCLA 4PZ0A 1A2OA 3CKMA 4KREA 2E4ZA 2FTKE 2HSGA 3KYIB 2JBAB 4G0MA 2ZWMA 3HO1A 3DZDA 5GOTA 1KMIY 2WJAA 3OQMA 5IULC 1JBEA 1DZ3A 3RVPA 4ZYLA 1DBQA 3SM9A 1K68A 1K66A 5IUKC 4YV7A 1VKRA 2PMCA 2IPMA 3H5LA 4MQEB 4O1IA 2MYUA 4QYMA 1ZH2A 1Z18A 4DADA 3LUKA 4PICA 5EWMB 3OLWA 4UHKA 3CZCA 3H5IA 1BAPA 1P6UA 4YP9A 2B4AA 3OLXA 4KNYA 5HQJA 1NXTA 4H3HB 3M9WA 1RZRA 1PUXA 3QLUA 1R8JA 4XASA 2PL1A 4ETNA 8ABPA 2JCGA 2MSLA 3RVMA 4XLTA 2A9OA 5DLEA 2PUCA 5KC9A 2L18A 4G0ZA 4ML3A 3M6MD 4WXEA 1S8NA 5HM6A 5C5EA 4RK4A 4KVFA 3QX9A 4IRXA 4XAQA 2PUDA 3H6HA 2GWRA 1ZDMA 1EWVA 3LUGA 5TPWB 4RK7A 4HNQA 1QKKA 1JX6A 3HDVA 4RKQA 5KQGA 1MVOA 2P9HA 1C0EA 1HEYA 4HNSA 4Z4EA 4LZLA 2E4YA 2F8SA 4IMIB 3DGEC 2WY2D 1DRJA 1YS7A 3L6UA 2FLWA 2PUGA 2NT3A 3CTPA 2E4WA 3UUGA 3O1JC 3HZHA 4EGSA 2CD7A 3M9XA 1GUDA 4LDAA 5HSGA 2Q5CA 1SXIA 1U0SY 3HUUA 1MB0A 1ZITA 3O2QB 4LDZA 2IPLA 3GV0A 4RV5A 3OMXA 2H0AA 2JVKA 3LMKA 2PAFA 2QVCA 3ILYA 3URMA 1JFTA 4LE1A 1QMPA 2FQYA 3O2JA 4Z0NA 3QEKA 2JB9A 1NXPA 1Z12A 3Q7TA 2R47A 5FWYB 3A0RB 4MS1B 2CHEA 2NZVG 3RVKA 4MLCA 4TN5A 5TQ2A 2KYRA 3QLTA 4OBBA 5HKOA 1FFSA 3N0WA 3K4HA 4MRMA 4QICA 3F73A 2PUBA 5B3JA 2F8TA 3C3WA 3CS3A 4LX8A 1U04A 2ID7A 1P8AA 3MM4A 1DCFA 1TM2A 5DGCA 4ZPJA 4Z4GA 3H1FA 1TLFA 5CNIA 2FMFA 3UKJA 3KYJB 1QPZA 1Z26A 4YWHA 2M1ZA 3T8YA 3RVJA 1SRRA 2J48A 1W9HA 5ED4A 1T34A 4Z9BA 5TQJA 1YIOA 2X7XA 5BQ3A 4P98A 2YHBA 3DGFC 4W5TA 4RXUA 5JNVA 2MYNA 2B1JA 3N0RA 1Z16A 1DBPA 2HQRA 1JFSA 2JVJA 4MS4B 1YTUA 3DLBA 3CNBA 4TLMB 3SG0A 1EHCA 3IP9A 3P9YA 4JB2A 5JS2A 5GQSA 2WMYA 3RH0A 3GBVA 3C3MA 5EWJA 3IDOA 3LTEA 3LUAA 3SY8A 5KI6A 3GRCA 1VLZA 1JDPA 2L2QA 5I4CA 2JVIA 1ZGGA 4P1ZA 3N8IA 3OLVA 3T38A 1D1QA 4RXTA 5FBKA 1RNLA 4MS3B 3TD9A 3EDCA 2NUBA 5E3JA 1NXWA 6ABPA 2FMHA 4JAVC 4CBVA 3HV2A 4ETMA 5T3YA 4KV7A 1URPA 3O74A 3CLKA 2DRIA 3F6CA 3JPYA 1ZY2A 2L19A 1WETA 3QLUC 4OG2A 1PEYA 3QEMB 3Q15C 2MSWA 4MR7B 4MYRA 1DJMA 2JBAA 1D1PA 2V0NA 5TPZA 3EAFA 4KQCA 1GUBA 3B2NA 3RVNA 2QXYA 1MAVA 1JHZA 1U8TA 5C5CA 2LBPA 1USIA 4YO7A 4EY3A 1QO0D 2QZJA 5CNKA 4YRZA 3EJWA 3MYYA 4Z4FA 4KK4A 4MQEA 3O75A 5IEBA 4KQ9A 3FFTA 1ZHHA 4H3KB 2HJ9A 2L17A 1QQBA 3NNNA 3VNBA 6CHYA 3HXMA 5JNSA 3NNSA 4Q7EA 1AB6A 2PE5A 5KQMA 4Z4HA 1M5TA 4RWEA 3LUHA 4EYGA 3NNDA 1VRVA 4O1HA 3IPCA 2FKAA 4FB4A 3RVQA 1GLGA 2LPMA 5TPWA 1I3CA 4LE2A 1USGA 3GYBA 4G0OA 1BA2A 4XXHA 3OM1A 5JS1A 1C4WA 2NZUG 4WUTA 2E4VA 1XHEA 3KCNA 4KK3A 2HQBA 4RSMA 4D6YA 2GKGA 1Z2EA 2QW1A 3BRQA 3I42A 2QV0A 1EAYA 2JRLA 5F64A 2O20A 3D8UA 4XARA 4E7PA 2JK1A 4G0YA 5B3JC 4Q6BA 5FBHA 1A0OA 5BRAA 2AYZA 5DKFA 1FFWA 3DBIA 1OXKB 4Z4CA 4B09A 1KRXA 2GI4A 4M88A 5BR1A 1SD5A 3O1IC 4G0QA 4NCAA 4FE4A 4EVQA 3NHZA 2FQWA 1BVHA 1MIHA 1CYEA 3F6PA 5JNWA 3Q9SA 3MQ4A 3Q41A 4OLAA 3FFXA 1M5UA 3QK7A 3QELB 2IKSA 3GWGA 3G1WA 4L4UA 4RY8A 4G86A 3OQOA 2FMKA 4G97A 1DBWA 2E4UA 3GT7A 3JPWA 3KJXA 4MR9B 5FWYA 1F4VA 4MS1A 3QLVA 2LUOA 3O1HB 3NHMA 1L5ZA 5IUJC 2RDMA 3KTOA 5TQ0B 4D74A 4W5QA 3HVRA 3BRSA 1GCGA 2W42A 4HNRA 1ZGZA 4KMRA 5EWLB 1APBA 3HM9A 3CG4A 4RK6A 4IF4A 5JNTA 3LKVA 5IEJA 1KGSA 4WWHA 4MLDA 1JYEA 1M2FA 1Z17A 3BILA 1J56A 4OTZA 4QYWA 4HYEA 3HUTA 3IP7A 1RPJA 1QNLA 1YMVA 1ZH4A 1JDNA 3KHTA 1QP0A 4RDCA 4N76A 3H5TA 1DRKA 2FQXA 1EWTA 4MRMB 4TMYA 2IPAB 1ZESA 2RGYA 4QPJC 1FQWA 1DCKA 3FDFA 3IP5A 1DP4A 3TB6A 4W5NA 1M2EA 4F11A 2FLKA 4G0XA 3IP6A 4PYRA 1FSPA 1RXIA 1DC7A 3JY6A 4RS3A 4MS4A 3BREA 4EYQA 1UDRA 3JVDA 4RU1A 3KG2A 1JFVA 3IPAA 5KWSA 3H5WA 3RQIA 1SXHA 3I45A 2FSPA 3T95A 5JNUA 2TMYA 4RY9A 2IDMA 4EVSA 1ABFA 2MYTA 2VUHB 3EQZA 4MS3A 5FWXB 5BRJA 2QVGA 4WT7A 1E6LA 1L5YA 2PKXA 1NXXA 1OXBB 5PNTA 3HJFA 3Q7RA 1DCMA 2WB4A 2HPHA 3LUFA 4GPAA 4F8JA 1A04A 2HQOA 4RZSA 9ABPA 4ZMSA 4Z4IA 7ABPA 4O5AA 4LE0A 5IBQA 2P4UA 4MR8B 2YHAA 4YLEA 1QP7A 3O21A 4EUKA 3CFYA 4ZMRA 1Z25A 4RK5A 2WJWA 2VK2A 1D2AA 1JL3A 4F06A 3QEMA 1TJYA 3OQNA 1B00A 4EYOA 4MR7A 4GNRA 4IMJB 1VPWA 3JS5A 3KKEA 3HEBA 4D6XA 2IYNA 4MQFB 1P6QA 2CWDA 3LUJA 5CHYA 1PNRA 1QQAA 1USKA 3LUDA 1IIBA 4N0QA 1P2FA 1CHNA 4NICA 4RY0A 2OENG 4NQRA 2AYXA 3C97A 5EWMA 3CRNA 1ISRA 3N75A 1E6KA 3H5OA 5D2CA 4JA2A 3TX6A 3OMWA 4DN6A 4YS6A 3QX8A 1Z2DA 2FEPA 3RVOA 3C3KA 2BGGA 3A10A 1QP4A 5T7BA 3EQ2A 2IPNA 1LJLA 1W25A 3OLYA 4PEVA 5IC5A 3F7NA 1ZN2A 4NV3A 4PE5B 3SQNA 4JASB 4N03A 1KRWA 5DTEA 4W5RA 3FGZA 2FEKA 4H60A 5TPZD 5JNRA 4XFKA 3TMYA 4S05A 1EWKA 5CNMA 3A0UA 4EVRA 1CEYA 1JH9A 3LFTA 2VYCA 5KC8A 2M98A 1EFAA 3N53A 3CZ5A 1JYFA 3FMVA 2RJOA 2LIVA 3OLZA 3Q7SA 3MA0A 4KRFA 2CHFA 2GX6A 3G85A 3JVIA 3LUCA 3QLVC 2I6FA 4ZJPA 3T6KA 1BDIA 3GL9A 1GCAA 3CU5A 4E7OA 2PL9A 1RZRD 1LJUA 1SXGA 4YGXB 5IX8A 3ROFA 2FN8A 2PJUA 4MPTA 4UHJA 3HDGA 3MF4A 3OO0A 4W5OA 1YVUA 4KZKA 2FEWB 1Y1LA 4DQDA 3UK0A 2ZAYA 2FN9A 3H1EA 4RK1A 2FW0A 2FMIA 3KLOA 4G0PA 4KPYA 1BDJA 3L49A 2PUEA 1DG9A 2XDYA 3D02A 3QELA 3ROTA 4ETIA 1FFGA 3S99A 1XWWA 4LRQA 4MR9A 2R48A 4JOQA 1LK0A 2PUFA 1BDHA 1LBHA 2FVYA 5TQ0A 2A9RA 2E4XA 4N47A 1TMYA 3KS9A 3MMNA 4Z9AA 1PNTA 2LP4Y 3TO5A 3W9SA 3EULA 4RKRA 5EWLA 2VUIB 1Z15A 2FXIA
chains in the Genus database with same CATH superfamily
2P6UA 5CPFA 1P0PA 3CHYA 4HQNA 1T2CA 5JD6A 1TD9A 4N7MA 5FOWA 3IS3A 1C1DA 3D3QA 3KXKA 4KEAA 3ZD7A 3JTEA 1JEAA 2I71A 2BWJA 2GCNA 2WLSA 4QUGA 2NO9A 3JQBA 3DP7A 3WP0A 1VJCA 2DHQA 3R0JA 1NJ8A 4MCHA 5LUAA 1EFRA 2Q3LA 4RK0A 3A6PC 4GXTA 2W7TA 1MB3A 2RH4A 4IWNA 1E5VA 2HQSA 2FF5A 1IOWA 1PJBA 2Z5VA 4OK3A 4ZAWA 3CJQA 4BCCA 3ZIDA 5EI5A 4BMSA 3U44B 2ZWAA 3VI4B 1N78A 1BQ3A 3OIFA 1T43A 3FMOB 2YJ4A 2GK4A 4ND4A 4HCJA 3WBJA 2AN3A 4IGIA 3V9AA 2BGIA 5FTKA 1OCEA 5K3DA 3TZBA 4AX8A 1FC0A 3S2IA 2ZRHA 4PG8A 4YXWD 1NDHA 1C8BA 1XKLA 1ZIPA 2YZKA 4GWKA 4V0SA 4EM6A 5DOZA 3PNKA 2HSDA 3MBIA 1VLVA 4I4CA 4NENA 1RRPA 1Y9AA 3JD0A 4KE7A 3EBPA 4MGIR 5AXBA 5B58C 5KTKA 1HDEA 1NU6A 4IQ0A 1RMQA 4ADSG 1MH1A 1XEWX 1OZFA 3L0BA 3QOFA 1LBQA 3N2LA 2E55A 2G72A 4HWPA 1FU4A 3D2AA 1N75A 2ZITA 4YFYA 5KJ1A 2ZIFA 4WKPA 2GA8A 3T7RA 3CRMA 3H75A 4LKRA 4BP8A 4X71A 2PNFA 2F64A 5ITZB 2RBKA 2AE2A 1C1YA 2WINI 4AN1A 1OC4A 1F7VA 4GSLA 3AF5A 1QO0A 3RVRA 2LNDA 1Y3AA 2E4AA 4JR1A 5EJEA 5CNJA 1JI3A 4KSYA 5EIEA 1P1FA 3L7CA 2BDUA 2H1WA 2HIAA 4J0CA 4AUNA 4S1TA 1Y7LA 3MZ0A 4F96A 1AV7A 1PBTA 1ESEA 1HFWA 1D4ZA 3QMWA 1EUYA 2FMTA 1F0YA 5G0TA 4NF2A 2D74A 3BXHA 5J5VA 1L5FA 4CW7A 5K09A 1GU1A 2VXCA 3V4RA 5THXA 1W5AA 1V48A 5JARA 4IDGA 5IJ0B 2Y2UA 2IGTA 4PZ0A 3QA9A 1JLLA 3P9IA 1YZHA 2FN4A 2GM9A 1QO7A 2NO6A 4QTXA 4B74A 2IRWA 3ZY5A 5MFPA 4EJFA 4CM4A 1Y5LA 4J03A 3GPDG 1N4AA 4BJ1A 3B7PA 2WJAA 3OQMA 3A4VA 5K8VA 1J5EB 3GPLA 2YVLA 3DLTA 4FFPA 4EPTA 5C7IO 1J2JA 4ZDJA 2DBYA 1US8A 2C4WA 2G0NA 4KDEA 5M34A 3WFIA 2Y1FA 4BJ5A 4CR7A 2JGRA 2PUVA 1EXWA 2FWPA 2GPSA 2VI5A 3FMFA 3BMCA 5NLLA 2EVWX 4A6XA 1AZLA 2VOEA 4P9NA 5I01A 2XYGA 1ODCA 4LRWA 3INTA 4OIFA 4TQGA 1GGVA 1B23P 2NW6A 1K7CA 2G1KA 5IT0A 2V65A 1NQXA 1NXTA 3INGA 3R5SA 4Y2VA 5L7TA 2GMWA 1RJDA 2EEPA 5DYIA 3I8OA 1AN9A 2H5EA 3EH1A 2VZ0A 4OYLA 1XMIA 1I4DD 3QVUA 1XROA 5DJ5A 5JSUA 4JCCA 1QQ6A 1S8NA 3V2UA 5A7GA 1SURA 1WXGA 1WPXA 2I62A 3A05A 3F3KA 2FZ5A 5JVDB 1HFKA 2WKRA 1MVOA 2IS2A 1N5KA 1HEYA 3EA0A 4I1SA 4I50A 5TEWA 4DT1B 1XZNA 4GLBA 3H65A 1P5JA 1IJFA 1X1QA 1FJGB 1GAQA 4B0PA 5G1NA 3FHOA 1K8YB 2V8BA 1LBEA 1XD8A 3MFYA 4KPUB 1TCUA 3LOUA 4W9NC 4C87A 3TM4A 4CF6A 4F9TA 1VIDA 2P3LA 3UUGA 1HZJA 3K0EA 3O1JC 5KEIA 1I32A 2V6MA 3PDWA 1YR8A 3GUZA 1QHSA 4HYYA 4CNBA 3VOBA 3PDUA 2NOAA 2PLAA 4HMPA 2IOFK 4RD3A 5SYNA 3TFQA 1J70A 2WHPA 1ZITA 2NYRA 2H16A 3K5PA 2NUTA 3V7YA 4HDOB 3WR5A 3X2EA 1WXHA 5ALUA 2GAAA 2R7MA 2C61A 3WIEA 4TQUS 2AQ8A 3HJBA 1PDWA 5KNDA 2BRUA 2CHQA 4N01A 2O0KA 1PFUA 3FOCA 1E9RA 4RFLA 5BOSA 3LM8A 4DHEA 1QR2A 3WTCA 4LE1A 2IUTA 4Y6OA 4LGCA 1YDGA 1FE8A 3BD8A 2WHXA 1GKLA 2DPLA 4U2KA 3WLAA 3KDSE 4Z6KA 2JI8A 2AXEA 1K8RA 4OBBA 4KQIA 4Q15A 3GCWA 1A2BA 1ONBA 1H94A 4DRXB 4RHTA 4RQTA 1EJBA 5L9AA 3LCUA 3AEQB 4KH1A 2FWJA 4DF3A 5KDDA 1QCYA 4IJQA 2P9CA 4NYMR 4WH0A 2WFLB 3OU7A 6GPBA 2OPBA 1JG1A 1T2DA 2O2GA 2WT4A 1T3LA 1W0JD 2QZZA 4QBIA 1QCDA 3KU4A 3QBDA 4QU0A 4AKEA 4AJ1A 1SRRA 2J48A 2QRJA 1STOA 3JQGA 4IZ6A 3CVOA 4XRRA 2VP9A 4XVHA 4F7WA 3VNVA 3ISVA 3KKQA 2FZCA 3R5TA 1CETA 2P1RA 4NHEA 4MINA 3HUEA 4ZT3A 1Q21A 3PZRA 4M53A 5AIAA 3A9RA 2FFHA 1CUJA 3E2IA 2JA2A 4HXFB 3KTFA 5K0SA 2ZSUA 5LNK6 2EBHX 3N7TA 1M74A 2JCSA 2P9JA 3FW1A 1UMKA 4IZOA 1KFEB 3VYRB 4O29A 3EZ6A 2BLLA 4UTZA 1E1QA 1H6CA 1PGPA 1ZD8A 1CNFA 4FN5A 1CERA 5LXTF 4TLAA 1H3EA 4P1ZA 4PW0A 4QHTA 1FJXA 3T38A 3IPRA 2IT1A 1H2AS 3SF8B 4R54A 5FBKA 3TI7A 4M9RA 4EAQA 2VNSA 2RKBA 4LBYA 4Y7CA 3LQ1A 4E08A 4DLNA 1MG5A 2DWUA 5AVOA 4LNAA 5JE8A 2GUWA 3H9BA 3HV2A 4A1OA 2PX8A 1URPA 2NQ8A 3CLKA 4IUDS 3X43A 4IH9A 2VTDA 3K0FA 3JPYA 3QKTA 1ZY2A 2D4AA 3RFXA 3SKVA 3WIVA 2ZE6A 5I9TA 1PD1A 3ZE2B 3F7MA 1H1TA 3BE5A 1LC0A 4NPHA 2VDVE 2JFVA 1P4HA 2Q5LA 4RCVA 4ZYUA 4X93A 5ESDA 1KO5A 3OPVA 4IFEA 4I4TB 5KNCH 4WCFB 2AKEA 1J90A 1YQQA 2KMLA 4DSAA 3C7TA 3EAFA 1RRMA 3ADBA 4H35A 4RM2A 1P1IA 5LIRA 2NQ2C 4JLKA 3GMSA 1U8TA 2YCBA 3C4VA 4EQ6B 2H2DA 1KKUA 4GPZA 1DU4A 4YBZA 5KNBH 3AY6A 4FDAA 1AK2A 2ZPUA 5IM4A 3AW9A 1C7JA 1GQYA 1PYDA 1VJ1A 3NNNA 2HADA 1JT9A 1NHGA 3PPVA 3KSZO 1R9NA 4ATNA 1FDTA 2C4NA 3GDWA 4QHSA 3TIGA 3GDOA 4K9QA 1WDMA 3NIGB 2WU3A 3PP8A 4RHEA 4Z3OA 1YDWA 4EJ2A 3LP8A 3MINB 4FX5A 4XFJA 2JLVA 3DFKA 2H1SA 2PX3A 3UJCA 3EUAA 4RZ2A 1QAQA 1C14A 3TUZC 2ZIGA 2GAJA 3ZGYA 3ZW8A 2R6CA 2PA3A 5K8UA 2E37A 2NM0A 3E53A 3KQMA 4ZALA 4ZT2A 5A4IS 4AULA 1OE0A 2O2IA 2YFQA 3FUCA 3EF3A 3GYBA 1NNI1 3WLKX 4CTMA 4C5CA 1VRCA 3KT6A 2QUKA 3CF2A 1QRUA 4L7VA 3ES9A 4ZI3A 1C29B 2C31A 3IBCA 4UQPA 4UUQA 1KZHA 2YR0A 3T9DA 2I2XB 3H05A 1RKUA 1V5EA 3HMQA 2OOKA 3I42A 3PR2B 2H2WA 2R79A 3D0RA 1EXMA 1VC2A 5HOQA 1CEEA 2CD9A 1FFWA 2UYGA 5D8DA 1XPUA 2BKLA 4ZD6A 4DYVA 1SD5A 3B20A 2RCNA 4NBSA 3FUVA 1IY9A 4XW2A 1MR3F 2PR7A 5JSKA 1II8B 3H19A 4OBEA 2UZ3A 1RRGA 3GRFA 3A2KA 4WK6A 1M2VA 3DUFB 3BF7A 3ESRA 3KAPA 2IPXA 2ZRGA 3O8OB 1A3CA 4NE9A 4OP3A 1L5OA 4V39A 2WJYA 3QELB 3NKLA 1GGJA 2ZUCA 4G86A 4Y1RA 1F0PA 1DBWA 2FPIA 4KO2S 2HCJB 3CRVA 2HM7A 2IJGX 3QLVA 4TROA 2EW1A 3H7IA 2NU7B 3HKBB 5FA8A 4X9XA 1QV9A 4QYSA 5FB3A 3W7VA 1X80B 4EGJA 3BB1A 3MTBA 5LL6P 2W42A 1AUOA 4RD6A 1NLUA 3HU2A 1IY0A 5D3KA 3T0IA 4MB0A 3PFIA 5IKPA 3TF5A 2GHQA 3I64A 2WMNB 3DBHA 3T4XA 4RKYA 3KOWA 5CG2A 2IIBA 1Y8CA 3W2FA 5D7NA 3AR9A 4JGIA 2V7XA 4DLZA 4DQUA 2XOKD 2EX4A 4DTCA 2P6PA 3K70D 4M9CA 3AVWA 5HCIA 4HAVA 1JDNA 1X8LA 4KJXA 1E5XA 3PRHA 2RB4A 4QRDA 4BO9A 2XZLA 1FMCA 1H0RA 1CULC 3A6FA 2H0QA 3LRTA 4BRUA 3SC3A 1PP4A 2XCIA 3OF2A 3ZVKA 4UMFA 4ZT7A 1Q7GA 1XCBA 4OI2A 1ECCA 1G0OA 3UT5B 2QA5A 2CHVA 4YECA 2NGRA 2F1OA 3HCRA 4AMBA 1ZSYA 2ZATA 2CW5A 2P6OA 1IMJA 1T1JA 3ND8A 4K28A 2W2OA 2YW9A 4P54A 1ZBQA 3JVDA 2NU9B 5KWSA 2HRRA 5DXAA 4TLEA 4X66B 1EFRD 2P4SA 3CRW1 5KCMA 3L0SA 4GDMA 3Q3GE 4M6WB 1Y81A 3V4OA 1UMCA 3QFRA 1UP6A 1BO6A 1P62B 3JZMA 2ODEA 4L4RA 4PHHA 1I1QB 2AEEA 3IIEA 2H11A 2RK4A 1AY0A 2XECA 1FTYA 4TKVB 1X1TA 1UJ6A 4L50A 4BVFA 4TYWA 3FYDA 2VJCA 5J4HA 1XN4A 3E8XA 4ZIRA 4QXQA 3SE7A 1EZ4A 1XRPA 4MLPA 3ZV4A 1Z34A 1P7PA 1P33A 1RAHA 4LXQA 2GBCA 1NBMA 1Z28A 2HQOA 1PJZA 4PCUA 1L5LA 4YJ2A 4M0KA 1NVDA 3L7KA 1JPNA 5GOZA 1VSVA 1ZICA 3CFYA 2X0RA 1EFPB 3MQ2A 1LVHA 1P17A 1ZM4A 5F2KA 2JFHA 2Y6UA 3MHPA 1DTWA 4PS1A 3WZLA 1XEWY 4IICA 2P68A 2P1DA 3L0ZA 1FB5A 2PCJA 3PXEA 1PTKA 1XG5A 1KPIA 4EF6A 2OILA 1SQ6A 4Q9IA 2A0XA 4LOHA 2NO7A 2AXPA 4JJ6A 3HEBA 4IF6A 1RLMA 3SDZA 4G4SO 4QDJA 2OHGA 1FTNA 3WB2A 1XZEA 1XMPA 1ZZEA 5AVKA 1E9DA 1EVEA 2H29A 1ODKA 1Z0JA 3KB2A 1SB9A 3O9ZA 2YW2A 5AJVB 3TBHA 1D2EA 1P5FA 2FDRA 1BX3A 4HADA 1TZ2A 3FZGA 3JALB 4RY2A 2D00A 3OZIA 2CB9A 5ICFA 3KEOA 4X20A 3SQLA 4Q05A 2GZHA 4ID3A 3NFRA 2QZ9A 4XWKA 1V11A 1E5QA 1FPMA 1W25A 5IC5A 1CJSA 4DM7A 1W2WB 2XZDA 1QQAA 4NV3A 1R6AA 1TZMA 4PYQA 1WMEA 4IIFA 3FZYA 5DEOA 3ILSA 4KIWA 2VJYA 4ENPA 4QNNA 1DXQA 4PC6A 4PFJA 4Q3BA 5DZSA 4LI3X 3UN1A 1CEYA 4F3CA 4REOA 3A32A 2BFWA 1JYFA 4O4JF 3FMVA 3U4GA 2G80A 1GEGA 1AF7A 4P4LA 3RJZA 5CD1A 4G09A 4A15A 3OLZA 3MA0A 5I7EA 2QF7A 2Q5HA 5L6MB 1SVKA 5DE3A 3V1UA 2AJCA 3WXBA 5F78A 2D7DA 4OI1A 1JWAB 3AILA 3T3HA 4CL3A 3R6DA 5JT1A 2H1VA 1GP2A 3K31A 3O4FA 2GVDC 4ID9A 3WRYC 1G7RA 4IDEA 4OIMA 1L8QA 1NV8A 3ZOKA 5I9NA 1N32B 2JHAA 2DHCA 2H5IA 4RLQA 2FN8A 1JIKA 3QTTA 3MF4A 4MVJM 1BCRB 4RADA 3JQQA 1P4JA 4M8LA 4XM0A 1S3IA 3IAM1 1V1RB 1S2LA 4MQ4A 4AZSA 1WPGA 3D8SA 4JBGA 3ZXSA 1XNHA 1BG6A 4UD6A 4CT4B 2R6AA 1L5QA 5K8LA 5EXEA 3TLKA 1L4BA 3I32A 4I55A 5CITA 2QK4A 4FGSA 4PX5A 3EWIA 2O07A 3BA6A 2WUGA 1KU0A 4WFQA 1NBAA 4ARSA 2C4UA 4GNKA 4Y1FA 1LK0A 1VI6A 4OF4A 1N34B 5IAGA 3W9SA 3E05A 4BFLA 2W6CX 2Q9BA 4C0KA 2FEAA 1MV5A 2RIPA 5F73A 4MUAA 3F4LA 2G28A 2UUOA 2X0KA 1H93A 1P9RA 3KETA 1GNLA 1DCTA 1NOIA 2FCAA 1W96A 1Q0PA 2DR2A 2QE6A 3KELA 3MTQA 4PSAA 5KWEA 3A8TA 3IUJA 3LKDA 1SUWA 3V1LA 1J8MF 1GL3A 3BZBA 4TXLA 3WL4A 3F47A 2P6RA 4QO8A 5KNDD 2XBUA 4FD2A 4JH0A 1ESMA 3BK2A 2C95A 4BLWA 2W2KB 4A0GA 1VMKA 1DLJA 2IYOA 3P2OA 2QD5A 5JIBA 3RSGA 2R8BA 1B76A 4V38A 3ZDFA 3OCWA 1TZJA 1KK3A 3AR5A 3LKBA 3O47A 1Q3HA 2IZ6A 3GEGA 4UUPA 3ZDAA 3L3BA 3OQHA 1DEOA 2M6SA 2PGJA 5JC1A 2QU7A 1ZJYA 1ABEA 1LNZA 1TYBE 1AQJA 2POQX 2HU7A 2A9QA 3B3AA 3DT8A 4Q1CA 3UB3A 2HBQA 3EIHA 4UU8A 5DM2A 1RFLA 2AVDA 3FUWA 3PPYA 3CW8X 4LF9B 5LOVA 1P1CA 2HRCA 2WMDA 4NWIA 3TOVA 4RIIA 4UXIA 1EK5A 2GYUA 1SUEA 5CVDA 2Q3MA 5DP1A 3VKVA 5C3MA 5JECA 3V5NA 3FLMA 1N6OA 5A6SA 1XIVA 2DAPA 2IW1A 2PWAA 1YBMA 4CQNA 3W5DA 2WNIA 2ATVA 1ORVA 1WHSB 1A71A 1GSHA 2GNPA 2X3UA 3AP2A 4RIHA 3DS8A 5HK8A 1QK4A 4OA5A 5D84A 4DUYB 7GPBA 1EQ2A 3OIVA 3KR9A 4Y9TA 1J49A 1SCUB 2VP3A 4YCMA 5EA2A 1XX6A 1XYGA 2O2DA 3ABQB 3PSAA 4HNGA 3IEVA 1LTHR 1EJ2A 3G0GA 4NMMA 1KEUA 1NTRA 3STYA 4CM5A 5K3OA 2DFKB 4UTXA 1GXSB 1NXSA 2CZGA 3LRPA 4NRDA 1BCSB 1TKRA 2B37A 1E1QD 2R6FA 3WKCA 5CFOA 1BWSA 3E61A 4C2AA 3KSMA 4FR0A 1WKCA 1D5WA 1ZCFA 2FP3A 2I34A 4CCWA 4EW2A 1B8OA 2IYSA 3WDKA 1P3Y1 2OORC 4TWBA 3TQQA 3ZGVA 4HLUA 2HWWA 3ITNA 4UEJA 1Y8QB 2BEUB 2XMZA 4ICIA 4EBBA 3P19A 2PD4A 4XX0A 2QTMA 1Z7YA 2BEJA 3B9RA 4U7HA 3MT7A 4YK7A 1OHHA 4PN3A 4LA4A 3NVKI 5EHIA 1T2UA 1H2ZA 3GRAA 3DBRA 1AGRA 1IHPA 4W7IA 4BNUA 2WM2A 1M2WA 1AKUA 1DBQA 2RHOA 2VJAA 5JXHA 1E0SA 1I80A 3M5DA 2JFQA 4URXR 1GAJA 4TOIA 1VGQA 1AS2A 5JDCC 3R9XA 1E2IA 4CV2A 5BSVA 2ILTA 2WZBA 5LZ2A 1ZH2A 2IYYA 1E3QA 4QYTA 3LUKA 2ERYA 1P9OA 1E9EA 2FR1A 4MRRA 2KWIA 4JU8A 2AQKA 3VZBA 1NN1A 1G64A 2O2JA 3MJ4A 1MOPA 2Z6VA 3N05A 4OLFA 3N2EA 3WB0A 1KQFA 4ZEMA 4OAPA 1YRYE 3QITA 1XB2A 1HEIA 1N2CE 1NW9B 3IB6A 3PJGA 5LP6F 1XU9A 2R5FA 3A1NA 3RVMA 2GBFA 3BK1A 4D3DA 5AW7A 2GARA 3M6LA 1AM4D 3EHDA 3HHEA 2V7QD 2APJA 1IHYA 1QG6A 4HTAA 3FRJA 4IRXA 1T9CA 4G07A 1ZDMA 2WJVA 1JX6A 3HDVA 3U4IA 2P9HA 2EJBA 3H8SA 1EFKA 3TXAA 5LXTB 5IKXA 4FHDA 2E5LB 2JFOA 3O9VA 1FLDA 4X00A 4MKHA 2FPKA 5ALHA 3IKMB 1ZA1A 4PYKA 1E96A 2PCLA 4LYEA 1M6HA 4U5XA 4YMVA 4DV0B 1JDVA 1YS7A 2CGEA 4XKJA 1OIWA 1TJPB 3ESDA 3ZTTA 3HFGA 4YUXA 5E7IA 5GIPE 3OHPA 1IXRC 2G9QA 4L2IA 1IZ9A 1MIOA 4JVNA 2VRCA 3DLCA 1CR0A 4LXGA 1ENYA 2W58A 3A26A 1EK2A 1LLQA 1SIUA 1V6AA 2HDOA 4NQZA 3WRWA 2COEA 5U4XA 1RI2A 3ER6A 5DWVA 4QT0A 1Q50A 2G83A 4MW6A 4BFWA 4DV5B 1E3WA 4HB0A 2KE5A 1TEVA 5LFAA 4ROTA 2AN1A 5C1IA 5LKRA 3N7UA 2EL7A 1AQIA 4DV7B 2FAXA 4WHMA 3TCNA 1JFTA 2PXHA 2ALJA 2Q4DA 1WLYA 2QEQA 2ZAGA 5FNVF 4NU0A 5BUQA 4MW4A 5KTNA 3EGOA 3Q7TA 2QZ4A 4R16A 2ATIA 2VDKB 4D0RA 4UDXX 4HFNA 4ZZ2A 3RADC 3BMOB 2KS6A 4L6CA 1EEXB 4KQXA 2QRUA 4MEBA 4BMYA 5BVHA 1TEHA 1YSCA 2PRIA 2DLNA 2W6PA 1V35A 2YWJA 2ZETA 4LY9A 4ZVPA 3EASA 4YV2A 2OO7A 1DCFA 1T0UA 3EUFA 2BE7A 4NOLA 4J0KA 5DGCA 5JDIA 4YMIA 1ORWA 3RSLA 5KWJA 3B9PA 2WTEA 5FA6A 2FWRA 2PN1A 4KWCA 1K6EA 3FGNA 5HDBB 4F8EA 1SEVA 4F6RB 4YWHA 1L7XA 4KLCA 1JXAA 4P36A 5K45A 3W05A 3HB1A 5KVAA 5HQ3B 3U19A 3JD4A 1AKWA 3I12A 2JFFA 2EKZA 3PUIA 4TTRA 4UFPA 4ZDIA 4C7XA 2GN0A 2X7XA 2A7XA 4AMVA 1KQPA 3WFZA 1NW5A 2XT0A 2DGDA 3DGFC 3ED1A 3FUTA 5IJWA 1YAJA 5CJJA 2P62A 3ZGLA 2H7YA 1DMSA 2R96A 2JGFA 3ISTA 3OECA 2VBCA 2ZBUA 4RHFA 3OURA 4DMLA 4WLOA 1CD5A 5A3VA 2EYUA 4N6GA 4Z53A 1MABB 3L1HA 5LIPA 2QAJA 4J16A 2YDXA 4MEAA 1Z4JA 1U3CA 3IQIX 1OFVA 4Q93A 1ZVQA 3ZHUA 1E64A 2QYSA 4QUEA 4J6FA 1KA9H 1D2MA 2X3YA 1M1UA 4JJIA 2CVOA 2H1RA 4MO9A 1G20E 2PU5A 4WESB 4HDRA 1QH9A 1NSTA 1Y48E 1ND6A 2QAIA 2FZGA 3U3DA 5HUJA 5JADA 1JZQA 2XF2A 3FLAA 3OTIA 4FLFA 3ZZTA 2REOA 9LDTA 2ZUEA 1N6LA 2LRHA 1JQJC 1ULHA 2JLBA 2I54A 3B3QA 5K0LA 4EHLA 1BNCA 3F6CA 2VHXA 2CLKB 2HZBA 1EA5A 2OGTA 3AUJB 3PPXA 4HGPA 4K7JA 4L76A 1X87A 2D0PB 5E3IA 3RHZA 4MH0R 4YRBA 3BM5A 3GDHA 3M6FA 5AHOA 4L15A 3EWNA 1JDJA 2WVHA 1H6DA 2A58A 4PYJA 1HR0B 3IUEA 2RGUA 3HLTA 3PXDA 2JBAA 1NBMD 3RUCA 2PLFA 1GFIA 2ZI7A 3I9LA 3QUQA 4FFVA 2X14A 4HDNB 2L82A 1THGA 3R4VA 2EYQA 2O0MA 2MINA 2ZSFA 3MQFA 2D1FA 4YAUA 4UAVA 2A5DA 4DDHA 2OY0A 3RPEA 2D5AA 1HYBA 2O59A 5DNAA 3EPJA 5HDQA 3IE0A 4S2EA 1MGOA 1L4MA 3FBTA 2YVQA 1EYZA 1XRMA 2Q3DA 3IAS1 5BSUA 1PSWA 3WQSB 5JRJA 4WECA 3KPWA 1GD1O 2B20A 1FPQA 2JANA 1YMQA 4CIAA 2ZUDA 1M73E 3SXUB 2VXBA 3TL2A 3ZZUA 2CLEB 4YPOA 1YZKA 2FN7A 4EKEA 2I4LA 4M76B 1V7CA 4DLWA 3GFPA 4GWGA 2IUUA 4DCCA 3OBIA 4QU8A 1AA6A 1Q57A 1UKEA 1D8TA 3F5MA 1X15A 1K7YA 3IBTA 2QNRA 3QW4B 4KH0A 2K7FA 4C06A 4O2AA 1NE7A 4EIWA 1SK8A 4HSEA 3U0VA 2C9DA 2GO1A 3MC1A 1A7JA 4HOYA 3CVYA 4PANA 3WC4A 4FEAA 3K53A 1U3DA 1ADGA 5F23A 1S2DA 4P0TA 4R4JA 2AGVA 2BFEA 1H2RS 3TBFA 1BQEA 1GPBA 3L8EA 1EDBA 8OHMA 2HDWA 2ZT5A 3GP8A 3OJWA 3TGLA 2QU8A 4RGQA 3BUSA 2CSUA 5F64A 3BPSA 3V2HA 2WSYB 4MVJF 5GJVC 5B3JC 1XN1A 1G4UR 2R3SA 3WL5A 5K99A 2AYZA 2BFDA 2R8YA 4Z4CA 1HYGA 4P0PB 3KZMA 3LLUA 3MFQA 5E4TA 4NCAA 4GKJB 2CMFA 3U2QA 1FW6A 1G42A 1KIAA 1M1NA 2GERA 3P2JA 2BL4A 1D4AA 2I29A 3NWOA 4HH3C 2NZ2A 2H07A 3HADA 3IQDB 1RQRA 3DF7A 3RYFB 1YBVA 2B6NA 2YH2A 4ONEA 4RM3A 2CL6X 3GT7A 4UVGA 3VTAA 5FWYA 5CVUA 4ECAA 2XBMA 5BQPA 3K6RA 3Q3IA 2A33A 1R4NB 2VYNA 4L8YA 3QPVA 3WE7A 2PQ0A 1WZCA 2P9FA 4WACA 5T67A 3RS3A 4GI3A 4LVUA 1KAOA 1L8OA 3ZNQA 3ZQ6A 1I0ZA 3OY7A 4CKWA 4TYNA 4LYDA 1PR3A 1UFRA 2YMMA 3BCUA 5B3LA 3Q7EA 1S5PA 1P2UA 5KS2A 3U3KA 4B2LA 3QTBA 9LDBA 5CCBA 2GK3A 1ETHA 2I3AA 5CB4F 3WLSA 2C07A 3FNHA 4CIXA 4PVCA 3PC3A 1TADA 3IL2A 1IK4A 1G20B 2OG1A 4XWWA 2C2HA 2GOYA 1TW2A 2JGIA 2QLLA 4BKOA 5A4FS 4YJ3A 4HPWA 2HMVA 5A1TA 5E1BA 4IWXA 3W3AH 1ILWA 3B2EA 3WGHA 2FRDA 3FTEA 1G63A 1NRWA 3FSRA 1M2EA 3MN1A 4JEUA 3WKAA 2WZQA 1ENOA 6REQB 5TQVA 5TMEA 3KR1A 3RFFA 1FS4A 3DHEA 4HMOA 3HR7A 4LWZA 4IL5A 1N92A 1Q1EA 1UDRA 1DTSA 1T8PA 1BYUA 1TECE 3BWEA 4AICA 2OAGA 1GSOA 4UUAA 1QC5B 3NTVA 5EL0A 4BO3A 2Z2ZA 1VCIA 4TUYF 3U7QB 1FYVA 2TMYA 5E38A 2P2GA 2D59A 1QIGA 2EJCA 1A9ZA 3I2GA 1K7EB 3PFNA 3G0BA 4ND5A 4LF8B 1RAGA 4BNDB 1YIDA 1XXHA 4MGZR 2PX5A 4LMPA 2VUHB 5K3SA 2R4TA 5I9IA 1EDEA 1REQA 3ZHYA 2C9MA 1FFXB 5C53B 1OXBB 5EY5B 1CJMA 3RYHB 4DBLC 1DPGA 3W06A 4YRQA 3H97A 2FSGA 3WL3A 3ZWXA 4BLPA 2DHRA 4UBLA 3LX4A 3PDCA 1B0PA 2FP4A 4P83A 4N54A 5JQGA 5E2AA 1OU0A 1QP7A 1ZGJA 2QQEA 3N8NA 3UW3A 3NDBB 1G1AA 2VHYA 4KGDA 3T9EA 2WJWA 4DCNA 2E21A 2A9VA 1I6KA 4FZVA 3NATA 4GBED 4QPDA 5B36A 2J3EA 4HWGA 2GEDA 3UAXA 3ISJA 1EDZA 3KHKA 5AVZA 1M2JA 3UK6A 3ENNA 3Q2KA 3TSOA 4F85A 4DLPA 3EEOA 2QN1A 3TNDA 3DMGA 3HRIA 3JS5A 3ET5A 2FG5A 4CDRA 4CLDA 1H1LB 4RPJA 4EEKA 3MJTA 5ADWA 3LUJA 5MGNA 4NS1A 1H2WA 1YE5A 4HLNA 2EEZA 2KQUA 2IIPA 4LHEA 3V4FA 4EDHA 1Y34E 3RC9A 5A7FA 5KIAA 4PGAA 1EM6A 3LXUX 4WSOA 4EZBA 3GPIA 4AO7A 5JUWA 2ZPTX 4G1FA 4UM5A 4QD3A 1QWOA 3OZFA 3DC2A 3EOAI 1HY3A 2WZDA 2ON6A 2NO0A 4UVHA 1EHYA 3UM9A 3MRXA 3CJRA 5FLKA 3I6MA 3SD7A 1LDGA 3WGLA 1TNDA 2EHDA 3K0KA 3DAFA 1U9CA 3L8DA 4NBVA 4PSKA 2BGGA 3CUSA 2OXFA 3L1JA 4HTFA 4FVTA 3DDSA 4PQFA 2EC5A 3UO8B 4Z54A 5BORA 5JFOA 3WQRA 2Y1GA 3V4PB 1NUUA 1CY4A 1RYFA 2NYAA 2I22A 3OP4A 1W4ZA 1ECJA 2PH3A 1TF2A 3NT5A 3AHJA 2GN6A 4BKPA 1TEXA 3IGFA 4MICA 4W5RA 3GGCA 1E4VA 3JAWA 2PH7A 4H60A 2Z30A 1ZK4A 2O50A 3EISA 1LU9A 1Q7TA 3I73A 4OJQA 4UDNA 1VA5A 3TMYA 1WCIA 1VJ0A 1MPTA 5JPDA 5M5BA 3AU8A 1X8JA 3CPHA 3PNBA 3RS8A 3B3FA 1JS1X 4ZVNA 3C5VA 5DBOA 3WIOA 3QU4A 2GXQA 1OXXK 4ETWA 3NTUA 3E3LA 2GPJA 2CHFA 3KAKA 1V5WA 2DKFA 3IV6A 2HPVA 1J21A 1QTNA 2NO5A 3QSGA 2PK3A 1ZVMA 2Q0XA 4MV6A 2B2XA 1BD4A 5GAJA 5KAMA 3FAKA 4JI5B 4DBLE 4P7GA 5CLLA 4MNTA 2PKEA 2GPTA 3WXMA 1N9ZA 1VXRA 2PPVA 5FCDA 2X4DA 2VJNA 2AFHB 2JAWA 1ZP6A 4MWDA 1QS0B 4HVLA 3H9JA 3M4NA 4AROA 4ENSA 3PX2A 4XSGA 2GM4A 1D9XA 3WK9A 4R0NA 1HPLA 2ONCA 4DM3A 2WA2A 3WJ1A 2PBZA 3GAZA 3REOA 4DCJA 1XNGA 2NVWA 1LPSA 2I55A 1ZIOA 2AK2A 3B60A 2PGOA 3FVVA 4IDHA 4WNAB 2LIPA 3I01A 1QIKA 4E31A 3QVJA 1WUYA 4S0ZA 2PX6A 3UF0A 1BSVA 3QTLA 2XGGA 5EXPA 1CJKC 4EUEA 1QZXA 3K0HA 5JCOC 1U3TA 2BUAA 2A6PA 2XXJA 3MCZA 4IIBA 4MW9A 4R5HA 3BQMB 3SFVA 3LT2A 1BHSA 4CKZA 1YL5A 3OFSA 5EHXA 5HFJA 2RSLA 3CEHA 1CNEA 4UD2A 2O5RA 3CX3A 4RUKA 4CCSA 1P7ZA 3DZKA 2VF7A 2J9FA 3ON5A 3N2KB 2NZ8A 2VRCD 5CEJA 3DXZA 1UZAA 3ZW9A 4HKTA 5KCZA 4MVJG 1H9CA 1PEAA 1QRRA 4RVSA 1F4PA 1KERA 2H3HA 5HF6A 4UFOA 4E1BA 4KYVA 3T5PA 1RU3A 1ECPA 2A2ZA 1QG0A 2DQZA 2PLRA 2ZYRA 3BERA 3C6QA 2DTEA 4S1VA 4UCFA 4OQMA 3REGA 1ZPDA 2XNCA 2ZBVA 1MX3A 1YRWA 3DSRA 1G8MA 2QJOA 3NLLA 4OHPA 4ZZ1A 4BVHA 2CV2A 3ZPXA 4TM8A 4RBNA 2FUG1 2Z95A 1RXSA 1TW3A 2ZJ8A 1UFKA 2OR3A 4LYGA 3W5AA 5JJCA 4UHFA 4W63A 3WL7A 4KX3A 4CMJA 4UTPA 3ZJVA 2IH4A 3WWPA 3GCGA 2OQRA 2HSEA 1VYVA 1JKIA 4CKEA 2JF0A 1EFTA 2LDBA 3ASVA 3F6SA 1YC5A 1LDMA 3ZD8A 3ZWOA 1X86B 1NVBA 4MUYA 2N1MA 4ODIA 5FPTA 3ACDA 1NATA 3H4VA 2SHKA 2ECFA 3RRYA 2FPOA 1H9AA 1V16B 4JP1A 1WQ1R 3UEOA 4PBRA 4CF4A 4BMOB 3S29A 1IN6A 2AQHA 2JA1A 5KJCA 4KAJA 3DE0X 1TLLA 5EMJA 4ZU3A 1I7QB 4ZC8A 4UAUA 2R4QA 1NX9A 3L8ZA 3H5VA 1B73A 3WMEA 1CQIA 3O3CA 2BV3A 1TYCA 3NEJA 4FMDF 4OYYA 1AHPA 1XMQB 2BKXA 1QPBA 1T4CB 5FI0B 1GAEO 4KQ6A 4OYRA 4RPLA 4C4TA 1DBIA 4WKNA 1NR5A 4I5DA 4TXMA 4ZZ3A 4JT4A 3QF4A 2MYPA 1SU7A 4WJKB 5AK6A 1U9ZA 2XTZA 2W4QA 4HDMB 1UDBA 2RAVA 5FTLA 3TLEA 1J5PA 2C84A 5AICA 3I58A 3U13A 5FDFA 1M34E 3AKYA 3P9KA 2PMWB 3LT1A 4YJHB 3VU0A 2CUKA 3BL8A 2W2VA 5KZMB 3HL0A 3C15C 1DKPA 3ICWA 2ODWA 4UAGA 1UINA 2J5XA 5IASA 3PD1A 1GPLA 2FV8A 1J9EA 3DVRX 3PICA 4KUEA 4OB6A 2DJIA 3M1YA 1JQ3A 1CUIA 1MJGA 3N8KA 4Y8VA 4P8RA 1PZFA 2Z9DA 4G0MA 3EQ8A 3UZUA 2PT6A 1PFGA 3C5HA 4B40A 5IZCC 1JBEA 1BZYA 1DZ3A 2P77A 3LX5A 2H4YA 2P79A 3A6HA 3PI7A 3SK0A 4EI2A 3I9NA 3M4YA 4QASA 1M0TA 3ZDCA 2I76A 1L5GB 1IB0A 3H5LA 1U63A 2Q8NA 5C8VA 3PGJA 4PICA 1QIEA 2P27A 5CVJA 1K86A 1N4DA 1S3SA 4OQLA 2QV7A 5H80A 5IAKA 1VLLA 1UKYA 4C14A 1QYDA 1KK0A 1W8IA 2WTMA 3JVUA 4TL9A 1AG9A 2WWWA 1R4ZA 3QV2A 3C43A 3OE7D 1AUVA 4LTMA 4P4UA 2JJ2A 4BFTA 1UADA 4H77A 3E82A 2UZAA 4XASA 2HIGA 2OFFA 7ADHA 2BMFA 1GA4A 1MQAA 3PFWO 2A9OA 2BFBB 3TAXA 8MHTA 3NEYA 3G6WA 5JSFA 3CO5A 4MQLA 5DHTA 5C4GB 1HYHA 4RK4A 5FL7A 5EN4A 3ZCUA 1GIAA 3W5UA 1P7VA 3P9QA 2PT9A 1WU7A 2VJLA 1ISHA 1FLVA 2EQ5A 3MPOA 3MOGA 1J07A 1ZMOA 2H8KA 5FLYA 3C1UA 2G8NA 3VKHA 1OASA 2GAOA 2XWPA 3ZS9A 5TXGA 2Q5FA 1RAIA 1TI7A 4BNVA 1U94A 2FLWA 4OJTA 4D98A 1V71A 2AMLA 3SU8A 2P6MA 3AY3A 2CNWA 5ENVA 5D5QA 4P3OA 2VG8A 4NYJR 5HA5A 2QS9A 3GF4A 4OBWA 1FVXA 5EE9A 4UMEA 2XB9A 4E94A 3U7RA 5K6RA 3GLIB 4CU5A 2K7ZA 1CJBA 4PXYA 2QYOA 2XXBA 4BRSA 1N0WA 4CG3A 1Y9ZA 2IY8A 2KHZA 2R6JA 3LDAA 4TV9A 4B43A 4BP3A 3W7BA 2QZPA 3GVXA 3MWGA 3KE8A 4W1RA 1R0RE 3PR3A 3O8RA 4R41A 3Q85A 1T4MA 3DMNA 4I3FA 2CBZA 1AX9A 3RKUA 5FPPA 1HLDA 4C6TB 1NJ5A 3RBVA 2PH1A 4WUVA 3A0RB 3CLUC 1UIRA 1XI2A 3FPAA 3OCVA 4MLCA 1L5VA 1WY5A 2HNKA 3QVVA 2VWHA 3RARA 2Q45A 3AM3A 3T06B 2W70A 3VR3A 4CDGA 3ZNNA 1P8AA 4P82A 1F8FA 1NPDA 4BX9A 3AF6A 1HTTA 2GESA 4UAJA 5ALJA 2XCTB 3PL5A 3RK0A 4ND1A 4GSKA 5CNIA 1DC4A 1P4SA 2VHVA 5T64A 3ZTWA 3HP4A 1Y6FA 2QVBA 2VYND 5CIQA 4LK3A 5ICCA 2VP4A 3IILA 3L1VA 2Z2YA 1OWMA 2OD7A 4DR3B 2CE2X 5JQWA 4TYMA 3B9BA 2P9YA 2WHYA 1BJKA 1QOPB 3QX7A 2Z58A 2J3IA 2OCPA 1VBKA 2G77B 3R8CA 5KMGB 4W5TA 5JEEA 4AQDA 1M34B 1R4AA 4WAUA 1YFJA 5JD5A 4DNOA 1DBPA 4G3XA 4YRCA 2MIIA 3RAPR 2V4MA 3L6RA 1KEEB 1VLJA 4HEA6 4IDQA 5AKLA 2XGMA 4TVBA 4X7PA 1V5GA 4ZKEA 3BGIA 3LUAA 4Y6SA 1UK8A 1YJCA 2FPRA 4K03A 3VNRA 1HDYA 3L77A 4ABYA 3ER8A 4R7TA 2VHZA 4NZMA 5MDHA 2G76A 2ZJBA 2W2QA 3OOHA 1JBQA 2BI7A 4HY3A 5TS3A 3TZLA 2O2EA 3AOGA 3RS7A 3TD9A 5FR1A 4PXAA 5BRNA 2YYAA 5E3JA 4JLAA 1EFVA 1W581 1DQNA 1NBEA 1SZDA 2BPOA 2J3KA 2X6TA 4KV7A 5T3YA 2ONJA 1E79A 4K1LA 1NN0A 4XCVA 1O5IA 3V1NA 2PWBA 3I83A 2HHJA 3A3OA 1Q7BA 3MWYW 4O4LF 3TTXA 2O5VA 3RTGA 4FBGA 2IYAA 4HH0A 3QVGB 2C7RA 5AWFC 4C2UA 3N76A 4J8PA 4JVMA 2RB5A 3VU3A 4ZQGA 2QW0X 3EXHB 3FYTA 2P4HX 1EVQA 4MYRA 4ZC1A 1O6CA 1S6YA 1W47A 3JVVA 1NY6A 1CS0B 3EY9A 4MEJA 4OKNA 1AKEA 1GL7A 1KYZA 5BSWA 3EVCA 3ZLBA 2I8CA 4IPTA 2DFTA 1WXEA 2DH5A 1KYVA 1USIA 2H1FA 1OBOA 1JDSA 2O6HA 3ANLA 3IFSA 1XAGA 2XUHA 3HP1A 4EY3A 4YRZA 3BXGA 2VRNA 5CLQA 2A9FA 5F2EA 5BN5A 4Q7LA 4OAQA 2GPBA 3NOQA 4RJJA 4I9GA 4N3BA 4WBSA 1GZVA 4H3KB 1CE8A 4ZTBA 4U7DA 2PS1A 3HXMA 1YQ9A 5CH8A 5E9WA 4CTKA 2REQB 3U40A 5JZ9A 1CUUA 4JJKA 4MDYA 3IPLA 4R8RA 2D54A 4GW3A 3GARA 2IKQA 4HDCA 1IVSA 4DMUB 3CVJA 4P3YA 3GEIA 3KFVA 2EIXA 1ODFA 2V9PA 4KRYA 5F5NA 1IJEA 3BK7A 2UZ1A 3DFMA 3TD6A 5K1ZA 1DKUA 1USVA 4DOMA 3IPCA 3OCCA 4JEIA 1A7KA 1DC3A 1ES9A 1L1EA 3IHKA 2HPAA 5GTDA 2UYCA 3TX2A 1DXYA 2IELA 1U02A 3V80A 4L73A 1F6BA 2BUCA 4NJEA 3QYPA 3LPMA 3B1FA 3MBOA 4QRHA 1M72A 3Q5DA 4Z86A 3KCNA 4AM8A 4RH1A 4CUKA 5AW4A 3THYB 2VZEA 4PYNA 3DV0A 1X3SA 2QW1A 1OYYA 3HY6A 1ZCJA 1LTKA 4B47A 4ZCMA 5KVVA 4C7OB 3R9WA 1HKUA 2HJRA 2V7EA 1CY1A 3V7UA 3TR0A 2Y77A 5DMHA 5AOCA 4E3WA 1A0OA 1CS4C 2J3LA 3W2IA 2EAUA 4A5OA 1GPUA 3JARA 1J1UA 4V0OA 5ECYA 4JC4A 2H54A 3PXGA 2RCYA 1CY0A 2E3JA 4ZAXA 5G3YA 3IXQA 2CVQA 4IW3B 3ZQUA 2ISQA 3SHWA 2Q1XA 4WXRA 4DJEC 2R7AA 3TVDA 1L5MA 4QM7A 5AD1A 3ONEA 5AKGA 2AS0A 2R87A 3BHIA 2ZDHA 1F2UB 2ZTMA 3FPFA 3Q6IA 4D7AA 3Q41A 2VP2A 4N9QA 1MDFA 1HRKA 5IVIA 1EGAA 4UARA 1H3FA 2RI6A 4ARIA 1UBGA 5HILA 1KP9A 5D1NA 1RXWA 1SEPA 2PX0A 3AEKA 2DQSA 3HKDA 4JJEA 4PY2A 5FBLB 4YCLA 5IUJC 1KEVA 4MMXB 3OJXA 4H3VA 2J7KA 4F5DA 3IELA 4WLUA 1QG2A 4HNRA 3WLQA 2HBZA 1AQUA 2I66A 4Q37A 5EWLB 3RTDA 1APBA 3OIYA 4J0IA 1DFIA 2UUBB 1ZXXA 1ADCA 1DIOB 1V3VA 5HGJA 3DZIA 1P0MA 4X84A 1EGMB 3V1TC 2FQQA 3TLJA 4D41A 2P3QA 4F4UA 3K9WA 1R6DA 1U2ZA 3AJ8A 4H7FA 4KI0A 1YS2X 3MD9A 3PNQA 4LHZA 2Z2IA 2ZRPA 2QXUA 3HYLA 4M60A 1WVGA 4PO8A 4RDCA 4W9NA 3JR7A 3JWJA 3U7IA 4XVQA 3FZEA 4GG1A 5EZ5A 2H92A 1P91A 1PVDA 4MRMB 4UTNA 3ONDA 1OFGA 3AUFA 3DL0A 4B4KA 1Y5RA 2JKYA 3JSAA 4ZOLF 1RE1A 5IT5A 2WG0A 3HN2A 3UMYA 5I7VA 4GMDA 4B6RA 5D7BA 5CIWA 3OJOA 1N5DA 4Z7QB 3L9WA 3ZGOA 1E7YA 2PTHA 3GZJA 1XT6A 2AC4A 2Y0CA 2FSPA 4MARA 4N8DA 3SC2B 4G24A 2B7BA 3T5MA 4RTLA 5IVHA 4A2PA 3PDHA 1ABFA 5CFNA 3LXXA 1OLSB 4YAEA 3T0GA 5JZBA 4DR1B 1NXXA 5IK2A 3HY3A 4AFNA 3AFNA 3RS9A 4DSZA 2XRMA 2UUPA 1C7FA 1VZ3A 3MJHA 4JLOA 3V1KA 1X7WB 2I2AA 4F8JA 5SY4A 4BN5A 3QKUA 4TSFA 4OB7A 3K20A 4IGKA 1PJ3A 1XCPA 1U7XA 4JWTA 1P18A 4E22A 2OG2A 3VBEA 4BVEA 2RHLA 3NAZA 4Z2AA 3M6AA 4N39A 1IN1A 3PCTA 3QEMA 2HHHB 2I78A 4JBXA 4QFBA 4LHYA 5H83A 5FA5A 2ZJ1A 3AHEA 4HGYA 4ZWNA 4AS2A 2NVUA 2RBGA 3E9CA 3KYDA 3LC0A 2WT8A 1Q6ZA 3DDZX 1E2GA 2V9ZA 4MQFB 5K4AA 1G5TA 1SIOA 4U7FA 1USKA 3QU7A 3BKWA 3GRZA 4TGLA 4BO8A 1P2FA 1D9ZA 2HFKA 4LNUA 4KQHA 3TZ6A 1FJHA 3NOVA 4NZNA 1J1IA 2IYFA 2QPAA 3IRUA 3NS7A 2RD2A 2ZSEA 4ZTUB 5ES3A 4RSHA 1BKYA 1CZOA 2RHMA 2VXYA 1YJXA 3GCZA 1UMBB 2YZMA 3E5HA 3K1AA 3HBLA 1Z2DA 3C3KA 2DPGA 4TZKA 2P2ZA 2WTUA 3OZTA 5IG2A 3T5CA 2P5TB 1PUJA 3SZMA 3A28A 5BN3B 3QKSA 4XTRA 5REQA 5K3CA 1OXSC 3R7WA 4FOSA 4LY0A 4PE5B 4BEBA 4N03A 1EAMA 3FGZA 4M1YA 5IKEA 4TUYB 5ELLA 3NHSA 5JYCA 2OEPA 1W4LA 1XALA 4AS3A 1EWKA 5KSPA 1ZBDA 9GPBA 5FLEX 3R23A 3GPCA 1V8ZA 3GJ6A 4B8ZA 3BGDA 1B4DA 3E48A 4FKZA 2BHNA 1QCCA 2BM1A 3NGMA 4NU6A 4HAYA 2O14A 2ZJ7A 3ZEAA 2BBOA 3SSMA 5BMOA 5DX0A 4PHFA 5GIOE 2EIHA 5JLAA 3TRFA 1G7SA 3IERA 2JJ2D 2OV8A 4ALLA 4XCXA 1KIFA 2WJ6A 1QHEA 2CZCA 1W46A 2ZRLA 1UPXA 4U0JA 1EBUA 1RKQA 3W9YA 4D9EA 1JN0A 2D13A 5JW6A 1ZEJA 4FBMA 4CKCB 1CZRA 4JL6A 5FL7D 1TM1E 1NULA 1UXKA 1QAMA 4K40A 2VAXA 3RU9A 5DN6A 4C1NA 4YLGA 1QIIA 4FSHA 4E07A 3EDQA 3BGWA 4KPYA 4OD0A 2ETVA 2PKQP 2XDYA 3D02A 2ZRMA 3J7TA 3ZY6A 4M99A 2JH9A 4QXPA 2GZ2A 5LQJA 5AKYA 4CKBB 1GKYA 2ARKA 3ENZA 2XVMA 2PUFA 4QT4A 1RLUA 1LBHA 3VH2A 2ZZKA 4KDFA 2CNWD 3VM6A 1TC2A 4UPDA 2ZBPA 4GL4A 2Q7XA 2GDJA 1Q0SA 3P9NA 2TS1A 3KUKA 4H7HA 1CR4A 3SDBA 1WZNA 2QE7A 4H1UA 4YDRA 2O0JA 4QDOA 2ONZA 4EQZA 1CX9B 4QDKA 4EJ0A 2GCPA 4G8CA 1I4LD 3T1QA 2AN9A 4JBHA 2C3UA 4UM9B 1RZVA 2WQZA 2HHLA 2ZRBA 1KWKA 3UPDA 2PEZA 4AY3A 1WVMA 4KAXA 4O33A 1DDOA 3ZBTA 3RAEC 4CM8B 2Z3ZA 1MO5A 3D81A 3IURA 3NHRA 5J40A 4JLDA 3BICA 4C04A 4B32A 5C1DA 1VIVA 1HMYA 1ISFA 2DEUA 4CEHA 1HZZC 1UAAA 2O2HA 4N41A 2QSYA 3LIPA 1OAAA 2B7LA 5C8YB 5ER6A 3VR3D 3GP3A 3IPXA 3KUUA 1CY6A 3SAJA 3FPCA 4XEHA 4X64B 1G6Q1 3ORHA 3QUAA 2B35A 1OBHA 3HA5A 1V39A 2R00C 4JC8A 3GA5A 2ODNA 2PX4A 1GWNA 2FRXA 4MVJI 5WRFA 2GYWA 4B5LA 2DKOA 4PPGA 2I9PA 1B8VA 4IS3A 4TQAA 2H2GA 3DMFA 4RZXA 1NDQA 1LFDB 2JGMA 3H5AA 1GRCA 1TM4E 2EARA 1BN6A 1KETA 1MAHA 1NOKA 1TK9A 2X4IA 3PKZA 3QJ5A 1QGDA 4RLFA 3VJLA 5L7WA 2JEZA 1O03A 5A5EA 1CF2O 2UDPA 5FH9A 3KR2A 1J23A 1K8QA 3VDNB 3ECCA 4FLMA 4RA6B 4OHOA 2JK0A 2P40A 4QUHA 3KSBC 4PNHA 4DLBA 4MWZA 2AHRA 3HB5X 4AY6A 4BJ3A 2XQIA 1QRSA 5EG5A 3V46A 1TCAA 5DYYA 4AUKA 5D3QA 1TJ5A 3ONNA 4DANA 3ZLVA 1RJ9B 1SOAA 1V3QE 5CFPA 3K8QA 2PUAA 3NTLA 3TN7A 4JQYA 1G5RA 4NOMA 4R8KA 2NZXA 2V59A 3MS7A 4RW0A 1TCBA 2I3ZA 3QIVA 4XDHA 2GPYA 1U4OA 3WQBA 1JSLA 4B3DA 1E3JA 4TQ9A 1UJCA 3Q2OA 1WZUA 4ZHQA 3PHGA 4X1YA 1A4RA 1ZONA 2PSJA 3ETNA 3KJGA 1T4GA 3VHRA 3WNCA 1E79D 1R15A 3KPYA 1VJ5A 2XDWA 3PX3A 1JKJA 1ICIA 4L8LA 2Q49A 1XK7A 3NM5A 2O3SA 2AEJA 4DMCA 1QHYA 1EE1A 2VPPA 1ULBA 1GUZA 2WKWA 2Y76A 4YRDA 1K68A 5LCXA 1IG3A 3EVAA 7REQA 5C4MA 1M2NA 2GO7A 5TF4A 1EHIA 1FDRA 4KGZA 3NTQA 5E0OA 1HDCA 1F06A 2ACWA 3COSA 5ITSA 1J2YA 3W5SA 1TQDA 4UHKA 3CZCA 2V3CC 1KJYA 2C5EA 2LKDA 3P9ZA 3LQRA 5IARA 1A77A 2H3EA 4PFSA 1IBMB 1MO6A 3MWLA 4G67A 3SHTA 4Q66C 1SXJC 1OFUA 1UKBA 4NOKA 5B6IA 3THWB 2O8BA 3LPLA 2BI8A 2YBEA 4RJLA 5CRIA 4IO1A 3LLVA 1E1KA 2ZS8A 5DLDA 4JOCA 4TMTA 4ND6A 4DJTA 2VSNA 1ANKA 1RRFA 3MTDA 4G8DA 3RHSA 3QG1A 5IP5A 1NRIA 4QTTB 2BFFA 3PI6A 1U0FA 1EWVA 1W2HA 1RHRA 4TRMA 3GGDA 4HNQA 4DDMA 4HX5A 1J39A 4EITA 1O6FA 2AUNA 4A6PA 3ITEA 3N07A 4M9ZA 3IIKA 4BU0A 1PZHA 4WZAA 4NP6A 2E4YA 5GONF 5J47A 2IC5A 2WIBA 3H0EA 4CQJA 2CLHB 2WR8A 3DCJA 4KUHA 4WVFA 3R44A 1D4OA 5BMVA 3HUDA 5AKJA 1VM6A 2EFEB 3UA4A 3TG8A 4DV2B 4G2TA 1B16A 4MVCA 3Q87B 4M38A 2C4MA 5IJ9B 2P9GA 3WWDA 1L7PA 2A14A 4HDQB 1SXIA 2OGUA 4V2IA 3UXMA 3DBLB 3OKAA 2QG6A 4P32A 2L69A 3DCNA 3O2QB 2X0FA 1IHXA 2YMPA 4WXYB 5C2JB 3FUUA 5IDVA 1JAZA 5AJTA 2NTVA 2PAFA 2WD7B 5ALFA 3FROA 3UFXA 3CNHA 2Z6AA 3I4FA 4AJNA 2BTQB 3M5CA 3ZH2A 3URMA 3BMQB 3CXUA 2QN8A 2Q4TA 4LFBB 1W48A 3U16A 2BP7A 2H31A 2V55B 3O2JA 3RE1A 2BISA 1OC2A 1Z12A 5KYTA 3QVTA 3VC1A 5E7MA 3ZE0B 2QGFA 4KC0A 3HO8A 2QTAA 4HDAA 4TS9A 1KJNA 2IEBA 4OGGA 4R5MA 5CVCA 5F12A 3JX9A 5EHNA 1G3MA 1R10A 1PR4A 4P3XA 1YRQA 3NGLA 3TPCA 4LXXA 3WRYA 3DO8A 3INNA 3V8QA 2ZJZA 1WEHA 1DV1A 2HZ7A 4I5GA 1MZVA 4BVJA 5BVGB 3D1JA 5DLPA 2YWRA 3T9FA 2DUNA 2PZFA 4NONA 4D45A 5E1DA 4ENTA 5JXGA 4PRZA 4MV5A 2BIFA 4AIRA 3A1EA 3A3YA 1OAOA 2BSXA 5BN4A 4FM9A 1Y5MA 4U7TB 1WNFA 2CKMA 1XPOA 1T34A 5A3SA 3K9LA 4JU9A 3NR2A 4Q3NA 1KMQA 2WMOB 4KN5A 2OECA 1T6NA 3MGBA 2I65A 2YHBA 4OKSA 1OFHA 5HIMA 1ZXLA 4DA8A 1UK6A 1FX1A 1X1RA 3ADCA 5HMLA 2HR1A 3D6UA 2B9EA 5HKAA 2FMUA 1TJ4A 1AKVA 3CLRC 2HQRA 3VSAA 3TGWA 1M1ZA 2H1HA 2ZU0C 4MS4B 5JWRA 5LYJA 3ZE7A 1XMSA 2ZJFA 4JB2A 2BHTA 5E6RB 3AY0A 1N2OA 3RH0A 3KTAB 1VG1A 2XE4A 3GFGA 1R0ZA 3LTEA 1DAIA 4ZYZA 2H59A 3GRCA 1J0BA 1U99A 1JDPA 2ZS9A 2O4UX 1ZSVA 4LTNA 1ODTC 2HA0A 3SHVA 4ED9A 5A03A 1LH0A 2PD6A 2X9NA 3M3DA 3C6KA 1J4AA 2Z08A 4PYIA 3RNLA 4MPJA 2DLDA 4ALKA 3JYPA 4LDRA 4M37A 2W6ZA 1ZOLA 2R1UA 1GZDA 5EKTA 2C77A 2H4WA 3B8EA 3EJ6A 3O94A 3Q3EA 4IKPA 4V0LA 3TUJC 4D9KA 4UZFA 3UJAA 4J75A 2QMOA 1J9ZA 2XOXA 4LZZA 3DTVA 5KMGA 2WUDA 4XGNA 4XM2A 3OFJA 2FR8A 4C9BA 3SJAA 3QGMA 1HE1C 2XEDA 5LZ4A 3A58B 4I3GA 1VQ1A 1WEKA 4MDHA 1NF9A 5DM1A 1CJTC 2EWMA 4EMUA 4Y9SA 3T7TA 2AOXA 3KCQA 3BJZA 1P5HA 1YCFA 2M6RA 3LLSA 4AK9A 1D1PA 4TSFD 4HNVA 4BNZA 1WMDA 3DOUA 1V95A 1WMAA 1H66A 1QHHA 4ZFNA 1ZISA 3T7AA 1JQBA 2YY7A 3HSSA 5JSZB 1A5SB 3EQ9A 4IINA 1AOXA 1RPNA 2C2GA 5EZ6B 4BGIA 3O8CA 5H9VA 3H1AA 2X0IA 4P5DA 1TUIA 1U2DA 2BGLA 2YXNA 5GJWC 2D7CA 4J76A 1ZK3A 5EKXA 2HA4A 2Z0MA 2R2GA 2XA9A 1UP7A 3BFPA 3WLMA 3WQHA 4ZEOA 3VSCA 4YAIA 5EIHA 1N8TA 1NPTO 3MWJA 2YUTA 1L7VC 4MUGA 4CT0A 3D4OA 1PFQA 4RWEA 4ZPXA 3OSZA 4MA0A 1I7NA 1LPOA 2IZ5A 4YAOA 2VC2B 4PWYA 4KMOA 1Z5WA 2VYVA 2Q6OA 3NNDA 4FPXA 4JOBA 5H3CA 1VHLA 4J6EA 5AW0A 2V6FA 2JBWA 3RFCA 5IT4A 1E92A 3BSSA 4GGOA 4CWAA 3U3ZA 3TZEA 5AI4A 3JASA 2OHJA 4LTDA 1OWLA 3ND6A 2QTVA 4I81A 3C3AA 4CDNA 4MP8A 2DPYA 2JKVA 1I4TD 3D7MA 4ROSA 3A1FA 3C70A 4RSMA 2FE1A 1P7YA 3ECAA 4D0GA 4G0WA 2CFCA 1IN7A 5EESA 1DKNA 1JFFB 3OJ0A 3AWDA 3N2GB 4JN6B 1JJ7A 4R81A 5FOXA 2I8LA 4OJKA 2YFHA 2FUCA 4EG8A 5TY0A 3BHMA 3PKJA 2EBUA 1DIAA 2G06A 2D2FA 3IUNA 5JDCA 1F1JA 3I9V6 4XYGA 5JPCA 2KLBA 4BEJA 3UMSA 5CT5A 2NZYA 1TOAA 2BTOA 1MIHA 3QVXA 3AV3A 1YCGA 4G4GA 3QE4A 4R05A 5TF0A 3ZWAA 3Q9SA 1JIUA 3FTCA 1G19A 2YBDA 2CHGA 4K87A 4X54A 1MENA 1PK8A 4L4UA 4LDJA 2O48X 1GNPA 5BQ5A 4AYWA 1VP3A 3B48A 3UMJA 3E1KA 1LNQA 1RWNA 4D44A 4RCZA 3TOXA 2X23A 3HVRA 4ZOAA 1BW9B 1R50A 3BD6A 4WEOA 2CB0A 5CGQB 5DDIP 5TQ0B 5DN6D 1RYNA 1JAYA 2GFQA 1Y1SA 3D54D 4Q7KA 1N6RA 4YONB 1GAXA 1DT3A 1U28A 3MJVA 5J2TF 5L45A 5IEJA 2C2BA 3JWEA 4ME6A 3UKDA 4X6YA 1Z8HA 4YQZA 5ALOA 3TIVA 1SBNE 5I6DA 1M1YA 4BZWA 4FI3C 1QTRA 4HQOA 3NYWA 4IXTA 2F43A 2QX7A 4AF8A 3S2UA 2Q3FA 2INGX 4TT3A 3UQZA 1YS9A 2G3YA 2ZDGA 1T15A 4MDEA 1KH3A 4QUKA 2D5LA 4LCEA 5LSAA 2EX1A 1XJ0A 4LS3A 4PYRA 1DC5A 1JSCA 2ZQ5A 5HTKA 4DMMA 4XIYA 1KOFA 4W7SA 4XPIB 1TQ4A 2RH5A 4CL8A 4INJA 5CVVA 1CRWG 5L3ZA 1VHTA 2P90A 4HG2A 3HP7A 4J2HA 1U7UA 4U1RA 5B2FA 4REQB 1XDWA 2CFSA 2Y1LA 2PM8A 5DXJA 4I1UA 3SJZA 2GKSA 4AP5A 2W2PA 1RACA 4I19A 4MS3A 4XVUA 3TOZA 2HSJA 4EGFA 2FPWA 1GV1A 1ZKDA 3AJAA 3UW1A 1DX4A 4A0HA 2AT1A 2HWKA 5LJLA 3OC0A 1R8SA 3OKFA 1P5ZB 4U9IS 1XZCA 2HGSA 3UJPA 4FONA 2IYUA 1M6VB 1DKMA 1L3CA 4IJWA 3KKMA 2JIPA 1JFRA 4UBKA 3HCEA 4OHUA 3EIXA 2ODPA 4LE0A 2ZYHA 3NTRA 4Q12A 2Q6VA 4XQGA 1GSIA 4NEHB 2J9RA 5AOAA 1JEOA 1L5HB 4H7EA 3KZKA 5HIKA 1JL3A 1IWOA 4F92B 1PV4A 4B3BA 4OGWA 2H51A 4GC9A 4NYIR 2HK9A 3H2BA 5ELMA 5CIYA 1WB6A 1W44A 2C8VA 4HNAA 4YIKA 3TLZA 2RHRA 2ENUA 3VHXB 1E94E 5LQUA 4O63O 1OX6A 1P6QA 1T8RA 2PZJA 4MVYA 3KSAC 3PTLA 1KYWA 3HKCB 4EPYA 3DAPA 5L8VA 2DC1A 3AUTA 4M98A 3L7BA 3COYA 3PYMA 1B6SA 2O8EA 3CRNA 5J23A 3WBFA 3UJ6A 1BIFA 1G3IA 1E9BA 1T2FA 2C7GA 2UYQA 4JA2A 4RLSA 3TQHA 3U60B 2PV0A 4M89A 5C81A 1J25A 1T9BA 5KYXB 4AB1A 1GCOA 4HUTA 3LXMA 1EUDA 2Q9AA 1XRNA 2AOVA 2G0AA 2VH1A 3LY8A 2X42A 3K32A 4UZSA 1JDBC 2MU1A 3HJNA 2N46A 3L7MA 1JNXX 4U4AA 4JYMA 1WR8A 3DO5A 1GO2A 1FSFA 1MEEA 3GEBA 4JASB 4JX9A 4NFHA 4K9MA 4AU1A 5DIFA 1NBHA 1HNXB 2V03A 4KXVA 3ZE1B 1V5FA 5TPZD 1X70A 3DW1X 4BGUA 3OPMA 1NVMB 3DOCA 5HFNA 1AKQA 3KUXA 2H1OA 1KBOA 4U0KA 1WDTA 3Q0EA 3OTOB 4B80A 1QBKC 1YCDA 2QUHA 4KV9A 5KX5F 3EY4A 2VJMA 5CAEB 3EPPA 4PPNA 5I8ZA 1G8YA 4GYJA 3GEEA 1SC4A 4PHTA 1NVFA 2XA1A 3HB4X 4RPCA 3CU5A 5EE5B 3G59A 3ENQA 3LC1O 2AEMA 4I5EA 4WKBA 1UOPA 4E7OA 3ZZNA 4ZHSA 1YQGA 2OGWA 1VOTA 4Q00A 1VIYA 3O2NA 4OXRA 5JH7A 1LDEA 2Z4SA 5JZSA 2C96A 4WDQA 4ND3A 3IUYA 1E4YA 2PXXA 3OO0A 3KSDO 1YJQA 1NVEA 3HDQA 5AI0A 5DI9A 1NLYA 4RJIA 3JQ8B 4CIVA 4P84A 3KYCA 3TTTA 1K4YA 1RWKA 1TYEB 3FNBA 4PLWA 4I6EA 1C2YA 4LW8A 2XADA 3Q7QA 2D1YA 2IP1A 5DBIA 4UE2A 4F9EA 5CLFA 5BSFA 1J0EA 1NFRA 3MNFA 5AJZA 4XQEA 3BGVA 1G5IA 2CYBA 3CZPA 3BAFA 4LRQA 4AJ4A 1T1EA 1CY8A 1UZUA 2OBFA 3GR6A 1P4AA 4PAMA 4OP1A 3EXEB 3VR4H 1IHDA 5DCYA 3T3OA 1SBYA 3F6EX 4HNHA 4RA9B 1PNTA 5CJ2A 4L6IA 3EULA 4RABA 5CLGA 1P9WA 4R1OA 2IU6A 2MSDB 3DWGA 1XZGA 3K8ZA 5FPYA 2NU8A 4B9AA 5BR4A 4HR7A 5K8JB 4ZAZA 5KYYB 4NFYA 3O3MB 4D9BA 2L42A 1MB2A 2B94A 4IZIA 2GWHA 1IN5A 1SVOA 2HAEA 3ESAA 5IUNC 5CU7A 1EX9A 1C9JA 3DM9B 3IOYA 5JZMA 1A5TA 2QTGA 1MZPA 2DPMA 1MDBA 3ABRB 1H23A 1YB7A 1YK1A 1F14A 1YO6A 1GU0A 4O2BB 4ZT5A 4OU4A 1SULA 2C3MA 4EPRA 1DJQA 2YYZA 1TTQB 4RVGA 3RF6A 1MW8X 1UF9A 3RVLA 5U4QA 3P0FA 2BN4A 3IUSA 4EAAA 2WDPA 1O9GA 4DPKA 3OUTA 1U5CA 2QNBA 3Q12A 4C0QC 3FYCA 3VTZA 2B5OA 1OWOA 1TRKA 4FCCA 4EYKA 1PGNA 3TVYA 1O95C 4IUCS 4OMCA 1TVMA 3HZZA 4K9NA 2CZQA 4DR5B 2JLQA 4ILEA 1FNDA 1W7AA 1R1DA 5ALQA 4DFDA 2G40A 3ILXA 4KXQA 2XVZA 3MUFA 3NH6A 5FPQA 2CVPA 4G5HA 3G9UA 2Z9CA 1NVAA 5TMBA 5JV5A 3U4QB 2HI0A 4HVTA 4BCDA 5IH7A 4M8KA 4GZ3A 3OIUA 1X7XB 4GEGA 4YUVA 1X94A 4CUJA 2GEFA 2OBNA 3N2IA 1TAUA 1WTCA 4ZOBA 1WXFA 3OM0A 4DNXA 1LVUA 2O7NA 2EFDB 3P8ZA 4LQ4A 2JATA 3K6JA 4JIGA 1U8YA 5IT9A 2HRDA 4CV3A 1NY5A 2PLNA 4U39A 2BFOA 1A97A 3IOMA 5G3ZA 3EFEA 1RP1A 4FILA 4OAOA 4JI6B 2WKQA 1ACMA 2L0XA 2FFRA 5THKA 4D5GA 1BMFA 4DLTA 2QVYX 4NJOA 5LA6F 3IESA 5EPEA 5ALIA 4KFCA 1QVWA 4DLVA 1XHFA 2D1QA 3FCAA 3MTGA 4E5YA 3L4BC 1JJVA 2HA3A 1XCLA 2RIRA 5K5EA 2YJTD 1T6ZA 3QYAA 1N5MA 4HBGA 2CXXA 5E6SA 4C4AA 3X1ZA 2BBTA 5EXDA 2JIQA 1E7RA 1ESDA 1FRNA 3O92A 4HXEB 2QUIA 1A2OA 2BF4A 3SPXA 1YI8A 4A6EA 1GQ2A 3AEUB 3K9BA 3PITA 4ZU1X 1R5OA 2MMCA 2HSGA 1XZHA 3P0EA 5I7AA 5CX1A 4Z2YA 4I99A 3UTDA 4DCVA 4EY7A 5H7XA 2YN4A 4BGVA 4DCTA 3HXLA 1WKBA 4ZAVA 3DTVD 3M3HA 2IXDA 3M70A 5CA1A 2A35A 4YJFB 3SM9A 4UUOA 4YJGB 1FDWA 4EY4A 3ACCA 3ZWYA 4JEHA 1G16A 3OTGA 4J3NA 4D4JA 4HNTA 1V8DA 2GD2A 4AKSA 2MT9A 4F0JA 4ENUA 4YIHA 1QGUB 1EVKA 1RRVA 2GBLC 4FYMA 3M1IA 4MWCA 4CEIB 3K1YA 3PQ4A 5B57C 2J59A 1JR6A 4CJXA 5EEHA 5HRCA 4JFAA 4H3HB 2QM3A 4GM1A 1YFZA 3GK3A 1C30B 1Z4KA 4HDKB 3AVOA 5KYNA 4BY9E 1WB4A 3DG9A 1C8VB 1E1CB 1T9ZA 3D6FA 3G7UA 3I3OA 3OICA 1E4EB 4JHLA 2L18A 1QHGA 1RM4A 2IGBA 3UAYA 4OXNA 3ZZ1A 4E4RA 4AQ7A 4G5QA 2R62A 3DEYX 2ZWVA 2R84A 1SC9A 1PFYA 3TAUA 4JQCA 1TU4A 1CUCA 1UWCA 4WGGA 5B7PA 4FGZA 2VR1A 1MH9A 3ZWDA 3NDPA 1T36B 2HF9A 2B36A 1W75A 1DBSA 3F5FA 5K3BA 1EWYA 4CN9A 1CUVA 1V4NA 1TIKA 4IMIB 2X8JA 2VYVD 2GASA 1G21A 3FI0A 4DR2B 1KPHA 4WLNA 4QQ8A 3CTPA 4XD7D 1XQWA 2D06A 1VL0A 5JCJD 2SKEA 3ZX5A 2CD7A 1QVVA 2I2BA 3KEFA 3TM5A 3UB2A 4BFUA 3QV1A 3W2EA 1SC3A 2HPZA 2P5SA 3KEGA 5EIBD 4YYEA 4D57A 3NI2A 3EWAA 1BRTA 3AU9A 3WB1A 3U7JA 4NVRA 4ASUA 3LMKA 4PSCA 3O38A 4RDIA 1XZJA 3OP1A 1E18A 4HEJA 2O1SA 2RAFA 4RMIA 3V48A 3FVWA 1OZ0A 4N18A 2XX3A 2BKAA 1UFVA 2DOKA 3K0CA 5KOJB 1ZI8A 3HDYA 3H11A 4WW0A 4Y3UA 4OL9A 3SBOA 2WNSA 3LUBA 4H08A 3IRVA 4KG7A 3TSZA 3QLTA 5HKOA 1R6UA 1NI4B 1U31A 1BXGA 3C5WP 2XY4A 4QZVA 4UUNA 2F8TA 4LX8A 4MYDA 4LQLA 4QJ3A 1IOLA 4Z4GA 1FNBA 1WXXA 1H65A 2RBEA 4K6FA 4JYAB 1JXMA 6YASA 1IL0A 3L6CA 3HWRA 3K0AA 4KSBA 5KNBA 5KU7A 1XA3A 2B0JA 4PX9A 2WWYA 1X7YA 4K6OA 3KXPA 4A7PA 1GFWA 5JALA 2C54A 1CW2B 2AR0A 5TMPA 1SXJE 1R0KA 5G0UA 4B45A 1A5AB 4CXMA 2DP4E 4B3JA 2IS4A 4CM9D 1MC8A 2WUEA 4JLMA 5JCOA 2RONA 1SFRA 4BGEA 3LKZA 1XAJA 2PBFA 3K2BA 4H1HA 1YNSA 5IYZF 1IBKB 2QROA 1VPLA 3CLSC 3ICVA 4BRWA 6LDHA 3NVMB 3JQAB 4C0BA 4CG0A 2JVJA 4C3VA 1MJ5A 1EMDA 3AUXA 3GQVA 4TT3D 1HFEL 1OX4A 3IP9A 4L0MA 4O4IA 1I36A 5CTAA 5JS2A 3U48A 3KAQA 4OJNA 3W1EA 2RHWA 1JZTA 2OHXA 1ONSA 2MTBA 2XUGA 3HDHA 3PUXA 1X1AA 1V45E 1NKTA 2H6EA 4NZPA 4B4UA 1SA0A 1YS1X 1A27A 1Z82A 3EDCA 1Q3TA 2CLIB 3GVIA 1NNSA 2I4RA 4ZDWA 3H4TA 3TQCA 5BNWA 1SMKA 1II9A 2VYFA 4ZYWA 2OV2A 5HX7A 4GPD1 1ZC4A 4LYFA 3SKXA 2XCRB 4KCGA 1HURA 2V4ZA 4MJLA 1KEPA 3FKJA 3IBYA 5GV7A 2WFZA 1VSBA 1JEYA 2P3SA 3IXLA 3FWYA 1IQPA 5A1JA 5CEEA 4LVOA 3VSEA 2DR3A 4IFTA 1E6UA 2W43A 3T5TA 5EMNA 1H69A 4BC1A 1OIXA 2MSWA 2OZEA 4JV5B 2YIVX 2EKQA 1CZKA 2W93A 1W36C 5G4KB 1VBMA 1GUBA 4E13A 4PNPA 1MAVA 3HH8A 1IMOA 3HJGA 3OZXA 3S55A 1I9CA 2JHCA 3K5WA 3J80A 2G1AA 2X58A 4Z4FA 4AG3A 1Y89A 2C3OA 1SO8A 2VPIA 3CEJA 4C0AC 4CM7A 3G0CA 2ZSIA 1L9XA