1YZFA

Crystal structure of the lipase/acylhydrolase from enterococcus faecalis
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
195
structure length
195
Chain Sequence
MRKIVLFGDSITAGYLDEAVSPVLVDLVKRDIAAMGLEEVAVINAGMPGDTTEDGLKRLNKEVLIEKPDEVVIFFGANDASLDRNITVATFRENLETMIHEIGSEKVILITPPYADSGRRPERPQTRIKELVKVAQEVGAAHNLPVIDLYKAMTVYPGTDEFLQADGLHFSQVGYELLGALIVREIKGRLKPKQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the lipase/acylhydrolase from Enterococcus faecalis
rcsb
source organism Enterococcus faecalis
molecule tags Hydrolase
molecule keywords lipase/acylhydrolase
total genus 74
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2005-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1yzfA00
4K7JA 4OAPA 1VYHA 3C1UA 2Q0QA 1FXWA 5B5SA 4M8KA 3PT5A 3U37A 2WAAA 2WAOA 4RSHA 1YZFA 1VJGA 5JD3A 1FXWF 3SLRA 5HOEA 4RW0A 1BWPA 4Q7QA 4K40A 4OAOA 1V2GA 1ESCA 1ESEA 1DEOA 3HP4A 5BN1A 3DT8A 1IVNA 3DC7A 1ESDA 4PPYA 1Z8HA 3SKVA 4JKOA 2W9XA 4H08A 1BWQA 3P94A 4XVHA 5CD9A 2O14A 2WABA 1DEXA 4JGGA 3MILA 5A4AA 4NRDA 3BZWA 4S1PA 1ES9A 1ZMBA 4JJ4A 1BWRA 3DT6A 1U8UA 4LHSA 3DT9A 3KVNA 2VPTA 4I8IA 2APJA 4DEVA 4TX1A 4Q9AA 2Q0SA 3W7VA 1PP4A 4HF7A 2HSJA 4HYQA 4JHLA 4JJ6A 3DCIA 3RJTA 1WABA 4K9SA 4K3UA 1J00A 1JRLA 4IYJA 1K7CA
chains in the Genus database with same CATH superfamily
1SBIA 4HGZA 2ZR9A 5KO2A 4CODB 3TZCA 3SFTA 1LK5A 4EMUA 1D6NA 2E49A 3BD6A 3QG1A 5CVJA 3IUPA 3VTAA 1RQXA 3COZA 1QVAA 1ZVJA 3MCUA 1UF9A 4Z1MD 1IN8A 1FLVA 1MRZA 5C5EA 3PX7A 2IODA 1MVNA 2YJ3A 2XH8A 1HNWB 3HN6A 1XTZA 1TX4B 1E1NA 1WXIA 2CFIA 2H5LA 4RM3A 2VZEA 3ELBA 2P62A 1H1LA 2WYWA 3UWPA 3INNA 4ZVMA 1NHGA 4E5PA 4HLCA 1KVQA 1QSGA 2WM2A 4TROA 5ERYA 4OQ4A 4DLKA 4ZIRA 2EJCA 2WU8A 4B31A 2RG1A 1J1ZA 1F0PA 1RM0A 3O94A 1I4OA 4OVKA 4M0KA 5LJLA 1ZU4A 3VUFA 5F64A 4P5EA 1EJ6A 1OFUA 1SUCA 2PTHA 2H4WA 4KGZA 2FMFA 1VFPA 2GJSA 2DP4E 1UFKA 4LJKA 5COQA 4ZVLA 4MEJA 1U0JA 3F7NA 2QHXA 3P9PA 4OIMA 3P7MA 3I52A 2RBKA 4PO8A 4KQ1A 2LDXA 4DVGA 2HV9A 2ID9A 4G5XA 2UAGA 2GEDA 3A28A 2HHHB 1IY2A 2XWBF 3I73A 1W0KD 1B2RA 1KKUA 2VAPA 4WZZA 1HEIA 3C7TA 2H0QA 5FL7D 4CLXA 3N74A 4LYYA 3F5SA 4L27A 5GONF 4AJHA 4B2PA 3BZBA 1UBCA 1U7DA 1O0SA 1UMKA 2ZJOA 3AOEC 3FUVA 3HE3A 4RADA 2QVLA 4DQDA 3R44A 1U7TA 3U80A 4RTPA 5U9CA 2DBZA 1JIIA 2JS7A 2Y0EA 1I30A 1FRNA 2CEAA 2I6GA 2X4LA 1KAMA 1HQDA 4J03A 5E1OA 3ICCA 5I51A 1TB4A 1OOEA 3HJBA 3IMEA 4N7BA 1HUQA 1RAGA 2D2XA 3RRZA 4YHBA 1ZUWA 2BDUA 5A4AA 1ZMOA 2RIPA 4IKOA 2RK3A 2YZ2A 4RMIA 4A0GA 1W88B 1XAHA 5IJ9B 5FI5A 5EXEA 3ZDAA 5CXXA 2QN9A 4IRUB 1KAOA 2QTFA 3E15A 4CF6A 2NV6A 1JQAA 2WUFA 3TLXA 4BGDA 2HUPA 3FGZA 2A3RA 5A0FA 3W77A 2WB2A 1GRQA 3V6LA 4R2KA 2FMKA 1EIZA 1NC3A 2YWEA 1W88A 1FTNA 2OL4A 4TWAA 4N8DA 2QRHA 2PBRA 4DDVA 2XGJA 2PGOA 2L19A 4L6IA 1Y34E 3W7VA 1MGPA 4HADA 3VOAA 3BGWA 1XQ1A 3D6UA 3E48A 4CUZA 5JYDA 1VIMA 2PJDA 4C7VA 4R1MA 2J3DA 4F2DA 2ZYHA 3RC2A 3U3OA 4UNRA 1T35A 3FX2A 1TK3A 2GSWA 4FGUA 3PIDA 4KYUA 5J3JA 4J0JA 2OPBA 3HBAA 4N5HX 1ODLA 4BOYA 2JK0A 1PJ8A 1TNDA 1PEKE 3Q1KA 3EF1A 3FFWA 2WLSA 2H5IA 2HREA 1XMXA 2FNAA 2H7CA 2X3YA 2ZSKA 1VE7A 4GF5A 4NBRA 5CM8B 1RE0A 3PPIA 1GL7A 4L6CA 4OYLA 3UGJA 2BM0A 5H82A 3DVSX 2OCPA 3PK0A 4HV4A 4Y3UA 3UKDA 4B71A 4ENPA 2OHHA 2J67A 1XV5A 4IIEA 4YJ2B 1ATIA 4GGOA 4C0XA 2BR5A 2IHUA 2PXXA 2W2LD 3G0CA 1YQEA 4FHGA 3TINA 3INGA 1WY7A 3DDCA 4WXHA 5DGHA 5DVZA 1MJNA 3LGSA 1FDIA 4IH1A 2PUHA 1ZNQO 1J2JA 3QKTA 5F33A 3QFHA 3LI2A 4Q3LA 4K3VA 1H8HD 1SU4A 2IPLA 2ICAA 2JZNA 3UB2A 3UT6A 1PQUA 3ZDEA 4JJZA 4UJ3A 1E6WA 1NUAA 2HMYB 3WISA 4POOA 3T1TA 5CX1A 2BM9A 1AD2A 1N2BA 2WJPA 3R0ZA 3JQ9C 4QOGA 3GBSA 4UUAA 3KKPA 4YCJA 3V46A 1OXSC 2WT8A 2OCLA 4JL5A 3NETA 4LGCA 4LDJA 3B12A 2ZBVA 4FE4A 4TM7A 4ZWNA 1LEHA 2PRSA 2VFAA 1E9FA 2XCSB 4IO1A 3K94A 5EIHA 5EJIA 3UB3A 4Y0AA 4ZCMA 3WYEA 3NDJA 3U2QA 5PNTA 2CLLB 1MABB 4IWXA 1Y5NA 1QGOA 3C8HA 4OP1A 1TO1E 3T7CA 1K4MA 2WU1A 4LSGA 3WJAA 2R9VA 3TQIA 5I4CA 4EB6A 2GQ0A 3A04A 3C5EA 3N0XA 2QW8A 1MG0A 1WV1A 3KB2A 3Q6NA 4AXBA 3KQNA 3J80A 2HNBA 4XVQA 4O2BB 2AYXA 4KMMA 1W7AA 4F4UA 3R0IA 3RIHA 1SBYA 4BB9A 1NV9A 1EDBA 4JJAA 2G08A 5LIRA 2HMTA 2BFDA 2P67A 4FFPA 3CNBA 3H5WA 4ZT3A 4R01A 3TOZA 1TTTA 3MYYA 2QJRA 1PR4A 2GCOA 5JJ5A 2XCTB 2NACA 2EDAA 1PBTA 2Q5OA 3N1UA 2X41A 1KSGA 1DTWA 2Y1OA 3KALA 2A67A 3JQDA 1ADGA 1GIAA 2X3FA 3DDWA 4RH0A 3SQNA 1XZHA 1ZCAA 3ELDA 3TIVA 1JSCA 3AHHA 4PN7A 4LNAA 3NCHA 1T5OA 3D0RA 3VZQA 4DG5A 3PQEA 2FCAA 2V98A 4NHOA 1ZMBA 1B1CA 1XHEA 2CUNA 4CEIA 3LUHA 5KX5B 1XLTA 4E2FA 5LQJA 3CUYA 3TFOA 1GUYA 4YVFA 5EJ2A 1Z83A 1T0IA 3URKA 4D43A 1TFUA 3THYB 3G9ZA 1ZEJA 4FYWA 4NK5A 3U13A 5BP7A 4TMKA 3DFUA 4KPYA 1EUQA 5A6SB 2WF5A 4RZUA 3UAWA 1DCMA 2V3VA 4GPAA 4N0DA 3H5LA 2FHPA 1SG9A 3DJYA 3V1KA 2NU6B 1DDOA 4ZRNA 5HF5A 5A9TA 2IU0A 2Y6UA 4HDAA 2ZJ8A 2FJ0A 3HABA 5FYDA 4BS9A 2I76A 3CVVA 1C5KA 3ORFA 5GP1A 1RSZA 5JO9A 2F3QA 4KLAA 4KR6A 1REQB 4JOBA 1I7PA 4HLUA 1K8QA 3MWEA 1L4EA 2QSYA 4NMXB 2RGXA 4MI6A 5E6RB 3WTBA 4X64B 4YRMA 5IDQA 3CVUA 2VRBA 4OQYA 5KIAA 1ORHA 3DMDA 4K9DA 2WD7B 2WKRA 4L95C 2JH9A 1EK6A 1V1MA 4UHHA 2H3HA 3GLUA 1OX4B 1M0WA 1VPEA 2QJWA 2RGWA 2ZOSA 1K75A 1J21A 5AI5A 2GN4A 4JBIA 3V1LA 2AJ8A 4LX8A 2G25A 2WPDA 5LQAA 4AS1A 1X39A 3B13B 1PT5A 1CUFA 3MPUA 3NP7A 4OMDA 3KWMA 2FW6A 4MGZR 1QNLA 5HVNA 1OU4A 1YR8A 2B8JA 4R8SA 4I3HA 3GFGA 4X24A 3TLKA 2YINC 3K0FA 1TFRA 3FPJA 4W99A 4UCWA 4Q9KA 2EJUA 5J63A 3THWA 3FF4A 5T6BA 1HL3A 4L8FA 3JCZA 3M1AA 2JCXA 4FPXA 1HFJA 4XLLA 5AQEA 1TYDE 3EVGA 3F1LA 3H6KA 3CQ9A 3D59A 4M0FA 4NV1A 2GKOA 4TMFA 4TXLA 5LB2A 3RRMA 3Q9UA 2ZRDA 3NYIA 4Y6QA 1RD4A 3ZZTA 4MZXA 1MT3A 4UTPA 4GP7A 4CM8A 1WVGA 3VBCA 5HW0A 1Z63A 3HJFA 3FHTA 3H4MA 1B1AA 3UJCA 2JIQA 2DJIA 1N75A 3ENNA 4DIEA 2FR8C 3DSRA 4KQEA 4ZVOA 1RM5A 2CFCA 4G9BA 1SD5A 1DV2A 1TM2A 4HQRA 4K1XA 4P33A 2LWIA 1ZM7A 2V96A 2VHWA 5GONB 3UFXA 3WIUA 4FB4A 4IIGA 3SC2B 5D3ZA 3IP9A 4DLNA 2O5VA 3NCTA 2GUGA 2PXHA 3C7DB 1ENZA 1F7VA 4TXMA 1CJMA 1E20A 2FWJA 3AYZB 3DBRA 3G6WA 5THXA 3IB3A 1FFXA 1TW2A 4LGYA 4EMBA 2I80A 2IU3A 4KTVE 3NP9A 3WLMA 4MVXA 2QVCA 4PAWA 2FDRA 3K9LA 4F1JA 2ZEJA 3IAFA 1FBTA 1QP8A 5K0FA 3SYRA 5FPYA 2G72A 4B73A 1YQGA 3FDJA 4MHSA 2W4QA 4H7IA 4M36A 3OT1A 2ZJ2A 3PCXA 1JHUA 2LE0A 3H9UA 1VHLA 5CTAA 4I4TF 4RHXA 1S9HA 3S2FA 4B3JA 1UODA 3ITKA 3FPKA 5DHAA 2GYUA 4ARSA 4G0YA 3R20A 1Q20A 2GZ1A 2M1ZA 5JJCA 2A1TR 2P1DA 3JTEA 4DIDA 1BD4A 2CNKA 4L8YA 1EBBA 5I7UA 2WSYB 1IK4A 3KL2A 5ARDA 1FDTA 1P9WA 2HQ1A 3NAGA 1VLHA 4GX1A 5EHQA 3UV3A 5B3JC 5K8LA 2VK2A 1ZN8A 3TRJA 3JQGB 3SX2A 3BD8A 3CO5A 3I8XA 4I8IA 3OM9A 1P4GA 1QHFA 5CA0B 3FB4A 5EEHA 5K3FA 3PDUA 3VH1A 4RTNA 3OU7A 3K35A 2A1UA 4YP0A 3SKXA 4A6PA 4E4TA 2IHJA 2NZWA 1KDRA 2Q0SA 3UHPA 2B94A 5LDHA 2ONZA 3AR9A 5C8YA 2KLHA 5L3QB 4D0NA 4BVBA 2Z30A 1PGPA 2R4UA 4BZZA 1HOTA 1U94A 2PSFA 4CL8A 1Y1PA 2Y99A 1RBZA 2NQ8A 2JGDB 2X1HA 2VO1A 2E48A 3RT9A 3IE1A 1JWLA 2A1UB 4NYMR 3A4LA 1TT5B 4YLEA 3G0DA 3NHRA 2ZJYA 1KEPA 4IXNA 5IT5A 3MLAA 4B2YA 4E5UA 1GPJA 1GHTA 3MN1A 4TYYA 1WABA 3OAAA 3GNSA 2BFNA 3KOZA 1F2UB 1VP9A 1VBNA 2J1LA 2W8BA 1XTVA 3M89A 4GXTA 4LSMA 4TKZA 4WN3A 1LBQA 5HGJA 4DSNA 4UOEA 2BFFB 3CX6A 4B9AA 3MCWA 3WXMA 4EFLA 5HX7A 3LIPA 4DRXA 1UBGA 3Q87B 4R8MA 4E4RA 1P5RA 1PYDA 2YV3A 3E3NA 3FUCA 2BV3A 3ONVA 1IJKA 4FMDB 4GM1A 3TMYA 2V55B 4EABA 4DMFA 4WZBA 1W47A 2ECOA 3DOCA 4OHPA 4LEIA 3ROZA 3IQZA 4DYDA 5IKPA 3HA7A 5DHPA 1HPLA 4B47A 3QPAA 1R0LA 2IQIA 3QELA 3VC3A 1S01A 4RK6A 1QAQA 5L45A 5J47A 5I48A 2H0AA 3TEMA 5I8ZA 3KELA 5E1BA 2X8WA 2YUTA 4LOIA 1IZYA 1CK4A 5CUQA 1U99A 3LHIA 3EMKA 2R00A 2RHWA 6GPBA 5L51A 2IEDA 3MWJA 4IR7A 3W6ZA 1C8VB 1KEWA 2D62A 1Q0ZA 3RK0A 3RUDA 4A8JA 5JJLA 2WZQA 3LC1O 4JOSA 2P7IA 3T1HB 1UKYA 4P4UA 1E9VA 4XVCA 3WWPA 3QY0A 4K6FA 1OB2A 4LRQA 4OYRA 1WQ1R 3PLNA 5H9WA 3OESA 1GKIA 2GILA 1CY4A 2N75A 1T2VA 2DH5A 1L7MA 1E9RA 1RYHA 2C3UA 2CDNA 2WYUA 4X62B 2LV8A 2PRJA 4NZYA 2OA0A 1VQ1A 3RVDA 1WCWA 2RGRA 2YYAA 5EP1A 5J2UF 3NTUA 4OFZA 4A1OA 3A1DA 3PXGA 3SYLA 1D2MA 1HYBA 1NLFA 3JQAB 4KLRA 5DXAA 3RYFB 4EQ6B 3GW8A 1WHTA 4N6OA 3CCBA 3THOA 4P3KA 3U7EB 2XVMA 3HZRA 3PQDA 1DJNA 3F98A 4WXPA 5L7YA 2VTBB 3ICOA 5JSQA 4UNNA 3EC7A 3PZBA 1R5OA 2W9XA 4F5WA 3RJMA 2FUKA 2NW6A 3JD3A 3OMWA 2O2GA 5JNSA 3LYUA 4JL8A 3T7RA 4DLRA 4L2IA 4Y1EA 3SIXA 1TU3A 4RSRA 3UWKA 1NVVQ 1SVOA 5JDCC 3ZZ1A 4PEVA 2BBWA 1U2TA 2CXRA 3LY7A 4J43A 4D9CA 3ZJ4A 3A31A 3O9MA 1AQIA 4EI2A 4OHCA 4LCBA 1XELA 3WWEA 1Y4DE 4XARA 1RMQA 1T3SA 3DEHA 4BPRA 2HW8A 5GJBA 2QU8A 3UCXA 4DC0A 1BE1A 1NHWA 5AKLA 3BULA 3RQSA 3CSDA 4HNUA 1ATZA 2J9FA 2GZMA 1ORDA 3LT1A 3T5PA 3TD2A 4NY1A 4XQ9A 4I81A 3V42A 3AVXA 3C1TA 1N32B 4PO9A 2C59A 3T7DA 1D6MA 3ZXSA 1CCWA 1EJ0A 2V9CA 5IJ0A 1IOWA 3OEWA 3EPKA 1YE5A 2B61A 5K6RA 3QE0A 3PHLA 2VSYA 1DS6A 2VP3A 1CP2A 4IIUA 3RTAA 1WW2A 5JSFA 3D7RA 1QH8A 3UJ7A 3RBXA 1PS9A 3IOEA 1B0AA 3RVQA 2YIMA 3GAZA 1ODSA 1XXLA 1BXZA 5IDXA 4HGOA 3GCWA 1TJPB 1U8AA 1JZTA 3U3DA 4HEJA 1PGOA 3IQFA 4YREA 3EBPA 2JLBA 4GZMA 1I3CA 1Z36A 2AXNA 2PR7A 3NT5A 2KMLA 3DVQX 3PDHA 4JR2A 4MR8A 4TTIA 3SQOA 1ULUA 3MUFA 2FEMA 3M9WA 4WVFA 4AQDA 3E22A 3F6PA 4P3PA 1JG6A 1YGYA 1TMOA 3JQ9A 3MMNA 4H0FA 4EH1A 2NNLD 1P0IA 3I4LA 2P9EA 5DPMA 4C6TA 2DBVO 2GPNA 3TQCA 5ALIA 2ZRCA 1YKFA 3I9JA 2ZJZA 5IT9A 3ZY2A 2I2CA 3H4VA 4V0LA 4RD3A 3ETNA 1QPGA 2O8BB 1X8JA 1VOTA 3GOHA 3I5MA 4Z53A 3GCZA 1J09A 2XKKA 2WWFA 1RAFA 1WD7A 3WMGA 4RULA 1NR1A 1ZXXA 4EMTA 2EWWA 2PUDA 4BPBA 5KYKA 4CT5A 4B74A 1ANKA 1QGUA 1YL7A 1JIXA 2H63A 3G7SA 3PGA1 4C87A 4FHFA 1YQWA 3PQ3A 4ZI3A 1Z45A 2G09A 3AQ4A 1NMQA 4TV9F 4RJTA 1JHQA 4V2UA 1M5RA 1RI3A 4WCFB 1SQGA 1SWVA 4RTJA 1KMHB 1RIFA 3KXPA 1DG9A 1GCOA 2P2DA 3JYHA 1X0VA 1NJ1A 1CUSA 3N0VA 2HPVA 1JT9A 1DO0A 3CNNA 1QB7A 3NB0A 5ALHA 1QRAA 2ZIEA 4RTKA 1U28C 2P91A 1W59A 1WXXA 3B6JA 2LKDA 3D0KA 1KS2A 3N59A 4H4EA 3HDJA 5CB8A 5DIFA 1A8QA 5EP4A 4BMZA 3IIMA 1TQ6A 3W4IA 1US8A 1E2UA 2NX2A 4FZVA 4RY8A 3EGDA 4W5JA 3IOBA 5EWJA 1G3RA 4DTIA 2VF7A 1NT2A 1R9GA 4P84A 4ZVPA 3WNDA 1U3FA 2YN2A 3MT7A 5EERA 4D1YA 3U4QB 1MC4A 5ECDA 3MVEA 4DNFA 2O7SA 1UXJA 2OKCA 5A2GA 4FNGA 1T5SA 2AX3A 4BFSA 1FUYB 1E96A 4S1VA 1PW5A 3I45A 4XM0A 1AKUA 1W94A 4GP9A 1CVRA 5CCBA 4BO1A 2ZE6A 2E4AA 3R3ZA 4LYJA 2ZAIA 1JJ7A 5H3HA 5CIYA 1TZCA 3G2HA 4B85A 4CU5A 1QQTA 3JQCA 5GIOE 5BUCA 2J3HA 1ORIA 4MWSA 1WPRA 1Y9DA 2J3IA 3D7LA 3FI0A 3PE4A 2LCQA 3RHSA 2I6TA 4Q19A 4CJXA 5BWMA 2G4CA 1YZUA 2Q8PA 3T1QA 3OPQA 1S1MA 5EE0A 2JNWA 3IIEA 4N5IX 2H5JA 1ECPA 4QFDA 4RCYA 2RGGA 4LI0A 4EW1A 4EEKA 3ZE7A 3WBKA 4ZJYA 2VP4A 3OQJA 3QKUA 2NUTA 4U39A 2A78A 2EHJA 4X1IB 3WAGA 3M4NA 3C6BA 4L57A 1P0MA 4FZJA 2WJAA 4YUAA 2RH4A 1W6RA 2W2KB 4X7RA 4ZVTA 4JGIA 2PMDA 4WA7A 4F06A 1K0FA 3FUXA 4EGSA 4DSTA 3GQBA 1UM8A 1PQWA 5D3MA 3NVAA 2R8BA 3A8TA 2H4XA 6AT1A 3G5LA 3UAYA 3H5RA 4QVGA 1H2YA 1DEHA 4F0JA 4LDRA 4YRQA 1IBLB 3PR1A 5AKIA 1ICIA 1T8TA 5CDFE 5AVXA 4ND4A 2FZCA 3ESQA 4ND6A 7GPBA 4F9FA 5EIBD 1OHHA 3LJKA 4QPZA 3ZW9A 3D6AA 3NXKA 5KS2A 1BN6A 1VGVA 1HE4A 1RCFA 2DSNA 1QZZA 3L6BA 4B84A 4JDUA 1V0JA 4DNPA 2VJKA 1SUFA 4KVFA 5IS2A 1AQ6A 4OF4A 1CETA 5CNJA 2DQKA 4AJEA 1QZTA 2B0JA 2CLSA 3LFHA 2GD6A 2GXUA 1QOQB 2G82A 4M1TA 5AVRA 3QM1A 4WNYA 4XR4A 2ZLBA 1CDOA 5D6OA 4PX2A 5BW4A 2DECA 2RC6A 1L4MA 2JBWA 1GA6A 4GIBA 3ADCA 4UREA 4XCQA 3R7LA 3UJ9A 1CUIA 1J7KA 3WFIA 1FFEA 2B1JA 2XNHA 3R23A 4B82A 1SIBE 1XU7A 3GPCA 1KK0A 5AK6A 1QV6A 1IM2A 2EF1A 2P4HX 2PS0A 1EHCA 1OV4A 4DRZA 1DOAA 1GPAA 2ZUSA 4JLDA 1WMEA 2GPTA 4IUYA 5C5CA 2MSLA 3EULA 1XQ6A 3QBVA 4CV0A 2WZDA 4D7AA 4BNDA 2C4KA 1BHSA 1CWUA 1FK8A 1R88A 3VR4D 2SKCA 4TLAA 3JYNA 3FKSA 4HO1X 2D0OB 1X1TA 4KIWA 4JCOA 4WZBB 1WMSA 5FA6A 1YMUA 3HP4A 1L5GB 4B7XA 3OIWA 4FSHA 2BUBA 1QVVA 2QX6A 4LYHA 1RXVA 3EEFA 2PY6A 4MW2A 4CKEA 1V35A 3PD1A 1U8EA 4LF8B 3DCNA 1KJWA 2H16A 5E9QA 4E09A 2M6SA 1RAHA 3LRXA 2AJDA 3T3IA 3VR2A 2P5SA 1FFWA 3LT4A 4BTLA 2C03A 1W73A 4BY9E 4MLCA 3STXA 1FNNA 4DBLE 4LYAA 4UTRA 4PLCA 1JTFA 5F2NA 3IS3A 2G9RA 4XVRA 1IJFA 1SZJG 3CT4A 4JEIA 2Q9CA 3GA5A 2O9JA 5F51A 1E9DA 1X7XB 4NU8X 2G80A 5FBVB 4YNBA 3RH0A 2O4CA 3MRXA 2Z6VA 4ALLA 5JWOA 3QA9A 1B8OA 3H3XA 3K4PA 5D6NA 4YEDA 3T61A 3E9CA 1BZYA 2J7PD 3OG9A 4S2UA 1RZ3A 3HEAA 5AM4A 2I55A 1W34A 2PWZA 4KOAA 5DXJA 4RVFA 4U02A 5E4TA 3PE6A 2YN4A 4WE3A 1AKQA 4V03A 4WJKB 3QU5A 2PD3A 4HDRB 5AI8A 1J7JA 2AMYA 4JKIA 4TV8A 1TM7E 3HUEA 1Q84A 4LJYA 4S35A 1EHIA 5JPDA 3C7AA 3NHUA 2XI4A 3B3GA 5HJ2A 3FOAA 3GT7A 1T9CA 1L7EA 1G63A 1G5PA 1ONSA 2FW0A 2W48A 1EP9A 4N40A 1BCRB 2HA3A 3WL5A 2PRIA 1N57A 3BWDD 3RTCA 2WJYA 1MR3F 2UVPB 1EWYA 1LLFA 1OYVA 1UMBA 1G8FA 2FUG6 1I2AA 2O0LA 1L5OA 3EARA 3LUAA 4ZHSA 2OK7A 4RD1A 1XLUA 1G42A 3GA7A 3HZZA 1FQWA 3VBEA 3QUTA 5JJIA 2CDCA 1CJUC 3ZNQA 4A92A 4LHEA 4J0HA 2YMQA 5LOVA 1C7IA 2CLEB 2JIPA 3RANA 5BWBA 2PUAA 1K3FA 1Y3BE 5EJGA 4A0FA 4ARAA 1RHRA 4K46A 5FTNA 4MCAA 1QYRA 1WWKA 3CRMA 3N2KA 3PUXA 4ER5A 2FP3A 5HDBB 3PI7A 2OCIA 1AV6A 1MA0A 5K6AC 5H9VA 3FJ1A 1F4VA 4UDYX 2HJSA 4JBYA 3SJBA 2ZU6A 4IVNA 2YFQA 3K9FC 1KQ3A 1SBTA 1J24A 2PRYA 3BQNB 1NF9A 5FPHA 2X8AA 1KYZA 4G0QA 2J3MA 4C6SA 3PICA 1DOHA 2EKLA 1SKUA 2FPLA 3LSYA 4TKUB 4C7JA 1C9DB 3NBFA 3U3KA 2V7QA 1V39A 3ENKA 1TTPB 1PJ3A 5FX2A 3RVKA 3JAKA 2AG5A 2CSUA 3ICWA 3CWZA 5EE9A 1EPUA 4CBVA 1YRYE 3T3NA 4QASA 1SKMA 3L7NA 3SS9X 3KD3A 4HX5A 1GGEA 2O57A 5ALLA 4FCTA 3EQ8A 3VZPA 1VE3A 2Z6AA 5H02A 5B7QA 3AGQA 1AUPA 2HFJA 3R7WA 4DY4A 5JROA 1TCAA 1QK5A 3CUVA 1EFLA 3Q12A 4UVEA 4E1BA 2V7PA 4ICIA 1Q3TA 4BJHB 3D3QA 1KI6B 4WK6A 1G20E 1KAGA 1PDOA 1XLTC 1QRSA 1NRXA 4KH1A 1J2RA 4GUDA 5ENVA 3CW8X 3HVUA 2HRRA 4G23A 3KJGA 2CXSA 3ZY5A 4YRTA 4CEIB 1Z5GA 2KX7A 5DXFA 1VYTA 5FD8A 2YW9A 3X1KA 3EA5A 2ETXA 3B1KA 3HDGA 4XLZA 3AERA 4AJ9A 1PVVA 3LTNC 4K6OA 4EYGA 2I65A 3N6VA 1BFKA 2RKBA 3JX9A 3WBBA 2Q21A 1GQQA 5FLEX 1T1RA 2CYCA 2NU7A 4H7EA 5IJ0B 1V7QA 2OC4A 1JPNA 4KFUA 1Y1SA 2V7XA 5IWCA 1ARZA 1E6UA 4M1ZA 2XMRA 4NXNB 3U0VA 4MVJM 5AKJA 2G83A 5C52B 1X7GA 4IMPA 1EEXB 3HDYA 2NXCA 1ST2A 1X8XA 3K1TA 2FWBA 3KZ1E 5JXHA 1ZHOA 2CHEA 2NU9A 1JEYB 1II0A 4IQFA 1YS9A 4R8VA 3MMXA 4GYYA 1W8IA 1X7WB 3QG5A 3JYQA 4R9RA 4H6WA 1GPWB 1TK2A 2PXAA 2WTNA 1U2QA 3CSUA 3GRZA 3JYOA 3KB6A 4Q02A 1SBHA 4FGWA 3BWVA 4YJHB 3MTGA 4C6RA 4QYWA 4EGQA 5JVDF 4XD7D 2Y8EA 1DAMA 3KYDB 3MS4A 1DKNA 4XXHA 5K99A 2VJPA 1V45E 4S04A 1MJFA 3LPLA 4M60A 5ALRA 1H5UA 1PK8A 3QV2A 3IAM6 4TVKA 3QW4B 4QDOA 4RDHA 1DAFA 1ZGBA 5DTJA 2PT9A 4P3OA 1RKQA 4I2NA 4A8JB 1P8AA 3HH8A 1VG1A 3W1WA 4X6LA 4OK6A 3B1FA 3KWLA 5KOJB 2IYUA 3B1JA 2R7KA 4RLQA 2WWHA 4F2HA 3AILA 4WFJA 2UUCB 3HDTA 2FP4A 1T1EA 3K6RA 2IEBA 3GG2A 2EP7A 1LX7A 4ZQHA 2D5IA 5AOBA 3RIYA 3SU8A 3SQXA 4P4SB 1FXSA 5JANA 4JHLA 2H2DA 4MULA 1CEQA 2GCOB 5I9TA 1RMTA 1XZDA 4DF3A 2ODNA 1QHGA 2WI8A 3FCAA 3DHWC 4YMWA 4UNIA 3OEHD 4JAVC 5B1YA 1DOZA 3ZNPA 4N3NA 5TXGA 4ADSG 1SAYA 5AVOA 1LJLA 3HYTA 3DLTA 1NULA 5SYMA 3QHPA 1L8AA 2FZKA 3VU3A 4AJPA 3AHFA 4ZO8A 2LUOA 2WM9B 3TTTA 5IKEA 4L5BA 1FTSA 1XR3A 3P5BA 4FFOA 4TKLA 3RF7A 3T5AA 2ZUDA 4IHJB 5ALUA 2ZUVA 3DL2A 4MIEA 2O8CA 4MHOA 4NAHA 5JZMA 1GJRA 2IP1A 4R6XA 4CKBA 1UZUA 5EZYB 3NGXA 1E3EA 5GIPE 3BK1A 3DXYA 3DEKA 3J7TA 3RFFA 5L3SB 1KMIY 3OTHA 1RPNA 4B09A 3TKYA 1OH8A 3NASA 3HWX1 1N9ZA 4YRDA 3NVMB 3D1JA 1I6LA 4LDPA 4QWMA 2Q3LA 5E9AA 4DKJA 2E55A 4PIMA 1AE1A 4NMWA 3UAGA 1VDZA 4AKGA 4O4IA 1MJGM 1M9NA 3OIDA 2PBFA 5IEBA 4UBMA 4HWTA 1WSWA 3JXEA 4AJJA 3I76A 2C92A 2I8CA 4TVSA 1F51E 4QNRA 1SCJA 5KYUA 4XPIB 4QG3A 3ROPA 1MNQA 2EHDA 2NXNA 2OCAA 3I01M 3LPMA 3E3LA 5I4BA 3TDMA 3A6FA 1CXZA 3VZSA 5DM60 4MI3A 2NZ8A 1NTOA 3UW1A 3U7JA 3F6SA 4C0WA 4IVRA 4DV3B 2FVXA 2CMGA 4M1OA 1E8DA 3NX4A 2PZGA 2Y1CA 3F9CA 4DSUA 2DG2A 2EQ5A 1FUKA 2IU6A 4R51A 3GPDG 3ZWVA 4WZAE 2DGDA 2X86A 3LKVA 1ZZEA 3NONA 4NPHA 3SIRA 2V0CA 2HNAA 2DM6A 2IJGX 3FFTA 3KNZA 1KR5A 2C61A 2CVQA 4DR5B 1OD6A 3B7PA 4KR3A 4YS6A 5AJZA 3WGIA 2XZOA 1XLVA 4WLVA 4D9FA 5TMDA 5BN5A 2VDUE 3AOEA 3BICA 3GGSA 1XJCA 2X7JA 2GHTA 3I6YA 3VNUA 3NBXX 4D4IA 2REQA 1G3UA 4QJIA 3GI1A 3PXEA 3F9RA 3GUYA 3M4YA 4DM3A 2VL7A 4BVJA 1OVMA 3RUEA 3I42A 4QBFA 1PVOA 5EWMB 3PFIA 2JFPA 5BSTA 3FROA 4HXEB 4JVOA 4AYXA 4W6QA 2PUBA 1TM3E 4DMHA 9ABPA 1P31A 3AHGA 2PE5A 1HFWA 3FPGA 4QWWA 2P77A 1IOZA 1ECLA 1E1YA 2OLJA 3G5MA 4FK8A 2C57A 1E77A 1XTTA 4KJZA 1KTVA 2PGXA 1ADYA 2FN4A 3HB4X 1T4CA 3NXSA 3P0HA 1PFQA 3JRNA 3GQBB 3UJBA 4ZYTA 5DYGA 1W46A 1X7DA 4DDWA 3LZCA 1DC7A 1E94E 2EKDA 3M3PA 2VYNA 4R1LA 4TX1A 3R8CA 5J58A 1EFRD 4NECA 3FWHA 3KOYA 4JB2A 2XHZA 3D4PA 2DPHA 1RLIA 3IQGX 3DA8A 4O33A 4UBIA 5DTEA 2AR9A 3JAKB 3IYLW 4L16A 4LN1A 1NVUQ 3CKKA 3IR6A 2B3TA 6Q21A 3NBQA 5EMJA 4EMSA 5J43A 3D8RA 3QZUA 1GAEO 4GLBA 2GNOA 2HJVA 3WLLA 2QIPA 1PRYA 3CRNA 1C8BA 4WA8A 5FL7A 4EL5A 5E6UB 4EF5A 3L0DA 3TO5A 1YZKA 5BN4B 4IJUA 3I12A 1B8PA 3F4BA 4HNQA 5GONA 5JRJA 1W0JD 3HN7A 1GEEA 1NIJA 1Q92A 1EINA 1USWA 2X14A 3G2JA 3TTYA 1U9IC 5SYNA 1OAOA 1F17A 3L4SO 5IZ4A 2OLEA 2DCMA 4JLOA 3KSAC 1BMTA 2IYEA 1B93A 4X00A 4X6XA 4M2LA 2CV1A 3RYTC 2PO5A 2C7RA 5CJPA 2WIDA 3FF1A 1FXWA 4J3FA 2C07A 5U4QA 1G16A 3S81A 1M0EA 4M8KA 2BZ0A 3UEOA 2D8MA 1RXSA 2FMIA 1R27A 3LFTA 4B6EA 2GA9A 2UVPA 1JR4A 2NUPA 5TR9A 1J0XO 1I4WA 4IJVA 4W8HA 5IUNC 3LA6A 4P0QB 3HCEA 4QX6A 1N2JA 1V26A 2G7MC 3FWPA 4XVUA 5BNIA 3HVJA 4KW7A 3KAPA 1GQ2A 1A8HA 2AJLI 5F7OA 2YV5A 4IICA 1U0LA 2QRZA 3OECA 2W90A 4PIPA 3IXMA 4BV9A 3C4VA 4C2TA 3ZE1B 5EGNA 5FTWA 1SPBS 1R3DA 1KFJB 1AGRA 1FYVA 1T2EA 2IY7A 2GEUA 3V8NA 4XWWA 2F4VB 4MAMA 2M1XA 4JKYA 5K3DA 4EITA 1PG2A 1C3OB 1LV8A 4KQHA 1WDKA 1P33A 3BTSA 3T4EA 1OBVA 1VXRA 1LUAA 1OLUA 4RE5A 1OX5A 1WKBA 3MTBA 1LY1A 2P3LA 2XJ4A 2ZI7A 2XB4A 3GD7A 5H3CA 2JBAA 1PWXA 2YXBA 1U1GA 3PNBA 4INOA 3OMXA 3NEJA 3M6AA 3BXPA 3NWBA 5HCIA 4DPLA 4JP5A 1BJKA 1E6EA 1YI1A 1Q7EA 2CUZA 3NDPA 4KR7A 2BEUB 3VPBA 1Y3DE 1XQWA 5TEVA 4B7ZA 2C9CA 1BS9A 1TW3A 1PUXA 3KV1A 4Z0HO 4EOGA 4UHEA 3NNSA 4TT3A 2VSOA 4MV7A 4PCUA 5IJWA 1XFDA 2PCJA 1GSOA 3QQPA 3ZGOA 2AV6A 3K2QA 1TEHA 2WAYA 4RK7A 4F85A 5TPZA 6REQB 1A27A 3HEBA 4WZAB 3RC9A 4BNWA 4Y9UA 1NXQA 2H9YA 4YDQA 1C7ZA 2OLKA 5ALZA 1PNOA 4C1BA 4D4JA 3WBJA 4C5AA 1BE6A 1QQ7A 1SZDA 4LA4A 5FLYA 5JTTA 1KFKB 3MGGA 3HUFA 3PHGA 1EB8A 1XRLA 3QJGA 2OB1A 4YIHA 5ITVA 5JNUA 1U1EA 3A1CA 2FMXA 4RCVA 2OY0A 4DLBA 5EG5A 4RPCA 1P9NA 1N5IA 3ZKAA 5I9IA 2I1VB 3BXHA 4Y2GA 3IULA 4MQ6A 4N8SA 2OZPA 2P9FA 2ZRGA 4KE8A 3BFXA 3WLPA 1C2YA 1N5LA 5CA1F 5L3SA 3S8YA 3R40A 5HTKA 1MX1A 3R9WA 5FTLA 1Z7WA 2JFXA 3DAFA 2JGFA 3IESA 4U2CA 3EGWA 5JYBA 4BO5A 5MN6A 3G2MA 3KYIB 4P9NA 5MHTA 1E1RA 2BFCB 3VR5D 2V6JA 3IPRA 4FCCA 3GDHA 3K53A 3DEAA 2DPMA 2NSLA 2R4QA 3EK2A 4UE3S 2J45A 2RARA 2QGNA 2W93A 2OBNA 4WRRA 1A8PA 1PFVA 1DX9A 1A2BA 1UBTS 3OPVA 4L8LA 4L7VA 1Y8QB 2JCSA 3VU8A 3SE7A 4DHWA 2WE7A 3ND9A 5CW1A 3I5UA 3RYIA 2CEKA 2AGVA 4D4HA 3OQBA 4JHXA 4DM4A 3TLMA 4R2JA 1VMEA 3R2JA 2VHTA 5AM5A 4RV4A 2QRPA 5TDHA 3DLPX 1O96B 3MWDB 3A05A 4GRAA 4LJ7A 2NTEA 4J1TA 4JYPA 4U7HA 3GMIA 1ONBA 2CD9A 3DF7A 4G1VA 3UGQA 3WLEA 2A33A 2CVFA 4BVLA 1KY4A 2MIIA 2I6FA 4QO7A 2QRMA 2YV4A 3KLPX 2DUNA 3SOPA 5DW0A 1YZQA 2WTEA 5D8DA 4P4GA 3VAAA 4AUMA 3C3MA 1W1UA 1CUYA 3EF3A 1QIIA 3IXLA 1T34A 5DRTA 1KWGA 1PZNA 4MICA 4E22A 3EW7A 5K0LA 4MCJA 1G5HA 2A30A 3T9CA 2W5UA 3NBKA 3C70A 1ZIPA 3EFHA 3KL4A 4MQMA 1EFVB 1PJZA 4YMLA 4C2AA 5TNXA 3AI2A 2ODQA 3ZGVA 1TO2E 1UWKA 2PT6A 4FMCB 1P0QA 3TD6A 4IH9A 3T1OA 1WBJB 1RHQA 1U3DA 2FX5A 3ZVMA 2CKDA 1YS7A 3ADDA 2IYFA 4FWTA 1EZZA 1SCNE 3HRHA 1PZGA 5IHPA 2VTEA 1KERA 4JZKA 4MROA 1HL7A 1KA9H 1ZK4A 3AIMA 4I6EA 4JXJA 5LKRA 1A8SA 2VIIA 3S0JA 1N4DA 3IT3A 1K7XB 3L7MA 1TQHA 4YECA 1Q74A 3A14A 4QXQA 2V7GA 1QO0A 3ZVLA 3QVSA 4E1VA 1CUAA 3JQBA 5HDQA 5EPUA 2G07A 2HLPA 3EEOA 1YTLA 1YD7A 3IVCA 4RJJA 3IDQA 1VG8A 4MLDA 3MG9A 2ZIZA 4J91A 5CDUA 4R1UA 4TTVA 4PICA 4GI5A 3S7ZA 2JGEA 2GPYA 1Y6GA 3OQ6A 4KKVA 1XTSA 4B3FX 3UT0A 4OX9Y 1R4MB 1S96A 2XYGA 3BIXA 2INGX 1M5TA 2VHVA 2X9VA 4C76A 1MC5A 4FCWA 5AWFC 3AUYA 3DCYA 1J97A 4Q00A 3W06A 4ZICA 2Q28A 1Z5ZA 2FWPA 1UBSB 2YZGA 3H04A 4RACA 1INLA 1N6IA 2EFCB 2FEPA 2VDOB 4GICA 3E1SA 5F9MA 2JLYA 3OTIA 1ZVMA 1K6EA 2I8AA 3FD8A 1TGVA 4JUFA 1RJWA 2QPLA 3FWYA 4WPGA 5ILQA 1T4GA 4P7JA 5BSUA 3P96A 3RVLA 2HM7A 4IDAA 4KWHA 1TKAA 3FWKA 1D2RA 4J16A 4OH1A 1Z06A 4BHTA 4BXOA 1TPZA 4CYMA 3VHXB 4PZEA 4RHEA 1SBNE 1PR3A 2APJA 2Q6VA 4Z1MA 4YYZA 1YA4A 3FW1A 2I7VA 3C3CA 2OZVA 2XQJA 2RHMA 1B00A 4FKZA 4FXPA 4Q4DA 4BQOA 5JW6A 3R5HA 2B4QA 1JI3A 3CG4A 1XA4A 2E1PA 3U31A 4A2PA 5THKA 2BGLA 4JXXA 2QR2A 2BMDA 2EOAA 2FWNA 2WVAA 3Q7QA 3ZE0B 3ZWAA 2YC2C 4EJSC 2ONKA 4FGJA 1NBHA 3COSA 3V5NA 4GP6A 3W04A 1TVMA 1W2HA 4GL4A 1SHKA 3B52X 3QMPA 3FH0A 4RHYA 5EJFA 4DW8A 5ILGA 3RABA 5LPNA 4LYGA 3HFSA 4Q9IA 4IJWA 4Q4AB 1THZA 1TDJA 2AN4A 1FS5A 1OLSB 3W90A 3CPJB 3PS9A 2P8JA 1U2ZA 1M6YA 2YS7A 3CUUA 2P9ZA 2HPAA 1Y6ZA 3CF4G 3PC4A 3L77A 3WQRA 2GVZC 3FPEA 2WHPA 1E98A 2D1QA 4OFXA 1QU2A 2PX4A 4HSGA 4M7RA 1KO1A 1ODKA 4MLPA 5H4HA 1SK9A 1KZ7B 1JNYA 2IF0A 1MX3A 3L02A 3LP8A 5IAKA 5IYZF 3V4SA 3EA0A 1TC1A 2ZETA 7ADHA 2X0RA 4ZV4A 1BGWA 3LUFA 3BDIA 3NH9A 3ZPXA 1T10A 4J1SA 1C30B 4PTYA 3PT5A 1JEQA 3BJMA 3IQXA 1UC5B 4QNMA 3GJ5A 1PQ4A 2HOQA 1RWPA 3PWTA 3QVLA 3TL3A 2AJTA 3ESRA 5H80A 1T8UA 3GFBA 4C0JA 2QDXA 3EG9B 5DT9A 3K0FB 4ZCQA 2ZUCA 3EBLA 4GPZA 2HYDA 5AW7A 4FNOA 1FXWF 2AR7A 4LYDA 4N0PA 3SK0A 3DTVA 5JARA 4DNQA 4JI8B 2Z56A 1A2OA 4X8HA 1N3IA 2VK4A 4ZYVA 2GAIA 1KI2A 5AXDA 1UFOA 2XRYA 3TCKA 3X44A 2VYVD 2HPHA 3FDZA 1Q0LA 5FXMA 2V7BA 1D4FA 4KR2A 3L9XA 4QBGB 4YMGA 3L92A 2AYYA 4OBEA 5SZHB 3BK7A 2I5PO 2QMYA 1KQNA 3KTDA 4L0DA 3WMEA 4I9UA 1PJTA 4GEKA 2XVYA 1ZVVA 4JFAA 3ZLVA 4QJ4A 2VRCD 4DOMA 3PPWA 1PUJA 2HL6A 4PVCA 4KYTA 4LY0A 4QRHA 4QXMA 4UNSA 5K09A 1KETA 5IKMA 2VNHA 1P45A 1EVJA 3SZ3A 3GUCA 3ZWXA 5E95A 2FETA 2JL1A 4CIDA 2WYVA 2ON6A 4O02B 4P83A 2YOFA 1D7OA 3WGNA 3U81A 3WSVA 4AC9A 3RASA 3HADA 1L5RA 1QIHA 5SICE 4ZV9A 4FGLA 1E2BA 1P91A 2XLBA 4GU5A 3ABRB 2PSHA 4WBNA 3EBOA 2XMBA 2BCEA 2PKCA 4MV1A 3TH5A 3W2FA 4DDUA 5LU8A 4MWGA 3E7FA 4UUOA 4CV2A 3PKZA 1D0VA 1F4PA 1T1GA 2C04A 1NI5A 1RPAA 2QAJA 1E3WA 2VF2A 3QLVC 3ER8A 2IH4A 2O48X 3VKUA 5HR5A 2Z8ZA 4WLEA 3GOQA 5EXXA 5KAMA 1ISHA 3R6LA 4MKFA 4GSKA 4W5TA 1PZMA 1OX4A 2I87A 2EYUA 4DUGA 4KFSA 4W9RA 3WLJA 2RHHA 3G0IA 3AVPA 1WRBA 1MIOB 2ES4A 1MAAA 3HCWA 1DBVO 3LU1A 3R1IA 5T8KC 3T3HA 4WNCA 2R2GA 3UUGA 3ZKWA 3CMCO 3GROA 4N47A 1QHNA 1V3TA 1D04A 1ZQ1A 4GMXA 1YQUA 5DWVA 3QUBA 1VHQA 4PSCA 1E7YA 5FNVA 2Y4OA 4JSRA 3ZC3A 1PGQA 1IRXA 1SXHA 2TMKA 4R9UC 2KJQA 5TVKA 1ZITA 3AMVA 4DM7A 3SBEA 4DB4A 5LMUB 4R2IA 3KKEA 5LA6B 2FWRA 1IJEA 3WB9A 2BFPA 4MRVA 3RBVA 1Y4AE 2NO0A 3JPWA 5IP5A 3GAFA 1XRNA 1JU9A 2DY1A 3M6VA 2OSVA 3T9EA 1E92A 1IG0A 1DQNA 3A1TA 3WMWA 4IEFB 2RAVA 4XYGA 5BUSA 3C6MA 2FLKA 1YZLA 4PRKA 4REQA 1CF2O 2HTEA 4JX8A 1G2OA 3RJ9A 3K1JA 3VH2A 2Z8YA 3QKRA 3B3FA 5TF0A 3ZK8A 5T5QA 5CB0A 3HXOA 1H2ZA 4R3WA 1PZFA 1YS2X 4WESB 1RIIA 2VDQB 3OO1A 4RLSA 3TNLA 1GKLA 1R18A 4MI1A 4DR6B 1OUMA 1RJDA 2NVUA 4CIWA 1ZM9A 3DTYA 3ONDA 5EN4A 2OCKA 2RIRA 2VTBA 2FE1A 4K26A 5EA2A 2QDKA 5EZ5A 3KCQA 4MP6A 3QP9A 5EESA 4BLTA 5B1IA 2ZATA 1Y7TA 3NDIA 4UM8B 2REQB 3UAXA 5AK3A 3DCJA 4A4DA 3AU8A 4ALIA 4FEYA 4CVNA 1SPXA 1MQAA 2VZLA 4TMVA 1C3JA 2GLUA 3L0YA 4QTUB 3T3PB 2I7CA 2OENG 5B5SA 1AGPA 1HWYA 3KPWA 4QUBA 4INPA 1WCV1 4RK0A 2YZKA 3HXLA 4MRRA 5CK5A 5AT1A 3L1IA 5KSZA 2VXOA 4UC0A 1F8XA 2QAGB 3ZW7A 4NIMA 1NPTO 3HUUA 5CM2Z 3Q0EA 2VH5R 5ALWA 3UYLA 1UBUS 3RQIA 4JI5B 4EW2A 4HB4A 5D5QA 5A2QA 1QNFA 2LW7A 3VFDA 5K3FB 2JHAA 4FMCF 2WAMA 2OOSA 1P3JA 4KV9A 3QK7A 3DZIA 4JNCA 5KOJA 3ILVA 4XD2A 3H19A 4DV0B 2FYTA 2J6CA 2YYZA 1W4CA 4NMLA 4MNTA 1FOEB 2BJHA 2ZJ5A 4OFBA 2PQ2A 2ORIA 1NJ5A 4Y6RA 1YQ9A 3KC2A 3KYCB 1F8YA 2J6HA 4HDSB 2PPLA 1OPRA 2ZT6A 5DLDA 4C3ZA 3HSYA 4DCSA 1YQQA 4X90A 3X2SA 2GYYA 2PUTA 2DOKA 2AFHE 1PTJA 4PFKA 4CMCA 1Q1NA 1EXVA 5IVKA 4OJKA 2PSJA 3D3JA 1ZL2A 4NXMB 1L5HA 3OJLA 4JVSB 3OZCA 3DKIA 5FQNA 4JJFA 1JR6A 2WYIA 1XEWX 4ER6A 1K3UB 2J0EA 3D7NA 4RXMA 4AZ3B 1HDRA 1NFFA 4M0MA 1JA1A 5B37A 3R3VA 4FWIB 5AOAA 5TRTA 5J2UA 2Q5FA 3VSCA 3H9JA 4X1YB 4E5YA 4UVDA 1KDYA 5K8IA 3RYIB 1FIUA 2WWTA 3JAWB 1KEUA 1SU6A 4G4SO 1HKUA 5ALNA 4YXWD 5BYAA 4US2R 4KQGA 1SUAA 3GJ3A 4DZTA 1RWMA 2PA3A 5LQDA 3OE1A 1TT5A 1RLJA 1ZI9A 4HLUC 4D3YA 5J1SB 4BEWA 1NUUA 3NHAA 5JE8A 2KHZA 4RK5A 3V4FA 4B8YA 1PNVA 5SY6A 4DV1B 1AQNA 3LL7A 4PW0A 1H0HA 2VQSA 4R9SA 1FLNA 1X87A 2H57A 4PNPA 2YJ5A 2WJ4A 4HGRA 5M5BA 3K4HA 3P5SA 2ZUBA 3K0AB 1QK4A 4GD3Q 4FKBA 1U9ZA 2XEDA 3JQGA 3MTQA 1LW6E 3AG6A 4OU4A 3MRTA 5IC5A 2H2IA 2PAFA 2MHCA 4L5YA 3O84A 3C3EA 1LTHR 2XIJA 5ILOA 4LRUA 1FTWA 1GU0A 1SEVA 4S3MA 5BNZA 5JH7A 2PH5A 3SFZA 1GZSA 3IKVA 3VPDA 3GAAA 1S8FA 4I4TB 5KTPA 3AV0B 4R8RA 4MO9A 3E7DA 1LK7A 4EPVA 4W7HA 3TECE 3C3PA 3VO1A 1ZMTA 2NQ2C 3BMNB 4FOOA 1YDHA 3UT5B 2UXDB 2IPXA 4OFWA 3G85A 4HLNA 4DSAA 1A1VA 1YXMA 2YMMA 1KZ6A 5AVTA 2CD7A 3MIIA 1JR2A 5HM8A 1E66A 2QRNA 3JWHA 1CE8A 1Y8RB 1U2GA 3PWSA 1HNZB 1IXKA 1V2HE 4HQKA 5EIWA 3D4BA 1J33A 2J5XA 1JDJA 1CR0A 1NLYA 4TLDA 1MTOA 2L17A 4O1MA 3P2JA 1OFIA 1U3TA 1CR6A 1M1YB 2XSZD 2Q0QA 4PXAA 5ETJA 2D3TA 5TGZA 2G36A 2Q0XA 2Q5LA 4BB5A 5I01A 3NBYC 2CZGA 3DMTC 3CVYA 4OAQA 3FZYA 3HNRA 4L9WA 4PQEA 3RS3A 2GVNA 4MMZB 3IDFA 2WFMA 4GOMD 4KO2S 4ER7A 4Y1RA 4OMCA 1TUGA 3KHUA 2WSLA 2AQHA 2VSFA 1SOVA 2WTXA 4DLTA 5IXSA 3ZY3A 3TE7A 2IOHA 3LQYA 2IOYA 3L05A 4P3YA 3AIOA 1GY8A 1OAKA 4G8CA 4JB8A 5I9BA 5AVUA 3CVXA 3DTVD 3GX1A 4KZPA 5C31A 1EZ4A 5D5HA 1PCXA 4NS4A 4JS0A 2HD4A 3QU4A 4JQZA 3N5CA 1QOPB 3TLGB 3HPRA 3R3UA 3MWLA 1SXQA 3SGLA 2I7TA 3RSOA 4OHWA 3BE8A 1O6ZA 4D9GA 3EIQA 4X5OA 4EB3A 2EZ8A 1UQTA 1KF0A 4MR9A 2CY0A 2ZT8A 2C4WA 1B41A 3P9QA 1G8JA 3GJ6A 3MCVA 4O25A 4Q1BA 1KPIA 5CIQA 5J40A 4YRPA 1EXMA 2AOTB 3HU3A 4KUGA 4BE7B 4TWJA 3EY4A 1DFGA 1AO3A 1NRWA 2D2EA 5K3CA 3AGPA 1QR6A 3C6KA 2HK7A 3JQAA 2W00A 5JS8A 1QHSA 2YY7A 4GI2A 4LHZA 3RREA 2EWMA 4CETA 1CRPA 1M34B 1JTEA 2FLWA 1UKZA 4CKCA 1XL1A 2W6OA 1S2DA 3F8WA 1JDVA 3DGEC 3EZLA 4MS4A 4YMIA 4EKNB 3W9BA 3ST7A 2YMPA 3E61A 5CVDA 1PT7A 1T8YA 2A0KA 1V1JA 1F5SA 1N3YA 2CXNA 4Y30A 4I1PA 1O5OA 3BF8A 2CUTA 4HDKB 4RLHA 3EC1A 3QEOA 1EK2A 3FSEA 3QPBA 5KYGA 2R1UA 1ETHA 3LF2A 3FYUB 4WKGA 5CK4A 3U44B 4L2IB 1GCIA 1X3SA 2PKRA 4KXUA 4C21A 1YBFA 3V2HA 4N1AA 2ET6A 2J3QA 2RGYA 3HU5A 3C98A 4EG7A 2VJAA 1P2GA 1H8EA 2C5GA 2H1LA 4HLDA 1NMYA 1V37A 2A5FA 4QHTA 1SUSA 3VHQA 5LJIA 5E2AA 2ERCA 3ZHBA 9MHTA 3IBYA 2WJVA 2IEYA 3NGLA 1B2LA 1B3RA 3K8OE 2OOKA 1P7ZA 2X7XA 1I0ZA 4D6PA 1TCBA 2GXSA 3IHKA 4LZAA 4UUMA 4E7PA 3T5MA 4EHKA 2PZBA 4OMUA 4TXJA 3VPSA 3ANLA 3H0CA 3CUEF 4RKRA 1J2TA 1RLMA 2C5FA 4OIFA 1E4EB 1N6OA 4XIFA 3RTDA 3HPQA 1P7YA 1WD5A 4BKPA 3SNHA 3KJQA 2ZQYA 2I1QA 3FNFA 2N42A 4JY7A 4BTVA 5DNEA 2NT3A 1IY1A 2HGSA 3IEVA 1Q14A 1RE1A 2A8YA 3LCCA 4IIJF 3FHCB 4QD3A 3D81A 2AKEA 3D2AA 1ZD3A 5GY7A 4EHLA 1ZUD1 2BAGA 3RC8A 3T7EA 3RSHA 4D56A 3PYLA 4U2FA 1LS6A 3TOSA 4IIBA 3S1AB 5C4GB 3JD4A 1BA2A 1PW7A 1RWVA 1CSEE 1LLQA 4K5QA 4OQEA 3O38A 2WM8A 2CDRA 4HK4A 1ZVQA 3TGWA 2R79A 1OBHA 1RJ9B 4QUDA 4EKDA 3E5HA 4C4SA 2VAMA 3VNVA 1HLFA 3UMRA 3WDSA 1QM5A 3MJCA 1QH9A 4B6FA 2G40A 2R7AA 5LZ5A 1FP2A 1H3FA 1AQLA 4PBRA 3KTAB 3KX2A 3EWAA 4D97A 4MSUA 4BMPB 4EAAA 3WOHA 5KMGB 1OI4A 2QENA 1PG0A 3GMDA 4JWTA 4W7SA 2BKAA 2GWHA 1OREA 4GMFA 4R2LA 2V7EA 1FA9A 1HZZC 4D45A 2EBUA 1MJHA 1PR5A 1BH6A 1XAGA 2RGDA 2CNNA 5BV8A 2R47A 3FUUA 4BGVA 4AJ4A 3EVDA 2C9YA 4KGDA 3YASA 5BORA 5JDIC 3CN7A 1SVLA 2R8YA 1RPTA 3CH6A 4Y9SA 3EF0A 1PT6A 3UAOA 4UOQA 1W25A 1L8LA 4N5LA 5EXDA 5IAGA 4EG4A 5KOHB 1L5VA 1P4AA 3HWWA 2FVYA 3QKWA 5FO0A 1B8NA 4K2HA 4B8WA 1G6HA 4BFVA 2Z98A 1BCSA 3ANXA 2J7PA 2XD9A 1CF9A 3N75A 5DGCA 5DBFA 5GJVC 3ZZMA 4F8JA 4PPYA 3VR5H 1Z8HA 1LNZA 1J2YA 1MO4A 1P19A 1PQYA 3KXKA 8ATCA 4MDFA 2PPVA 3LPCA 3A2MA 1BMQA 1LQTA 2P9JA 1W5SA 3TL2A 4CQMA 5AVSA 5K01A 2ZW9A 5JAIA 1LZKA 1TKCA 5LD2C 2ISCA 1W0CA 1JR3E 4WINA 3WRWA 2P65A 2DWCA 1W29A 4BNNA 3KHSA 4DUYB 1N3LA 3B78A 1W19A 1KS9A 3USZA 3MUEA 1BYUA 2MINB 4WZ6A 3OT5A 3A32A 1CBUA 1ZLXA 1SUEA 2B2CA 1QUFA 4YUYA 5LD2B 4F12A 2X0IA 2IYLD 2BHSA 3EZ6A 1XA3A 3WGVA 2PIAA 2YHSA 1C50A 3ELYA 1UZLA 4Q7LA 4AG3A 3TR5A 3VR6D 1IDN1 5GJWC 4AUNA 3P97A 2QD5A 3QOXA 5FL3A 3KSBC 1TKRA 2HNKA 1NNEA 3K7EA 3HFGA 4WDRA 4J0IA 4KXQA 1TEVA 1U9CA 1B6RA 2A35A 4IMRA 4XJSA 4OX9B 2B4YA 1THMA 3EGDB 5DWDA 4QECA 2V9ZA 2GZ2A 5KOYA 1P2VA 4FYJA 4KIUA 1ZU5A 4J0FA 2C84A 3MJHA 4G4SP 3VR1A 2NUTB 4CZ2A 2BI4A 3AFIA 1K8RA 1UDXA 2ZJ1A 1SIOA 2QVBA 3OEED 4PG4A 2FJUA 3O0DA 3Q88A 3SVTA 4YACA 3KYDA 5BQOA 5KJEA 4LC9A 2NO5A 3IFSA 2VPWA 3TUIC 3W1VA 1WG8A 4ZPJA 2HJHA 4B4OA 4LKRA 1PLLA 3FUTA 2XAUA 4LTDA 1KY2A 3SJUA 5MF6A 3WLFA 4NCXA 4HJXA 4MYCA 1DKOA 5FB3A 3MJSA 5J2TB 1PEYA 1MA3A 2VPZA 4MK4A 4Z4HA 2VS1A 1TD9A 1A76A 1RXCA 3CEAA 4CI9A 4E5VA 3K05A 3P2OA 4I55B 1U0SY 1T1JA 4YRBA 2C88A 1H2BA 1AS3A 1VA4A 3HU2A 4GE3A 4UXHA 2C8JA 2OG2A 1JU3A 1TIPA 1PR1A 5C8YB 1ZM3A 2GBGA 2ARKA 3TD9A 1W8DA 2JGKA 1P61B 1IBCA 1AZLA 4HQFA 3CX7A 3DLCA 2VJYA 2VKQA 5AHWA 2J32A 1LSOA 1ZSNA 2I4LA 4RSHA 4DSOA 3ZDZB 4K05A 1L8OA 2BI7A 1UDAA 4J9VA 4RVCA 4AKHA 1UOPA 4ZQCB 5D1NA 2RI6A 4AK9A 2H6EA 2XNCA 2IW3A 2ZUWA 4CMAA 1N8KA 1OFVA 2X8JA 1FDOA 2ZBGA 2GF0A 2NZYA 4GR5A 1FTGA 1KFCB 1UMCB 2CWDA 1Z6GA 4HH0A 1GTZA 2JFHA 3CW2A 3ZLUA 4A0HA 4DT1B 1FJ2A 2XYVA 3OFJA 2B7LA 1KI7A 3AF0A 3GEPA 4NFHA 5GAJA 4NULA 3E0QA 5E7IA 2RCNA 2A9FA 3KSZO 1XD2B 2YFKA 5FNZA 3E8SA 1NBAA 3GC6A 3R6WA 4KTTE 4IDEA 4ED9A 1V3VA 1CU1A 4RKYA 4MV9A 4UULA 1RLTA 2AUMA 4GC5A 2P40A 4UQPA 2OBXA 2QMUA 1QFSA 3GLFB 4WIAA 3MJ4A 3WKDA 1N78A 1GPH1 4YJ3F 3S2SA 2PT5A 1TYAE 4NJMB 2Y1FA 2VT7A 3FZGA 1GVNB 1DX6A 5CT5A 3TMAA 2XNDA 3W4JA 4GLFA 2LDBA 5DTQA 1LXCA 2WSSA 3UK2A 3NOOA 4MP8A 1MHTA 2J9ZB 1WZEA 2OQIA 2JGRA 1EP2B 4EB6B 1G9XA 1M83A 3N2GA 1RKBA 2PWBA 4HY3A 1KO7A 4JC4A 1XEWY 1Y9JA 4MQ4A 4WDQA 1SBZA 1E7RA 3DL4A 3DQZA 2NZJA 1V4VA 4ASUD 4ZYZA 2G77B 4OD0A 1ND5A 2GS9A 2X5JO 4OOEA 1KSHA 2JG3A 3EZFA 4Q0MA 2K7ZA 1ZW1A 3N5KA 3NHWA 1R0CA 4JMPA 3LY9A 3FMFA 3S29A 1FX0B 3X1YA 5JNTA 5KYWB 4PAMA 3M4ZA 1G2PA 1JEEA 1VMDA 5EIEA 1VIYA 4XGKA 3G59A 2XITA 1C8KA 1SZPA 4MGEA 1AZTA 4R8LA 4YCLA 4QGHA 3ZH9B 2O7NA 3DVRX 5HFAA 3ZU4A 1ML3A 2UYQA 3OURA 4Q9AA 4W82A 1GFSA 4XFJA 1GG5A 3TKLA 1Z7EA 1NUQA 1HNNA 2QNBA 4RIFA 4HX2A 1JT2A 2PN1A 3WNVA 4N48A 1KQOA 4EUFA 1VSBA 4NFYA 2IBSA 2OZEA 3DQPA 3LZDA 3DPSA 2FEXA 4EUHA 5E8JA 2GZRA 3RS2A 5CA1B 5C4IA 2QUIA 1H4TA 3KLMX 4I6JA 1FY2A 5TPWA 1EDOA 1VGRA 4DN6A 5B57C 1E2IA 1F9AA 1V25A 4FMPA 2NTNA 2QXYA 4I2VA 5JFTA 1SUIA 3G7UA 3B2QA 3CZCA 2YVUA 1A77A 3R3HA 1J00A 4BJ6A 4OHZA 4BNVA 1AKVA 2PUVA 3DAPA 4GO1A 3JD0A 3TWOA 1E1QD 1TZBA 2BR3A 4ZZIA 3PP8A 4UCFA 1PFUA 3LKDA 3AH8A 3RJZA 3QEBZ 2WDPA 2KB0A 2FXIA 4BBJA 4PZLA 2IA5A 3FN4A 3FXAA 5EIAA 2B5OA 2G1PA 2Q1YA 4BCBA 2A4KA 2OXEA 3NM6B 2AMFA 1AB6A 1VE5A 1LDGA 2R8RA 1NVWQ 3ZDQA 4INAA 4W5RA 5KOHA 3I2IA 3R3YA 3E9MA 1A2KC 1L4YA 3TR6A 1NVFA 3QY9A 2CYBA 1HT1E 2J33A 1V8FA 1R74A 1UOQA 3M8KA 4CEHB 2D0PB 3S68A 5CBPB 5JZSA 1WIWA 3OAAD 2QRKA 4FW9A 3BMNA 4LHYA 4XW2A 4EG8A 3LQKA 1WVIA 5AUQA 1CS0A 3HXTA 4LDZA 4FGKA 2K7FA 4OHMA 3KOMA 5T4BA 2DTXA 2ZCJA 1V2GA 2IYPA 2RAUA 3ZHVA 5JSHA 4PG6A 1K9SA 3KRTA 3PFHA 1O1YA 2OBYA 3U4CA 1R8XA 5C37A 3E2PA 1ODJA 1WXWA 2GN8A 5J4HA 1EGQA 4MW0A 4XLTA 3VOTA 2GZAA 1R9NA 4ZHQB 3WYGA 1G59A 4P86A 1ISRA 2VUIB 4HMQA 2P9QA 1GZ6A 3K4QA 4A6EA 4C7MA 3E9QA 3H2BA 4KXFB 2WF7A 2YRXA 3C4QA 4BQQA 2W6MA 3BSSA 4HSEA 3W8RA 2ZRQA 4FYXA 3S5JA 3Q3HA 4CEJA 2J8ZA 3KQLA 4Q4JB 2HO4A 3FM9A 1L7OA 3N8KA 1UINA 2DFTA 1MIOA 4ML3A 3A4MA 3GAMA 5LYJB 3HKCA 3PNSA 2JAXA 3INTA 2DFPA 3EVAA 4LVNA 4JQCA 1VJ0A 2X23A 3QNUA 3IIJA 1NMZA 2AFIB 3OF2A 4M76B 3SJCA 4ZJUA 1SKAA 1V9CA 2I8LA 3K6KA 5AHRA 3DEZA 3AL0C 4BEVA 1DC6A 2H8GA 1OGYA 4WJLA 2ZAYA 3A4NA 2FFRA 1KOLA 4LF4B 4EB8A 3LBYA 4CLOA 2PEZA 1A69A 2H85A 4OHKA 4O1HA 4YIKA 1SCBA 4WBNB 5CFOA 2ZBQA 4M21A 3E05A 2XSZA 3KVOA 2OQVA 3WVNA 3S99A 2D06A 3VMMA 1P2TA 2O2DA 4IXMA 1QG0A 2PMFA 2W8BB 4OEHA 5KBYA 1VXOA 2HDNB 1X1CA 2ZAMA 4B6GA 1AURA 1WY5A 2HWYA 1HF3A 4X1IA 1UBOS 1CIVA 1UPTA 1FS4A 1O2DA 4KWTA 3QE4A 2V3CC 1FX0A 1XJWA 3TX6A 2BTQA 3R0JA 4PNEA 1AK2A 4WHMA 2HA7A 4US0R 4YXFA 2OMKA 4BNUA 5JU6A 3WSTA 2LCFA 4QVKA 4Y9DA 4DRYA 2FSIA 4HNGA 1QVWA 3BRSA 3GP8A 3TZKA 1AQUA 2ODBA 2CHQA 2QGFA 4K86A 2BZSA 2XOKD 5JR3A 1AGXA 1Y1QA 1QC5B 4IJQA 5CA1A 2AVNA 2PYZA 1T4DA 4OXNA 3M6MD 4X8OA 2FZ4A 1DMSA 4ND2A 1HLDA 3H8JA 3QLJA 5FUWA 2FR1A 2Q62A 3C3DA 4I1RA 1YR9A 4AY3A 4P6VF 1U7PA 4HGPA 4TZKA 2BKXA 2WWWA 3EMVA 1XTKA 4ZVRA 2EFHB 4OAPA 3WV5A 1T9ZA 1WL8A 1Z25A 4YRNA 1XQ9A 3K09C 4G9GA 2JAWA 2G28A 4H59A 2YWBA 4JB0A 4A1FA 2JI9A 2ZYUX 1GFZA 1AF4A 4GPIB 4NBLA 1A5TA 2GPJA 4BBZA 3LV8A 5MFPA 2AWOA 2HIGA 1AMOA 3IR7A 5G4LA 1QFJA 2X6TA 3I04M 1TPYA 4PFQA 2FPOA 2ZJ0A 2ZS7A 5C5DA 1TA0A 5EJ4A 3DEYX 4G1MB 4URYR 2HJGA 2RJOA 4FUQA 5DOVA 2GF2A 1FSZA 4PWZA 3ZBPA 1J9ZA 3ILHA 1KWKA 4H35A 4BNFA 3H3JA 1V96A 4PFJA 2O8NA 4TMXA 4P5DA 4TQUS 1AKRA 1UJ2A 3GGGA 5FWYB 3WC4A 4BCDA 2ZIFA 3MWFA 4M54A 4K6MA 4EKGA 2AG0A 1X7WA 3EOAI 4JSYA 1P1IA 2HSEA 2QRQA 3HZHA 3IERA 2O3RA 3E8XA 2O8DA 1TL7C 1DAPA 1WCYA 3IXQA 3AF2A 4NE7A 1F1JA 3CH7A 3K92A 3KJFA 1NF3A 3WJ1A 2CCJA 1PHRA 2CK3D 2OBFA 1DEAA 2RH8A 2JVJA 3L6CA 4K1LA 4S1OA 5A0VA 1O9BA 1R6UA 1WZIA 3GRCA 3OOSA 2R11A 2H3EA 3LCVB 4XWTA 5IASA 5DHFA 2UYCA 1YFJA 1JTVA 1B15A 4HNVA 3CVWA 2OP0A 3CMMA 2BISA 5K3BA 1DV1A 3OPYB 4WGFA 4BWGA 2P75A 1COWA 4BIMA 4X65B 2BMFA 2WIFA 4YJFB 4IGFA 2AI1A 2WVJA 3U4IA 3UOWA 4Q48A 2XXAB 3MYRA 3DMHA 2GBLA 4A73A 5ITZB 4YO8A 3DG9A 3U7GA 1Q0PA 1FDWA 2YYSA 4YJFA 5KJ6A 3ZV7A 4YLYA 2KPOA 1LWOA 3MJDA 3TSOA 3IQHX 4L15A 1GSIA 3DUWA 4X63A 1CUWA 4EVQA 4BLWA 5JAPA 2FG7C 3SBXA 1UJNA 3G2KA 4FWBA 3GHYA 4LWPA 2Q4TA 1M6NA 2WIBA 2BGNA 5KKCA 2VPTA 1Q12A 4JP8A 2C4UA 1TIBA 5FBHA 4IMIB 2ACEA 1DX4A 1IN5A 3IHLA 3QUSA 2Z43A 5DI3B 1TCCA 1C4XA 1SOWA 3AFHA 3BN3A 3STVA 1RI5A 4MW6A 3BRQA 1M5UA 2IYQA 3B9BA 2ZSUA 4MPDA 4KLCA 4OJNA 5CXSA 5SZJA 5CFNA 5KTSA 2ZI3A 5CMLA 1VG0B 1W85B 5FBQB 1TT7A 3E2IA 1XDGA 2OQRA 2AD1A 2YHIB 5BNTA 5JJBA 3ELWA 3BIWA 2Z6QA 3QHAA 3LBIA 1N92A 4C4PA 5FWNA 2P5UA 2PZKA 1ZGAA 3TX2A 4JB3A 3GH1A 4KXYA 1KO5A 2VA8A 4NL4H 3M5WA 2WIJA 4HEQA 1STOA 4V3BA 1ZJ4A 2DWQA 1Y9EA 3ND8A 1UC4B 2IHTA 1JHXA 3N8NA 5ESDA 4CTMA 4YT4A 2YWJA 3F2VA 1UM9A 2A5JA 3C16C 3D6NB 3DXXA 1Z2DA 3U09A 2P6OA 1NKSA 3UJ8A 2DLCX 2CE7A 1Z7BA 4Z1OA 1AUXA 1T4CB 3TR0A 3ZTTA 2R6FA 3IAS1 4Z49A 2UYGA 4R7ZA 5FWXB 2GN1A 1W4RA 1Z88A 3E9ZA 1FS6A 1T9KA 3GXBA 3L8ZA 4RA6A 2O6HA 5REQA 1G19A 1NM5A 2ZSDA 3K5WA 3PF8A 3B2NA 1GGVA 4LIPD 3A0RB 3PC3A 1SJ9A 3VHRA 3OJOA 4F4JA 4I50F 1VRVA 3TI7A 2P8SA 3MNFA 3VC7A 4DB2A 1F2UA 2EDCA 2GI4A 1HDOA 3FPAA 3ONEA 2O3JA 4ZVUA 2ZXEA 2Q45A 2BJVA 1FUUA 5J4VA 4Q03A 1NVKA 5FOWA 2GPAA 2Y1WA 2VK8A 5EHIA 4N5NA 2GX6A 3V4ZA 4MDEA 5BVHA 2IYXA 2GD2A 3OC6A 2AN1A 2PUWA 4R9VA 1YFLA 4HFJA 3LA8A 2CJWB 5J5VA 2XMSA 4PLWA 2V7UA 5MGNA 4LK3A 3NHBA 4HLQB 1RYFA 1D9ZA 3MGKA 3W3AD 2Y77A 2J87A 3CF6R 3PHJA 1RBQA 4YQEA 3TNJA 1SUPA 3EOBI 4G5FA 1CNMA 2I3BA 3OZFA 1WKVA 2AQKA 5CYOA 2BMJA 2R85A 1J1IA 5LL6P 2ZJ6A 3Q98A 5TV2A 1Y89A 5IF3A 1RT9A 2FDCA 4N65A 2RK6A 4PLPA 2HCRA 4OQNA 1NYLA 4YONB 3VJMA 4W6ZA 2GHIA 3O1LA 1I3KA 4I36A 1E2HA 1NE2A 1K27A 1U0OC 2ECFA 4XA8A 3R8XA 2DQZA 4AUEA 1E18A 1WEHA 1ODTC 1V5GA 4WESA 5B1DA 2AA3A 3JD2A 1ZHHA 1XMVA 3AW9A 3HC7A 2R6HA 3NJ8A 3QFCA 4FR5A 4YQFA 1J5PA 1ZD8A 1L8XA 4KR0A 5ICFA 4C7OA 5DU2A 3JRWA 4QPJC 1NW7A 1VYUA 3PKJA 2IHYA 3W5AA 4IG4A 1ZWLA 1ULSA 2OO5A 2E5FA 1TKBA 4GX5A 4LMBA 3WK8A 5K4AA 1M6VA 3T5GA 1N7HA 3OO0A 3BWEA 4WT7A 2XUDA 3IMCA 3QVJA 4OQQA 1FDUA 1CZOA 3GFRA 2E21A 4KMOA 1T2AA 4P58A 3U7RA 3VAYA 4B7UA 1OGJA 5K6AA 2DQYA 4D8XA 2WC1A 1JIVA 4IIFA 3K6JA 1Y5IA 4OOFA 3Q8LA 1LPMA 1EK1A 4NZNA 4D0RA 2CW5A 4MTLA 3I8SA 2BHTA 3ASYA 3UJPA 1A9PA 1DIAA 1PP4A 3M3HA 1UJ4A 2Q6TA 3S1LA 4RFSB 1P29A 3KEGA 1VIDA 5EHNA 4B80A 2PKEA 3QRWA 5JDIA 3WWCA 1GU7A 4XX1A 2I66A 3OPXA 3AM5A 4GBGA 3AM3A 3GFQA 5D7NA 1O6GA 4TTAA 3SOZA 1N9GB 1Z5VA 4QE3A 3ZJ5A 2G6TA 1Y4UA 5IM5A 4C30A 3AG5A 2W2TA 1B8VA 5JDCA 2Y1DA 3TSAA 3MHPA 3F6YA 4R2WA 3H1GA 1JAZA 1U5BA 4W9MC 1MVLA 4BMCA 4N7RA 1PDWA 4GBMA 3RRYA 1RBYA 3ADKA 1O0CA 4NZMA 4L73A 3L01A 2IV3A 1Z2CA 4MJ3A 1WEKA 1YJ8A 5D3MB 4YRKA 4FT2A 4YV2A 5JCPA 5A3RA 1KP3A 5ALOA 4BU1A 1X3LA 3FAKA 3G6KA 3ETJA 2B4RO 4Q3OA 3THXA 1F20A 4LWOA 1IIRA 4PXSA 4UXIA 5D51S 4BLVA 4CR8A 2Q1XA 4GI3A 1EGAA 5EJ7A 3AF6A 4ZQGA 5JH7F 1CFZA 1L5LA 2I9KA 2X4GA 5FV7A 4KQMA 1YVPA 1WXFA 3DQQA 4B48A 3VKWA 1RRCA 2OCXA 3WOVA 1YBAA 2WHEA 3FYUA 4A2WA 5A62A 4JV5B 1E7SA 1GAQA 3NTXA 5LLSA 2WMDA 4TVOA 1MUUA 2RH9B 3UTDA 4B43A 5K8TA 3NAQA 4K9QA 2D13A 4PR0A 4EKEA 2ZYWX 2FV8A 5KC8A 1W1WA 4IVPA 1VLZA 2XOKA 5KCMA 3ROQA 1KRHA 1KYQA 1GLGA 1ZNYA 4WQMA 1DRKA 1T3HA 1Z5OA 1GXSA 3CRW1 4ZVNA 5SY4A 2X8LA 3RWMB 3MOIA 3P1JA 1IN7A 1Y5LA 4PYOA 2Q1TA 3VNAA 2FF5A 5CCEA 5DASA 4KSCA 2NU8A 3CISA 3RKSA 3IQWA 3RFXA 2JC3A 1QYIA 2JI4A 2VP6A 1LVUA 4L75A 3WNZA 3UUWA 1CC1S 1PYGA 1G21B 3ODGA 3WRYA 4K0RA 4LWZA 2GGSA 4E5MA 4TV9A 1EFKA 1BYIA 1U7HA 3VTZA 3EXHA 3OLVA 2BGKA 3B1WA 3C5HA 2PGDA 2C3MA 1NFQA 3AP3A 1IRIA 3QTTA 1BU8A 4Q9DA 3VZRA 3ZY4A 2J08A 1OFGA 3Q8XB 3AESB 2JEYA 1LLDA 1V71A 2HJ9A 3AFMA 4MUMA 2WWXA 1BO6A 4BX3A 2QT0A 3WP0A 1C0LA 4YR7A 4IX9A 3KAQA 4OTZA 1EFDN 1U8XX 3L7BA 4AWXA 4Z2YA 4QL3A 4H15A 4LCJA 4UD2A 3I09A 3EQ6A 4Q93A 5ALQA 2C31A 3AKZA 5E6SA 4IFIA 5IAOA 1DTWB 2BTOA 2GTPA 2P9BA 2BBOA 3COYA 3ASVA 4B79A 4BKUA 3QF4B 1XTRA 2X58A 4G01B 3H65A 1CEEA 2JFYA 3DNFA 4MYDA 5F1YA 1DVRA 1VDMA 3RFCA 3RU2A 4W8GA 3GDFA 2RCYA 4ZARA 2DE0X 3V7FA 1W75A 1GZ4A 1HQCA 3DDNA 1VP3A 3TI9A 5A4DA 3LPDA 3AY3A 3ZGLA 3QF4A 4GDFA 4D2IA 3L1JA 2PKYX 4GLLA 4B4UA 4Z4IA 3A9CA 4TYNA 4GQBA 1SHJA 4BO0A 1EEHA 3OQOA 5LA6F 3A2NA 2IRWA 4P92A 3RHFA 3JZDA 1Z33A 1IEQA 3FCYA 4C4ZA 4ESVA 5EE3A 1YMVA 4ZDKA 1EVEA 2VJQA 3VTFA 5BYBA 2DFNA 1J23A 2OV1A 5D84A 1UT8A 5BRNA 3KOOA 2XKJE 2W37A 3BWYA 2PL3A 2IZ7A 2E85A 4D44A 2B1QA 3AZPA 4JLAA 1FQJA 1KVSA 4QM6A 2Q3FA 2WB4A 3I37X 2EKBA 4HH3C 1XQVA 2QL5A 2I29A 4ZOCA 3VI3B 3DTNA 3QJ5A 4I4CA 5LUAA 3FZNA 1E8NA 3OF3A 2ZB4A 3CLTD 4JJGA 4BLPA 3P2EA 1CUVA 1VL6A 3GFVA 5COAA 1E7WA 4ZOLB 1EJBA 3I3OA 5JASA 5BNWA 1W9MA 1DO2A 2BF4A 1SXJA 4ZT4A 1UEJA 3QE3A 1X1RA 1U1IA 3LUDA 4L4ZA 4WOPA 5DO9A 1YO6A 4BYMA 1DBWA 2YICA 1U5BB 1MMFB 5H1YA 3SN6A 4XAQA 2G9UA 2SCUA 2BGUA 4PGMA 3Q4GA 4LJ5A 5IVIA 2FU5C 1OH6A 3C6QA 4O2BF 5A04A 3GZNB 4C5BA 5DHTA 4HC4A 1EGHA 2ERYA 3H5NA 3OZIA 5FJIA 2PGAA 2QG4A 4HT3B 3A06A 4RVDA 3RU7A 3GFTA 3SJ7A 2F62A 4EZIA 1NNSA 2BFBB 1HYEA 3N3AC 5C46F 3DF9A 3RO7A 5DN6D 2HZ7A 1GPLA 1M2HA 4ZFNA 1UP7A 1ZCFA 3W4KA 1UP6A 5HUHA 3MJEA 1QF7A 3F6EX 1WPGA 3OQHA 1E3MA 1Q3KA 4I0WB 5BQXA 1SO8A 4O4HA 4UUNA 4F2GA 4HUQA 4M86A 2C7PA 5L53A 2F8SA 1NQ5A 4AO6A 1IPEA 1K0UA 1S8AA 4CE6A 2B8TA 2I6QA 3HLTA 1RP1A 2DERA 1KSJA 1XZNA 4H6XA 5GQSA 1QVRA 1LRLA 3AEXA 2W2XA 3E53A 1JEAA 1L5HB 4PS0A 4PGGA 1Z62A 2NP7A 1BXGA 3DT8A 3QUAA 4R16A 1D1QA 3I6BA 4I1VA 1KK3A 1N0VC 2AK3A 2W0MA 1XZBA 4Q7KA 5ALSA 3PBKA 1XDDA 2ZULA 4QEKA 5KTYA 3ZCXA 3BWMA 1OIWA 3GZJA 3BZUA 1C41A 2C5BA 3DJFA 4KXMA 3WKAA 3MCZA 4U7DA 3M5PA 2PEYA 1I8TA 3GRUA 4G6ZA 1J0BA 1JAYA 1PD0A 2HF7A 4OP2A 3O8QB 2MMGA 4XX0B 3HO1A 3FBTA 5FYQA 3MM4A 3WGLA 1OTYA 3I61A 1QDEA 2QQFA 4NEQA 3OPMA 3LWDA 4G2TA 2Q2WA 1O94C 4DBVO 3H1FA 2PWPA 4JLPA 3H5IA 2VK1A 3IHTA 3KFLA 1Z12A 1YHZA 5LYJA 2HR1A 4CDMA 5LA6A 4R0MA 3FHOA 3D8NA 2F43A 2W22A 2ZRMA 1CHNA 1CJCA 1NBOA 2IDZA 4L22A 3CUWA 4IXTA 4BQIA 4KMSA 2DPGA 3FGNA 1FNBA 1QH1B 2BLLA 2OFWA 3T9BA 1F1BA 4IGEA 4RSGA 2I2BA 4MUKA 1H9CA 1XZKA 3HBFA 1X7HA 1E2PA 2NAFA 2HBYA 3AEZA 2W71A 4PO3X 5GWXA 5C35A 3K1ZA 2EKQA 2O5RA 3N0TA 2VHEA 2Z2JA 3FBGA 4OXQA 4TSFA 3AFGA 3FWZA 4AZWA 5KPDA 1RPJA 2VPQA 3F5MA 2AJCA 4R7GA 5M34A 3FAZA 2IYSA 4G41A 4EY5A 3D5QA 3GLVA 3L0OA 3B38A 4FSXA 4RTOA 2D2VA 2C7QA 4FINA 4ZV7A 3DLIA 4K87A 1D2AA 1NA5A 5AFSA 5TY0A 3FRIA 1G5FA 3IUSA 1NSFA 2AMJA 1G41A 4BQRA 4I19A 2R0QC 3CR7A 2OV2A 4WGGA 3KKLA 1ZOOA 3SYMA 3H6GA 3JARB 1H23A 3R0XA 3UWDA 2PH1A 3LGXA 3N9IA 1IY8A 2OM6A 3LVBA 5LVAA 2IEGA 4JUAA 3GVPA 1MPXA 2JIDA 3AUAA 5GM2A 3WLNA 1G17A 2BGGA 1J06A 4PC2A 1CY1A 2PNFA 1YUNA 2C8VA 3MSCA 1BDJA 3NTQA 2BM1A 4CG3A 4LQ4A 1GDDA 2NADA 3NHKA 1K5HA 3SZLA 4A2CA 3L0CA 2NWQA 2EXXA 4Q47A 3ME5A 4N3BA 3CLRC 3EPRA 5BN3A 1ECBA 1YDMA 3TUJC 5L95A 3ERCA 1DT3A 2JCVA 1YHNA 4JXKA 1QQ5A 4M99A 2I3ZA 1E3TA 3TB6A 3ZNOA 2VZ0A 5IAJA 3D7KA 3NTLA 3DBHA 4OV6B 3OPYI 1HRDA 4H3VA 4KI0A 1E4EA 1E3SA 2SCUB 2PVPA 4QU9A 4G1UC 3CXRA 2IPNA 1R6BX 3B3AA 3A1FA 3MIZA 4PX5A 1RU3A 2NLOA 4WV3A 3ROMA 2XKAA 3I0ZA 3ZCQA 3P2MA 1ECGA 4DNXA 2VYVA 3BSYA 3PLRA 1MP0A 1OQAA 4CMIA 1XYVA 1D09A 4GXRA 1GNVA 1TC2A 2OO5C 2YZNA 4NBNA 5TT0A 3PXDA 3TCNA 4C6HA 4ZIRB 3R6DA 3DM9B 2C98A 2OAGA 1VKOA 2R48A 4F3CA 4J07A 5CT9A 3ETLA 3O47A 3P9ZA 4UARA 4DA8A 1S89A 2CVZA 1R6XA 2ZI5A 4HB3A 2EFEB 1GNSA 1RS0A 2HIMA 4A23A 3ZHSA 3IDSA 5BVGB 3TL6A 3O4GA 4CM1A 4MKRA 4KRXA 3D3NA 5AKEA 2YIVX 3VVBA 4WY2A 2X5KO 1C7JA 1YU6A 4PQYA 1QP4A 3A1VA 2IBTA 2X2EA 3LQRA 2XE7A 4I5EA 4V2IA 4YN3A 4YT2A 1CUCA 4JJKA 1Z6PA 2VP2A 4RK1A 3P2KA 1GXSB 1T3GA 3QU7A 4QBTA 1GL9B 2VCHA 1H2HA 3C6XA 3P20A 3T3MB 2I4NA 3KWFA 5AW5A 2WD7A 4UMEA 3K2EA 4O2AB 2ADMA 1J1UA 3UWOA 3GU3A 2VBCA 1B6TA 1ZD2P 3GEIA 4Q3EA 4YJ3A 2JAPA 2Q1SA 3HJUA 3QX8A 2Y0DA 1GFWA 2ZYRA 1C30A 1EXDA 3GGOA 3N0RA 4KFTA 4R3UC 3KPUA 6CHYA 4BQEA 2OAP1 1HSOA 1UPAA 4FFWA 1LU9A 4XDYA 3U16A 1E89A 4L8VA 5HE8A 4OYHA 2ZTHA 1JDPA 1OC2A 2YXDA 4BMVA 4DR2B 2JRCA 6PFKA 4ZGGA 1CE8B 2C9MA 3D2BA 3QBEA 1KXZA 4XQCA 1KY3A 4YCBA 4F38A 3MHTA 4F9TA 1WJGA 1QF6A 1EFPB 3AESA 3OHMA 1KXJA 3KE9A 1Z08A 2WU4A 2VYQA 4NBUA 5ALKA 2ACWA 2V0NA 5LZ8A 4RGBA 521PA 2ZCUA 3A36A 3WL8A 4Q4AA 1S9DA 4QYIA