2BMEA

High resolution structure of gppnhp-bound human rab4a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
176
structure length
176
Chain Sequence
SETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED PROTEIN RAB4A
publication title High Resolution Crystal Structures of Human Rab4A in its Active and Inactive Conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 62
structure length 176
sequence length 176
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2005-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bmeA01
3ADDA 3PEUA 3SOPA 3ADBA 4QHYA 3IKJA 3TVDA 1FX0A 4KFTA 1M6NA 3L0SA 1YRAA 4GOJA 4OI2A 1KSFX 1Y63A 4PHHA 2ZROA 3ZVRA 2GVDC 1JR3E 3ICQB 2YOGA 5JSZA 2FGKA 4BZPA 5HCIA 1TQ2A 1Z2AA 2QPOA 4HB2A 4WXPA 1KI4A 2DHRA 3CZQA 4B48A 4BFUA 1W7AA 2QEQA 2B21A 4FMCB 3D8BA 1HH4A 3L8YA 2DB3A 1CTQA 1DARA 5E95A 5C4MA 2WJGA 1PLJA 1W36D 3ICEA 1CRPA 5FUXA 3LVRE 3P1JA 4ACBA 2IYZA 1KDRA 4BEBA 2BMJA 1FL9A 4LV6A 4B71A 2EWVA 1UBEA 4QL3A 3U3OA 4W7SA 2CE2X 5E7JA 4C0JA 2VBCA 2PEZA 4KFSA 3MSXA 4F4IA 3KKOA 4URWR 4D4KA 2C8VA 4HUTA 3BK7A 3GLFA 4ESVA 4ZKEA 2O0HA 4PFSA 5HZHA 2F55A 1NLFA 1QHNA 3PEVA 4UXIA 5AUQA 1VYUA 2PT5A 3MFYA 4LYFA 4C3ZA 3CF2A 3SI7A 2BBWA 2ZVQX 5FI1B 4B47A 1ODFA 2QPTA 3JVUA 4CYMA 1IAQA 2ZI7A 3E1SA 3NBXX 3WHKA 2QL6A 2F9MA 3F8TA 2IA5A 2VLIA 3GQBA 4Q01A 2A7QA 2XJ4A 1GM5A 1G4UR 3P32A 3HU3A 3RANA 2RGNA 1NJFA 2H8KA 4NCNA 4DSUA 4B2PA 2JJ2A 5CDFE 1Z6XA 3SJCA 1JBKA 2ASEA 4DHEA 1AKEA 4HUQB 4NCIA 2IWHA 2OHFA 2ZRKA 3WP0A 2HT1A 4OL0A 1E9AA 1OHHD 1F2UB 4GI7A 4PSAA 3THWB 5JEEA 1D9ZA 1RJ9A 3VMFA 2ZRJA 2ZRIA 2WJVA 4ZV4A 2BVNA 4U5XA 4DEXA 1NVVR 4QM7A 2A78A 3GJ7A 5P21A 2OSBA 4KVAA 1MR3F 4KAXA 1E96A 1Q22A 3I5XA 1IN8A 3CPHA 2GESA 3EA5A 3ZQJA 1GRQA 2CVFA 5H8WA 1RIFA 2P67A 5B58C 3EASA 3HR7A 2DCUA 1KGDA 1Z0IA 1CP2A 3QNUA 4LBVA 4XD7D 2C03A 3HWSA 1N5LA 4PC3A 4A4DA 4Q1CA 2PL3A 2IUSA 4B35A 5K8TA 5LPNA 3EG5A 1GKYA 1ONBA 2QPAA 1FTNA 2OG2A 3KXLA 1QHHA 3T1QA 2ZYWX 1E2MA 1WB9A 4CEHB 3QF7A 5KDLA 4MUAA 4D80A 4K81B 4BUJA 3P27A 2J45A 4M9QA 5L3SB 2CMKA 3C8UA 4RD0A 2FEMA 3QEOA 3K0AB 2BHRA 4B6FA 2ZJOA 1KK3A 3FPAA 4ON9A 5DHFA 3H1TA 3AEZA 3BOSA 2VSOA 4LHXA 5FOUA 1WE2A 2O5VA 4EFMA 1W4CA 4JZKA 5LDDC 4ABYA 2W00A 2HCJB 3EIQA 4ITRC 5KPJA 4BZXA 1YZKA 3SDZA 1E9FA 2GBLA 4LGMA 4DRZA 2FG5A 2I1QA 3WMFA 3KUCA 2OBMA 3FMFA 5EJEA 4DCTA 2G6BA 1VMAA 3LH5A 4X8OA 2W2TA 1E4YA 1QHYA 3KQHA 2IYLD 4B2LA 1YZNA 1MABB 2OAQ1 3BB4A 5FL7A 3W5JA 1OT3A 2N42A 3IPXA 4A8JA 2ZRNA 4V0OA 2CK3A 1KOFA 1QF9A 3NXSA 4Q21A 4RFVA 2GJ8A 2GRJA 3BH7A 4RZUA 2BEJA 1PZNA 2XOKD 4TLBA 5A4JA 2GZAA 3IO3A 1H8ED 4O0MA 3U2QA 3SEAA 2HYDA 5EXXA 2AFHE 1G9XA 3QPWA 3AP3A 4NYJR 1XCMA 2O8DA 2IK8A 2Q9CA 2AHOA 2AX4A 3TQCA 1EX7A 1S0UA 2H17A 4L9SA 1AJEA 4AKHA 2W0SA 3QXJA 1CR1A 4IVQA 2GXAA 4C4PA 2XSZD 4N1AA 5BN5A 3JZMA 2NPFA 3GLGB 3CRQA 1Z29A 2C9OA 1GL7A 4ZKDA 4R2HA 3CWZA 4S2EA 2EFEB 2OO7A 5IK2D 1PLKA 3O47A 4KSBA 2FOLA 2RHMA 2FU5C 2O8EA 3QKTA 1TQ4A 4PAMA 1VCMA 1E69A 3GLIB 3ZVNA 1YR8A 3MWJA 1XZPA 2W6IA 2CL0X 3PUWA 2VF7A 2YWHA 3NC0C 3RS2A 1TU4A 3C7KA 3QXXA 5DN6D 2YZ2A 1L7VC 2BC9A 4NYIR 4TT3D 1G17A 3W6PA 1KO5A 1N6LA 2YNMA 2QI9C 1P3JA 4CEJB 4ZDIA 3U6KA 2WKPA 2ZAMA 1OYYA 4NKRA 3NC1C 1NKTA 2R9VA 4TTPA 1S2MA 3LW7A 3DVLA 3AVUA 4C0SA 4Q4AB 2QBYA 4MYCA 3AP2A 1L4UA 1BMFA 2GEUA 2D7DA 3FYHA 3EX7C 5SZJA 2EYUA 1KJWA 1SXJD 1UFQA 3WYFA 3OIUA 2QN6A 1ESMA 1G16A 2C77A 3HR8A 2OBLA 3K0FB 2RGEA 4BGDA 1WDTA 2ZTSA 2BCGY 2EVWX 4C0LA 1NNEA 4W5JA 4JLOA 4LJAA 3SE0A 5DHAA 1KKLA 2NIPA 5J47A 4Q19A 1N6KA 3CX6A 1NKSA 3GFOA 2FV8A 4P3YA 2UZIR 3K9NA 3ZIAD 5KO2A 4RKFA 3GD7A 2MSEB 3I5YA 2PCJA 3KKNA 3W3AA 2J0VA 2IS2A 3BFXA 1KTVA 1XP8A 3F0TA 1YZGA 1JECA 3CRMA 4LDJA 1T0JB 1TEVA 1EFRD 4Q5IA 1PVOA 1WA5A 5KTYA 1P2TA 3L0OA 4KJZA 4YXWA 5FTNA 4HLUC 3ZLJA 3KJIA 4M9XA 3C16C 4G5GA 4HAZA 2YV5A 4JBWA 4P33A 1RRFA 4D0LB 2WWXA 3OEHA 4JL8A 2Z4SA 1PUIA 2ZE5A 4DIDA 2BDTA 4L16A 1N5JA 2ZSEA 3GJ0A 2VYFA 2X77A 4KV9A 2PCLA 4BRWA 2Z0MA 5JCZA 2VO1A 1F48A 4IDQA 4AD8A 3I73A 3EPKA 2WWYA 4NP6A 4EFNA 1KDTA 3LBHA 1FTSA 2QTFA 1J8YF 4Q18A 1NSTA 2DYKA 4QBGB 2BMFA 4AKEA 3MWLA 1E2LA 3CRRA 1ZVQA 4XSGA 1T3SA 1W36B 4II7A 1E2GA 4AK9A 4OQLA 2Q9AA 4LJ9A 1AS2A 1MRSA 3QXSA 1GNQA 1EXMA 3CO5A 3UWKA 3RC3A 2IYXA 3F5FA 4XVQA 2XXAA 4D4JA 5L3VA 3KQLA 1RYHA 1KNQA 5EXTA 2PMDA 1ESNA 1SKYE 3LW8A 5HZKA 4R9UC 4B3BA 2ODBA 1AZSC 5IRCD 1FQJA 1XXHE 2MMGA 3VKWA 1N6PA 2CL6X 1G8GA 2HXSA 6Q21A 1BS1A 3VR3A 3AKEA 4IDPA 2NO7A 2OEPA 4WZAE 4D0NA 4ZCLA 4I99A 3PEYA 1KO1A 4O2RA 5AUNB 2Y8EA 1W0JA 2D2EA 3VAAA 2J0UB 3TBKA 2JGNA 2IBMA 1Z06A 1EWRA 2ZE8A 3OAAA 4TSFA 1IY1A 2VP0A 4NYJQ 3VU9B 3X1WA 1D5CA 1V5WA 4DLXA 3NTUA 5JHHB 2REOA 2F1HA 4D0GA 1P75A 4PXAA 2WPDD 1J90A 3Q5DA 2RB4A 1CR2A 4BZQA 1HYQA 3QJYA 4GOXA 3FKQA 1NBMA 1ZBDA 2NG1A 2IS1A 2W83A 2YJTD 4Q1FA 1GVNB 4JKYA 1RC8A 3TR5A 2WAXA 1ZM7A 4M1MA 4DBLC 2XTMA 3SHWA 2GXUA 3OF5A 3B1XA 4KBFA 1U2RA 4A6XA 4KYUA 4R2IA 1PJRA 2QT1A 2CLDX 3ZH9B 1W0KD 2D06A 4NYIQ 1NY6A 4RD3A 4LJ5A 2ONJA 1KSGA 2PZEA 1T3HA 4TLEA 3RS3A 2VSXA 3EARA 3IQXA 3ADKA 3W34A 1DBSA 2XB2A 1HT1E 1C9KA 5DYIA 5JWHA 4CZ2A 3ZQ6A 1P72A 1AGRA 1YZQA 4RY2A 5BWMA 1XD2B 4B32A 3RRMA 2KBEA 1LB1B 2JLWA 1JR6A 2WOOA 3CW2A 2I1VB 4KI0A 1XPRA 4HAVA 2JEOA 3OEEA 5FOVA 1QG4A 4V0LA 1IJEA 3MAAC 4MRSA 2A9KA 3DKVA 1GTVA 1SVIA 3PXGA 2HEIA 4GDFA 1A4RA 3MGCA 3SQXA 2XZLA 2IYRA 2GHIA 4FMDF 3OESA 4LJ8A 4YMTA 3MRSA 3IBGA 4QBFA 4KHZA 3BXZA 2BJVA 4UJ3A 4CGZA 4XWAA 5LB2A 4B33A 4F93B 3MD0A 3WNCA 4M22A 2QE7A 3BS4A 3AVPA 4UJ5A 1AIPA 2P6RA 1MKYA 3TVTA 2ZSDA 2QQEA 2W0MA 2R2AA 1UAAA 1AM4D 2JATA 2LKDA 3OZXA 3QIAA 4Q7LA 2OCAA 3AM1A 4URUR 1O87A 2ZRPA 2EFGA 5DISB 1JXMA 5DLQC 3ZJYA 3QVUA 4RZXA 1R0XA 2RHDA 3GJ6A 4CDGA 5JBQA 3U7FB 4DZZA 1ZD8A 2QMUA 4UKDA 1G7CA 4LPSA 3IILA 4Q66C 1GNRA 2NO9A 2C78A 1M7BA 2AK2A 2NO1A 3EWAA 4WZ6A 3EZ9A 3QF4A 1T5LA 1DAKA 2ZSBA 4R98A 4PQYA 1FP7A 2Q3MA 2WHXA 4E09A 3WNDA 2O8FB 4KFUA 1DPFA 1ZRHA 5H1YA 1XPUA 1JR3D 3BC1A 3MWKA 4QHTA 5SZKB 5F98A 3DHWC 5EUQB 4O2LA 1OB2A 1Z5ZA 1X3SA 3CBQA 1ANKA 3SFZA 1G3RA 2H92A 4FMBB 2Q3FA 4L5BA 2WSMA 1WRBA 721PA 2ZIAA 2CCJA 2DWQA 3VR6A 1W4RA 2A5YB 4B34A 2EWWA 5DNYB 4WVFA 3SS8A 4CT4B 4YONB 3M0EA 1Z3IX 2JJ1A 4LBWA 4QNRA 1IY0A 3ECCA 2WICA 3K0SA 1CKEA 3PITA 1KMQA 3TJZA 1JXOA 3KTAB 4IW3B 4YQFA 3U3MA 3V00A 3T61A 4G5OA 2OE2A 3EZFA 4Q47A 4P4SB 1E79D 5AUOB 2ZR7A 1F5NA 1SXJB 1Q3TA 1N0UA 3B1WA 3EZ6A 4OQFA 2FF7A 3ASZA 5J5CA 4BLTA 4TT3A 3T1TA 3GFPA 4U7DA 2FFAA 1SVWA 1JPJA 4PO1A 3DOEA 4YMVA 4BLOA 3V4FA 3K9HA 1A2BA 1W49A 1ZNWA 2GTPA 4TQUS 3K0CC 2YWFA 4QC2A 4AYTA 3LBNA 5JS8A 1G291 2VF8A 4ZPXA 4ASUD 5KNCA 3BFKA 1J2JA 4D25A 3EWSA 1YZUA 2W2XA 3DMNA 4OJQA 2FN4A 2IL1A 1AK2A 4J0QA 2OM2A 3T15A 1R6BX 4RD2A 3FKSA 4OHZA 1I4LD 2ZJ2A 2BBSA 4Q4HA 2P3SA 4IXMA 2FWRA 4N0EA 1Q1ZA 1KI7A 1IJFA 4MRVA 1E2QA 2FGJA 1W48A 5BQ5A 1TPZA 2PZFA 1Q21A 4TLAA 3DO6A 4KO8A 1P60A 2EW1A 4V03A 5JEDA 1XMIA 1DOAA 3SBEA 4DCSA 1IN4A 3QG5A 4Q9LA 4Z1MA 4F7WA 1YHNA 5CK5A 5FR2A 3K9GA 2BCJQ 3B60A 5AJWA 4LHYA 2QTHA 3CX8A 4ERNA 4XWKA 2GCPA 3DEFA 4OI4A 1SKQA 4I1UA 2D2FA 4MGIR 3UIEA 2BV3A 1XFAA 5JMTA 1S9DA 1UM8A 5J4VA 2ZI4A 1YQTA 1Q1EA 2WBLC 5KDDA 4TYPA 5G41A 1E98A 1II9A 3CNOA 4QGHA 1S3GA 1D2NA 1OPXA 3KKQA 3T5GA 2ZEJA 2IT1A 3BAFA 4PX9A 4LWZA 1GITA 2IF2A 4V02A 5BYJA 4MDFA 2FPMA 3J81k 3OE7D 3NG1A 3PENA 2DR3A 5C4GB 1XTKA 2QG6A 3UKDA 2FFBA 5G53C 1UBCA 3KFVA 2VPPA 2ZYTX 4URXR 3AKDA 2GNOA 1NF3A 4LYJA 4MRRA 4AY2A 1TL7C 3ZS9A 3W5IA 5FTMA 2PEYA 3ZDQA 3I62A 1FFHA 2P0EA 3FDIA 4V0NA 1W36C 4OHYA 4KSCA 2VTKA 1IXSB 3OIWA 4FMCF 1AA9A 2F43B 1UDWA 3NHAA 4A0RA 4IEIA 4IFEA 1RW4A 4HB0A 3SJAA 1IONA 3BJIC 1OXSC 1IXRC 3MJHA 1EFTA 2WJIA 2FH5B 1XCGB 4K46A 4C2TA 5E3HA 2HYIC 2QUZA 1G3UA 1E4VA 1ZC4A 2Q21A 3KXKA 5BN4A 1NG9A 2XNSA 2FSGA 1Z08A 3GLFE 5E7IA 1DTSA 4JVMA 2CJWB 2ZUDA 1II8B 4UNNA 4DUGD 4IXNA 1A5TA 2G3YA 4WA7A 3FOZA 1H8HD 1Q57A 1R7RA 3TW4A 4TMZA 2A5DA 4RVCA 3C15C 621PA 2V9PA 1Q20A 2WWGA 4XTCS 1DELA 2ZANA 3K53A 1CIPA 4DLVA 2H57A 4NL4H 5KSPA 3RAPR 4DC9A 5B30A 5L3RA 2ZREA 4Q9IA 3AF0A 4HLUA 1CXZA 3QXHA 2CXXA 4NTZA 5CB8A 1D8TA 2GJ9A 1HURA 1E2FA 5SZIA 4B73A 4FCVA 2IUTA 5JSZB 2MMCA 3TAUA 2CNWA 4HZUB 4E03A 3EA0A 2KSQA 1J70A 4B44A 2CDNA 1QVRA 1S1CA 5UKDA 1S1MA 2QENA 3GJ3A 4Q7KA 2Z6VA 2JIZD 5DIFA 4EFLA 1H65A 1ZAKA 5JI2E 3QKSB 4EUNA 2WV9A 2N1BA 1KK0A 5E7MA 2BM1A 4BFXA 1G7SA 2AWNA 4M9ZA 3U4QB 1JPNA 1E94E 2CLSA 2JLZA 3VKGA 2OESA 2GXSA 4RZ3A 2JA1A 3QSYA 3GFTA 1M7GA 1DAIA 3R9XA 1MO3A 2WJHA 1C4OA 1LV7A 4DLZA 3IO5A 1FUKA 1VG0B 1E2IA 3BWDD 4HATA 2HV8A 5CJPA 3THYB 1ZUHA 1TAGA 1HEIA 1IBRA 1LTQA 2JLUA 4B74A 3AVOA 4PO9A 1SQ5A 3F3YA 1Z47A 1NVUQ 2R44A 4PZLA 1AQYA 4JLBA 5FPYA 4TZ6A 4JKIA 2IX3A 1COWD 2GCOB 1ZM2A 3CPEA 3U7HB 4QNMA 1GZSA 1X8JA 2JLYA 4F38A 1DEKA 1RJ9B 1ZD1A 3I32A 1G20E 3T1OA 1EFCA 3KQKA 3UG6A 5HTKA 3OIVA 3T06B 2V7QD 4BLSA 2XTZA 1KSHA 1UKZA 1XZQA 1ZUIA 3SHFA 1IHUA 3CIOA 3LXXA 2IUUA 1X1RA 1VHTA 5DE3A 5J4KA 1QBKC 2CLCX 4JLAA 4JIMA 2ZUBA 3IIMA 4OHVA 4ILEA 1W46A 4TLCA 1G5TA 1U0JA 2F7SA 1N6RA 2J41A 2O0KA 2Z5FA 3M6AA 4M1OA 1JB1A 4RZ2A 2QA5A 4HUQA 1G8FA 1Z0AA 1Z8FA 4ARZB 1YRBA 3ZVLA 2W6JA 1X86B 1AS0A 2HLDA 1F2UA 3BBPA 1E9CA 3TKLA 3THWA 3KJEA 1SVMA 4GNKA 1BIFA 1JJ7A 1ZD9A 5HPYB 3AF3A 4DSTA 4EJSB 3SNHA 2P6NA 1OXVA 4RJLA 2ZR9A 1G8HA 4DLRA 4GMDA 2EFDB 1P2SA 1P4SA 2EYQA 3HP1A 3W8NA 1J99A 2ANBA 1M34E 1XEWY 4EPWA 5HKKD 1OLOA 1HQCA 4EKDA 1E2PA 2WJJA 4EAQA 5CB6A 8OHMA 2REBA 3B1VA 1OIVA 1G5PA 1UADA 1W5SA 3QPVA 3HU1A 3OFND 1F2TB 4HLCA 4HAYA 2GCNA 3MUFA 4BQSA 4M1TA 1G41A 1X6VA 4RKEA 3K1JA 3R9WA 1D6JA 2QSYA 3BFVA 4P4UA 1I4TD 3UATA 2H7VA 4RCYA 4CEHA 3KUDA 4DKXA 5F9FA 1KMHB 3QBVA 5JJLA 1SXJC 1P5ZB 4ZO4A 5L3SA 4PANA 1P62B 5EZ5A 1VDZA 2W58A 3PCRB 4GZLA 4IVRA 5IHPA 2AXNA 4HDCA 4JLPA 4GP7A 1TMKA 2V4ZA 2Z83A 1ZM3A 1P2UA 1OE0A 2IEYA 2ODEA 3K0AA 4IOMA 4AURA 5KSZA 4TMXA 4B43A 1F6BA 3KZ1E 4IRUB 3D31A 3DL0A 2QP3A 4I1VA 4Q03A 4EPTA 3RSOA 4PHGA 2ZU6A 1E1RA 4DLTA 3WRYC 3TSZA 2ZS8A 5DI9A 3KFXA 1WXQA 4DLSA 4PC7A 2QNRA 4MKHA 2N46A 2YWEA 2ZPTX 4GRAA 3AVWA 3P26A 1HA3A 2OCPA 4QOSA 1NSFA 4C7OB 4GFDA 5C1BA 2ZRDA 3TE6A 4LK2A 1ETUA 4ZDJA 3CX7A 1A7JA 2RGAA 2GEDA 2ZJAA 4G5QA 5FBRB 4QGAA 3RRZA 2D3WA 2J59A 1E1QA 2XB4A 3BRWD 5DI3B 5F9HA 3U61B 2RH5A 3SC3A 5CIWA 3RRNA 2QTVB 2ZRCA 2NMVA 1R2QA 4QGGA 2BJWA 3ZVMA 4MH0R 2GILA 3S1AB 2HF8A 2QAJA 4M53A 4QFMA 2XNDD 4PC6A 1OB5A 3B78A 1GILA 1ZIOA 2WWFA 3LX8A 5JWRA 4C9BA 1ZU5A 4MDEA 2RGDA 3GLGA 2WSSD 2F1JA 4G5SA 2GEVA 2FA9A 3FMIA 3TUJC 1Z22A 3FMPB 2QQ0A 4M1WA 1GP2A 1AZTA 1XTSA 4M2LA 4LX0A 4WXRA 4BECA 4Q1EA 3AF1A 4NONA 3GLIA 2YC4C 3VNVA 3DDCA 4GL2A 1DS6A 2J3EA 1GG2A 1E0JA 5JHGB 3AVYA 2FZ4A 2I4IA 1PLLA 3JVVA 4TQ9A 2ZSAA 4QBIA 4CEJA 4FI3C 1XD9A 2QMOA 5DYGA 3X1ZA 1M8PA 1XCPA 2JLQA 2R65A 1U9IC 1QZXA 1P6XA 3IGFA 4URYR 1Z0DA 5EP3A 3K09C 3K0CA 4Q4AA 4JSYA 1KZ7B 1Z6TA 4XH9B 4ZI3A 4NE2A 4BFYA 1FZQA 2YVUA 3G82C 1UBFA 3CH5A 5BXQC 2WWHA 1KI9A 1ZCBA 4PR0A 1U99A 1XTQA 2JLSA 4D4MA 1FMJA 3K0FA 3EAQA 1EFUA 4ACAA 1RKBA 4A2QA 1LY1A 1G3IA 1XNJA 3SJZA 1WBBA 3C5HA 4HI0E 5EXPA 1NI3A 2GDJA 2J46A 3FWYA 4GT1A 2XX3A 1NMXA 4M1SA 4LJ4A 2O8CB 4AC9A 2H5EA 3VHLB 1R0WA 1XTJA 2GF9A 2K5UA 5D3QA 2V1UA 1EX6A 5KUTA 4IOKA 4W5HA 1OKKA 1G64A 3REGA 4TMVA 2FFQA 2GETA 3ZZ0A 1XEXB 2O0JA 4US1R 4PHTA 4H1UA 1NBME 2GWHA 3K9LA 4FCWA 5D3MB 1TU3A 3RHFA 3N2IA 4CRWB 2BBOA 1GNPA 1W4BA 2JDID 3LQRA 3BGWA 4Q48A 1KK2A 1B23P 1XWIA 2G1JA 4WIAA 3DM5A 1TQ6A 2F3TA 3AUYA 1P9RA 1SGWA 5HE8A 4BLQA 3SN6A 1GKIA 2PX3A 1N3BA 3R8CA 5EUMA 1XF9A 2CL7X 3DZ8A 4OHWA 3PUVA 3PFIA 4DB2A 1W44A 4BWYA 2GJSA 1AS3A 3QY0A 3HU2A 1R4AA 2BM0A 2YKGA 1E9DA 5G40A 5CM8B 4C0HA 1N25A 4YDSA 3GLHE 3ETLA 1LW7A 4KBGA 1CJTC 2O8BA 2J5XA 1EK0A 4JSTA 1RRCA 2GKSA 1OIXA 1V43A 2GVZC 2OFWA 2QGNA 5HR5A 1U8AA 2J7PD 5FOXA 4B75A 3EPJA 4JVLA 2WKRA 1G7TA 3I4LA 4AIIA 1KK1A 2E9SA 3GP8A 2QSZA 3LFUA 4DIEA 4OK3A 1RFLA 1GWNA 4KODA 1YR6A 4QJ5A 2VEDA 2QT0A 3MG9A 4JT4A 2GZDA 2RGNC 4RD1A 1Z6GA 4OK5A 5GJBA 1FUUA 2PJZA 4I4LA 4MKFA 2HJVA 3CKLA 5K8UA 3OIYA 4V0MA 3B9PA 2IYTA 4Z8XA 2G0TA 3LVQE 2IYSA 5BW8A 2J0UA 2AL7A 1T9HA 2WIBA 1TNDA 2YWGA 5C2JB 3VU9A 1UEJA 3SYNA 3NKVA 1B0UA 3SBDA 1MT0A 4URVR 4US2R 4R71A 4JL5A 2P65A 4M0LA 1VTKA 4D4LA 5SZHB 2I3BA 1OHHA 1SKYB 4F91B 2F1IA 3FVQA 5FOTA 1WF3A 5JFGA 1ZINA 2WAYA 4YC7A 2ZRMA 1VYVA 5EXSA 1BH2A 1XXHB 2DWPA 2GZHA 1TF7A 1NVWQ 4XVUA 3GLHA 1F60A 4DCNA 1ZUNB 3BE4A 1JAHA 3MMPA 4I1OA 1IXZA 1LF5A 4QG7A 2A5FA 3FB4A 2VL7A 2KJQA 3ASYA 3CRW1 4P4TA 5HE9A 1UF9A 4RFSB 1D2EA 3VR2A 3FHOA 3RWOA 2CCKA 1JQJC 3AKCA 3GJXC 5CM9C 5FL3A 5JJIA 1UDXA 1KZGB 4XD7A 521PA 2ZR0A 1UPTA 4L8GA 4EJSC 3CH4B 1XB2A 2P5TB 5H68A 3LV8A 4KCGA 4CVNA 2YYZA 5JI3E 1FOEB 3CF6R 3Q85A 2IXEA 4URZR 3L82B 3IEVA 2RGGA 3IEUA 2C95A 4I1SA 4W9MC 2ZJZA 3NWJA 1XD2A 4IEEA 1CU1A 1LS1A 1Q3HA 2ODNA 3TW8B 5L3QB 1W2GA 2ZM5A 4MKGA 4CEIB 1N5IA 1HV8A 3FFAA 3U3JA 2G0NA 2NPIA 2ZRAA 4TMKA 2ZRGA 5EP1A 3Q7QA 2GBLC 1SVOA 1OJLA 2D74A 3CF0A 4FWIB 2WZQA 1CR0A 2OBNA 2JJ2D 2BBTA 2ZXUA 3C14C 2FMXA 3BB3A 1BYIA 1M74A 4JLNA 5AJVB 3U3KA 1S8FA 1U81A 5FTKA 5JLJA 1RVDA 5FTJA 1M1YE 4PC2A 121PA 4DDVA 2IWRA 3ZYCA 2EU8A 1RZ3A 3KXIA 4UXHA 1FNNA 4B3CA 1E6CA 2QAGB 1N0WA 1E9RA 3QQ5A 4Q1AA 4A0FA 4TL9A 4MITA 3Q5EA 5KOYA 2NO6A 4Q00A 1LNZA 2G9NA 3EPHA 3CNLA 3MLEA 3X2SA 3NBFA 3FFBA 1NVXQ 4XOIA 3AVTA 1YZLA 1AKYA 3LDAA 2BIFA 5CK4A 3FTQA 4Q7MB 4JYBA 2EQBA 2XOKA 1FW6A 2ZAOA 4LC0A 1H8EA 1MOZA 4PPFA 3GEHA 1OSNA 3BD9A 2OUKA 5CITA 1R0ZA 4DT1B 2O8FA 3BH0A 4JS0A 4DB4A 3UMSA 3H0KA 5FPTA 2AK3A 2XSZA 3QXCA 1N2CE 2OFXA 2IW3A 3IIJA 1T8UA 3U3RA 3V9PA 4X8LA 2IXFA 5IK2A 1T8TA 1W2HA 1Z2CA 3Q8XB 5CLQA 4HEJA 4A92A 5LB4A 4D26A 2IYYA 2IHYA 2OXRA 1NRJB 5DN6A 5G3YA 1Z0JA 1CJKC 3PG5A 4LRWA 2CE7A 4Q4JB 3RYTC 4TL6A 3W8RA 4BLRA 1DG3A 3K70B 5GJVC 3KX2A 1DAHA 2HF9A 3H2YA 4MYTA 4LSGA 1VCIA 4G01B 5KNDA 2EFCB 2ZE7A 1DADA 1EWQA 4KXFB 3GJ5A 2DBYA 3O8RA 3ZD6A 2UVQA 3U44B 2QRZA 1E9SA 5DO9A 5FL7D 2G88A 3VNUA 2AKAB 2BKEA 3CNNA 3LLMA 4P4SA 4B3FX 2C2HA 1SXJA 1VCOA 3FMOB 4GOKA 4PTLA 5GVRA 4B3XA 5FPKA 3THXB 1Q0UA 4AKGA 1S3SA 3I3SR 5JRZA 3GEEA 4CW7A 2ZRBA 1Z0KA 1K5DA 2VP5A 3KB1A 3SFVA 1KO8A 3U60B 2IEZA 4GZMA 2NZJA 3RS5A 1JJVA 3ZD7A 3DM9B 4MYUA 1S4QA 2OXCA 4PHFA 221PA 3ZIAA 1CLUA 1ZW6A 3BORA 3HJNA 4A2WA 5GJWC 4ZIRB 2D62A 3HYTA 1GUAA 4TYNA 1OW3B 1X8KA 1XEWX 3B2EA 4S35A 1E2JA 1MV5A 4HAXA 2IHBA 1YU9A 4TL8A 3UXMA 1EFRA 3IHWA 1QG2A 4LHVA 5FFMA 3I8XA 1US8B 4LZZA 3A37A 1VYTA 2Q6TA 1G6HA 1UKYA 2W6ID 1ZCAA 4IDHA 5H70A 5GADl 4B3GA 4C0QC 4DLYA 2HCBA 1E9BA 4M4SA 2WIAA 1JI0A 1F3OA 3I61A 2IC5A 2QROA 1XMSA 2W2VA 1SVKA 2HXYA 3GJ8A 3C5CA 4LBYA 4RD6A 4B6EA 1XEFA 2ZJYA 3UMFA 1EESA 1W47A 1IN7A 1TUEA 3U5ZB 4JLVA 3AVVA 4PSVA 3LBIA 1S9HA 4QGFA 4Q9KA 5ANRB 4IOLA 4LC1A 4HDQB 3RS7A 1AQUA 1BMFD 1VECA 3H84A 5AWFC 1Z83A 4EQ6A 4YMUA 2WWIA 1GKUB 3PJRA 2AXPA 4E22A 4ZCMA 1RE0A 3CRVA 3EXAA 1KDOA 4UNQA 1N6IA 4EPXA 1CRQA 2DFKB 4NCJA 1R0YA 1KJZA 1E2EA 2B7CA 1SHKA 1OH6A 1ZYUA 2VHQA 3B1ZA 5FBVB 2ZQ5A 4C0AC 3LD9A 2JASA 3B7GA 1BOFA 4JYCA 1P9WA 3QKRA 1X1SA 4GP6A 4TTQA 3SJBA 1W4AA 1K8RA 1TQDA 3R7WB 3W3ZB 5CJ2A 3L0IB 1SZPA 1CBUA 4NYMQ 2PX0A 1CJMA 1LF0A 4HLQB 1XBTA 4Q02A 4OK6A 5DH9A 2IYWA 2ZJBA 3QUSA 3W9YA 2NQ2C 2F43A 3G0HA 2VHCA 1M7HA 3K09A 4GPTA 3IDQA 1TUIA 1T5IA 4YXWD 3MJRA 4JJKA 1VG1A 3IHLA 2QZ4A 2FDCA 1XMVA 1JAIA 5LD2B 2Q9BA 2VSFA 4M1YA 2QRNA 5FUYA 2FJUA 4X8MA 2A5GA 1OXUA 3N2EA 3SYLA 4LJYA 5EP4A 3UWOA 3LWNA 1KAOA 4ZI2A 1FX0B 1Q12A 2V8OA 1G4AE 3TUZC 5B64A 1II8A 1HE8B 5CIQA 3CR8A 3A1WA 4IOJA 1DG1G 2WPDA 4LJ7A 3SYKA 2CCGA 2X2EA 2QP9X 4YLGA 4TMWA 5FBLB 1YR7A 3N5CA 4A36A 4X8HA 1N6OA 1S96A 5JECA 2ORWA 3PUYA 1SHZA 1RRGA 2PH1A 1TEXA 3QE0A 4FN5A 4YDHB 5B2ZA 1KI6A 1XX6A 2OT3B 4TTRA 1AGPA 1VKJA 3AGPA 3PIRA 1W0KA 3U6BA 1R5NA 4U00A 4NHOA 3RWMB 2QM7A 2OLKA 3IPYA 3THOA 2NO0A 4ZCIA 3BIFA 4WW0A 2OZEA 4AWXA 4BFSA 3A6PC 3CR7A 1WQ1R 3RS4A 5KSYA 1Z6YA 3O8DA 4PAQA 2REXB 3GLFB 3UMRA 2BOVA 2RAPA 4HZUA 1KDPA 2XJ9A 3VHXA 2AN9A 4JT2A 2KE5A 2ZJ5A 1XPOA 3TNFA 2HDNB 2XZPA 3AUXA 4JMPA 4NDZA 1N6HA 1OFIA 4FINA 4TLDA 3X1XA 4LHZA 4V0KA 1U0LA 3R20A 1E0KA 1TF5A 1OFTA 2IYQA 2BWJA 2RGXA 4P0TA 1OH5A 3ZZUA 1Z0FA 1W0JD 4FW9A 2XEXA 1OXXK 4LHWA 1TTTA 3QKSA 5KYKA 3SU8A 4E5UA 4TQAA 3OAAD 4TSFD 3WYGA 4B76A 2OILA 5J4LA 1TX4B 1YR9A 4LV8B 2J1LA 4JVNA 4XSHA 3TAHA 1NLYA 2E87A 3Q7PA 3WMEA 3B82A 3U4QA 2WKQA 3LRPA 2ZS9A 3PQCA 2P2LA 4ZDWA 4DXAA 2AR7A 1X8LA 1KY3A 2QGZA 2WMNB 4A15A 4TYWA 1NBMD 2BEKA 3DPUA 3BB1A 4GBMA 2C99A 2B8WA 2F3RA 1I4DD 2H1LA 2ZU0C 1G18A 4XIGS 5KDOA 4I81A 3DOFA 3THYA 2AWOA 4HYYA 2V6IA 1L8QA 1G7RA 1E99A 4TWZA 4FWTA 4JLJA 1KJYA 3A4LA 2C96A 3P4XA 5JZVA 3CUEF 4M8NE 3ONWA 5IDVA 1PUJA 2ZI9A 2WWWA 2QAGC 4IFBA 1ZJ6A 3A1UA 2ZVPX 3D3QA 4JLMA 1RPZA 2VQSA 3LQQA 1IOZA 2R6GA 4FIDA 1UKEA 821PA 2GCOA 1L2TA 2C98A 4C30A 1T3LA 2H18A 4DVGA 4BFWA 1K5GA 2J87A 2ZITA 3LXRA 1VPLA 4FCTA 1QHHB 2PZGA 3EIEA 5FPSA 1D2MA 1JR3A 3QBTA 2V55B 2YOHA 4PZYA 4A6PA 2WVJA 4A0GA 3ZGXA 2LWIA 2RMKA 3KDSE 2IYVA 2JAQA 1HT2E 1JEEA 1YJ5A 3ND8A 4OQXA 3TIFA 1KKMA 1RRPA 3LY5A 4OHXA 4UNRA 4OKSA 4NBSA 2ERXA 3VX3A 4BFTA 4C0KA 2JLRA 3OEED 4AKIA 3DMDA 4A1FA 5DGXA 4DEYA 1E2KA 1G5RA 5TVKA 4DCVA 4P31A 3EZ7A 4IKEA 4ARZA 3FHCB 3I92A 3NBZC 5FBWB 4D2IA 1QDEA 4BRUA 2CEAA 2ZJ8A 4HB3A 4POAA 1VCNA 3QOFA 4BE7B 3GLGE 1FPMA 1VIAA 2C9YA 2QE7D 1DAFA 2J9RA 4EJSA 5J40A 2XITA 5JS7A 2X1VA 5FUVA 2BMDA 3HYRA 4A8JB 3AP1A 4TL7A 4PO8A 3EPLA 1OH8A 3GLIE 2RGBA 1E79A 1C1YA 1NG1A 1W5TA 2Q0HA 1HE1C 3K70C 4LPKA 3T34A 3AF2A 4MRNA 2QY9A 1GAJA 1F2TA 3W90A 4QXAA 5CDFA 2OFOA 1ZNYA 5K8IA 3UK6A 3A4MA 1XTRA 1P61B 2XAUA 4HB4A 2O8DB 4IJMA 4ASUA 2D4HA 2O52A 3AB3A 1NN3A 3TLXA 1KMHA 3AVQA 4F4JA 2GJAA 4KVGA 2JLVA 3WYAA 1EGAA 1GOTA 3AH8A 2YOFA 1MABA 4UQOA 5EE1A 1NN1A 2QORA 3GJ4A 4EDHA 1KSJA 3FHTA 3WY9A 4AG5A 2O8EB 1NL3A 1FMLA 3TUIC 4QJ3A 2ZSFA 5FUWA 2FFHA 2XTNA 1G21E 1Z63A 2NGRA 1CS4C 1WMSA 3RC8A 1YKSA 4DSNA 3Q3JB 1QHIA 3C4JA 3RVBA 1G3QA 2LCFA 2FX3A 3KJGA 4LY6A 1KI8A 4US0R 3KKPA 2JJ1D 1NJGA 1XJCA 1P73A 1XTIA 4XVRA 5K8LA 1U98A 3E5HA 3R8FA 1KNXA 1E2HA 5JJKA 1O3YA 2E1RA 2DWOA 2HJGA 2P6UA 4NCKA 4OYHA 2ECKA 2A2ZA 4C7OA 1MO6A 3VX4A 2QBYB 1QVAA 1ZIPA 2ZRFA 1KYIA 1MO5A 3A8TA 4W5WA 1GRRA 2AKYA 4XWOA 4LOAA 5DI3A 5AUPB 3GPLA 4K8OA 4HLDA 2J0QA 4Q7JB 1XJQA 3V4RA 2VP4A 3WBJA 4NU0A 3OE7A 3LLUA 1HUQA 5TARA 3S1AA 4RCZA 1YZTA 4PPQA 3TQFA 5IT5A 3K70D 1IQPA 2ZYUX 2ZS7A 2VIIA 3EZ2A 3L2OB 1KIMA 4RD4A 5C46F 4LBZA 1E0AA 3UPUA 2FPKA 3FGNA 2RKOA 4PQFA 4MKIA 3SR0A 3FKSD 4G3XA 4NZYA 4L4UA 4Q9HA 3TGPA 2ZI5A 3WP1B 3RS0A 2X2FA 2ZRLA 3ZZTA 2X19A 3NIBA 1JEDA 1R5OA 1NP6A 3B8HA 2KI5A 3O8CA 2ZI6A 2AD5A 2VHTA 3P4YA 4MGZR 1N6NA 2R8RA 2DPXA 5A0FA 4CT5A 3QEJA 3KJHA 1E2NA 3M4YA 4PPNA 4P32A 4AYWA 4Z1MD 4UXJA 1T4GA 1KI3A 1GIAA 1QRAA 1N0VC 4TMTA 2BKUA 3A1VA 2GF0A 1CJUC 5BYKA 4IHQA 1FP6A 1QHXA 4YMSA 4DUGA 3M1IA 5LD2C 2PJRA 2XGJA 1DAMA 1T6NA 4DLUA 3RLFA 3W6OA 1H8HA 1NVVQ 3WNBA 2ZETA 3MCAA 3QPUA 4TN1A 3W6NA 4TYYA 3ADCA 3NH6A 2VP2A 4QM6A 1E2DA 3VTKA 2V1XA 3E70C 4V0ME 1ZM9A 2L0XA 5AK0A 3H4MA 3T12A 3AVXA 4WBSA 5ELXA 4Z8YA 3A4NA 3VR1A 1K6MA 3TK1A 1MRNA 5HCNA 4NH0A 4D6PA 4Q1DA 1NMZA 1VG8A 4LYHA 2OAP1 4BLPA 2O8CA 2QP4A 1GDDA 2Z43A 4HAWA 3RNLA 2ZI3A 3T5DA 2ERYA 1XD8A 1T91A 4IDOA 2RCNA 2XXAB 4QJ4A 2V6JA 1OFUX 1P2VA 5F2EA 3Q9LA 5E4FA 4PAOA 4OBEA 1JQLB 1XEXA 4KITB 2R6AA 2ANCA 3B13B 1SVSA 5D3MA 1M2OB 2AFIE 2F1RA 3GCGA 2DFNA 2DFLA 3TMKA 1SULA 2PLFA 421PA 2O8BB 3CM0A 1BKDR 5FOWA 1MH1A 1ZNXA 2A30A 2JIZA 2KWIA 3CPJB 4G0NA 4G1UC 4OI1A 5TMPA 1G1MA 4UNPA 3IUYA 4WAUA 1Q1BA 5A5GA 4UNSA 4YMWA 1YVDA 2A3RA 4KLNA 3LX5A 4MGKR 2ONKA 1OV4A 3A36A 2TMKA 4ESHA 3L8ZA 3NDPA 4M21A 1LVGA 3TRFA 5GVSA 2B92A 3CZPA 3TSWA 5BN3A 1QHGA 2QU8A 1SVLA 2Z4RA 2B6HA 4QKQA 3IQWA 1ZU4A 1OH7A 2DFTA 4Q1BA 2OCYC 4BPBA 4O25A 3QG1A 1NIPA 2IS6A 1WCV1 2VHJA 4QRHA 4IDNA 2DY1A 4M9SA 5TV2A 3U7GA 5M04A 3NEYA 1COWA 2UKDA 1KO7A 2EFHB 2IF0A 4DWJA 2R6FA 2FSIA 4DDUA 4GSYA 3RDPA 2CNWD 1VG9B 3D7MA 2FZLA 4KYIB 2C9CA 2GAOA 1TADA 2V7QA 2ODWA 3E2IA 3O8BA 5AJXA 2G77B 3GLHB 2CBZA 3GMTA 1W1WA 2PT7A 2ZE6A 1CEEA 1U0HC 4D82A 1I2MA 2ORVA 3SZRA 3CONA 1LFDB 1QHSA 5AR1A 4QBHA 4Q9JA 3WBKA 5JWOA 4BEJA 2G1KA 4DJTA 3PUXA 1KY2A 4DSOA 5IF9A 1J8MF 5J4HA 2V54A 3VR5A 2F6RA 5KHOC 5KPDA 2ATVA 5TXGA 3L0PA 3B9QA 1J7KA 4D81A 2G83A 2YHSA 2JLXA 3AV0B 1XXHA 1CF4A 1DO2A 5FPHA 1A2KC 2C04A 3G5UA 5EZ6B 1Z6AA 4RSGA 3TR0A 5HKKA 5FH9A 4A9AA 3RABA 3GEIA 4JLDA 4RFSA 4EPRA 3OFNA 4WZBE 3D6TB 4Q4LA 1WBDA 2CHVA 4KFRA 1E0SA 1L4YA 1WP9A 2CHGA 4XJXA 2NZ8A 1JALA 2KB0A 5TB5A 1U94A 1DAEA 1U90A 3QF4B 4ZDKA 2J0SA 1HY3A 4A8JC 4U02A 4DDWA 3A1SA 1U8YA 3I8SA 4NPHA 3U7EB 1KAGA 4MGYR 1GSIA 3MWYW 4H9GA 4HSEA 3KKMA 4NYMR 5L3QA 3PEWA 1XRJA 4CEIA 4LI0A 2ZUCA 1OF1A 1OFHA 4AYXA 4TYQA 2MSDB 1A1VA 3QENA 1ELOA 3NEJA 2HUPA 1SXJE 1UBGA 1CULC 4LUCA 5FI0B 4EPVA 5FR1A 3KQNA 2FSHA 4M1KA 5KU1A 1CJVC 1NIJA 5B57C 1GRNA 5GJCA 5EE0A 4CF7A 4N0DA 1DO0A 5G3ZA 2FNAA 5J4YA 1JNYA 4PC1A 1G3MA 3HDTA 1XU4A 1G19A 1KO4A 2AD1A 2W6JD 1NMYA 1DE0A 1GL9B 2HLDD 2WMOB 2QAGA 3K0EA 4Y0AA 3HPRA 5FBQB 4AG6A 3HPQA 5L8VA 5AJZA 2ATXA 2WJYA 2J7KA 5EQTA 4JVSB 2P5SA 3PR1A 3WXMA 1FQKA 4Z51A 2NOAA 1N5KA 2JJ8A 3RRYA 4DCUA 4OJKA 1OIWA 3A58B 4N3NA 3BERA 3DKPA 3JZAA 1T0HB 1R5BA 1VHLA 3C41J 1P7CA 3PV0A 1P9NA 5CYOA 1ZC3A 4DDTA 1A82A 4PQRA 5F3WB 2FPLA 3CWQA 4LV5B 4B3DA 1D9XA 3LNCA 5TDHA 4JLKA 2VP9A 2V3CC 2SHKA 3UG7A 1GL6A 4DT1A 2XNDA 1FNMA 1R10A 2VA8A 4FMDB 4IVPA 1XMJA 3OHMA 3QI2A 3QVVA 4EIWA 1IN5A 3QKUA 5CYPA 1HQYE 3LAWA 5KSOA 1DVRA 4L15A 3T1VA 3AQ4A 4WOPA 2QM8A 2WSSA 3CB4A 4EPYA 4XTRA 2KBFA 3KTAA 5KNBA 3B5JA 5TY0A 1E9EA 1OYWA 3X1DA 4B2IA 4CIDA 2H16A 2IXGA 4Q4HB 2B7BA 2CK3D 3NH9A 4QHSA 1E32A 3AKYA 3TSOA 3UANA 2R6DA 4E07A 1UJ2A 2R6CA 4TZ0A 4Q4JA 4C0BA 4HDOB 1E1RD 3EC1A 4MA4A 2NTYC 2GAAA 2Q3HA 4MRPA 1R8QA 3EC2A 4LYAA 5FOSA 1BO6A 3KB2A 2GXQA 3U44A 3N70A 1Q44A 2VRWA 5EP2A 2WOJA 2BMEA 3AF4A 2B8TA 4PSKA 4G5RA 1G6OA 3RSLA 2YINC 3NBYC 3FE2A 5JCPA 4LCBA 3THXA 1KI1A 5CLLA 1NY5A 1E1QD 2ZRHA 4PPGA 4OI0A 2QMHA 1ZNZA 1XDBA 4JL6A 2PBRA 3I1FA 2VH5R 3DZDA 1IN6A 3K8YA 3T35A 2X8AA 4OQMA 3R9IA 2LKCA 4LJ6A 4NMMA 4A0HA 2GJKA 3PUZA 1NLZA 4OQNA 3LO5A 4ZIRA 3REFA 2OLJA 3WHLA 4BFVA 1I2DA 4FD2A 3X1YA 1VIYA 1KI2A 4A2PA 3AGQA 1YE8A 2IYUA 3KQUA 1U8ZA 1ZM4A 4EQ6B 1OXTA 5DSZA 3KL4A 1UEIA 1MO4A 1R8SA 1US8A 3I72A 4GMXA 2FSFA 5EE3A 2RGCA 5FTLA 1DAGA 1Q1QA 2JDIA 3ND9A 1HTWA 3IIKA 2R62A 4NCHA 4H1VA 2ORIA 3NVAA 4KLZA 5C18A 1KHTA 3A1TA 5EE5B 3IBYA 3QKRB 1G8YA 4PZZA 2HT6A 1NN0A 3CLVA 4FXPA 2GK6A 2FE4A 1BYUA 1EFHA 4BASA 1AN0A 2PMKA 2GA8A 2OCBA 4DLWA 3EIHA 1E3MA 2CVHA 3ZS8A 5JRJA 1U9IA 3H86A 1RYFA 2QMEA 3B85A 1Z28A 1IY2A 3L43A 4MQBA 1IM2A 1TF2A 1CR4A 2GK7A 5AJYA 1Z07A 1GFIA 1EG7A 3SQWA 3NDBB 2PLRA 1UKVY 1ZP6A 3WRXC 4C2UA 1NN5A 4HAUA 2JCSA 3VFDA 4BFZA 4F4CA 4F92B 2VHUA 3B1YA 4Y0VA 2F9LA 2WM9B 3VKHA 4MUBA 3Q72A 2C5LA 2J7PA 1LS6A 3P20A 3VQTA 2VP6A 3OEHD 1PV4A 2CHQA 2ZYVX 3R7WA 4JBYA 3LA6A 1ZMXA 2YC2C 4HZIA 4L9WA 1G8PA 3TH5A 2CJWA 1OKKD 2MSCB 4MYHA 4R7ZA 4JBXA 2FEOA 3EW9A 3NHBA 3VR4A 2WTUA 4O3MA 1Y3AA 4A82A 2D7CA 4AI6A 4JJZA 2XZOA 2UZ3A 3BH6A 5LBIA 1XJ0A 3WMGA 2A5JA 5EE9A 1II0A 4KU4A 3PVSA 4Z54A 2IS4A 2OV2A 1KI6B 3B6EA
chains in the Genus database with same CATH superfamily
4O2AF 2GZMA 3AR6A 1P81A 1DEXA 5A0VA 2VJDA 2FHSA 3CE6A 3ADBA 4QHYA 4WV3A 3T54A 1PZFA 4Q37A 4KFTA 1M6NA 3L0SA 1JB9A 4KQKA 5A71A 4M1ZA 3ISTA 1KZHA 1YL5A 4IILA 4MWCA 2WYOA 1SC6A 2R79A 4OXKA 4FR2A 4PHHA 4PRLA 4PVDA 3SX4A 2CNBA 1Y4SA 4MZXA 5I8ZA 3VSBA 5JSZA 3LU1A 1NQTA 2VWHA 5ADWA 4F9GA 1Z2AA 3QYFA 2GK4A 5LBUA 3VXKA 1N1DA 2FW9A 3O84A 4BCCA 1C3OA 4ILKA 3A06A 5HJ5A 2QAIA 1SUEA 4HWOA 1CRPA 4WNAB 1C9MA 3QNMA 1P1FA 1PLJA 1WX1A 4DR6B 3D8RA 1GPH1 4JJEA 4JP2A 4ACBA 2IYZA 4AXXA 4BEBA 1U7TA 3ID6C 4IV8A 4LV6A 4QUGA 2ZSUA 1SBYA 1YA8A 4B71A 3SF0A 3AL0C 3PWTA 3UUGA 2FP4B 1PD1A 2EGUA 1B6GA 2PA3A 3MCTA 1SBIA 2CE2X 5CYGA 3IP6A 1Y80A 2AUTA 4RF4A 2BI4A 4ZWNA 1FUIA 4EAAA 2QLMA 2VPZA 3E5MA 3KKOA 5IKEA 3QEAZ 5A02A 3C6QA 1WV1A 1AO0A 2JL1A 2FEWB 2RB5A 2O0HA 2ZB2A 3ZE9A 5TQ2A 4LTDA 4RXMA 4AJ9A 3UMMA 4DR1B 3ZJ4A 2O5CA 5A9RA 3DOIA 4PG8A 2NTEA 3OT1A 3SI7A 2FK7A 5FI1B 2OZLB 3FSGA 3SG0A 2QPTA 1IAQA 3V8NA 4AJJA 2ZI7A 3WHKA 3JALB 1IRXA 2WHRA 3C4QA 4LOJA 2F9MA 3H9UA 4LXGA 2IA5A 4DCOA 2O1XA 4KR7A 1GZ6A 3BMNB 3GU3A 4Q01A 5AVSA 5JZMA 3MWFA 2XRZA 1G4UR 1K2VN 3P32A 3ZHXA 1NJFA 4DLLA 3UBMA 2OORC 2Q3DA 4O2BB 4DSUA 2JJ2A 1F8XA 4QPCA 3DEZA 2JARA 4ZOCA 1O9BA 1Z7BA 4IM7A 1OYVA 4I8IA 4N48A 2D0PB 2BEWA 2HA4A 4P3KA 3GGPA 1PD0A 5IJ9B 2J31A 3N2GB 3RE1A 3C1TA 1HE5A 4YJ3B 1TYDE 2PVPA 2BTEA 3THWB 1RJ9A 1WXIA 1YCDA 2G0AA 3K8QA 4BV9A 3ACCA 2B4AA 2ZRIA 4ZV4A 3ZWVA 1V9SA 2VT6A 4QM7A 4KVZA 1FFXB 4YASA 2OXFA 3RIHA 3VR5H 2XH8A 1N7HA 1G2IA 2GESA 3EA5A 3OLXA 4UHBA 4B8ZA 2BGJA 2R84A 3D4NA 3F7NA 1WMFA 3KB6A 4U9UA 5BSWA 4WK0B 4MUIA 2HRBA 5CT6A 3L4JA 5IX8A 2NQTA 3QNUA 4RNDB 1GTRA 1KYTA 3NS7A 2C03A 4RVFA 4PC3A 3KV1A 4XD7D 2ZWAA 1IFXA 3EG5A 5EQFA 4QDUA 3PXCX 1Q0TA 3GY0A 5BXYA 1FTNA 2PGLA 1G55A 1QHHA 3BWBA 3T1NA 3T1QA 4G09A 4LYGA 1E2MA 3AEKB 2ISCA 2VZEA 3QF7A 3QTBA 1EFVB 5ALHA 1ZI9A 5KDLA 2H1CA 4A0SA 3HO1A 1I7NA 3M81A 3C7CB 5AM0A 3V1NA 5DBFA 5AOCA 3GO4A 4AAYA 3WLKX 4ND2A 1G8KA 3C8UA 2FX5A 4KTVE 2QTCA 5IN4A 3VYRB 5F4BA 2WYWA 2AOVA 3EYAA 1GLGA 4X90A 2WUWE 1JAYA 4ZQGA 1P77A 3Q12A 3M4ZA 5FOUA 4WINA 4GO1A 1E58A 4OB6A 3SF8A 1IC6A 4JZKA 3JXEA 4BNIA 1RQ2A 2HCJB 4WKNA 1E3TA 3MSCA 2IV3A 5KWSA 4L07A 5KPJA 3K4PA 5JV5A 3SDZA 1TC2A 5GONA 2NYRA 1MLDA 1G2QA 1BX1A 4DRZA 3WMFA 4G0XA 3OCCA 1CY2A 2OBMA 1OX4A 3IP8A 3FMFA 4QPZA 4U7TB 5EJEA 2V03A 2FW1A 1A4UA 1OU0A 1W1UA 1R4MB 1CNMA 1VMAA 2W2TA 1EU1A 1I01A 1QHYA 1ZMRA 3L7OA 4KQ1A 2IYLD 1Y5NA 2O23A 3JYNA 3LKBA 3OKFA 2XGSA 3BB4A 3R40A 3IPXA 4XB6B 5EMKA 2ZUEA 2ZRNA 1GV0A 3G88A 2CK3A 2CVQA 2AIRA 4Y6QA 2ODAA 1C9YA 4IUCS 5FNVB 1TJ4A 1OYOA 1RM5A 2KYRA 2WE7A 3EF0A 4AKTA 5JNUA 4J0HA 2BDUA 1M2KA 4RZUA 4L2IA 2QRUA 3IDOA 2Q0SA 1JHYA 1Y8QA 1N9ZA 2GN1A 3WL4A 2XOKD 1PWEA 2YZNA 4GWGA 1H8ED 1NASA 1UFRA 1VZ2A 2Y1EA 2Y9PB 2AFHE 2DPGA 3IAFA 3B8EA 4IBOA 3UENA 1M1ZA 4F85A 1YAJA 3AP3A 1DFHA 4OX9B 1YV9A 2O8DA 2V5VA 2IK8A 2Q9CA 3OOHA 4FQ5A 2OTCA 1Z0UA 2EAUA 3DE5X 1EX7A 3BCSA 4L9SA 1P7VA 5KWIA 4ZT3A 4DLAA 3FTPA 5C8YA 1C8LA 2OK7A 3A14A 4ZU3A 4C4PA 2XSZD 4MWTA 4ETNA 2PY6A 3JZMA 5BN5A 2O1WA 3CRQA 4OKNA 2C9OA 1GL7A 2HA0A 5A7GA 4RTQA 2NUTA 3KJZA 4E88A 2RHMA 3S2SA 1TQ4A 4PAMA 2G7MC 3PRHA 1RC0A 4OQ4A 3ZVNA 2PGOA 4NMWA 2CL0X 2Q2WA 4GOND 1MOQA 1YUMA 2B1GA 2JIDA 2VF7A 2YWHA 3PUWA 1HQDA 3C7KA 2G9QA 1ZO8A 2RHRA 3O1HB 3QXXA 4JT8A 4GG1A 3EGWA 1HT0A 3OO1A 4NYIR 4ZGWA 2ZYAA 4RPGA 5B5SA 2YNMA 2FTKE 4ZDIA 4FFOA 2YICA 4KB5A 3TEFA 1HZZC 3UO8B 4KPUA 2IJGX 1PS0A 4TROA 2R9VA 1QAOA 1RMQA 4REQA 4BO7A 1F0YA 2YXBA 2PHZA 3H75A 2CMHA 5D85A 4NQRA 1BA3A 4Q4AB 3LL7A 2IHTA 4CF4A 2QBYA 2XZDA 2AF3C 2OR3A 2EYUA 3SWWA 2VRBA 3WYFA 3EUFA 3OIUA 1DC6A 1U3UA 4F6RA 1G16A 1PDOA 1NU6A 3HR8A 1BDBA 1GPJA 3MZ0A 2UYCA 3DAGA 4BGDA 1SCQA 2QLFA 3TRIA 1RXUA 1QH0A 4C0LA 2GM4A 1R6UA 2FZWA 4JLOA 4LJAA 4BMZA 1R15A 4ZJZA 1KKLA 3USCS 4A6DA 2NIPA 2QXUA 3SQNA 4MWDA 3WGIA 2UUAB 2QJTA 3IXQA 3L8FA 1D1PA 3NIFB 3QGMA 4G0QA 4U6NA 4RPHA 5HF8A 3VH4A 3VNAA 3ZXIA 1E3QA 2F1KA 3L0YA 2P79A 5IG2A 4LXYA 2NXCA 1RDFA 3EEBA 2J0VA 2IS2A 4YRTA 5CTJA 4RLHA 1KMCA 1UFKA 1WCWA 1YZGA 1XKXA 1T0UA 1TFRA 1TEVA 2LW7A 2P9FA 2COKA 2W2KB 3E05A 4B4VA 1D4FA 4LMPA 5KZMB 1GZ4A 2HWUA 4YXWA 4GYKA 3T3OA 5FTNA 1B15A 1Z18A 1QIJA 1X1DA 4YMGA 4M9XA 3UGJA 1XLUA 2P9JA 4XPIA 2FRDA 1N3LA 2QR5A 1ADGA 4R0NA 1QVWA 2Z9BA 2Y0EA 1SUFA 2LXNA 2P69A 2X3YA 3ORRA 4L1KA 3VC2A 3EQZA 3OEHA 4JL8A 3D7NA 1E1CA 2MIIA 3KTOA 2ZBEA 1MQ8B 1PUIA 3S2EA 1C7EA 4HCJA 4PE5B 2JLBA 3GCDA 3HWX1 4L16A 4TSKA 2FFRA 4R51A 1BOOA 2O2JA 3Q11A 1BWRA 2Q6VA 3GJ0A 2P6OA 4XW2A 3FA2A 5SY4A 1U7DA 3OU2A 4NLLA 2PCLA 1DKPA 3QZUA 4BRWA 4K6KA 1XI2A 2NV2B 2IZ7A 1XTBA 2OKGA 4AD8A 2AR9A 3EPKA 4U8HA 1VJ1A 3FPEA 2FW7A 4NP6A 1GKKA 2OHXA 2OZVA 3C87A 3DZKA 1FTSA 2GZRA 2I2AA 3IOEA 1BDIA 2ZBFA 4MLZA 1XKTA 3TTUA 1IN1A 3E7FA 3C3EA 1PGQA 4MPDA 5IPFA 2AYYA 4LZLA 1E2LA 3O8OA 5D3ZA 1ZVQA 4NENA 4XSGA 5LN1A 3H8VA 4UBNA 1IOWA 1RU3A 4H27A 2XE8A 2OBXA 1GVHA 1ZIDA 2IYOA 2Q9AA 3FBWA 4OQLA 2YIMA 2H4FA 2GNPA 4PINA 2VJYA 5WRFA 3SZGA 4YJFA 3VYTB 4BNVA 4KPEC 2HQOA 3QXSA 4HX9A 4OQYA 1GV1A 1GNQA 1EXMA 1SCJA 1SUAA 4JMLA 1F7VA 2P9QA 2K2WA 3N2ZB 1QDUA 3RC3A 4XVQA 1L5KA 4NG4A 3URKA 1DI0A 3GMDA 4Z0HO 5CHEA 3KQLA 2C5FA 4UHCA 1XRLA 4PCUA 4JKOA 1Q17A 2UDPA 4K9RA 3OX4A 2X23A 1PEAA 3ZWMA 3K3PA 1H05A 4E13A 2ODBA 5F33A 4ZHQA 1I1OA 1XXHE 4CKCA 1Z88A 2FE1A 2MMGA 2RHWA 2ZFUA 1N6PA 3QLVC 3QVWA 4W82A 5EIWA 5EKXA 4Z4EA 1U3FA 3C45A 2ADMA 2NO7A 4K6FA 4WZAE 1J0CA 2WF6A 2YJ4A 3MQ2A 3Q87B 1RHQA 2CFTA 3LBAA 4GDMA 4QXQA 4WJKB 4PCAA 4OGKA 4ZCLA 3VAYA 5FUMA 4Y30A 2CHEA 3NTVA 1RKUA 1J2TA 1I2BA 3A27A 3K0HA 3OC6A 4KO1S 5C5IA 4DZRA 5CVTA 3V8VA 3KQQA 1EWRA 1U65A 1SCKA 3VU9B 1IK6A 1W96A 4X20B 3M4XA 4OF4A 2OBFA 1DDOA 3DWGA 4NJMA 1V5WA 1STOA 3N74A 3D81A 2IVFA 4AROA 2LV8A 1Z4LA 5JHHB 2AOUB 2QRHA 4MV5A 4OAQA 1CUDA 1Q2UA 4D0GA 2WKWA 1N9GB 1J90A 5A05A 2AYXA 5LBTA 2RB4A 4BZQA 1IULA 4ZA2A 3FPKA 2HU8A 2X0NA 4G2NA 3BQNB 4Z9BA 5BUQA 1SZCA 1W25A 4JKYA 5DWVA 2XQIA 3T7RA 3ZGYA 4QUEA 1FMCA 1Q0LA 1X1QA 4FGUA 4TV8F 2GXUA 4EHNA 2GPJA 5LA6F 1GQYA 1U2RA 4UAGA 4KYUA 3MQ4A 4W63A 2FPXA 3GLTA 4ZYLA 3G9ZA 1XNGA 3ZH9B 2GB4A 2CXRA 3EZNA 1NY6A 3TIXB 3UHJA 3QEBZ 3HXPA 2OO3A 3DZGA 3IKVA 3DXXA 4TLEA 3SY8A 4C1NA 4F04A 4HNQA 4LMBA 1AXGA 4DJFC 2WJ6A 2I1WA 3EARA 2HMAA 1JMYA 3IQXA 4WERA 2IYEA 4OL9A 5CLGA 3IEMA 4FYPA 1R0RE 2Q4DA 3QRWA 1BE6A 1DBSA 4DCPA 5IKMA 1YDMA 4K1XA 2YXPX 3RAJA 1C9KA 5DYIA 4BMOB 1AGRA 2PX5A 3CBGA 4RY2A 3I6MA 1E7WA 4Y1FA 3DKRA 5BWMA 3HCRA 3R5XA 4DG9A 4B7UA 4QAJA 3RRMA 1UOEA 1JR6A 3FOEC 4BQFA 5KB3A 2XCTB 2I1VB 3LPNA 1XPRA 4IR7A 4WSOA 3I9NA 2JEOA 1LK7A 3HCDA 4V0LA 5IBCA 4P7GA 1S2DA 3HGTA 4MRSA 2A9KA 4CM1A 1K6JA 2C1ZA 4M76B 2FX2A 1S6YA 4WN9B 5J5VA 4EYQA 1TO2E 1MORA 2RH8A 4J03A 1YRLA 3KQHA 2Q50A 4EJ6A 1AY0A 4QBFA 3MBOA 1E7RA 4DQDA 1M0EA 2V6BA 1UQRA 5LB2A 2Q8PA 3D02A 3WKEA 4U3JA 1E7QA 3MD0A 2JRCA 2OV6A 5D8DA 1ZSVA 2VHXA 3AVPA 4LZJA 1N5DA 5HGJA 4BVGA 1YQQA 3GFBA 4KG7A 1MKYA 2PA0A 3E9RA 2P6RA 2W0MA 13PKA 1AF4A 2UVPB 3AR9A 3GNLA 3UMJA 1KEEA 1ZXXA 2XUKA 2WF9A 4HTFB 2IXTA 1GR0A 3DTYA 3MK31 3O3OB 3OQPA 4UQPA 3UAVA 3VPHA 2EBWA 3H5VA 1HDIA 3H2KA 1OI7A 2WJ3A 3DNMA 4MQEA 3IJ5A 2P41A 4ZZ0A 5JBQA 3AILA 1IZ9A 2QMUA 3KALA 4UKDA 3LZDA 5JOQA 2JFWA 3RTEA 4WBNB 4Q66C 1SOMA 3IILA 3I58A 5E4TA 2NO9A 4DQKA 4POOA 3C39A 2AK2A 4WZ6A 2YMQA 1Y1SA 1T5LA 3LFTA 3SZ3A 4ZI7A 4BAZA 5FT9A 2AR0A 1ZWLA 1FVHA 1UBSB 1NJ1A 1WMEA 2B83A 2I4RA 2OORA 3P2YA 1DPFA 3P0JA 1DKMA 3OLYA 4WADA 5CYFA 4ZZ1A 3OA2A 1XPUA 1JDBB 2WT8A 4EYOA 1NBWB 5T4FA 1P7ZA 3SKXA 2I2CA 3OQOA 3QJ5A 1YASA 2FQYA 4FKMA 2UUBB 4TKVB 2F62A 4ND1A 3QMPA 3OQVA 4PFQA 1OB2A 3E35A 5L4SA 4EG4A 5AOAA 4M0UA 4DOMA 1Y8CA 1UDBA 3AZQA 2GLTA 3HCFA 3MELA 2WSMA 3K35A 721PA 3KOWA 4KN9S 1LBQA 1BFUA 4FS3A 3W7BA 2B6NA 3GVCA 3IXLA 2WFZA 3FNIA 3AZOA 2D1FA 4H3SA 5D00A 4B34A 5ITZA 2C9MA 1DRVA 4FPXA 1EVJA 2II6A 3EVZA 3AW9A 3MOIA 4MAAA 4WZBB 5DNYB 4YONB 1NT4A 1LLDA 2ZDQA 1ZEMA 3GBVA 3I28A 1PS8A 2VNIA 5TMBA 1C3XA 3BIWA 2XQFA 3E22B 3H8JA 1YOVB 4N3AA 1N2BA 2WICA 3K0SA 1F2VA 3QVMA 4J43A 3KYCB 3WDKA 2RGWA 4BVHA 1QQTA 4M0MA 1R6TA 3UJCA 3VYVA 4IW3B 1EEXB 3O91A 5I48A 5JCXA 3PGVA 3REOA 2QQ5A 4ZVTA 3T61A 4G5OA 3AFOA 4F2PA 5BNFA 2OE2A 2WHQA 1ZGCA 1Z4IA 1SB8A 4P4SB 3G7SA 3PGXA 1XAHA 3VOBA 2PS1A 5J5CA 4AW9A 4OQFA 2FF7A 5KOJA 2O4CA 4J2OA 3A26A 1K6IA 3AFHA 4ZMBA 3T1TA 1JPJA 2BKLA 3DOEA 1MQ9A 4LQCA 1A2BA 1W49A 2XEDA 3V7NA 4XB2A 2AT1A 3Q8KA 3LBNA 5JS8A 5EJIA 1ID1A 4FSHA 5AVRA 1BD3A 4O5OA 1RM3A 1JT9A 4PSCA 4Y7CA 1L7QA 3WGZA 5KNCA 2VWPA 4N9QA 4PICA 4MW4A 1RYNA 2POQX 3EWSA 6REQB 1KZ4A 3L0DA 4PYLA 1L7RA 4PGHA 5CNKA 4D3FA 5A4MS 1PYOA 4EHFA 1B73A 2PKQO 4FYKA 1ECFA 1SO8A 1IBSA 3FKSA 4H31A 4KPGA 4S0ZA 4UBLA 1VZ3A 4MHTA 4Q4HA 4BNXA 4ZAXA 5K51A 4HSGA 2F3QA 1PQUA 1IVSA 2FWRA 1Q1ZA 3H6HA 1ENPA 1MHPA 2BLLA 4ZHQB 1FYDA 1W48A 2H1VA 5D7NA 2X1LA 1H23A 4S12A 1NF8A 1CUJA 1TU0A 3T3NA 4YMIA 1EBFA 4MV3A 3TNLA 3ZEAA 3MNFA 2D2XA 1DOAA 3DFMA 4J1TC 3V46A 3C85A 4O4HB 4EB6B 4OLFA 4F7WA 3P97A 2FW0A 2A0UA 3FCEA 5CK5A 2D54A 1Y37A 5EESA 4U0JA 3ZX5A 5KU7A 3K9GA 4N5DA 2MYPA 3RVKA 3T9CA 1LQUA 1P3DA 3PHCA 1N75A 4GPBA 4LHYA 4DM4A 4ODIA 3DEFA 1A4IA 3JZFA 3I30X 2NUAA 1K8QA 1KJQA 3C6ZA 4CL2A 1RI3A 3W5VA 1JPVA 4MGIR 4N8DA 4F12A 2J0SA 4F5YA 4ABTA 1RXWA 4F6CA 3HL0A 1UM8A 4WLVA 5J4VA 2G1PA 1DU4A 4FFBA 4CDRA 2I7VA 2AXEA 2WBLC 4RF5A 4ER5A 3MJTA 1II9A 2HJ9A 3Q0EA 3T5GA 3PUHA 1CQXA 1L7AA 1Q15A 2IT1A 1RBQA 4D98A 8AT1A 1WW2A 2IF2A 5LJIA 4V02A 1E5DA 4EY4A 3MXTA 4BOYA 2FPMA 2G1AA 4PQGA 3OE7D 3HY4A 5JAZA 3NG1A 2DR3A 3HVKA 4IZ6A 2EL9A 1XTKA 2APJA 3TLBA 4F21A 4KAAA 2CLHB 5G53C 1FZTA 2WQ6A 2VPPA 1M3SA 2EQAA 3AKDA 4MRRA 2HU2A 1N78A 1CS0A 3ZS9A 5FTMA 5KYTA 3ZDQA 4CCYB 1FFHA 2P0EA 1N1MA 3ZBQA 4ENUA 3OZFA 1HZZA 3HYSA 1HDOA 4LXQA 4FMCF 2AW5A 5IC4A 4KDRA 4II2A 1UDWA 2R5FA 4G5HA 4QBTA 3W3AH 4F9FA 4IEIA 4RJJA 2QM0A 1C4KA 3QHPA 4I5IA 3SJAA 3DLIA 4GWLA 3MM4A 1VGRA 3AEXA 4MS4A 1Y4ZA 4AP9A 1VLQA 1J0AA 1EFTA 1YZ3A 2R8ZA 2WJIA 3LLSA 2FH5B 4LS3A 3TXAA 1FUYB 1XCGB 3LZCA 3PA6A 3PU6A 4I36A 4K46A 4QJBA 3U31A 3ZDCA 2HYIC 2QUZA 5T4HA 2Q21A 2Z95A 3A1EA 3NALA 1IZYA 3O2NA 1THTA 2XNSA 2CN1A 4LF9B 3N2YA 3GLFE 4R1OA 1QE3A 4YGXB 1RAEA 1A77A 2CJWB 3HKBA 4JVMA 4L50A 2YV2A 3L7LA 4UNNA 4W5QA 2GR9A 3FGZA 1GU0A 4YQZA 3MT7A 2G3YA 2A4KA 4R01A 1DQRA 2YWRA 1ZOLA 1QH8B 5KYYB 4UCQA 1XQWA 3FCAA 2IYAA 2A5DA 2K2QB 4D46A 5FOQA 1WY7A 2JFQA 3AHIA 4GR5A 3CZ4A 1F6WA 4LRUA 1DELA 1HRKA 2P4SA 2VSNA 4KXWA 4XTCS 3ZKAA 3K53A 3PPVA 3QVKA 1WXWA 4OCZA 1CIPA 1JWAB 1O2DA 1W6RA 3GJZA 3WTBA 1P1JA 5EIFA 3S1SA 5IW8A 3T9DA 3IVGA 1JG3A 1NURA 1THGA 1K75A 2O07A 4NTZA 3I05A 1CHNA 4X92A 3Q3EA 1NU8A 3KT8A 1E2FA 4G4SP 5SZIA 2RBKA 4UMVA 1CLEA 2HK6A 3LM8A 1Y3BE 1H4VB 3UZUA 1X7WB 4Q82A 3I6ZA 3IAS6 3TAUA 2UV8A 3N0WA 3KZOA 4HZUB 5HIIA 3R8XA 4CM3A 5C5DA 2Y1CA 4Q9DA 3CR3C 3G2PA 5E6SA 3U4MA 4BNDA 3QEMA 2PS0A 5E7QA 4ZOLB 1QVRA 4YP9A 2A84A 2PX4A 2WUVA 2OSVA 1AUVA 1GPNA 2Y76A 4HMPA 5UKDA 1S1MA 4QTYA 1VE7A 2QENA 2XOXA 3ROZA 2I4MA 4Y8VA 3K16A 3QITA 5JAUA 1YMVA 1H65A 3BICA 3B3JA 2JFHA 1FQOA 4UBMA 3ZCRA 3HFGA 1VPEA 3MBKA 1JHXA 3TGWA 4EUNA 3KSUA 4XYEA 1L1RA 3K1AB 3C6MA 1TZKA 3O95A 4J76A 3DPSA 1I1QB 4BFXA 4ZD6A 1AQNA 4DV2B 3UHFA 4I1PA 2AWNA 1VP9A 4Y6RA 3TNYA 3IOYA 5LQSA 3M1AA 2YFYA 1B3BA 1DT5A 1E94E 1ORTA 2QJFA 4CETA 2OB1A 4RZ3A 5GZ3A 3QSYA 1J0XO 1AB5A 1JF8A 2ZOSA 3ICVA 3R9XA 1M8GA 1ZICA 2WJHA 4RPCA 4DY4A 5LYJF 1C4OA 1O6BA 1LV7A 4X63A 3PFNA 1PL7A 2ZIVB 3PYLA 4QOJA 4BX8A 3EMKA 1FUKA 3AG5A 3DC7A 3HUEA 4NULA 1UJBA 2DHQA 3R0VA 5JSYA 3T94A 3THYB 5C9ZA 1IBRA 3NAZA 4XXHA 4MVCA 5HG0A 3ZUGA 5GY7A 3QLVA 5IASA 2QTAA 5AKIA 1AC5A 1WNTA 3FKJA 3KVYA 9ABPA 1Z47A 4WDQA 3RGGA 5JMWA 4PZLA 3W05A 1FP2A 5DM70 1JILA 4TZ6A 3QUQA 1DIHA 2B35A 2B8JA 4MJ3A 1COWD 2FG6C 2OO5C 4IIGA 3CPEA 4DIMA 3U7HB 1LPSA 3ER8A 3P52A 4QNMA 1GZSA 1M2VB 1X8JA 3A3PA 3VH3A 4HS9A 1KDVA 1ZD1A 3I32A 1KYZA 1PV2A 2F59A 4WLOA 4JGBA 3KHSA 3EXHC 1T2CA 3CIFA 4FZ3A 3TZBA 3UG6A 1L5YA 1VE9A 2GEKA 3OIVA 4HX5A 3DGEC 4A3SA 2XTZA 1XU7A 4A73A 1IHUA 3CIOA 1UPFA 4L0QA 3ZU2A 4DWVA 4AMZA 1MJHA 1C0LA 5DE3A 2MR6A 1E1KA 2YZKA 4JLAA 2ZUBA 1BVYF 5A5EA 2C29D 1G5TA 1U0JA 5CR9A 2Z5FA 4LZNA 2O0KA 5JXGA 3MJ4A 3GGGA 3R7DA 5HW0A 4NZMA 1N34B 3EH2A 3A3NA 3H2JA 4RZ2A 3DB2A 4HUQA 1Z0AA 3JSXA 4HY3A 4Q9AA 5G4KA 3SXUA 4BVJA 1YRYE 3H04A 1SIBE 1LTKA 2P2CA 1YRBA 4RGYA 2IH4A 2HLDA 5MGBA 2J6HA 3KJEA 1DKUA 4X45A 1EAMA 5DCWA 4FYHA 4WCFB 4DSTA 4R1LA 1IWBB 3QP9A 4B6OA 3OZBA 3SNHA 4B6GA 4L7QA 5CDYA 1XROA 2ZR9A 2XY4A 4ARCA 4FP9A 3KFLA 1TXGA 5JYEA 1A9SA 1P2SA 1EXVA 1BWQA 3W8NA 2HA7A 2ANBA 3RJTA 3EJWA 5DMXA 3O31A 2HHJA 3ZOZA 1LWNA 4DG5A 1CUCA 1P1RA 1OIVA 1W5SA 3QPVA 3DYIA 4YRFA 4BQSA 1R12A 2OPBA 5FFNA 1Z34A 3GJSA 4MB2A 3EBOA 3L1KA 4ND8B 2W8ZA 3H8SA 4O4JB 1S2NA 2QSYA 4EW6A 2QX4A 4P4UA 5T7BA 2AC4A 1L7BA 4CEHA 3KUDA 2X1MA 5I7WA 2B82A 1PWXA 3REQA 3QBVA 1OJ7A 3HM2A 4ZYZA 1YBMA 1EVLA 3CT4A 2PTGA 3HJTA 1E3JA 3C70A 3WGOA 1NATA 4HDCA 2Q4BA 1WUIS 4JLPA 4L0CA 1NM5C 1TMKA 3LL4A 2GF2A 4AURA 5KSZA 1Y3CE 4L6IA 4TMXA 5TEWA 1MIHA 5JIBA 1SBTA 1WHTB 5JFTA 1D03A 3ZE8A 4IRUB 4Z53A 3FVVA 1BEZA 3DL0A 4JUBA 4KIUA 1U3CA 3EWNA 1L8LA 4DR4B 3D8UA 1ML3A 4PHGA 1K7XB 4INPA 5AJUA 4XM0A 2Z8YM 3GN1A 4DLTA 2QX6A 2ZS8A 2PKWA 2E55A 1RQRA 4IGFA 1W29A 1X7ZB 4UC0A 1OLSA 3AI2A 3E1GA 3ONFA 5JXWA 3FM9A 4JLUA 2OCPA 1NSFA 4OVKA 5C1BA 4MEAA 1AK1A 2ZRDA 3U4CA 4FGZA 4LK2A 1ETUA 1Q1GA 3CX7A 1TT5B 1QWOA 1A7JA 2VN8A 4C6TB 5BW4A 4RH0A 4F1WA 2ZJAA 9MHTA 1ZKMA 4WKCA 3RRZA 2VSQA 4ZAFA 2J59A 2XB4A 3BRWD 3R5TA 4TQGA 4JCCA 5CG2A 3LDHA 3SC3A 1RWPA 3N07A 3O3MB 3T7EA 4OG2A 2CUNA 4HG2A 1QRUA 3AY6A 1JAZA 4YQEA 2AZXA 2O3SA 2ZIGA 5F51A 4DR7B 3T7CA 4KBYA 4QFMA 5EJ9A 1RQ7A 4LCJA 1A76A 3HSYA 4HGQA 5ICMA 1OB5A 4C05A 5JH7F 1K4YA 1ZIOA 5JCJD 2I7CA 2CJPA 2RGDA 3BMOA 5F76A 3GLGA 2YXDA 3FZNA 1OZ0A 4G5SA 1I24A 3EODA 3EVCA 4IEFB 3RUPA 2AGVA 2JNWA 4YPOA 3LQFA 3FNRA 3ELDA 1SU8A 3M8KA 5H5JA 1GP2A 4KMSA 4M2LA 4OO3A 5I4CA 5HYVA 1ZD4A 1X9HA 4WXRA 4Q1EA 3AF1A 3SZLA 3WSTA 2DUNA 3GLIA 4Y2RA 2GN8A 3O6VA 4DCGA 3UPTA 4GL2A 1DS6A 4B81A 2J3EA 4R6WA 1E0JA 5TQ0B 3UTDA 3ZY4A 5JHGB 1KFEB 4I3FA 3AVYA 2ZGVA 3K6SB 2I4IA 3D5EA 4DGQA 1PLLA 2FSVC 3HUUA 2ZSAA 4QBIA 3O8LA 2QMOA 1I13A 4IF4A 2I3AA 2JLQA 2GA9A 1KOLA 4BB5A 1P6XA 2BGTA 3IGFA 2NU9A 3IMGA 2K6GA 3INYA 3R09A 5DX1A 4ARVA 2EL7A 3OJLA 3ZDAA 3KOYA 3Q7EA 1T6XA 4NE2A 5EZYF 4BFYA 2G07A 1UBFA 3G82C 3WDMA 1VRVA 2BGLA 1M0WA 4HXEB 4YAWA 1TZJA 2W6OA 2WNSA 5IT0A 3VDMA 1XTQA 2QYOA 2XKBA 4D4MA 1FMJA 4BHTA 2WNIA 4IIHA 3TZEA 4PLVA 1FP4A 2EKQA 3H97A 3ETNA 2KLHA 4FE3A 4H1TA 4I1RA 4I50F 5H59A 1LY1A 3SJZA 1OAOC 4IJ5A 2Q41A 3TOZA 3C5HA 3FYTA 3RIMA 4CG0A 2ZG6A 5ITVA 4QFDA 3MHPA 5GTDA 5EKSA 3K2BA 4LJRA 2C59A 4JB0A 1PZEA 2JAWA 3FUUA 1BEUB 5BSTA 2O8CB 5K45A 3INRA 2H5EA 3VHLB 3WJ2A 3TSAA 4UFPA 3GEGA 4RK4A 1CX9B 2Q1TA 4KNWA 1XTJA 4IIDA 2GF9A 1VI6A 2K5UA 2ZTUA 3IBFA 3TR6A 4J1TA 3L05A 4EG1A 1OKKA 4OBBA 3V2IA 3C3PA 2FFQA 2GETA 4UD2A 2AI3A 2AOXA 2YHBA 1XO1A 4K2AA 4PHTA 5HFAA 1NBME 1MRZA 2GWHA 2WUDA 1GY8A 3B12A 3K9LA 1PQWA 4FCWA 4PIVA 5EWJB 2C2KA 3RUCA 2BBOA 3ELYA 4Z3OA 4WT7A 4DUPA 4MV8A 1P33A 1Z5VA 5EHXA 1Y42X 1VA4A 3LA8A 4Q48A 1G2PA 3R2JA 4U2BA 3WK6A 3FLEA 5GAJA 1USVA 4S1PA 4RA9A 5ARBA 1FPQA 2BH2A 1UBUS 2EERA 2VC2B 3IP5A 2F3TA 3ZR4B 2GSWA 4DIBA 2CZQA 1GZDA 3PD0A 4BX3A 5K05A 2C2BA 4BLQA 4JQOA 1IHOA 3K7EA 4XOUA 4NOJA 4YAFA 3BL5A 3LK7A 2QL5A 2I4LA 4OHWA 3HVUA 1Q74A 3PUVA 1AGXA 4CM6A 3WWYA 1E4EB 4IJVA 3PC8C 3GIWA 4BWYA 1AS3A 2E49A 2H3EA 1C8BA 3HU2A 3MPUA 3JPYA 1H6BA 3ILYA 3PHHA 4I6GA 4C0HA 5IBQA 1HNXB 4HXYA 3BEDA 5B12A 5D3KA 1DV1A 3DG9A 2A0FA 4IX1A 5LZ5A 4C3VA 1SUBA 1QCDA 2AA3A 4CKEA 3RRXA 1ZLYA 1XHEA 2WR8A 4YRSA 3BD6A 3SDSA 2YYYA 2J6CA 1DQSA 3R3JA 3OQIB 1DO8A 1C2YA 1V43A 2FMUA 2QGNA 2OFWA 2ZJ7A 4WACA 3WVNA 2Z6QA 5JPCA 1KZ9A 3DTTA 2WKRA 5LC1A 1IBLB 1WHSB 1JFLA 3RF6A 3RFCA 1NNLA 3NDIA 4IFIA 2VDQB 3D59A 3W6UA 4QPJC 1WR8A 2WIFA 1XA0A 3HADA 3GP8A 1T1IA 3MF4A 4EWLA 3OUTA 2DBRA 2HBQA 2VRCD 5H02A 5BSEA 1UDAA 3VR4D 3CJQA 1C9NA 3MG9A 3TD9A 2FMTA 3H5NA 1FUUA 2RE8A 1VB5A 5CNJA 4RXUA 3CKLA 4IPTA 1T2EA 2JFNA 3C74A 4XX0B 2G70A 3B9PA 4OKIA 4DWOA 1K7EB 3MGBA 4PHCA 2JI8A 4XCVA 2W37A 4LSMA 5CGQB 1JIXA 3SS7X 1T9HA 2XAAA 3R6LA 1PRYA 2P2YA 2IEGA 1N2HA 1WCXA 3AEYA 4I1IA 4YP5A 4ATNA 3AI1A 4JL5A 3UM9A 4N7JA 4QU8A 4ARIA 4M0LA 1VTKA 4ZZIA 5HOEA 5KVVA 4BC0A 2G9VA 3N1UA 4D4LA 1YHYA 5ENZA 4DPLA 2QMQA 2HCTA 5JXHA 3H5LA 5IJWA 5JC8A 5KJCA 3QHAA 2CFIA 4IKPA 2CBXA 4OHCA 3NCTA 2YQ5A 4GXRA 3RSCA 3T7AA 1TDJA 1JI3A 3ENKA 3GA7A 2WAYA 3H18A 4YT5A 5JFGA 3A6HA 2ZRMA 3KEFA 3KTFA 4YJGA 1MC4A 2DWPA 5EXSA 1Z6QA 1N8KA 2AFIA 5E1BA 1XTVA 3UQYS 1V3QE 1LBIA 3A7EA 5ER9A 3T4UA 5G0WA 3IESA 2QRVB 1GN9A 3RIGA 3BE4A 3MMPA 4XVUA 4I1OA 4ZJYA 1IXZA 2HIMA 2A5FA 4TPKA 3OP1A 1T3ZA 4P4TA 1H2BA 1TYEB 1MW9X 1D2EA 1V1RA 2H1FA 1TD1A 4RFSB 2IFTA 5FL3A 4EECA 5HKOA 1OBOA 3EZYA 1EB8A 4HAOA 3NW9A 1CB0A 2ZR0A 4L8GA 4OQEA 4EJSC 2P5TB 2Q6KA 1D8AA 4KPYA 1SY7A 1TIKA 5H68A 4YMLA 3DEAA 3GVPA 2O7VA 1FEZA 4KCGA 1H4TA 2I03A 4PRYA 2OPHA 1F8YA 3TQTA 3Q85A 4CN9A 3IH5A 1SCNE 1IRIA 4DMFA 5CD9A 3L82B 5CH3A 2BF7A 1NXWA 1A9RA 5CMLA 1CU1A 1LS1A 2YJ5A 5L3QB 4AJEA 1Z9BA 2WD7B 3RK4A 3OF2A 4E30A 1N5IA 1HV8A 3FOCA 5ALFA 5C37A 3U3JA 1BN6A 1RZVA 4KLCA 2CXNA 1N7GA 1T5OA 3EJ6A 4PRKA 2WEKA 4TMKA 2W4MA 2ZRGA 4I4TB 4RKYA 5COQA 5EL0A 5EP1A 3Q7QA 4NFYA 2GBLC 1SVOA 2D74A 5K3AA 3ROTA 5G1PA 4DMGA 4B8YA 4YDQA 2CDCA 2OBNA 2XIJA 3MAJA 4TWJA 1UMBB 2BBTA 1KIAA 1ODKA 4XIJA 1BYIA 3JQPA 5AJVB 1NE2A 3DYBA 1U81A 1ATIA 4ICIA 4OJNA 5HJ7A 1DJOA 1HPLA 1RVDA 1THZA 4KTTE 1QXSA 1R6AA 3CH6A 4P22A 1Q0PA 1WKCA 2PL9A 2PL1A 3G0GA 2HO5A 3IV7A 1RZ3A 2GFHA 1FNNA 1E6CA 4F8YA 5DYNA 1ZN8A 5F5LA 3P2IA 1KARA 1I8TA 4Q1AA 1NYQA 1QYRA 4JELA 1C30A 1V6SA 2EEZA 5LLDA 2OO5A 1T1GA 2QLTA 3Q5EA 1Q83A 4MLCA 3RVNA 5BUCA 2PWBA 1LVUA 4GZ5A 4Q00A 3V1KA 3CNLA 3X2SA 3ZE2B 1KYWA 3NBFA 4MW5A 2GD2A 4V1CB 3L04A 3UBTA 3STUA 4W1SA 1AKYA 3IUMA 3H11A 4BLWA 4TV8B 1EG2A 1QZTA 3AM4A 3FTQA 3EXHA 1KTIA 2P35A 1RWKA 2Z98A