1YZFA

Crystal structure of the lipase/acylhydrolase from enterococcus faecalis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
195
structure length
195
Chain Sequence
MRKIVLFGDSITAGYLDEAVSPVLVDLVKRDIAAMGLEEVAVINAGMPGDTTEDGLKRLNKEVLIEKPDEVVIFFGANDASLDRNITVATFRENLETMIHEIGSEKVILITPPYADSGRRPERPQTRIKELVKVAQEVGAAHNLPVIDLYKAMTVYPGTDEFLQADGLHFSQVGYELLGALIVREIKGRLKPKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lipase/acylhydrolase
publication title Crystal structure of the lipase/acylhydrolase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Hydrolase
total genus 74
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1yzfA00
4JJ6A 3DCIA 4M8KA 1IVNA 2HSJA 1ES9A 3BZWA 3DT8A 3KVNA 4IYJA 4HF7A 4LHSA 1WABA 5HOEA 3P94A 1ESEA 3HP4A 4HYQA 4JKOA 4Q7QA 3DT9A 4XVHA 1YZFA 2Q0SA 4PPYA 4I8IA 1FXWA 2WAOA 3SKVA 1FXWF 4K40A 4S1PA 2WAAA 1ESCA 3U37A 1BWRA 1BWPA 1JRLA 1Z8HA 1K7CA 5CD9A 1VJGA 4TX1A 2WABA 1VYHA 4RW0A 4OAPA 1U8UA 3MILA 3PT5A 4NRDA 2W9XA 1J00A 1PP4A 3C1UA 4K9SA 1BWQA 3DC7A 4OAOA 3W7VA 4JHLA 3DT6A 2VPTA 4Q9AA 1ZMBA 4DEVA 1V2GA 2Q0QA 3RJTA 1DEOA 1ESDA 1DEXA 4JJ4A 5JD3A 4H08A 3SLRA 4K3UA 5B5SA 5A4AA 5BN1A 4K7JA 2APJA 2O14A 4RSHA 4JGGA
chains in the Genus database with same CATH superfamily
1QV6A 1NVMB 1ZI6A 1IHYA 1QGYA 1JKJB 1KJQA 1NA5A 2N0SA 3BIWA 4P4SA 1JL3A 5KCZA 4MWBA 2WTEA 4PGFA 1TKAA 1NXWA 2BBWA 2P78A 5IMSA 1N4AA 1MO3A 1KNQA 1ZQ9A 5FUBA 5DKFA 3L0SA 1KETA 1KBQA 1TD9A 1YA4A 4P4SB 3BA6A 1OLSA 3K9GA 2BEWA 5DW0A 3S2GA 4FWIB 1LV7A 3CLRD 1QRDA 1PDOA 3PDHA 2PH3A 1C8LA 3AOEC 3H83A 3RBXA 4AJIA 4F92B 3A1VA 1RJGA 4TXLA 4ZOQI 3ZD9A 2YV4A 2WJHA 5EGNA 3VR6A 2Q1SA 1CNFA 1U8FO 3ROPA 1B00A 3W3AD 1OLSB 1YVUA 1W581 2BEWB 2HTFA 2JIPA 3PTZA 4H17A 4GOND 2C7GA 1JP7A 2F59A 2R1UA 4NK5A 4ZAXA 1HFJA 3SC2A 3ZH2A 2N1MA 3WLIA 3ZZ1A 1BVHA 4MUXA 1XNHA 4INPA 2I3BA 4JAVC 4QSHA 1P1KA 3LO5A 4ZU3A 1J39A 3HYRA 5MGNA 3KM0A 4KN6A 3FR8A 4FYHA 1JEDA 1S1MA 1W87A 3MOSA 4FKMA 4L4RA 1GR0A 3S70A 3L6DA 3LA6A 5J23A 2Q21A 3SC2B 1ZSNA 3CH7A 3R9KA 2C9CA 3MQ4A 4OHBA 5LMUB 3BD8A 2HIAA 4AX8A 3DV0A 1CS0A 4IFTA 1V0JA 3ZJUA 3H5TA 4S1WA 1Z3IX 1WU7A 4LHVA 4WY2A 5D5QA 2GD2A 2ZI4A 4IIHA 1K66A 3PXCX 4NBWA 2DECA 2EDCA 1IBCA 1ZONA 2SECE 1C3OA 1U80A 3FSJX 2J32A 1U2GA 2WIAA 4B6SA 3I9LA 2I2FA 2OV4A 1Q0TA 3DV0B 3PS9A 1CS0B 4UKDA 2OXCA 3DE2X 4OHYA 2JLYA 1Z17A 2IKSA 4LVCA 4Q7JB 3TLKA 2KI5A 3D8UA 4P32A 4DN6A 1GAXA 1ZXLA 1C3OB 3GARA 5EXDA 4NHOA 3FY4A 2IZOA 4PLGA 3TPCA 2XITA 3AQ4A 3NHKA 3VI4B 3E15A 2GRAA 2C83A 1B4DA 1NBIA 4PTLA 2AN1A 3WGQA 1LJ8A 4ITVA 2X1VA 4I3HA 2L0XA 1ZR4A 5HR5A 3M6WA 1I6LA 1JQLB 3BWEA 4FB5A 3RPEA 4GGMX 2YMLA 4RDXA 5C52B 2Q0XA 4DHEA 3DVSX 4ZVUA 1UBCA 2QNIA 3TR6A 3QKWA 4CTOA 5E1BA 3BE5A 1P2UA 3ISTA 1TDJA 4IEEA 4I8XA 3EBPA 1BRTA 4LMAA 2ZS7A 1NMSA 4KCGA 1AV6A 5KVAA 5L6MB 2OG1A 1M6VA 2XGJA 1PZEA 1FFWA 4PLCA 2SCUA 5CD1A 2FP3A 3S28A 4GSLA 5ALYA 3W5BA 3QKRA 2ROQA 1WY5A 5D5HA 1SCKA 2FWMX 2WILA 4O4HA 2HUNA 2Y6UA 4DHWA 5AUNB 1CHNA 1VJRA 1JI0A 2P91A 3MCUA 1Y37A 4RCVA 3VO9A 4PZ0A 5AVUA 3QPWA 4EG3A 4TRMA 1LFAA 2SCUB 3Q5DA 1I0ZA 3CKYA 1G6HA 4ABTA 3H5WA 4O4HB 5EE9A 1T0UA 1QP4A 3D31A 3PGXA 5G53C 3DNMA 3HB0A 3MTQA 1RAGA 1Z2PX 2ZJZA 1P33A 1OTYA 3OWOA 5FNVF 2WWYA 3QWIA 3WK8A 1UM9B 2JD2A 1OB2A 4K46A 3EN0A 3ZE1B 3IX7A 5IAKA 4ETIA 2W2OA 4M8KA 2REBA 3QU4A 4HAYA 1PD1A 3CINA 1C80A 3RRBA 3F4KA 4DL9A 3ZTWA 3G02A 3O8BA 1TJ5A 1ISPA 1OXBB 1CIPA 2R9VA 4Q7EA 2FWAA 5HKKD 2J3KA 4HNGA 1HT1E 5LBUA 5CVDA 3FOWA 1QIJA 1QTIA 1T0HB 3PCRB 4L9WA 1MAAA 2Z8YM 5CXXA 5EIAA 4EPTA 3QELA 3VNQA 1DQYA 1VSUA 3NAMA 3HKDA 1CR2A 1E1CA 2WP8J 1IUPA 1WF3A 1XLVA 2WLSA 3DLIA 4EWLA 4ROSA 5EUQB 3A6DA 4YRKA 3C7AA 1F0YA 1C50A 2IFTA 3QYJA 4OIMA 6CHYA 2RONA 1PNTA 3L7OA 1AQ6A 1P81A 1GPMA 2MSNA 3QELB 1DT5A 4UUPA 4YJKA 5BXYA 3HKDB 4I4LA 3UQZA 2WSMA 4PS0A 2GJ8A 3R7NA 1N8TA 3VPGA 4ZGBA 4BIMA 2HSDA 1RJ9A 3F8WA 3HFGA 3QPBA 2H8KA 4FR0A 1EWRA 4MO2A 3A4TA 2FKNA 2NU8A 1UH5A 3WNZA 3PJGA 1VYUA 1XQ6A 4S35A 4TSFA 5AJHA 3ZCRA 3ZK7A 4DIUA 2EKZA 1E59A 4OJMX 1DCTA 3G2LA 1RAHA 1R8QA 5CXQA 3R77A 1X1TA 5AW4A 2Q3LA 2Y0CA 1YVEI 3IBFA 5D3MA 3AHHA 1RJ9B 1XK7A 5J9FA 3K6RA 4M1OA 4P92A 1OBVA 2FX3A 1OVGA 2HJHA 3B5JA 1Y1QA 6PFKA 3BQNB 3R8FA 3OOWA 2PUHA 3LC2O 4DA6A 2ZRLA 4MHOA 4DR1B 1UQTA 3LF1A 8LDHA 3Q12A 5D3MB 1VIMA 4A9AA 4NJEA 3KTAA 1VE5A 4POOA 2B4KA 4FYVA 3THWA 3RD5A 3W4KA 3RKSA 3S6JA 1JG1A 4RBNA 4A10A 1OTXA 1V5GA 2JI7A 2XOKD 3HBJA 3RF7A 3VI3B 2YHAA 2YQZA 4PYLA 4HX9A 5ANRB 2AUTA 4TPKA 1QORA 2HC9A 3BCHA 3KTAB 4MO9A 3LA8A 1J8DA 1N25A 1IY0A 1NE2A 5KYUA 2C03A 5TMEA 5JALA 4ENUA 1PYGA 2ZR7A 2LCFA 3I34X 1L7QA 2NXJA 4QE3A 1R0RE 5FOUA 1G9TA 3E9MA 3EMBA 5TGTA 1OQAA 1LK7A 1MXHA 1H65A 1KI7A 3F7TA 3FB1A 3I1FA 3Q2IA 2R7AA 4HNHA 3C6QA 4QFCA 5CK5A 4ZI7A 2DEUA 1K4YA 3ASYA 4V2UA 3DZCA 1PZFA 2XVAA 1DP4A 3WLEA 5L53A 4QM7A 4K1LA 2AUMA 4BATA 4LMBA 1RPJA 1J2TA 5K0SA 3LKVA 3L1VA 3TNDA 4Z51A 3PGMA 1DOZA 2GLXA 4IY1A 1EX9A 1T6NA 4KFCA 1NBEA 2KX7A 1I7PA 1SCDA 1URPA 3FDJA 3GGPA 4DIFA 4ZI7B 4BZWA 2G9RA 2PY6A 4RKWA 3SDBA 4KXUA 1C1DA 3G17A 1NQWA 2DP4E 1QGZA 3IJ5A 3VR2D 3VYSB 5LSAA 4WKBA 1XA4A 1P5HA 1SWWA 4F3KA 4HXEB 3ZGOA 4ASUA 3EFHA 4BLUA 5BNIA 2UUOA 5DU2A 4V0OA 3NGMA 2R68A 3FSGA 1PR3A 3FDXA 2FU5C 4C3UA 1LBQA 2QS9A 5LR6A 3KQLA 5SYAA 4N7JA 3FUVA 4PINA 8AT1A 5IS2A 3DLHA 2A4MA 1C1DB 4B80A 1VHTA 4DIEA 3A14A 4ZOCA 2ALJA 2IW3A 2VNIA 4E46A 1HQYE 1V43A 2V7TA 4US2R 2RHCA 3KELA 4LDQA 4QTUB 5ALSA 3TQCA 1T1SA 4R2JA 1X1RA 4E3WA 4MUFA 5DYNA 4P22A 1KAEA 1TFUA 2AJ8A 1T43A 1DC3A 2VP4A 3U26A 3VU3A 3H1AA 5CK4A 1E7WA 2GD0A 2C20A 4QVGA 4E1VA 1JQ3A 2Q4DA 2D4AA 2H7XA 3OCZA 3D6AA 4GPD1 4O08A 3NX4A 2NUTA 4JYZA 3ETGA 3F1KA 4QU0A 2AK2A 2C3UA 1VKNA 2ZVQX 3WRVA 2JIQA 3SPXA 1AQLA 3MUEA 3EGDA 3WLFA 5FWXA 1O87A 2OM6A 2CSUA 1F38A 2PL3A 4MCAA 4GDFA 1TYAE 2G06A 3TQSA 3X1JA 4HZIA 4EJ2A 3O9VA 2IZ0A 2NUTB 4QHYA 1XRRA 3VKUA 1QMGA 5A5EA 3LW8A 1W4RA 2BLLA 4UDXX 1WE2A 3QXXA 3PD0A 3WISA 3EGDB 5FWXB 1J8YF 1Y3HA 5EKUA 2R6HA 4PO9A 4KR7A 2PSEA 3F90A 3U6KA 1WVIA 2C99A 3QG1A 3W0LB 5AKGA 2V6GA 4ZZIA 1EE9A 1MHPA 3OM8A 1F6WA 1O6ZA 2PANA 2AYYA 2PJUA 3C5VA 3ENQA 3GDWA 3V9AA 4CV3A 2G67A 5EYPA 3FHJA 3G59A 4RD1A 1TVEA 2I22A 4M87A 5CB4F 4OMFG 1B43A 4L9AA 3WJ1A 4U0KA 1JVBA 2GNPA 3GBSA 2EHJA 3BORA 3H9UA 5GOZA 3QLVA 5CJJA 4XYLA 4NCBA 3IHTA 3MLAA 2UZ3A 3ASUA 4JA0A 4PQFA 4Q7MB 2DE0X 3RC7A 1XLTA 2YWCA 4RE6A 5EOVA 5EYPB 1Z08A 3WLPA 3TB6A 3DJFA 3IELA 3WK4A 5B4UA 1M2GA 3D7NA 1NDQA 2QJFA 3P0RA 2WRZA 3M89A 3TE6A 3ZCXA 4OXQA 1OYOA 1EJBA 4OG2A 1KOLA 2CB9A 1JMKC 3HGQA 1OIWA 3NTOA 3PHJA 5B1YA 1WOYA 3GLGA 3CB2A 2PX3A 4JFAA 4RIEA 2DQ4A 3LX4A 1BXKA 1Z9BA 4JBLA 4ZV7A 1K89A 3VHXA 2P2YA 4JJIA 4CDRA 5FWAA 4ZYVA 5AMXA 3R5JA 4IQFA 1XKTA 3GLGB 1UJCA 1I80A 3ILXA 4GXTA 4NCNA 9LDBA 3RU3A 2GYVA 4NOKA 4IIYA 1AGXA 1TCVA 5I8PA 4KJZA 4U6NA 5U9CA 4PYOA 4AQYB 3IVRA 1U8TA 4Q9AA 2TS1A 3DLCA 3SZRA 2IYNA 3MRSA 1E0KA 5F21A 3VHXB 2I9PA 3ANXA 3LW7A 1AC5A 2C7VA 2OESA 5A9RA 3A4VA 3ZVLA 1SHTX 3ONWA 3D4NA 1R0ZA 5C35A 1FSPA 1KJWA 2P4UA 2BE7A 3ZOZA 2CMGA 1ZCFA 3LXMA 4L16A 3LIIA 1PZNA 3S8YA 3I0ZA 5KWIA 1RAEA 5COBA 4CMCA 5JZOA 1E69A 3S1LA 2PLWA 2ZR0A 3RIMA 4AS2A 3Q8MA 4H08A 4CV2A 1RC8A 1KOGA 4CDGA 5FLXA 1W48A 1W36D 1U94A 4TLBA 1GZ4A 1B74A 3C3CA 1M34A 5BRAA 2XNKA 3DZFA 1NUPA 3MJFA 1H5UA 1XF1A 5LLDA 2OCGA 1FP2A 1SOUA 1GA1A 1EG7A 2Q8NA 4HFNA 4BVAA 1HDRA 5J3JA 4BPRA 2XB8A 3IUYA 1KMCA 1CRPA 1R0XA 1MT3A 3LY9A 4KAXA 4NMWA 5KOJA 4R81A 1PWEA 1M34B 1JKXA 4D1YA 1ZJZA 2YWRA 1Q5PA 2GBLC 4P3KA 4DLPA 2IYWA 4IHQA 3EIEA 3TN7A 1DDGA 3FCAA 2HD4A 2VWGA 3JQ9C 3S1AA 5KOJB 6AT1A 1WM1A 1FNNA 3C3DA 3ED5A 1A2OA 4G0ZA 2J9RA 2FSPA 3G79A 1DWUA 5LIRA 4O3FA 1KIMA 5BSTA 1WUTA 2A88A 2WJPA 2X7JA 4JQZA 1N57A 2BZGA 1WXIA 4NH0A 3CJQA 4F11A 2PO5A 4FGSA 4UQOA 3RK0A 4W9RA 2C84A 3S1AB 1QQTA 4F5WA 4XVCA 3PQ8A 5MFPA 2W37A 2CL7X 2VUUA 1ULSA 1SC1A 4LZOA 2ERCA 2OVFA 1YMQA 5HJ2A 2JKYA 1C0LA 2D1FA 2J45A 2PZBA 3M83A 2JAHA 5DGIA 2R79A 1KE2A 4BNXA 1IMJA 5JATA 3LDGA 3BFVA 2QVCA 5FPTA 1PZXA 3UT5B 4BKRA 4UM9B 2FMFA 4TROA 1UFOA 1LJLA 4PX5A 1I30A 1G20E 2F1OA 2C4UA 1BG6A 1E7SA 3PQDA 4NC9A 4ZALA 1AHNA 3LVQE 1X1CA 3IEMA 1ZA2A 5DHPA 2XA1A 2CFRA 1KR2A 4R0NA 1V1RA 4YRQA 3E1GA 3O8DA 1JEQA 5TS3A 1XEXA 5KI6A 4EUEA 1L4UA 3LO8A 4RVFA 4RHFA 4CKYA 4WINA 4MW9A 1Y1TA 3GH1A 4N01A 3HM9A 1P0PA 5GJCA 3SFVA 4DA9A 4ZYXA 3WB1A 1O4VA 1DG1G 2Q6IA 3C70A 4KITB 5JD5A 3HS3A 1BROA 1SY7A 2XXJA 4QRDA 1IBRA 4BKMA 1V1RB 1DV2A 2IE8A 4ALMA 1JEQB 5KEIA 1XEXB 1TXGA 2VPYA 2CE7A 3LQFA 1HSOA 4U9UA 4HWKA 3B6IA 3WLQA 1QNLA 2Y99A 2PL1A 4HFJA 2GAIA 1OKKA 2HCRA 1MQAA 1L7RA 5BN4A 2H5IA 2NXNA 3JALA 3LUHA 2PEZA 3DOCA 1T0IA 4I14A 2TMKA 3WHKA 1YCHA 3C6KA 4ZAVA 1NMQA 3GJ4A 1PLLA 4C2BA 1CB0A 3KL4A 5BN4B 4M8IA 3JALB 3EVBA 4AN0A 1L3CA 3F3MA 4A92A 2YHBA 5B4VA 2JLRA 3GIDA 3BILA 1L5HA 4IIUA 4MAFA 4AG5A 4DREA 3THOA 4U6SA 3HPRA 2GCPA 2ZRGA 2OGWA 5A03A 2VXCA 3ESAA 1XE3A 4L1KA 4MKFA 3EYAA 3FPFA 4PXSA 2ZJ6A 5EFOA 2I0FA 4Z2YA 3T7KA 4CU5A 1HE2A 1L9KA 1XPOA 3QMMA 4EM6A 4HP8A 1L5HB 3ZGNA 1CFJA 2HADA 4UHCA 3OTGA 2X4DA 1KSHA 2ZP1A 1Z5UA 3C4QA 2ZJ2A 4JL6A 4YRJA 1LW7A 2ID4A 2XTAA 1WZUA 2NVOA 4WK6A 1QKIA 2Q5LA 3DKPA 4NS4A 2OHXA 4QLBA 3JQAA 1UOEA 2IP2A 2IE0A 4RQUA 2HX1A 4RSHA 4L76A 4CKWA 3LK6A 1GSAA 3UW1A 1V6SA 4HH3C 4GX1A 2CD7A 4AN1A 1L4KA 2VQEB 2V3VA 2WFZA 3MCAA 3PWKA 2EZTA 5HF6A 3WVNA 4ERNA 4RTLA 2XB4A 1EX7A 4LDPA 1ACJA 1W94A 2FJPA 2HBZA 3IPLA 2BM9A 1GGVA 3OCVA 4KVFA 3JQAB 4MGIR 4O63O 5DSXA 4BFSA 4J4HA 1ADFA 1LA2A 3CRZA 3QLJA 5E1DA 1LSSA 1JFSA 1EK6A 3O8CA 1SPBS 5LXTF 2B4YA 2JGDA 1GL6A 2P3QA 3E70C 4WXPA 5HBRA 4CL8A 1D7OA 2JCBA 5AW0A 3EH2A 3BRWD 2CLLB 4EPWA 1ACLA 3VR4H 2TECE 5CX1A 1F06A 4MEBA 1QHGA 4RYLA 1NE7A 5K8TA 4DNQA 2DC1A 2JGDB 1Y98A 3OZ7A 2O7NA 4Z7NB 3NCTA 3F5FA 3DYBA 5DE3A 4UPDA 1QQ7A 2N9UA 3CZ9A 3EBLA 1FQOA 2EXXA 4NV1A 2PL5A 2AG8A 4ALNA 3KXLA 3ZWPA 5CX1B 3W2TA 2Y9MB 3HDVA 1ND6A 1YA8A 4MGEA 1IVSA 4XQCA 5CTJA 3SHQA 4BJ1A 2AKYA 4JI7B 1VSTA 2P2GA 2FK8A 2I4IA 1LS6A 2QTWB 2X0NA 2C9DA 1YS6A 2XWBF 4G56A 3D8TA 4QUBA 4UNQA 4W8GA 1IXKA 4GR4A 1VLMA 4H7EA 1A95A 3SX4A 2OTCA 1F51E 4RMIA 4CKEA 4KQXA 2OL4A 2Q8QA 3OZVA 1ZG3A 1CDEA 2CZQA 3EE6A 4X20A 5CUQA 3M1IA 1W0JA 2FR8A 2ZIGA 1E3SA 3Q3EA 4Q15A 3U4QA 3TQQA 4EFDA 1KSJA 5F2KA 3PC7A 4ED9A 4IVPA 3CF0A 5C0OE 5T3YA 3ZQUA 3D5TA 4CKEB 1E5VA 4X20B 2FWJA 3B2QA 5CW1A 3U4QB 4EMTA 5C53B 1FQJA 4UMDA 3QEBZ 1U1GA 2R8OA 2WWWA 2XIQA 1B1CA 3HDJA 2Y8EA 4MUAA 3UH1A 5LQCA 3JD2A 1V1MA 4WQMA 4WL0A 2QW0X 1WHTA 4J16C 4Q66C 5EJ6A 1MP0A 4XARA 4HYYA 3T06B 1M2JA 3IESA 2WUWE 2XGSA 1Q1ZA 2V6MA 2XVYA 2WFLA 1UOOA 2AKAB 3QKIA 4BB5A 3KJIA 2GFHA 1HOXA 5LWQA 2UXCB 1XCGB 2O3UA 5CT5A 2WR8A 4D42A 1A04A 1L4NA 1H94A 3GPDG 3OLYA 4HDKB 4KXFB 1WHTB 4OHOA 1Y7LA 2KB0A 3G2JA 4NENA 2ORIA 7GPBA 1Q7TA 2AOXA 1KOFA 3UJ7A 1MFPA 2K4MA 2WU3A 5JMPA 3REGA 4DZTA 1L5WA 5LN1A 3G2OA 3PPIA 3L49A 2WFLB 3U4HA 4CTJA 1PWXA 3VHQA 3UJBA 3NAQA 1WQ3A 4UBOA 2BMAA 2IEBA 4HRVA 2YBEA 5DLDA 3I61A 1XN1A 2G6TA 1IBLB 4V02A 4Y2XA 2H5EA 3L7MA 1CF2O 4K0RA 4NENB 4R9VA 3RUEA 2C78A 1Y3CE 4HG2A 2C1ZA 4RJIA 1CUYA 1P1JA 3KEMA 3KQMA 4EI7A 5LOVF 4EGCB 2EARA 2JGNA 3KJFA 5AI6A 3KSUA 2ZIVB 5B1EA 1NVUQ 1Z68A 1CR1A 1BXGA 1E5DA 1STOA 4I9GA 1K6JA 1P3JA 2FH5B 3TOXA 4FCTA 1OHHD 4Y6GB 4H0FA 3EIXA 5A4FS 2QMZA 1NWHA 2XMPA 3BL6A 1ZXBA 3KLPX 3S2ZA 3FKSD 1DINA 4AJ9A 1R4ZA 2Q1YA 1MQSA 3CEMA 1HLGA 1ZCZA 4MWEA 4FWBA 4PX3A 1DKNA 5BPFA 3G0HA 5AOCA 5ALNA 3IAEA 4GUAA 5FBWB 1IXRC 4ALJA 3KG2A 2OCLA 2FWIA 2GQ0A 1E8MA 3GHHA 5AK0A 4YFYA 2H4JA 2VPIA 4GZ5A 4OLFA 1OFVA 3FWZA 4PNZA 2OHGA 4CMIA 4B6QA 4JHXA 5E8JA 2HHCA 4BX2A 4UMEA 1ISGA 1QG2A 1Q57A 3VR0A 1XRMA 1QO0D 1UBKS 1C7RA 1O5OA 3BK1A 3HCFA 3LC0A 3NIBA 3NTVA 1WEKA 4GL4A 2ZPUA 4I4NA 5D6NA 3LX5A 2YJGA 3RC3A 4HSEA 3TEFA 3IDFA 3OAAD 4CMIB 1O9HA 3FGZA 1FJXA 4CL0A 1A8UA 4FFVA 2X7HA 2YXEA 2YINC 1Y8AA 4FN5A 1AKVA 1GU7A 2XT6A 3V48A 1RM4A 2JGLA 3ZBPA 3GNQA 3RYCA 1CDZA 3B36A 4I1RA 3TVDA 2G7ZA 3PFBA 4OQEA 1CUJA 1KO8A 2XMGA 5F77A 5ED4A 2ZRFA 5IT0A 1XTZA 3FFTA 1YS7A 4DSNA 4KPYA 2YZNA 5BMVF 3LUDA 3O2SB 1YU6A 3RYCB 2CNOA 2VYCA 5HKAA 5A5VA 1Z5ZA 3NWEA 2ZYWX 3OX3A 2GDJA 4JK3A 3UK2A 2O4UX 1A4IA 2P1DA 5EUMA 4B76A 1EVEA 3PI6A 1BVYF 3PC6A 3T35A 4NESA 2ONCA 4JLBA 2Q5JA 4S24A 2C04A 4D9GA 3WAKA 4XX0A 4MUEA 2P2NA 3CUYA 4L5YA 2B2CA 4IJ6A 4TWIA 2ZATA 2BHNA 3V8MA 4Q4CA 2C98A 3EOAI 2CJWA 2HMWA 2A58A 4L4YA 5GGXA 5K0ZA 1DKUA 2J9FB 2QY6A 1SEPA 2J0EA 3P52A 2IC5A 2BW0A 3HCAA 1T3SA 4XB6B 4E33A 3UMYA 1AE1A 1IN5A 2XNDD 1OBHA 1CYEA 4QXOA 2WOJA 3TLBA 4IJQA 4W6QA 4XX0B 4YXWD 3S81A 1RHKA 2A9KA 1YKSA 1J22A 2X1MA 1VKOA 2CJWB 3O2JA 4XCXA 2ZVPX 3PTLA 5REQA 4BWYA 4W5WA 2IXFA 1IEWA 5EESA 4LHZA 4E6PA 5JZSA 4HR7A 1M0TA 2ZJ5A 3A1EA 3DZHA 4QELA 4Z9XA 2JKVA 3LCCA 1I7NA 3OEYA 1K88A 3ZIAD 1V48A 1QIEA 2AW3A 1X94A 1ORDA 2J48A 3CRMA 3Q3CA 3PRJA 4TTQA 4BAGA 5ADWA 5REQB 3E22B 4OKSA 3EMKA 4MRRA 4CIVA 3V8VA 2JGEA 3U3KA 2EKPA 1M1YA 2R8YA 4KE8A 4MX8A 3E3LA 4U7GA 5DHRA 2B35A 5KQGA 5KREA 5IUNC 2Q3BA 2BDTA 3RKRA 1RYYA 3IAS6 3H1TA 2ECOA 5JD3A 4GOJA 2FLWA 4KIFA 4QXRA 3RYFA 4OX9B 2Q1TA 5HTKA 3IP1A 3LL4A 2QRLA 5JH7F 1F8YA 2HBQA 1TJPB 2CDCA 3EOBI 5AHOA 1M1YB 3DMTA 3EF1A 2QQFA 4MUMA 4NDNE 2HBYA 5CJ2A 3RYFB 1B8VA 1UM8A 1T2FA 3FOBA 4Q3BA 4ACBA 5A04A 2ETVA 1U8CB 4GVXA 4X3OA 3ZG6A 2I4TA 2H2AA 1Z6GA 1PFGA 1UMDA 5FWNA 3JWHA 2IYPA 1DQSA 1WB4A 3OWXA 3E8SA 1VJCA 3D5EA 4YV2A 4ODIA 4EHHA 1R64A 3SAJA 1SUDA 1G18A 3AUTA 4M54A 1YKFA 4EFNA 4GG1A 2YY7A 3IXMA 4MLDA 4BC1A 1UMDB 3UBMA 5T6BA 4JYAB 1AF7A 3EXHA 3GJYA 2QPLA 3KJQA 1VJDA 1ZCAA 3H1GA 2JH8A 4Y30A 4C9BA 2MT9A 1NJ5A 2ZOSA 3OQPA 4ER7A 2C4KA 4D9MA 3I45A 5FI5A 2HU2A 3NKFA 3VX3A 3ZKAA 4B2YA 1YAHA 2XY4A 1SELA 3BDAA 3QY0A 4O8ZA 4NFLA 4OJTA 4AQDA 4G0WA 3EZ7A 3BD6A 4POAA 2NSDA 4RVDA 3EXHB 2JKZA 3ESCA 5H9VA 2PVCA 3HJUA 3QVLA 1CEXA 1A8IA 1COZA 4ESEA 3AYZB 5J5VA 1OAKA 4FN4A 2P9YA 3OJ0A 4QJ5A 1N2CA 1B93A 2NN3C 3PUXA 2VF2A 4DR5B 1Z0IA 4P7KA 2AJTA 3GBPA 1MLDA 4RSRA 4LCBA 2QVYX 4NU0A 1H4VB 3EY4A 1YZYA 4XIJA 3KU1A 1M6YA 4IYRA 2F4NA 5C5IA 1N2CB 2DCMA 3MBOA 1JT2A 3WRYC 5ALZA 1YI0A 3DZBA 1BX3A 4HWSA 4XLZA 3WQHA 1YS4A 2C59A 4IF6A 3H9CA 1Z0ZA 3KC2A 2CL5A 4KXWA 2IY8A 4PYRA 2O3QA 4BGUA 2FUNB 3CCFA 1BDMA 4KK4A 5CU7A 1J97A 4NFHA 4RVHA 3WLOA 3QTTA 4E2YA 4ZZ3A 1UC8A 2WSSA 3BDVA 5C37A 3U7QA 1PWHA 2YMPA 2VZ0A 3TQFA 4A8HA 4F93B 3ABIA 4FDLA 1VM6A 2WVGA 1I2AA 1IHUA 4NNJA 5GP1A 3V1KA 4MUIA 4I1VA 5BY2A 2XMQA 3H8WA 2XUIA 1P74A 3K9QO 1NBMA 1J7KA 2VQDA 1KRXA 4XW2A 3QU2A 3OPYI 4FYPA 5AI8A 3U7QB 4AK9A 821PA 2ZYUX 3I6ZA 4G84A 3WJAA 1W4AA 4PZZA 1KAOA 4PG8A 3UWMA 4V3BA 5CM2Z 1QIIA 5T67A 3CLTD 3ERCA 3GQBA 1DZ3A 1UWCA 4BO1A 3W5VA 1O58A 1T2UA 4GLBA 5EEGA 1SCNE 4HRXA 4M89A 4OP3A 3HCBA 4HQ6A 3COSA 5B12A 1ZMBA 3EQ9A 1H8EA 4NNPA 3QFSA 4Q34A 1JZSA 1K97A 3G2MA 3GQBB 4K9DA 4C6RA 3CH6A 4LJ8A 5EY5B 5K3FA 2IPNA 4XFDA 4KSCA 5EINA 1U63A 4KYIB 4LBZA 1TK3A 2QEQA 3IIKA 3GU3A 2VQSA 2X9LA 2I54A 2H54A 1L4MA 3CH4B 2NP6A 1I3KA 3F98A 4LHYA 4HD8A 5JCXA 3LLVA 3HVKA 4XQEA 1BE8A 5K3FB 1GV1A 3HDHA 5DDIP 2QL5A 3GLKA 1XZDA 4GOMD 3RYHA 2X2OA 3BEOA 3W2EA 2W7TA 3E9CA 3BE4A 2VCEA 4B0OA 2LDBA 5IVPA 3TYXA 2WIBA 2A78A 4LJ7A 4L4SA 1C81A 1WETA 2NP7A 1CERA 4PHFA 1IVNA 5JJIA 1MA0A 4KR0A 1NU6A 3ZJVA 1P7CA 3NJ8A 3RYHB 4B2IA 1FA9A 1WCV1 3S99A 3KBOA 2R65A 4K03A 2H7VA 2PLRA 2QN7A 5ICCA 3FHOA 3G8CA 5AO9A 4YYZA 2CNDA 3C5WP 3N86A 4QFBA 5G0VA 2XR1A 4D79A 2XCIA 3HRHA 1H2AS 3LPAA 3WRXC 4OTZA 5IDYA 4YDHB 5CVUA 3R7DA 4D45A 3RROA 1ABFA 3RUAA 5EIXA 3A2MA 1NLFA 1VJ0A 1IQ0A 2F4VB 1X0VA 1D6JA 1HT0A 2QTLA 4LY0A 3SLKA 4KQWA 3D6JA 3NATA 2PZJA 4MP6A 3PDWA 4YBRA 2OGSA 5C4GB 4YAKA 2BL4A 5JSQA 1RQLA 5M3BA 2MIIA 1BKSB 3AVQA 4YPFA 1YCGA 1SUFA 2VOEA 4JLOA 1QIHA 1QFZA 2EZUA 4G0OA 5B58C 2E4UA 5ALLA 1LDBA 3RB8A 3KSZO 1N2GA 4MPDA 5CCEA 4OGFA 4IXDA 3QU9A 5TY0A 4EP1A 3HU1A 4JLKA 2WUGA 1P0MA 5KTTA 5DTJA 2Z2IA 4UTOA 1I4WA 2O2IA 1KDZA 4EY7A 2OQVA 1EVIA 1PK9A 2HA7A 4J7CA 4BB6A 1R0CA 1DO2A 3K0SA 1SIBE 4CF4A 4LI3X 4IAOA 3MF4A 4AROA 1H42A 1RJFA 3RVLA 5IFKA 1NVTA 2QAIA 2JARA 2P11A 5F1PA 2A1TS 3UCFA 3BULA 4HDSA 1OWLA 3Q7SA 3CNQS 3G9XA 3WP1B 1HYHA 4DV1B 2ZUWA 5DH9A 2V58A 2BSAA 1IOVA 1Z6AA 4LBVA 4OGWA 1CY1A 1E7YA 3ZHXA 1H0KA 3HU2A 1ZL0A 5FA5A 4HDSB 1NASA 3IE1A 4KWTA 5PGMA 3FXAA 4OXNA 5YASA 4ZGGA 5AYVA 2PUBA 2BZ1A 1DARA 3BCSA 1PFQA 4F9TA 1ISSA 1KSFX 3BOSA 1A2KC 3OFKA 4UUMA 5JVDA 4ZIRA 2NWQA 2MOKA 1V37A 2ZJOA 4M0CA 1GVNB 2DBYA 1LV8A 3B6EA 4MGZR 4CF5A 3UMMA 2Z2JA 2C5FA 1ZVVA 3IAM6 4ZOLA 3BYZA 4EF4A 5GZ6A 2IHZA 2FMHA 2ZJBA 3G0CA 3K1ZA 4PBTA 4ZIRB 4F85A 4AB1A 1QGOA 4O4LA 3FIJA 2G80A 1P5FA 4KDRA 1JKIA 3QFCA 3LLUA 2PZGA 4JJ4A 1FDUA 4WXYB 4S0XA 1HETA 2BF7A 5BV7A 3UJ9A 4DR3B 4FFMA 5EMKA 1YDWA 4YI5A 3DONA 2JLZA 3OZIA 4H2DA 3P20A 4O4LB 4OOFA 3LQKA 3FFBA 3MJ4A 1T9CA 3W3ZB 1T0JB 4NMLA 4ZO6A 4ZDWA 5BYBA 1RLMA 2A0WA 2ZJ3A 3BHNA 2V7GA 3ZCTA 1SVLA 2KYRA 1YS9A 2WINI 4B83A 5AJVB 3LCJA 2ZRBA 1YZLA 5A1JA 2H6EA 2JB9A 2ZRDA 4II7A 3FYCA 3O9ZA 2QP3A 4TM8A 2D74A 3L8HA 3KNZA 4HEHA 1JTVA 1PV2A 2PK3A 4MVJI 1KGSA 1N5KA 2WKPA 3EXFA 3PFKA 4TQGA 3D7KA 4NZ9A 4CNQA 1F6DA 4UZEA 1UXIA 1IUNA 3MUFA 1SOMA 4MK4A 4CE6A 1NUTA 4HMOA 3W04A 2WNIA 1X15A 3PEEA 1E0AA 4IIJF 2C58A 3EBOA 5JSUA 3PWZA 2J0UA 5L3QA 1VSQA 1Y42X 4WASA 2L17A 1BAPA 5EN4A 5FA8A 1ACMA 4KLRA 5B2FA 1N0WA 3VVLA 4UXHA 2LNDA 5HDBB 1XQYA 5DRTA 1GYRA 3WYGA 5EJ9A 5DWDA 1XQ1A 1M5TA 2VAVA 3K8OE 5KPJA 5CLHA 2J0UB 5L3QB 5SY9A 1UK7A 1GL7A 2AX3A 2PQ2A 2RGYA 2ZJ7A 3FM9A 1CZNA 3L0BA 3MPUA 4PPYA 4RNDB 5DBGA 3OLCX 3SC3A 5JBNA 1SJ9A 2Y93A 1YI8A 4LRSB 4WOCA 1N9GA 3H8SA 3ORYA 4L4UA 1BSVA 1X7HA 4F4IA 5LJIA 3OQIA 2VAWA 1EM6A 1T9ZA 2EP8A 1EH5A 4LHWA 4MV1A 2CHVA 2FSHA 5AJUA 1LK0A 3H4MA 4N3NA 4YACA 2OILA 2VXOA 1M8JA 2Z95A 4CKCA 1YHZA 1NRIA 3ZHCA 2Z5LA 4WGFA 5IJZA 1TJNA 3LRXA 1N9GB 3IUNA 2B6HA 3LUAA 3GUHA 3FHLA 4XLLA 3OQIB 4QLAA 1V8OA 1YL7A 2Q1XA 2QAGC 5DBFA 3CLRC 3GD5A 1YQUA 3QVVA 3QUQA 1HQDA 3K5HA 1TTPB 5DYWA 5E7JA 1MX9A 4EUNA 5C32A 2D7DA 5HWSA 2PN1A 1NW5A 3OE1A 1D8AA 2X13A 3KXKA 4E5SA 2RGNA 4RO0A 3DE7X 1U3GA 3D2CA 1X77A 1JFRA 1FP1D 2HPHA 2QMYA 4IICA 1N6OA 4YS6A 1G3RA 3KUCA 1G8PA 1XZJA 3PFGA 4YV1A 3M6LA 4QFDA 4DIBA 2ZAGA 2C54A 3A2NA 4PWYA 1O03A 2Z6VA 2BISA 2ZVJA 5EZSA 1GUZA 1PQUA 2NU9A 2O2YA 2YDYA 3LV8A 3HLKA 4D0SA 4CL2A 3TIXB 1T5OA 1JDVA 3OLVA 4W99A 2W22A 3UB3A 4D4JA 2IHTA 1OWOA 1LW6E 4L5AA 4XSGA 1XD8A 2G8LA 4MB6A 4D9KA 1MCZA 1OE0A 1RKBA 2ZYGA 3DC2A 3U5ZB 3QF4A 1Y81A 3QVKA 3NM6B 2NU9B 4JB0A 3B82A 3LHKA 1ZNXA 1EQ2A 3JZDA 2GAOA 2QMQA 3RVJA 1UPBA 4HGZA 4KJXA 4EENA 3DBVO 2X1HA 5D6OA 5CFQA 1RXWA 1M6WA 3HABA 3ENZA 2OKCA 1XAHA 3QF4B 5JXWA 1U2RA 1WW2A 1B1AA 2D7JA 2ATCA 3FI9A 3P9ZA 4M4SA 3RVKA 4XEUA 2Q99A 2Y1WA 2ZRJA 2DHEA 4JGGA 3ZNQA 3JYOA 3VZSA 4B34A 5EJIA 4DXDA 4V39A 1SIOA 2C8LA 4EG7A 3AP1A 4WNIA 4Z4HA 2J0QA 2QYOA 1R0WA 2AZ4A 1GPLA 1GDDA 3BWCA 4P4NA 3HSKA 3DOUA 3DUFA 3PJEA 3DKIA 2NPOA 5LBIA 4QYSA 1WX1A 1QHYA 4UMVA 3FYSA 3DAOA 1NURA 5G1NA 5DPMA 5K09A 1E61A 4OI0A 3RVOA 3IE2A 2BEVA 1MA3A 2AJBA 3PUVA 1DX9A 4ZEWA 3I5MA 3ESQA 3KLNA 4G9GA 2PG3A 3DUFB 3DO8A 2FFRA 3EVAA 3TL3A 4PV7A 3PD7A 2QZ9A 3OPXA 3OZAA 1QVRA 1UBEA 3EGXA 3HWWA 4LJ9A 3CVWA 5FI0B 1ZEJA 2UYQA 1NM5A 1UMBA 3HRKA 2BEVB 4B2LA 3Q2KA 1NN5A 1YUNA 1XMXA 2CN1A 5LUAA 2JLSA 3VNUA 1OI2A 3O93A 3HP7A 3EGXB 3DOOA 2PKQO 3N8GA 4UTVA 3FKJA 4I66A 1VJ1A 2FOXA 2Q8PA 1UMBB 2UYGA 1USKA 3DSRA 2VHYA 4YEDA 1W5AA 3DCYA 1UWLA 3ICCA 3P4UA 1FLAA 1MJGA 2H92A 2ZI9A 3H5VA 4CMEA 1QFMA 3OM0A 4ZP1A 5JG7A 2ID9A 4LZJA 1J0EA 2WAAA 3KHUA 2A14A 1RR6A 1AKEA 1SOVA 1FYWA 2ZIAA 2RFLA 1T5LA 1IM2A 2AN5A 3C5EA 3DEJA 1MX3A 1UMKA 4M38A 1XJWA 1NFQA 2ZBRA 1OU4A 2AMJA 3C3YA 3ZE2B 5KQSA 2MWMA 3CT4A 3JD1A 3PFNA 3CZPA 4JP1A 4MIYA 3W9SA 1L7PA 2E4AA 4EHNA 5EG5A 3LPNA 2WUDA 2R8EA 1G9XA 3AP3A 3EC7A 3I6IA 1D1TA 4TMKA 4UVIA 3TI7A 2FSSA 2OLKA 3T5BA 3WKBA 1K75A 4EQ6B 2GN6A 3V33A 1O7JA 4R40A 2WNSA 4NOLA 2R8XA 3TSCA 4P4TA 3UK0A 3UV7A 2W00A 4C1BA 4JZYA 2I03A 1CUBA 1CB7A 4MRVA 4RX1A 2GEUA 4UUQA 1SXJD 1IDN1 3PT5A 3O4FA 2XI4A 3V8EA 3T61A 2FEKA 2W9XA 3QW2A 2XQKA 1EVZA 1CK4A 3DXYA 4FHEA 3AIMA 5PNTA 4FYYA 3W6PA 5I7SA 2BZ0A 3HCDA 4N39A 1DAMA 5AI4A 2G6BA 3R5HA 4WZAA 5H9WA 1DAHA 2D1SA 3F46A 2P3LA 4X8MA 2O2CA 2OE2A 2PUJA 4MROA 4QXMA 4HMPA 1C9JA 3U3JA 3WWEA 3V7YA 221PA 1J25A 3GXBA 3LUPA 4KI7A 1PGQA 1CDDA 2BEUB 4RCYA 4HB0A 5I5EA 1NUQA 2PCJA 2QT1A 3OEHA 4LDNA 1EFRD 1NRJB 1RKUA 1TF5A 3RWOA 4WZAB 4QDOA 3ZGYA 4E51A 2ISCA 2HMVA 4HEA1 4CGYA 1YR6A 3INRA 1CQXA 4PX2A 4C88A 4LRXA 3TK1A 1YBVA 3OLZA 2HO5A 4DVGA 2IIQA 1LNSA 1JJ7A 3DO5A 4KXLA 4R9SA 3W8FA 2V1XA 1NN0A 2V7WA 7MDHA 4P84A 4IX9A 4DILA 4ND6A 5BQFA 2GHIA 3M9XA 1W34A 1FTSA 2FXIA 4HGPA 5CITA 5DASA 2NSYA 3KLOA 1X8XA 3EIHA 1R4MA 4LF9B 2PO7A 1YZQA 4C4AA 5AHXA 3PXGA 1ZH2A 2GN8A 3N76A 1BEEA 3PLNA 1XRPA 1GSOA 4PPQA 4EJSA 2MINA 2GPTA 3AI1A 3GT4A 5B2EA 1Z2OX 3ER6A 2EBFX 1ZUNA 5CVTA 4HOYA 4XJXA 1RZUA 3S5UA 3V4SA 1R4MB 2FEPA 3EDCA 3ITEA 1YQEA 2FRDA 1DIOB 4C0WA 4C07A 4EJSB 3D1VA 1AQJA 2AB0A 1O8CA 3NAZA 2IEZA 2G25A 4IBOA 2MINB 1HZZA 2GLTA 4WVLA 3PXBA 3TCXB 1P0IA 3ZW8A 1W2HA 2C2KA 4CIAA 3U4IA 1QF9A 4L8LA 3SI7A 4BU1A 2N47A 2J1LA 1KGDA 2XLBA 4JJEA 2E4VA 3PCTA 3RR2A 3K30A 1QC5A 1HL7A 2O7RA 2QG6A 1PSWA 1SHJA 2OVBA 1SHUX 5E4TA 1E94E 3UPUA 4KDCA 4DQVA 2F8LA 2CVHA 2YCBA 4BN0A 3JQ6A 1SFRA 4BMXA 3GMDA 3GRCA 4Z4CA 3DHYA 2O59A 3EZ2A 1AKQA 2RI6A 3QWBA 2AJCA 2GNAA 3HC7A 1RJDA 4BMOB 5AM4A 3TLAA 1WTAA 3U3XA 1XJ5A 2JDIA 3SQDA 3CR8A 1E1QA 2DKNA 5JCJA 4UULA 1A9TA 3H9BA 3UJDA 1AA6A 2R86A 4M1SA 2QD4A 4GI5A 4U7DA 1VLLA 1XVLA 2DY0A 3G9QA 3P97A 5DLPA 1FDTA 1ODIA 7ABPA 2G17A 3ZZMA 3WNDA 2QN3A 5JAHA 1F7VA 1JVNA 3MWEA 1PEYA 3RHZA 3L4EA 4DLXA 3SBEA 1CF9A 4B8YA 2RIRA 4L27A 4TLMB 4XVUA 1ZKMA 2YC4C 3Q7RA 4YAOA 2VOJA 4JT9A 5EZQA 4DCVA 3OIUA 2QRVA 3DHVA 4EG4A 2OO5A 1I0LA 3T7EA 1EHCA 5T4BA 2E3JA 4I1PA 3QX8A 1G8FA 3MWEB 4IEFB 3COZA 4MS4A 2P0YA 2RHMA 3TLGA 4B7XA 3K6SA 2R5FA 1RXSA 2ZKIA 1CUUA 3EGWA 4FEGA 1FFDA 3ZJTA 5AWFC 1UKBA 1X1AA 4M1QA 3OM9A 5DHFA 2QRVB 4JUDX 4R9NA 4RUKA 1L8OA 2OAQ1 4X93A 3CSSA 3DR3A 3GT7A 3MJHA 3E9EA 3MZ0A 5F3DA 4BQRA 4ZCRA 4V24A 1V9SA 2P69A 3L4KA 4MS4B 1ZISA 2V7QD 3EW9A 5A4JA 1JWBB 2IDKA 2JD1A 1Z5WA 4B71A 3FYUA 2O3TA 4L85A 5DVZA 1N7IA 1YQQA 4TV8B 3RRNA 3A6JA 3ZU6A 3UOWA 3QVOA 1DDIA 4GYYA 5CB0A 3OHPA 3WYBA 3HXQA 1UBMS 3KZKA 1M6HA 2XMCA 3T9CA 1J1ZA 3OD1A 5TPZA 2P6PA 4KK3A 3VDRA 3FYUB 4B8ZA 3HMKA 1MJHA 1ETUA 5IC5A 1V3TA 2F43A 3FTCA 1XP8A 4YAGA 4OXKA 3IP9A 2VDLB 4FBLA 2GILA 4Y2HA 3F3SA 4BLWA 1AZWA 1HDIA 4BAZA 4DCSA 5TV2A 2J6CA 4CTNA 3KQHA 1ZNYA 2ZE5A 1G7TA 1G8GA 3D7MA 3DWIA 4FMPA 4HCJA 2F43B 2W0MA 5LQKA 1D2CA 1RZRD 4MDFA 3Q8LA 3KSMA 4PTZA 2FFBA 5B6IA 2I3AA 3U13A 3D0OA 3D8HA 3R0ZA 2C7BA 2VDUE 2VDQB 1ODJA 4HSGA 1NQ5A 5JMTA 3AQIA 1WPQA 1QRRA 2BVNA 5ENZA 4FFLA 2DKOA 1I6KA 4JR1A 4ZK6A 2CWDA 5IM4F 3AEXA 2QGZA 5DCWA 1A27A 1E2KA 2AXEA 2II6A 2O2JA 5DHAA 1E1RA 2FSIA 3TLCA 1RI2A 3AFNA 1M5RA 3DQZA 4FOSA 2R6FA 4UMFA 3ZLUA 1NF8A 4II3A 5JXGA 3NHWA 3Q0EA 1JFLA 3D4PA 4L02A 3BGWA 4RYDA 4YK7A 5C3UA 1GRRA 4S04A 2PT7A 1MJNA 2XJ9A 3KRTA 1H8HD 1SQ0A 3GAZA 4WUTA 5H0IA 1P39A 3IP3A 2UVPA 2JFBA 2W2MA 4CIBA 4H4DA 5CW2A 4DKJA 2IYEA 1X7ZA 4WXRA 3BRCA 4B9AA 1PFKA 1TFRA 2PGOA 4BRWA 1W36C 1GA4A 2CB0A 3DKVA 4QOIA 3E61A 2JG3A 3F9CA 3PXAA 2UVPB 1H2ZA 1F2VA 3UEOA 3LTNC 4A1OA 1JG6A 3IQGX 1X7ZB 3K0CA 3FPLA 3X1KA 3CSDA 4URVR 3V1TC 3ZY5A 3JY6A 3EHEA 5KDLA 1KI9A 2AR9A 1NJFA 2B8NA 1UP6A 2YXNA 5E9JA 5AI5A 2Z1NA 2ON6A 2BEKA 4NL4H 5H81A 3RQSA 3VFDA 3IQIX 1SCQA 2Y68A 4CU2A 2R2GA 1CRZA 4B79A 5BN3A 1QF6A 3K70D 1N78A 1WMDA 1GXSA 2V6FA 5CDGA 1ZJWA 3AEKA 3HXOA 4DLUA 3OZXA 3OJEA 1IBKB 3I6YA 3VNVA 5F23A 1SQ5A 1KO7A 5KNDA 5DLQC 2V8BA 4BQQA 5BN3B 4OI2A 4W1PA 1KQNA 1DC6A 3IEKA 4YO8A 2GPNA 4KEAA 1BE6A 1M1XB 1GXSB 1XMOB 2JA2A 3D6NB 2FSVC 3HZRA 3AEKB 3P9CA 3V1LA 2GM4A 3COVA 5EXXA 1XZFA 3NUGA 1JJBA 1FUUA 2H1CA 5KNLA 1ZGJA 3EUFA 4MMYB 4UD6A 2BM8A 1EFTA 2QM8A 3QXGA 3ENKA 3FI0A 4IQ4A 1DPFA 2XMRA 2DBQA 2P6OA 3WLKX 4YJHA 5J1TB 5KTYA 3KQKA 3O0TA 5T64A 3GZNA 4E22A 5K8CA 5KTSA 4IWNA 2ZAYA 1NW7A 4N9QA 4BRSA 2COKA 1YC2A 2QMUA 1Z28A 4MLZA 2YNMA 4IDGA 3TJZA 2B4RO 5K2MA 1YB5A 3DT6A 3FB4A 4NYIQ 5AM0A 4GR5A 3ET5A 3LHFA 4YJHB 4BLVA 3GFBA 4FMBB 5KJFA 4FDAA 4YT5A 3GZNB 1H3FA 1XZHA 5AHWA 3RRZA 4ZI7F 3DP7A 3DR5A 1ZWLA 2R00A 2WWTA 1WKCA 2IPLA 1UBLS 3FN4A 4GH5A 1RAIA 4IKOA 3E81A 4NE7A 4PAQA 4UNNA 3URMA 1JW9B 2OQRA 4OYLA 4ZMSA 5C1BA 4QO8A 1I9CA 2DF8A 4E5DA 3QPCA 4F45A 2EJUA 2ZJ8A 1GTG1 2AI3A 1X7GA 3BXOA 5ALPA 3FW1A 1WKBA 3NH6A 1NVVR 4FZ3A 1DHRA 1LBTA 1XZAA 2VJBA 3E18A 3RO7A 3NHYA 4H3SA 3RODA 3I2GA 2VT6A 5CLIA 1RRCA 1JHYA 1D1SA 1CW2B 2JF0A 2HU8A 4QTYA 2PRYA 1YRYE 1CUFA 5IULC 4CR8A 2QBYA 3M33A 1SZCA 5I8ZA 5JNRA 2HRDA 3QK7A 2E82A 4NV0A 5FUQA 2ZJ0A 2WUVA 4CG3A 4N12A 4KV9A 3WZ2A 1W96A 3GI1A 1O4WA 3EPHA 5A06A 1FVOA 2XRFA 4XVRA 4U8GA 5FFMA 3P2OA 4AG6A 3DMRA 1EB8A 4JYBA 4AI6A 4Y0AA 2QBYB 4GPBA 3ZNPA 3KLMX 5JARA 3CU5A 4R8LA 1PZHA 2GWHA 3KXIA 3SNHA 3WGNA 1J90A 2IYQA 2PXAA 3BMXA 1C4WA 3E0XA 1H2RS 4FI3F 4JJFA 3CC8A 4PYKA 1RM5A 3P19A 1Y5NA 3GJ0A 4KP7A 1CR6A 1ESEA 5CNJA 1YZTA 3VSDA 4CCSA 2YZ2A 2F9MA 1WUJS 2DPXA 3CIOA 3JWIA 1KK0A 4BQIA 2QN8A 4K28A 3FNIA 5CLQA 8GPBA 2AW5A 5K7SA 2A0XA 3IIJA 3N70A 2HQSA 4P4LA 4YV7A 1JHMA 3QW4B 4L8VA 1JB9A 3O21A 1UKVY 2BRUC 4M0PA 4B3CA 3FPJA 1ZIPA 3ZPXA 5IKPA 1QG0A 3IULA 3ECCA 3ZY2A 5M7EA 5DMHA 1Z4MA 5DOZA 2C95A 2EDAA 1Z6ZA 2B1GA 4E88A 1VPLA 5LIPA 1D2HA 1GDTA 3UOAB 4KIGA 2QUJA 3WL3A 4JOBA 3VOTA 3T3IA 3QMVA 1PJ4A 5HM6A 4F4FA 3CLHA 3CVJA 5JXHA 5HNKA 3KJHA 2XEXA 1EP1B 1G8JA 2W93A 3RS5A 5JDIA 1PL8A 1PUIA 2XMDA 3F3KA 5FCDA 5FF9A 4RADA 2WWRA 2YJZA 4JJZA 1JKFA 3MJRA 1JLLA 4NBVA 3EAGA 5JEEA 1H4QA 3ZE8A 3WMXA 1FDSA 3HFRA 1VXOA 4AMVA 3Q7QA 4NXMB 5E3HA 4FIZA 5AOBA 4DLBA 2QJTA 4QOFA 5JSZA 1MVLA 2F67A 1W85A 1MDBA 3UTDA 1JLLB 4OB8A 4IH4A 3C1UA 4UUBA 1V5FA 1CY8A 1JHRA 1LC0A 1YK0A 2ASEA 2Z6QA 5GM2A 2OHIA 2XCUA 2ZPTX 5JSZB 1W85B 3EY9A 1YXMA 4Y6LA 4OHPA 1WAMA 5A7HA 4QU8A 1BJTA 5HYVA 1RC1A 1Z5NA 5DP1A 1NI4A 2CYAA 2YVLA 3D3WA 3MS2A 4UNPA 1JU4A 4G97A 1U28A 2PXCA 3CPSA 1U3UA 3ZU2A 5TDHA 3ZYZA 1U1EA 4YWHA 1GADO 1M1NA 3OCJA 4BN5A 1FNSA 1EK1A 1GPWB 1O6BA 3SSMA 1XNQB 1R37A 4FR2A 4G3XA 5CEFA 3MC1A 4HUTA 1L7NA 1E1YA 2QOEA 4JITA 1NI4B 1FS4A 3D3WB 4FHFA 4QGFA 5JJBA 3UGJA 1BQ3A 1M1NB 3LD9A 1Z0AA 4PTYA 5CGZA 5EVCA 2IT1A 2VP5A 4FGWA 3GPIA 3TWOA 4CF3A 2X2FA 3IDZA 5HM8A 2WM3A 3EYWA 3ND5A 3TXYA 5HUJA 1EVLA 1MV8A 1ZD4A 1UZUA 2HEGA 2X19A 2HB6A 3H2BA 3TDNA 4KXVA 4F3YA 3AM1A 4R31A 3VR6D 3IQDB 4JLUA 2DTEA 3EWIA 1A1SA 3C5CA 4BFVA 5CBKA 5IHPA 3VOAA 3E58A 3PC4A 5I8WA 4AJ4A 2MSEB 1Y63A 4JP3A 421PA 4JROA 2HSJA 5ELMA 3WK5A 4ND2A 4FYJA 5CH8A 3R9IA 3CISA 3DT8A 3VO8A 1S7CA 3ZHVA 3WIEA 5C46F 1E9VA 5K8IA 3JAMA 3EA4A 3O83A 3PP8A 1XYVA 3ZXXA 1ICIA 3NO4A 2IH4A 3N6VA 2BGGA 3A2LA 1ODLA 3CG4A 3MFYA 4L74A 3MMPA 3U61B 4TS9A 4Y7DA 4N1AA 1NUSA 3NT4A 3RLIA 1HBJA 1HM5A 1SBNE 1G0NA 1U6IA 2HZBA 2PYDA 3ANNA 4WWHA 3ZGVA 1FW6A 1UKZA 4EB0A 3GYGA 2O57A 2QP4A 2IEGA 4HDAA 1IUKA 4UM7A 3BGOS 3LOPA 1SCUB 2IU6A 5LYJB 4BX9A 4M8NE 1CQPA 3WL4A 1A5TA 4DPLA 3COPA 3OX4A 3JYLA 2W4MA 3S2FA 2R8RA 4RC9A 5BV8A 5CA0A 2MYNA 2Q4OA 2VR1A 3QPUA 3VAAA 1YZHA 5FL3A 1J1IA 4RLQA 4BMSA 1MFZA 3LM8A 1G8KA 3TSWA 5D5PA 2QTHA 1VE6A 2FQWA 2XKAA 1H2WA 2R6CA 2ZI5A 1E9BA 4K9MA 1ZR2A 2B83A 1PJ2A 1Z4OA 2V9ZA 3NP7A 3P2EA 1OXKB 4M1WA 2ZRMA 5EXEA 4YQYA 2OZVA 4K8RB 5CA0B 1A71A 1EM8A 3ACDA 4JBWA 1AQUA 3K6JA 3R09A 4LNUA 3CLUD 4R54A 3CHYA 1JQAA 2FMIA 3E7WA 4UEJA 4MVJM 3DHWC 5H3CA 1JHPA 4JR0A 3P4XA 4QUAA 1QS0A 3OKPA 1L8LA 1FF9A 2H8GA 5IBCA 4Z4IA 1HKHA 1EM8B 3AR7A 4LNUB 4M9SA 4Y2TA 5EKDA 1ISHA 2Q7XA 4ETWA 4X61A 3OO0A 4WKOA 4FZVA 2FVXA 2Q2WA 1NFFA 3MRXA 4P0TA 3NHJA 1QS0B 3VC3A 3B9QA 2B8TA 3NDPA 5GV8A 4MW7A 1ZUWA 5BT9A 2W6ZA 3P2KA 3O75A 4DPKA 5C1DA 2H4WA 3F6PA 5KYGA 4A5OA 2VXBA 4UW9A 5IEJA 4CUKA 2VDVE 1K3UB 4ZI2A 1DAPA 1VA5A 1N2EA 1A9RA 4H1UA 4B7ZA 1RQPA 3BSWA 1GFWA 4B6FA 4CM4B 4IV8A 1JHZA 3G7NA 4EGQA 1MQ8B 4YMTA 3RUPA 5IZ4A 5KO2A 1GQYA 5FJIA 3FZEA 2NSJA 2P5TB 1CVLA 3QG5A 4DR4B 3PGA1 2VEOA 4GWGA 4ZAZA 3QH4A 4ETMA 1P77A 1NLMA 4A5SA 2AX4A 1BH6A 5ICFA 2V8OA 3AWIA 4NMHA 1Z06A 3L4BC 4BZQA 3SIWA 1G55A 3ETDA 3U7JA 4NPAA 5GQSA 2ONYA 3Q3VA 2NAPA 3WGKA 1ADYA 4HNRA 4AJHA 4MZDA 4BYMA 1XPUA 1KMHA 4MUHA 1L8XA 4GRIA 4Y6SA 3T5PA 4DQXA 3T15A 2HRZA 4EJMA 1P45A 2HDWA 2NXWA 4JLVA 4TXMA 5IAOA 1DBPA 4G4IA 4AG3A 2JLUA 5G41A 5M04A 2REXB 2F2TA 1PKXA 1KMHB 2C2WA 4XWYA 4JH0A 4Z86A 5HCUA 2DTDA 3TINA 3V1NA 4BGVA 3A04A 1TLTA 1Z45A 2X9QA 2ZYRA 2SHKA 3L46A 4CM1A 2PWZA 1BD4A 3FOEC 3OO1A 1HK7A 2BJVA 2BGUA 5TJ9A 4FP9A 5K5EA 2YZMA 4IQ0A 1W1UA 5ECYA 4GS5A 3PGLA 1G0OA 4LS3A 1PV1A 4D8XA 2X5JO 4X63A 3EFOA 4BXOA 5C7IO 2RE8A 1OASA 1FUEA 1K7FB 2BI8A 2C77A 1II8A 2CXOA 4TSFD 5CG1A 5I7VA 1I7DA 5IXSA 3EGVA 3GAMA 4D74A 1JLRA 4XAQA 2O6HA 1ZGBA 1HV8A 4BKOA 5JRZA 1KY2A 3NYQA 4W5OA 2GEKA 4W63A 3ND9A 4YP0A 3EFOB 3ZWNA 3BL8A 4BXOB 4LJLA 2DLNA 2L69A 3BWXA 3U7FB 2V0GA 4OSOA 1II8B 3VISA 2A9PA 3CB4A 4J0JA 2YWDA 4PC2A 2ZZMA 3NGLA 5T6MA 4DFDA 1VHJA 3O4JA 2ZZNA 3HBFA 3MMSA 4JBIA 4F5ZA 2YOHA 4QOHA 1KYZA 5CNMA 1OAOC 1H6CA 4YAFA 4F0JA 7ADHA 4PQGA 2OCKA 3UG7A 1Y8CA 2OO7A 5HP4A 3SJCA 1KAQA 2A9QA 3TIGA 3EVNA 4GI3A 5CAEA 4XIIA 3S2SA 3SEZA 1MB9A 4EI2A 3BAZA 1T9HA 4ATNA 3Q3GE 4QTTB 3PUJA 2X8LA 1EDBA 3IVCA 1VBNA 1F8XA 3BHMA 4GOXA 4NATA 5B3LA 5K45A 1QFJA 3FWYA 4Q9LA 4GR9A 3ZK9A 1FVFA 4LDAA 1O0CA 3WE7A 4MDEA 2O2EA 5E1MA 5CAEB 4YUAA 5BSWA 2B5VA 1WULS 5JUWA 1HEUA 3K9BA 5DYGA 3E6AA 1SUSA 1U0SY 3GA7A 3PL5A 4ARAA 1AHPA 1U8UA 1WQ4A 2VSNA 5DCLA 4OH7A 2X9NA 1U6KA 1JFVA 3MAAC 3C74A 2AGVA 3IBGA 5EHXA 4M9QA 1PEKE 2IXDA 1CR0A 3E5HA 3UZUA 1LVGA 4C87A 2OGUA 1MU0A 1NL3A 3QENA 1YK1A 4GGOA 1VE1A 4N6GA 4IRXA 3ZJYA 1U9IC 2ZJAA 4PRZA 5H70A 3B9BA 4O02B 1Q1BA 4QDKA 4ZHQA 1LNQA 2J3LA 3AF1A 5ULLA 4G5FA 3M4XA 1CVIA 1S6YA 2PKRA 3NWPA 3ENNA 5F51A 2DHRA 4S1TA 2Z8ZA 3K1JA 1JNXX 4LOHA 3CRNA 2I3DA 3CRRA 3PKJA 4B6GA 2WMYA 4ASUD 1L5FA 2XGMA 4US1R 2YN4A 3G9ZA 3VA7A 1XNGA 4F2PA 1KDTA 3FSGD 3KUXA 2PGAA 3MTDA 1WPGA 4ZHQB 4Q7KA 4CXMA 4ZO9A 4IWXA 3IIMA 3Q88A 4DCPA 3FHCB 1GT6A 1BQEA 3LY5A 3PHGA 2FEWB 3OZTA 3AKZA 2Q6TA 3AESA 2BONA 4Q6WA 4ML3A 3A9UA 3CZAA 1P5JA 1WBDA 4F4CA 1BOFA 1VLQA 1IHPA 1Q0RA 2BR5A 4Z5XA 1L4FA 5KVQA 1H69A 2CL6X 2OYSA 1ZH4A 4WACA 1EQUA 3TIVA 4B6RA 4XRRA 4N8SA 4E15A 1WBBA 3PQ6A 1ZK3A 4F56A 4G8CA 3EXEA 2P67A 3AESB 3O90A 2DUUA 1AQIA 4E1AA 4EB6A 3R0VA 4BLSA 2X8JA 5BN5B 1ZM3A 3O73A 1ORHA 2H1OA 4F72A 1FL9A 2LTAA 2O50A 3QVXA 3P8ZA 2O0MA 1J0DA 4I1SA 4I4TA 4X94A 4YAUA 1N2IA 3AF5A 4PF1A 2K87A 4ITRC 4YDSA 5BWMA 1G16A 1O2DA 2GZDA 2QYHA 3EXEB 1GGHA 1ZDMA 3NYRA 3ETEA 4L7VA 1A50B 4Z8YA 4Q03A 1UJ5A 2LGJA 3BF8A 4J0FA 2AG6A 1HL3A 1POWA 2C4MA 2X8JB 4LZZA 4RA6A 5EE5B 5CHEA 2UZIR 2VP6A 3SZLA 1JV2B 1E3QA 1UBNA 1IPEA 3BMOA 3CLTC 3KKNA 3IR6A 4I4TB 3L8FA 5JZ9A 4GD3Q 1GNLA 3UO8B 4EJ6A 2QL9A 3PR1A 4JLSA 4BQOA 5G2OA 2NU7A 3AJRA 2C88A 1J20A 4NXNB 1WABA 4GMFA 5IJWA 2P2SA 2YXLA 4AECA 1MW8X 3VNBA 3BMOB 2VJLA 4ARZB 3A6PC 4EYQA 1N0VC 1WKVA 4QUKA 2C5EA 4XSHA 4YT4A 4WXHA 1RQNA 4IQ8A 3N2EA 3R5TA 4JCOA 2NU7B 1HYQA 3SU8A 5C5EA 1XWWA 4CT5A 4ZJUA 1TNDA 3GEIA 1YQGA 2AG0A 4WIAA 2PU7A 2X3YA 5KOYA 2AQHA 2J6IA 3CKLA 3LDUA 3OCCA 5EPEA 4Q82A 5J2UB 3RGGA 5BR4A 1P31A 3FZQA 1OLOA 2HSWA 4KQIA 1EFLA 2FGJA 1JAIA 1K1EA 2Q1WA 5JO0A 2R7NA 1FNBA 2F1HA 3C1TA 1RPNA 4BZZA 2FZVA 3WJ2A 3GUZA 1DFGA 4JOQA 4DCNA 3OQMA 2UU9B 4ZYWA 1LDGA 5HSGA 2QRPA 3KSDO 4AJ1A 3CPHA 1Z0UA 2EEZA 5A05A 1G7SA 3GA0A 4KQ9A 3HB7A 3DG9A 1KARA 1VC2A 3AEYA 4P3YA 4D8VA 4LX8A 2H2DA 2OHFA 2R66A 4WY8A 4GIBA 4WOBA 4TZ6A 2BF4A 2RG1A 3SYNA 3UHFA 2P40A 4P34A 3T9FA 2PTHA 5F9FA 1XZGA 2ZLBA 3IAFA 2ZBQA 4LX0A 5CYGA 5KNDH 2A8YA 3RJ5A 1CUWA 3UVEA 4F12A 4FGZA 1YFLA 4AAYA 4MULA 1E1NA 1HRDA 1SVMA 3JQ8B 3N2KA 2IIVA 4PFKA 1U0OC 1KR5A 4J90A 1XMQB 1AO0A 1HURA 2F90A 3OZEA 4C4TA 2X5XA 2OBBA 3NTXA 3CZRA 1ZGZA 4M98A 1LVUA 3GLHE 1E2FA 1XZMA 4KYVA 4F21A 5A71A 2VFAA 1MAHA 4NF2A 3RS7A 2C4HA 4MW4A 2G71A 1B6TA 2Y1EA 1R8JA 3DS8A 3N2KB 4Q9DA 4Y2RA 4JVMA 5LZ8A 1ATZA 2O8BA 1ZM4A 4P36A 4UZSA 1EE1A 1PR4A 4FC6A 3VDQA 4CMHA 3IE0A 4UZFA 5T5QA 5TEWA 1ISFA 1CY2A 2QZZA 2ID7A 2H0AA 3P9YA 4EQZA 1E1LA 4LF6B 1NDHA 3ROTA 5JNUA 1BFDA 3N75A 3QBVA 4N0PA 4ZQIA 2O8BB 4UCFA 1KXZA 2ZYSA 3VM6A 1R88A 3O82A 3Q3JB 4C6TB 2CNNA 1EWQA 1XOIA 3MWDA 5MFZA 3U3DA 4AMUA 5HRUA 5CDTA 3FE2A 1GPBA 1O08A 2DUWA 2A0UA 1V5WA 1WCWA 1C7JA 2Y4NA 3L40A 2D0OB 3QUSA 4UM9D 3UKOA 5AXDA 5KNCH 1Z5GA 5DW3A 1R66A 3QHQA 4MR7A 1YCFA 2QQ0A 2QI9F 1FFCA 1NIPA 1T3HA 1C3JA 1JQDA 1UK9A 3LBIA 3MWDB 4RXMA 5D8DA 3JYNA 4ZPXA 1K5HA 1GNQA 3RABA 2W2LA 3KKMA 2HHLA 3PIRA 5JPIA 2Q29A 1LTHR 1Z6TA 3L8DA 4HH0A 1YWGO 5H3LA 2JS7A 5HF5A 3MINA 2A7XA 3DV2A 3H97A 4I2VA 4J2TA 2G4LA 2R62A 4PZAA 4CTMA 3ELDA 3NWJA 4DYDA 2VHVA 3I23A 3OQHA 2SBTA 3F96A 3MXOA 4MWCA 4NCJA 3V2HA 4B3DA 5LZ4A 2GK3A 5CM8B 3MINB 2YJ3A 3Q0TA 4OM8A 3WYNA 3GRFA 5ALHA 4BBAA 3EDMA 3T1NA 3IGFA 4G1CA 1ZZGA 1JXQA 4AP5A 5FBQB 5G40A 5T4FA 1L3BA 2ZSDA 3P27A 2HNBA 1RYDA 1V8BA 1I5OA 3D4OA 3HJAA 3PC8A 3HJTA 2J3MA 4OJQA 1MOQA 5CX4A 2K2WA 4ZVNA 1DCFA 4DG8A 5AESA 1I3OA 1OKKD 3OZBA 3D4BA 4L07A 2LW7A 2PUFA 4WLNA 5JI2E 1C7IA 1NY5A 2MMGA 3AUAA 1D0VA 3MGKA 1LI7A 3FUWA 4PAMA 3DTVA 2HA0A 4ZU1X 1A72A 1SUAA 3HA3A 3DOIA 4F4JA 2BMVA 2CNLA 4WPGA 3C3WA 1QCYA 4MRMA 1F7UA 1O5TA 1XG5A 2J4FA 3UMFA 5CDSA 3L8MA 4WLFA 2WABA 3JR7A 1YDGA 4ZC1A 5CFNA 4QPPA 2PR2A 2FG7C 2E85A 1R16A 3LDHA 3OOHA 1KMQA 2FVYA 4KXYA 2PUEA 4RHCA 3GMSA 4MRMB 4IWYA 4BVFA 5L40A 4MQEA 4UU1A 2RHBA 4TVBA 4KNVA 4G65A 1YE8A 1NNI1 1ZD5A 5DK4A 5FR2A 3SXJA 1U6JA 5K3SA 3ROXA 1KK3A 1BA3A 1YKGA 4IDAA 5CDHA 1NV8A 4GMDA 1FP7A 1XU7A 3QY9A 4UJ3A 3U56A 4U7HA 4QX6A 1GAEO 1U2TA 2GOYA 1S3IA 3E35A 3FNRA 4MQEB 1RWXA 5EKTA 1N7GA 5EWMA 4K6FA 4QQKA 5AKEA 1S01A 1KY5A 5G02A 3SD7A 3CPEA 2REOA 3DEKA 3JQAD 3MTAA 5TQ0A 3V42A 3QUAA 4CT0A 4D26A 1KKLA 1UBFA 2CF5A 2E0IA 4DEVA 4XOUA 2A30A 4LXIA 1XEAA 5P21A 2JLXA 2J5BA 5EWMB 2V7EA 5JDCA 2BIFA 2RI0A 1DEXA 4Q3AA 3G8DA 5TQ0B 3OOEA 1FU8A 3Q8KA 5F1YA 9GPBA 2C2OA 3DCJA 3GP3A 1J0XO 3N8NA 4LZNA 3T41A 4TWZA 2VS1A 1Q0QA 1R4AA 2DUNA 3LCUA 3FFAA 2QD3A 4REQA 3E03A 2VC2B 3DMDA 3UAOA 2XOEA 2RGXA 1RRMA 3IMFA 1KYXA 1TZBA 3K3PA 4OL9A 5ELLA 3RSOA 2FJ0A 4PANA 3CLVA 5ECDA 4HBZA 1PVOA 3MIIA 3V4VB 4REQB 1RYMA 2EATA 3P0FA 4AN4A 1NQAO 1Z34A 2UDPA 4MCHA 5HFAA 4TMWA 3PYXA 5TMDA 2H29A 4EAAA 1TM4E 1DXQA 4LSMA 2VJDA 3GRAA 2A2ZA 2EYUA 3JQPA 2ZUCA 3NWOA 3S27A 3TOVA 1GHTA 1TW3A 1UFKA 1FRVA 3OF3A 3ETHA 1Y80A 1NVVQ 2ZT8A 4A3SA 1H66A 1VHDA 2WIFA 1BS1A 5CDFE 3TH5A 3T8YA 4EG5A 3M4NA 4N3GA 2WIDA 1I3LA 3N0WA 3R0XA 4RMHA 3UAWA 4MUYA 2POQX 3CRW1 5IC6A 4RTMA 1W0JD 1B0PA 2FW7A 3TW8A 1RAFA 3UT6A 2A57A 3DXZA 3R3VA 2J7KA 4PHCA 3WFZA 4Z2AA 5EIEA 1R12A 2WHRA 4GSKA 1S2GA 3KUUA 4TMZA 5ED0A 4J7AA 2ZUDA 2WAOA 4DM7A 2P5UA 3A6EA 3DVQX 4O29A 3NDJA 2BI7A 4OQ4A 5AW3A 2FSUA 4DR2B 3RHSA 1IOZA 4Q37A 5A9SA 2OD2A 3KLBA 1SD2A 4C0BA 3TW8B 4ZI3A 4M1KA 2XWQA 3OT1A 2C42A 3DDSA 4G0VA 2IZ1A 3MG9A 5IAJA 4OBEA 4KXNA 2NIPA 1ZC3A 4LMPA 2GYWA 5KUTA 4LWPA 1AB5A 1YT5A 1M0EA 5A9SB 2IYXA 3OWHA 1TA4A 3U7HB 3OT1B 2I29A 2B25A 3MMXA 4BGDA 2H4HA 1CUAA 2Q6LA 2XQJA 1E4EA 3W1VA 1NVKA 2BD0A 1CQIA 1NGSA 3DHEA 1DKLA 4ZXPA 2ZFUA 3RYIA 4IL5A 1AV7A 3L1KA 4IDOA 5DWQA 2GEVA 4J07A 4FT2A 4KIUA 4GPIB 3SS8A 3B7WA 1J9ZA 3CUEF 4KWHA 3I5AA 4MVXA 1SBIA 2VDJA 1HE4A 1EA7A 4OB6A 2H85A 1Q0PA 2JRLA 2O1WA 1AHHA 3QWFA 1CQIB 3RYIB 2FPGA 3TRFA 1YQXA 1ARZA 2CVZA 1PGOA 1B76A 4OAQA 3GRUA 1IQUA 1DOAA 1RWWA 1U5AA 4JXJA 2PWYA 5K0GA 1ZWKA 3PFCA 3ZEAA 3PDJA 3BSYA 4BOYA 5AVZA 4PZ9A 4AT1A 1U7ZA 4COKA 4H59A 1Z73A 3DUWA 3HE3A 4K5QA 1TPYA 2FPGB 2Q28A 1Y7PA 4EL0A 3A1WA 5FLKA 2D0DA 4KQ6A 3NNDA 4GNKA 3NTUA 1A5AB 4M49A 5EMHA 2J5XA 4RD0A 1TM5E 2Q2NA 3E48A 2PWPA 5JMOA 1Y48E 5HMLA 1A9YA 3WFJA 5AQEA 1IOWA 2HUPA 2VN8A 3BXPA 4NKRA 4AO7A 4B6JA 1E6WA 1CR4A 1NJ6A 3A10A 1RQGA 2IK8A 4P81A 2GHRA 3D2BA 1PLKA 1IE3A 4HS4A 3TZHA 1Z4KA 5BSVA 3L3BA 4LV8B 2VBCA 4OI1A 3EULA 3K15A 1SXJC 5G4LA 3P9XA 3T6KA 4B3XA 3RRMA 3A37A 3WGYA 3SZUA 5EFZA 3K9HA 3A6GA 5EUBA 4YN3A 2D2EA 1DQRA 3G7UA 1Z39A 2HGSA 1KP3A 1CDOA 2PHZA 1VJ5A 4B8WA 3QOFA 1P2BA 4G5YA 5I47A 2P6NA 3DM9B 1AF4A 3MXTA 3NKVA 4KR6A 1S4MA 3CURA 4F9GA 2ZROA 1M2HA 3F67A 4LZPA 1M83A 3VV2A 3L77A 1W8IA 2PBFA 5CG2A 3L82B 4BO9A 1WCIA 3CZ5A 1T25A 3TGWA 3KFLA 1GFIA 2DUMA 3CX4A 4JI2B 3C7KA 1P4HA 1J9EA 3GR6A 3O4GA 3P94A 1YD7A 4QRHA 4R7ZA 2HBRA 2Z6AA 1ZSYA 1ZW1A 2PJZA 1SZJG 2AN4A 1A97A 6REQB 1YFJA 1FRFS 1RLTA 1Y82A 1D04A 5BSKA 4YCLA 1WCIB 1YCDA 2CLOB 1GFZA 5BVHA 5IYZF 2C2YA 3DB1A 3EIUA 4HLQB 1WMSA 1YJBA 3QBTA 3RW9A 3ICVA 3HXLA 3JD4A 2Q2VA 3O26A 1FXWA 2DJ5A 2Q5QA 3CZCA 1O97D 3UHOA 1FTYA 6ADHA 3H13A 2A9OA 1HQKA 1VLJA 1RM0A 4FD3A 5BVHB 3JV7A 4D9EA 1QGUB 3WA6A 2R3SA 3W3AH 3ZQ6A 1E2NA 4YQFA 2X0EA 3T9BA 1C30A 4DLTA 2CWWA 3G13A 1RYBA 2EZ9A 1W9MA 2FF7A 1IN1A 1IQPA 2EEPA 2IHVA 3UJAA 1DBIA 3ICEA 1I1HA 3GMTA 4PLFA 2OXRA 1HE8B 3EPJA 2DBRA 3DFMA 3MPOA 2BFPA 2OV1A 4XI9A 1TEXA 3B2NA 4WV3A 1GRCA 4BJHB 4BV2A 1C30B 1G9SA 2FKAA 3DDNA 3SX2A 4B7UA 4D96A 2JJQA 5EMJA 3HUUA 3ISJA 2IJGX 4ILKA 2RK4A 3HB9A 4DRZA 3E8MA 4CW7A 1WDTA 1QYRA 1ODSA 2GCGA 3SHFA 1WVMA 2VP3A 1DQZA 1ECGA 4PNPA 3SMQA 3F73A 1TEZA 4EUHA 3F3YA 4JDUA 1UQRA 3G2PA 1ONOA 1DPGA 4B6PA 4QG7A 3N6XA 2FMXA 1HT3A 3EPLA 4EVSA 2C5GA 5JYEA 4XUEA 4H0CA 5TLSA 1YACA 2V9CA 3HR8A 2MTBA 1E2HA 4IOKA 1NX6A 4XB2A 2QG9A 4Y2VA 3WLMA 2O8DA 2PAFA 3AF6A 2RGWA 1T4GA 4RMNA 5CB8A 1DAFA 3PEUA 3KX2A 3LYHA 1H5QA 3PQ7A 4I9HA 1OZFA 1JG3A 1L5RA 1WVGA 1ENYA 2V7PA 4JGIA 4MV4A 3T5DA 5FTLA 2V4MA 4CM7A 1GG2A 1W2WB 1LH0A 1IB6A 1KC3A 1Q0HA 1TCUA 2JJ8A 3R3ZA 2XTZA 4ZA2A 4E32A 2HF8A 4EIWA 1RXCA 3FG9A 4LFCB 1J07A 1KBOA 1QUFA 1X9HA 2VHEA 2J7PA 4KXXA 4TYQA 1Z5OA 1USIA 2WTNA 2PUVA 2QSZA 2PGNA 3BWDD 3ICQB 2QP9X 3ICOA 4GZ3A 2M6KA 1TK2A 3INGA 3KIPA 2HL6A 1HDCA 1SXIA 5B3JC 5FOWA 4L4ZA 2D2IA 3FRHA 4IGAA 4MUJA 4AZVA 1X9GA 3T54A 3ZDBA 4MDHA 1VCIA 3KT8A 1DEHA 5HMMA 2UYHA 4UASA 1QX4A 2HF9A 4QHTA 4DS3A 4HV4A 1YS1X 1U7XA 5JNLA 2Z9BA 1TOAA 4JN6B 1CZKA 3MMNA 2GKOA 2X4IA 1O0SA 2P0AA 1CEQA 1XB2A 1DU4A 2BGLA 3LKBA 5AM3A 1Q21A 2WYWA 4MQMA 4BX0A 1QLHA 1THTA 2BFFA 3U3MA 1X38A 2IU4A 2VYNA 4QBGB 2LCQA 4RQTA 1FNDA 1N6RA 1RI1A 2WVHA 3SK0A 3VYWA 1M2KA 2NO6A 3O91A 3DDHA 4FQ5A 4BE9A 4YR9A 1BZYA 1GNVA 5ICMA 4J76A 3P0EA 4JJGA 4ZT6A 4AC9A 1NQTA 5BQ3A 2OBXA 4UHFA 4BLOA 1GTZA 2BFFB 3CN9A 4GKVA 1BOOA 1KI4A 1W73A 1DNPA 2FSFA 2JASA 3CXUA 4MYUA 4BO5A 1ZQ1A 1AS0A 3L8CA 5LYYA 3OCXA 1Z0JA 1SD5A 3KQOA 3L7BA 1RWQA 4P3XA 4G85A 4NZZA 1CJBA 2HNKA 5E0KB 1ZHFA 3MS4A 1A8QA 2OD7A 2CZGA 3QNWA 3R0JA 4M0KA 3ORSA 4FFBA 4Q1CA 3ZGZA 3ADOA 3HP1A 3R3WA 1QQ5A 5EE3A 3EWAA 3OEWA 3ZWVA 1OROA 3LNCA 1WDMA 3HUTA 3B3QA 1BHJA 1AZTA 1Q1AA 4J75A 3SQNA 5C7LO 1E2LA 1VGQA 1NIJA 2GA9A 2WSSD 2HFJA 1PUXA 4IIXA 1NXOA 1LSOA 1MB4A 2OCAA 1R27A 4DQDA 3AJ8A 4FFBB 4D9JA 3O2QB 2ZWMA 3DAYA 4LCEA 4DG5A 1DVRA 3NH9A 4G4SO 1HZJA 3K2IA 4NHEA 3DWFA 1XEWX 3H1FA 4KO8A 5ENDA 2ACKA 4AYXA 5LM3A 1B0ZA 2ECPA 2ODTX 1NBMD 2YJ4A 3DV9A 2IQIA 4QGGA 3TR0A 1U3FA 4O2AA 1TQ6A 4PC6A 3JASA 3KOYA 4M37A 3FTFA 3LWNA 4ESOA 3E5NA 1EK2A 4GE0A 4RACA 4E5KA 1JN0A 2YHSA 3WBBA 1LGYA 3JASB 4KODA 4N03A 2JLVA 1H8ED 1R9NA 3GWZA 2FMTA 4KQJA 4JXZA 1NWCA 4MAAA 3U3ZA 3JZAA 3RS0A 5JTUA 2RKOA 2HRBA 4JBYA 2QTCA 2OEPA 1TJYA 3HKCA 1UJ6A 4RELA 1A82A 4PC1A 2P30A 2YQ5A 4L0CA 1U2DC 2D62A 3ADCA 2I4RA 1KDPA 3Q7EA 1DKOA 1MJGM 1VRVA 1X3SA 3B51X 1RHQA 1P72A 2WF8A 3BTUA 4X7RA 5JSYA 3SSNA 4D7AA 1B15A 1YIAA 2ZETA 2D5BA 4PZUA 4XCQA 5EZYF 5A3QA 5KVVA 1A96A 3HKCB 1H85A 3TKAA 1J9GA 4BBJA 1BHQ1 2ZBGA 4QBFA 4UDOA 1FJ2A 3K70C 1CJVC 2UKDA 3BQMB 4ZT5A 4QPZA 2SKDA 4BNIA 1G3QA 4FB4A 2AR7A 1K5DA 3HCRA 1KHTA 3T34A 1NVFA 5FLYA 1NLUA 1YQ9A 4G63A 2NSHA 2I2BA 3WQSB 2GERA 2X2PA 2YIVX 4MI1A 1JR6A 3VSEA 2CC2A 4Q01A 1R6BX 2WSYB 3A31A 1ZK2A 4M55A 2DWQA 2WG0A 2ZJ1A 5H1YA 4EO9A 1XJ0A 3KR0A 4OIFA 2RGCA 1FE8A 1EVKA 4I50A 3TIIA 3O8QA 4F4HA 2AT1A 4OQMA 3PC3A 5DI9A 2ATVA 3NHSA 2DBVO 2JBWA 4K2HA 5IPFA 2XF8A 2H2IA 3NHLA 1ESMA 3HYNA 5FBRB 1ZBQA 2JFHA 4QICA 2V5AA 4BMVA 1JDPA 4EJ0A 5FUYA 3EXAA 4I50B 2JEOA 4IMRA 1AIPA 1K7YA 2RHRA 2ZM5A 2VYVA 1A76A 4GOOD 1BD3A 4WK2B 1LSUA 5LMCA 3DZKA 1AKWA 1AZLA 5C8ZA 3WDLA 2IRWA 1QVVA 1IN6A 2G0NA 3D54D 5HK9A 2GUWA 4O25A 3WB2A 1AKTA 1P8JA 4FYMA 5G4KA 4YRPA 3C16C 4J0GA 1G2OA 2VA9A 3B78A 4JLDA 4JIMA 4BE7B 2ZT6A 3AF3A 2Y1OA 3B6MA 2HYDA 1NBAA 1MDFA 5J1SB 1JFFA 1A9QA 4MRNA 3VSCA 4DIKA 2HSEA 2NZJA 3U4AA 3UPTA 4UE2A 3LOUA 5G4KB 2AQ8A 4B44A 5LQDA 4M99A 3ZUPA 3PNYA 3V3KA 4UVHA 4BNJA 5CURA 1EHYA 2OMKA 5LVAA 1QIDA 1T4BA 2EKLA 1FMCA 2C1EA 1JFFB 2D1TA 2W5UA 1K4MA 1KFBB 3D4IA 4OHVA 3RVNA 2HF7A 2ILVA 2AXNA 3UB2A 1N6PA 2VYQA 4FPXA 3TLEA 2WAYA 3K9FC 1NJ8A 2L18A 1GA6A 1MQ9A 5DM4A 4ZT3A 4GVPA 1YTUA 1Q1NA 2XXBA 1SBYA 3HU5A 1LXCA 3U31A 3OD5A 1O94D 4JX9A 2ZWAA 4Q9NA 3ZDQA 3ZY6A 1XA0A 5I45A 2BTOA 5JPCA 4RM3A 5C1IA 4QZVA 4XPIB 2IHJA 3H04A 1FFEA 2FMKA 2IOYA 1WUYA 3ANLA 1I8TA 1QR6A 1G8AA 1TKCA 2GESA 3KE9A 1NSTA 3HA7A 3I9V1 1MH9A 4PG7A 5KHAA 3H5OA 3BD9A 3FAKA 1QOQB 1D8TA 3W2FA 2DPMA 4PS1A 2FEMA 5DF1A 4ZDKA 3MW8A 2X23A 4FCCA 1EXVA 2FPMA 4PZCA 3PXUA 3H6GA 4PBSA 1KP2A 4OFZA 3VGJA 4S05A 5A4MS 2HLPA 2A92A 1A4RA 3MSXA 5FH9A 5E3JA 2R1ZA 2XRZA 1HGXA 3KOZA 5AW7A 1ST3A 3LOQA 2BKAA 3CT6A 4DABA 2ZB2A 1G5FA 2PZKA 4Q00A 4TV8F 4C0QC 4MS1A 4CI9A 4DIDA 3V46A 5IRCD 4BNVA 1RWVA 3QBEA 3DBRB 2JJYA <