1RHKA

Crystal structure of the complex of caspase-3 with a phenyl-propyl-ketone inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
140
structure length
140
Chain Sequence
b'DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 46
structure length 140
sequence length 140
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1rhkA00
4NBKA 3R7NA 3R5JA 4I1RA 2DKOA 3H11B 4HQRA 3D6MA 2XZTA 4FDLA 3E4CA 4QU8A 5IAJA 3DEKA 4QUJA 2H4WA 1NMQA 2QL7A 4FXOA 1I51A 2QLFA 2H54A 4JR1A 1RWXA 1IBCA 2CNLA 2C2KA 3PCXA 4NBNA 2CNOA 1GQFA 3H11A 2FUNB 3S8EA 4ZVUA 1QTNA 2J32A 3IBFA 1CVRA 3H0EA 3R6GA 4NOMA 3RJMA 4AW9A 4DCPA 1SC1A 2XYHA 3UO8B 2H48A 1RWNA 4QUAA 2AR9A 3IBCA 1PYOA 1RHUA 5JFTA 4N5DA 4EHKA 4D3YA 3ITNA 2HBZA 1NMEA 3PD0A 4D3XA 3KJFA 3R6LA 4NOJA 4EHAA 4FEAA 4QU9A 1RHQA 2QLBA 5IC6A 2HBYA 3R7BA 4AWBA 4PRZA 1RWWA 4NOLA 1I3OA 3BIJA 4N7JA 5IARA 4AWAA 2CNKA 4IEFB 4PS0A 1RWKA 2H5JA 3NR2A 2CDRA 3QNWA 2Y1LA 3UOAB 2XYPA 2HBQA 1RWOA 2C1EA 4ZVPA 5IBRA 4N6GA 5IAKA 3GJQA 4JQZA 4QU5A 4QUIA 2C2OA 1SC4A 4QUGA 2XZDA 2QLJA 1F9EA 3GJRA 3NS7A 4PRYA 2J31A 1RWMA 4EJFA 4QTYA 4EHHA 1RWVA 3PD1A 2CNNA 2K7ZA 1QDUA 5LUAA 4JJ8A 1M72A 4JB8A 3DEJA 1KMCA 1RWPA 2NN3C 4FGUA 5IAEA 2QL9A 3R5KA 4JR0A 4JJEA 4NBLA 4QU0A 3EDRA 1RHMA 5IC4A 4EHFA 3H1PA 3V3KA 2QL5A 1ICEA 5LUBA 1I4OA 2C2ZA 4NOKA 3S70A 1JXQA 3SIPA 4N6NA 3V55A 3V4LA 1CP3A 2H51A 3D6HA 4ZVOA 4N7MA 1SC3A 1NMSA 1K86A 3KJNA 2HBRA 2H65A 3DEHA 4JJ7A 4EHNA 1SHLA 3V6LA 3R7SA 3H13A 1I4EB 4QUBA 2CJYA 1SHJA 5IABA 1GFWA 1NW9B 1RE1A 2Y0BA 3V6MA 4HQ0A 4ZVQA 2J30A 2CJXA 3P4UA 3P45A 3GJTA 3K7EA 4QUDA 5I9BA 5IANA 4QUHA 5K20A 5IBCA 1RHRA 3OD5A 4HVAA 5IBPA 4ZVTA 5LU9A 4QUEA 4JR2A 4D3ZA 3NKFA 1BMQA 4M9RA 1RHJA 4PS1A 4EHDA 1K88A 4EHLA 4ZVSA 5IAGA 1PAUA 2H5IA 3KJQA 3V4OA 4JQYA 2FQQA 4QULA 3D6FA 3SIRA 5H0IA 4I1PA 4LSZA 4QTXA 5LU8A 4DCOA 2H4YA 3DEIA 5I9TA 1QX3A 2J33A 1RHKA 2C2MA 2FP3A 3GJSA 1F1JA 2XYGA 4ZVRA 4IYRA 4DCJA 2P2CA 3EDQA 4N6OA 2WDPA 5IASA
chains in the Genus database with same CATH superfamily
4IXMA 4JIMA 4I1IA 5FOTA 3V34A 2B82A 5CYGA 4UBIA 2AF3C 5CBPB 3WKAA 2IX3A 4OJKA 4W63A 2AYXA 4AL4A 1FFDA 1KHTA 4LXYA 4RE6A 5KVVA 4RL4A 1IC6A 1U2ZA 1GGHA 2Z9CA 3WOHA 4YR7A 3GMSA 4WASA 5I4IA 3H6KA 1V16B 3T15A 1BEUB 1JX6A 1VLJA 3RTEA 3TSOA 4E4TA 1GTSA 1CE8B 1HE8B 1Q2XA 4BLOA 1GQFA 2OD9A 3PPYA 1TYDE 4JC5A 4RULA 2J32A 4Z3KA 1V7PC 4Y1FA 4HDCA 4C06A 3G2HA 3TVTA 2QQGA 1G3MA 4K88A 5JOQA 1MJGM 2MCFA 1BHQ1 2O0LA 1JIUA 3OWXA 1KPGA 2QI9F 3IOYA 1U3WA 3D6UA 3K0KA 5BQXA 1YC2A 1UP4A 4YRQA 2CXHA 2YJZA 1MJFA 4FBGA 3MUOA 4MA5A 1PNQA 2ZIEA 4I55A 2BHRA 2F3SA 5C7IO 3A9RA 4UNQA 5DNUA 3IUBA 1E60A 1TMOA 4M1TA 1NASA 1MENA 1SPXA 3PHCA 3P27A 1T0PA 2C1EA 4URZR 4YHBA 3RVNA 3ADKA 4KCGA 5CYPA 3Q15C 3SDSA 3L1HA 1AU9A 1ZINA 2CMDA 3N7TA 4KPYA 1QK4A 4NJMA 1SVMA 2XUGA 4E15A 4EPRA 1Z2CA 5KX5F 1NVDA 4LDZA 2B5OA 3WLJA 3QENA 4DMCA 1C30B 1M2VA 1PWZA 2YUTA 3GI1A 3L0OA 3OPQA 4NXNB 3GEIA 2P3QA 5FI5A 1T1RA 3WMFA 2C4MA 4TSRA 2H17A 2LVBA 5B5SA 2N1BA 2QG4A 5AW4A 5JCPA 3Q6MA 4B9AA 2IHNA 5TMDA 2FPLA 3NM5A 2LE0A 3V7NA 1SURA 4B7ZA 3T7TA 1QIEA 2VBFA 3MLBA 4O63O 4V02A 3HO1A 1JDPA 3F0TA 5G02A 2FSGA 8LDHA 2IEGA 3ENWA 1EUDA 3FFWA 2G17A 1ZG3A 2A7QA 2OZPA 3H4IA 4J2HA 3NBUA 4TTVA 3QFHA 2AN5A 4C05A 3N2YA 3RPEA 3TZBA 2WZCA 5LQUA 4A4DA 5AO9A 3EVBA 4WOKA 5LQDA 1CEQA 2FMTA 1ADCA 3QX7A 3D8UA 2Q3BA 1YR2A 5AVKA 5FEUA 2WOJA 3A32A 2WE8A 1G8SA 4OL9A 1PGJA 1RLUA 2ZB7A 3AHGA 4YNBA 1EE9A 5BR4A 1F2TB 1NLZA 2N9UA 3NFRA 3HM2A 3DDNA 2YRFA 4QG3A 5KOJB 4O2AF 3UZUA 4PLYA 5I7RA 1I4WA 5BT9A 3QF4A 5BWNA 4MV9A 1JWLA 2XQJA 1RAAA 3BCUA 1M74A 3CBGA 2HH9A 4BYGA 2OGSA 1ESCA 3DP7A 4M1OA 5L7WA 4L8GA 2JHAA 3RVPA 1IYZA 2QR5A 3ELDA 4WWHA 2IY9A 2ZRKA 4KGXA 5KBYA 5EP3A 5K0SA 2QV7A 4QTXA 4FYIA 1I4DD 1RKBA 1WZUA 2ZVQX 2QLMA 3BFKA 4HY3A 4QWMA 3T7JA 5A62A 4PYLA 5BORA 2JD1A 2V7PA 4PM4A 5BNFA 1UKBA 2HWXA 3U3RA 3GP8A 1Z63A 2P2GA 2OT3B 2VIIA 3ESQA 3GRZA 4P32A 5IP5A 4KFCA 1B6GA 2VPWA 4NU6A 4KC0A 3VV2A 1AY0A 1G3IA 1O6FA 2DWCA 1NDHA 4PFKA 4U1RA 4HNUA 2VDPB 3L46A 4JX9A 2FCRA 5BR7A 5K9ZA 1GU0A 2B35A 3O1JC 5IK2D 4J3JA 1L5MA 3EVTA 5EMHA 3AUYA 3PZRA 5K3AA 2Y1KA 2FR8C 4F91B 3CLTC 1LNQA 3K0FB 4CM7A 5C1OA 1WB6A 2ZRHA 3CZMA 3KEOA 4Q9IA 4NS1A 1BFKA 5CB4B 2NO1A 1MIOB 3GAMA 1SIUA 1N4DA 3FRIA 3MPOA 5IM4F 2CNOA 3BXGA 3UK1A 4UTXA 4BQEA 1NTOA 3ZWYA 3LXUX 5I01A 2AG8A 4FCTA 4J0QA 2GBLC 2H48A 4RELA 1DAMA 1QNLA 2PX3A 3O3OB 7ABPA 5IVHA 2IBSA 4LK3A 2E55A 3AHEA 3AQ4A 4HSEA 1XMSA 3UJPA 4BO2A 2Q50A 4Q21A 1FJHA 1BGXT 1NJ8A 3I58A 4YJ2A 1R0CA 4C0HA 2RBGA 5JSHA 4JQSA 1LDGA 3GA7A 3R44A 2WDZA 3H5NA 3I9V6 5DFAA 2C5LA 4GX5A 3OX3A 1U4NA 3EEBA 4GLFA 4KLCA 1PS0A 1YZVA 5KNCA 2YW2A 1PSZA 1ONOA 2W5UA 3K0AB 2WKRA 5B3JA 3MQ2A 1E6CA 3DUWA 3EGOA 1FMJA 2W42A 5HG0A 1VOTA 6ADHA 2P7IA 4D4HA 3E8XA 2BBWA 1RYYA 1Z7GA 2XRMA 1Q1GA 1V3QE 2ZE6A 3D7NA 2VZ8A 4NFYA 5K6TA 1ESEA 5KNBD 3KYCB 1FDVA 4G8JA 2VF2A 5TR9A 4ED9A 3TW8B 2V7UA 4RANA 3X1MA 2CDCA 2FA9A 2VOEA 1KK0A 4EVSA 5JZVA 1HYEA 2V3CC 1EUCB 4MUKA 2OPBA 1D1SA 3CZCA 3GGOA 1SXQA 4OX9Y 1NXOA 5IAEA 4FMCB 1A7AA 3VHXA 2CE7A 3VNVA 1CEEA 1YVEI 4Y2VA 1QIJA 1A9XB 3MA0A 1W4ZA 1L3CA 4FONA 4NLLA 5DDIP 3RIHA 5DI9A 5LUBA 1KYZA 5C8YB 1PR4A 3CBQA 1ZN2A 2FUKA 3KTFA 2AFHB 1RJ9B 4I8IA 1O58A 4EZEA 1MR3F 1T2CA 4PV7A 1L7NA 2FR0A 1NURA 3HU5A 5JJBA 4CM9A 5A03A 1KSGA 1P2SA 1UBFA 3VVLA 3DDCA 2NNWB 1XDZA 2VQ6A 2YHAA 4Q3AA 5CW2A 2YHUA 1NHWA 1TOAA 2EJWA 3LU1A 3QG1A 3RRZA 1ZUNA 2JBHA 3GJTA 3ZLBA 5FI0B 2NOAA 1HL7A 3W3ZB 1GARA 4GMKA 3V80A 1WDLA 1L5KA 2FY8A 2POQX 1MVOA 4Q34A 1ZU5A 2AFIE 4S2UA 4KO8A 3S7TA 1DX4A 3PITA 2HMTA 1G5HA 2BKEA 4OBEA 3KC2A 4PVCA 4I55F 1KKMA 5HCUA 3KB8A 3TR6A 3NPMA 5KWVA 3JVDA 3A6KA 4PEVA 4ZWNA 4AURA 2V58A 2C4HA 2NP6A 1P1FA 3EAFA 4MW4A 2MYPA 1RP1A 3AZOA 4YV1A 4KVAA 3JQ9A 2JFWA 5LVAA 3DEIA 2R8EA 2XADA 1KJQA 2NPIA 3KL2A 4IZOA 4D4KA 4G0UA 1R4AA 2CVOA 4WKPA 4YXWD 2Q1TA 4LXXA 4KQ1A 3Q0TA 4UQLA 1OI3A 2M9MA 4LDJA 2DQSA 3ELUA 3ZV5A 5K3OA 4HNAB 3SZ3A 3W5UA 2C2XA 3ZLUA 4YB8A 4O6VA 3I6ZA 3LV8A 1WCV1 4KFUA 2DKOA 3EEQA 5KC8A 4OHRA 1HKHA 4JD5A 4FYHA 1UJ6A 4IIJB 5ADVA 2HJGA 2NU9A 4O4LB 1EK5A 1K6IA 2WIAA 3JPYA 3MPUA 3C87A 4IHJB 5BN5B 4RCVA 3VZDA 1PW5A 3T4PA 1NWHA 3O1LA 3CZ5A 1KWGA 1AHHA 1G21E 4LQLA 3RD5A 2O8DA 3JQRA 1E2FA 3QE4A 4PPQA 2ACVA 2WJZB 4B4VA 1X8JA 3FKJA 1IHUA 1XNRB 1JBEA 1GD1O 1Z56C 4C6SA 3OJXA 3O92A 2VAWA 2FEMA 2FWNA 1JI0A 3UF0A 2QT9A 1QV9A 2NG1A 2R7NA 4BZZA 1A2BA 3L1KA 4XWOA 4XR4A 4YUAA 1U7PA 5C8VA 5MN6A 3BEDA 1YI1A 3V1MA 4GP7A 1PR0A 2ID4A 2CUZA 4B3IA 4OXNA 1GDTA 1ZUWA 3UT0A 2QMOA 4BUCA 4YJGB 1MMFB 3CPSA 4FD3A 4N3NA 4A2WA 1T8WA 3AL2A 3L8ZA 3L4KA 2PNFA 3T3EA 4F0JA 1QC5B 3U4GA 1RI3A 2NO9A 5F3DA 3AP1A 1JJIA 1R0WA 4A82A 4ZTZB 5F9HA 2G04A 2MOKA 2LW7A 4H3HB 5LZ5A 3QU2A 1NQUA 3CXRA 3EXEA 1AQLA 4W9RA 3COJA 3ROTA 3P2YA 1KMHB 4EA6A 5K05A 4PZAA 2BFDB 2IBTA 3E70C 3CE9A 1TCVA 3QVTA 4D9FA 721PA 3EZGA 1IHOA 1A96A 5CTJA 3HDYA 4AJOA 5KNDH 3PEUA 3SQNA 1NRWA 3JU3A 2VDWB 4ML3A 4R7GA 2AG1A 3EMVA 2DBYA 1GA4A 1P44A 2XMRA 2O5CA 2QENA 1FQWA 1U0FA 3PV0A 3URMA 3TAXA 4CV2A 2A0UA 2H51A 1P0MA 4BNJA 3CRZA 4NEGA 1QIDA 1Q14A 1SA0A 2UVQA 3HDVA 3MUNA 4MO2A 5ALRA 3RHSA 5DLQC 2AUNA 5EMJA 3ENVA 4JCOA 4B6EA 1QGZA 1JZQA 2FW1A 2ZBFA 3ZJ5A 5BOSA 4HYEA 2PD6A 3VRHA 4CF7A 5EJGA 3GMIA 1HDGO 1GPAA 3UMMA 1IZ9A 4XOUA 3MUEA 4B34A 5JYCA 1D2GA 3HY4A 2ATCA 5I9BA 3OF3A 4RGBA 4ZT4A 3S2YA 4EMSA 3EH1A 3DOEA 4FZVA 4XIFA 4OI0A 3BTOA 1JPJA 2OXIA 2DFPA 2PKRA 4YJ2F 3RROA 4H7PA 1MXFA 2QZZA 1U1FA 1HTBA 1G17A 1DRJA 4E2ZA 1H1TA 1VSTA 4P4SA 2CEAA 4KPUA 4Y98A 1H4SA 2D59A 1JDVA 1QHNA 4WNYA 3ROMA 4LIPD 1TNDA 3MHPA 2XQFA 3TW6A 5LFAA 3DF9A 4LZPA 1ZH2A 4Q01A 1UR5A 1H8HD 4KDCA 3AHCA 1N78A 1X3SA 2QZ4A 1KXJA 3GJ6A 3L8MA 4QL3A 3P94A 2Q9AA 4EX6A 1GAJA 2W2XA 5M29A 1IVNA 1F0PA 1AUVA 2G07A 4O2BF 4CZ2A 2Y1FA 2JGKA 1BU5A 1KMMA 2XUQA 1S1CA 3O2NA 4X61A 1Z33A 3B6EA 3AP2A 2ZTVA 4RGQA 3UJ9A 4GBJA 5AVOA 5MGBA 3O4FA 2P0AA 6Q21A 3LUPA 4WK4B 3TCNA 4DM7A 3HDHA 1S2IA 3IMEA 2BI4A 4FZ5A 2WQ7A 4A8JC 3ZD6A 4CN8A 1FEZA 2BUAA 3TLJA 4QM7A 2XNHA 1JFTA 8AT1A 4QTZA 1BDHA 1NYRA 1YMQA 4QPCA 3L8FA 5HGJA 4CHTA 5FLKA 3BIXA 1RAGA 1T4MA 3AERB 4M0DA 3LUJA 2HRQA 3DB1A 1ZICA 4Q1CA 5D01A 4J3NA 3UK0A 2C7RA 1T9KA 2X5XA 1PS9A 2Q8QA 2VJPA 3SHOA 1VKNA 3WYFA 4KXWA 3PUIA 2CBZA 1A8SA 1EM8B 3CRW1 4KVGA 1X2BA 1EBBA 2CBGA 2EKBA 3JZIA 3Q9NA 4UFNA 3HO6A 2WSLA 1O77A 4LZAA 1H0RA 4UE3S 5TARA 3L9WA 5GTDA 3A58B 3WLIA 4NK5A 2YNMA 2RHOA 2QMZA 5JH7A 1ULSA 4L4UA 1UDAA 5DRYA 4JUBA 4DL9A 1ZY2A 5K6RA 3L0IB 5ED0A 1NDQA 1OAKA 3CE6A 3HCRA 2JRCA 3U1TA 1JJFA 1RWOA 3FVTA 3INGA 4E08A 5L3QB 1KY5A 1A7UA 5ENVA 3KQYA 3WVNA 3DXZA 1N5MA 1MAHA 5FOSA 3PXCX 3OCCA 3CRNA 5AUQA 5HPYB 3OLYA 1Q3HA 1LPAB 3GFFA 3KKNA 4EKGA 3VO8A 4Z4HA 2FEWB 4AG3A 2W4QA 2P75A 3DEJA 2D3TA 1GSHA 4HB2A 2EQBA 2G5CA 1N0HA 4KIFA 3Q8KA 3OCWA 4AB1A 5B7NA 1RZ3A 2O7VA 4AMUA 2GM9A 4G63A 1C3OA 1Y3IA 1KK3A 1JJAA 1U9IC 4IDQA 4KWEA 1JWBB 6ABPA 1JFSA 5E3HA 2ZE5A 4FMDF 1XD2A 2DXIA 3AYXB 4M6WA 5LPNA 3IE1A 1NQ5A 1NMSA 2QN8A 2CEKA 4MJ3A 4AP9A 1HUQA 1SHLA 4LF8B 1FQOA 2QXTA 3LIIA 3I9FA 5D6NA 1C4XA 2VF7A 2YV5A 3P9NA 4WXRA 4DGSA 3B52X 3GNLA 3ZH2A 1LLDA 3AY7A 4LTDA 2GAIA 3OZ7A 3AF6A 1M6EX 2HU5A 1KU6A 1XZ8A 1GAWA 1V1RA 3AV0B 1KFBB 3CF4A 1WW2A 3OFVA 1E18A 3HKDA 3WKCA 3ONEA 3B1XA 4PICA 2IBMA 2R7KA 5FPPA 4CKWB 4M8NE 4D0SA 3SQWA 1R4MA 1IH8A 1E63A 4MHOA 3BGDA 3QG5A 1RTTA 2EHJA 2OFOA 4LC0A 4M8KA 4AT1A 1K88A 4MRAA 1XZKA 3WL3A 5BXQC 4N76A 2B30A 3BBLA 2G72A 3BJMA 1ZJJA 2F1HA 3KHUA 3PI6A 4GKKB 4QT0A 2WSMA 2ZSEA 3RJZA 5EP2A 2Q7OE 1LXCA 1UJCA 1SXJA 2C2MA 4I9UA 4JVMA 3O8OA 2ZZKA 2DBVO 2QMHA 1RVDA 2HMWA 2NPFA 1OX6A 3PKZA 3EPKA 2OOKA 2ZK7A 3QXJA 1Y82A 3TCKA 1M0TA 3DJFA 1YA6A 1GTMA 1ZONA 3A04A 1CR6A 4PZ0A 1WVMA 2R65A 2OHVA 1F0KA 2VPZA 3ORFA 1GPLA 3H16A 3R5JA 3PFNA 4TT3D 3RB8A 4EO4A 1KZ9A 4NZYA 1T6BY 5ALMA 2YV2A 2DEUA 4HK4A 2Q6KA 4M8LA 4RTOA 2WG0A 3TB4A 4WLFA 3WIEA 1M2OA 4OPMA 5C4GB 5H4GA 1S3IA 5EI5A 2ZI6A 3REQA 5KOHA 3RSFA 2CXNA 5FL7D 4DNQA 4F4IA 2HMVA 2HJSA 2ID9A 1Z37A 3HXKA 3LKVA 1P74A 4GPZA 1HRKA 2IYXA 4QJ4A 4QLBA 3VUEA 3HM9A 3G9UA 2WI8A 1IAQA 4F7DA 2ZDQA 4CMHA 2O06A 4J90A 3TSZA 4CM4A 1GPNA 1SVOA 3OQIA 4W9NC 3SYLA 2JFXA 2XXAB 3WGOA 3SSAA 1GLVA 2R3SA 2YYSA 4HWKA 2HLDD 4QQNA 1YFJA 1FTNA 2O2DA 5FA5A 4CL0A 3IIIA 3LNCA 1ZKDA 2PUHA 3BD6A 4XQ9A 4G41A 3MB5A 3AW8A 4LECA 4O2RA 1KDPA 4HQ6A 5DCUA 4B9EA 1GTRA 1XXHA 3KHKA 2ZSHA 4DLWA 2MYTA 1MDFA 1TFUA 2R44A 3F8WA 4ENVA 4RYLA 2R1ZA 1QE5A 4RVCA 1DLJA 5JI3E 1G38A 2RBKA 2VJNA 3FOWA 1PJQA 5HTKA 2GH1A 1OH7A 3EPHA 4EGAA 4IGEA 4EI9A 4F1WA 1ZW6A 5KYGA 3TVDA 3ZUPA 1KQOA 1U8UA 3F96A 4GI3A 4C4PA 3W7BA 4BN4A 2B2NA 4U2EA 1JZTA 1THTA 3DYVA 4YP6A 4F85A 4MS4B 1TGVA 5K0LA 1XK6A 3HU3A 4WX2B 2O0JA 3FAKA 3VQTA 3U4CA 4WDRA 3SZLA 4BV3A 1AKEA 2OVBA 1S4QA 4RO0A 2XHZA 3DUFB 3JWEA 4LJ9A 1RIFA 2R8XA 3SR3A 2VNHA 3SZUA 1MOSA 3KCQA 3HWWA 4WFIA 5HKKD 3WNBA 4PZZA 3OA0A 3C6YA 2XF8A 2XE4A 2VZLA 1CQJB 3BRWA 3HCPA 1TA9A 4BMNA 4ZVVA 1YI8A 5A7GA 2OCBA 3H18A 1PDOA 1JRLA 4H17A 4E2FA 1UF9A 2QN6A 2GXAA 4I6GA 1XZBA 1SHJA 3EG9A 3KYJB 3RRYA 2VJAA 1B43A 4H1WA 1DKRA 1ZA1A 2G67A 3EA4A 3JAWA 3PL5A 4JITA 2SCUB 4KIJA 2Q6VA 1GFSA 3LPCA 4U7HA 1P3Y1 5AOVA 4ETMA 3ZD9A 2Y9PB 3ANLA 3IP8A 4ZVNA 1LLFA 2Z6VA 3C0KA 3QYFA 4NFSA 4BIMA 4E11A 1PV1A 2BR3A 2IH5A 1Z62A 3U80A 4XVCA 1USVA 1IG0A 3OZXA 4KBFA 2QHXA 2XLCA 3LECA 5JH7F 3TOCA 1RXWA 4Q4JA 1CIJA 1O0CA 2EBHX 5FDFA 4IIHA 4CF5A 4V1CA 4CLEA 2V4ZA 1YHNA 3MJVA 3MXTA 5IYZB 2PWPA 4QGFA 1G4AE 1QE3A 1Z4LA 1I01A 1Y6ZA 3A0RB 5IAOA 1NF2A 2IEBA 1EX7A 1HNZB 3PHBE 4EB6A 1U3TA 5J4HA 1BXKA 1KRXA 4MS1A 4FHDA 1KDTA 5CDTA 1I3NA 4DYDA 1JKJB 5HWSA 3ZJYA 2PG3A 4MPTA 3WLFA 2AMVA 3BFPA 4URYR 4W1PA 2OBBA 4EB3A 3N8GA 1PZFA 1Z18A 4BYMA 1K5PA 2AOTA 2CLCX 3QW4B 3V1YA 5D1HA 1GNQA 1FXSA 1N6RA 2K6GA 2JNWA 1VIVA 2XODA 3NDRA 4OAOA 4OUDB 5IULC 3ZDRA 2ZULA 3BHNA 1I51A 4B4WA 2GVNA 3U3OA 2QLFA 1KE2A 3K70C 1RXCA 1OX4B 4MI6A 2C8VA 1HLGA 2Q3EA 1NMYA 2Q5LA 2QG6A 3QQ5A 4QYSA 3TRIA 3GLIA 3C3MA 1ORVA 4P92A 1DTSA 3DFZA 4DRZA 3GLKA 4YCMA 2BDEA 2DHDA 4WAUA 4K9SA 4KMRA 5CDYA 1CYEA 1ZI9A 3LT5A 4LA4A 4YP7A 4B71A 4JVLA 4UU0A 1AF4A 1W49A 1GSOA 1UXJA 1FSZA 3D6JA 5ILGA 4FOOA 1WOYA 3T61A 4GXNA 4ZDIA 2C7OA 1N34B 1LZLA 3S7ZA 3KPUA 2ZROA 1NWCA 3ZVLA 3OMWA 2A92A 1VCHA 3JWHA 4FLMA 4J49A 4HDKB 2YS7A 1Z5PA 1MN6A 1BE8A 1HE3A 5AOCA 2R5WA 3WB1A 3WGKA 2ODWA 4E2XA 5JCJD 5EWMB 4WVFA 5A4KA 3TEMA 2XAAA 4FINA 3L41A 3SP1A 3WWDA 2PUCA 4PGHA 3F67A 2GESA 1S8FA 4BGIA 2ZITA 1ZK0A 1U98A 2J8ZA 2QE7A 5KSWB 4UDXX 4WA7A 5G40A 3TD2A 2P5UA 5KQLA 4WQMA 5CU7A 2FPPA 1KAHA 3L8YA 3QLUA 1WSWA 1VCOA 1WUIS 2PEZA 3GGGA 2BFFB 5TJHA 4AIIA 1U2TA 3I0ZA 2F7SA 2FZWA 4QU0A 3BDIA 1MC1A 5JW6A 3NNSA 1M75A 3FCEA 2CJWB 2WTUA 1DIOB 5DO9A 4EHBA 3SN6A 3ESRA 1DWPA 1OLSA 4JYMA 1V1MA 5E6SA 3U3ZA 3U1BA 1UK7A 5ECDA 3UMBA 1KMIY 2I4RA 4M0KA 4M38A 4ZVOA 3V4LA 2EFEB 5K3DA 4P58A 4X8LA 2GDZA 3R8FA 4YRSA 2PS3A 5AVTA 1HLFA 5ED4A 2ERCA 5I4BA 2PKQO 1PJSA 4PHFA 4RD0A 2R7MA 1NVXQ 3R7LA 2WVAA 4N47A 4B87A 1XL0A 3U7QB 3AUFA 3NBMA 2NU8A 4QC2A 3BULA 2NMVA 2A78A 3DMFA 3FKSD 1VJRA 5LQMA 2H2WA 5M34A 4HWTA 3A1EA 2ZJ0A 4DUPA 2W2KB 3PIRA 4AY6A 4D3FA 2BMEA 1T4CB 3KWLA 2IE0A 1ZGBA 4COOA 4KQFA 1W5FA 1G8PA 3JD0A 5L53A 2HA4A 4LMRA 1MO6A 4YQEA 4BQNA 3KD2A 4B0PA 1S8OA 5JADA 4RYDA 2G9RA 4ID3A 4KHPB 1PG2A 2BP7B 2ACEA 2DTXA 3QBVA 1C14A 3A70A 4N9QA 3D8TA 4IVQA 3L4BC 3RYIA 5BRAA 3JCZA 1IY2A 2J41A 9GPBA 4DV6B 4QREA 4D8WA 5HJ7A 2PX8A 2PA3A 3GDGA 4XCXA 1CY7A 2W43A 1JU4A 2YVKA 3PBKA 5L7TA 3JQGA 2VEOA 3NHSA 3V1KA 4BJ5A 2DAPA 3B36A 3F2IA 3OKPA 3WG9A 1N0IA 1NBHA 2ONCA 4LVUA 2R8OA 4ND8A 3JXEA 1MTZA 1PEDA 2HM7A 2OEPA 2ZREA 1Q0LA 2RHRA 3MS7A 1BDJA 2DU8A 4IDFA 3VZPA 1QORA 2HO5A 1NBWB 4HPJB 5HOQA 1FMLA 3G0DA 1PUIA 5EPUA 5BVHB 4FDLA 2V0GA 4FYJA 4CWAA 4BC1A 1GEGA 1J5EB 3TRDA 2ZRBA 1HURA 5LKAA 4DSUA 3DCYA 4FXOA 3ONNA 3MERA 3I37X 4Q3EA 5I8ZA 1BU8A 2YIVX 3SLGA 3ZE0B 2KW5A 4KV9A 3ND5A 3H11A 1HH4A 1WPXA 2VP5A 5K7SA 4ND7A 5EOVA 1UDBA 3LT0A 4MWDA 5FWYB 2GSWA 2Z6AA 4Z9XA 2NXCA 2QTWB 2V7QD 2JG3A 3D2AA 3H2ZA 4UM9B 1XF1A 3A7DA 3BIFA 5JFTA 3A0UA 1L9KA 2VTEA 1ABEA 5GV7A 3ZU2A 3RTDA 1C4KA 3PXUA 1KTIA 1QYDA 3JW8A 4G5SA 1XROA 3NEAA 2OFWA 1NX9A 2XSZD 3H6GA 1BWPA 2IX9A 3RARA 4W8OA 3UAVA 3QK7A 2OORC 2ZSBA 4AUNA 2FE1A 1GGJA 3OC6A 1Q7GA 3F6EX 2FEXA 3IOEA 4EG5A 2VSOA 3NBYC 3M1IA 2X5KO 1OH6A 3AQIA 1E4YA 4IP0A 2OBYA 4DUGA 5F7JA 2X7XA 4BNDB 5JS8A 1WMSA 4EY4A 3T3GA 2L0XA 4FKZA 3W7AA 1RADA 4L22A 3SR4A 5A5GA 1A77A 3HPRA 4O02B 3RUHA 3K92A 4TVSA 2ZWIA 3O7WA 2EYUA 4NG4A 4BAUA 3LQ2A 2X9LA 5T7BA 4JI7B 1VMIA 2FP4B 4CKCB 3W5IA 3BOSA 1KEEA 1ISHA 1S5PA 3BDAA 4MEJA 2XUFA 3V6LA 4JH0A 4ZARA 1ULBA 3HZRA 4HL6A 2N3ZA 4MKRA 1Q0ZA 3H3FA 3ACBA 4I4IA 2HX1A 3WS7A 3IMKA 1D5CA 4HAZA 2QI9C 1GZSA 4LWOA 3WWPA 2GLTA 4Z0TA 4CTOA 5CD9A 2O0KA 4QFMA 1K7YA 4Z3DA 1JQEA 4GF5A 5JSZA 2R6DA 2X0RA 5DX0A 2FW6A 5IT9A 2XV1A 5LU9A 3TOSA 2EDCA 4EYQA 1X1TA 4NECA 4FLFA 1DJLA 4FHEA 5KYUB 4DUZB 4DLRA 3I92A 3M5CA 4LVOA 1ORWA 1RM4A 2H29A 3HA2A 4XJTA 4MYUA 5CCEA 1WPGA 5J4VA 3DFMA 1EXMA 5EESA 4AZ0A 3D0KA 1W36D 1GRQA 2IP2A 4MWZA 3VH1A 4QE3A 2WNIA 2HA3A 5F7ZA 2C4TA 2QVCA 3Q0EA 3OZTA 1QQ7A 3HJCA 3BB4A 5HJ2A 2JEOA 4ARAA 2C07A 2ANBA 4GXRA 4I36A 5CT5A 3I32A 4HI0E 5GOZA 4AJHA 4CMEC 4LS3A 4C2AA 5DGDA 5H3HA 2XKBA 5L6MB 3N3AC 2NVOA 2MHCA 2X4GA 2CHFA 1IZ0A 1LK0A 1XGKA 2HMYB 2PMBA 3PZBA 4RJIA 5SYAA 1VB3A 3ZX5A 4BMCA 3TG2A 4KN5A 1Q50A 3SYRA 1FW6A 1P6QA 3I23A 1O7JA 1T36B 4GMGA 1Y9AA 3NIGB 3ZGZA 4IV0A 1P8JA 5BT8A 1KZGB 4FHZA 2GETA 1JHAA 2R6JA 1ZNWA 3WIVA 1K2VN 1ZZEA 3OT4A 3RIGA 4MRMB 3CM0A 2OZEA 4JQOA 2SECE 4WK2B 5KNLA 1GKYA 3H2SA 4F84A 5MHTA 3A9SA 1ESZA 4MTCA 4XWKA 5IG2A 1DMRA 3QFTA 1I5OA 3RAGA 3AI2A 1T0JB 3R1IA 3R2JA 4HUJA 3UJ7A 4HCJA 2PFSA 3ORHA 3PICA 4I5FA 4X20B 1ICIA 2QRGA 5K03A 1XTVA 1U3VA 1BEZA 3ZJTA 3K31A 3LKDA 2OXTA 1GCIA 2CXXA 4AG6A 4JIGA 4AJNA 1HLDA 3MMPA 4C0XA 2WHEA 1ISIA 2ZG6A 2KLBA 1QM5A 2JH8A 4O5OA 2PRZA 5JVDB 3ZY2A 3TQFA 4CKBA 3S8YA 1E3JA 1VGQA 2ZAOA 4LQDA 3I34X 3V2GA 5JXJA 1LK5A 3SHWA 3C70A 3G5MA 3ZX4A 4G6ZA 1N3LA 2R25B 3QYJA 1UEJA 4XI9A 4E07A 4Z1OA 1LFAA 1FPMA 1SFRA 1N0VC 1BFUA 4WH0A 1SUCA 3E2MA 2ZJ2A 3A2MA 2NYRA 4EHHA 1TEZA 1A95A 4N0PA 2WV7A 2XH8A 2VEDA 2B2CA 4M1MA 3FDJA 3G2PA 1Y1QA 4WFJA 1OV6A 3UFXA 1TIPA 3OAAD 3UUGA 1N2IA 1V5FA 1LQTA 1SOMA 1DNPA 4G1UC 3ETNA 1VKZA 3IP3A 1RVV1 1N9GA 5KNCD 4IIXA 4IFTA 4C89A 3GVIA 1E2LA 3JZFA 3LHFA 4G8BA 1Z36A 2ZUCA 2DUNA 2C8JA 2ZW9A 3AKDA 5DASA 4D26A 4YJHA 2BMAA 2RI6A 4BJ3A 4P4LA 1H1LB 1TAQA 3HYCA 1BXRA 3B2NA 5T8KC 4QNNA 1CRLA 2E5LB 2Z30A 2F3PA 3IBTA 4HGPA 1RPNA 1OPRA 2W6NA 3KZOA 4PTZA 1VHLA 5EJ8A 4HNHA 1GQQA 3BTUA 3I5YA 3DZHA 2PX4A 3NALA 2WB2A 1ODIA 4LSWA 5KB3A 3T12A 1FRZA 2AC4A 2ORED 1ODCA 3WV5A 4WXMA 3TUJC 4BCBA 4Q5IA 1D7AA 3BMOA 2D4AA 3VPAA 5BQOA 1WD7A 4FIDA 1RRVA 1YRQA 3OD1A 1AK9A 3S1LA 4ARUA 1II0A 3ONDA 4GKVA 3E03A 3VAYA 3M5WA 2W6QA 4CM5A 1DWOA 1VKOA 1P5RA 1J7JA 1YZHA 2BM1A 2P9BA 1TM3E 3AMVA 3Q1KA 4U3JB 4CM9D 2RHCA 4CEJA 1MQAA 3GLHE 4LY9A 1B8OA 1E5DA 3O0TA 5HUHA 1S01A 2QWXA 1J07A 3DKPA 2IXDA 1G8KA 1OR8A 2YIDA 3L01A 4HQNA 2FWPA 4U7GA 4YACA 4QDOA 1WDMA 2KQUA 2XIQA 3CB4A 3FCAA 1T5LA 3K9LA 2JAWA 3Q98A 4LHWA 4OCZA 4MDEA 3RYTC 4YPFA 3P2OA 5B7PA 1U2DC 3PNMA 3VU1A 2IZ5A 4D9BA 5ALIA 3X1JA 5F7XA 2A9OA 1A8HA 2HCRA 2X2FA 3CZPA 3CC8A 4DW8A 4ER5A 2ILVA 4EYSA 4GL2A 1H6DA 1YGPA 1GUYA 1NZDA 2AJ8A 2C59A 3GDFA 4ABYA 4CMJA 5LD2B 4N48A 2EQAA 2WW8A 2ZVPX 1C81A 3BFJA 1C4OA 3BSWA 3GUYA 4V2UA 4Z3OA 9MHTA 3ID6C 3IEKA 4FS3A 5HBRA 4LFBB 1KI9A 1BRMA 2JEZA 2QIPA 1L5WA 1M8GA 2RKWA 1CNFA 3KNZA 3R5HA 4H0CA 3JRWA 1QHYA 4OSOA 3K1TA 3KTAA 4YPVA 1N1EA 4V0QA 2ZT6A 2J09A 5B4TA 4X1IA 5EJ9A 4FDTA 4KGDA 5LQCA 1PNVA 1XELA 2O2HA 1LJUA 1CU1A 3NATA 3A1TA 2ZSFA 4ZV4A 1JR4A 5GZ1A 1Y3CE 4X95A 1BXZA 4D9IA 1Z8FA 3ZHVA 4D6YA 4ERXA 2OZVA 3SICE 3KYDB 5FHQA 1Y5NA 2G5TA 2JH3A 2NV2B 3CVOA 2G06A 4ALKA 1OZFA 4ZXFA 5FOQA 2GEFA 2IYEA 1H94A 5GZ6A 4B6JA 3VKGA 4J0JA 3M3DA 3BB3A 5LZ8A 3T7AA 3ZK9A 3ND7A 3QE9Y 1EJ2A 1IB0A 1WZCA 2NTVA 2X9GA 4BLPA 5F33A 2PXHA 2R5FA 1QGED 2LKCA 4BJ6A 4E12A 2D5LA 4HXYA 1OZAA 2GWHA 4Z8YA 1KETA 4ZVPA 3IE2A 2X0DA 1EFAA 4P7GA 3G17A 5ICFA 1VI5A 2GZSA 5E0KB 3THYB 1WB4A 2C1XA 5JZMA 2WUGA 4JEUA 4NI5A 2MT9A 4OGGA 1NNLA 4DUYB 1BYIA 1SUFA 1JG1A 1HDZA 4FFVA 5AJVB 1U3DA 4P8RA 4KR6A 3NKLA 3WL6A 1U3UA 3GJ7A 1A0OA 3PPVA 1XXLA 1RWPA 3BE4A 3KQLA 2FG6C 4JR0A 3OO0A 4CCYB 3DHVA 4R3NA 2HJRA 5CD1A 2R8YA 2RHHA 4TL6A 4ZQIA 5FBQB 1A9ZA 3NU1A 1JSXA 4ZYLA 3IEMA 3GJ0A 3GOHA 4QTTB 5K8VA 5LWQA 4KLNA 2FB9A 4PPYA 3SEQA 3OZSA 4BECA 4E4RA 4RDXA 1N36B 2FN9A 1E1NA 1W5TA 4EJSB 1Z5ZA 1YMVA 5JS7A 1W36C 1MOQA 3W5JA 4BU0A 1ZN8A 2HSJA 1SHUX 1CBUA 2DSNA 3IA7A 4O3FA 1FUEA 3EULA 1TM2A 3TMKA 2COKA 5KO2A 3CUWA 5FOVA 3RWBA 3M4XA 4FMBB 3UK6A 2AJLI 1YJBA 5C18A 2QTNA 1XJ5A 4TVBA 2JBAA 4BMXA 3FTEA 3AI7A 4W8HA 4JL8A 3FPGA 2JCXA 1RKUA 5JE8A 4XR9A 2Z5LA 3PUYA 2DBZA 2OM2A 3B60A 1EX1A 2FQ1A 1UZAA 2GFQA 1SOWA 2AB0A 4HXEB 5YASA 2A5LA 4FOTA 4ZREA 1OWNA 3DEYX 2GT1A 2FRVA 2SICE 1MW8X 3R74A 4P36A 4F06A 2WAMA 3VTZA 2NZXA 3IP5A 1FDRA 3VNQA 3AEKA 3GGJA 3HJUA 2BH9A 2FZ4A 3OLXA 3OZIA 3BH0A 3FNRA 2GXSA 3NH9A 1U80A 1NG9A 4KR7A 1YZFA 3RI3A 2I2XB 5ITZA 4DM4A 2IDJA 1IWBB 3P2KA 1YQXA 1KZ4A 3V8RA 1QFSA 5DHSA 1OFHA 2Z08A 4RA6A 5FBWB 3DG9A 1ZM2A 2REQB 1TYEB 3F8TA 4DG8A 3GWZA 3T5PA 1C7IA 3RIMA 2HWUA 1TVMA 5FYDA 1XMIA 5DHRA 2M6KA 4X1KA 4PN7A 2VJLA 1UH5A 3OOJA 4BV8A 2G40A 5GV8A 3FLBA 3UB2A 2JLYA 3P19A 1TAHA 3ZWXA 3RLIA 4AF8A 3G9ZA 1N5RA 1Y1PA 2RGAA 4UD2A 3NI2A 2ISCA 2X23A 2XJ9A 4M49A 4D0LB 4PIVA 4FT2A 3ABSB 2GILA 3JQ8B 4MKIA 3UWMA 2XCTB 2EW2A 3U37A 1RPJA 3R3YA 2CJFA 3I0NA 5IJ9B 4QJ3A 1ZVQA 1ZS9A 2CB9A 1P31A 5DTMA 2ZB3A 3T3IA 5JC1A 4LJ8A 3ZCXA 4HMPA 1BKSB 1CYDA 1SELA 2R1VB 3JS5A 3DR3A 1WB9A 5LLSA 5B3JC 2XMCA 3H8JA 5I9LA 1MABA 2MYUA 3H0KA 1VLVA 4LHVA 2E5WA 4IH9A 5EXDA 3EX7C 2Q3DA 5JXHA 1ELOA 1Q0RA 4MV6A 5EXPA 4CTJA 5KTPA 2QR3A 3ZPXA 4DV7B 2AOXA 5F98A 2O0MA 1P1JA 1US8A 2HSGA 5K0TA 3DYBA 4ETWA 4XJSA 2R1UA 3TL3A 4OEHA 4UPDA 1ZUIA 4JBWA 1GVNB 1HY3A 2HA2A 2NU7B 3VUFA 4J91A 4PWYA 1KMCA 4PAOA 5E6UB 2D2FA 2RKOA 4OHXA 2YNMD 3SBXA 1MU0A 5AKLA 3CF4G 3CX4A 3OCUA 2QYTA 1X86B 2FMHA 3BVPA 3H9BA 4YP1A 3QY9A 4FUQA 3SCZA 1G20E 1Y6JA 3G8YA 4JU9A 3T1VA 1FDIA 1JQJC 2HTEA 3C3CA 3RDPA 1ENZA 1XLTC 1ZD2P 4WBXC 3TRJA 3NKVA 2BGLA 5DP2A 3R7SA 5JT1A 2YXLA 1J23A 1IFXA 3FIUA 1Q77A 1ZMTA 2JGAA 1XLUA 1CB7A 3B6IA 1T3SA 5AHXA 3V5NA 1W35A 2ROQA 2QRKA 3BXEA 3NUZA 4J0DA 4PLHA 4RM3A 5DCWA 5HKAA 4GXQA 1FK8A 3MMSA 2BLLA 3NWJA 3A31A 1TQ6A 1UFRA 4H6VA 4S1PA 3EXHC 2C9BA 1GGFA 2NT3A 3R77A 4KLZA 1KJWA 4OK5A 3B6ZA 4UPVA 5TGDA 3WK7A 1LPMA 5B2EA 4PTLA 4BVGA 1F8XA 1B41A 3KJQA 3MB8A 2HO4A 2O52A 1YB7A 2PZLA 3W5VA 5CA0B 4QEKA 3SJCA 4PCAA 5DCLA 4HDNA 1C8VB 4F56A 1H5QA 5FV7A 4X1YA 2ZUSA 4HX5A 4YLYA 1XRJA 4QODA 1II8A 3FVRA 2V8OA 5EHIA 4A6PA 1F8YA 4EIWA 2P5YA 3QEBZ 4WZAE 2R4QA 3LCUA 4DR4B 3O84A 3MG9A 4P3XA 1LU9A 1MQSA 1ULHA 1HTTA 2OV8A 3K8OE 1RM0A 4J7XA 1KIFA 4DJTA 1LF0A 1TW3A 4M9SA 4ZDWA 1LKZA 5AI4A 3T7RA 1GRVA 3ZU5A 1AKYA 3DQPA 1IOLA 3PUWA 4R2KA 3AFOA 3FPHA 4P5PA 4S1VA 5FUYA 4LX8A 5J23A 1JKIA 2OWEA 1IY1A 2R6GA 4IIFA 4NV0A 1KOLA 1B00A 2AZXA 4TRRA 3ZLVA 1ZNYA 1QH8A 1M76A 4B35A 1BAPA 2H92A 4TYPA 3WKEA 3OJEA 3DKKA 4BEJA 5ALEA 4TL9A 1SXJD 3G0HA 2FMUA 1AVTA 3VJKA 3DKRA 4M9QA 4BQFA 2YHBA 1WQ1R 4GP9A 4RU1A 1BS1A 1BVYF 2FUNB 5K45A 5CBKA 5BN4A 2VJMB 1A8UA 1SIOA 4LC9A 4OXQA 3QX3A 1IBRA 4I55B 2B36A 4NU0A 3NJ4A 4OQFA 2H1CA 3VTFA 1Q6ZA 4XGNA 3ZVRA 3H1FA 1J8YF 1MEJA 1K2WA 3SS9X 1ACMA 1IXRC 3NVMB 2ZIVB 4ZOCA 1NOIA 3W04A 4IIEA 4A73A 2XRZA 2AEJA 4KH1A 3BL6A 3WIOA 5A9RA 2GK4A 2WJHA 4GPIB 5BWCA 5IJZA 5A71A 5C8ZA 4OHMA 1DAGA 4CIDA 3G1UA 3JYNA 2IPNA 2VKQA 3HCEA 3ICWA 1K66A 1TKAA 3EEOA 2JANA 1XF9A 4MIEA 3W7VA 1R27A 3ENNA 2GZDA 1YE3A 1ZC3A 2IVFA 2OCIA 4HT3B 2VHCA 1M1YA 1CRQA 3DL0A 3T3PB 4CKYA 1T9ZA 1FP4B 2IKSA 3ZWKA 1I6KA 1HDCA 3ESCA 3WXBA 2OXFA 1QDUA 1ISJA 2XGGA 2JRLA 4G1EB 5J4KA 3AZQA 2E48A 4JI8B 3AJ8A 3DBLA 1EUDB 2ODNA 3HEBA 4IVRA 4P4TA 1W36B 4BX0A 3DTNA 4F86A 3UIEA 4F3CA 4WGGA 1XJWA 4CTNA 4MV7A 3CX8A 4R69A 4UNPA 1SC3A 2RGGA 4X9XA 2JJQA 5ELMA 4UOEA 2VXCA 2W2NA 3PA8A 1JJ7A 1KSJA 1MGOA 4GU5A 4ZAVA 3S0JA 4BEWA 4CIYA 3B1VA 3QVWA 1XU7A 3K1AA 3VZCA 2O14A 3HB4X 1BA2A 1KEVA 4L4RA 3QF4B 4YRBA 2VHXA 2C54A 4P7JA 2J30A 3G7SA 4DIDA 5IDQA 5BSFA 3FYTA 3OOEA 1DIHA 2IZ6A 3QXCA 1IK6A 4P4UA 1RXUA 4TTPA 3PXAA 1KO8A 2WWVD 4DLBA 4CF3A 2NV0A 3HCDA 2OCXA 2LDXA 5EWJA 2WFMA 5DGXA 4PANA 3USES 4AJEA 3P71T 1GY8A 4J1SA 2B0JA 1IONA 3AFIA 4RC9A 4YQYA 1ZMOA 4L0MA 1VHQA 2FEPA 4BB5A 4LZJA 4PHCA 5A6SB 1E6UA 2XMSA 4MW2A 2ZE8A 4NHEA 5C5EA 4YH1A 4BMZA 1X7ZB 4MNTA 2FZGA 2IHVA 3R8CA 2VQEB 3R3UA 1JVBA 1CTQA 1SUSA 3NJRA 4GBGA 4Y7CA 3AHHA 4FKBA 3UCEA 4ZVRA 3VDRA 4S1TA 3WLKX 4ZMRA 1X3LA 2ZRCA 3LQ4A 3AR3A 5BOVA 1V45E 4OQEA 1REQA 4MLPA 3FFAA 4BB9A 4D98A 4R3UC 5I3ZA 4PG4A 2JJ1D 3GRFA 1F38A 4NMMA 4BO0A 2YY5A 4DQVA 4HKTA 2ZTMA 1M0EA 3KIPA 2VRNA 1MP0A 4QOSA 3VMFA 3WQQA 3OUTA 2Z3VA 2AQKA 1O8BA 2HPHA 1DAEA 1FBTA 3DL7A 3NAGA 1V4NA 4XIIA 5EYPB 2P91A 4R8VA 2R0QC 4ZODA 1ZJ6A 5REQA 5FT9A 2G3YA 4C3UA 3DEZA 4RHTA 3LW8A 3ZCUA 1JZSA 1RC1A 1T2AA 4LNAA 4NV1A 1GUBA 1CUBA 3WQHA 5JAIA 1L1QA 3IUEA 2JD2A 4HN9A 4ROTA 3COWA 3Q9UA 1RHUA 4HLQB 3V9PA 1LDEA 4EG7A 4DNXA 3OURA 1QRSA 4R9UC 4EHAA 1XI2A 2YNMC 3EH2A 1SCUA 3L2OB 2HSZA 3RVMA 4C0LA 5BW4A 4OK6A 1HETA 3GP5A 3FD8A 3KUXA 5AKXA 1E0SA 4ZU3A 4D74A 5JAOA 4BDSA 1AKTA 4WOCA 2UYCA 4IEFB 1ETHA 3FFXA 1ZJ4A 3AVTA 3QVOA 1DZ3A 5ER9A 1JEJA 3OMLA 4GEKA 3UYLA 1VJTA 1YWGO 4IBOA 4FFBA 3D8NA 3H2HA 3Q7RA 4JNCA 3VHXB 2FAXA 5L4LA 2GK3A 3QUTA 3R5FA 4XDZA 4ZVKA 3EZ2A 3ZDQA 3X2EA 3QI2A 1QG6A 3DULA 4HH4A 3KLMX 4CKEA 4B3HA 1CXZA 2GCEA 2XYVA 2VF8A 3DOOA 4P2BA 4RD1A 4RADA 2VVTA 3S2IA 1X94A 1GEEA 2C97A 2NUBA 3TNDA 5IKXA 2PPVA 1R6DA 3IEPA 5C0OE 5LMZA 3NIWA 3HN7A 4OQXA 5SY6A 4PAWA 4OQYA 4GGMX 5ARDA 3FI0A 3V3KA 2ODQA 2H7VA 4OAPA 3IP7A 2LGJA 5F35A 1TJ3A 3IKMB 2KX7A 3DE2X 2A9QA 1OFVA 4X3OA 1P9LA 4D4GA 1PU2A 5C4IA 4PYRA 2Z09A 2XT6A 4ZI2A 4EJMA 2HA5A 2YQ5A 3FOZA 1E6KA 1MAWA 1OWOA 1TCUA 1ZFNA 2EKLA 2QE7D 3I2HA 4GECA 3OCJA 4Y6GB 2NUTA 4CBVA 3KAQA 5IT5A 1PVDA 1UOQA 2QZ9A 2LCIA 1ZRMA 1NUAA 2ADOA 4BNHA 1SU4A 1M2JA 4MB0A 1OY1A 2RGUA 2IDKA 4Q3KA 4CIAA 1CRZA 3WB9A 4BFZA 1DIAA 1YZYA 1SC9A 4URFA 3GGPA 3DVSX 1JECA 3CPHA 4CN9A 3RHTA 2DMRA 4PG8A 3JALA 3VZSA 3ETCA 1F5NA 3PUHA 3A28A 5D5HA 4JLVA 5HXAA 2D5BA 4IZIA 1TI7A 2WHRA 1SXJC 4JYPA 2Q3JA 4QYWA 2N47A 4I5EA 1XZLA 3OI7A 3RTGA 3NYQA 1YCHA 4X45A 2FZKA 1GZUA 2FFJA 2GSDA 1PJ3A 1LSSA 1X7GA 4CMCA 3VR3A 3R4CA 1KJ9A 1XEAA 3R9XB 2PZAA 4JA0A 2NU9B 5DBEX 2AZMA 2PKEA 1J42A 2QD2A 3U9LA 1JL3A 4R8SA 5DNWA 5E3IA 2QUKA 4IAOA 2J48A 2YHIA 4U2FA 3PF8A 2ZM6B 2O8DB 3HKEA 4DDVA 1AXRA 3RTAA 2PNJA 9ATCA 1NYLA 4NONA 3K9CA 4I1YA 3UHAA 1J1UA 4TXNA 2HHJA 3NCHA 2XDQA 5EGNA 2QYHA 2RAUA 2GYUA 4L28A 2I4MA 5AVZA 2VS1A 3SE0A 1ZA2A 3OX1A 1G8AA 4TWRA 5D51S 521PA 3PQ8A 5AM4A 3RJMA 1M66A 1T8TA 2GD1O 5EFOA 3ILSA 4QBIA 4V24A 4RS4A 4ARIA 2PZJA 1JB9A 2AYZA 1TLLA 3KQPA 4LMPA 3TAHA 1DJMA 1OF1A 2O2CA 4DB2A 1VCNA 3PWTA 3HVHA 4QU9A 3FH0A 2IUEA 1XVVA 1DBPA 3RNLA 2PVPA 5BNZA 1SHTX 4RF2A 3AU9A 3MWEA 4QUKA 4Z4FA 3DT8A 4L16A 1YR8A 4RXUA 2Y1LA 2P4QA 1RCFA 5IBRA 2QD1A 5HK9A 1H93A 4QUIA 2Q4RA 5AVQA 3E9YA 2VNKA 3RT9A 2FX5A 3GJRA 4ZIRA 3D8BA 3E27A 1E1CA 3E9RA 1JG6A 4KRGA 1JG2A 3UATA 4I4TF 1NAIA 5CVEA 1Z6ZA 2EKDA 3ANNA 1WHTB 4L5JA 5AW5A 1NYQA 4KBGA 3RASA 4BVHA 2QVXX 1SA0B 2ZS8A 1L8XA 1C8BA 1O5OA 1PYGA 2RHGB 2VOJA 2ZKIA 3IQHX 3MINB 2XTZA 2J0SA 1EQUA 5BY2A 4NNOA 1ZD9A 5BOSB 4ZALA 2GD2A 1UKZA 1XPJA 2AFHE 1ICEA 2QJTA 1U94A 2CBXA 2WJYA 2Z4SA 4RNCA 4QYIA 4KE8A 4Z9BA 1LZKA 4U2CA 5LQAA 1PG0A 1RRGA 1KZHA 1LI5A 1BNCA 1L4YA 1W88B 3EIUA 4ZI7F 1P4HA 1E1KA 4KE6A 5CB6A 1X7XA 4R2WA 1KFCB 5A3SA 3WQRA 2WMDA 3NTRA 4GYWA 1GQOA 1QVAA 4DUGD 5JRZA 5KWSA 2WAAA 1JPVA 2WHPA 4GOXA 4N3AA 3V2UA 1MV8A 4BLUA 4RAQA 2XYRA 1S3SA 3M83A 1XMXA 3IVGA 2PWYA 1VI6A 2FW9A 2Y66A 4KPUB 4KMOA 4QUDA 4RHCA 5AJHA 2R4TA 3WMRA 5KREA 1VYTA 4NESA 5EY5B 4Q7MB 4BWFB 4WBNA 1KARA 1Y8RB 2B3DA 2C7BA 3K6RA 3ND8A 5ECWA 4K9NA 4LOKA 1V95A 3DWIA 3IEUA 5FR1A 1E2PA 1MVNA 4UASA 4UD6A 2Y1EA 1LJLA 2PVSA 3PQ4A 4PONA 1Y6QA 1Z15A 5BW6B 3QX9A 1ADJA 2QGFA 1W6RA 4EM6A 1YKGA 3NP9A 1BA3A 2AMLA 1YS7A 2BVNA 5EIHA 2W0SA 3X1WA 4CTMA 2Q2WA 1CD5A 4KACA 3HABA 2BGIA 1YRLA 3FVQA 4FDUA 3OZEA 4IIGA 3F6PA 4WEOA 3W2GA 2PZMA 4Y3UA 4KMMA 2F59A 1BMTA 1FTQA 2GCOA 2VT6A 3ZCVA 5T6MA 2QOEA 4DDTA 2FZLA 3LRTA 3W5BA 5EAIA 3HR4A 2ZJAA 3K16A 1F6DA 2A5DA 4Y67A 2EDAA 4XTCS 1D2MA 4CFYA 1GKUB 4ZCPA 2J67A 4X7BA 4CCWA 3D3EA 3DOHA 1SIBE 5LQSA 2G80A 3LZCA 1GKKA 3SM3A 1WXQA 4AZSA 3FUVA 3ZXSA 4G0XA 1PKEA 2NZJA 2GAFA 2HNKA 4OHPA 1BVRA 4IFEA 5U4QA 1PFGA 2JLWA 1XDWA 5LB2A 3B53X 1PF7E 2JCVA 4W5TA 4LRUA 1R6XA 2H5EA 3ICOA 1P5ZB 4CDGA 4F11A 1Z0UA 4NX2A 1LQUA 1KVRA 1SG9A 4EECA 2B4RO 1KOJA 1JE1A 2ZSUA 1GNRA 5JH7B 4BFSA 3OG9A 3MFYA 3DFFA 1S2MA 2NXEA 4OLJA 1RQNA 1XL1A 3H19A 2BLNA 5JS2A 1PHRA 2I4IA 1WEKA 4CM3A 3CVWA 1DUIA 3DR5A 4UZFA 3WK8A 3WMGA 3ZCPA 3R7BA 1DO0A 1FBNA 2HBYA 3K3PA 3UNXA 4BNUA 3QUCA 3CGGA 4GR9A 5H02A 2XUAA 3R9IA 4JZKA 5CT9A 5HE8A 3U17A 3UMSA 4Z4QA 4AQDA 3RWOA 3HK2A 3KFLA 5F51A 4JSTA 1W4BA 1J99A 3B5IA 1UKAA 3JYPA 1ANKA 4XW2A 1MGPA 3SI7A 1JFFA 1ZGAA 2BELA 3L5OA 4L6IA 5D2CA 4B6PA 5A5VA 2MSWA 3PQEA 2WSSD 4R8KA 5B36A 1HX7A 4MCIA 3IPLA 1E2UA 3SC2B 2G70A 1DQRA 4CLOA 1JHMA 1I9GA 2ONZA 3QLUC 4B8YA 3F90A 4B75A 2PMFA 1PKXA 3SNHA 5D85A 4ZKDA 1E92A 1XD2B 2IPLA 4YRLA 5EVCA 3RS2A 2JHFA 3IDQA 3NAQA 2JI9A 2YOFA 4N5LA 4O1MA 4L4SA 5ALKA 5T41A 2AUTA 1YIOA 2BGWA 3GX1A 4OBBA 2XUPA 4XVHA 2CL0X 3GB9A 3AY6A 3W9SA 2HMUA 3H5TA 3M81A 3EMDA 3IUPA 2XOKA 5JQGA 3CR7A 5F5LA 3HMKA 3UJHA 1DO8A 1E3DA 5WRFA 3RTCA 1V1RB 4YAFA 1UPTA 1O95A 2P1DA 2YJ3A 3HLKA 1M34B 2X1VA 3D3WA 3HKDB 3M2TA 4Q1AA 1L5LA 1QYCA 4BFVA 5BNWA 2Q29A 2ZS7A 1N2HA 4R51A 1R4MB 3ZOZA 4TWBA 1AGPA 1TU0A 2VXBA 3MCVA 2VHWA 3WRYA 1TPZA 4HVTA 1GUZA 2QD5A 3P20A 3GP3A 3TQCA 2YRXA 3HNPA 3K1YA 2ASEA 1IN7A 2PWBA 1BMDA 3H2YA 4B4DA 3LTNC 2BFAA 2P62A 1NOKA 3HEAA 3IO3A 3QVJA 4UHFA 3BFVA 5FP0A 3EZFA 2WILA 3U4AA 4A2QA 2DQYA 2PRKA 4Q7KA 2CK3A 1K8YB 3OIFA 5JSKA 2Q3MA 2IPMA 1NVMB 1QP8A 2IUYA 3LQYA 1SUDA 3NKFA 4PS1A 4BNYA 1ADGA 2HQRA 3GELA 3IUYA 1M10A 3O8OB 4ZOLA 3UBMA 3AVXA 1MXHA 1VLLA 4YO8A 1G16A 2IF2A 2VP0A 4P80A 2RAFA 5IS2A 5FORA 3HS3A 1X7HA 4I1PA 3PLNA 5DGIA 3MTBA 1UBJS 1SQ5A 3DZGA 2W00A 3H0CA 3Q3JB 5A4AA 2FN4A 1H3EA 4IQ0A 4B8ZA 2J6BA 2V03A 1RHKA 3N58A 4R4JA 2XCQA 1V1JA 2QTMA 4TM7A 2OD7A 2JKVA 1QR6A 2OO7A 4L4ZA 1FLDA 4YLGA 3UTCA 1N32B 3P9QA 2YINC 4KP7A 5BXYA 3NANA 3REQB 2WWIA 1K3UB 4KFRA 4OIMA 5ILOA 3QPDA 2IQIA 2VPQA 3NDIA 1FNBA 5H70A 1NF9A 1XZEA 3KYBA 4MLDA 2FG5A 3E4CA 3KHSA 2EJVA 3F4KA 3L07A 5AH0A 1JHVA 4ZQCB 4CM4B 4Z49A 5JZSA 2P9EA 2B5WA 1EWTA 1RCTE 2KPOA 3BK7A 3N0XA 1PDVA 4MQMA 4P0TA 3COPA 3ZE2B 5A4FS 2VDJA 4F3TA 4AKSA 1M7HA 3MMXA 4PG6A 4PRLA 1SNYA 4S1NA 3PI7A 2C9OA 3VPCA 3FNQA 3GFSA 3DZDA 4BKMA 5KYKA 1QWOA 3ADOA 3UO8B 1WXIA 4XX1A 4WLNA 3CLRD 5AKHA 3UHJA 1G4UR 3FCSB 4PPFA 1F4PA 1MV5A 5HE9A 1U4OA 2HSWA 1LV8A 3I5UA 4WBNF 3L3BA 4QAJA 4OKNA 2GVDC 2K5UA 4PRKA 1AN9A 4TMXA 3TPFA 3JY6A 2O2SA 4QBGB 1XDGA 2WUFA 4W7HA 1MO3A 1NVKA 2JBWA 4UMEA 1AE1A 4PG7A 4N6GA 4IIDA 4PC2A 4QPPA 2JGFA 1EDZA 3RR2A 4G8CA 4MKXA 4XYEA 3M0EA 1E3EA 1N2JA 5A7FA 3I6QA 2ONYA 1SK9A 1ATZA 5TQ0A 3BXZA 1A5SB 1UZLA 2Q49A 1V9CA 2PV7A 2NYUA 5L40A 2PX5A 5FPSA 1WKVA 4MA4A 3ZYCA 5IWCA 2ZJ6A 4Y9SA 2MJLA 1RKVA 3FCOA 3NC0C 2D7JA 2IW3A 1FXWA 4LDQA 1IBKB 1NN1A 3PLRA 3SBEA 1YZQA 3N0WA 3IAEA 2BGMA 1LBQA 3DKVA 2WYHA 3OY2A 2GA9A 2I7CA 3DCNA 1H6CA 4AJ4A 2IWRA 3OHMA 4EG6A 1SQGA 1ZGZA 2IGTA 2VPIA 4IGFA 2FFHA 5IUKC 1E98A 2QTAA 3I64A 4LKOA 4X91A 3RVLA 1KIMA 5KJ6A 4D42A 5A7HA 4EFMA 3IT0A 4Q6BA 1KYQA 3BQ9A 3BXFA 4XGKA 3TS1A 2QP4A 1ZXXA 1M2HA 4Q4JB 2J9RA 4DQXA 4PZLA 4V1CB 4ZJZA 3DE4X 2IP1A 4E2YA 3FWPA 4KLAA 3GFBA 5D3MA 2OQVA 3WP1B 2WPDA 3UJ6A 3JYOA 4DARA 1NY5A 2JH9A 1JG7A 1ZHOA 1GNVA 4FYWA 5A0TA 3IGFA 1TF2A 1ZIOA 2AC2A 3C4QA 2EZUA 2O8NA 4L2IB 3GLVA 1J0CA 1UC5B 2O8VA 2J0VA 2VBCA 1RMTA 3K8ZA 3QEOA 2FFAA 5G0SA 5KTSA 1NXWA 1AB5A 1FUKA 1T2DA 4MS1B 3HJBA 2PGJA 3VISA 4EH1A 1TEXA 1W19A 4REMA 3EW7A 3ZQUA 2C3OA 1Y8CA 4MV5A 1UC9A 1W5BA 2AOTB 4JEMA 1BS2A 2J9XB 2ONKA 3PVSA 5EA2A 3HVRA 3I5AA 4ZN6A 5E1MA 2I1WA 3A1WA 3L04A 1T3HA 1QP7A 3VKUA 4TS3A 5LB4A 1XPOA 3KSZO 1XJ0A 1RS0A 1JIKA 5ALSA 4TT8A 3TZQA 3GYGA 3GLIB 4ZTBA 1DTWA 1J1ZA 4OL0A 3NHUA 5BWBA 1R0ZA 2UXBB 1VFPA 4DA4A 3CEJA 4YRDA 4E33A 4EABA 1MOPA 2BFBA 5JQGF 3CH4B 5LBUA 4DBZA 2PGXA 3AM3A 3C74A 3R3VA 4R6WA 4GOKA 3ZTTA 3YASA 4WMLA 5ICEA 4YJ3A 2JS7A 2NLOA 3CN7A 1YB1A 2R6HA 5E7JA 1P19A 1X74A 3T9FA 3M8KA 1PRYA 3A7EA 4I3FA 4R7TA 3FCCA 2VRBA 4DZTA 3SEAA 2Y92A 4IVPA 2EC5A 2RIRA 3ZZMA 4FEEA 1QQ6A 3ESAA 4Z4GA 1YA8A 4LRSB 4UBKA 5D5QA 4MI9A 1KERA 4KO2S 5F12A 2QNRA 2D5IA 3PDJA 4DG9A 3N1UA 1NVFA 2OVFA 4IRUB 5JAPA 4GD3Q 1S8NA 1JNYA 3ROPA 3PENA 1C0PA 2H1LA 3ZKWA 5BWLA 2G1PA 1QHGA 4YWJA 1XA0A 3AVUA 1XWFA 2HLHA 2FPPB 1RYEA 5HKLA 3BH6A 1UAGA 2Q4OA 2IXTA 2V7WA 4LZNA 1GTZA 1DHTA 4LV8B 4L1KA 1QP0A 4I7EA 1U9JA 5E4FA 3B82A 1P1RA 1KJYA 5KDDA 3A4NA 2BFMA 2O50A 2QTFA 1A8PA 2J31A 4E2WA 2O07A 4WK0B 4OREX 1V1MB 1KSHA 1CQWA 1Q2UA 1G1AA 2ZYDA 3DPUA 4TMTA 4QG7A 1J0XO 1FP6A 2YJTD 2DR0A 2QLLA 4UBOA 4DLLA 5K0EA 5JFOA 1CLEA 3DAPA 4BB0A 3RV4A 2OQIA 1SUIA 5FBVB 3ZS8A 2YXNA 1VJ1A 1ORTA 1W9MA 1GPJA 2D74A 2CB0A 3NRJA 3OT1B 2YWDA 1SBZA 4LNHA 4QGBA 3IXMA 4MQEA 4LSGA 2FUCA 2GZHA 2P6PA 2PEYA 5AKZA 3EWAA 3IE0A 2HNAA 4Q7EA 2NU8B 3VKWA 1SPBS 4H0FA 5CDSA 5AHRA 5EC8A 2P9JA 2QW8A 4KR0A 5IT4A 2HBRA 3QP9A 5FA8A 4V39A 2ZCUA 3VBEA 3LY9A 4AX8A 5KOIA 1AZSC 1RNLA 3DAOA 5M04A 5B6IA 4YCNA 4NAVA 4NMWA 5B1DA 1EWKA 5CPBA 2X19A 4KYUA 2EV9A 4LVNA 2B1JA 5CDFA 1BGVA 1RXYA 4MW7A 1K6EA 4MRSA 4WLOA 3QLVC 4QGHA 4ZANA 1JEQB 5KQRA 2J6HA 1EYZA 1P7ZA 4HDRA 3RK1A 3NHZA 1GG9A 4B33A 5KYXA 2I03A 1XU4A 2PT5A 1T8PA 4B3RB 1J39A 1DADA 1QVWA 2G88A 3GUZA 4J6FA 3JQGB 3D7KA 3LQKA 4MGHA 3SKVA 4BC0A 2IS4A 2Z4TA 3NEYA 1UZNA 1O9BA 3Q72A 1QHSA 4AXXA 2P41A 3ADDA 3JVVA 1G8MA 3EASA 4H59A 1FW8A 2H4YA 2G08A 2IYNA 2WP0A 2JIPA 3M3PA 1KEUA 1KI6A 2CHEA 3QKSB 4N3GA 4Q1EA 4BMPB 3A6EA 2FWAA 3TQQA 3TG8A 1Z5WA 1EBFA 1MPXA 3IXLA 4Y9TA 5AJYA 5SICE 3DHNA 2EX4A 2A1UB 4XVQA 5AK4A 5DJ5A 3T3DA 3T06B 2JGNA 3FPLA 3N07A 2I2BA 5ALUA 1JHZA 1WUJS 1ZO8A 3AVPA 3CLRC 4LJSA 5E6RA 1ZW1A 1XQVA 5A3RA 2Z2KA 2VP4A 5HIMA 1V5EA 3LUAA 4GLBA 5EE5B 4CRWB 2AQIA 4RSRA 3H11B 2P1ZA 3A6GA 4A5SA 3X0DA 3ZHCA 5L51A 4WZBA 4DADA 1CP2A 1W96A 1Z4JA 4B3FX 3S2UA 4N0MA 3DEKA 4C7OB 1HE5A 1HLPA 1JT9A 3EARA 4GO1A 4P5DA 1GSIA 1JWAB 2DFLA 3KAJA 4J6EA 1HE1C 4CL3A 4YV2A 3LF2A 4LPKA 3P9KA 1W75A 4CV3A 1HZZC 1WXHA 3HZOA 4RWZA 3A3KA 4NOMA 2ZI7A 4J43A 4F4CA 4QPZA 3C3WA 2HF7A 1UZMA 4WNCA 4BN0A 3ML1A 4XLZA 1WULS 3LLVA 1ZITA 1AGRA 2EJTA 2J6CA 1PYOA 4YLEA 2NQ2C 1TVKA 2QK4A 2I7DA 1E3SA 4WKCA 2CL5A 2Y27A 3W4IA 2YXPX 4K3VA 2CV1A 5CTAA 1A3CA 5K3EA 5GJBA 3W5SA 3W2EA 1J0AA 1VE7A 3I3OA 3HFSA 1TMKA 2R4UA 1M0WA 3OLVA 5EKXA 3OOHA 5KTYA 1VE3A 2B20A 1JJBA 3A3YA 1ZIYA 2B34A 2OAQ1 3U31A 4ZAXA 4DDKA 4NBSA 4EA7A 2PUAA 1VJ0A 3BJIC 4KXNA 4X63A 1N6PA 5CVUA 4Q19A 4CYMA 5CVCA 3G68A 5M5BA 2V98A 5AIAA 1ECJA 3D5QA 1ZOPA 2B7CA 1PV4A 1AKUA 2NTEA 3SD7A 5JQWA 4GP6A 1ZD1A 2I4NA 3M6MD 5JXWA 3PD1A 4Y6QA 1E2BA 1FYFA 1Y48E 1AURA 1OJLA 2GZAA 2OLJA 2WU0A 3BCHA 1DEAA 1MT0A 1YB5A 2JHPA 5J9FA 3TR0A 4BQRA 4M22A 4PLZA 1S2OA 1SJ9A 1U0NA 4RLSA 2IF0A 3WZ2A 4K40A 3T94A 2QL5A 3PNYA 4MQ4A 2Z5GA 1I4OA 2XA9A 3IELA 3R09A 4UVIA 4IZ6A 4Z0PA 2JI7A 3OZCA 1BDBA 3OIDA 5LYJF 3WL8A 1TJYA 1HG1A 1IEVA 2VSFA 1VLMA 1QGOA 4DAOA 5JSZB 4IRXA 4RDIA 4AN1A 1E1YA 1OWMA 3KFXA 4ZVLA 5IABA 3ORYA 1GFWA 2L69A 5JAHA 4NXMB 3N6RA 1Q1EA 2M6RA 4MI3A 3HDJA 4X85A 3WLEA 3GZNB 1MT3A 3TF5A 3KSRA 2B8TA 2J0UA 5JG7A 2DLDA 5DBFA 1GR1A 5EXSA 4UAVA 4K9MA 2C1ZA 3DM5A 5LQRA 1ECCA 1C7EA 1DV2A 2HW8A 4WESA 2RG7A 1I4LD 2X7HA 1YB2A 4F6RA 2R8RA 2QQFA 4HNGA 2Q3CA 4GFDA 2ZIFA 4GZ3A 2YS6A 1U0RA 1NC3A 1FDTA 1D1PA 1J21A 4KYTA 3FOBA 1M54A 3SHQA 4ZTUB 1N2BA 4N54A 4QJBA 1RZUA 4POOA 4X71A 3C7CB 4L15A 5LP1A 3NG1A 1CJMA 3GUVA 4BLRA 3DCIA 3A2NA 4IYRA 5CITA 4XGRA 4AQ7A 1FFHA 4XGIA 2C5BA 2MMGA 4NCAA 3QHAA 2X9VA 3C5CA 3K0SA 3E6AA 1E77A 4UM7A 1MAVA 5HUQA 4DY4A 1HEYA 1T3GA 2H2IA 3ESDA 4W1RA 4EFLA 2GVZC 1QF9A 1VKRA 1Z5UA 3ZQ6A 1LFDB 3QV1A 4V2IA 3FJ1A 3FNIA 1ZH4A 4QTUB 4Q9LA 4DKJA 4C7JA 4IX9A 1ZLXA 4U9HS 1SB8A 1YBMA 2RKBA 4C0AC 1UPCA 1ZVKA 3AHIA 1GNPA 4QEDA 2QRLA 3CUYA 1UM9A 3BYZA 4HOYA 1C4WA 1DJNA 3L9XA 1TA0A 4ZPJA 1CVRA 3OPVA 3IAXA 1NVEA 1CEXA 1WNFA 5JSYA 4DSOA 5KYYA 3UPTA 4EL0A 4NFHA 1FA9A 1XZPA 4TMWA 3UB4A 5JZ9A 3JQFA 4IKOA 1N2CB 1Z0DA 1BVHA 2WUEA 4I3HA 1Z12A 1OUMA 2I0FA 3QVSA 4O4HF 1CZNA 1NSFA 3R6LA 1Y3FE 5FTMA 4B5KA 3G02A 5KYTA 1KFEB 5B7GA 2G6BA 2I6UA 1C9JA 1U1DA 3WHPA 3D8SA 1CZRA 1LA2A 4KYIB 3VKFA 4QO8A 1ZUHA 4ND5A 2YWFA 1NJ1A 1Z8NA 4GRDA 4NBTA 2H5JA 1JNXX 5E95A 3WRXA 1GTL1 3F47A 4EB0A 1JILA 2WJJA 1MG0A 3IAHA 3UFXB 3UXMA 1BCSA 1W2HA 1OMOA 1H2HA 2Z9BA 3G2QA 4JASB 4NEQA 4OXYA 3LDHA 4PXSA 3VPFA 1UWVA 1SC4A 1ZD4A 4F9TA 1GHTA 4YCBA 4MROA 4JXZA 1O5TA 2A1TR 2BN4A 2DSTA 1SBIA 3FDZB 3P9RA 1N9GB 2Q0SA 4IUYA 2QT1A 3KE9A 5KJEA 3ZH9B 4EBBA 2ZUEA 3L6UA 4IDGA 1NA5A 1Q11A 1UBSB 2XWQA 4D0RA 3IUQA 4YCDA 1RLIA 4C29A 4JA2A 1V5WA 2QP9X 3LX4A 3QM1A 2RE8A 3U4QB 5CX4A 4BLSA 3A06A 5GONA 1HT2E 4L7QA 1K8RA 4EPYA 3C4VA 1BXRB 3KHTA 3GG9A 2ZUDA 2ZRNA 1PD0A 4YUZA 1QCYA 1SY7A 1ZEMA 4GR4A 4HFNA 2Y6UA 2C3MA 3INRA 1PS8A 4PYNA 5KKNB 2C78A 1ISMA 2C2ZA 4IDDA 4TZTA 1JXQA 4WJZA 3TD9A 5JTUA 2FUG6 4R8MA 4QOIA 4QPJC 1ZJWA 4QVIA 3UXYA 2GB4A 4QYXA 3WNZA 2IELA 2LDBA 4DMHA 4KX3A 1FRFS 3BMOB 2RHWA 3TTUA 2JAHA 4O59O 2OQRA 4UATA 2PWAA 3VC2A 2C9DA 3IVRA 4CI0B 1FFXA 4YA6A 4F9GA 1HYGA 4D82A 2NUPA 2XX3A 3CTMA 4V03A 1HF3A 1XZAA 3DMGA 1L7OA 5IANA 4CHGA 1AMUA 3RC8A 4TKUA 4CEJB 4W5OA 3SS7X 5K3SA 1K4MA 3ZQ4A 1F60A 5ALFA 3EUAA 3CJRA 2BRUA 3C3JA 3OEEA 3P1JA 5GP1A 5I9SA 4A03A 1OPXA 4CNBA 4I9GA 1BVUA 4FP9A 1XV5A 5CA1A 3NIFB 1DAKA 1X1QA 3ETLA 1I14A 3OTOB 2AI3A 2P9ZA 1N3YA 5GY7A 4QULA 3R0IA 3ROQA 4RW0A 2C94A 2FPOA 2WAYA 4XCQA 5K5EA 2WWXA 2Q5HA 3COSA 2WNSA 2CF6A 2O3UA 4K46A 3HGQA 4U7PB 5FNVA 1Z74A 3OFKA 3ZY4A 3KD3A 3IUSA 2N46A 2ZBEA 3BORA 5ILQA 4IILA 4DLSA 4RTNA 4GQBA 4JDUA 4MJXA 2MTBA 2RG1A 2BTOA 1HSOA 4LJKA 4U0KA 2FU5C 3FSRA 3TDKA 4B83A 4BZWA 3LCRA 5F3RA 2QKYA 4PYKA 3O31A 2ZUBA 4YDRA 4XCVA 5H4HA 3QPCA 1L5SA 2PUFA 3KTAB 1VMAA 1YNSA 3UG7A 2A58A 2G0AA 1VZ3A 3NHKA 1EIZA 3BKWA 4FQ7A 4JL6A 4X1IB 4A0FA 3D6MA 2NXWA 2QUAA 3OF5A 5HQJA 3E22A 1TYAE 2C0QA 3CUVA 3KT6A 3CO5A 1BHSA 4MWBA 5SY4A 3RJ5A 3DKIA 4EZBA 2XNKA 1Z4OA 1N5JA 4ESEA 3CVVA 3VR3D 1NPDA 2UYOA 1LI7A 2W2QA 2ZYGA 1XK7A 5EJ2A 4FDAA 4L5IA 1NXXA 2I2DA 4HDSB 3F9CA 3DZBA 3ZW9A 2OKCA 1FZTA 3CLHA 4F6CA 1NONA 2QVBA 4JOQA 1JTEA 3ECSA 4FC7A 4INPA 4UNRA 4YAUA 2CVPA 1KBQA 2YUIA 1XTRA 3LOQA 3F5DA 4WXPA 3K9GA 4XTRA 4HGZA 3WJAA 2RSLA 2R11A 4QASA 3MCUA 1N0WA 4DJFC 4P0QB 3MYRA 1FY2A 5ARBA 3P9ZA 4CQJA 4NQRA 3KKQA 3PUXA 4GOLD 3GCWA 1MB3A 2NTNA 3NR2A 1PTJA 3N6XA 4G07A 4MGKR 2F9LA 5SZHB 4XSGA 3R7WA 5IAKA 1XTUA 2GN4A 4BATA 4ZRMA 1QQBA 4L3WA 1E20A 2LPMA 4FCCA 4BMOB 5MN5A 2QSJA 2KBEA 2O4UX 3AEUB 3ORQA 5BQ5A 4G5RA 3ABOB 3D0RA 4XOIA 2K4MA 3PDCA 1CUUA 5GGXA 2G71A 2IOHA 2NO6A 1RYDA 3ZS9A 2AN4A 5C7YA 1RWVA 2ZB8A 3W8FA 4A6DA 1DIRA 3W2FA 4F8YA 2NQ8A 3BH7A 1JIXA 2B6NA 3R5TA 4EYGA 1J70A 4YVFA 3G89A 2BJHA 3CKYA 3P9PA 1G8HA 1GQ2A 2I67A 2X1LA 5LZ9A 1B3BA 2VNSA 4MDFA 1DC8A 1J49A 1TYBE 1Z9BA 3PDIA 2B98A 4Y2YA 4BX8A 2J7PA 3RAEC 1Z16A 3EWSA 3K6SA 1Z17A 3PC3A 5HJ5A 3LT1A 1EFRD 2IYZA 3ELWA 3GCGA 5TX7A 1TUBA 2Q5EA 5EWLB 5GWXA 4LBWA 2NTYC 2JBAB 2QTZA 4OOEA 3ZW7A 3EDYA 4GLLA 2I1VB 1VECA 3LY7A 4HZUB 1HWYA 3DLHA 1X38A 2VR1A 3C43A 4G0QA 1N25A 4M7OA 4M9XA 1Y8QB 4O8ZA 1CKEA 1OVMA 4G5XA 2LXNA 2IIQA 3JARA 3OM1A 2UZ4A 3IIJA 3OE1A 2PT9A 4B7CA 5I47A 4RZXA 1Y7LA 5KCZA 1T5TA 3GFVA 3P2JA 4G56A 2F1JA 1TXGA 2Y0EA 3AEKB 4QUEA 3UY4A 3GPCA 3I2YX 1YR6A 4DREA 5J2TB 2NVUA 4M37A 4BVKA 1C3XA 1OYVA 2FMIA 4A0SA 4LF6B 5JSQA 4R05A 3I5XA 4KODA 1OXXK 2QW0X 1PZXA 3E61A 4CEIA 4H31A 1V5IA 4IICA 3J80A 3CKLA 2BUBA 1X9HA 3JAMA 1NNEA 4ARSA 1SUPA 1U7ZA 4RA6B 2VUIB 4FK8A 5CXXA 3ZCTA 4G23A 4K2HA 4UU7A 4RCZA 3ZYZA 2IZ1A 3WK4A 1PZMA 4D2IA 4DNFA 5A1TA 2WJ4A 1ODTC 3QRWA 3R5XA 4K9KA 2GBPA 4X1KB 1UBOS 1RBMA 2A9RA 2OSVA 3BFXA 3DQZA 3IRUA 2V1XA 1TU4A 2BGKA 3S2ZA 4DLYA 1TCBA 2ZJ3A 4GQIA 3OESA 4YN3A 3D7RA 4ZFNA 1KRHA 5JMWA 1CZHA 1VPWA 2P8SA 1PVOA 2TMDA 2AXPA 4OB6A 5TPWA 4GSLA 3DLBA 3KT8A 3T41A 4NYMR 1B2RA 1OAAA 4C7VA 1V37A 1OJ7A 1QRDA 1YI0A 4OJQA 1RJGA 4LEIA 3SQDA 5AXBA 4FOSA 2HD4A 1EUQA 5LXTB 2FRDA 2ZWMA 3QTBA 3AVYA 4G5YA 4C14A 1L7XA 1WCXA 3VH3A 4RY2A 2PE5A 3UBTA 1E2IA 1MABB 5JUWA 1X92A 3AIMA 1PK7A 3RYFA 3S5JA 3KEMA 1GA6A 4IDAA 3VYTB 1Z13A 1FVOA 1L7VC 5L3ZA 3TOZA 4FX2A 3P9SA 3PUKA 1CS4C 2VNIA 5L3RA 4HO1X 1GPMA 2VP3A 2VP9A 3CNLA 3TXYA 5EJ4A 1TJPB 1PYDA 1MBZA 3NCTA 5H83A 2JATA 4RWEA 3RYCA 3OC0A 3JQCA 1NXPA 4GYJA 1G5PA 2OYRA 1TM7E 5C35A 4K8OA 1U2RA 2ZJ7A 5IUJC 1W52X 1P81A 1Q22A 4ZRNA 4PZPA 1KBOA 2BSXA 5FNVF 2BC9A 5HDQA 3VGJA 1KR5A 5EJMA 1A97A 2C3UA 1IQ0A 2P5TB 3AGPA 1EFVA 3MJ4A 3TLCA 4FFDA 4DV4B 2IUSA 4M7RA 3HBMA 4QGGA 3NBQA 5T6BA 5E1OA 3T0FA 2P79A 2PGNA 4XLLA 4Z4IA 3NBKA 3HVKA 3K2QA 4L4YA 4Y2XA 5DCYA 3KLBA 3RS7A 3IBYA 3MGCA 4CQNA 3H1PA 1IY0A 2P3LA 2BMVA 3PNPA 1WXXA 2VQ3A 1NBIA 1WUTA 2VI5A 3S2GA 3VU3A 4BZXA 1IY8A 1MFZA 1YSCA 1FUUA 3C8UA 4XFDA 2WF5A 5D7NA 3FUTA 1WKCA 2EWMA 3EGCA 9LDBA 2BOVA 3GJYA 1QX4A 2D00A 2OAGA 1T1JA 3PL1A 1SULA 3G13A 3OEHA 4X60A 3A10A 2QE6A 4KWIA 5JDIA 3ET5A 4F38A 1CK4A 3MRVA 2X0IA 3UKDA 3WBBA 3U5TA 4DE5A 1AHPA 3FPBA 1N9KA 1UPFA 3KTDA 3VR4H 4C7XA 1LBTA 2UUPA 4YBRA 5E8RA 3TQRA 2O3RA 1UL1X 1RZRA 4FQ5A 3Q0IA 2XOKD 1TT7A 4EF5A 4E5KA 4EEKA 4X1YB 1WMDA 1AXEA 4UCWA 4EELA 2SNIE 1O95D 4IFBA 3TJMA 3ASVA 3V4OA 3N2IA 4F8EA 2F3RA 2PK3A 3R0XA 4KITB 5H9WA 3F98A 2Y2VA 1CQPA 4LKRA 4MS3A 1H3FA 1KH1A 1EU1A 2GNPA 4XB6B 1Y5IA 3KOOA 5J2UA 4K9QA 2WKPA 5DTEA 3G9QA 3TXXA 2QJFA 5A3VA 3AO0B 4DLUA 1TKCA 4NMLA 1ZIPA 2OV6A 3QEAZ 2UDPA 2W7TA 2Q28A 4CL8A 3AOGA 1JF8A 2CK3D 1E89A 4EGCB 5FPKA 3QTLA 2NSLA 2LWIA 3TIVA 5C32A 4GOND 1P0PA 5FLXA 4PYJA 1A50B 4KEAA 5BN4B 3KCNA 3IMFA 4EZIA 4JFAA 4HX9A 4L27A 2UYHA 4KOEC 1S2LA 3K4PA 1HFJA 3OTGA 1J6UA 4YC7A 3VR5H 2OCDA 4BFXA 1JR6A 4G4GA 1PR9A 3IQWA 2Q9UA 2C2KA 2Q46A 4OSEA 1NW6A 3THSA 3CF6R 1KO4A 5F5XA 4BFWA 4ZCRA 3Q6NA 2NT4A 4L75A 3IVCA 1Y37A 4US2R 3PC6A 3PHJA 1BH2A 2DECA 3QVGA 1P75A 3R7AA 3O3NB 4XLTA 3UAWA 4ESHA 1L3BA 3EXG2 3HR7A 1HG0A 4YUYA 1PGPA 1S2DA 3KQSA 4GPD1 1KAGA 4WBSA 3VPGA 2E7ZA 3GZJA 2RK6A 1EFUA 3MEQA 3R23A 3R8XA 1T2UA 1WP4A 3DZKA 3OCXA 4IF6A 2BGJA 3FTFA 4P35A 4CMKA 2ZUWA 1FUYB 2OZLA 2YOGA 5K0FA 2HWWA 1CIPA 1CJVC 1KYTA 2F00A 1XCJA 3B1KA 2ID8A 4LUCA 3THWA 1YTLA 1L3IA 1NUTA 4GE3A 4I9FA 4LYEA 4UCQA 3F1KA 3DBLB 13PKA 4EW1A 3RC1A 2HAEA 2B37A 3QOWA 2IGBA 1DBIA 1FNMA 2GYYA 3IPXA 4W6ZA 4PZDA 3IMGA 3RUIA 2ZYTX 5CFMA 3FG9A 4CQMA 1YR1A 1V4VA 2HK9A 3D3KA 3M5PA 2KM1A 3Q7IA 1YQDA 4KUEA