2BMEA

High resolution structure of gppnhp-bound human rab4a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
176
structure length
176
Chain Sequence
SETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords RAS-RELATED PROTEIN RAB4A
publication title High Resolution Crystal Structures of Human Rab4A in its Active and Inactive Conformations.
pubmed doi rcsb
source organism Homo sapiens
total genus 62
structure length 176
sequence length 176
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2005-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bmeA01
1X1SA 1G7RA 2FPKA 3DM9B 3NKVA 4NMMA 1YHNA 1LNZA 4CEJA 3PR1A 2ZSAA 4EUNA 2FSIA 3DKPA 3ZIAA 1XJQA 4BZPA 2W58A 5AK0A 3QY0A 2PEYA 4A6PA 1VECA 3CX8A 1D8TA 1YRAA 3QSYA 4TZ6A 4Q00A 4Q21A 1OV4A 4JLPA 2ZVPX 3EWSA 1SGWA 1W46A 2ZS9A 2OBMA 3NC0C 2ZRHA 3HYTA 4TMZA 2Z0MA 1XJ0A 3EC2A 1OHHD 4EIWA 1D5CA 3VNUA 1E1RA 4KAXA 3LVRE 1LB1B 2IHBA 5EQTA 3EASA 4B3BA 2IC5A 4PO9A 3ZQ6A 4BZQA 2W2TA 2A5DA 1D2EA 1H8ED 4PHGA 3TR5A 1F6BA 1AZSC 1Z0IA 5L3QB 1QZXA 3MMPA 3UKDA 4EPWA 4EJSA 2F43A 3CR7A 2IXGA 3I5XA 2C78A 1Q21A 2XB4A 4LPKA 5KO2A 4HYYA 1KNQA 1TQ2A 5J4YA 1KKMA 4EPVA 1U9IA 4HUQB 5F3WB 1GKIA 1SQ5A 4YMVA 3NHAA 1PLLA 2JEOA 4ILEA 4D0LB 3GLHA 1WF3A 5DYIA 2R62A 3GEHA 4D82A 2R8RA 4TT3D 3LLUA 5IRCD 3EW9A 3N5CA 1UEIA 4IXNA 2HLDA 1U8ZA 3SJAA 1GL7A 1M7HA 2OLKA 1FOEB 3GLHE 1CBUA 4P4SA 3TUJC 6Q21A 3O8BA 3FMPB 1YR7A 4DJTA 5FPHA 2WKRA 4NPHA 1KY2A 3PV0A 1RZ3A 2EQBA 1H65A 1TF2A 1Z6YA 2QU8A 4CEIB 4ZPXA 3KL4A 2ZUBA 3HPQA 4HEJA 3P26A 1HTWA 5CIWA 1W0KA 2AK3A 2IS4A 3F5FA 4H9GA 5L3VA 3IHLA 4KO8A 5B64A 3CW2A 5JMTA 2A7QA 1OH8A 4LBWA 4ZDIA 5JI2E 2V54A 3IEUA 3P32A 2ATVA 1S2MA 1W4CA 1E2HA 1FPMA 1XP8A 4D81A 4B3DA 5M04A 5JECA 2PCLA 5H68A 1EX7A 1VPLA 1H8EA 121PA 4KI0A 3QKTA 2ZR0A 1ZM7A 4M1YA 5KDLA 4YXWA 4C0HA 4H1VA 2ZE7A 1U81A 1LV7A 4PZZA 1R0YA 1QHXA 3AF1A 1CRPA 2VHJA 2PMDA 3C5HA 4R2IA 4URYR 2A30A 1XX6A 3B6EA 3TVTA 4US0R 2OFOA 3FKSA 1VCMA 4PC6A 1ZJ6A 2C03A 1E2GA 2VP5A 4O2LA 5DN6A 1KGDA 4FCTA 1IY1A 3ZS8A 5DI3B 1L7VC 1D6JA 4KITB 5E7MA 1MKYA 3RS4A 1FX0B 2NZ8A 2XSZA 3THXA 2BEJA 3TW4A 1KDTA 1KO5A 2VF8A 1X86B 3TNFA 2OESA 1O87A 1K5GA 2ZRIA 2OLJA 3ZZTA 2XGJA 1E2QA 1N6OA 4TQ9A 1X1RA 5FBVB 3CRVA 1WB9A 2OZEA 4E22A 1XD8A 1SKYE 2ASEA 1XCGB 2D4HA 1Q1QA 2J45A 4MRPA 4NYMQ 4RZ2A 4U02A 1ZC4A 2ZITA 3EZ7A 3GFOA 1W48A 5D3MA 1AKEA 2D62A 4PPNA 5KPDA 2H5EA 2OFXA 3MAAC 4ZDJA 2CDNA 4JLKA 4Q19A 5DO9A 4MDFA 1OKKA 4JT4A 4M1TA 2V7QA 5D3QA 1T3HA 4Z54A 5LD2B 2BBWA 2ZRCA 1CR0A 4OHZA 3THYA 1N6PA 3IQWA 2QN6A 1GOTA 1GDDA 4P33A 4GZLA 3I62A 5FBLB 3DMDA 1PVOA 3FKQA 4LYAA 4C3ZA 1ZNYA 2VEDA 2OG2A 3PIRA 3CR8A 2WSMA 3EA0A 3G82C 3R8FA 4Q4JB 3U6KA 3A4NA 4WXPA 1T3SA 2IS6A 3CX7A 2CL6X 2O0KA 4GZMA 1AK2A 1YR8A 4TQAA 1W1WA 3RSLA 4DLZA 1SULA 2WIBA 1DAIA 3BH0A 3BH7A 5F9FA 3B1VA 1XJCA 2FSGA 2ZJBA 1N6IA 5CLQA 3PUVA 1JEDA 4GMDA 1IN8A 3RS5A 3OIYA 4IDQA 3QENA 4F93B 2JJ1A 1RE0A 2J0VA 2FJUA 2KB0A 4OJQA 4A6XA 5JS7A 4TYQA 1S4QA 3WMGA 1EG7A 3ZDQA 3GJ3A 3B13B 2CLSA 2BKEA 1S9HA 3IKJA 3X1WA 3CPEA 2DFKB 4M9SA 3IPYA 4NYJQ 1D9ZA 3WYAA 4DEYA 4PFSA 4B75A 2GEDA 3VR5A 3C15C 4HUTA 4M22A 5DNYB 1FTNA 4HLDA 4OQFA 1JR3E 5EE0A 1JEEA 2NQ2C 4KU4A 4L9SA 4XTCS 4WA7A 4AG5A 5KSZA 3ZD6A 2C5LA 3BJIC 3RS0A 3AP1A 3OHMA 3AVYA 1G8PA 4XVQA 2KBEA 1FZQA 1M34E 2E1RA 3BD9A 5G3ZA 3VTKA 421PA 5BN5A 2QTFA 3KXKA 4DLXA 2OO7A 4GMXA 3A36A 1SKQA 1VTKA 1KI1A 2GVDC 1T91A 1AKYA 2BJWA 2YZ2A 3KB2A 3QXHA 3OEHD 3H1TA 3VKGA 5HE8A 2ZQ5A 2B7CA 1II9A 2GRJA 2J7KA 2DWOA 5K8UA 4IEIA 1J90A 1UKYA 1UAAA 1NG1A 2V8OA 3K0FB 4HAWA 3EAQA 5FOSA 3T12A 1KDOA 2NMVA 3TE6A 2H7VA 5FFMA 3VR1A 2IUSA 2ZAMA 3QKUA 4FWTA 2V55B 4A8JC 1ZUHA 2XNDD 1L2TA 4NCIA 4Q7JB 1NMXA 5P21A 4F91B 1N5LA 1BYIA 4L4UA 3U61B 2V6JA 3QF4A 1KIMA 2ODWA 2WOOA 3B7GA 5JJIA 2ZSDA 3TMKA 5EE5B 4GOXA 2WAXA 3PVSA 2XB2A 1GAJA 2CJWA 2GEVA 3SBEA 4BFVA 2XXAB 1M74A 5EZ5A 3W6PA 2G88A 2Q9BA 2GJAA 2VHQA 1R8SA 2HXSA 1W0JA 4TTRA 2YVUA 3PITA 3UG6A 3R9WA 2GCOB 1NVXQ 2DFLA 4YMTA 4FCWA 5JS8A 2R44A 5DISB 4TTQA 1IN6A 5IF9A 5JWRA 4OI0A 2F9LA 5F2EA 3VNVA 4MRNA 1ESMA 3LNCA 1BYUA 4A2QA 2ANCA 2X77A 5EP4A 4DB4A 5GJBA 4YDHB 2O0HA 1N6KA 2FDCA 4HAZA 1E2DA 1R5NA 4ZKEA 3SNHA 3A8TA 3WP1B 4OL0A 5CJ2A 2QBYA 2PCJA 3OEHA 3M0EA 3DZ8A 2Y8EA 1E9BA 3PUYA 2AFIE 2YWGA 2ZJZA 1RIFA 4L15A 3GLGB 1GKUB 2YKGA 2WKPA 2JATA 1ESNA 5EP2A 2WSSD 2VSOA 4QHTA 5SZIA 1OFTA 1LF5A 4K81B 4BLQA 1DVRA 1NLZA 1JJ7A 3N2IA 4E09A 1EFRA 1RJ9A 1B0UA 4URXR 1E32A 4NTZA 1XMIA 2WWHA 4IFBA 4DUGA 1ONBA 4M53A 4LV8B 3JVVA 3SS8A 2LKCA 2WMNB 3LLMA 4HB4A 3SJZA 1UBEA 4QBFA 5C2JB 5EE1A 1E6CA 3QF7A 3QPUA 4BFSA 2VP6A 3AVWA 1ZMXA 3X2SA 2YC4C 1AJEA 1OPXA 2D7DA 5LBIA 1Q22A 1W4AA 3WHLA 3AGPA 4WZAE 4PC7A 1C1YA 2B92A 3FGNA 3WMFA 4RKFA 1TU4A 2VP0A 1G3IA 4US1R 3RC8A 2FFBA 4B2LA 1I2DA 4Q9HA 3HYRA 3L0IB 4C0AC 4F4CA 2WKQA 1ZW6A 4LYHA 2QP4A 4MQBA 4DDUA 5JI3E 1TX4B 4QFMA 2ZR9A 1YZTA 1Z0KA 5JHHB 4C7OB 2O8CA 2ZIAA 4MGZR 2QNRA 2RGBA 3KFXA 5GJVC 4BRUA 3RHFA 1DAHA 3MRSA 4KFSA 3I4LA 2PZGA 4JYBA 2QG6A 5BN4A 3ND9A 3MG9A 2ZSEA 4G3XA 4HATA 2AX4A 4URZR 1KSJA 4UNSA 4XTRA 4DSTA 3GLIA 1LF0A 2BM0A 4XOIA 3K0EA 2FOLA 2QUZA 2IYWA 5J4LA 4TTPA 4R2HA 2GHIA 3U44A 2JDIA 3TSZA 2GAAA 5EXSA 2X2FA 2AWOA 4LCBA 4AKEA 1P9RA 1N5IA 1NVUQ 3QKSA 1JPNA 2GA8A 4B35A 2VHTA 1NRJB 1XXHA 2O8BB 1P75A 2EU8A 4MGYR 3VHLB 3AP3A 3FTQA 5JSZB 4UNRA 3D31A 3QEOA 2AFHE 3ZGXA 2PX0A 1DAKA 3CWQA 3VHXA 4QXAA 1N6NA 4PSAA 1E2JA 3BE4A 4B33A 3AVVA 4WZBE 2Q9AA 1XXHE 1EFUA 4V0LA 1FUUA 2QQEA 1IN7A 3HU1A 2G9NA 4EPYA 3KTAA 4Q4LA 1XPOA 2G83A 4N3NA 4TSFD 1ZP6A 4LHZA 2HYIC 1QG4A 4M1OA 1NN1A 1Q3HA 1KI6B 2V1UA 2GK6A 1VMAA 2ATXA 3LBIA 2JLVA 2OUKA 1P5ZB 221PA 4DEXA 1HQYE 1GTVA 1G1MA 1OXXK 4BFTA 2EWVA 1W5TA 2XJ4A 1WBBA 4B76A 2D06A 1Q12A 4BEJA 3L43A 4YMSA 4UNQA 4EDHA 4PZLA 4XSHA 1JXMA 2NGRA 2F9MA 2IT1A 5C18A 4F92B 1KHTA 5EJEA 2RH5A 1PJRA 1IXSB 3RYTC 1MT0A 5FR2A 1IXRC 4LBZA 5AUNB 2IXFA 3CRW1 4A8JA 1XTJA 3SE0A 1SXJC 4KBGA 1E9EA 5F9HA 2PLFA 4GNKA 4CZ2A 3NG1A 5FOVA 2ZI5A 3W9YA 5L3SA 2FA9A 4LPSA 3RABA 2WJIA 1J8MF 2BM1A 2VA8A 1AZTA 1U0HC 1QG2A 5IK2A 3FMOB 1ZIOA 4LBVA 3LQQA 1UEJA 4C4PA 3Q3JB 1VG1A 4V0ME 3UPUA 2GILA 1AGRA 1Z8FA 4NE2A 1IAQA 4CEHB 4PO8A 4P3YA 1XEFA 3FFBA 3B78A 2J1LA 3CRMA 2J7PD 1FL9A 1ZNWA 3GLFE 4XIGS 2IS1A 2QI9C 5CLLA 3FHOA 2AXPA 3U7FB 4V02A 4OKSA 3EA5A 1T0JB 4B3XA 5FL7A 4JLJA 4ZO4A 3K70D 1RC8A 1Q44A 1KAGA 5KNBA 1TF7A 2W6IA 4OI4A 1BKDR 1X6VA 2BBTA 3E5HA 1HT2E 1KTVA 3PXGA 3IO5A 3TGPA 5TVKA 1QHSA 4OHXA 4AWXA 3VR4A 1Y3AA 4QBIA 4A0RA 1W36B 3OESA 3K9HA 2RGXA 1IHUA 2FN4A 2R9VA 4ASUA 5SZHB 5AUPB 2A5YB 1WQ1R 2G0TA 5DIFA 2ZROA 3GPLA 2BMJA 1R8QA 3DOEA 4D25A 3TQFA 4LHVA 3U6BA 3CZPA 4EJSB 4B3FX 5G3YA 2WBLC 1XRJA 4HZUB 2OHFA 4HLQB 4LWZA 4S2EA 2J46A 5DH9A 2N42A 3KKPA 4HDQB 2R6FA 3SBDA 2TMKA 5TV2A 3TK1A 3U3JA 3MSXA 4AIIA 2O8FB 1HH4A 3LQRA 1OYYA 3RRYA 3AB3A 1MRNA 2FZLA 2R6AA 3DHWC 2E87A 2MSEB 3IUYA 1F48A 4C0KA 4CRWB 2QPAA 3SEAA 1SVKA 4FXPA 2ZI6A 1KI3A 4LHWA 1P2TA 1CJTC 2JLYA 1XZQA 2YYZA 4ZCLA 3I61A 4JS0A 3QG1A 2EFCB 5CDFE 1D2MA 2GBLC 3HR7A 5A5GA 4JBWA 5EE3A 1NBMA 2P6NA 3GFPA 5J4HA 4HAXA 2ORIA 2CBZA 3BC1A 1SVIA 2XEXA 3A1UA 4ACAA 4F4JA 1K5DA 1NVVQ 2A78A 3UMRA 3TAUA 3AVQA 4JLOA 1DO2A 2VP9A 5KUTA 2HJGA 4GOKA 1JALA 4LJ9A 5KOYA 1KK2A 2JLZA 1G5TA 1NBME 3ZIAD 4BPBA 4HB3A 5EXXA 2UVQA 5TY0A 2QAGB 1W2GA 5IT5A 2QRNA 2NG1A 2ZRFA 3BH6A 3BORA 5B30A 3THWB 1AQYA 4AK9A 1CEEA 3CO5A 1E1QA 3OEEA 4K8OA 4HLCA 3H86A 4BFZA 1OIXA 4JSTA 2IL1A 4GRAA 1DTSA 4GSYA 5JHGB 4B48A 3KQUA 1UDWA 3NEJA 1N3BA 1SVWA 2PX3A 1A1VA 4LC1A 1G8FA 3AVPA 2ZE8A 2VL7A 2YOFA 2RCNA 3CONA 4DB2A 1W7AA 3EG5A 3KUCA 2ZRMA 4ERNA 4KFUA 3WHKA 2K5UA 5G40A 5JFGA 4QM6A 4QHYA 3KB1A 2GF9A 2IWRA 2DHRA 4LV5B 3BXZA 4OI2A 1JR6A 5FBWB 3K0SA 1P72A 3FPAA 1W47A 5DLQC 3VX4A 1XEXA 2ZJYA 5BWMA 1D9XA 2W00A 3REGA 4R98A 4CYMA 4NYMR 4QM7A 2WM9B 2RGNC 2V4ZA 4N1AA 3AH8A 1NIJA 1ZAKA 2J0QA 1IN4A 5J40A 4A15A 5CM9C 2HLDD 1KOFA 5B2ZA 4KYIB 1G3RA 1II8A 4LJ8A 1DAEA 4CT4B 2KI5A 4ZDKA 2OM2A 3CF6R 3LBNA 3CB4A 2WV9A 5FL3A 1CIPA 4OBEA 4W5HA 1NKTA 4Q9LA 1QVAA 1KDRA 3B60A 2QMHA 4BLOA 3SYLA 3QIAA 5KSYA 1F2UA 1KDPA 1W0KD 2FFAA 2ZRBA 2FX3A 3B82A 1N25A 5DHAA 2G0NA 1KSFX 4C2UA 2FH5B 3VQTA 1RKBA 2B8TA 1PLJA 1SXJE 1QRAA 1EFHA 2NPIA 3VMFA 3B1YA 2J9RA 2OT3B 3MWKA 4PQRA 3C5CA 4JL6A 3X1XA 2DFNA 4HDOB 4RZ3A 5KDDA 4A0FA 5HR5A 4ABYA 1MO5A 4YXWD 1F2TA 3EIEA 5DGXA 4W5WA 3AKCA 3VFDA 3AM1A 1LY1A 2J59A 5TMPA 1IM2A 1CJKC 2VHUA 3GEEA 2FV8A 2YOHA 4TL6A 2HDNB 5AUQA 2J0SA 3FDIA 3FKSD 4B2PA 4J0QA 4TYPA 3LA6A 5CITA 1AN0A 3GEIA 1UJ2A 3QKRB 4GP6A 1ZIPA 5DN6D 1GUAA 4DWJA 3TR0A 1G41A 3WMEA 3N2EA 1KMHA 4NHOA 3EPHA 2XSZD 3EIHA 5KHOC 4NYJR 4PC2A 1NF3A 4JLMA 4FCVA 2D74A 2ANBA 1NNEA 2ZPTX 3VU9A 3W34A 2RMKA 4R7ZA 2FE4A 1TQDA 4XVRA 1XZPA 3RRNA 4NCJA 2P0EA 3CH5A 2ZRNA 4BWYA 2XZLA 3O8RA 1UKZA 3RWMB 5JJLA 1I2MA 1DO0A 2QGZA 4L9WA 2QORA 1Z3IX 4LJ6A 4TL7A 1Z2AA 2IBMA 2F1HA 4AYWA 2F3TA 1AS3A 1W5SA 3L0SA 1OKKD 4HLUC 2JIZA 1I4TD 3UWKA 4DLSA 3QEJA 2OSBA 2V7QD 2IS2A 2C04A 1EESA 3QE0A 2ZI9A 4L5BA 4IEEA 2X2EA 4EQ6A 1FQJA 1T8TA 2L0XA 2VP2A 3LDAA 4TN1A 1MABB 1EWQA 1EFCA 2NO7A 2G3YA 3GD7A 2A9KA 1J2JA 3RNLA 2F1JA 2PLRA 1PUIA 2WIAA 3TRFA 2MMCA 5KU1A 3A37A 3JZAA 4LUCA 1CS4C 1UADA 4LI0A 3BOSA 4OQXA 3SN6A 2REBA 1RRFA 1FFHA 5G41A 2IUTA 1US8A 1CLUA 4OK3A 3HWSA 3TBKA 3ADBA 4A4DA 5K8LA 2WWFA 2HT6A 1J99A 1BO6A 1M6NA 2NO1A 2VP4A 3OZXA 2SHKA 3NBXX 3H4MA 4JBYA 4XH9B 4DDTA 1N5KA 4B44A 2CJWB 2GJKA 4QNRA 3A4LA 4WXRA 4BRWA 5K8TA 4BE7B 3FB4A 4M9XA 1GM5A 3CPHA 5B57C 1E4YA 1Q3TA 2JJ1D 1U8AA 2WVJA 3HP1A 4QJ4A 5IDVA 1RYFA 2ZI4A 2QP9X 4PAQA 2R6GA 1T8UA 5AR1A 1ANKA 1QHIA 3CRQA 2O8EA 3CX6A 1JR3D 1R0XA 4GI7A 4I1SA 4MKHA 4DRZA 3K1JA 4Q1CA 3D3QA 1DAGA 3K53A 2RHDA 3P20A 2J5XA 3GJ8A 1UBFA 4ZIRA 4GFDA 3RANA 1OXUA 2F55A 4Z1MA 4AKHA 1FP6A 4PQFA 3WY9A 4M9ZA 1S1CA 2JJ8A 3IBYA 1TUEA 2BV3A 5LD2C 3GJ4A 2C99A 1KNXA 3CUEF 3RS2A 2J41A 2ZRAA 4QGAA 5CIQA 1XD2B 2XTZA 1N0UA 1RRGA 2J0UB 4NYIQ 1JQLB 2FPMA 4I81A 2OAP1 2XX3A 5J4KA 1NP6A 3E1SA 2EFDB 3K0CC 1E9DA 3HR8A 3BFVA 4YLGA 1KJZA 2ZS8A 2CL7X 2VHCA 3SQWA 5FBRB 4DBLC 3R7WA 3NBZC 2VSFA 1GG2A 4QGHA 5FUVA 1E9SA 1NVWQ 3NH9A 2BBSA 3KZ1E 3FHCB 2GNOA 5KNDA 4RKEA 1ELOA 4LHXA 3WNCA 2UKDA 1M7GA 4AC9A 4DLYA 3EZ2A 4RD6A 3HU2A 2QEQA 4LJ4A 2RGNA 5IHPA 3SHWA 2CE2X 5FI0B 3LV8A 1KSGA 4A36A 1R5BA 1Z29A 3V00A 2IYQA 621PA 2LCFA 2ZXUA 3TVDA 3U60B 5FBQB 2IUUA 1P2SA 4OK5A 1CJMA 4OI1A 3LRPA 1K8RA 4JSYA 2ZYWX 4PR0A 3LAWA 5AJWA 4XWOA 4RD3A 1QF9A 2VF7A 3X1DA 1HYQA 2YNMA 5FOXA 5JCPA 3I32A 1G5RA 3SI7A 4B2IA 2Q3HA 1Z0AA 1JR3A 1Z06A 4PC3A 2BC9A 3I3SR 2E9SA 3MFYA 1RYHA 3U7EB 5L3QA 3T61A 4WIAA 1ZD1A 3A1VA 1W0JD 1L4YA 4I1OA 2AL7A 2V1XA 3FFAA 1SHKA 4PHHA 4G5OA 2I4IA 1AGPA 4TLDA 2XZOA 4I4LA 3GLIB 2BKUA 1S96A 1P9WA 2ZJAA 4KSCA 3IPXA 2RGAA 3SJBA 1KZ7B 2QTVB 4RY2A 3IO3A 3B2EA 3LBHA 4JL5A 4X8OA 4EAQA 4DT1B 3QKSB 1E99A 2ZI7A 4LJ7A 4M9QA 2Q3FA 2YWEA 3KQLA 1IONA 2UZIR 4BFYA 3W8RA 3HJNA 4M1WA 2ZS7A 1KJYA 4HZIA 1PLKA 4BLRA 4CEIA 4BEBA 1Q1ZA 1EFRD 1TADA 5SZJA 2C9CA 4TMWA 1G3UA 3AQ4A 2IXEA 4JLDA 4YONB 5H1YA 5FOUA 2FNAA 4R71A 4DUGD 4KCGA 4MGKR 1LW7A 2NOAA 2EFHB 3I1FA 1VYTA 3ZZ0A 3PEVA 1G6HA 2QT0A 3QPVA 2W2XA 2HT1A 3AGQA 5FUWA 4DCUA 1B23P 1IJEA 1DS6A 1CR1A 1SZPA 2MSCB 1UFQA 5EXTA 3W90A 3R8CA 4RSGA 3LXRA 4Q1EA 5A0FA 3OIWA 1WCV1 2B7BA 1R6BX 4LJYA 1KO1A 2FG5A 2HF8A 3FWYA 1NLYA 3RSOA 3W5IA 5GVSA 4H1UA 4LK2A 4Z8XA 1SVMA 4DKXA 1KJWA 3ZLJA 2BWJA 1E79A 3EZFA 3TUIC 1AIPA 3ONWA 4RJLA 3NDPA 2CHGA 2KJQA 4W9MC 2PJRA 4O3MA 3RS3A 1NY6A 2OFWA 2CNWA 1XU4A 3I92A 3NBYC 4HSEA 3U4QB 3NDBB 5DI3A 4TLEA 4RD2A 1FX0A 1MRSA 4DLRA 1TAGA 2AKAB 3WNBA 3BRWD 3FE2A 3S1AB 4IOLA 2QE7A 3IGFA 3PUWA 4M1MA 2G1JA 3K0AB 1DG1G 1QHHA 1MH1A 4NZYA 5BQ5A 3AF3A 3M6AA 1Z2CA 4EPXA 4U7DA 2JDID 2EYUA 3EARA 3AVTA 5L3RA 4BFWA 5KSOA 3DM5A 2O8DB 1NKSA 1FQKA 1YU9A 1G7CA 1ZCBA 1GNRA 5K8IA 1HE1C 1XD9A 2JAQA 3Q7QA 3UMFA 2LKDA 2ODEA 2I1VB 5HTKA 4ARZB 4GL2A 1YZLA 4N0DA 1ZVQA 5FH9A 2WZQA 2DR3A 3T1OA 1M7BA 4F7WA 2VTKA 4CT5A 2DCUA 4FWIB 3FHTA 2QPTA 3WXMA 2W6JD 4ZDWA 2QMOA 4LBYA 5FOWA 4ZI2A 3OE7A 4GP7A 3K0CA 5JEDA 1ZNXA 1LS1A 3L82B 3ZZUA 2OXCA 4QRHA 3KFVA 4GT1A 3KQKA 4Q4AB 3DZDA 1KKLA 1OF1A 5KPJA 4BLSA 1X8LA 2P5SA 2WJYA 1FW6A 3MJRA 4Q4JA 4RFSB 1Q1BA 5EZ6B 4HB0A 1Z63A 1E94E 3NIBA 2R6CA 2XOKA 1XTIA 5C4GB 5ELXA 2YHSA 4B3CA 3MD0A 4OQMA 2H8KA 2ZYTX 2ZRKA 4X8LA 1J70A 1W4BA 3SZRA 3OAAA 2WAYA 1ZUNB 2GCNA 2ORVA 2OCAA 1Q20A 1J8YF 2P2LA 3QBVA 4TLCA 1HY3A 1YQTA 1ZYUA 2AHOA 1XNJA 3DPUA 2RGGA 5TARA 1N5JA 4KYUA 2BHRA 2JCSA 2ZU0C 1VYVA 2ZRJA 4B71A 2C8VA 1ZUIA 3GJ5A 3IBGA 1P3JA 2GXQA 5E7JA 4DLWA 1N0WA 1Z6TA 2BOVA 2QZ4A 2ZVQX 4KV9A 2YWHA 1PUJA 4DSOA 3IDQA 4DZZA 2BCJQ 4JVNA 1YZUA 5IK2D 3ADKA 4PZYA 4QGGA 1VG9B 3CNLA 4DCTA 2NO6A 1XBTA 5HCNA 1MOZA 1YR6A 3C16C 3K70B 3BB3A 1E2FA 1KO8A 2AK2A 2YINC 2VIIA 5E95A 4A0HA 1NVVR 2QSZA 2W6JA 3KKOA 1BMFA 3O47A 2DFTA 3U3KA 4FW9A 1P62B 2A5GA 1FTSA 3H2YA 1MV5A 5FL7D 1NMZA 4YQFA 2AXNA 3AKEA 4P4UA 2W6ID 3LW8A 1ETUA 3PEUA 2EW1A 5FPKA 4NP6A 3K0FA 2FEMA 1VKJA 3PUZA 2QTHA 1CR4A 3T35A 4S35A 5KSPA 3TQCA 4Q7KA 4JZKA 2FF7A 4Q9JA 2GCPA 1Z83A 3VR3A 3K9GA 5FTMA 4Q4HB 1YZNA 1SHZA 3GP8A 1T9HA 4TQUS 4ASUD 4QJ5A 4AD8A 4NL4H 4JKYA 1XCPA 3C14C 2BIFA 1E3MA 2D7CA 3UIEA 1XTRA 4B6EA 2Z83A 3ZS9A 2PEZA 1RRCA 5CB6A 1G4AE 1E9AA 2V3CC 4MKGA 2XXAA 2I3BA 2OBNA 4MUAA 3LXXA 3TKLA 1RRPA 3MWJA 5JEEA 3B9PA 3FVQA 1NN5A 2F6RA 2H17A 1HT1E 4Q47A 4V0MA 1U0JA 2F7SA 1H8HA 1HURA 2ZEJA 3CZQA 2GJSA 4A0GA 4UNPA 3QXXA 1XEXB 3LFUA 1U2RA 2GCOA 1IY0A 2FMXA 2GESA 5JRZA 4A9AA 1EK0A 2Z4RA 3RRMA 3GLFA 4D0NA 4Q18A 3CH4B 3JVUA 2XITA 4AY2A 1ZM9A 1FNNA 1M8PA 2EFEB 2IYZA 2JLQA 4CDGA 2ZE5A 3IIKA 3NWJA 1U98A 3BS4A 3TW8B 2CCJA 1II8B 3NC1C 4CEJB 2DWPA 3KX2A 1XCMA 2RGCA 4PAMA 3P4XA 4HB2A 2VPPA 4RD4A 5BW8A 1NBMD 1T0HB 2WJVA 4FMCB 3DKVA 2ZUDA 2GXSA 1F2UB 4PXAA 1GKYA 4RCYA 1RVDA 1W36C 3ASYA 1JNYA 3QOFA 1YZQA 3U7GA 2HCBA 3Q5EA 2ZRGA 4M21A 3MWYW 5BXQC 1UPTA 2C98A 3EC1A 2G1KA 2IWHA 3GLGE 4ZCMA 1W44A 4Q5IA 4Q7LA 5ANRB 1P60A 3DOFA 1OH6A 4EFMA 1CJUC 1E1QD 4EJSC 5EP3A 3ADDA 5FUXA 3OEED 3X1ZA 1ZRHA 5A4JA 2BMFA 1XF9A 1IJFA 2F43B 1M2OB 3BB4A 1GZSA 3W3ZB 1HV8A 2FGJA 3BWDD 3P4YA 3U3MA 2JA1A 1G20E 1YKSA 4BGDA 1G4UR 3RS7A 3D7MA 5EXPA 2CHQA 2WMOB 2XZPA 4Q03A 1KO7A 1P61B 2AWNA 3CM0A 4GPTA 1V5WA 2IF2A 2FEOA 3GJ0A 4ZKDA 3N70A 2OBLA 3RDPA 3GLHB 5CDFA 3OFND 2D2FA 4DXAA 4R9UC 4K46A 2ZJOA 4WAUA 3DMNA 3X1YA 1E2KA 2EWWA 2GXUA 3K9LA 5C1BA 4OQNA 4QBGB 1CKEA 3VU9B 1PZNA 3B1XA 1EX6A 2JJ2A 2PL3A 2YC2C 4U5XA 3ZD7A 1T4GA 1ZU4A 4MRSA 4P4SB 4B47A 1FMJA 1G6OA 3ZQJA 2IYVA 3Q7PA 2H1LA 3HU3A 3KDSE 1Z5ZA 4KVGA 4RFVA 2LWIA 2DWQA 2QAGC 4D4JA 4MA4A 1E0KA 4KLNA 4IOMA 3BFKA 4UXJA 4PHTA 4EQ6B 1IBRA 3CF2A 5GADl 3U5ZB 4Q48A 2N1BA 1MO3A 4C0JA 4TLAA 2HJVA 4OHVA 3MWLA 3MJHA 3T1QA 4MRVA 4DCVA 4IDPA 3NEYA 2IEZA 2O8BA 2X8AA 4L16A 4W5JA 4EPRA 3UATA 5JSZA 2A2ZA 4D2IA 1G291 2RAPA 1Q57A 5HZKA 4LV6A 1Z0JA 4ZI3A 2J87A 2KE5A 2XAUA 4TMVA 2QRZA 1ZC3A 2WHXA 4XD7A 1VCOA 1T5IA 3QI2A 1FNMA 4JYCA 1IXZA 4PAOA 1VHLA 1ZM4A 3NBFA 4MYCA 3PFIA 3RC3A 5JBQA 2CHVA 4KXFB 1OIWA 2DB3A 4NU0A 4Q1AA 1C9KA 1JB1A 3CWZA 1E9RA 2H92A 3MUFA 4A2PA 4US2R 1SKYB 2PT7A 1S0UA 1R10A 3OFNA 4ITRC 3THXB 3B85A 1OH5A 1P6XA 1GNQA 5JJKA 4C2TA 5J5CA 2VQSA 4PO1A 1AM4D 4MYTA 2NZJA 3SC3A 1P4SA 3QVVA 4BUJA 2B21A 4LJ5A 5D3MB 5JZVA 1DOAA 1E2IA 1DPFA 1TL7C 4GDFA 5E7IA 1HEIA 2ONKA 4MRRA 1E0SA 1DELA 3NXSA 2UZ3A 3FYHA 2CK3D 4JVSB 1QBKC 3I73A 1WXQA 3UANA 1E2NA 4B32A 1G3QA 3PENA 4C30A 3GFTA 2WWIA 4QOSA 1G18A 2C9OA 3PUXA 4JJKA 1NSFA 2ZETA 3KJEA 5FOTA 4PPGA 1Z47A 4QBHA 2ZR7A 1AS0A 4IVQA 4NYIR 5HE9A 3IQXA 1Z6AA 1SXJA 3P1JA 1Z22A 3THYB 1OE0A 1JAHA 4TL8A 5B58C 3L0OA 2ZJ2A 1VDZA 2JIZD 2GZAA 1COWA 1WP9A 2PT5A 4URUR 1V43A 2B6HA 1JJVA 2WTUA 4Q1FA 1E2LA 5HKKA 4CEHA 5GJWC 2QROA 3G0HA 3B9QA 2OCPA 2CCKA 1OFUX 2OCBA 2RKOA 3VR2A 1DBSA 3O8DA 4LDJA 3IHWA 2H18A 4IVPA 2IW3A 4KFTA 1LTQA 5AJXA 4DIEA 2FZ4A 2FWRA 2IYXA 5FPYA 3BFXA 4PPFA 5TXGA 1EXMA 1OXTA 4XJXA 4B73A 1A5TA 3T5DA 2IYYA 1XFAA 2W83A 4EFLA 4Q9IA 1TQ6A 2ZU6A 4Z8YA 5FTNA 1G8GA 3AVOA 4B6FA 1F60A 3E70C 1X8KA 3CKLA 1CR2A 2Q3MA 3OIUA 4QGFA 1TEVA 4IDNA 3CPJB 4AKGA 1AS2A 4O0MA 1KK1A 2CE7A 2GTPA 3NTUA 3KJHA 3U3OA 3W6OA 3RRZA 4HZUA 2CK3A 3BAFA 4RCZA 4MDEA 1YZGA 3R20A 1OYWA 4LC0A 3LW7A 4A2WA 4AYXA 2O8FA 1P2UA 1GRRA 2QP3A 4MGIR 4C0SA 5C46F 4M2LA 4Z1MD 1CULC 1OSNA 4WOPA 2QPOA 4AURA 1Q1EA 1ZD9A 3H84A 1G8HA 4EPTA 2H57A 3NVAA 3IILA 2R65A 4QJ3A 1Y63A 2VRWA 1E9CA 2O5VA 3DEFA 2OCYC 3K09C 3ICQB 1DAMA 2ORWA 3QG5A 2FFHA 4Q01A 3I72A 2BVNA 4IHQA 1JPJA 4IW3B 521PA 5E3HA 1NJFA 2Q0HA 2GBLA 3LH5A 4EKDA 2IHYA 1XMSA 4PTLA 2GJ9A 3QVUA 4II7A 2RGEA 1E4VA 3M4YA 5EUMA 2ZYVX 2JASA 4A1FA 2QAGA 1VG0B 1OHHA 3QF4B 3SQXA 4CVNA 3Q72A 3THWA 5H70A 2FGKA 1LFDB 2IEYA 1A82A 1NLFA 3QQ5A 5JWHA 3SJCA 2QA5A 4OYHA 3TJZA 4D4KA 2WWYA 1F3OA 1EFTA 4WW0A 4BECA 1G3MA 4D0GA 2C95A 3DVLA 1NN3A 2WJGA 2X1VA 4CGZA 1A7JA 1YJ5A 3A58B 1TMKA 2GETA 2IA5A 2OXRA 4NONA 1Z6XA 5AJVB 1WRBA 4M0LA 4G5SA 1HE8B 1MR3F 1OXSC 5TB5A 1R2QA 1E69A 1G64A 5DHFA 2BJVA 1A2KC 4OJKA 2O52A 1DARA 1PV4A 3AVUA 1VCNA 3EPLA 2WJJA 3W8NA 5C4MA 3PEWA 1UKVY 3CBQA 3DO6A 4M1SA 3AF4A 4WVFA 5AUOB 4DC9A 1TNDA 2YV5A 4TT3A 3ZVRA 1KI8A 1NIPA 3TAHA 2QBYB 4M1KA 1XMVA 3PEYA 4RD0A 1MO4A 3LY5A 2A3RA 3W3AA 3WRYC 3AV0B 3SHFA 1GVNB 4MITA 1TEXA 2PJZA 4V03A 1QHHB 2R6DA 4YDSA 2HCJB 2JGNA 1TTTA 2BCGY 3RLFA 1OW3B 4PX9A 4X8MA 4G01B 1Z0FA 1RJ9B 1UKEA 3IIJA 2DBYA 3NHBA 4JT2A 4LRWA 8OHMA 3GMTA 3C7KA 2ZJ8A 1NJGA 1FUKA 1JI0A 2BEKA 3W6NA 2FSHA 2JLSA 5KDOA 4I99A 1W2HA 5H8WA 1VIAA 1VG8A 4A82A 4N0EA 4F38A 5CJPA 2ZRDA 1LS6A 3R9IA 3V4RA 4WZ6A 3SFZA 3REFA 4B74A 1FMLA 1I4LD 2QENA 4KFRA 4X8HA 5KNCA 1OB2A 2P6RA 3KKMA 4JIMA 3EPJA 1CU1A 4IRUB 4LZZA 2KSQA 2GVZC 2ZANA 1OH7A 1XWIA 3VKWA 1KSHA 4E07A 2YJTD 3ASZA 3ZH9B 3KKQA 4KLZA 4O25A 1G8YA 4KVAA 1QVRA 2O8CB 3T34A 2RGDA 1JBKA 2A5FA 3H0KA 3KKNA 4UXHA 3EZ6A 1E79D 4W7SA 3OF5A 3M1IA 2ZSBA 1E2EA 2QQ0A 3A1WA 1OJLA 3CF0A 1KAOA 2ZRPA 4LYJA 2GAOA 1MO6A 2CNWD 1OT3A 3T5GA 1EGAA 3QKRA 3V4FA 1G7SA 1TQ4A 4HUQA 5AJZA 3WNDA 3T1TA 4TYNA 4YMUA 1HA3A 4RZUA 4JLVA 2P3SA 2GEUA 2AN9A 3U44B 3L8ZA 4B3GA 1JXOA 1KZGB 1Z6GA 2ZYUX 3BK7A 4DDVA 2P65A 3I8SA 2OILA 1NY5A 2FSFA 2NPFA 4QKQA 2ZM5A 2ZTSA 2QE7D 1GP2A 4Q1BA 1BIFA 1XXHB 2XTNA 3WYFA 1QDEA 4CIDA 1GFIA 1ZM3A 3VR6A 2D2EA 1KI9A 4DIDA 4D4MA 3LD9A 4Q66C 3SR0A 3B1WA 4XVUA 1F5NA 1UDXA 1ZBDA 1TU3A 2YOGA 1R7RA 1GIAA 1A2BA 1S9DA 4E03A 3KTAB 2QM7A 4HAUA 2W2VA 1UM8A 1N6RA 3T1VA 3KJGA 4KJZA 1MABA 1XEWY 2VBCA 1XEWX 3QNUA 4G5GA 4HLUA 1NI3A 2WJHA 5FTKA 1NL3A 1DEKA 1AA9A 2C96A 3BERA 2IYLD 1YZKA 3IEVA 3PJRA 2HV8A 2JLWA 3OE7D 3R9XA 3K09A 2GJ8A 1EWRA 2ZRLA 1JECA 2WPDD 1GRQA 3EIQA 4QHSA 2P6UA 5FR1A 5GVRA 1QHNA 2AD5A 4AYTA 4OHYA 4UJ5A 4M4SA 1U94A 2Q6TA 2DYKA 2X19A 2XOKD 4MKIA 1R0WA 3SYNA 1G17A 1KI2A 3AVXA 4MKFA 3AKYA 3WP0A 3F3YA 4TWZA 2YWFA 5AWFC 4I1UA 3F8TA 1DG3A 1CP2A 3QPWA 1SVSA 4A8JB 2NO0A 3VKHA 5FPTA 4TZ0A 3QXJA 4IOKA 1T6NA 4FMBB 1N6LA 3OAAD 1NMYA 4OK6A 2XNSA 4PQYA 3AP2A 4V0KA 821PA 1E2MA 2PZFA 3K9NA 5L3SB 4DSNA 2HF9A 4JLNA 2REOA 1G16A 3LX5A 4YC7A 4Q9KA 1FP7A 2CL0X 2QMUA 2IYSA 2PH1A 2V9PA 1OFIA 2ZJ5A 3EXAA 2GKSA 3HDTA 5LPNA 3GLFB 2GZDA 1XB2A 2NTYC 3QUSA 1T5LA 4O2RA 3AF2A 2EVWX 1E98A 4L8GA 1CTQA 5FI1B 3B8HA 1KK3A 4LY6A 3U3RA 4TMKA 1XD2A 2J0UA 3THOA 3WYGA 2QAJA 4JMPA 5CM8B 2WWXA 4M8NE 2WOJA 4URWR 4DLVA 3TUZC 4FINA 1BMFD 3KQHA 3BB1A 1C4OA 3Q9LA 3B5JA 2IX3A 1WMSA 1ODFA 1II0A 2WPDA 5EP1A 1VIYA 4BLTA 1E96A 1IN5A 4NDZA 5SZKB 1GL6A 1UBCA 1G9XA 4ON9A 4UNNA 2ERYA 3A1TA 3QJYA 2CLCX 1GNPA 3UWOA 2XNDA 4IFEA 4A92A 4ESHA 2PZEA 1YE8A 4QNMA 4U00A 2P5TB 1BOFA 3AF0A 4BQSA 5LDDC 4Q1DA 4KSBA 1KY3A 4RVCA 1WDTA 2QL6A 4HI0E 2F1IA 4WBSA 4Q7MB 4DSUA 4IDOA 1Z0DA 1GILA 3K8YA 1Q0UA 2OAQ1 1WBDA 3A4MA 4CW7A 2AD1A 4POAA 2W0MA 1P2VA 4XSGA 2IK8A 3CRRA 4BFXA 4I1VA 1IOZA 1OLOA 4KODA 1GL9B 4PPQA 3C8UA 721PA 1NG9A 2F1RA 1UBGA 4UXIA 2CVFA 2Z43A 3L0PA 5CYOA 3MLEA 3W5JA 2WWGA 4LX0A 1ZD8A 1BH2A 1HUQA 3LO5A 2GWHA 5BYKA 5EE9A 5KTYA 2VO1A 1H8HD 1RW4A 1SVLA 5CK4A 3MGCA 2ODNA 1QHGA 3ETLA 3K70C 1XPUA 5FTJA 4RZXA 1XDBA 2JLRA 3J81k 3L8YA 4P32A 4OHWA 4XWKA 2EYQA 1YVDA 2ZREA 4G5RA 4DCSA 1BS1A 2ZI3A 3PG5A 4JJZA 2EFGA 4RD1A 2HEIA 2FU5C 2ZAOA 2WSSA 2Q21A 1KYIA 5HCIA 2IYRA 4HDCA 5JCZA 1DE0A 2G6BA 3GLIE 2VSXA 3HPRA 4FMDB 1WE2A 2IYTA 4NH0A 5DSZA 4DT1A 5KYKA 2GXAA 4V0OA 3GQBA 5CB8A 5TDHA 1GRNA 1WA5A 1VCIA 5DE3A 4G0NA 1KI7A 1CJVC 2VLIA 4BFUA 1VYUA 4KBFA 1G7TA 4Q02A 3UG7A 2NIPA 1T3LA 4AI6A 4MYHA 4C0BA 1L8QA 1LVGA 5JWOA 4JKIA 1R4AA 2R2AA 3B1ZA 3BIFA 4B34A 1R0ZA 1X3SA 4DLUA 2HUPA 4GBMA 3LX8A 4BASA 2FFQA 2GZHA 2CXXA 1VHTA 4UJ3A 1E2PA 1DADA 2CVHA 1TUIA 3AUYA 5E4FA 4P0TA 2Q9CA 2REXB 4TLBA 4FIDA 1P73A 2QGNA 3ADCA 3P27A 2V6IA 4JVLA 5FPSA 3T06B 2C9YA 2OE2A 4QG7A 5CYPA 3GJXC 3V9PA 2RHMA 1OIVA 2GK7A 3GCGA 1RFLA 1S3GA 1ZNZA 2CCGA 1J7KA 2BDTA 1Z28A 4PC1A 3D6TB 2ONJA 1KO4A 3UXMA 5FTLA 3U4QA 1E0JA 3PCRB 4JL8A 2JJ2D 3C41J 1JAIA 3KUDA 3SDZA 3SU8A 5FUYA 1U8YA 4D80A 1KI4A 1E9FA 2JLUA 2ODBA 4JBXA 3WBKA 3ZVNA 1D2NA 3UK6A 3MCAA 3IIMA 4TMTA 3TSOA 4BZXA 1SXJB 1Z08A 3GJ6A 3EPKA 1E0AA 4FN5A 1XTSA 1DAFA 3S1AA 4D4LA 1XTQA 4LSGA 3GLGA 4IXMA 4OQLA 3U2QA 3QXCA 3K0AA 4FMDF 4IVRA 3SFVA 3TIFA 3TLXA 2I1QA 2H16A 4C0LA 2KBFA 4DVGA 3ZYCA 1S1MA 2O8DA 4PSKA 2CLDX 1NN0A 5L8VA 3AEZA 1R5OA 3D8BA 3EX7C 1KMQA 4ARZA 4Y0VA 1RPZA 1ZU5A 3KXLA 4TSFA 2HYDA 2AKYA 1OFHA 2G77B 2NO9A 4NCHA 1F2TB 3CNNA 4Y0AA 1NSTA 4IKEA 1KK0A 4XD7D 2BMEA 1UF9A 2VYFA 4TYWA 1U9IC 3FOZA 1G19A 2PMKA 4ESVA 4LOAA 4BLPA 3C4JA 2FPLA 4Q4AA 3LVQE 1CF4A 3CIOA 4JVMA 3WBJA 5JRJA 2OV2A 4RFSA 4V0NA 3O8CA 3E2IA 2Z6VA 4LGMA 3TH5A 5LB2A 1KMHB 1W4RA 1TF5A 1CRQA 2ERXA 4IJMA 4P4TA 4ZCIA 4FD2A 3G5UA 5F98A 4AKIA 4C7OA 1G21E 3QBTA 5GJCA 3CNOA 4AG6A 3KJIA 3Q85A 1OB5A 2ECKA 2Z4SA 4MUBA 3U7HB 1N6HA 2C77A 2Z5FA 1GWNA 3OIVA 3A1SA 1SVOA 5JLJA 2ZE6A 1JQJC 2B8WA 1IY2A 4TL9A 3SOPA 3UMSA 2XJ9A 4G1UC 5EUQB 3KXIA 4E5UA 1GITA 3QXSA 4DLTA 4FMCF 4MH0R 1W49A 2QMEA 3ICEA 4TYYA 5BYJA 5UKDA 4D26A 1K6MA 4XWAA 2BMDA 2D3WA 1G5PA 2KWIA 1N0VC 4HAVA 1SXJD 4B43A 4UKDA 4NCNA 3Q5DA 4IOJA 2J7PA 2PBRA 3F0TA 2W0SA 2BBOA 4LYFA 2CMKA 4LHYA 4LJAA 1COWD 4URVR 4F4IA 2DPXA 3Q8XB 1S3SA 2ZUCA 3WRXC 3TSWA 2C2HA 3JZMA 3PQCA 1US8B 5HKKD 3SYKA 4D6PA 4CF7A 2N46A 3A6PC 3RWOA 5HZHA 3ECCA 5BN3A 3LWNA 3ND8A 4C9BA 4FI3C 3FMFA 4Z51A 1P9NA 4C0QC 1YR9A 1Z07A 5G53C 2QY9A 2IYUA 4DCNA 2IF0A 2QSYA 3NH6A 3EZ9A 3I5YA 1KI6A 1GSIA 3BBPA 2A5JA 3L2OB 4HAYA 1N2CE 4G5QA 4ZV4A 2JLXA 4PANA 1L4UA 3RVBA 2ZSFA 1W36D 1U90A 2XTMA 1E1RD 2AR7A 4TMXA 1OXVA 3I8XA 4NBSA 3DDCA 3KQNA 4Q4HA 4NCKA 2O8EB 1X8JA 4IDHA 1O3YA 4GOJA 5LB4A 5HPYB 1A4RA 2WWWA 4NKRA 2MMGA 4ZIRB 1YRBA 3DL0A 4JLBA 2DY1A 4QC2A 1TPZA 2CEAA 1QHYA 2WICA 4KHZA 1S8FA 4P31A 3ZJYA 3ZVMA 3FMIA 2O0JA 4YMWA 1I4DD 4DHEA 3VX3A 3EWAA 1AQUA 1HQCA 1M1YE 1XPRA 2GDJA 1P7CA 2OEPA 2J3EA 2RB4A 2VH5R 5AJYA 1XMJA 4MYUA 3AUXA 2F3RA 4JLAA 3AKDA 1CXZA 1U0LA 1ZINA 4ACBA 3BGWA 5DYGA 1U99A 4QL3A 5DI9A 2P67A 4PHFA 3CLVA 1XTKA 1ZCAA 1ZM2A 1IQPA 3R7WB 3RAPR 3T15A 5J4VA 3GJ7A 4DDWA 2GF0A 5CK5A 2QT1A 2QM8A 4EFNA 4PSVA 2HXYA 3ZVLA 3VAAA 2MSDB 5J47A 4UQOA
chains in the Genus database with same CATH superfamily
4YBZA 2FPKA 3DM9B 1BMDA 3NKVA 3Q9SA 4NSNA 3TW8A 4BFCA 3C3EA 3PR1A 5CU7A 4X6XA 4BO8A 4ESEA 5KB3A 4U7JA 2BSAA 5EJ4A 5LNK6 4Y1GA 1MENA 1ULSA 3GRYA 3IR5A 4OHUA 1UDCA 2W58A 4PU0A 5EMJA 2PEYA 3DEYX 1VECA 3SWWA 3E8MA 4MS3A 3QSYA 3JY6A 3ONDA 4AU1A 3LNTA 3Q8MA 1OV4A 1P5RA 1LDMA 1S2NA 4JLPA 4PRLA 3QWFA 1SGWA 1W46A 4RMHA 3G2PA 3I28A 2OBMA 4NXMB 4Z86A 2GFHA 4HC4A 4KYVA 4YRAA 2PKYX 1CETA 2JAUA 1FRNA 4QODA 1BTOA 3QX3A 1Y37A 4RPCA 1XJ0A 2DPMA 3RHZA 1EGVB 3CC8A 4DV4B 1Y6GA 3VNUA 2EXXA 2YJ4A 4Y9RA 3LVRE 1JV2B 1SU6A 1UJBA 1CUHA 1DTWB 2QV7A 1GDHA 2DECA 4KQGA 1YH3A 4KQ6A 4MDHA 4PO9A 4B3BA 4BZQA 1I6LA 2QE6A 4HEA6 1FLVA 4V0RA 5AHWA 3ZJ4A 1H8ED 3DNPA 4IMPA 5IU6A 4ZVTA 1Q7GA 3BE5A 5L3QB 3R74A 5BQ3A 3L6EA 2PNFA 1DT5A 4HXGA 2MHCA 3KYBA 3ZXUB 3VPCA 4EPWA 4MP3A 5AOVA 3LHSA 4WN3A 3CR7A 2IXGA 3AHGA 3L8CA 4QFBA 3I5XA 3ZDDA 1Q21A 4H4CA 3QBDA 2D1RA 2PA3A 4OHMA 3WGUA 4HYYA 4E13A 5J4YA 5M5BA 4KKXB 1XA0A 4KRYA 1GGKA 2P3LA 2M6KA 1F5SA 4GPAA 4HUQB 5F3WB 1KC1A 4NMXB 1GKIA 4XDYA 4YMVA 1O95A 1YASA 2JEOA 4D0LB 2XNKA 1N1MA 1WF3A 3MUEA 4J2TA 2AB0A 4BMPB 5TNXA 5KNLA 2HQSA 3LLUA 4YB8A 4RQBA 2XCQA 5IZCA 5TGTA 3E3AA 4AG3A 1T13A 4IXNA 4BUZA 1WCIB 4KXMA 1RTTA 1QIMA 3E23A 3ZE8A 3FJ1A 3KHTA 1SUWA 3FMPB 1RYNA 3O8BA 5E4TA 5AXDA 1PNOA 2F4NA 5B3JA 1CUFA 4B2YA 2QW0X 3KSZO 2PAFA 2PGLA 2XWPA 1H65A 1TF2A 2EP5A 2QU8A 2A9RA 1SVNA 1RXWA 3M6FA 4D74A 3OECA 4OIFA 4ZI5A 2E1PA 2CNBA 3RF7A 2IPMA 2CNNA 2QOEA 4FNGA 2FMTA 1RNLA 4UM9B 5ICFA 3DE5X 2PA0A 5D1HA 1E0DA 4O2AF 4R7TA 5CEFA 5CFQA 1K4KA 2VNSA 3H18A 5ICMA 5JMTA 4B3JA 1TMGE 3ZZMA 4UFPA 1EQUA 1AUVA 3ANXA 3HEAA 2ZLBA 1DEOA 1ZXLA 3P32A 4GPBA 4MWDA 4WK2B 1QO0A 1CY7A 4MUXA 5AKKA 1A9PA 4IGIA 2F90A 5CNIA 1M6EX 1UH5A 3OCUA 2LW7A 1S8AA 3KPVA 2PT9A 4UE2A 1FSZA 3UICA 2L18A 1Y1RA 4M1YA 1EK2A 4GLOA 4P82A 4ZVUA 4C0HA 5KNCD 1FBNA 1VI5A 4MR7B 3LA8A 1AUPA 4IWNA 1LV7A 2UVDA 2WLSA 4KN8A 4PZZA 3RCBA 3T4UA 1QP0A 1X1DA 2PMDA 3LUCA 1H1LA 4QT0A 5EGSA 3CRZA 2A30A 4G36A 3TVTA 2OFOA 1NPDA 2K2WA 3GCWA 5LZ7A 3NHPA 2C03A 1AX9A 3JVEA 1MH9A 5BR4A 4KX3A 2ZJ0A 3OO0A 3FA2A 4JX9A 4KITB 1W94A 4LEIA 1MKYA 4YJFA 1Y1LA 4KNVA 1MDFA 1R6DA 1FX0B 1Q6ZA 1UWCA 2JI4A 3OLZA 3VU0A 5KSYA 3FOFC 1KDTA 1YAHA 2A57A 1SM4A 2VF8A 2OESA 2WTAA 2ZRIA 1K5GA 4L5AA 2XVMA 3LCRA 3A70A 3CKYA 3HBFA 3PE3A 4P36A 3ZZTA 4TQ9A 2QRGA 4CMCA 3CRVA 1NA5A 1ST2A 3SF8B 5JAUA 2OZEA 2HKIA 1X70A 3W5UA 3LY9A 4P35A 1L1RA 4X63A 4BMOB 1SKYE 4E22A 1J24A 4NYMQ 5ADWA 4PBTA 1XA3A 2GN8A 2R6ZA 1PF7E 1LBTA 3GFOA 5D3MA 5DVZA 2D62A 3UJPA 4PPNA 4QPZA 3WAGA 4YQZA 4BJHB 3BZWA 5IEBA 3KJXA 3ZK9A 1UJ6A 2CDNA 3MYRA 3BVPA 1OXKB 3I0NA 4YT8A 4MDFA 1PTJC 1Q7EA 1NUQA 3HS3A 2FLVA 1TJ5A 2PV7A 3FF1A 1DP4A 2BFNA 2V7QA 3AXTA 1ACLA 4HSGA 3K2EA 4ZC8A 3CZCA 2R4UA 2BBWA 2ZRCA 3HRHA 4OHZA 1XLVA 5LDHA 5DYYA 3ONEA 2PSJA 4HDSB 5ENVA 3B9BA 1I4EB 1Y9AA 3EIWA 1DUVG 3IQWA 1GOTA 4KN9S 1JHXA 1TLTA 3TZCA 4ZCRA 3DAHA 2ZYHA 3D2AA 4BL5A 3JQ9C 1CC1S 1P0PA 4LGVA 3PZRA 1NDQA 2I34A 4JKOA 1ETHA 1S2LA 2MYTA 4KIFA 1VP9A 1E9VA 3KDAA 1GSHA 2VEDA 2A9QA 3UMBA 3V6LA 2CV0A 2Y05A 2WSMA 3G82C 5I8ZA 2C4VA 4CMGA 3A4NA 4WXPA 3NRBA 2I3ZA 3G9QA 4LK3A 3CX7A 2I91A 1EZ4A 1QG0A 5BMOA 4KYTA 2X8BA 4DLZA 1W1WA 1PYGA 3O1IC 1SULA 3BH7A 1WZCA 3ACCA 4OLHA 5GV7A 3D4BA 1U7TA 3B52X 4GO1A 5LSAA 3KPYA 1XJCA 5CBKA 3LSTA 2C61A 3LXUX 1TW3A 3UJBA 4DPKA 4NCAA 4E3ZA 1XZLA 1W5EA 1Y8AA 1ZMTA 1SCNE 5AI0A 3C7TA 1RPAA 4FKMA 1SXHA 3KELA 4N5NA 4BV8A 3IMEA 4HPJB 1IDN1 1RE0A 2J0VA 3HCOA 3PLRA 2KB0A 4OJQA 4A6XA 5JS7A 2UVPB 4GPD1 1S4QA 1EG7A 1ZN8A 3K35A 4TUYF 2VJLA 4FZ5A 3S3TA 2BKEA 1OT5A 4NQZA 2QIOA 1Q0LA 2R1TA 3IKJA 3AIOA 4M9SA 2P41A 3E53A 1ZK4A 4NYJQ 4PYKA 3UA4A 5DWQA 2RH9B 1RLOA 1IWBB 2DWUA 3FCCA 2OQVA 1JG6A 1X7WB 3ICCA 3ZDZB 3BJZA 1XFDA 2QUJA 1ZHOA 3NTVA 2SCUA 4HLDA 1JEEA 2NQ2C 4XTCS 4L9SA 5KSZA 1C3LA 3MAGA 5TQ0B 1HNZB 3ZD6A 3BJIC 3D0KA 2YN0A 4LMBA 5CVUA 3OHMA 2BW0A 3JAWB 1YRQA 4QUEA 4CL8A 3CVXA 3I0MA 4XVQA 1LPNA 2WIKA 4E33A 2KBEA 1FZQA 1U4SA 4YDRA 2E1RA 5DU2A 4L4XA 5DBHX 3WL7A 1P0CA 5BN5A 3KXKA 3UW1A 4AZ3A 3IVCA 1NR1A 4GOOD 1PGJA 3F78A 2JI7A 1VTKA 1BXGB 4UHJA 1UXHA 4DWOA 1TEZA 2E5LB 3HYSA 1D0SA 1MC8A 3QXHA 3Q3CA 1VL1A 3AR5A 3ZV5A 3PX2A 4QOEA 4FBMA 5EJ2A 2ZQ5A 1GV0A 1NE2A 1II9A 2B7CA 1JQ3A 3QPAA 2G5TA 1V7QA 3Q8LA 3B8EA 2FPIB 2B35A 1K3FA 2PHZA 4IEIA 3MN1A 4PSDA 2YXPX 5DGCA 1UKYA 1RYYA 2V8OA 3H5OA 3K0FB 5FCDA 4Q4CA 3OTHA 4BWGA 1E3SA 4H7HA 4MQUA 2A9VA 1C9NA 1ZH6A 1MUUA 4PG6A 4ZOLA 1AKMA 3TE6A 3VR1A 3IBSA 3QKUA 5IVPA 1M72A 3FW1A 4FWTA 2WPNA 3B7PA 3L8FA 3UK2A 3T1NA 3IP9A 4DJJA 2HLHA 2WP0A 4Q7JB 2YXBA 4YROA 4J91A 2OBBA 3FUTA 2CLHB 2YL2A 1J5XA 3V1TC 4F56A 3NETA 1A8UA 4L4UA 3BX1A 3FMGA 4ZQEA 3QF4A 1KIMA 2PFKA 3N8NA 1ONNA 5EE5B 3C3AA 4GOXA 2WAXA 3ZI0A 1IWOA 3N2KB 5L7TA 1N8KA 3FTNA 5A7GA 2XB2A 2JANA 4H17A 2W6ZA 1O9GA 3G5TA 2PQ0A 2XXAB 1M74A 4LG1A 4OMDA 1M75A 4CM4B 3EFBA 4R0NA 3T3MB 2KX7A 3BDVA 4WY5A 1Q0TA 2LRHA 2VHQA 4XM1A 3VVBA 1BN7A 2YVUA 5CLHA 3G2QA 3GGDA 5AVWA 2FQXA 1NVXQ 4KGXA 3B2NA 3S6JA 1E1MA 4A27A 3VKVA 4YAUA 5IF9A 2PBZA 4UUBA 3ZLVA 2BRUA 2OVBA 2V0CA 4F97A 4EA6A 1E58A 3LNCA 1Q0ZA 4M98A 1PT8A 4HJRA 2PPLA 4MZXA 4A2QA 3E84A 4P92A 3UJNA 4N49A 1HLPA 1QB7A 3ZUPA 4BN5A 5I9LA 4EB6A 1QKJA 4DB4A 5HFJA 1OI7A 4RPHA 2AFIA 4UU0A 5GZ6A 2BMVA 2VYVA 5MFZA 3U4MA 4L07A 3FNQA 3FOBA 4OLBA 3QWBA 3PZBA 3DTNA 3GU3A 3WP1B 5JW6A 1XP5A 3OQOA 5CJ2A 1T2AA 1UJ5A 1GYQA 4UVEA 1Q91A 1QIHA 1E9BA 2AFIE 1H23A 2YWGA 1KOLA 2V7PA 4DIKA 3FTFA 3KHKA 2XE4A 1HYHA 4IGEA 4DV0B 2YKGA 5CVCA 1NTOA 2P79A 1UP4A 4MA0A 4QHTA 4JELA 2FI1A 5SZIA 1RWXA 3M70A 1WDKA 3VR6H 3RFCA 2PKRA 1JJ7A 3E9ZA 4TS4A 4Q4DA 2VAPA 3AUUA 4BLQA 5JXJA 3QJ5A 1B0UA 3MBIA 1IEVA 2G4VA 1E32A 3OG9A 4IFBA 1XAIA 3QVTA 1OILA 1N2SA 4BNNA 2LKCA 2WM8A 1Z0UA 3ML1A 3HJTA 4ROTA 4TXJA 1QSGA 3GT0A 1GZ4A 4Q1VA 3QF7A 2QQ5A 5CM2Z 3LKZA 3QPUA 5ALPA 1U7HA 5DF1A 1D7OA 1P7YA 2A1UB 1YFLA 2HR1A 5BNFA 1TZKA 3D6UA 3ZV7A 1JHUA 2UZ4A 3RNOA 2D7DA 4XLTA 5LBIA 3WHLA 5MN4A 1V16A 2O7QA 1C8LA 1G9SA 4CNQA 3PS9A 2GPBA 2PRKA 1XZMA 3EXEB 4HX2A 5AVJA 5LQDA 3RC8A 1S2GA 2YMPA 4P83A 3R8XA 5ADUS 2WTMA 1UBUS 1E3EA 4Z3KA 2VDRB 4N9WA 1BVUA 2C20A 3PR3A 4C0AC 1ARZA 1ZW6A 2J0EA 4DV6B 3AY6A 3UFXB 3BGVA 4JODA 1Z2EA 3JPYA 4JBIA 3ME5A 4LZNA 1NXTA 1T3ZA 4DDUA 5JI3E 1R6UA 3AF6A 4ENSA 4QFMA 4R2MA 1NV9A 2ZR9A 3QYAA 3W9BA 1CPYA 3OJFA 2RGBA 3KFXA 1ZK2A 1V6CA 1MGOA 3FLBA 2F2TA 2GLTA 3Q98A 3QEMA 2AXQA 2PZGA 3W5CA 4INAA 2X7JA 4JYBA 1M9NA 3ND9A 3MG9A 2ZSEA 4G3XA 5JXHA 2XCRB 1KJ8A 2GPTA 4UNSA 5TE9A 4DSTA 4JV5B 2Q4TA 1DC4A 1P8JA 5M29A 3BIXA 1XDWA 2C4NA 3I83A 3K0EA 5SV2A 1A95A 1ULZA 2P6OA 2QN9A 4YCCA 2V5VA 1AD2A 3HKCB 4LE2A 2TS1A 4DXHA 2GHIA 3U9TA 2IXDA 5EXSA 4IJKA 3UHPA 2HMUA 4OM7A 5BY2A 4LCBA 4AKEA 2XD9A 2ZUEA 3R6DA 2WJZB 1NVUQ 1R8XA 2GA8A 3QKSA 3TL3A 2HU8A 3UMJA 3W8NA 2NO5A 4XFJA 4CIXA 1P75A 1Z6ZA 4MGYR 2XXJA 4C5BA 4JYPA 2IX9A 1NUUA 2Y0EA 3PL1A 4JHXA 3ROXA 1V8PA 1NW5A 1TTQB 3L84A 2CVPA 3DXZA 2PX0A 4M76B 1ACJA 3NANA 1MB9A 1ISJA 4L1KA 3CG0A 3BE4A 3F5QA 3GRZA 3TB6A 5I8WA 1TA0A 1FUUA 3FPEA 1IN7A 1AXEA 1N36B 1U2PA 4F45A 1LH0A 4K9QA 4J9UE 3HXPA 4E21A 4LHZA 2HYIC 4A0SA 1CK4A 5BQOA 4P7KA 5BWOA 4D3XA 4HP8A 1VMAA 1ZICA 3WQRA 2I4RA 2FN3A 221PA 2OUKA 1N2XA 3I4FA 3UB2A 3KQOA 5I4BA 3I53A 2CXNA 5JD6A 1VGRA 3JATA 3LF2A 1NBEA 4UE6A 2D06A 3L43A 2E2WA 3R7DA 1DAOA 1GNTA 1JHQA 1LPBB 1MV8A 4EDHA 5KTKA 4F2DA 2NGRA 5I4KA 2B9VA 5G4KA 4F92B 2JGDA 4E1VA 1T1JA 5EJEA 4LDAA 1IXSB 1XQ6A 4DLAA 1F38A 1VYHA 2QTWB 2AC7A 4LBZA 4XUCA 3RVDA 1NUAA 1Y33E 4HV4A 5AHRA 3UB3A 3CYFA 3PXUA 3VH2A 4ABTA 2RK6A 1ISGA 1SXJC 1L9KA 4Z4EA 3DR3A 2P9BA 4HTAA 3O0DA 3DDNA 4WH0A 2CXQA 2HU5A 2R96A 4H08A 3DP9A 2OKCA 5JSFA 4A6DA 1KYZA 1X7DA 3I6ZA 1O77A 5LQMA 1ITZA 3K1ZA 3RABA 3L4KA 4GKAA 1GQYA 2R4TA 1EA5A 2XMGA 1EE2A 1OQAA 2QPLA 4HWGA 5LOVB 1QH8A 1ZIOA 4G4SO 4LBVA 3SXUA 2XMBA 5T7BA 2EBFX 3H0CA 5BSFA 3HC7A 3LWBA 4C4PA 3Q3JB 4V0ME 3DTYA 2CNDA 3DE6X 1UXJA 4EZBA 1IAQA 4ND8A 2VXCA 3FFBA 2YN2A 4DMMA 2J1LA 3Q2KA 1LU9A 1ZNWA 1K7YA 1JHVA 3HI6A 3SQDA 4BPRA 4N41A 1CFZA 3CVWA 3AETB 2WD7B 2XVXA 1O0SA 4GC9A 2AXPA 4H6XA 4KP7A 1KFJB 3ZJ5A 3U7FB 4OKSA 4AY5A 1A8QA 1T0JB 4BO6A 1R12A 5DW3A 3DPSA 4RS3A 5ESWA 3WIBA 3R0JA 4D43A 3FWHA 3PSHA 3K70D 3WI7A 1BRTA 3ESAA 1NI5A 4GYJA 4KPYA 2W6IA 1Y6JA 3HSKA 4M87A 2BBTA 2ICAA 2G9QA 2RAFA 3ON5A 2ZZMA 9LDBA 3EEBA 1QHSA 1RXUA 1VGVA 2RHTA 1KS2A 2P75A 3DLCA 1KFEB 2NU8B 5ADHA 1W36B 4X1IA 4ZQHA 4BNHA 3KS9A 5EKDA 3AFHA 2R9VA 1CZHA 3T0GA 4EATA 1ZRSA 1WPGA 5SZHB 1WQ1R 1DWQA 5DIFA 4E5SA 2ZROA 2IDKA 1HYBA 1MAVA 3FTCA 4O63O 1DKQA 1R8QA 1U1DA 2HRCA 5JXGA 3TQFA 2C92A 2V45A 4G4GA 4JJ7A 1QTNA 4TKUB 4EJSB 2GJ4A 2HUNA 2EKBA 2J46A 1B93A 3KKPA 4HDQB 4CT0A 2GK4A 2R6FA 3TK1A 3ZY4A 4AIIA 3IL2A 4A7PA 1EVKA 1NAIA 1CB7A 1Z7WA 2R84A 3ROMA 3VJMA 3WK7A 2PUFA 5AI9A 4D9IA 3QFTA 3RRYA 4DLPA 5BORA 5JCOC 1N1EA 2FZLA 4K6CA 3IUYA 2YFYA 4C0KA 3V4ZA 3KTDA 4R84A 3HXQA 1H4SA 4J3JA 3A10A 5DHRA 3RC2A 2MSWA 3ZZ1A 2VH2A 1CJTC 1PZXA 1Z2PX 3GELA 2JGMA 1F0NA 1Z6PA 3VZBA 4CLHA 1GLGA 4ZCLA 4EITA 1GG5A 1NXVA 3UM9A 2B1IA 2WJPA 5TJ9A 2I55A 3PNSA 3M6LA 4B09A 4ZOBA 1RWWA 4JENA 3WKCA 3G02A 1NBMA 2NZ2A 1MIHA 4HAXA 4GRDA 1NJ2A 4NOJA 2VTBB 2ZUTA 2JI6A 1Q7TA 1RHRA 3L1JA 1C3VA 2Q0XA 2ZDGA 4GQAA 4DV7B 2XB6A 3ESBA 1FDOA 3RSCA 1DO2A 2AV6A 2VP9A 3R6GA 1WLSA 2HJGA 1T2CA 5IP5A 5KOYA 4QUJA 4XOUA 4HH0A 1NBME 1GUDA 4HFRA 3ZIAD 1RHJA 4DYHA 5EXXA 2UVQA 3ZKWB 1CT9A 3JR3A 2XCSB 2CLKB 2RHGB 4ZVLA 1I32A 3L46A 4E3WA 2H0AA 2NG1A 3E15A 2FN8A 4A03A 1U1GA 1Z5UA 2I3DA 4AK9A 1JDTA 2ZCVA 1XN4A 3CO5A 3T3NA 2PDAA 5ESXA 4ND5A 4D8UA 1VPVA 2LNDA 3EVEA 3SFZA 1RLIA 3HRKA 2AS0A 4BFZA 5BW5A 1T2UA 1JFVA 1E7QA 2H1IA 4N3CA 3GG9A 1N5OX 5JHGB 3AHFA 3QTBA 4JI7B 6REQA 1A8HA 1SUIA 1UDWA 3AW9A 3TQQA 3CZ9A 2E85A 1HFJA 1FYWA 2WA2A 4LC1A 1H05A 3LUJA 3OC6A 3SKVA 1T5DX 3DTVB 2ZE8A 4KPGA 2VL7A 2A0UA 2RCNA 3QK7A 3TLZA 3GDFA 4HWKA 4JC0A 5A7FA 2ZWAA 5DM70 3B6MA 1U4NA 2EJWA 4YRGA 1QPGA 1V11B 2JRCA 5J5AA 1NC1A 2ECFA 2HMAA 4GXNA 2ZRMA 4ERNA 4RXUA 5JU6A 1SCKA 1BH6A 5G40A 3VO1A 4QM6A 4PLCA 1WW8A 1VLVA 3B9RA 3H5NA 3P97A 4YEDA 5C5IA 3LT4A 4G86A 2BFFA 4MWBA 4OI2A 3HZZA 5FBWB 3NT5A 3WGJA 4DA0A 2O19A 1T25A 3JQBC 5JADA 1RTKA 3O5AA 5BWMA 2ST1A 3T3IA 2VDQB 3REGA 2I6FA 1JIKA 5FWDA 3ABRB 4AP9A 3LY8A 3L6CA 3HDHA 5H3CA 2Y1DA 2PD6A 3TM5A 3DMPA 4N1AA 3K8OE 4DMRA 1V5GA 3EVCA 1IN4A 3ROZA 3B89A 3SPXA 1IB0A 3CGWA 2HLDD 3I2YX 3L18A 4KYIB 1G3RA 5FBZA 4M83A 3CBGA 1TK9A 2FLKA 1BEEA 2CYCA 2Y1GA 4OUDB 4WJKB 4WXMA 4BC0A 3LBNA 4Z4CA 1V9LA 5FL3A 1CIPA 2CY0A 4OBEA 4W5HA 3URMA 1KDRA 2NSJA 1K6JA 3A4IA 4P34A 5BSTA 2JH9A 3QIAA 2I76A 4WOKA 1W0KD 3OLCX 5CB0A 3JAKB 4U0JA 2EG9A 5DHAA 4C2UA 4F6RA 1KSFX 3L9WA 5KWVA 5IMSA 1JR4A 2ZT6A 1T8PA 1R37A 2QMQA 4X1KA 4LYDA 4CM9D 1QRAA 5EJ9A 2PE5A 3ICPA 3GBSA 4IJQA 2JGKA 4G0YA 4ZT7A 3PCXA 3TLMA 3E61A 1NXQA 5C32A 2GFIA 2NPIA 3H97A 5I47A 4DIUA 3B1YA 2XYQA 1QCYA 4UMEA 1QGYA 1QYXA 2X8JA 3O83A 2WRZA 3LDHA 3PR2B 2FZKA 2DUWA 2E5FA 4HNQA 3R9WA 2DFNA 3DKRA 2OCLA 1TKAA 3B1FA 2C4UA 1C1DB 1QAMA 1TJ4A 1F2TA 2P9EA 3DZKA 3E9EA 3EIEA 3UCFA 4W5WA 2FZVA 3UA3A 3NHWA 1U3GA 4HNGA 4J0FA 13PKA 1TJ3A 1Z68A 2VHUA 4ENPA 3UJDA 3WMWA 2WU1A 4FGLA 4QGSA 4WACA 5CDYA 3I9FA 3FKSD 4B2PA 4J0QA 5ITZA 2VHZA 1ADGA 3GEIA 4O4JA 2MT9A 4GP6A 3EOZA 4MVJH 1ZIPA 4UUOA 2XWQA 1Y9JA 4WL0A 1G41A 1SC9A 3PYMA 4IDCA 2GK3A 1KMHA 4I6GA 3N3BC 4ZHQB 1C0PA 1QX3A 4Y18A 1KQOA 3WHPA 4CJXA 5A3QA 1RCUA 1H6DA 5KHOC 3PGXA 4KIGA 3HDYA 1CF4A 2VNAA 2QQGA 3LPDA 4FCVA 4X9XA 2P9CA 5I9SA 1T8SA 4IRXA 2YWCA 1J1IA 3W34A 2RMKA 1WR8A 2BYTA 2G6TA 3DFIA 2C29D 2WTEA 3I5MA 3MBOA 3RRNA 3NAMA 2P0EA 2V65A 5AW3A 3J7TA 3CH5A 2ZRNA 3GZNA 3DCYA 3SDBA 3MIIA 3UVEA 3O8RA 4ISCA 3ROKA 2ROQA 5JJLA 2XIQA 3KM0A 1FK8A 1Z3IX 3LYAA 5ALGA 1MOQA 2IBMA 4GE0A 1GR0A 2P0AA 2PRJA 5KOHA 3D8SA 4XQEA 1YMVA 1TYCA 4HLUC 1L5KA 2JIZA 3UWKA 1BHO1 3PPYA 2IS2A 4J07A 3SD7A 4M38A 1D0VA 2ZI9A 3V8BA 5IAAA 2P2NA 3OZWA 2X2EA 4X71A 1FQJA 5E2IA 2L0XA 4EQ6A 1JA0A 4F12A 1CHNA 1UOPA 3BF8A 2MR6A 4CI0B 1GPWB 1MABB 1PS9A 1EFCA 3CSDA 4ZAWA 3RVPA 1EWQA 5IVIA 1QIDA 3SC2A 4AULA 1EUDB 3R23A 1PR4A 1J2JA 2WUFA 4N5HX 2F1JA 4QDOA 4BQQA 4DW8A 1FRFS 2I9PA 1PNVA 2WKWA 2VHWA 4B3RB 3BOSA 3IVAA 2GN1A 3IKLA 3ICWA 5G41A 2AMLA 1US8A 2GEJA 3G79A 2V4MA 2O20A 1Q2UA 3QYJA 3FKJA 3K1AB 4OK3A 4WBXC 3TBKA 3ZTTA 2W93A 4A4DA 3ABZA 2BH2A 5K8LA 2HFKA 5IXJA 2WWFA 1D1TA 2VWHA 2XOEA 4I1YA 4NWIA 1J99A 1BO6A 1M6NA 1P6UA 1Z5WA 2WU4A 1GGVA 3DG9A 3LECA 5T67A 1J9EA 1XQ9A 2SHKA 3L06A 4P7GA 2Q7XA 3FB1A 3OSUA 1W4ZA 3RG8A 3KALA 3H4MA 2FHPA 1ULHA 2XYHA 3JALA 1SB8A 2TECE 2C83A 5KYGA 1BDBA 1FU8A 1VLQA 1N8TA 4M8LA 5ALHA 5EOVA 3B2QA 3U3ZA 2CJWB 2GJKA 4G41A 3A4LA 4QNRA 4ZO6A 1BG6A 4X92A 3UH1A 2NV2B 1VIMA 3CPHA 1QS0A 2XE8A 3F9RA 1P19A 3Q88A 1E4YA 1WY7A 2J5KA 3R0QA 4JQZA 4QJ4A 1A8SA 2I6XA 4UM8B 5AK6A 5IDVA 3ICQB 1RYFA 2G07A 2NYRA 2ZI4A 2QP9X 2AR0A 1A8PA 1E6KA 4GX2A 4AF6A 2RHLA 1QHIA 2VRCD 2O8EA 1R0XA 4GI7A 4MKHA 2I65A 3D3QA 3K53A 3WGQA 4E5NA 5HRCA 2J5XA 3GJ8A 1UBFA 4ZIRA 4GFDA 3RANA 1OXUA 2I6SA 2F55A 5I7EA 2CNKA 1DC8A 4IH9A 4M9ZA 2QLTA 4WKGA 1NHWA 1TUEA 2BV3A 2XTJA 4JFAA 4IQ0A 1TAQA 3GPCA 2C99A 4R16A 2Q3DA 3RS2A 3TXXA 2BLLA 4EY8A 3OT4A 1JILA 2AVDA 2ZRAA 1MVOA 2XPCA 2XTZA 4IIJF 2J0UB 1RRGA 1TKBA 2FPMA 4I81A 4PGHA 4P53A 3HR8A 1QV7A 4FHCA 2C3YA 4DBLC 3L7JA 3R7WA 1USVA 3OT5A 5FB3A 1PJ3A 1ATIA 1CNEA 2AOXA 4QDJA 2HREA 1SCQA 1IJBA 2GNOA 4PFQA 5FF9A 3RT7A 4GI3A 1WMBA 5DBFA 4PBSA 2W6NA 3OHPA 2UKDA 2VJOA 2Z2JA 3DV9A 4QO8A 3E18A 5AJHA 1L4MA 4LJ4A 3U26A 2RHRA 1Q84A 4OGKA 1TAUA 1KSGA 3EIFA 3SKXA 3BZUA 3V00A 4YV1A 3TEMA 3SEFA 3G0OA 1X7XB 4HDRB 4IO0A 1K5HA 4KOAA 1Z8NA 2CDBA 3U60B 2Y0PA 3EXHC 3SIWA 1EFDN 7YASA 1K8RA 2ZYWX 3LC1O 3PQ7A 4PR0A 3CN7A 3FFTA 3ZK7A 4NECA 4E15A 1C2TA 3EOAI 4JUAA 4YP9A 3X1DA 2YNMA 1ZIXA 3EQZA 4CGYA 3ELYA 1G5RA 1YB6A 4GM0A 4MEAA 1BW9A 3SI7A 3GEDA 3OCCA 3H9CA 2HPVA 2P69A 2WNSA 3N2ZB 3F67A 1JR3A 1SCDA 1Z06A 3CGGA 4YRRA 4QASA 2BC9A 2B83A 5AK3A 4J1SA 5H7XA 4F2WA 2HNAA 2QXTA 4Z2YA 1FUYB 2IPXA 4RKWA 3K7EA 3T61A 5KX5B 2I4TA 5C1IA 4R3UC 4AUMA 5CD1A 3A1VA 2K7ZA 3CIFA 3VM6A 1JG2A 4FNAA 1L4YA 1QPBA 4C3OB 2XVZA 2HU2A 5F77A 2NW6A 5K3FA 4CM8B 3P52A 4EELA 4ND3A 3RQSA 3M1YA 2Z4TA 2DQSA 1CUCA 4YV2A 4I6EA 4OOEA 4TLDA 2XZOA 3UUGA 1PT9A 3GFSA 4I4LA 4BN4A 3GLIB 1NV8A 1SXGA 2EFYA 5I4CA 3PVCA 4RVGA 3IQDB 3AFGA 3DEAA 2DSNA 4AZ0B 2A6PA 3WWYA 1KVRA 3RVNA 1YGYA 4FYVA 1QRRA 1GU0A 2O1SA 2O2SA 2HA3A 4CQMA 3RSHA 1DXHA 1ZOIA 3IO3A 4L9RA 4TTVA 1DJQA 3D8RA 4GYYA 5GONB 3QSGA 2R7LA 4EAQA 4E4TA 5BMVB 1KWGA 2EKLA 1APBA 1BHSA 2Q3FA 3F7MA 2YWEA 3HO6A 3MIZA 4RLHA 5C8DA 4HRXA 2D2VA 5D87A 1L5QA 1H0KA 1XDUA 3C6BA 4FX2A 2H29A 1ZLXA 4UAVA 3HJNA 1ZO8A 4M1WA 1RLMA 1GO2A 4WFQA 5AIAA 3NZEA 1KJYA 3P8ZA 3P9KA 2GR9A 3PDWA 4WGFA 1T1IA 4G9GA 4CEIA 4UE3S 2XQFA 1EFRD 3S2SA 1PWHA 2DKFA 3QA3E 5IDXA 5FOUA 5GIPE 2I8CA 4DUGD 3FSGA 3Q3EA 2HXGA 4KCGA 3CJTA 4ZVPA 5BVGB 3X2FA 2G06A 1TTHA 4ZXFA 3DFFA 1G6HA 1F51E 1U1FA 1E77A 3B3QA 2W2XA 3W1EA 4I4TB 3TXAA 1CR1A 3RFUA 5MDHA 1UFQA 1AHHA 1TQ8A 3R8CA 4BV3A 1TO2E 2CV1A 5BOSA 4DDMA 5A0FA 1NNLA 1WCV1 1HL3A 2Y67A 4MZDA 4MRAA 3W5IA 3FWYA 3RSOA 1VE9A 1ZR2A 4O1HA 4H1UA 4WLUA 1S2DA 1KJWA 4RHCA 5F51A 3TRHA 3LUKA 2AJLI 4X1YB 1UBLS 3ZLJA 2BWJA 3DOUA 1PL7A 4NS1A 4YCSA 3OZDA 3TUIC 1JKJB 4KK3A 5ITZB 2PSEA 2V7VA 3H11B 2CHGA 3IMGA 4E70A 4O3MA 3WGMA 2NVWA 1NM5C 3JYQA 2AMFA 2CNWA 1XU4A 3JU3A 3LSYA 3NBYC 4KUHA 5D3KA 4CL2A 3U4QB 1DHTA 2FCRA 3NWBA 1HSOA 2YHAA 4FGJA 5I3ZA 4WE3A 4WT7A 1ZITA 3H3FA 4RGQA 2C8JA 1I94B 3DBHB 3DFKA 2GB4A 3WNBA 5SY9A 3BRWD 5KJEA 1PTKA 3VR5H 3JZIA 4LC9A 3S1AB 1T3TA 3N5KA 4Y6OA 4M1MA 1I3KA 3C3DA 3F73A 4B6PA 4NZYA 1AHPA 1DZIA 3GJQA 3M6AA 5BUZA 2J6HA 4EPXA 3LYHA 3ZDEA 2JDID 4RIHA 4I5IA 1CUVA 2BGIA 5KSOA 3DM5A 3OZAA 2O57A 1E1KA 3GHHA 1K08A 2X0FA 1YU9A 1G7CA 5KAPA 3VBCA 4PG8A 5K8IA 2I1WA 1XD9A 2ZSKA 3TQIA 2DU8A 2MSKA 3UMFA 3WWPA 4GL2A 2OP1A 4WEOA 4N0DA 1ZVQA 3BDAA 3T1OA 2OHJA 1M7BA 1JWLA 1ZEMA 5IXSA 2VTKA 4FWIB 4EGQA 3FHTA 4JOBA 1I01A 1OREA 2BFDB 5KINB 2GX6A 3MINA 3MTDA 1UIRA 2W6JD 1EQAA 4LBYA 1KWKA 2P11A 2D0PB 2C9ZA 3OE7A 4EY6A 4GP7A 5EIAA 1ZNXA 1FW8A 2OZLA 3L82B 4LXGA 2WK1A 1GG9A 2RHOA 2ZIUB 1YK1A 4QRHA 3KFVA 4AVYA 2ECQA 4BDTA 4ER0A 1JGTA 1S8NA 1ZL2A 4WEQA 1FCJA 1X8LA 2FKNA 2P5SA 4URFA 1V6AA 2XYVA 4R2WA 4BLSA 1FW6A 1UWKA 4RFSB 2M32A 5K0JA 2ACKA 2EKDA 1YMQA 1TZ2A 3R3VA 1FYEA 4HB0A 2R8BA 1WXEA 3NIBA 5EZ6B 3RT1A 1G5FA 3T6KA 3ORFA 1QFZA 4BJ6A 5C4GB 3QU9A 2YHSA 1XZIA 4ZCQA 4BNYA 5I7VA 2VJAA 3ABQB 3Q3IA 4UTPA 1E7WA 1NXPA 1PGPA 4OQMA 4X8LA 2W7TA 1J70A 3UK1A 1IL0A 2GS9A 2BFBA 2JFOA 2WAYA 4DG9A 5K6AC 1W88B 2JLAA 1MJGA 1Z4OA 5T57A 2ORVA 5EJ7A 2P2LA 5TLSA 3U4IA 3EAFA 3QBVA 1TM2A 1CSEE 2PY6A 1XNGA 1ZYUA 5KYVA 2AHOA 3DPUA 2RGGA 3DVAB 1N5JA 3ET4A 3FUCA 4RZIA 4B71A 4BX3A 1YL7A 1ZY2A 4E6EA 1ZI6A 4D44A 5I01A 3D3EA 1K0FA 1P3JA 3E5NA 3NLLA 3P2JA 3UB4A 1Z6TA 4A8PA 2R8PA 3PXAA 2F59A 2ZVQX 2R48A 2YWHA 3PNLA 5J5VA 4QDZA 5TT0A 1PUJA 2R1ZA 5K0BA 2O0MA 1ZVJA 3SNKA 2GM3A 5CPFA 3HJAA 4A10A 3ADKA 1Y1KE 4MX8A 3TZKA 4TVSA 1DBVO 2Q7DA 3I9MA 2WV7A 1CQJA 3CNLA 2BL4A 4N6GA 3DF7A 4KIUA 2OOKA 4C14A 1TCAA 3BB3A 2AK2A 1KO8A 3GV0A 2VJDA 2VIIA 3D3NA 3IODA 4A0HA 3TGLA 2VJYA 1AZWA 3T4PA 4B6QA 3L5KA 5EJFA 3ZWVA 4XUGB 3U3KA 2AA3A 5HIMA 3BWMA 2J9GA 1JS1X 1KS9A 1SKUA 4FHEA 4RU1A 2VCEA 3PEEA 3O8QB 3H2YA 3QW2A 1MV5A 3WC4A 5FL7D 2IIBA 5CCXA 1KFKB 4FW8A 4ZQBA 2AXNA 4FFPA 5JD3A 3AKEA 3HXLA 4JUIA 1ECPA 3NAZA 1AKWA 3PEUA 1T5SA 1JAZA 2AN5A 2OFPA 3NIWA 1X7GA 4FFWA 3PQ3A 4LRTB 4LSWA 2QAIA 2J31A 4KNYA 1S3FA 2UUOA 3TQCA 3TCNA 4J7AA 3VYSB 2KMLA 1Q83A 2GCPA 1KH3A 1ZCFA 2DE0X 3K9GA 3BG5A 4EO7A 4Y3UA 1B3BA 1QUEA 1YZNA 3GP8A 1T9HA 3NHSA 4QJ5A 4CBVA 3FOAA 3V55A 3BGSA 1A4UA 4B3HA 1O9HA 1WU7A 3QEKA 4IUBS 4JKYA 4DUZB 2G7ZA 3C14C 1E3MA 4L28A 2D7CA 4KMSA 1J5EB 5LN1A 3ZS9A 4CKWB 5G4LA 4ALIA 4QUBA 2PEZA 2RIRA 4ZEVA 5CB6A 1QP4A 3EIUA 1G4AE 4XGRA 3RS9A 1ISPA 2XA9A 2IDJA 1GCIA 2V3CC 4GMKA 1WPQA 5CEJA 2C3PA 1ZI9A 3H99A 3DMTC 3MWJA 4MPDA 1QR2A 3HGTA 3S2IA 3AR9A