3NNSA

Bef3 activated drrb receiver domain
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
117
structure length
117
Chain Sequence
MMWKIAVVDDDKNILKKVSEKLQQLGRVKTFLTGEDFLNDEEAFHVVVLDVMLPDYSGYEICRMIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA BINDING RESPONSE REGULATOR B
publication title Regulation of response regulator autophosphorylation through interdomain contacts.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein
total genus 42
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3nnsA00
2I6FA 1LBIA 4S05A 2R47A 3N0RA 1P2FA 3RVRA 3NNNA 3G85A 4MYRA 5PNTA 1GLGA 5CNKA 1APBA 1URPA 2E4WA 3D02A 1JF8A 2HQOA 3IPCA 4UHJA 5ABPA 4N41A 2WRZA 4LDAA 1C4WA 3FFWA 3MIZA 2MYUA 1NXXA 3FFTA 2F8SA 5TQ0B 2MYNA 3JTEA 5IBQA 3NHMA 4MR9A 4E7PA 7ABPA 2QSJA 4NICA 4W5QA 4Q6BA 1BDIA 4MLCA 5JNWA 1EAYA 2PUFA 5KC8A 3Q15C 3JPWA 1A04A 3NNDA 3O1JC 2L17A 4RXMA 1YK0A 4RK7A 1R8JA 2A9RA 3LUKA 2H0AA 3RVQA 4TN5A 4WZZA 1JX6A 5KC9A 3H5WA 4KMRA 3GA5A 5HSGA 3C3WA 2JCGA 3JY6A 1KGSA 3QELA 1LK0A 4ZYLA 3QLVA 2NZVG 5BQ3A 3Q7RA 2QVCA 4O5AA 5JNTA 4DN6A 3OQOA 1DBPA 3DGEC 5IUKC 4LDZA 4TLMB 3NBMA 1DG9A 2FMFA 3F6CA 1U2PA 4WXMA 1IIBA 1JYFA 4H3KB 1DRJA 3LMKA 3KG2A 1QMPA 3O75A 4G0XA 2GWRA 2MSWA 2M1ZA 3OLWA 3BREA 3KJXA 4O1IA 5EWMA 3RVNA 4RU1A 2Q5CA 5HM6A 1TLFA 3IP9A 4RK4A 4EYGA 4LX8A 1E6MA 3O1IC 3QLUA 4LZLA 1YMUA 5DTEA 3UUGA 1JBEA 2PUDA 2IDMA 3BBLA 4WT7A 3KSMA 2PAFA 5B3JA 1YK1A 5JNUA 1KMIY 3OMWA 4MLDA 4YR7A 2FLKA 4KV7A 4XARA 4QICA 4ZJPA 4Y9TA 4FE4A 3EQZA 1BAPA 3MA0A 3VNAA 1Z2EA 1L5ZA 2RDMA 3N75A 3GBVA 2WWVD 3CRNA 1F4VA 1YVUA 4MS1A 3ILYA 2PUBA 1EWTA 4QYWA 5FBKA 3LUCA 1LJUA 3A0UA 4MRMB 4EYQA 3C3KA 3SY8A 4MS3B 4N47A 5T3YA 4JOQA 2A9PA 2FKAA 1P6UA 2GKGA 5TPZA 4W5TA 1SD5A 4M88A 1JWLA 1BVHA 3K4HA 4JASB 1M2FA 1CEYA 2R4QA 1P8AA 2PL9A 2FQWA 2FTKE 3E61A 4EGSA 3M6MD 2IYNA 4YS6A 4Z0NA 1JDPA 3C6QA 5TE9A 3LTEA 2V0NA 4F11A 1MVOA 1AB6A 2YHBA 1ABEA 1D1QA 4MR7B 4OBBA 2KYRA 5T7BA 4RWEA 4RV5A 3HM9A 3OLXA 1YIOA 4MQFA 2QU7A 1ISRA 5IEBA 5EWJA 3O2SB 1OXBB 3CFYA 3SAJA 2MYPA 3JVIA 3RVKA 5CNJA 1KRXA 3BILA 2ZAYA 1DJMA 2CHFA 4RK6A 3GT7A 1RNLA 4QPJC 1TVMA 3O1HB 1B00A 4MS4A 5FWXA 1QO0D 3OLYA 4IILA 3W9SA 5DKFA 2P4UA 3OM1A 5TPWB 4HNRA 5GQSA 4TMYA 4D6YA 4Z4IA 1DC8A 3F6PA 4IF4A 3FGZA 4HNQA 2R25B 2IPNA 1SXIA 1D4ZA 1MB3A 3TMYA 2E4VA 1Z13A 3S99A 5FBHA 3I45A 2O20A 3NHZA 4F12A 4EVQA 3UKJA 4MAAA 3LUDA 3Q7TA 1JDNA 2NZUG 3H1FA 3CU5A 3SG0A 1JHZA 3KYJB 1DP4A 5D2CA 3SM9A 3N0XA 2HPHA 3IDOA 5TPZD 3L49A 3ROTA 2MSLA 1XHFA 4S04A 1MB0A 2NT4A 5TQ2B 2PUCA 2MYTA 5IUNC 2FMIA 2WJWA 4G97A 2JBAA 4NCBA 4YRZA 1U04A 3P9YA 5JNSA 2FEWB 2HJ9A 1JFVA 2WB4A 4RY8A 5KWSA 6CHYA 5F64A 1EFAA 3E3MA 3HO1A 5DCLA 3LUGA 1GUBA 4MR8A 2LIVA 1M2EA 3D8UA 1RPJA 1T34A 4N76A 3QEKA 5CHYA 3DBIA 3MF4A 3OQMA 1Z2DA 4W5RA 3HVRA 1QQBA 2LBPA 2GX6A 1A2OA 3M9WA 3FMVA 2HQBA 3O2QB 3QLTA 3HEBA 4LE2A 4RK1A 1Z25A 4RK0A 2E4ZA 1ISSA 1VRVA 1W9HA 1ZH2A 3KLNA 2A9QA 3N53A 2PUGA 4EYKA 2VK2A 1FFSA 4YCSA 4F8JA 1D5WA 1QNLA 1BA2A 2QVGA 1DRKA 4EVSA 1QO0A 5E3JA 1EHCA 4EYOA 4UHKA 3G1WA 4JA2A 3GBPA 4IGAA 4MR9B 2FN9A 1DZ3A 3LUFA 3H5VA 4KQ9A 2FEKA 3C97A 3K9CA 3H1EA 3H5OA 5DGCA 1Z26A 3KYIB 1USGA 3NNSA 4JB0A 1EWVA 1VKRA 2GBPA 2FQYA 2JVJA 1ZN2A 1JLKA 4KPYA 4KK4A 1J56A 1ZDMA 2PMCA 2QZJA 3MMNA 4D6XA 1PHRA 1MAVA 2QR3A 4JP1A 4YLEA 1VLZA 3QEMA 1H9CA 2IKSA 3EULA 4D74A 3GL9A 4MGEA 1YTUA 1JFSA 1TM2A 4IMJB 4G0OA 1W25A 2CWDA 3T38A 3QELB 3JPYA 1LJLA 3I5AA 3RVMA 3URMA 4OTZA 1UDRA 5EWLA 2JVKA 1NATA 4Z4EA 3LUHA 3GV0A 1HEYA 1JYEA 1PEAA 4OATA 3TX6A 4EVRA 1E6LA 2L19A 2B4AA 2FLWA 3OLZA 2CHEA 3A3KA 1D1PA 5FWYA 1U8TA 2E4YA 2PJUA 4HYEA 3LKBA 5EWMB 4N03A 4FB4A 3OM0A 3HDGA 2FMHA 1M5UA 2NUBA 3HDVA 4P98A 3ROFA 1SRRA 4KREA 2JVIA 4H60A 2OENG 1QQAA 4KNYA 4W5NA 1F51E 1NXPA 4RY0A 4PICA 3UK0A 1PEYA 1QP0A 2L18A 1FSPA 4JAVC 4Z4CA 4WXEA 1M5TA 3CNBA 3IP6A 5HKOA 4OLAA 1FFGA 2R48A 3O2JA 2FXIA 5KQLA 4FE7A 5JNVA 1ZAYA 3H5LA 1D2AA 2MSKA 4GPAA 4RXUA 4KVFA 3KLOA 3DZDA 3OQNA 3LKVA 3DLHA 5IULC 1A0OA 4MS1B 2RJOA 2X7XA 4Q7EA 1NY5A 1GCAA 1QKKA 1XHEA 3R0JA 5TQ0A 1EWKA 2B1JA 5KQPA 1AB5A 2HSGA 1ZVVA 3I42A 3FFXA 1JFTA 4IRXA 4L4UA 1QP4A 3KKEA 3OLVA 3Q9SA 1Z15A 4OLBA 3RVLA 4F06A 3T95A 1BDJA 3VNBA 3KCNA 4ML3A 4CBVA 3GWGA 3IP5A 4PEVA 3H75A 3LUJA 3CLKA 2FVYA 5JS2A 2M98A 4MPTA 1WETA 2BGGA 3RVSA 3B2NA 3QLVC 3Q7SA 1YS6A 4G0ZA 4MQEB 4G0MA 1BDHA 1NXOA 4L85A 1RXEA 4IMIB 2FSPA 1C0EA 4G0YA 1QP7A 5IC5A 1GUDA 4RSMA 3A10A 4PYRA 2PKXA 1K66A 3GYBA 1TMYA 5HQJA 4EUKA 2OQRA 4E7OA 4XFKA 2IPMA 1Z16A 1NXTA 2ID7A 3C3MA 4YP9A 1KRWA 1ZY2A 2AYZA 2DRIA 2ZWMA 2JB9A 3EAFA 3CS3A 4MQFB 2JRLA 1SXHA 3QLUC 1ABFA 1DBQA 2PLNA 4N0QA 3IPAA 5EWJB 2GI4A 1ZHHA 2WJAA 3Q41A 4NCAA 1YMVA 5B3JC 5KQGA 1PNRA 9ABPA 2YHAA 3QX9A 4HNSA 1ZESA 3LFTA 1NXWA 4ETIA 1NXVA 1RZRA 4MS4B 4RK5A 5FWXB 3MM4A 2XDYA 3HZHA 1OXKB 2PUEA 1XWWA 3EDCA 1E6KA 3QK7A 1USKA 2WY2D 2RGYA 4OG2A 4RZSA 3T8YA 4Z4GA 3DGFC 3RVOA 1DCMA 4DADA 2FN8A 3M9XA 4LE0A 4H3HB 1FQWA 1TJYA 2FW0A 1ZGGA 2IOYA 3FDFA 1I3CA 1NTRA 4KZKA 4GNRA 4MRMA 1P6QA 2LPMA 4KRFA 1YS7A 2IPLA 1Z17A 3A0RB 3N0WA 4MS3A 5BRAA 2QXYA 4TLLB 5JS1A 1PNTA 3CTPA 4G86A 3HS3A 5KQMA 2JK1A 3JVDA 4P1ZA 5C5CA 3OO1A 4NV3A 4DQDA 4Z4FA 1LBHA 4JB2A 1SXGA 3SNKA 5KI6A 4ETMA 4KK3A 3ILHA 2FMKA 2JBAB 3CZCA 1U0SY 2E4XA 1Z18A 5ED4A 3HV2A 4WWHA 2VUIB 3KS9A 1U2QA 3HUTA 4WUTA 2PUAA 4RS3A 1DC7A 3I09A 2WMYA 2E4UA 2CD7A 2LP4Y 3IP7A 4MR8B 2TMYA 4MR7A 4NQRA 5IX8A 3CZ5A 4XASA 3EJWA 1JH9A 2LUOA 2FQXA 3RQIA 1RXIA 1VPWA 3CG0A 2J48A 4ZPJA 1CHNA 1Z12A 1ZGZA 2AYXA 4RDCA 4Z9BA 4XAQA 2L2QA 3RVPA 4XXHA 8ABPA 3BRSA 5CNIA 1Y1LA 3TO5A 4G0QA 1L5YA 2QW1A 3CG4A 4KQCA 1ZH4A 1MIHA 1QPZA 4W5OA 3HK2A 2FEPA 2HQRA 3H5IA 4XLTA 1GCGA 1PUXA 1CYEA 3QX8A 3EGCA 5BR1A 2H3HA 2VYCA 3N6VA 5TPWA 4YV7A 1RZRD 3OMXA 2QV0A 3MYYA 3HSYA 3LUAA 3F73A 4N0PA 4YGXB 4B09A 3TD9A 1DBWA 3O21A 1USIA 3H1GA 6ABPA 1FFWA 2ID9A 2IPAB 3BRQA 4YO7A 3OO0A 3TB6A 2F8TA 4RXTA 4EY3A 1E2BA 3H6GA 4KFCA 2N9UA 4Z99A 4LE1A 2A9OA 3N8IA 4MQEA 1ZITA 3SQNA 4O1HA 3HJFA 4RKQA 4ETNA 3QEMB 5BRJA 2P9HA 3MQ4A 3RH0A 4YWHA 5IEJA 4PE5B 3HXMA 3EQ2A 3F7NA 4Z4HA 3DLBA 3KHTA 3JS5A 5TQ2A 4RY9A 5EWLB 2W42A 3EODA 1NXSA 3T6KA 4Z9AA 3H5TA 3LOPA 5DLEA 5TQJA 5FWYB 1S8NA 5IUJC 4F3TA 3HUUA 4RKRA 3H6HA 4G0PA 4LRQA 5CNMA 1K68A 3RVJA 4QYMA 1DCFA 4PZ0A 5I4CA 3HCWA 2PL1A 5GOTA 4ZMRA 2RJNA 3L6UA 3CHYA 4Q6WA 5JNRA 3O74A 1JL3A 3KTOA 3CKMA 2VUHB 4ZMSA 5C5EA 3GRCA 2PE5A 2NT3A 1DCKA
chains in the Genus database with same CATH superfamily
2UZIR 3C6XA 4DCUA 5ALTA 3OZDA 3SX0A 1YDGA 3T35A 4S05A 1JPVA 1P2FA 1SG6A 1YRBA 4X6UA 3WYFA 1C9EA 2CC2A 4B35A 4D9MA 3UG6A 2GYVA 5JROA 1HZZA 1XZEA 4ZVVA 4YT2A 1F5SA 3B52X 3M6VA 2FN3A 4C5CA 1ODIA 3LFHA 5H1YA 1F6WA 1DTWA 4MOWA 4X1OA 3RBAA 1M2OB 4JBLA 1MIOB 1KDRA 4DEVA 1WMBA 2OV8A 4Q5IA 1JQLB 3A2LA 3NDJA 4B2IA 1Y3HA 2XUDA 4B0PA 3GLFB 4IIEA 3IDSA 1P4RA 1G18A 3WLAA 1V6AA 1ZCBA 1NSTA 3NC0C 1Q2UA 3Q15C 5KC8A 1GU1A 3PEFA 5HCUA 2AZ4A 1Z8FA 4UAVA 2XKAA 1QF6A 3LP6A 2JHAA 2BE7A 5KCZA 3I58A 4Q93A 2WJZB 3UUWA 4RD2A 1BG6A 5AJWA 4ANFA 1VMIA 1RLTA 4WZZA 2CZQA 5L53A 2PZLA 3ZEAA 1PU2A 3IQGX 3K70D 2IYLD 3R5HA 1BA3A 4X65B 1EDDA 5BNFA 3BK2A 1NI3A 5JD6A 3Q3VA 5JLAA 5COAA 3FE2A 1H1DA 3K7EA 4LV5B 1ZKDA 4GE0A 3SU8A 4ZJUA 1MOZA 3T7TA 5T3UA 4R8VA 4TLMB 3A7EA 1G8HA 4P58A 3QVGA 4CR8A 3GPLA 4GKAA 3OQBA 3SX2A 1WE2A 1VL0A 1W8IA 3U7IA 4P93A 1FDSA 3CLHA 3GFFA 4ACBA 1ZNZA 1M33A 4ETWA 4IEEA 2JS7A 1YZ3A 4BP1A 1VMEA 4DQ0A 1VHTA 4YJ3B 3FCAA 3RARA 1AGXA 2HM7A 3HDHA 1P2SA 4CLRA 2V9PA 1GZ4A 1KZYC 1YMUA 4JGIA 2XJ4A 2A7XA 3DLTA 3KFXA 2WQ6A 2R9VA 4RS4A 3OCZA 1I4OA 4CG0A 5I7OA 3IDZA 2OKCA 1FP1D 1VG8A 3NM5A 1X77A 2OMKA 4FK8A 4Q7KA 5BQ5A 3ZHVA 1DG3A 1EXNA 3W5DA 4U6NA 1N2CE 3QPWA 4PZ9A 3NORA 4UXHA 3GEPA 3UAXA 5CB0A 1OLSB 1O89A 3LYHA 1E1KA 2YNMC 1RWQA 3PIIA 3HHEA 4ZVRA 4BRZA 1YRWA 2HIAA 1QQ7A 3FJYA 4IKPA 4CDGA 1P2TA 1GCIA 4NK4A 1YS1X 1DXQA 1WZNA 1TCAA 2UUOA 5AKHA 3BXOA 4DRXB 1JLLB 4WXPA 1ZGCA 1PK7A 3CRQA 4K6OA 4FM9A 2C29D 2ODQA 1CF4A 3O82A 2C1EA 5LQJA 2GASA 2WJIA 4ZU3A 5FYQA 2JFZA 1MA3A 4F4FA 3EOAI 2HEGA 3W7AA 1FSZA 4ZJYA 1ORTA 1EFPA 4IQGA 5LP6A 2P3OA 3R8FA 3I4LA 4TQGA 4RV9A 2H2WA 1TEVA 3UQZA 4UVIA 2E1PA 4JT4A 3LI2A 4BNMA 3BE8A 4UE3S 4X5OA 2I4IA 1A8QA 2RONA 3L1KA 1D2HA 3G02A 3PIRA 4JGBA 3UJ6A 3PWKA 1TL7C 1PSWA 2EQBA 4ARSA 4M1WA 5B6PA 2WABA 2ZLBA 4U7WA 1R0LA 5DYIA 3ZH2A 5DO9A 2VT3A 2YBEA 3FVQA 3OFND 3V33A 4W4TA 1RHMA 4PINA 3SKYA 4JP3A 5HRAA 2XB4A 3K9BA 1ULZA 4GMXA 3IAS1 3IO5A 1NQWA 2O0MA 2V8OA 1CQZA 1JHVA 2QL5A 2WDZA 3BD8A 3M70A 4UARA 2ICAA 4CCYA 4W82A 4MQFA 1E2IA 1WG8A 3G88A 1G7RA 2KI5A 3L93A 1K5HA 3I23A 4FQ5A 3PT5A 1TD1A 4D2IA 2IV3A 3FYUB 2HHHB 2Q29A 1PBNA 5KNDH 1W36C 1GTVA 1FZTA 3FSGA 3K94A 4BFZA 2NNLD 4IOMA 2E0IA 1U65A 4ZHQB 1TFRA 4DLNA 2RK3A 4QWWA 4GI3A 2VA9A 2CGEA 2BTQB 2FFAA 1GT6A 4RVFA 5B5SA 2QTNA 5C8YB 2RGBA 3KUCA 1QVWA 3LUPA 4G63A 5A9SA 2WJHA 4YIKA 1Y4ZA 3DEAA 2D1RA 2C8JA 5ITVA 4NCXA 3FLMA 3L5OA 3K09A 3ZV5A 5BW8A 3WZLA 1JFRA 2P1ZA 3W2FA 2Z1NA 3U7RA 1HRKA 4UUBA 4KRXA 4NMWA 1UBLS 4J94A 4H0FA 4HH0A 4PX9A 4WJZA 3RABA 1JAHA 2V6JA 4L27A 1H5UA 1RHUA 1R0BA 1W581 4GYWA 5AJHA 4BO9A 3TTXA 2VWPA 1U9CA 4UU8A 4EEXA 4ARZA 3LA8A 5I47A 3E05A 2JD0A 2QRJA 3I12A 2JLRA 2NUAB 1BO6A 4PVCA 2DOKA 1JHZA 4O2AA 5KYNA 2BSAA 4XTCS 3ZX4A 1Z2PX 3JAWB 4YDQA 2J6IA 4L9AA 2DHRA 4N3GA 1XEXB 4N1AA 1TJ4A 3KZVA 5HS6A 5GADl 1SC4A 2JGDB 4AO8A 3GC6A 3ZHYA 4W8GA 4JLAA 5BV0A 2NT4A 5K05A 1THGA 2QNIA 3PEUA 3QEBZ 3VKHA 1A5AB 1CUDA 2FMIA 4ZYTA 5J5AA 3F3SA 4AICA 4YRZA 5DYNA 4PNHA 5TJ9A 5EIFA 1XYGA 3TL6A 1KFEB 3FMFA 2AR7A 1G20E 5DMHA 1I2DA 4JI6B 1BKDR 1VYVA 1X1SA 3I1IA 3IH5A 2I99A 4OI0A 2OHJA 3EY9A 4BNUA 4BHTA 3A6EA 3T1TA 3PUVA 4PFKA 2V7QD 1PJSA 1ZJYA 2NO9A 1EEHA 1FP4A 1LBEA 1XZ8A 4N54A 2WT9A 3AHCA 1SHZA 2PYDA 4V0MA 1UWCA 4LOAA 1Q21A 2PJDA 2C9OA 1IC6A 1GILA 3WV5A 3RUFA 2JKVA 4XJXA 3O31A 4R1NA 3UHFA 1BW9B 3DOFA 3PZBA 5MFPA 2GM3A 1L4BA 1VFNA 4E6PA 3VUEA 4DT1B 1HG1A 4TXHA 4JV5B 1RYZA 2Q4BA 4WK2B 2XZDA 5FUVA 4UDOA 3G3EA 3NOXA 1OPXA 1FNBA 1FRVA 1PIWA 1U2GC 1V8BA 5I7AA 4RIFA 5BMOA 5DBOA 1NPYA 3KKNA 4IIBA 1SVUA 5DP1A 1H1LA 5ALQA 1QCZA 1G2QA 2Q5HA 3SS9X 2O8BB 2OORA 4YAKA 2YMMA 2VPIA 2AJCA 1WBBA 4L5YA 1E59A 1JRLA 1X92A 4M83A 4XVQA 3TFQA 4RIGA 3AM1A 4JYBA 4ZO8A 4UUAA 4XW2A 3ZNQA 4EJMA 4O4HA 2ZSUA 2NGRA 4ZZ1A 5IAAA 3CPEA 5LN1A 3WIBA 3EC1A 3P9ZA 2PZAA 4I3GA 2J5RA 3SXUB 1OHHA 1E9FA 3KFVA 3G5LA 1CERA 3L7IA 4PO3X 3ZXYA 1V11A 2R751 4F4UA 5DN9A 3THXB 1WTAA 5AVQA 3SJBA 2YZKA 3KDSE 3ZN2A 2JFBA 2JGJA 4MPDA 2ZUEA 4I55B 1GA1A 4HGNA 1B6TA 3F8SA 2JGFA 4QA9A 3RVMA 1SKMA 3HBFA 1V1JA 2QMQA 4IFIA 2WE7A 1L7BA 2IIVA 3FF1A 3I2HA 2VDVE 2Q6TA 4P80A 1EBBA 2Z2KA 3FUUA 5DHSA 4WESA 5D3MA 3TNJA 3WWCA 4BPBA 1QHHB 1WNTA 2FP4A 1FXSA 1EK5A 1JKFA 3GN1A 4RE6A 3A3KA 4OH1A 4P2GA 4BFLA 3HCNA 2BGUA 1Q7TA 1VMAA 3A9SA 1OXUA 3X1YA 5ESRA 4WCFC 1W9MA 1ETHA 1HK7A 4G0WA 2DR0A 3VJLA 1L4MA 5T4BA 3V9AA 2J9FA 2HLHA 3GCXA 2CMKA 2JAPA 4P3XA 2H07A 3VDRA 1CJSA 3DONA 4OP1A 1XUOA 1Z35A 3SJ7A 4P6VF 3SQDA 1DAFA 2DLNA 1HQDA 4MZXA 2FMXA 1S89A 4M0CA 5ILQA 5I48A 4GIBA 4OXRA 5I51A 1VBMA 2IITA 1A9QA 4FSXA 4BRSA 3KETA 5JNVA 4BX9A 3ZV6A 2FRDA 4EPXA 3EF3A 1TMKA 4JFRA 5DXJA 2PUJA 2BGIA 1HE8B 3KLOA 1ECLA 1W4BA 3OIWA 3U4HA 3PDIA 3DUFB 2X7XA 3PI6A 2OBBA 4MDFA 1JA0A 3GRKA 3LVBA 3CRMA 2H2HA 3I9OA 3QHAA 3RODA 5KQPA 4JP5A 3SIXA 5I9SA 4CEJA 1VCHA 2C58A 4LZOA 5CJ2A 3VNSA 4CL3A 5AK6A 2FSHA 1QF7A 3D5EA 1CK4A 1TYZA 3PQ6A 4KPUA 5G1OA 1UK8A 1UJBA 3RADC 1F0KA 1MX1A 4DMFA 3RRNA 4CBVA 1TC1A 3U9TA 3TXYA 4WZBE 5LBIA 4F96A 5K8UA 4KO2S 3NO4A 3ABQB 1KEWA 1QYXA 2OBFA 3PC8C 4AO6A 4IHAA 3W04A 4UEKA 1EUDB 2RHOA 1XXHA 1NNLA 3ITKA 3K2QA 3LECA 4LQLA 7MDHA 4PRYA 1YS6A 9GPBA 3T1HB 2CLCX 3AF0A 3W3AH 3WRYC 1Z4MA 4ZFNA 5C9ZA 2CMHA 1HI9A 4BFTA 3COJA 4OHXA 2G72A 3V1UA 1N32B 1I01A 3RRXA 4B3CA 4XPIB 1GITA 3UV3A 3E9QA 4LMBA 4L0DA 4M0KA 1N8KA 3MWDA 4Y2JA 1Q77A 4P08A 1XZKA 3G1TA 2BT4A 4PHTA 2OQVA 2OE2A 3WV4A 5JSHA 1L5SA 4B6EA 1QIGA 1ESZA 1V0JA 4P35A 2DUJA 4BC0A 4O6VA 2J3LA 4D9GA 2O8FA 3QLUC 1X7GA 2F90A 2VL7A 3GRAA 1SU7A 2AI3A 2QMYA 1BCSB 3TUIC 4A0QA 2NP6A 2BKVA 2NUPB 3QEJA 4ZI5A 4D3XA 4B4VA 3FOCA 3KKZA 4RD3A 3V2GA 1WVIA 2QGNA 1KI6A 2B69A 3L8CA 1GGJA 3EEQA 1NULA 3KVOA 3QX9A 4P3PA 3MELA 3O95A 3QHQA 1L7DA 2QTGA 3KXPA 1CZOA 4HNSA 4DNQA 1NXWA 5I9BA 3S2IA 1ZJZA 1KSJA 4EP1A 4WH0A 2YVUA 2OSVA 3ILVA 5DBHX 1ZA2A 3R75A 1NBEA 3OZIA 4N0EA 2QRMA 3F1KA 1FRNA 3HZHA 3KALA 4KMOA 4EVIA 1G3MA 5JBNA 4KQ6A 4EB0A 5LA6F 1W5FA 3Q8KA 2RGYA 5HDQA 3VU0A 3CCFA 1W7AA 1PQ4A 4WDQA 4ABYA 1LXCA 4LE0A 3LD9A 2RBGA 4LOLA 3L1UA 3JQGA 5ECYA 1JSRA 5CXSA 3JQRA 5ERGB 3S2UA 2EX4A 1IHPA 1UT8A 4NPAA 4PU0A 4AMBA 1CJTC 1FMCA 3QW2A 1JEAA 4AN0A 3A2KA 4PLWA 4W1SA 4AKGA 1NVMB 2NAPA 5FPPA 4YUZA 4ZOLA 1U3UA 2YWGA 5DYWA 1IWBB 3HCFA 2BEVA 3GJ8A 1VBNA 4QFDA 5CTAA 2C4TA 1T4MA 3THOA 1HOTA 4F60A 2QTMA 1U2EA 1YDHA 2IZ1A 3JVDA 3N8GA 2WOJA 4P1ZA 4UM8B 4URFA 1JQEA 1G8SA 4Q4JB 5IG2A 5CHEA 3GFSA 1H05A 3VYSB 1LBHA 4J16A 3DP7A 4M36A 2J46A 1Z5NA 3RROA 2JBAB 4RADA 1MQ9A 1K8ZB 1WDMA 3D3EA 4P7BA 1VKJA 1IRXA 1KGDA 2VUIB 1JXMA 4L95C 4E88A 5AVXA 1KHTA 1V5FA 2PUAA 1NUPA 4ZPXA 4DA9A 1O96B 2HX1A 5TB5A 1G7SA 5H9VA 3J7AC 2HHAA 5EYPA 4GX2A 3TAHA 5K09A 2TMYA 1PG0A 4MR7A 4UU7A 3WXMA 4CL2A 3CZ5A 2B61A 1H4TA 5CH3A 1WOMA 2BEJA 1S2NA 1VE7A 1GA4A 4U7GA 3IR7A 3GRYA 1Z2NX 3O7MA 4DG9A 4GOOD 1D0IA 3NLLA 3R5SA 3EQ8A 1BHJA 1IYZA 4B2LA 3H0CA 1I24A 2BMFA 3NAQA 3EYAA 3Q85A 1RYEA 3RVPA 2J3JA 3W4IA 1FMJA 2P7HA 1RVDA 3PNQA 5AW7A 2A1UA 3B3FA 4ITVA 4OHFA 4TVKA 2YMPA 1ZH4A 1MIHA 4ZZ3A 1JG6A 2O2IA 2PBFA 5K3DA 4AI6A 1SHUX 3HVUA 3W2HA 1QWOA 2XVYA 1U3FA 4OJQA 5CVDA 2V6FA 2PPVA 4U5QA 2FPOA 1JGTA 1W75A 4BO0A 2IHNA 3AR2A 2UV8A 3JVVA 1VLLA 3NVKI 3ERCA 2QV0A 2QX7A 3UB4A 3SWWA 4C2TA 5FEUA 4HXYA 2X7HA 3OWHA 1KDTA 2ZOSA 2X0RA 3TRDA 1ZX1A 2PUTA 2DQZA 4B4OA 4IJWA 1J1UA 2YW2A 1ZN9A 2AV6A 2C4WA 3KLBA 3N3BC 5GP1A 5LLSA 3TCXB 3TNFA 4F3CA 4KFCA 3DF9A 4ZT6A 2JFQA 5CB4A 3H9CA 1NU8A 5I8ZA 1CJCA 1YXMA 5TS3A 1QRDA 2VF4X 3QVOA 5LYYA 3RH0A 2W6NA 1W87A 4IS3A 3RRFA 3BTUA 4X54A 2IX9A 3CLVA 2J9XB 3BMNB 2PXAA 1ZXBA 1CUBA 4N82A 4RLHA 4Z4HA 3T41A 5EXSA 3O4FA 2H7VA 5BN4B 2IODA 3KVYA 3ORYA 3EZFA 1FTNA 3UATA 3O4RA 2KHZA 3KZXA 3MQFA 4Z9AA 5F9HA 2IYFA 1X14A 4Y9DA 3THYB 1E1QA 2QD1A 3BA1A 1NVAA 2Z9BA 4XQGA 1IPEA 4DILA 4PZ0A 5BWOA 2WU8A 2CSXA 1JE1A 3DDSA 1BXRA 1UL1X 2OCXA 3P4XA 3LX8A 4H35A 4UEWA 3J80A 3HXKA 3D8TA 3SSOA 4NEHB 1JPNA 1YHZA 4PXSA 1ODTC 2IE8A 3WYNA 4K0KB 4WNIA 2ZE6A 3DPUA 1IUOA 4FVTA 2P0YA 3ETLA 3BDAA 3ED5A 2IUTA 4CU5A 1MH9A 4YEDA 3DZJA 1LRLA 3D4NA 1U9JA 4ZN6A 4UTOA 1OX4A 3GLIB 421PA 3ILSA 1C3LA 1K06A 4UVEA 4XVRA 4DLUA 4NCIA 3V9PA 4MW6A 2PJRA 5T4EA 1N0IA 3DHNA 4P4LA 4RHFA 5LXTB 1LRJA 3K1JA 4J3FA 3V8MA 4JJZA 4NDZA 2MYUA 3TB4A 4Z7JA 1A1SA 2YWEA 3GA7A 3VV3A 1POWA 2OHGA 5J2UB 5KTSA 5K3EA 1N5IA 1XL1A 1X7ZB 3QKSB 4H2DA 4I6EA 5IBQA 4MRPA 1CUIA 4LJ5A 2FKNA 2YIMA 2QP9X 4NICA 4O4IB 2R00C 3BEDA 1JLSA 2HDNB 4Y6SA 1CB0A 4BVBA 3NM6B 3EPLA 3HA7A 3BSWA 2GMWA 3OPVA 4GEKA 4CKCB 1Y6RA 3C5HA 4Q05A 2B83A 1BS2A 1FQKA 5BW4A 4O3FA 3P2YA 2HU7A 4HUJA 2XNSA 1MRZA 1U0HC 3GGDA 4O59O 3VU8A 3CVJA 3JRXA 4AK9A 2BM0A 2F3TA 5DCYA 4UUPA 3QYPA 3OURA 3JATB 4PWZA 1CY1A 1KU6A 3MD0A 2GJ9A 2JK0A 2A88A 2GN9A 1H2RS 4FBGA 3OWOA 3TTVA 1IL0A 3V8VA 3WAKA 4XE5A 2IHZA 1F7VA 1X9IA 1B3RA 1YNSA 2XKBA 4BV9A 1MJFA 1OTHA 5H68A 3RUAA 3ZWNA 4D43A 4EUEA 2QJFA 1TTPB 2RG7A 3L4BC 4XQEA 3NBMA 3WWEA 5BOVA 4EA9A 1MC5A 2W71A 4UOQA 1REQB 1V5EA 2ZB2A 1L7OA 4X66B 2YIDA 2GWRA 4NNOA 5IZCC 4E4TA 3BSSA 1ZSVA 3CZMA 2YQZA 5CFOA 4OQQA 4U7PB 4L5CA 4RK4A 4EYGA 4Q48A 1Z8NA 3HLTA 4O2RA 4FEAA 2I3ZA 4QVIA 2EFYA 4GH5A 2G6BA 1WDWB 5C1OA 3EGEA 1FNSA 1W36B 2XZTA 4CV2A 3BKXA 3EBPA 4ZOAA 2RHWA 1F3OA 3AERA 1MJHA 3GQBA 3X1ZA 1LDEA 4NECA 1A8HA 2I55A 1MG5A 1LF5A 1P2VA 2M6SA 5JS6A 2ZCVA 4BKQA 1F4VA 3F3KA 4KX5A 3PQ2A 1DL5A 1GEGA 4CR7A 5LJIA 2MTBA 4UUOA 2UYGA 4UEQA 1I33A 3NANA 4PYMA 2XITA 5JVDF 2F59A 1N6NA 3C3AA 1MQ8B 2F8TA 4YV2A 1U3GA 3MUFA 1Z7BA 1LQ2A 3A1UA 4QBHA 1GSAA 4PZEA 2ZDGA 1ZD4A 1BDBA 3E3AA 2AKYA 3ZIAA 2HWWA 2Z5LA 2FI1A 2XCUA 4G37A 4DV2B 3D3QA 3IJRA 5JPIA 4CKYA 1GL7A 2WVAA 3TPCA 5MN5A 4URHA 4RKWA 4QQKA 4L15A 4US2R 1JMKC 1S7GA 1JDPA 1NE7A 4RKYA 5C7IO 4DA6A 3REOA 3F6BX 2XCRB 1P2UA 4M9RA 3IPLA 5IH7A 3V4OA 1A9SA 1M8JA 1VSQA 1MVOA 2UVDA 2J9RA 2IIQA 5FTWA 1I7DA 5EHQA 3M5WA 1AK9A 3UAGA 4RV5A 1Q15A 4AXBA 1PS0A 2AN5A 4LBVA 4MUAA 4B1FA 1FTQA 5B55A 4KQFA 4DEXA 1ISRA 4I4NA 1Y34E 1QH0A 1ELOA 3ZK9A 4E22A 5IVHA 1T15A 4L72A 1M74A 1X1EA 5K0TA 3LYUA 4NOLA 4LC0A 2B1IA 3BILA 3ZVNA 1DJMA 4G5SA 2NSDA 2YRXA 1USWA 3GT7A 1ZC3A 1DTSA 1SZDA 2QUHA 2KLHA 1C80A 2F1JA 2XYPA 1PJTA 3HJAA 4UEJA 1V39A 4DSTA 2UZAA 1CRQA 2R1TA 2VDUE 2VSYA 4R7ZA 3OLYA 4E94A 2AOUB 3RM3A 1YKFA 1IUKA 4C7MA 2F3PA 2ECFA 3G59A 4Z4IA 2QTWB 1U98A 3BMCB 4PG7A 3F6PA 4B46A 3BHJA 4DM7A 1TVEA 3OSUA 3AEUA 4HDMB 1UM8A 2AEEA 4L0QA 2POQX 1AS0A 5LQRA 4UREA 5IM5A 3DTVA 3ONWA 3IPXA 2ACKA 4ZZ2A 3STXA 4MVJP 2XNJA 1V6SA 3ZHCA 3BD7A 3LY9A 3U61B 4IJQA 3BMQA 2WMNB 1PR6A 3NW9A 1NQUA 3COYA 3DLAA 3PC7A 1OAAA 4XX0A 3CU5A 5AVKA 2PSDA 3RIHA 5BV1A 5ALWA 5A7HA 1O5IA 2F8LA 5B3AA 5E1OA 3FR7A 1VE1A 1G19A 5AM2A 5FDFA 2JLAA 3VO2A 2WJGA 4HGOA 5IAJA 3ZCUA 1ZJ6A 4K9PA 1GKUB 4JLMA 4M8LA 1E3TA 1ETUA 3O8DA 5GGYA 5TQ2B 3UXYA 1SUDA 2QM8A 3NH6A 4ZRMA 2WJWA 3KR2A 4IF6A 1NF9A 1Y7PA 3DPSA 3I32A 4B6GA 1L8LA 4EHDA 3VX4A 5KNCH 3IA2A 3WRWA 1KE1A 5EE5B 2QUZA 1GPAA 4B3SB 3QYAA 2OILA 5CA1F 1E32A 3I2IA 2YN0A 4MEAA 2AFIE 4YJGB 2G1AA 2VPQA 1Y4UA 2AEJA 2QTCA 4DBVO 2XGGA 2JLWA 3RTBA 2YHUA 3LDAA 2JCVA 5JQGB 3CNQS 4OKSA 2XMBA 3MF4A 4TRRA 4WCFB 2W00A 1DV2A 2IIBA 3WYGA 1Z6ZA 2IXFA 5CPFA 3NX4A 1XLVA 3C43A 5AO9A 5KVAA 1Q7GA 2MMCA 1N1DA 1HWYA 5GIPE 3ER8A 1C1DA 5AI0A 2ZCJA 1KKLA 4A6DA 2EBFX 1D5WA 3WJAA 1PHPA 1DEAA 4EWLA 4X93A 3U6KA 2R1UA 2Q9AA 2RI1A 4JQZA 6PFKA 4L4XA 2H4ZA 3SVTA 3T61A 4YAEA 1RQLA 3EDOA 4D99A 1J8FA 1QE3A 3BIOA 3H5VA 1WZEA 1WKCA 4FXPA 2CV1A 1EVKA 2YRFA 3C7DB 4RJ2A 3RLIA 1F14A 2R6DA 2WWIA 3H1AA 1JZSA 4B8ZA 1ZA1A 2ZUVA 3AOGA 3DHYA 5BNZA 3H7AA 4AG3A 1Z75A 4FPXA 3Q8XB 3T99A 3MTDA 1L2TA 2Z04A 1DQRA 1FDUA 3G2IA 1U3DA 3AC0A 4G26A 5EERA 1D04A 3EXG1 1ML3A 4R1TA 4A8TA 4RORA 2AB0A 3BZWA 3J7TA 4JWTA 1EKXA 1YACA 5IN5A 1ZKMA 2QZPA 1QH9A 2V4MA 4CCWA 3VR3D 5C5IA 1QXSA 1UMDB 1ZD9A 1QKIA 1VSUA 4BX2A 2I67A 4QGFA 2YHIA 2X40A 3ZVKA 1RZVA 3T38A 4ER0A 3K32A 3ZKAA 4WBNB 5IXYA 3G13A 3KXIA 1YE8A 3X1JA 5B7PA 4IGKA 3PQ7A 5EWLA 4BNKA 3KSUA 2JVKA 2YZNA 3D6UA 1G21E 1GXSB 4IZHA 4F8EA 1PEAA 4Z4EA 4C0WA 1GKLA 4UBLA 4RDXA 1PLJA 1E5QA 1EFVB 1Y37A 3L77A 2FXVA 4OL0A 5KNDD 4KR3A 4IDHA 4ZAWA 2VDPB 4KXVA 4RJTA 2N47A 2VAMA 4LJ8A 1GTSA 3SLKA 1E8MA 1YO6A 4N03A 1RMTA 2FZVA 4RA6A 1G4UR 3D3KA 3AJAA 3LBNA 1H2YA 2OCAA 4FHGA 4J2TA 4J0KA 3W9YA 4U2GA 1WCYA 2VBFA 1V4NA 4H60A 4LKOA 1ZCJA 1NNI1 3AQIA 4YRGA 1TLLA 2AA3A 3IV6A 4J0IA 4ZEOA 3UK0A 3WNBA 3AP2A 2JFYA 1J22A 4UZFA 4D8VA 4LYFA 4ZXPA 5FD8A 3WTCA 3AUYA 5GV7A 1XNHA 2GK7A 3HA2A 1SBYA 2Y71A 4IDNA 2HZBA 3H5LA 4RVDA 3FHLA 2QY9A 3WB1A 4YECA 1L9KA 2A35A 3TAXA 5FKJA 1NOJA 3U3RA 4TLBA 4HRAA 3RRBA 1Z6AA 2VEOA 2JGMA 2P6MA 1DIAA 3K0EA 3L8EA 5JSKA 3SQMA 1NMYA 2NG1A 2BMDA 2R6FA 1UPBA 2ECPA 3D8BA 4RPLA 4DMHA 4LF8B 2XOKD 4WERA 3QU4A 2XNKA 1JQDA 1T1IA 4JELA 4KQJA 4LXUA 4OLBA 4MA4A 1DEXA 1KEUA 3H2ZA 4MYTA 4I1OA 3RAEC 2XKKA 1HYQA 4BFXA 4MUBA 4P2BA 2ZRLA 3CVOA 2Y27A 3H75A 1IZYA 1VM6A 1JA9A 3KZ1E 3LUJA 5DHAA 4KPFC 2O23A 3UAOA 1OFIA 3IMGA 3JD4A 1Y3CE 4B6RA 2ZS8A 4EJFA 2BGGA 1M6VB 3OQPA 5LC1A 5TMBA 3MMXA 4YY3B 1OFGA 5C2JB 4QG3A 1Y9AA 3AG6A 4HDSA 3IALA 1C1HA 2D5AA 1XSEA 4HAXA 4ATNA 4F5EA 1SUPA 4NATA 3H5AA 5HF8A 4MGHA 1RYYA 1BJKA 1XCPA 3AJ8A 3UMGA 1XTVA 3MT0A 1YC5A 1XQ6A 2EF1A 2XGMA 2PV0A 3BGOS 1C1YA 1K5DA 3CKKA 5JCOC 2JAOA 3LHSA 1ZY2A 4R7GA 1QHEA 4LWOA 4OV6B 5LA6A 1P0FA 1JXQA 4P36A 2KBFA 4K87A 3KYBA 4LBWA 3QA9A 4FS8A 1I4EB 2CLHB 3TIIA 5KOJB 2P2CA 3MRXA 3A8TA 5FLEX 1T5TA 3SKVA 5KQGA 1GLNA 1ZMXA 2EW8A 2Q7XA 2WHPA 2EGUA 1UQTA 3KPYA 4L8YA 1LX6A 2HYIC 4PAOA 1N7JA 4EOGA 3VVMA 1YRQA 4BQFA 2PZEA 4ZEMA 4UD2A 1L4NA 1RZRA 4JN6B 3LNTA 1JEQB 3WHPA 4AKSA 4EG8A 1USVA 5JXGA 3F5FA 1ZD8A 2J3KA 2AG1A 1RC0A 4QO7A 3T3EA 1O57A 2AOXA 3R9IA 4AS2A 1OH6A 3VU1A 2VYQA 1KQPA 1YA6A 3UNXA 3RVOA 5B3LA 1XT6A 2FUG6 1XKTA 1TMGE 3FCUB 3V2HA 3ANNA 3I52A 3VU9A 3TVTA 3U80A 4D4MA 3DE4X 3LWZA 1QFMA 4FW8A 2I7DA 5AVOA 3AOEC 4BE7B 4UFOA 1DFIA 5JFOA 3C24A 3WK9A 1OZAA 1B0PA 3NPMA 2H0RA 4X97A 3R0IA 1OD6A 4QDOA 5C7OO 4TLLB 3V8EA 3ADCA 3EGVA 1Q0LA 1JIIA 4JJAA 3TN7A 1XJ5A 3WC4A 5KYWA 4ESOA 5DGTA 4CW7A 3GLGA 3S40A 1E2JA 4WBSA 1V41E 4I50A 5C5CA 2OZEA 1XZFA 4DQDA 4E5PA 3A6HA 4O2BB 2VTBB 4TZ0A 1SVOA 1E3DA 3MRSA 1Z45A 1FE8A 2CJWA 3E9CA 4JB3A 3PJEA 4MCIA 1MO3A 5F4BA 4C7KA 4DA8A 4LS3A 3ZDFA 1J06A 4EY6A 1V2HE 1OF1A 3I9FA 5JAQA 5J4YA 1C0PA 3K73O 3QKRB 1D2CA 5HKBA 4I9FA 4JZKA 2BFOA 3IP7A 5L3QA 2Z5GA 3ORSA 5G02A 5FBRB 1CUWA 2W6JD 4KZPA 1VPWA 4GDMA 2KLBA 2PFSA 4X85A 4GPIB 1IUNA 1ZGZA 2I65A 4ZPJA 1Q1ZA 4TL7A 3RYHB 4LYYA 5AKGA 4C6SA 1XHLA 1Q1EA 2B8TA 3FYDA 3LHDA 4N5HX 5IKXA 5KVVA 4QJBA 1GM5A 3COZA 3JASA 3FWPA 1XEWX 4IJMA 4LRSB 1AURA 2FPGB 5CD9A 4IJUA 4R9NA 4C1BA 1H22A 1OC4A 3AY3A 1CQXA 1QH8A 4E21A 4WK0B 1TJ5A 1FNMA 2ZR7A 1JIXA 1LNSA 2BVNA 3EGCA 4Z2YA 3N6VA 2QEQA 4ES6A 1CE8B 1LDMA 1YSCA 2AJTA 2VA8A 4YRCA 4ERNA 1UBGA 2RH4A 5JCXA 4OHCA 3LVRE 1Z0IA 1QB8A 1JQJC 1TQ2A 1Z34A 3FM9A 1E79A 4R2LA 3NHKA 3DEFA 5SZIA 2BTEA 3DOOA 2PVSA 3FHCB 2GFQA 1C30B 2XQKA 3KJNA 5ECDA 4AQDA 3FZYA 4NOKA 3VPAA 2DX7A 1EEXB 1I4DD 4XD7D 3SBOA 4PZZA 1S02A 2ZRGA 4YIHA 2H5IA 1XZQA 3FGOA 2OYCA 5TARA 3D6TB 3IUJA 1NXQA 4M38A 1UJCA 5AKYA 4NZYA 3DAFA 3QUBA 2YXPX 4RLFA 1X13A 3BIJA 3UWMA 3S4YA 4AWBA 3K30A 4HPWA 5HKLA 1QJCA 4PSUA 4MVJF 4LOHA 5JADA 4PE5B 1NKVA 2REBA 1DG1G 3IT2A 3QJ5A 1Q5PA 4WQMA 3RJZA 4R1OA 3KHTA 4QJIA 5ICGA 1LI5A 4JDUA 1UXOA 3IIJA 4ZGWA 1KOLA 4C29A 5IAOA 2ONKA 1J39A 5KIAA 4XVUA 1WEHA 1JHQA 3RK0A 3M6IA 3UJ9A 4CQMA 1O7JA 2BFBB 1G4AE 2GCIA 3Q88A 1LRKA 5CIWA 1K68A 3UAZA 5EZQA 3FH0A 3SM3A 4DJFC 2IP2A 3GGJA 5EIBD 1F8FA 4S12A 4YRKA 3VPFA 4O4LB 3UMFA 4NCHA 2IH2A 3CHYA 3GWZA 3A04A 4RVSA 2YMLA 4FKBA 2ONJA 1O8CA 3PRKE 1N9GA 3FKSA 4RAQA 1LLQA 4ZTZB 3W4JA 5AW2A 1YB7A 3ZWMA 1ECFA 3R7FA 2JFGA 3EXEB 4R9VA 5CVTA 3QG5A 1LBIA 2C5BA 4D44A 2H4XA 5CFZA 3RVRA 1QM5A 1SC9A 4MNTA 1Z5ZA 3G85A 2P2SA 3KQOA 4QYXA 3D02A 3QE2A 5EI5A 2IOFK 1OXXK 2ZREA 5BOSB 4PF1A 1UMCA 2HO5A 3A4LA 4DLRA 1QE5A 1L6IA 3DZ8A 2D5LA 5TQ0B 2JJ2D 1UM9A 1SIWA 1UXHA 1EBFA 3HYSA 4C5AA 1U28A 3U13A 2BFMA 4MWOA 4UNSA 3LCMA 2PGNA 4B83A 1WZIA 1CQJA 2IYAA 4M0PA 1CR6A 3SD7A 2KS6A 3WKCA 4QTXA 2Q1XA 3LXRA 1NYRA 1YUMA 2R60A 1WB4A 3ESBA 4FHFA 2P9ZA 3G5TA 4MKRA 4NYMR 2FF7A 1PQPA 3O1JC 2A33A 2HJHA 3ICCA 2VHYA 1YK0A 3INNA 1PNVA 4HQFA 2C2GA 3DZFA 4CNQA 1N6OA 2CKDA 1SK9A 2IHKA 3ME5A 2XT6A 3U19A 1II8B 1LX7A 4NK5A 2UXDB 3MCAA 3E3NA 2H31A 3ZDXB 4ZYLA 1YE5A 1ISPA 1XVIA 3UA3A 4KJZA 3IUNA 2D4AA 4HNTA 1G3RA 1CY7A 4KQ1A 5ELLA 1IK4A 4U1RA 4OB7A 4RETA 3M5CA 2B5WA 2PS0A 3NHLA 1IIBA 2NM0A 5JALA 2QMZA 3AZOA 5KOHA 1Y5RA 4G0XA 4IUDS 1N34B 4M1QA 3OLWA 5JJLA 3GG9A 4IIXA 4RTMA 1J9GA 4Q1EA 5JVDA 1M8FA 3DBHA 1YI0A 4RU1A 3UA4A 4IXTA 1Z5PA 2W6QA 3RGGA 3J81A 3B2QA 2AFHE 3C7TA 2YMQA 2PAFA 4WUVA 4LZAA 4AWAA 4GPD1 2BR4A 4FOTA 2DPGA 4KV7A 1RWNA 3G2NA 3K1TA 4MKZA 4RMNA 5GJCA 2GHQA 2OPHA 3ROKA 1XTZA 1UFQA 3QXXA 5LUBA 2OVBA 4O33A 3BQNB 5H82A 1MW9X 1IBMB 2LNDA 2QRUA 2RDMA 1L4HA 3ZJVA 2Q6KA 1Y81A 4NKRA 2PUBA 4KN8A 4MRRA 2V0GA 2GS9A 1W88B 1E0DA 3FZQA 4RZIA 1S2DA 5JE8A 5TVKA 3TTWA 4KAAA 4A7PA 1HQKA 2XTJA 1LC3A 1T9GR 2Z83A 4D3YA 3KJEA 2A9PA 3B9BA 3F5SA 3SJUA 3AFIA 4KV9A 4AWXA 8ATCA 4MRVA 1ILWA 1NQOA 3W2EA 1UFRA 1SD5A 2V03A 3MB8A 4JC4A 4K6MA 4MITA 3AHHA 4GI7A 2MSEB 4EFKA 3LT0A 1OZGA 3W6ZA 3O8QB 1HYBA 2FTKE 3G23A 4PZLA 4W5HA 1M34B 1BFDA 4PONA 4YAOA 3P2KA 1XDDA 4WADA 3DE0X 5DMXA 3BE4A 4EX6A 4Z7QB 4WW0A 2HSJA 1S3GA 4JLNA 1YQGA 2PMWB 1DKQA 5FFFA 2J07A 1KO5A 2WZBA 5JFGA 2ZYTX 4I1YA 1Z3IX 2XB8A 4G89A 3W9BA 4K28A 3ZDZB 2F9LA 5F21A 1N3YA 3E53A 1HURA 1MTOA 2C2OA 1PZGA 1EAMA 1YJBA 4P4UA 1E9AA 2IOHA 5MFZA 1Y5MA 2B9VA 1CP3A 1EQUA 5ER6A 2YJZA 5SICE 2P91A 3C5EA 4MQBA 4BQSA 1SQ6A 1CQIB 1ZL0A 5LR6A 3LBAA 1X7XB 3L6OO 5ETJA 4CQNA 3R9WA 2JI7A 1Y1PA 4IPTA 1MIOA 2CEKA 3W6OA 4GMHA 4KI7A 3DH0A 1LSJA 3ML1A 3QUQA 2SKCA 3RJTA 2D62A 3IEXA 1F1JA 3OM1A 4NBNA 2HGSA 4M6WA 5DLDA 3UWOA 2IYXA 1MP0A 1LPAB 1RWBA 2PRJA 4N3CA 4ZVSA 2JLYA 1D0VA 1LNQA 2O6HA 4HNQA 3ADBA 3AUXA 4I14A 4WMLA 1D4ZA 1MB3A 3RBVA 3P0JA 5EXXA 1YZKA 1FL9A 1J24A 3DM9B 4DLXA 1FNNA 1J0DA 3T0GA 5ITWA 2X6TA 3L6CA 2RK6A 3EG9A 3EF1A 3MXOA 3Q7TA 4HY3A 5DXAA 5LLTA 1L5FA 1VI5A 2WIGA 2VJPA 5FOVA 1WY5A 3WQRA 1UMBB 2CW5A 3E15A 1YBVA 1N77A 4R9UC 3FCYA 3KYJB 3R0XA 2WF6A 1PL0A 3BXHA 2BKAA 3GPDG 2XZLA 4R2WA 4DCPA 1WDTA 3C3XA 1W4RA 4R6WA 1L6RA 1IZ8A 1SBNE 2FWAA 2IP1A 5EIBC 3INRA 2IIPA 4HNHA 2XT9A 3KQLA 3R9XB 2PUCA 2RGDA 3IAFA 1I30A 1PR3A 2BR5A 2QM3A 2EKQA 2QB5A 1RJ9B 1FFXA 2J5QA 2JKZA 2VDWB 1X8JA 1JP7A 2Q4TA 5TGTA 4HRVA 1F0PA 3O26A 2EBWA 4D9JA 4EI8A 2Y76A 2A84A 1C50A 3JVUA 1ESNA 3SSNA 2X4LA 2W2MA 3AB7A 2GN6A 5F64A 4EGCB 4C0SA 1Y7TA 1UANA 4NYJQ 4P4SB 4MR8A 2L0XA 1C7RA 3FOEC 4M7PA 1L8OA 1ITZA 5GMOA 4QT4A 1T0UA 2IYZA 4IHKA 4HDRB 4JXZA 2OK7A 2OGUA 3LFUA 4DDTA 2FW1A 1QQBA 1QWSA 4EELA 1F2TB 1NMZA 4ZP1A 4L9RA 2XRZA 4ZCLA 1WQ1R 4YV0A 3MQ2A 2JIPA 1OBHA 4HNGA 4ZVMA 1NM5C 4CV0A 5CT8A 1AC5A 2VLIA 1FVOA 1OLSA 4UBKA 3T52A 5AQEA 4BQOA 1G6OA 1NF2A 1U7TA 4MKIA 3BGSA 4B71A 2EDAA 4MWDA 3HA5A 2GLTA 2Z8YM 1JLLA 3A4TA 3WWOA 4AJJA 1JALA 4DSNA 5KYXB 2V7TA 1A95A 1B0ZA 2WJYA 1E62A 1EJ0A 2OL4A 3B3AA 1RBQA 1NSYA 4FMPA 3DMYA 1SEVA 4IGIA 4O4JF 4UULA 1T9AA 2QRQA 4KO3S 3TPFA 1VKRA 3L4KA 5EJ5A 2YASA 3A27A 5WRFA 2BFAA 3D8HA 1D6SA 2COEA 4X8LA 2FHSA 1OYWA 1T13A 2ZB3A 4I2NA 4TTSA 2PMFA 1XXLA 5K4HA 1XD2B 2C2HA 2DPXA 3AESB 3QEMA 4PYOA 5K0SA 1Z0FA 1X8XA 2UU9B 2OZVA 2ZIXA 1JAZA 1PJCA 4POOA 5H3HA 3VC2A 3GL9A 3B9RA 4RZXA 3RE1A 2V5AA 3IIKA 1DKOA 4YONB 1HEIA 2Z6UA 1RJDA 2BOVA 2GK4A 4MZDA 2LV8A 1ZGHA 4H7EA 4EI2A 5J2TF 3TM5A 3UICA 2ZTHA 4EG0A 1GG9A 4Q1VA 2ANBA 4IY1A 3WHIA 1B14A 5GJVC 4X91A 7REQA 5K0ZA 4AY4A 1ADGA 2WIDA 1YAJA 3FYUA 3HRKA 1T3HA 2X9VA 4BNHA 3C87A 2ZVQX 4HYEA 2B35A 3K92A 1CIPA 1O95A 2NP7A 1U2RA 2IRWA 1SVIA 1SQFA 1ZMTA 1TW2A 2WSSD 4ZQGA 5EL0A 3DDNA 1BFUA 2NO6A 4G4SO 4D9EA 5JASA 4QOIA 3C8ZA 1PYDA 1UR5A 5LOVB 1WP4A 1QIIA 3A9RA 3CF2A 2EQAA 3T12A 1U0TA 5ALXA 3BCUA 2H51A 1CTQA 2EZ4A 3A1EA 1P9NA 1IZ0A 5ALIA 3GJ5A 1NSFA 4K26A 2V4ZA 3WMXA 4KVFA 1J8QA 1WHSA 3HR7A 1FRZA 4RPHA 4AS1A 1P7PA 1D4AA 2NUAA 4XLZA 5K6AA 3VJRA 1IUPA 4O1MA 2ZUTA 2Q8PA 3SOZA 3RS3A 1CZHA 5CCDA 1KIFA 4CMKA 5D87A 1XEXA 4YT8A 5HS4A 4CT5A 4DV6B 5ALDA 4DL9A 2EWMA 2AI2A 3KCNA 1SIBE 1H85A 3WO0A 1RAEA 1RWKA 3LHFA 3MNFA 1XZJA 1ORHA 4GXNA 5KNCD 2DFDA 1TKRA 2ESRA 5BVGB 3WBFA 1T5HX 4L4ZA 5FPSA 4CCAA 1GAEO 1GA6A 3BGVA 3QLVC 2P9JA 4YQZA 1KQNA 5K51A 2QX9A 1Z28A 2YY5A 2FEAA 3HBLA 1RXEA 1UWLA 4TXNA 3CLUC 1EIWA 4KAJA 3E5MA 5DDIP 5IVKA 3U4QB 4CN9A 3JQPA 5KTMA 1P0PA 1TQ4A 3JSXA 1TXGA 3Q87B 4XM2A 4OQPA 4B44A 3KKQA 5K0GA 3GGSA 4DZRA 3H5NA 5M5BA 2F1RA 2HRBA 1VLMA 2FWJA 3EAFA 3WVNA 2BYTA 2ZJ6A 2Q4DA 3NAGA 4A3SA 3KQHA 1NA5A 4MULA 2YJGA 3P4YA 1V6CA 2QE7A 2B5OA 1YZNA 2WJAA 3AKCA 2JZOA 4LHEA 1KC1A 4MQLA 4DT1A 1NONA 4Y6QA 1JNXX 5CXQA 2P9CA 3HKEA 3ZZ1A 1N33B 5I9TA 1ZI8A 2OQ2A 3FOZA 4GE3A 2HHLA 4RKEA 4XR9A 1XNRB 3CEJA 4P5PA 2JDID 2AZXA 4RJLA 1JBKA 2C1ZA 4QQ8A 2YWXA 4NFYA 4UE6A 1DAEA 3FBTA 1YRYE 1CPYA 1RU3A 2IYOA 4G2TA 3PL1A 2A3RA 2DJ5A 4GX5A 1E5LA 1NVFA 1HC7A 1EWYA 1XZDA 2J0EA 4X92A 4CM6A 4BGUA 2GEBA 3HJHA 3HKDB 3OD1A 4JH0A 1MA0A 2FW0A 4DF3A 1L5MA 3GUCA 1OB2A 2QRVB 5CM8B 3W8NA 3D1JA 3PTZA 1E98A 3VTAA 1E4EA 4ZVKA 4BQQA 5JYDA 4C07A 2NXCA 1ZEMA 4KO1S 4NWIA 3DTYA 4QEZA 2D7DA 4BN5A 3WBBA 3ID6C 2QN9A 3ESXA 3HN7A 2P0EA 4MO2A 1PNOA 2BP7B 5ALKA 4C2BA 1OWOA 2GN2A 4ETMA 1YGYA 3PX3A 2E4XA 5CK5A 3CUEF 2ZB7A 3G9ZA 2WYHA 5GPBA 3U40A 1MV8A 2C5GA 1J7JA 3KZOA 2NQ2C 3PWSA 4RL6A 2ZWOA 2BL4A 2WU0A 1A7KA 1FMTA 4ROSA 5A3SA 2OD2A 1G59A 1SVKA 1MKYA 3L1VA 2E5FA 3R3WA 1K4KA 4GVLA 3VPSA 4DDWA 3GDFA 4XASA 5TGDA 2LUOA 1ZOOA 2Y1KA 3HI4A 2XTZA 4B6PA 2B37A 4OQNA 3LY7A 4CF6A 2WPDD 2BZ0A 2DWPA 3C3PA 1N5RA 1ZZEA 1U6JA 3PHJA 1IULA 4TXMA 4IHQA 1XCLA 2AX4A 4JVLA 4YFYA 1TMOA 4A6XA 1B74A 3A26A 2WHEA 1G2IA 4HB3A 1PZNA 3TO5A 5LIRA 1L5YA 3OIYA 3CG4A 3G0OA 1J5PA 1D9ZA 3QVSA 4EF4A 3HK2A 2FAXA 1ZIDA 4JQOA 1N0UA 4EO9A 1YZUA 3MTBA 4BLTA 4DCJA 4F3RA 3U26A 1UWKA 1UJ2A 1L1QA 1R0YA 2GA9A 3HBAA 1QDLB 3TQHA 4O0MA 4DDMA 1TU3A 3RF6A 2H3HA 3UWSA 4ZC1A 2OXCA 4MVJA 3VH2A 1X9HA 4TTIA 4HQ6A 1DEOA 2ZETA 2Q50A 3FWYA 3WYAA 3KWJA 1O94A 5FOQA 4D26A 1E8NA 1Q1GA 3BHIA 3BWXA 3GQVA 1FDRA 2ZYAA 4DDKA 1OYVA 2D5CA 2UUAB 3BFJA 1TAQA 4BQNA 5J3JA 1W6UA 3AEKB 3JX9A 2YCLA 2ET6A 3HVHA 4RJIA 2V55B 5A3QA 3M1AA 4CI9A 1XRMA 1MEEA 1F2UB 2PIDA 2WF5A 5ITSA 1E94E 4O1HA 3P2MA 2Y4NA 1GUFA 1ZIPA 4AY6A 2PX3A 5G1NA 2FJ0A 3MQ4A 4G3XA 3GF4A 2DY0A 1HLFA 2ZIWB 1WF6A 3Q1KA 4WKPA 4CMCA 5B6JA 5AVYA 1XAHA 1R2QA 3IJEB 3QPAA 2Z2XA 4S1PA 2CCKA 1MQSA 4NS4A 3OPYB 1NMQA 3AR8A 1WKBA 4LWQA 1ZPDA 1FLVA 3JAKA 3AEYA 3K1AB 2WTEA 4MRAA 2NO1A 3RYFB 2KQUA 1I4WA 4QWMA 4EO4A 4C4XA 3L0BA 5FWYB 4URZR 3MFYA 4D4JA 3MWYW 2D1SA 1EP2B 4G0PA 4LRQA 5IDXA 1JWAB 1DCFA 2OC4A 1S6YA 1JU4A 3CX6A 3PFHA 1TLTA 3EISA 1H4QA 2I3BA 3MFQA 4CMAA 1C3VA 4Q6WA 2WLTA 2C0CA 4MWTA 4IL5A 4F56A 3DZKA 2C3YA 2VZ8A 4FINA 3REQB 1B26A 2HWKA 3U7JA 1WXDA 2PE5A 1NC3A 3ORHA 3P94A 5IN4A 3E5HA 3VISA 1VL6A 2VWHA 3LAWA 3UN1A 2NZ2A 2WFZA 2VHEA 3MGCA 1KK0A 4ZGGA 5HFJA 3ZU4A 1KWGA 1FIUA 1G8MA 1Z7YA 3QUSA 2GXUA 5DHFA 1EQ2A 1SUEA 1GLGA 5CDFA 2HQOA 4BLRA 5TLSA 2CHQA 4M9ZA 3STYA 1QVAA 3VR4H 1C4WA 3FFWA 3GJYA 1WZCA 1PSZA 3UT5B 1XMSA 3G68A 1FYFA 3U48A 1UBFA 2DFTA 2HMAA 4OHBA 3JTEA 7ABPA 3GNQA 4V0RA 1IXZA 3LBFA 4WD3A 3KE8A 3DA8A 3VR5A 3QBTA 3V8QA 2O2EA 3AR4A 3GDHA 5C8ZA 1J09A 1Q7BA 3O9MA 4ZOCA 4DA4A 4UBNA 3NNDA 2WIAA 3ZLUA 3TZHA 1J8VA 3FF4A 4FKMA 1OY1A 2Z2IA 3T0IA 4IXMA 3LDHA 4OXYA 5BR8B 2A9RA 4EFLA 3E1KA 3F78A 4MW0A 3UPUA 1IM2A 3SF8B 1LTKA 4CEIB 2H3EA 2O4CA 2ZI4A 4GBGA 1XX6A 2JJMA 2J9ZB 2I4NA 2NV0A 1VG9B 4NV0A 3C3WA 5AK3A 1Y7HA 3OE7D 1YQ9A 1ZN8A 2DTEA 3NC4A 4FQ8A 4JBNA 5A4FS 3C6ZA 4WV3A 1K4MA 5ICFA 4GFDA 2TECE 2JD2A 3RUPA 3WNZA 4NY1A 2W8BB 1ZM2A 4LXYA 3ZBQA 1HOXA 3QA3E 4LDZA 5H9WA 1O58A 2Q5JA 4YHBA 2QQ0A 4LCBA 1MX9A 3AYZB 1OYOA 1Y3AA 1LNZA 3ITNA 3OKFA 4RJJA 4UNRA 1P7VA 3BM5A 3BFKA 3L04A 3V1LA 4MYHA 4ND8B 3A3YA 4WRRA 3B6ZA 2WD7A 1DX9A 1J0CA 3V7WA 4BY9E 1RRKA 2OFPA 1XAIA 4I4TB 1SULA 3SVZA 4KBYA 3T1QA 3HHPA 5FA5A 3I28A 5GZ6A 4TSFA 3N58A 2H9AA 4A4DA 3NVDA 3D2CA 1LUAA 3PUHA 4RD1A 5EZ5A 1OE0A 2H11A 2ZUSA 5JOQA 5K20A 1QP0A 4RMIA 2EGHA 1OASA 2EATA 1T4CB 3AV0B 1Y3IA 4YJ2B 4OA8A 1LSSA 1YVUA 5CG1A 4XIGS 5AJTA 1XTBA 4DR4B 2C4NA 2DPMA 4NHOA 2DVMA 2HN9A 4QUBA 3DLIA 2H18A 4OX9B 5IJZA 1U8EA 3K2IA 2H2AA 3GAFA 2PJZA 6AT1A 2NVOA 3WL8A 1TADA 3LGAA 1Q17A 2H2DA 4GD3Q 4LGMA 3ZV7A 4BV3A 5BN4A 3ZHSA 2OCYC 2PRYA 2V3WA 1M2FA 2WUFA 4F91B 3IE0A 2KPOA 1Z4PX 2PBRA 4IM7A 1IG0A 1K6MA 4JKYA 3THYA 2Z43A 2FPSA 1WR8A 3SMQA 4Z0NA 3PZRA 3VDMA 1CEEA 1AQJA 4UUQA 1BJTA 3UMRA 4NNPA 2W0MA 1VGQA 1NPTO 1Q6ZA 3QY9A 4CIVA 3N59A 4WLVA 2VXOA 3O6VA 1T6BY 1NUHA 2OV4A 3DMPA 1D1QA 3DBOB 2DSNA 3NTVA 3CGWA 3OY2A 4UNIA 2RE8A 2RKBA 2ZIGA 1YZVA 3QI7A 3LF2A 4GL2A 2WYWA 3UB2A 3TSZA 4F4DA 2VK4A 4PCVA 4D0RA 5JSQA 5EWJA 4TWZA 1GZUA 3CFYA 2FW9A 4Q1DA 3RVKA 3H84A 1PYGA 2O2GA 3DFUA 3F98A 4ZCRA 3BDIA 4JT8A 1QBGA 3VAYA 4O4LF 4W6ZA 3KJZA 3MLEA 4GQIA 2D0DA 3MOGA 1X7ZA 3QKSA 4YJHB 1JQ5A 3P71T 4FYPA 1D5CA 1J33A 1ISMA 2GCNA 2ZG6A 5FOSA 1XOIA 4LV6A 1QANA 3BFXA 3TRHA 3W9SA 4RHYA 1PZXA 1QS0B 1W5SA 2DBRA 3EVNA 2YNMA 2ZJ2A 3ZD6A 5AI6A 3UUEA 2FOXA 3QI2A 2VP4A 3NXKA 1ZN7A 2YOGA 2IQIA 4DJTA 4Y9SA 2C59A 4QFMA 2J41A 2FZGA 2G9UA 2WJPA 4OP2A 5A7GA 2VJMA 3Q8MA 4Y2XA 2RC5A 2Y9MB 3FMGA 2EHDA 2WSLA 4Y67A 2AQIA 2JKYA 2XNCA 3H1FA 3IUEA 1ODCA 2IZOA 3BB4A 3H11A 4NDAA 2GT1A 4X95A 1W5EA 2CMDA 3P96A 3UPTA 4FYVA 4CLDA 3RAJA 4OJKA 2O2HA 3MSXA 3ZWQA 3P9CA 1A9YA 1RQNA 3DULA 4FR5A 4CQJA 3SVLA 2Q4OA 3R44A 1XHFA 5DX8A 2R79A 3KLMX 1ND6A 2R6R1 1QHGA 1YQWA 2GR9A 3FLAA 1NRJB 1JN0A 1ODFA 4PLCA 3SPXA 4EW6A 2PX5A 4J1SA 3PCTA 4OYYA 2IS4A 2IZ7A 2CXNA 1XMPA 1JWBB 1M2GA 2BFDB 5KWSA 4P7FA 1AUOA 4DQLA 4EJ6A 5AHRA 1S3FA 2FJUA 4LXXA 4MP8A 2XWBF 2A3NA 3PQ3A 4R1MA 4B3HA 3AEXA 2CHVA 2VHVA 1HDIA 2QTFA 3UWKA 3S2YA 3VM6A 3ZU3A 4JCCA 3QE0A 2C7BA 4OHZA 3USES 3HNPA 3U62A 1I6MA 3N6XA 4U7DA 4O4JA 2FCRA 5F7JA 3SK0A 4WZAA 3KIPA 1UCFA 3IRVA 3NCHA 5CMLA 1UOEA 3GFPA 1P5FA 3QBDA 2V7VA 4CM1A 4HXFB 3SJZA 2R6GA 2A9QA 3PUXA 3UT0A 1ODLA 2ZYVX 2J45A 5J1SB 4B4UA 2GETA 3EEFA 3PEYA 2K4MA 4PLGA 3FSGD 5IT0A 1IEXA 1SA0B 3ZCPA 1L3IA 1JJBA 1U0JA 2BUCA 3CURA 4GSKA 1ORDA 3UGQA 3GBPA 4L5JA 2FN9A 4XWOA 3OLQA 2HMUA 2FEKA 4WLOA 2E3JA 3LO8A 3VHQA 2FDRA 3C3BA 4J1TC 2NWQA 5AJUA 5J2TA 2HW8A 2AKAB 4OQYA 4RTRA 5D1HA 1X87A 1U8CB 2XGSA 1CUHA 1GCUA 1J56A 4B5LA 1KFKB 1MH1A 1E9CA 5EJ7A 1Z5VA 2P69A 1IMOA 2HWUA 3CB2A 2C95A 2EWWA 3DBLB 2P27A 3E9DA 4NJMA 4BAZA 4Q4AA 2ZBGA 1TM2A 2G06A 4ODIA 3FUCA 4Y1FA 4TLEA 2RI6A 3ASZA 1T2CA 3PGA1 1NL3A 1E1CA 4N65A 1OQAA 4B3GA 1ZGAA 4HVCA 3DFIA 1FYDA 4Z5XA 1IB0A 1NNEA 1BRTA 1BTOA 4DM4A 1P9LA 2PLFA 3LUHA 3GV0A 4ASUA 3IE1A 2JLZA 2ZEJA 3TX6A 1T5DX 3NWOA 3L4JA 2RGNC 3VNVA 2RMKA 2V7PA 5D5QA 3C45A 4YP0A 3RRYA 1U8TA 4PZAA 2OC9A 4K1LA 3UBMA 2H4WA 1OB5A 3F49S 2GHRA 2IHTA 2WF7A 1TECE 2TYSB 3OF2A 1EDBA 5CFNA 5EWMB 1M3SA 4EO7A 2ODTX 5DNYB 3V4ZA 4EG5A 4RD6A 3RYIB 1X0XA 4KREA 2XWSA 3W1WA 4LJRA 3CH7A 4KNYA 3N86A 4LF9B 1RVV1 4QXOA 3DO8A 4TMXA 3LCCA 3NT5A 4RQTA 3K9LA 3LE8A 5DRTA 1FSPA 2QTVA 4KN5A 1X8KA 2BLNA 1NX9A 1TU4A 1GZDA 3TOCA 2FXIA 1U2GA 2AEFA 3M3HA 2P0AA 4O0LA 4IH4A 3CMMA 1L3BA 1YFZA 2WYVA 4R0NA 4X41A 1EFTA 4J0CA 1QPBA 3B1WA 1TZCA 1Z38A 2FUNB 3ANLA 2YFYA 1Y6GA 2C9BA 4UNQA 1L7XA 4IFEA 5E6SA 4K6GA 3T9EA 2PD6A 3THRA 1SB9A 4C4TA 3NEJA 3V6LA 1U31A 4IRXA 3L9XA 3OAAA 4L4UA 2ZRKA 1KVTA 3HFJA 4CIYA 1BS9A 4F06A 1M2KA 1SMKA 4E5KA 2NTVA 3LT1A 4X20A 3GWGA 5SY9A 1CQPA 5LWHA 3C3DA 1M6YA 4MGYR 2IBSA 4QQNA 1QONA 1U1DA 1DARA 2PWPA 1EDOA 2AZMA 2BF7A 2LKCA 4OAOA 4ZV7A 3TWOA 3VKWA 5HWSA 3RVSA 3U16A 2ZJFA 5JDIA 2BKLA 2V65A 3L1IA 2XMSA 4HEQA 4BZXA 2P2YA 1IY0A 2WWTA 3HUFA 4YJGA 4D9IA 4JZYA 1N2BA 3T3GA 1JVSA 2V97A 2VP0A 2OBNA 4H08A 3G5MA 2OVFA 4X7BA 1KPIA 4XIJA 5B1DA 4WCFA 1QOPB 3OCWA 4WZ6A 1KS9A 2W6OA 1FTWA 3C3MA 4XFKA 5F5XA 4E7OA 4E2YA 2AZTA 2ZWMA 4BATA 5F52A 5K3AA 3WBKA 2B4YA 5DE3A 1FQOA 3CGGA 1BD3A 3MCUA 2PLNA 5K3CA 3MT7A 1T0HB 2Y0BA 1Z0DA 2XCOA 4U5XA 1ONSA 4ARBA 4UTNA 1P1KA 1SJ9A 2APJA 1DGQA 1EWRA 1GTJ1 1XJCA 2JGIA 2VHTA 1J2JA 4JT2A 2W4QA 1KBQA 3DCJA 4RWZA 2QMOA 1PKXA 5JH7F 1A7UA 3BX1A 4MPRA 4BQPA 1NXVA 2CJPA 3AEQB 3NGXA 4L4RA 1H5NA 4MS4B 2ZB8A 3SFZA 4FFPA 3V4FA 4DGSA 1ODSA 2HKIA 3L7OA 5HTOA 2ZJBA 4E1VA 4HDKA 2W98A 2FWIA 4FLEA 3QK7A 3TG2A 5BW5A 4E08A 3N2GB 4HL6A 1G17A 2C04A 3IOBA 1NUQA 4Z4GA 1AU9A 4YRJA 3AFGA 4IVNA 3U7QB 2P30A 2FN8A 3IBFA 3TOXA 4KO4S 2VI5A 1I7NA 1RC1A 3FA2A 1T8RA 1RACA 1UMDA 3ZYCA 1C7IA 2OAP1 3NDRA 5IJ0B 5LP6C 2AGVA 5H8WA 2FWPA 4XZ3A 3M3DA 4WBNA 2AMFA 2O0LA 1H0SA 1FXUA 2JK1A 3L9WA 1GXSA 1Q7EA 1N4AA 2GEVA 3WK4A 1NQVA 2PK3A 3OO1A 2A9FA 3OETA 2JLBA 2PVPA 4NV3A 5E1DA 5K8LA 2HD4A 2QI9F 2I6SA 1VHLA 2WWXA 1J1IA 3JQQA 4NMXB 3ILHA 2FMKA 1F8GA 3KJQA 4HQ0A 5G4KB 3A1SA 1XVAA 3ZCRA 4EHIA 2ZE7A 4YAUA 3IAAA 5EIEA 4KSBA 1EXVA 1EDZA 4FFOA 1IHUA 2O1WA 1JG7A 1K08A 3DWEX 3OT4A 4I8DA 4GWGA 4MI1A 5CJPA 3TRIA 4QODA 3U6BA 1D2MA 2OGSA 3A4IA 3A6FA 1YR1A 3QEOA 3UJ8A 2JJ1A 1HLDA 3R6TA 4IZIA 4JLWA 3KT3A 4EY5A 4U2KA 4LF7B 3FTEA 3H5RA 2WVHA 2Q4EA 4FX2A 1AZWA 2VT7A 1ZRNA 2WFLB 2XA2A 4BQEA 3PHLA 4EABA 4MDYA 1SHTX 2GGSA 2NLOA 4H7DA 5JJ5A 2WB2A 3RHTA 1HT1E 1MR3F 5AUPB 3U1TA 2O52A 2HF7A 2IE0A 3U7EB 4KMSA 3AUJB 3FTQA 2FB9A 4UFNA 4PFQA 4TQUS 5CX1B 5CYFA 2VKQA 1I0LA 2H4HA 4EZIA 3IQZA 3TGLA 4BN0A 3AF6A 3QSYA 1AGNA 1RAHA 3E9ZA 1ESMA 3K09C 4NESA 5HJ2A 4I1PA 4ZIRA 2OZKA 3MBOA 1B2LA 2WQZA 2GZDA 5DTIA 1L7QA 5AT1A 4PPGA 3JCZA 3AIKA 3IOCA 2C99A 3F73A 2X7JA 1MHTA 5JATA 1CJMA 4HEA6 1L4YA 4E46A 6ABPA 1K3TA 4BJ3A 2BCEA 1XK6A 2O8EB 5DJ5A 2AMYA 3OJOA 1U0FA 2IS1A 3OO0A 4XB1A 2Q1YA 2AL7A 2H59A 4ZO9A 3EGXB 3RTAA 4OHMA 4U7JA 4MROA 2DJIA 3VSCA 4GUDA 3S68A 1EXMA 5KYTA 1PJBA 5ILGA 2ZYIA 2J3EA 4RENA 4BX8A 1LV7A 1VRWA 3E2MA 5GVRA 5BPHA 4GDFA 4D56A 5BRJA 1NDQA 3QVVA 1SXJA 4L28A 5H7XA 1I2MA 2QVXX 3IT3A 4M22A 4EY7A 5A1JA 3V1KA 4EUHA 5IEJA 2VDMB 3CUUA 3H87A 2V4UA 3GVHA 2NOAA 4P81A 3NHRA 4I1VA 1AH2A 1QV9A 4O8CA 4DCVA 3Q7QA 4FGKA 4Q3NA 1Z07A 1KFCB 4HUQB 3GZTB 3CNOA 2Y1LA 3BWEA 3C5VA 1RXUA 3D7KA 3BXGA 3HLKA 4G5RA 4TS1A 3UH1A 3W1VA 5CNMA 3D6NB 1L5LA 1EG2A 1XD8A 1U8ZA 1Z6YA 4YRTA 3G8AA 3RFVA 3JQBA 4BECA 3BSYA 2RJNA 3NATA 4H7JA 5JANA 2CL0X 1JEQA 1FY2A 1V35A 2JLSA 4ZMSA 4BGDA 3KL2A 1HLGA 2AJDA 3NBUA 4QDUA 4DR2B 4YB8A 4HVAA 2R2GA 5BV8A 2ZM5A 1AHHA 3KBBA 5AKKA 2F43A 2DBVO 1QB7A 2GEJA 1P6XA 5ULLA 3NNNA 3HH8A 3WGGA 1UKZA 2W4IA 4HSGA 5M7EA 2FX5A 1FSSA 5DHTA 2XUFA 5IK2A 5ABPA 1A77A 3VRHA 2OORC 1O6GA 2WRZA 4DMRA 5KMGA 3KKPA 4R8LA 1YU9A 3WLPA 2Z9CA 3O8LA 4Y6LA 5JRDS 3Q10A 4E7PA 2HQ1A 4NC9A 2I66A 2P7IA 1JLRA 2BBOA 3GZNB 4YALA 3W79A 4P9NA 1G41A 4Q6BA 1BYUA 2G0NA 2NV6A 4RVOA 3UXMA 5IS2A 2XUAA 2FPUA 2QZSA 3V4PB 3HGQA 1YOBA 1SCDA 2PQMA 3FPEA 1KEZA 3FLEA 3K5WA 3UJDA 3ZGYA 4MVJG 5K3FA 2DZDA 1IHOA 1XFDA 2M6LA 3E0QA 3PHIA 1UZLA 3ZG6A 3B82A 3EIQA 4B4KA 1N3BA 2ZQ5A 3EGOA 1TF5A 4K86A 4C7BA 3P9NA 3LQQA 4JI2B 2C4MA 2Q3JA 2WT4A 4LDRA 4RSHA 3EPPA 1L7AA 2H17A 3UC9A 3WYEA 1E5XA 5DULA 2D1TA 1T0IA 2C42A 2NXWA 1OI3A 3MWGA 1KMQA 5FPYA 3RYHA 4EYEA 3WGIA 1BSVA 1E0JA 3GVCA 4CQLB 1U2PA 3Q12A 4URXR 1NKTA 1Z5WA 1AKUA 2Y0PA 3EZXA 2JEYA 2VQSA 2WVJA 3LXUX 1AQYA 3KG2A 4HLUA 3S2GA 4LOIA 2WPNA 2UZ3A 2P8JA 3PNBA 2PNFA 3B1VA 2FPGA 4CTMA 4JXXA 1P75A 2A86A 5IT9A 1NBMA 1NIJA 2SCUB 3HKBA 3M4JA 4M8SA 2C07A 1SEPA 1E6MA 1LK5A 1EZZA 2C2KA 3VHRA 4PN7A 1CE8A 2FRDC 4L22A 3ORFA 2BKUA 2IDMA 1GPUA 4MA0A 1TA4A 1GRRA 2JLXA 5ENZA 2Y6UA 4LHYA 3ROGA 4OMFG 5CYGA 4FE4A 3WFJA 3G7UA 4EA8A 5DNCA 2PS1A 4TLAA 2V58A 4L76A 5I4IA 2BY4A 3ZQJA 4PLYA 4U02A 5C5DA 1P7WA 3AI1A 1OTYA 5DSXA 5DWVA 3GBVA 2ZAOA 3K9FC 1A2BA 2C0PA 1OV6A 2WD9A 5FI0B 3AWDA 1MO4A 2PUVA 1CJUC 1YONA 2DTDA 4ENTA 1BE1A 4OGWA 9LDBA 1RYHA 2M9MA 5IFLA 4XYEA 4XSHA 2E37A 1RIIA 1PDOA 1OWNA 4H6PA 3TSOA 5THKA 3M6UA 4QGGA 1SB8A 5JYBA 4CDMA 4DUGA 2PTHA 3ZWYA 3QW4B 3C39A 1ECGA 4EMSA 1QTNA 4Q9NA 2A5JA 3TLBA 3KQWA 4EMBA 1PJQA 3PPIA 3GEBA 4L08A 2R4QA 1U8YA 1SKYE 3FPBA 7YASA 1NVWQ 1ODJA 1P8AA 3HU5A 3NWBA 1X74A 2VJOA 3SGLA 2W2QA 2FPPB 1NRXA 2HADA 1TF2A 1VYHA 2ZBDA 3VYUB 1GG8A 5DNAA 4O4LA 1GSHA 2D2FA 1H4SA 1Z56C 2A0XA 3ZU2A 4MW7A 4IJKA 3TGWA 1GPWB 1LS6A 1JPUA 1M0EA 1E9VA 2IHVA 2YWCA 1LFDB 4NXNB 5AW4A 1XDSA 5KJ1A 2VOJA 3AETB 4C4ZA 4M46A 3KQMA 3L84A 4ZVPA 3PR2B 1V48A 5U4QA 3R7DA 1TX4B 2NO5A 3AYXB 4Z86A 4ZQCB 1UZMA 3KC2A 3TRJA 3O2SB 1Z4IA 3CIOA 2FUKA 3KOOA 4KGVA 3RJMA 2DCUA 1RABA 2YYZA 4CE6A 2DWCA 1TYBE 1XMQB 121PA 3I05A 4GO1A 4RA9A 4EUSA 4OXNA 1ORRA 1RNLA 3ECSA 3HCEA 4HN2A 3BXFA 1E3JA 5AOCA 3TLKA 2ZPUA 1YT5A 3L7CA 3PUYA 5HIKA 1DBSA 1FTGA 1SBCA 3CZ9A 4HWTA 3GP8A 5I7UA 1YBHA 5M2QA 1O0SA 3E9EA 5KYUA 1DKRA 1E7WA 2OECA 3HB1A 4F7WA 2E2WA 3NUZA 1Y4SA 4LNHA 1T9BA 5JXWA 2PMKA 3O73A 4M98A 1P7ZA 1TKCA 2IPNA 2ISQA 5DI3B 5E9JA 5JLJA 1ISFA 1A2QA 3PGKA 1E96A 3Q6NA 1CUUA 2D8AA 3AM3A 4MUFA 4TV8F 1Z8HA 3TDMA 5AR1A 4JBXA 3CONA 4ND4A 4Q9AA 3TIVA 4RTNA 1RRMA 1COWA 2BGLA 1M75A 4DVGA 3OC0A 3CQ9A 1II8A 3G0IA 3V1MA 2X4GA 2XYVA 2EX1A 2FPWA 1U3TA 1S4QA 3BC1A 4UM7A 2PR7A 2ZJ0A 3E4CA 4B82A 5B4VA 1MX3A 5KSZA 4H4EA 5FNVF 1J2YA 2HLDA 1Q11A 4BLSA 1ZBDA 2PZFA 4X6XA 1L8AA 2YWBA 4R0MA 2Q99A 4AYTA 2JJQA 3GX1A 1NE2A 1K7CA 1ODKA 2BM1A 4KQEA 2WTNA 4BZZA 3ZE8A 4CMEA 1WXQA 3EFEA 2B34A 3MAJA 4HAIA 4JBWA 1XFAA 3KYDB 4UAJA 3CJRA 3UENA 2ZE8A 4FLFA 1RW4A 3B12A 4G85A 4ENPA 6CHYA 4MPPA 2QMEA 3VNBA 5K8TA 1EFAA 4GGPA 1G8AA 1W0KA 1YR6A 2CVZA 3PFFA 3K9NA 1QGOA 1WY7A 4LQDA 3QFFA 4KIFA 4X8HA 4DWJA 4DE5A 3CW2A 2OOKA 2JFOA 1AK2A 3OJLA 2AC2A 4XUCA 2J0UB 3G79A 4KCGA 5BXQC 3HVRA 4DEYA 2YDXA 3PJFA 5A4JA 3E7DA 1EK6A 3O2QB 3TS1A 3SZ3A 4DBZA 1FXWF 4K0RA 2BUAA 1K2WA 1RAGA 3OD5A 4BTLA 1YI8A 3ZBTA 1LSOA 2GF0A 3MS7A 4XGRA 3F67A 3OU2A 3SNHA 1M67A 3GLHE 4G67A 1VRVA 2DFPA 2ZSKA 3N53A 4JBYA 3X0DA 3AV3A 3VKUA 2C7OA 1GSIA 1W88A 1Q7CA 2WV7A 2X2OA 3FI0A 3G0BA 1CR0A 1DTWB 1FNDA 4FT2A 1AGPA 3L6RA 3N1UA 4PLPA 3TMKA 3QVTA 3SC6A 1W59A 2IPOA 3S6JA 3M33A 3ZHXA 4OQ4A 2R8EA 5KVSA 1T5SA 1FK8A 5C81A 1CRLA 3FVWA 1E1MA 3QFCA 5JIBA 5KOYA 4C6HA 1O6ZA 1USGA 2UYHA 3H19A 5IAKA 3E58A 3OKCA 4LN1A 1U7HA 1CZLA 2GB4A 3O8QA 1C7EA 3E7FA 1T6NA 3DTVD 2D59A 1RPAA 1DBRA 1ZDMA 1RYNA 4F46A 3OUUA 4XJVA 2O2JA 3GDWA 9ATCA 5C1DA 1JEJA 1T0BA 3DJYA 2FV8A 1F8UA 2WILA 3TEJA 5E4YA 4G1VA 4JL5A 1GAXA 3W8EA 4YT5A 4Q02A 2C31A 2G8NA 3ANTA 1B8PA 1UZUA 2PRIA 2CF5A 1W4CA 3OC6A 5H5JA 3GHHA 1RAFA 4DLTA 4IJ6A 3O94A 3UM9A 1I3MA 1ZINA 2SNIE 3DXXA 3JXEA 3QG1A 1ZJ4A 5DHPA 3PIDA 3D9QX 3PJRA 2L19A 4UZSA 3WY9A 1A9XB 3GMDA 4OREX 4QASA 2ZZKA 2PNJA 2G7ZA 5EXDA 1IXSB 5ARCA 3GMIA 4BC1A 3WYBA 2DBQA <