2BMEA

High resolution structure of gppnhp-bound human rab4a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
176
structure length
176
Chain Sequence
SETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED PROTEIN RAB4A
publication title High Resolution Crystal Structures of Human Rab4A in its Active and Inactive Conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 62
structure length 176
sequence length 176
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2005-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bmeA01
1PUIA 4L4UA 4BLSA 2VSXA 3NEYA 4P4TA 4O3MA 4M9XA 1E9BA 1YZUA 3BERA 2PZGA 3K9LA 4TYYA 2DHRA 3BE4A 3NC1C 4PC7A 2CBZA 2FA9A 1F2UB 2A30A 1F60A 2ODBA 2B21A 5HKKA 4D4LA 2AXPA 1N3BA 4B2LA 1RRFA 3GQBA 5AJXA 3PVSA 2FPKA 3ADDA 1OKKD 2DWOA 4LJ5A 1G8FA 2GXUA 2XB2A 3HJNA 1Z2CA 1FTSA 4QBFA 2CCKA 3DOEA 2FX3A 4WZAE 1E0SA 1P61B 3T5GA 3IEVA 2YKGA 1EXMA 3C5CA 1II9A 2PCLA 2IHBA 3CRQA 4IDNA 3TR0A 1GILA 3Q7PA 1VCOA 3K53A 1W5TA 2JLWA 3FKQA 5DLQC 1T5IA 2KWIA 2ZSBA 2RHDA 4D0NA 3A8TA 2HCJB 4GZMA 3NBZC 4A92A 1OFUX 4AIIA 4Q1FA 4A6XA 4NYIR 2V7QD 1BYUA 4A0HA 2IC5A 4DUGA 2HV8A 1TQ6A 4FCTA 1IN5A 4WW0A 4JLMA 3QKSA 2IYVA 4MRRA 2J87A 1XPUA 4HLCA 4QBIA 1NN0A 3B6EA 1R5NA 5JEEA 2P2LA 4FMBB 2KB0A 4PAOA 3BJIC 2GNOA 2JDIA 2WWYA 1CJKC 3KXKA 2DYKA 3CNOA 4AYTA 4UJ5A 3CKLA 4P0TA 3O8DA 3OEHA 4EJSA 1ELOA 5EZ6B 5TB5A 3CIOA 3IIKA 4RCYA 4DB2A 2VP9A 4BGDA 1M6NA 4FMCF 1KO5A 2CK3D 2CE7A 1ZRHA 2ZI6A 4L15A 3GLGA 4HB0A 4PO8A 3BC1A 4DSOA 1LS1A 3QG1A 5CK5A 1D5CA 1R10A 2WJIA 4GOXA 5DISB 3NHBA 3E1SA 1R6BX 4HDCA 1CIPA 3VU9B 1GIAA 1N0UA 4M9ZA 2BDTA 2WBLC 4FMDF 4EPXA 4UNSA 4JLPA 2ZU6A 4PAQA 4PC1A 4ZCMA 4BFSA 2G88A 2Z6VA 1E1QA 4IOJA 2AKYA 5JLJA 2ASEA 3ADBA 4F93B 3K8YA 5L3VA 3K0AB 3PEUA 2XJ4A 1U0LA 3W9YA 1DAFA 3AV0B 4EPTA 1KI6A 2LKCA 1KI4A 4CYMA 1T5LA 3RNLA 1K6MA 4BLPA 2IS1A 3ND9A 5GADl 1KSJA 5HE8A 1W1WA 4G5GA 5SZHB 2XXAA 6Q21A 4LBZA 1AA9A 2BMFA 5GJCA 2RH5A 1E2QA 3C15C 4IRUB 4A1FA 4C7OA 1OLOA 2NG1A 5LPNA 3K0EA 2QMUA 1ZYUA 2PL3A 2V8OA 4BLQA 4I1UA 3WY9A 2CLCX 1G4UR 2VF8A 1Q44A 5GJVC 4ESHA 4DT1A 1G3UA 3EW9A 3HPRA 1RZ3A 3C14C 4PC3A 1XMJA 1L4UA 4CRWB 3WHLA 4JZKA 4CDGA 1T91A 2JATA 4ZDJA 1ZM9A 1F2TA 1ZBDA 1Q3TA 1UFQA 2ZRBA 1HT1E 4JL8A 2PZEA 3IHWA 4DLWA 3QXXA 4PX9A 5IF9A 3LXRA 4W5WA 3HU2A 2H17A 4LV5B 4AG6A 3EWSA 1GRQA 3EARA 1XBTA 1UBGA 2JLZA 3CF2A 1J99A 4OJQA 4AKIA 3MWKA 4AI6A 3AB3A 2BMJA 2ZITA 3N2IA 4M1MA 4MYCA 2A5YB 2GEVA 4KFTA 1SQ5A 5IK2A 2ZANA 1N5JA 2L0XA 4BPBA 2OE2A 4LHWA 1JAIA 1NN1A 3I4LA 4URUR 2ZJ2A 3CWZA 2ZUBA 3PFIA 2ZJZA 4ABYA 4B73A 3FWYA 1FX0B 1LF0A 3AKDA 4ZO4A 1YE8A 2ZETA 3AVWA 1ESMA 1F5NA 5BYKA 2D2EA 1II0A 3VX3A 2ZI5A 1VIAA 2ATVA 2IYLD 4ASUD 1X1SA 4JJZA 1GM5A 1TTTA 4PPQA 1RFLA 1W4BA 5KDLA 2FWRA 1FQJA 3OESA 4XH9B 1IXSB 3Q9LA 4I1SA 4U00A 2JLRA 5JHGB 4Q1AA 4AWXA 3BAFA 1H8EA 2HF9A 5DNYB 5B2ZA 5B57C 2FFAA 4DJTA 2A5JA 1D2NA 4A8JB 2ZROA 3A6PC 3SZRA 2W6JD 1KNQA 4DLUA 4HSEA 2R6AA 4XD7D 1E79D 4IVRA 3U3JA 1EFHA 3TIFA 1DADA 4GRAA 1B23P 4O25A 3C5HA 4IDQA 2IWRA 2IYSA 5FPKA 1NG1A 3GP8A 1CRPA 3WNBA 2ZUDA 4V0NA 4DCSA 4LI0A 2OCBA 3IQXA 3AVTA 4KCGA 4Q9IA 2QE7A 5EXPA 2WVJA 3GJ3A 2F1HA 2VIIA 3SJAA 2QENA 1H65A 1ZIPA 1IY2A 4BFYA 1L8QA 3ZQJA 2FF7A 1EESA 5KSYA 4Q01A 2DFNA 1VG9B 3AF0A 3GD7A 5FOWA 5JSZA 3GLFB 5TARA 3WMFA 4DXAA 1I2MA 3THWA 1XTIA 5KSZA 4D0LB 3RRZA 2PEYA 1T4GA 3PUXA 4ZV4A 2BWJA 1KAOA 5L3SB 1N5IA 2RGAA 2HLDD 2JLUA 4C0KA 1H8HA 4MDEA 4RFVA 4ZDKA 1AZTA 2W58A 2W6ID 4JYCA 4DBLC 4LJ7A 4TYWA 2O5VA 2IUUA 2DY1A 221PA 3D31A 2VP6A 2OCAA 4EIWA 2Z5FA 5FTJA 3NC0C 5BYJA 2WWHA 3FHTA 1BH2A 2D7DA 2F7SA 1P75A 3CH4B 3U60B 1C9KA 2A5GA 2QBYB 2EFHB 4D80A 2NO1A 3JZAA 4XTCS 5IRCD 1Z06A 3UANA 4IFEA 4TSFD 4AK9A 2P3SA 3AP1A 2C2HA 3BORA 4JSYA 5JJIA 1KI8A 4QJ3A 2XSZD 2G77B 3PUZA 1E3MA 1ZD9A 4OQXA 1G7SA 1VG8A 5DHAA 1QHIA 3W3AA 3I62A 1OHHD 4LX0A 2Q21A 3L0PA 4HLDA 4NCIA 3QBVA 3THYA 3K09C 2VHJA 1TQ4A 4YONB 1P2SA 2GVZC 3CRMA 2GETA 5KSPA 4IVQA 3R9WA 1ZM4A 2DPXA 2QGZA 1YR9A 1ZP6A 1JB1A 3MJRA 5DN6A 2I1VB 3AP2A 4Q5IA 4IDPA 4XJXA 1ZCAA 3A4LA 2EYQA 1Q0UA 1TADA 2F43B 2VP2A 3MMPA 3AVQA 2CHGA 2WJJA 3LAWA 5SZJA 1YJ5A 1J2JA 4IEIA 2WSSA 1NVVR 3FMPB 2OV2A 1CTQA 5KNBA 4URYR 3IBYA 1U9IA 2CL6X 1KKMA 3BB3A 4P4SA 2QROA 1X8KA 4IDHA 3IPXA 5GVSA 2YJTD 1UJ2A 2BKEA 2IUSA 3X1ZA 4LPKA 4QGGA 3QKUA 3RSLA 1V43A 3IUYA 1LY1A 1G7CA 4I1OA 3WRXC 4GOJA 1KK1A 5D3QA 3OAAA 1OXVA 1XMIA 1IY0A 4E07A 3CO5A 1XEWY 1OF1A 1US8A 1NSTA 2XOKA 1W36C 3Q72A 1NF3A 5FUVA 3W34A 4KLNA 1R4AA 3OF5A 1JR3D 3OIUA 3ZZTA 1OXSC 4JLKA 2NIPA 4TQAA 1YZGA 2N1BA 3F5FA 5KNCA 2GF0A 2H92A 4LOAA 4TLEA 2CHVA 1R0YA 3ASZA 2ZREA 2ZI4A 1HURA 4L9SA 2HYDA 2IBMA 5AJVB 3TLXA 3WRYC 1GVNB 2VSFA 1IOZA 2GDJA 5TXGA 3QVUA 1ONBA 2V6JA 1T6NA 3VQTA 4ZIRA 1G8GA 2C9CA 4F4IA 3Q7QA 1DTSA 2EFGA 3O8BA 2ZRFA 4LGMA 4TQ9A 4F4CA 2O8BB 1OH7A 2CNWA 4YXWA 5CB6A 1SXJA 5G40A 1E2IA 1XCGB 2QAGB 4JL6A 5G53C 3I8XA 1AS0A 1P4SA 2J0UA 3CNNA 2GBLA 4DEXA 3T06B 3TSOA 2CCJA 1ZD8A 4HUQB 4II7A 3BH7A 5H70A 5KTYA 2P67A 1XTRA 4URVR 3BFKA 4WVFA 5KDDA 2BIFA 3QJYA 1AZSC 3AUYA 3B1YA 4TQUS 4LYAA 2VYFA 1KIMA 4M2LA 3Q8XB 3FHCB 2OZEA 1K5DA 2EFEB 5FTLA 4HB2A 1VYVA 4DDTA 4KFRA 2J9RA 1NN3A 1YR6A 2P65A 1N2CE 2RGGA 4BEBA 1J70A 1ZNYA 1AK2A 2HJGA 1DPFA 4PHFA 3C4JA 3LY5A 2V1XA 5FL3A 4KVAA 4TT3D 2HYIC 4PO1A 1ZUIA 4FIDA 2BV3A 4LBYA 2ZS7A 1HY3A 2H57A 3DVLA 1U99A 5J40A 4QKQA 3LBHA 1HE1C 4DCVA 4UQOA 1RRCA 2VHUA 1WBBA 4CEIA 1G291 2A7QA 4YMVA 3CLVA 1E6CA 2QY9A 3NIBA 2GWHA 4ZI2A 2UZ3A 2DR3A 4CT4B 1P5ZB 4TYQA 4EJSC 1OH5A 3SFZA 2LCFA 5K8UA 1VHLA 2GXAA 4MRSA 3VR2A 4X8HA 5JBQA 5E7IA 2ZR9A 3NTUA 1YZTA 1P2TA 1U0JA 4Q4AB 2NPFA 4Q9HA 3RC3A 3B1ZA 3OFND 2IF2A 4WBSA 1OIXA 2AFIE 1NNEA 3SEAA 3EIQA 1RIFA 3QEJA 3UMRA 1AS3A 5EUMA 1IXZA 4M9SA 2B8WA 5DGXA 3GEHA 2BM0A 1AQYA 3GFTA 4PC2A 4V03A 2AK3A 2PT5A 3TH5A 4A0RA 1YZKA 3GJ8A 3U3RA 2XITA 2P0EA 1EG7A 2W0SA 5FOTA 1DO0A 1NY5A 4JIMA 3MWLA 4X8MA 1N6LA 1OXUA 1P3JA 4Q47A 4QFMA 1P9RA 3I8SA 1CEEA 3OHMA 4QHSA 1HYQA 3GFOA 2CMKA 2YOHA 3M4YA 4B33A 4TL6A 1UKVY 3K70C 2IUTA 3J81k 3L82B 3ETLA 1CR1A 3CR8A 1IJEA 4R98A 3K0FB 4S2EA 3UMSA 4Q48A 2W2VA 1BMFA 4BZQA 2ZSFA 5AUNB 4Z1MD 1VPLA 3LBNA 2D62A 1JR3E 4ZKEA 2A3RA 4TN1A 4NZYA 1BKDR 2IYRA 1EGAA 1TPZA 3R9IA 4ESVA 3SQWA 2VF7A 1IN6A 1LNZA 4AD8A 3ICEA 4BLOA 3KQKA 4EQ6B 3K9GA 5JRJA 4PPNA 3A1TA 1G3RA 4NCJA 4O2LA 1FNNA 1LF5A 3CB4A 2CVFA 1S9DA 1VG1A 3BH0A 3FYHA 5FBVB 2BOVA 1AGRA 2P6UA 4QBGB 1C1YA 1JALA 3SOPA 5JZVA 2IYUA 3N70A 3R7WA 1UKYA 3H4MA 4CF7A 1LS6A 1VTKA 4LDJA 2ZRJA 1OKKA 4FWIB 3GJ4A 4A9AA 1WDTA 2XNDD 1GRRA 4U5XA 1KOFA 4LV8B 5BN5A 3RS3A 1E69A 3LW7A 1P9NA 3QOFA 4C0QC 5LB2A 5M04A 1KO4A 1CXZA 3VNVA 4Q00A 3K9NA 1J8MF 5J4YA 5LD2B 1M7GA 3GFPA 1Q21A 1E2FA 1QHNA 2X8AA 1FL9A 4JT4A 4US2R 1TU3A 1OYYA 3LLUA 4NYMQ 2WKRA 5J4LA 5BQ5A 2VEDA 4OQLA 1OXTA 3EWAA 2NO7A 4I4LA 4V0OA 4POAA 1NKSA 2ANBA 5BW8A 2V7QA 3P32A 3RAPR 3EZ9A 1XPOA 1U98A 1G8PA 1VYTA 3SYKA 4MGKR 3SBEA 4JVSB 5LB4A 4B3CA 2ZRHA 4UNRA 3PUVA 4TMWA 3L8YA 1ZNXA 1LB1B 3AVYA 5LBIA 3VMFA 3CZPA 3L43A 4MDFA 2BEJA 4LYJA 4YDSA 3LX8A 4GL2A 3VNUA 4TTQA 1G3MA 3PEYA 2H8KA 2QA5A 2J0QA 1E9SA 3OIVA 4C2UA 3X2SA 3QF4B 5FL7D 521PA 4KLZA 3HR8A 3WYAA 1II8B 3QBTA 2IYZA 2ZQ5A 4BLTA 1Z0IA 1AJEA 3BK7A 2ZVPX 3UXMA 4GPTA 3CUEF 3QXHA 4EPYA 1XTKA 3QSYA 5EZ5A 4IXNA 5CYOA 4OI4A 4PPFA 1LTQA 2CJWB 4D2IA 1U0HC 4HLQB 2HT1A 4RKEA 5GJBA 5G3YA 2AX4A 1RW4A 2F9LA 3ADKA 2WJVA 3IO5A 2OSBA 4HLUA 5FBRB 3TQFA 1MOZA 1Z6TA 4PR0A 2GJAA 1CR0A 1T3LA 2G1JA 3KTAA 4B44A 2Q3HA 3EZFA 1G7RA 1DAEA 3AF4A 1UKEA 1GL6A 2YC4C 8OHMA 3K0AA 4QC2A 4F38A 2ZJYA 2AKAB 2D7CA 2PX3A 1GWNA 2H16A 2ZJBA 1RPZA 2FEOA 1G19A 3BWDD 3PITA 4G1UC 4IKEA 4CEJB 2O0HA 2IX3A 4PZYA 3FKSD 3H1TA 2NZJA 2J3EA 2IWHA 4HATA 2YZ2A 3PXGA 1W47A 1OPXA 3SI7A 1EFTA 1UF9A 1JPJA 3C7KA 1L2TA 5AWFC 4NYJQ 1RC8A 3CM0A 2NQ2C 3UWKA 1BO6A 1UPTA 2A5FA 3I92A 4JVMA 3NKVA 4B35A 1CF4A 1NG9A 4G5OA 3U7FB 4TLCA 2KBEA 4G01B 1XEFA 2RGEA 4M1OA 1OH8A 3U44B 5HCNA 2GJKA 2JJ1D 2ZYVX 3B9PA 1U94A 3UATA 4QRHA 3AGPA 2ZE5A 3QUSA 4KSCA 4TMKA 1Z29A 2VP4A 3AF3A 4V0LA 2FGKA 1W4RA 1DOAA 4HAWA 4GSYA 1U2RA 2HCBA 1KO7A 3TUZC 2CEAA 2WOJA 1MRNA 3SJCA 1U9IC 2GXSA 4KJZA 4TZ0A 3VR1A 2O8EA 2B7CA 3OE7A 1YR7A 2AWOA 1DBSA 3DEFA 4J0QA 1G6OA 4YMWA 2VTKA 2IYXA 1UDXA 1XDBA 4TMVA 2EU8A 4K46A 1UEJA 4B74A 1FX0A 1Q1QA 1JXOA 1W0KD 5EXSA 4M1YA 3SBDA 1ZU5A 4GMDA 3KL4A 3U4QA 1JR6A 3IEUA 2QP3A 5E4FA 1NVXQ 2F6RA 3TSZA 3CWQA 3LDAA 4JLAA 2GTPA 3Q85A 1I4TD 2ZEJA 4Q9JA 1X86B 1S3SA 1XJ0A 2FZ4A 4ARZB 4AKEA 2F1RA 5E3HA 5F3WB 1ZM7A 2DFLA 3FDIA 1V5WA 2Q9BA 1PZNA 2F3RA 3VR4A 4F91B 2V9PA 3M0EA 3T34A 1XZPA 3LW8A 4Z8YA 5JWRA 5ELXA 2J59A 4LYHA 1JJVA 2XTZA 2GA8A 3A4MA 4KBFA 4XD7A 1Z3IX 5K8IA 1G16A 3P1JA 1Z6AA 2BBSA 5C2JB 3CBQA 4N3NA 3IQWA 3VR6A 3AVOA 3GLIA 4KBGA 1Q1EA 4FN5A 2R6GA 2PEZA 4OI1A 1SXJC 4KO8A 4YMTA 2JJ2A 3K0CA 4URWR 2FPMA 2ZRDA 3UIEA 1GRNA 2GBLC 2GJ9A 1E9EA 2V3CC 2ZSDA 4F92B 4I81A 3U3MA 3GLFA 4GOKA 2QMOA 2ZRGA 1Y63A 3U2QA 2QSZA 3EAQA 1FPMA 1S0UA 4PHGA 2GCOB 3ZVRA 2D06A 4FMCB 4XWOA 3RLFA 2MSEB 2HUPA 5L3SA 5JRZA 1ZW6A 4TZ6A 2W6IA 3X1XA 1XRJA 1A82A 4N1AA 2QT1A 4V02A 5CDFE 2BMEA 5FUXA 3U7HB 3RS5A 3H86A 4QGAA 1MO6A 4FMDB 4ZKDA 1NSFA 4G0NA 2KJQA 1UEIA 5KUTA 2BBOA 3DM9B 1Z2AA 2VBCA 1XCMA 1MABA 1OV4A 2B92A 1GNRA 3CF6R 4DLZA 1YU9A 1XU4A 2BM1A 3B1VA 4M21A 5CLLA 4OHZA 4BFVA 4KAXA 2XZOA 2V54A 4O0MA 2WPDA 4Q7MB 5FUYA 1X8JA 3U61B 2OAQ1 1MO3A 1KDTA 4NPHA 2QL6A 4NCKA 2JCSA 4LY6A 4NDZA 3FTQA 4OHYA 1G3QA 1WA5A 4MUAA 5A0FA 2NGRA 2QMEA 3FMIA 3GLHA 3CRW1 3PIRA 4HZUB 4ITRC 1TEXA 4LHYA 3KQLA 4BECA 2N42A 1X3SA 1W36D 1W36B 1XEXA 4OBEA 1SVSA 4K81B 2BCJQ 1XTQA 4FXPA 3SDZA 1KJWA 1T3HA 2QPTA 4NP6A 2WOOA 4W5JA 1KMHB 3A1WA 2D4HA 3C16C 1AS2A 1E2HA 3QKRB 3TKLA 2ODEA 2JJ8A 4DLRA 2J5XA 2WWFA 3L0SA 2OILA 1KSFX 3DHWC 5GVRA 2F43A 2QP4A 3LH5A 1G6HA 3KFXA 1E9DA 4N0DA 4MQBA 1ZNWA 2IL1A 4ACBA 1COWA 2WSMA 2G9NA 4HAYA 2YWGA 4UXIA 5L3QA 2QQEA 2GRJA 1XMVA 2QGNA 2IF0A 4QJ5A 1D2MA 2IXFA 3IDQA 4TYNA 3NDPA 5G41A 3AVVA 4I1VA 2HXSA 3HP1A 1CKEA 4C0BA 3NH9A 1IN4A 3MCAA 3I5XA 3QXJA 5HKKD 1U81A 3ZS8A 3PEWA 1ZUNB 4URZR 4TL9A 5DH9A 5H8WA 1QHGA 2AD5A 1E2PA 3S1AB 4A6PA 2I3BA 4B3XA 2Q9CA 2CL0X 1K8RA 2ZPTX 3QPUA 1N5KA 2Y8EA 2OM2A 3EG5A 3D6TB 4MKGA 5FFMA 2X19A 4LSGA 2BBWA 4UXHA 1NVWQ 4EAQA 1AN0A 4Y0AA 3SYNA 1XXHE 2ZSAA 2H18A 4MYHA 1N5LA 1EFCA 1UM8A 3VX4A 3C8UA 3W6OA 5F9FA 2ZYUX 1EX6A 3ZZUA 2QEQA 3F3YA 2ZJ8A 2CVHA 1QRAA 3MSXA 1TF5A 1E4YA 3KJHA 4CEHA 3DKPA 3BBPA 2D2FA 2GKSA 2RKOA 2ZRAA 4Q4LA 2ZU0C 1N6OA 1GFIA 3TSWA 3UKDA 1Z08A 2QMHA 2ZJ5A 4E5UA 2O8BA 2WIAA 2ZAMA 1ZVQA 5KO2A 2QAGA 1M7HA 2VH5R 2X2FA 1PVOA 3OIYA 2WWXA 4MRNA 2QG6A 4OYHA 3JVVA 1G41A 1U8YA 1Y3AA 4IXMA 1TEVA 2C8VA 2V4ZA 3AF1A 2B8TA 5FTKA 2WM9B 3VHXA 3OEHD 4L8GA 4EJSB 5KOYA 1T8TA 2IS6A 3U5ZB 1EFRD 1OB5A 2C96A 1GDDA 3SHFA 3P27A 4WZBE 4Q1CA 1QBKC 1E1RD 1TUIA 2V55B 3KUDA 3NVAA 1KDRA 3B13B 4NHOA 4B75A 3W5IA 2P6NA 5K8LA 3GLGB 2J46A 1JQLB 2XTNA 4DSUA 2JGNA 1W0JD 2GCPA 1PLJA 2V1UA 1Z6YA 4ILEA 4MUBA 4B32A 5F9HA 5FR2A 1Z28A 3GEEA 3MRSA 3Q3JB 4HAXA 3I3SR 2XGJA 4TT3A 5H1YA 3VFDA 1FOEB 3V4FA 4YC7A 4QL3A 2XZLA 1KI6B 3NEJA 4GT1A 4R71A 4QM6A 4IVPA 1DAIA 5DE3A 2BJWA 2YOFA 1N0WA 4Z51A 3CF0A 2ZRMA 3A37A 2IK8A 4GDFA 1W48A 1S3GA 2XNSA 3CR7A 1XF9A 3W8RA 3WP0A 3ZIAD 4DCUA 4ZCIA 2XXAB 1RJ9A 1WQ1R 3ZYCA 2FNAA 4XVUA 2C9YA 4C7OB 3SU8A 4CGZA 3ZJYA 3IBGA 3NBYC 2Z4SA 1E9CA 3O8RA 2ATXA 4BQSA 4AKHA 3TW8B 2OAP1 3MWYW 2C95A 3QENA 1KO8A 4DLVA 4DT1B 1XWIA 2WJGA 3MLEA 4HLUC 1AGPA 3CRRA 3KB1A 5FOVA 2ZI3A 4DDWA 2FDCA 3WHKA 3SJBA 1Z8FA 4HYYA 5EE0A 2OCPA 1Q1ZA 3SYLA 5AJYA 3TMKA 5FI0B 1YZLA 3FVQA 1NBME 1E0JA 4D25A 2J7PA 4DLTA 1GG2A 4TMZA 2Q6TA 4DSTA 1FUKA 4FINA 2FEMA 4JLVA 5FOSA 4RJLA 4GFDA 4B2PA 1SHKA 1DAHA 2QSYA 3AH8A 1NI3A 3FMOB 5IK2D 1S8FA 3PUWA 4XSGA 1OXXK 4PSKA 3B82A 4R2IA 5FPHA 3K0FA 1IN7A 2QRZA 4B3DA 2ZRKA 5EP3A 4Z1MA 3V9PA 4US1R 2N46A 1OSNA 1QG4A 1VCMA 3WMGA 1G8YA 3A36A 3WXMA 5J4HA 2F55A 2V6IA 2Q0HA 2GCNA 2VRWA 3W6PA 3RVBA 4MYUA 2XX3A 4TLDA 5FR1A 4DIDA 1T0HB 4U02A 5GJWC 4M1TA 1XJQA 2GZHA 1SHZA 4Q1EA 4EQ6A 5JCZA 3RC8A 1VYUA 2O8CB 2DCUA 2F1JA 4C4PA 1MV5A 4LWZA 3F8TA 1NKTA 2ZS8A 1NN5A 1EWQA 3SQXA 4RFSA 4DHEA 1XFAA 1FNMA 4AYWA 1JI0A 1ZINA 2QQ0A 3B8HA 4L9WA 1KI2A 1W2GA 5EP2A 4A82A 1PLLA 3W5JA 5FOUA 5HTKA 2W2TA 3I61A 5TV2A 2O8DA 2YNMA 1YVDA 2R2AA 1TAGA 3TW4A 4KV9A 4D82A 2QRNA 2B7BA 1HA3A 2VHTA 4LHXA 1DEKA 4G3XA 2I1QA 1G17A 1ZU4A 4IW3B 3FHOA 1A2KC 2QE7D 4PAMA 2GESA 4PSAA 3HU3A 2SHKA 3KDSE 2CL7X 2YWFA 1N6IA 1ZC4A 3LWNA 1DVRA 3QG5A 1KO1A 2R65A 3OEEA 1OIWA 4M1KA 3GJ0A 1DELA 3KKQA 4TWZA 1RE0A 2PJZA 4JLJA 3THWB 1KY3A 3DMNA 3GLGE 2WMOB 2YVUA 5L8VA 3WNCA 1ZJ6A 1BS1A 3CW2A 1Z6GA 3O8CA 1JEDA 4H1UA 4C0JA 3D7MA 1Q22A 2EYUA 4C0SA 1BIFA 1W7AA 3DKVA 2ERXA 3GJXC 2GILA 4RY2A 4IOMA 2QM8A 5KPDA 1WRBA 3LVQE 1E2GA 3QNUA 2BC9A 3AVPA 3F0TA 5E95A 1Z63A 3PV0A 2RMKA 3MGCA 3UWOA 4TMXA 4TYPA 2VPPA 2CE2X 1G21E 1MO4A 3A1UA 3EASA 3QE0A 5DYIA 1NLYA 4RZ2A 5SZIA 3LFUA 4TL7A 4WOPA 1TNDA 3UMFA 4R7ZA 4LJ9A 5C4MA 1CULC 3FGNA 3K0CC 2QM7A 3L0OA 4W5HA 3SC3A 3BD9A 2FFQA 3BOSA 1KZGB 3VTKA 1CR4A 5TDHA 3EPKA 1ANKA 2ZYWX 4IJMA 4IOLA 4DVGA 1GNQA 2OFOA 1Z0DA 4H9GA 5EP1A 5DSZA 5C18A 1S1CA 4B2IA 4L16A 2X1VA 4MKIA 4OJKA 3WYFA 1SVOA 2IT1A 1MT0A 3A1SA 1KTVA 2GJSA 5IT5A 1SKQA 5DN6D 4QGHA 4UNPA 1GTVA 1JJ7A 2H5EA 1T0JB 2KSQA 3TJZA 1P2VA 3DO6A 4NYIQ 4HDOB 5HZKA 2ZS9A 3KKOA 4UXJA 1GKYA 1XP8A 1JAHA 2WSSD 5DI3A 1KI7A 1XD8A 1RKBA 4PQYA 3LQQA 4LUCA 3NH6A 1WP9A 4NMMA 3AQ4A 4KVGA 4A2PA 3GCGA 4LPSA 1KKLA 2FSHA 1B0UA 3LXXA 1R8SA 4QHTA 4A2WA 1DS6A 1S1MA 2IEZA 4M1WA 3RRMA 1ZIOA 1WCV1 4BRWA 1LW7A 4DLYA 2OFWA 4YQFA 1HQYE 4RZUA 4UJ3A 3I72A 2A78A 1E2MA 4US0R 4EPVA 4D4JA 5FTNA 5CM8B 2XOKD 4GNKA 3DOFA 2VLIA 2GAOA 3THXA 2RGDA 1XD2B 3EA5A 4JLOA 1G18A 2EFDB 4UNNA 2NOAA 3D8BA 1VMAA 1DO2A 4Q4JA 4B71A 1R0WA 5D3MA 4OI2A 4B6FA 4NE2A 3A1VA 4XOIA 5AJZA 4D81A 4MGZR 1SVMA 2JJ1A 2NO6A 3LLMA 1I2DA 1E96A 4M0LA 1GAJA 2ZI9A 3PJRA 3U6KA 1PLKA 3EXAA 1F2UA 4JBWA 2J1LA 1P72A 4JMPA 3ADCA 3TAUA 3UG7A 4L5BA 2KBFA 1LVGA 1OFHA 1N6PA 2GF9A 1E9RA 2WWWA 2JIZD 4A0FA 2QORA 3W90A 4OHWA 1E0KA 3EIEA 4RZ3A 3SE0A 1WXQA 1AKEA 1MRSA 1Q12A 2PH1A 4LJAA 4MRPA 4PTLA 3RWMB 4ZIRB 1YR8A 2VP0A 4KU4A 5L3RA 1X1RA 3R20A 5FUWA 3V4RA 5AUPB 3ZVNA 4PHTA 1G3IA 4RD0A 1SXJD 1SXJB 1W0KA 2REXB 3E70C 4IEEA 4R2HA 2ZRCA 2GZAA 2J0SA 5EXXA 2P6RA 3FB4A 2J0UB 4FWTA 4IOKA 2HEIA 1VIYA 2J41A 5EUQB 2JLQA 4Q9LA 3AEZA 2C98A 1W44A 1TMKA 2WAXA 3G82C 4C0AC 5BXQC 4JLBA 3NXSA 3KZ1E 2C77A 2RHMA 4ARZA 3VKGA 2WWIA 4C9BA 4C0HA 2EW1A 1NMZA 3LQRA 3T61A 3LRPA 1RYFA 2QPAA 3IPYA 2FN4A 3BS4A 5TMPA 1FMLA 3X1WA 4Q4HB 3PUYA 1C4OA 3PG5A 4DZZA 2RAPA 4JKIA 2AWNA 1KI3A 2O8FB 4JS0A 2OHFA 2ZIAA 2ODWA 3DDCA 2A5DA 1RRPA 1GSIA 3HR7A 1LV7A 3SS8A 4AURA 3R8CA 2ZSEA 4B76A 2CK3A 2IXGA 4F4JA 1G5TA 3LNCA 2JA1A 1G64A 1VKJA 5BN4A 1BOFA 4WZ6A 4B6EA 2JAQA 1QHHB 1SGWA 3GPLA 3BH6A 1KZ7B 2BJVA 2VHCA 3FFBA 1KSGA 3VU9A 4BZXA 3VAAA 1NIPA 1XZQA 621PA 4HUTA 1ZCBA 3K09A 1CBUA 1FQKA 2AL7A 2BMDA 3B7GA 2IS2A 4OQNA 1OJLA 5FPYA 2PBRA 3HDTA 1HEIA 3T1OA 1CLUA 5KU1A 1KY2A 2YOGA 1M34E 3AGQA 4KHZA 4QG7A 4H1VA 1YRAA 3BFXA 2RB4A 5CLQA 3CX8A 1LFDB 2WJHA 3MWJA 3E5HA 2A9KA 1XJCA 1IQPA 3K1JA 2Z43A 2CLSA 4HAZA 4V0KA 4B48A 1BYIA 1TQDA 4E09A 4M1SA 4NCNA 2GAAA 5AUQA 4FI3C 3K0SA 1M2OB 4ZCLA 3TUJC 4B3GA 2XZPA 3H2YA 1Q3HA 4FCVA 4KSBA 1E9AA 4P4UA 2GEDA 3VKWA 4LV6A 5J4VA 1Q57A 4ZDWA 3DM5A 4GMXA 3KUCA 4LYFA 5C46F 4B3BA 2FG5A 4NH0A 4PPGA 3SR0A 4XTRA 2X2EA 5JJKA 4HZUA 2MSDB 3RS2A 4D4MA 1ESNA 1KDOA 4EUNA 3AKEA 5CM9C 2JLVA 4RD1A 1XNJA 2QPOA 2ZRPA 4HB4A 2G1KA 4LCBA 4DEYA 1BMFD 2O52A 3QKRA 5JS8A 3VR5A 4JVNA 1NL3A 1Z07A 2UKDA 3AP3A 2VQSA 1IJFA 421PA 2ZR0A 1NMYA 1TUEA 1RRGA 4LHVA 3B60A 3KQNA 3ZQ6A 2FGJA 2JLSA 2O0JA 2PMKA 1N6HA 1PV4A 5P21A 5F2EA 1E94E 3SJZA 3ND8A 4A2QA 3BB1A 1Z0JA 2QNRA 2DBYA 3WBKA 5CB8A 3WMEA 5EE9A 3KB2A 3CPHA 3QF7A 3R7WB 2ANCA 4ASUA 4Z54A 1IY1A 4EDHA 1SXJE 3S1AA 4Q66C 1XXHB 4HZIA 4JSTA 5JMTA 1R5OA 1OE0A 2IYQA 2MSCB 1W49A 3JVUA 4WXPA 1XEWX 5CK4A 2REBA 1FP7A 4GI7A 4DCTA 1W5SA 2QT0A 3GEIA 3TGPA 4X8LA 1QG2A 1A4RA 2WHXA 4M53A 4A8JA 2ECKA 5J47A 2OG2A 2OBLA 3EPJA 4IFBA 2W6JA 3NG1A 1GOTA 4RSGA 4HAVA 1E79A 3ONWA 1D2EA 1QHXA 4AKGA 5F98A 1G1MA 2IS4A 2QTFA 1UBFA 5C1BA 1NVVQ 3PENA 5UKDA 1U8ZA 1IHUA 4JLDA 5HCIA 3RS4A 5G3ZA 2OUKA 4KYIB 4QOSA 3RRNA 3SHWA 2FU5C 4O2RA 4V0ME 1G9XA 2FH5B 4OK6A 3T35A 2PMDA 4LHZA 5JECA 2JLXA 3V00A 2H7VA 3BB4A 4HAUA 4YDHB 3VKHA 3WNDA 5B58C 2HJVA 1HUQA 3M1IA 3GMTA 2TMKA 2YWEA 3EZ7A 3T5DA 4D4KA 1Z0AA 4Q7KA 1HQCA 2HLDA 1EFRA 4AYXA 3QI2A 3FMFA 2FV8A 3KQUA 2KI5A 1E1RA 2ZR7A 4JJKA 4DDVA 1W2HA 3K9HA 3QPVA 5LD2C 4HDQB 1HTWA 4CW7A 4DB4A 2IXEA 4PQFA 3CH5A 2VHQA 1ODFA 4DLXA 1W0JA 5LDDC 2GJ8A 3RS0A 5KSOA 4QM7A 1G20E 2FSIA 1FTNA 3I5YA 2GVDC 2QBYA 2QAJA 4TTRA 3KTAB 3TVTA 1YKSA 2CCGA 3W8NA 1AQUA 4MITA 1N0VC 2G0NA 1KJZA 2HXYA 3PCRB 1R5BA 4G5SA 4TSFA 3RYTC 1X8LA 1D9XA 3IIMA 4D0GA 1FFHA 2F1IA 2XSZA 1M1YE 2K5UA 2PZFA 3BIFA 1R2QA 3KJEA 1OHHA 4I99A 721PA 1UKZA 5ANRB 5IHPA 1L7VC 4KXFB 3TR5A 2Z83A 4BWYA 4BLRA 1WF3A 3IIJA 3ZIAA 1GITA 5JEDA 1HH4A 3QVVA 1P60A 2JLYA 1UADA 2IEYA 2IW3A 5HZHA 2OFXA 4RKFA 4F7WA 1OH6A 1HV8A 3D3QA 2WMNB 1DG3A 1DARA 2GHIA 4OHVA 4Y0VA 4XIGS 4NYMR 4DC9A 1UBCA 1N6KA 1OB2A 2LKDA 3G5UA 4GZLA 3NDBB 1NBMD 1FUUA 2QUZA 1G7TA 4MH0R 2XAUA 2RGNA 3L0IB 2P5SA 3ZH9B 2BCGY 2R44A 4W9MC 1Z0FA 1JECA 5J4KA 4P33A 1TU4A 2IHYA 2FOLA 5FBQB 1KK3A 3REFA 2PLRA 1T8UA 1FZQA 3B85A 4PHHA 2R6FA 5TVKA 1Q1BA 2ORVA 5DYGA 3EIHA 2NPIA 5DO9A 2R62A 2NO0A 3P26A 3TBKA 4LJ4A 4EPRA 5CITA 2WV9A 4CIDA 1QHYA 2RCNA 1KNXA 2FSFA 2WJYA 4PC6A 2ZJAA 4TMTA 4C0LA 2OXCA 2ORIA 2O8EB 1JR3A 3OE7D 3DPUA 3SNHA 3T12A 1XB2A 2CXXA 5JFGA 2QTVB 4W7SA 2PX0A 3KKPA 2W2XA 1Z5ZA 4A15A 1PUJA 3IHLA 2AK2A 4EKDA 2OCYC 3MAAC 3T15A 3U4QB 3CRVA 1NVUQ 4UKDA 4B47A 2QN6A 3BRWD 4OK3A 3MD0A 3ASYA 2E9SA 4HB3A 4PSVA 4MGIR 1RYHA 1QVRA 4R9UC 5HPYB 4OQFA 3QEOA 5EE5B 1G4AE 1SVLA 4ZI3A 1IN8A 5DI9A 4K8OA 2O8CA 1P2UA 4JLNA 4QBHA 3AUXA 4DUGD 4G5RA 2FFBA 2NTYC 3QKSB 3RABA 3PQCA 3BGWA 1DAKA 1GZSA 5DHFA 3EC2A 3NBXX 3QIAA 2Q3FA 2JDID 2WAYA 2WKPA 4B43A 4KFSA 4WXRA 3B1WA 4HUQA 2GK7A 5FPSA 4Q7JB 4PO9A 4JBXA 5J5CA 3RANA 2E1RA 4DIEA 3GLIB 2W00A 4NYJR 3R8FA 4PXAA 3MFYA 1A2BA 2DWPA 5FTMA 2JJ2D 5A4JA 1AKYA 1SULA 4LRWA 2EQBA 4RD3A 1F6BA 2OBMA 1GNPA 4CT5A 2H1LA 2HF8A 2VO1A 5KYKA 1E2DA 2YYZA 2DFKB 3G0HA 1YQTA 2BVNA 2RGCA 3QXCA 4X8OA 4A36A 2IYYA 4C3ZA 3ECCA 1E1QD 2FMXA 3P4YA 1U90A 4NL4H 1DAMA 2P5TB 2WWGA 2XTMA 4FCWA 4N0EA 2G0TA 5KDOA 1P6XA 2W0MA 2BEKA 2AXNA 3TK1A 5C4GB 1GUAA 4PZLA 3QKTA 2FPLA 1KDPA 1KK2A 1N6RA 4BFUA 1Z47A 1VHTA 1OYWA 1Z22A 4LC0A 5SZKB 3KFVA 2PLFA 4RVCA 3X1DA 2OEPA 1MABB 2WIBA 4U7DA 4LZZA 4EFNA 1VDZA 4P3YA 2BBTA 4Q1DA 3K70D 3K70B 2LWIA 4OK5A 1T9HA 3CONA 4FW9A 1GL9B 1OW3B 1YRBA 5IDVA 4GP6A 2WPDD 4Q9KA 5E7JA 1ZM2A 1O3YA 3CPJB 4JBYA 5CYPA 4QHYA 4Q4AA 2ONJA 4Z8XA 1E2NA 3OFNA 4TTPA 4C30A 4PANA 3TAHA 2I4IA 3B5JA 3DZ8A 4ZPXA 3TUIC 2RGXA 2DFTA 3GLHB 2G3YA 1FMJA 3LO5A 4NBSA 1R7RA 1Z6XA 4JKYA 2ZRIA 1G5RA 4TLAA 2ZI7A 3PEVA 2CDNA 4M4SA 1XEXB 4JYBA 1F2TB 3WP1B 3CNLA 1F3OA 1DAGA 4ON9A 4A0GA 3WYGA 1X6VA 3NWJA 1W4AA 2EVWX 2UZIR 1L4YA 2RGBA 3THOA 3O47A 3FFAA 3W6NA 2C9OA 1DG1G 2PCJA 1S2MA 1WBDA 3N5CA 1SVKA 4KITB 3LA6A 1NIJA 3KKMA 3TE6A 1VCIA 2HDNB 1COWD 5K8TA 1EFUA 4XVQA 1KK0A 2OLKA 3TNFA 5JHHB 5L3QB 3ZD7A 5JWHA 2YWHA 5EQTA 1NY6A 4PZZA 4DLSA 1U8AA 4BUJA 1AM4D 2OESA 5A5GA 4XVRA 2OBNA 2W83A 1TQ2A 3Q5EA 5KPJA 3H84A 3QXSA 2G83A 1KMQA 4HEJA 4XSHA 2D3WA 3UPUA 1NP6A 1XD2A 1YHNA 4BFXA 1XX6A 1VG0B 3FOZA 3MUFA 2EFCB 1R0XA 2QZ4A 2QU8A 2WTUA 2PJRA 1TX4B 1H8ED 2R9VA 2IA5A 1ZD1A 4M22A 1A1VA 5FPTA 3MJHA 5CJPA 1NJFA 2F3TA 1JQJC 1KAGA 2VA8A 4EPWA 3I73A 1MH1A 3I1FA 3AKCA 1CRQA 1FW6A 1PJRA 4FD2A 4LK2A 2YINC 3HU1A 3T1TA 1XMSA 2JIZA 1GP2A 3OIWA 1SZPA 2YV5A 5EJEA 2R8RA 2ZE8A 4CEHB 2OO7A 2XNDA 3U7EB 4KYUA 3UG6A 2F9MA 3OZXA 2C5LA 1E98A 1M7BA 5E7MA 3T1QA 4BRUA 4JVLA 2EWWA 2OT3B 4M9QA 2ONKA 3GLIE 4ZDIA 5JSZB 1E32A 3QPWA 3LD9A 5JJLA 3H0KA 4Q21A 2YHSA 3TRFA 3M6AA 2FFHA 1Z83A 2GEUA 4MRVA 3ZDQA 3DMDA 1H8HD 5FBWB 2B6HA 4Q02A 3GLFE 1MR3F 2VSOA 3WBJA 2A2ZA 2DWQA 3QQ5A 4A8JC 1QVAA 4MKHA 4B3FX 3EZ6A 1IM2A 4PQRA 3RHFA 1MO5A 3AVXA 4UNQA 3ZZ0A 4JT2A 1KYIA 1NMXA 1HT2E 4BEJA 2CLDX 2KE5A 3MG9A 2J7KA 2Q9AA 4Q4HA 2EWVA 4TLBA 1HE8B 2AN9A 3L8ZA 2MMCA 2ZJOA 4V0MA 4BZPA 3QF4A 5FL7A 4ERNA 2O8FA 4BFZA 3CPEA 3TQCA 1II8A 3EA0A 3ZLJA 3ZVLA 2Z4RA 5CJ2A 1MKYA 3IGFA 4NTZA 3T1VA 5JI3E 1ZM3A 1QHHA 3RS7A 3THYB 2CJWA 4NKRA 1IBRA 1SKYB 1QF9A 3TVDA 1TF2A 5CDFA 1S4QA 1YZNA 121PA 3JZMA 1EK0A 1IONA 2QTHA 4QJ4A 1RJ9B 2AHOA 3U3KA 2ZAOA 2ZTSA 3GLHE 1OFIA 3W3ZB 1J8YF 3BXZA 1KSHA 1ZUHA 5AJWA 3ZGXA 2AD1A 4OI0A 3B2EA 1JXMA 2ZE7A 1VCNA 1W4CA 4QNMA 1N25A 4DSNA 1ZC3A 1CJVC 2Z0MA 3HYTA 1ZMXA 4DKXA 3KXIA 4DDUA 4MA4A 1KI9A 1P9WA 1RVDA 4AC9A 5B64A 2REOA 4PFSA 1EWRA 4P4SB 3SFVA 4CEJA 4S35A 1O87A 3RRYA 2OLJA 3FKSA 2ZXUA 1AIPA 2VP5A 1WB9A 4BFWA 2J7PD 3EC1A 4D26A 1N6NA 3OAAD 3X1YA 3PR1A 1XD9A 2C03A 1E2LA 4DCNA 3B9QA 2NMVA 1OIVA 1US8B 2J0VA 1CU1A 4E03A 2VL7A 3CX7A 4IHQA 2WICA 1TL7C 1KI1A 4XWKA 4OQMA 4QXAA 3U44A 3IILA 3A58B 4RZXA 3HPQA 2ERYA 1NRJB 4MKFA 5JWOA 1JEEA 1JPNA 1QHSA 2E87A 2JEOA 3REGA 3CZQA 2ZYTX 3KXLA 1JBKA 4E22A 3VR3A 1CJTC 3B78A 4D6PA 3KX2A 5JCPA 4OHXA 3EX7C 2AR7A 3FPAA 4LJYA 2RGNC 5EXTA 3IO3A 4NCHA 2ORWA 1E2KA 4KI0A 5KNDA 2BKUA 3RDPA 5FI1B 4LBVA 1F48A 5EP4A 2ZRLA 3HWSA 4BE7B 2QP9X 1ETUA 2CNWD 4YXWD 4DWJA 1P73A 1XTSA 4RFSB 2PT7A 5FH9A 1K5GA 1WE2A 1CJUC 2G6BA 3B1XA 5FOXA 3GJ7A 1OT3A 2WZQA 2XB4A 1FP6A 2ZVQX 4P31A 3Q5DA 4IDOA 2XEXA 2ZM5A 2O8DB 1E2JA 1CP2A 4QNRA 1QZXA 1G5PA 2QI9C 2ZUCA 1E4VA 1XXHA 4P32A 5EE3A 1NJGA 1UDWA 5BWMA 1QDEA 1A7JA 1W46A 2WKQA 1KHTA 2X77A 3A4NA 2GXQA 4AY2A 1S96A 3QY0A 1UAAA 2UVQA 3LBIA 4LJ8A 4EFLA 3ICQB 1G8HA 2CHQA 2JASA 4RD4A 1DE0A 3EPLA 2AFHE 3OEED 3UK6A 4Q18A 821PA 3P4XA 2DB3A 1XPRA 1J7KA 1GKUB 1E0AA 4CVNA 1NLZA 3IKJA 4WAUA 1D8TA 3I32A 3AM1A 1D6JA 3AVUA 3E2IA 2R6DA 3KKNA 4A4DA 3R9XA 3EPHA 3HYRA 2MMGA 4LC1A 4EFMA 3GJ5A 1A5TA 4G5QA 1E99A 4YLGA 3P20A 1ZNZA 2C78A 2QAGC 1VECA 3RWOA 1E2EA 4OL0A 1KJYA 5HR5A 1Z0KA 4Q7LA 5AR1A 4CEIB 1M8PA 2IYWA 4B34A 2R6CA 2BHRA 5FBLB 3AF2A 1TF7A 4AG5A 4YMUA 3FE2A 1CR2A 3AKYA 5H68A 4C2TA 2GCOA 1J90A 1IXRC 1SVWA 1D9ZA 1CJMA 5HE9A 3ZS9A 2NO9A 1SVIA 4HI0E 1SKYE 1I4LD 3GJ6A 3LVRE 1S9HA 2ODNA 1Q20A 1R8QA 4RD2A 4M8NE 3KQHA 2HT6A 1GKIA 2ZRNA 1JNYA 4URXR 4WIAA 1XTJA 5EE1A 5AK0A 1YZQA 2O0KA 4QGFA 4RD6A 2J45A 5AUOB 3CX6A 4NONA 1ZAKA 4LJ6A 4GBMA 3ZD6A 2ZE6A 1KGDA 3SN6A 1E9FA 3DZDA 2IYTA 4MYTA 5KHOC 1NLFA 1CS4C 3EZ2A 1T3SA 2Q3MA 1R0ZA 3C41J 4MGYR 4NU0A 5JS7A 1OFTA 2FE4A 3NBFA 5TY0A 2FJUA 4Q1BA 3NHAA 4Q19A 4OKSA 4KFUA 1UBEA 2YC2C 1P62B 1XCPA 5DI3B 3VHLB 1M74A 4KODA 4JL5A 5B30A 5JI2E 4TL8A 5CIQA 1GL7A 4XWAA 1WMSA 2XJ9A 3RSOA 1KMHA 1IAQA 3DL0A 2OXRA 3KJIA 4CZ2A 2FZLA 3LX5A 2NZ8A 4LBWA 1I4DD 4BASA 4YMSA 5DIFA 2FSGA 3U7GA 4BFTA 4DRZA 4GP7A 3U3OA 3LV8A 2GK6A 1NBMA 2GZDA 3L2OB 4RCZA 3THXB 4Q03A 4Q4JB 3BFVA 3U6BA 2D74A 3N2EA 4ACAA 3ZVMA 5D3MB 4WA7A 5CIWA 5BN3A 1EX7A 2C04A 2C99A 3KJGA 1P7CA
chains in the Genus database with same CATH superfamily
1PUIA 3FSGD 4IG4A 2AX3A 4P4TA 1QAQA 4O3MA 2JNWA 3FCOA 3O0DA 1ID1A 2VUIB 2XUFA 1ENYA 2PZGA 4MJXA 3CJTA 4PS0A 3BE4A 4YACA 4C14A 2CBZA 4HWSA 2A0FA 2A30A 2OGWA 3TPFA 1L7EA 4CR8A 3FCYA 5A05A 4D4LA 4F4DA 1ISJA 3G89A 3L79A 3R3SA 3R4VA 1N4AA 3X3HA 3R5SA 5GMOA 2XUAA 4M9UA 5KI6A 1CHDA 3GQBA 2PD3A 3LFTA 3D2CA 4ZU3A 3RD5A 1IVYA 4HTFA 4MW9A 4OHOA 3T41A 1G8FA 2XDQB 1G9TA 1W5AA 3E9YA 3FOWA 4LHSA 4RVOA 5EQJB 4BO1A 3NEAA 2IGTA 3HJNA 1Z2CA 4FFVA 2RHWA 2JEYA 2FX3A 3GUVA 3ZI0A 2PWPA 2N47A 2IU4A 4NVRA 2MR6A 2YKGA 4JUIA 1SBIA 2FPSA 5IXYA 1VYHA 3H8SA 3KHSA 2ZYAA 3F97A 1DC3A 3AZPA 3MOGA 3OY2A 1W5TA 3BRWA 3FKQA 2JIBA 1K8QA 1XDZA 4LMPA 5MGBA 2ZSBA 5JMWA 2FWIA 3DEYX 4FKBA 3GL9A 2XCLA 5DM4A 5HMMA 1ILWA 2F1OA 4RU1A 4IDFA 3C3KA 3TIXB 1Q11A 5AXAA 2BGTA 2QV0A 4O29A 3A6FA 4PLCA 4POOA 1CQJB 2YWXA 4XM1A 4FE4A 3U56A 2R5WA 3ZHOA 1VIMA 3ASUA 2PN1A 2NADA 3ZBTA 1MJFA 4PU0A 3QKSA 2J87A 3JATA 5IJ0A 2IE0A 4GPEA 3AG6A 3S1LA 3M1LA 1Y5IA 2JAUA 2JDIA 3WDSA 2IDZA 4WK2B 2FEWB 3KVNA 2FMFA 3N53A 3COJA 1OI7A 3CIOA 4FDUA 3IIKA 1UEXC 4DB2A 4BGDA 4CV0A 3S28A 3R6DA 1M6NA 4NWIA 4G0UA 3NHJA 1KO5A 2CK3D 3DZCA 2CE7A 2ZI6A 4Y1RA 4E3WA 3BC1A 4UREA 5JNUA 4RYLA 3SXPA 3QG1A 5CK5A 5IUJC 1XYVA 3F67A 3MWFA 1JG7A 1XMPA 2CMGA 2WJIA 3LXMA 3N39C 1E3SA 1HOTA 2BFDB 4N48A 4DXHA 1A69A 1O57A 5BOSB 4JSRA 2H2GA 3BL6A 1JYFA 2YWJA 4WCVA 3S8YA 2ZU6A 3CSSA 4PAQA 1Y3FE 1D4OA 2HQRA 3C8MA 4IIXA 4K5QA 4BFSA 3AL0C 5HFNA 3R09A 4BX2A 4MWOA 3LHDA 2O23A 2AKYA 3MELA 2ASEA 5CA0A 2YCLA 3RGGA 2GRUA 3K0AB 2SKDA 3PEUA 3WK7A 3ZK9A 4MW7A 4UC0A 3H1BA 4Q6WA 5A7FA 3H8WA 1KI4A 5EHQA 3GAFA 3D8RA 4H7KA 2HH9A 3F9CA 2FUNB 4BLPA 5KTRA 4CLOB 4ZEMA 2GK4A 1KSJA 4WACA 4Y6RA 5HE8A 4NFYA 4QULA 2IE8A 4YGYA 3D54D 1K0FA 3NHUA 3C15C 2QMUA 2DPMA 1JEYB 1J97A 3IDOA 1SQ0A 5JAUA 1SUFA 1X7DA 4INAA 4BS9A 5FWXA 4YRJA 4MR9B 4PLYA 2B98A 3BCRA 5IDQA 1B93A 1XAIA 1KP3A 3ZY4A 2HF2A 3L6OO 4GXRA 2Q5HA 1L4UA 1AUVA 1SU4A 2C9DA 2DWUA 2Y1FA 4G37A 4Y6OA 2RONA 2FUG1 3OG9A 5DGCA 4M6WA 3TXXA 4CDGA 5C3MA 1F2TA 3OQBA 2PFGA 1HT1E 4JL8A 1QLHA 4L5JA 1Y8QA 3L7DA 5F51A 3ZOZA 3ZQ4A 1LKZA 5K51A 1FTGA 2KM1A 4W5WA 4AG6A 3DMRA 3IQFA 4XGRA 2E4ZA 3VR5D 3I9V1 1XLVA 3HJBA 3IRVA 4L50A 4ECEA 2JLZA 4OLJA 3OPYB 2Z2YA 2RGUA 3S40A 2VPXA 4AKIA 2I2WA 3MWKA 2PAAA 4IYJA 4KTTE 3WKEA 4DGSA 5EG5A 2C5FA 4LZJA 2IRWA 1WZEA 3N2IA 2WUFA 5EHXA 3A1DA 1CUHA 3S2IA 4BPBA 1T25A 2ID8A 3KM0A 2ZJ2A 3CWZA 2P9JA 3PFIA 1E3WA 1I14A 3RHZA 3OCWA 3FWYA 4OXKA 4X54A 5C0OE 2GA9A 2ZWIA 3ENVA 3AU8A 4WN9B 1IZZA 1YE8A 3IP9A 3QKIA 2P2GA 2ZETA 4ZO4A 5KHAA 3ZV5A 3L1HA 5FQNA 4BO6A 4XARA 2C2KA 5CT9A 1IUKA 1QKIA 1NV8A 2PA0A 1Y9AA 1YZVA 2OYCA 3IQIX 4CJXA 5B5SA 2B0CA 3QFTA 4HVCA 2KLBA 4B8WA 2MT9A 2CJXA 2OO5A 2B25A 3H1GA 1NQAO 5ALZA 1F14A 2YYAA 4JUBA 3OESA 3DXFA 3IQZA 3Q9LA 4I1SA 4RHFA 1KYVA 1WV0A 3B36A 5A62A 1H8EA 1EDZA 1Q0HA 1XK6A 5FX2A 1BXKA 2GN8A 1NNUA 5DNYB 1KRXA 4HZGA 4NZOA 5DWDA 3UAWA 3D3EA 5E9WA 3VR4D 2A5JA 3GZNA 4CKWA 1HNZB 3N0TA 1P74A 3SYMA 1JIQA 2ZROA 2BDUA 5TSDA 1J7JA 1WCIB 3OC6A 4DLUA 1CZOA 3L8EA 1E79D 4IJKA 4XD7D 1T3GA 3TIFA 2P1DA 1RWWA 3L7CA 1Y98A 5FPKA 1NG1A 1G8SA 3O82A 1I1NA 1U04A 1OASA 1NUPA 4BTEA 5ALUA 4LI0A 2K87A 2OCBA 1XRQA 3DE3X 4X24A 1NBAA 3NV7A 4JCCA 3GJ3A 1L5ZA 2Z1MA 5G1NA 2HK6A 2I6TA 2QENA 4DQUA 1GGHA 5BNIA 4Z4IA 3ZJ4A 2PYDA 3MXOA 5DCYA 2W4QA 3G9ZA 1L8QA 2XNJA 5CCDA 4BFYA 5KU7A 1FSPA 1EESA 3V97A 3GD7A 4OGWA 4CKBB 2LDBA 5JSZA 1PK8A 2HZ7A 5M2QA 4F6CA 1I2MA 3MBIA 3THWA 4IWXA 2Y66A 1WXHA 1YQEA 5TGZA 3RRZA 1T4GA 3LKBA 1WZUA 2C4MA 1CRWG 4ZV4A 2Z8XA 1N5OX 5L3SB 5JDIC 3A0RB 4ZDKA 1AZTA 4KXWA 2X23A 1LGYA 1T6ZA 4UOQA 4XR4A 3AR3A 4A2PA 1NOJA 2ZJ3A 1X39A 2VKTA 1IPFA 1Z35A 2DY1A 1LEHA 4C3VA 1K75A 3D31A 4DQVA 1F1BA 3H5IA 1XKQA 1QNLA 4OM7A 4B3SB 1KF0A 3NC0C 5C5DA 4FYMA 5JAQA 1F9AA 1BH2A 1O95A 1Z0ZA 2F7SA 1HRKA 4G4IA 3WGOA 4HH1A 4D80A 1Z5UA 1AKNA 2CUKA 1MZVA 2JGEA 2NO1A 2PZKA 3AR5A 3DE2X 1W2WB 2OHHA 3N6RA 4H31A 1Z06A 2AVDA 2QQFA 1FFBA 3KE8A 3I2KA 2P4QA 4TSFD 4ND4A 5GOZA 5H3CA 4BCCA 4YUWA 2A1TS 2I4OA 2I8CA 1DOHA 2C2HA 1GA1A 3AP1A 3BORA 2AOTA 3KZOA 3MTBA 5DNUA 5MFZA 2H2DA 5JJIA 2PGIA 3DPSA 3PUZA 1QQTA 1ZD9A 1VG8A 4TV9B 3SJUA 3VTAA 3PPWA 1D5WA 4RO0A 4B6JA 3I62A 4PYIA 3N3BC 4NCIA 3QBVA 5DTRA 1SC3A 4OV6B 1NF2A 5D84A 3KVOA 4YONB 2GVZC 4EO4A 3PNPA 3R9WA 2CXUA 1KS2A 4GF5A 1MNQA 4ZV7A 1ZP6A 3HCPA 3PFHA 1PJQA 2FSSA 4F5WA 5L6LB 5HGXA 2R1UA 4YASA 3CLSC 1MOQA 2IELA 5DN6A 4CM4A 4MRMA 3AP2A 4Q5IA 1KZ9A 5BVHB 5KTOA 4O5OA 3A4LA 3OMLA 4D8XA 3WLJA 1RNLA 1VSTA 2AUNA 3ZBUA 2CHGA 2WJJA 4ENQA 5AHOA 4DA7A 3B52X 3IMFA 5JSFA 1JIKA 1NVVR 1X1AA 1F6DA 2OV2A 1C1DA 1HRDA 3WKDA 5DM70 1E6WA 4KDCA 1ZJZA 3IBYA 4XX0B 3CLRC 4HKTA 4HTAA 3MWDA 2IPMA 4CN9A 4U2EA 2J5QA 5CT4A 3DE7X 2IUSA 1XELA 2IPOA 4QUJA 3I28A 4ZO8A 5HJ5A 2R00C 1V43A 3B38A 3F78A 3SAJA 1TLFA 2VBFA 2XGGA 3P9SA 4I1OA 1RQXA 4U9UA 4XYEA 4BQOA 3QEBZ 1OLSA 3ENZA 2AEJA 1JHDA 4GOJA 3ZJUA 1GUZA 3OAAA 1XMIA 2BRUC 1E89A 1US8A 2QL5A 2XOKA 2Z2KA 2G9RA 2Y0BA 3A6DA 3Q72A 4GYKA 1NE2A 1NF3A 3WIUA 3AL3A 5K4AA 1AV6A 2OHGA 1R74A 3A0UA 2VOEA 3OIUA 5TT1A 4KJXA 3L6DA 2XHEA 3ZZTA 5SYNA 1YZGA 3IUNA 2H92A 1C1XB 2CHVA 4BQNA 2CV2A 4DREA 1R0YA 1XIVA 3VSAA 2BFCB 3UMJA 1HURA 3ZGYA 3GJRA 2QNIA 2YWCA 3UM9A 3EY9A 5BRNA 2VSFA 2GDJA 2VUTA 4LVOA 3QVUA 5TXGA 4EHNA 4IRMA 1MEOA 1ZESA 1T6NA 2ZIGA 4GGPA 1KRHA 4G0ZA 1U28A 1GR1A 3BK2A 4EB3A 2C82A 3H1PA 1NBEA 1AQNA 4K6GA 2C9CA 2JFGA 4F4IA 1KXZA 3WIOA 3FY4A 4Z4CA 3CZ4A 1FTYA 2BFBB 1DTSA 1OR8A 2IHTA 2RAUA 2X5XA 3DXZA 3HKEA 1PJTA 3I0ZA 4LGMA 4TQ9A 2IZ6A 2O8BB 1JVNA 2A7XA 2CNWA 1XFDA 2E0IA 1G5HA 2FZGA 4TXHA 4ZYLA 1EXNA 1U3FA 1Q1AA 1XCGB 2QAGB 3LUDA 4JL6A 4FIZA 5EZSA 3VZPA 1AS0A 1LRJA 1VXOA 2GBLA 3L4SO 5FAKA 3Q3GE 1PJ3A 2Q62A 1QZZA 1ZD8A 4ERXA 1MH9A 3EXEB 4II7A 5KTYA 3BH7A 1JQAA 3NUZA 3V6LA 3HFGA 1Z5GA 1XLWA 3BFKA 3Q9UA 4WVFA 4EL0A 4ZN6A 1GDTA 4Y7DA 3HJCA 1QGOA 2YRWA 4YECA 4JB2A 4LYAA 4M2LA 4EHHA 1X1QA 1HSZA 4ZA2A 4EATA 5KVQA 5HOQA 3TNJA 2VFAA 1RVV1 4U7PB 3M3DA 3WRVA 5FTLA 1H9CA 4HB2A 1K4KA 4AP9A 2J9RA 2X9GA 4FHDA 1YR6A 2P65A 1X7YA 2O07A 2RGGA 2WM3A 3ZDEA 1J70A 4BEBA 1ZNYA 3O8QA 4DWWA 3EYWA 4J16C 2GS9A 2HJGA 4FOLA 5LKRA 4F4FA 4MZXA 5LJIA 4EG5A 4O1IA 4LW8A 5HYVA 2Y2VA 4KVAA 3UB2A 4RY0A 2R7KA 2CDRA 2HDHA 3ZWCA 2FLKA 3QE3A 4C6TA 4FIDA 4NBTA 5ALKA 1BRMA 5JV5A 2BV3A 4OYYA 3QVMA 5K3FB 3IKMB 2JCXA 4R2WA 2DC1A 3GELA 4GWKA 3GT0A 4XE5A 5JAZA 4CEIA 1AD2A 4KYVA 4YMVA 1Z2PX 1XU7A 2GEKA 2Z5GA 2Q2NA 4JDPA 2UZ3A 4CT4B 4EJSC 4ZI2A 1C0PA 3AWDA 1JN0A 3D7LA 4JH0A 4CL2A 4XKJA 2C5SA 5K8UA 1BHO1 1C4KA 4H35A 2GXAA 4MRSA 3AX6A 4RC9A 4X8HA 4ZTBA 1I2BA 4YCAA 5A7GA 5E7IA 3NONA 1IIRA 1ABFA 3R3HA 1Y3IA 1YZTA 4Q4AB 2ZJ4A 3H87A 3PLNA 4Q9HA 3B1ZA 2WF8A 2O5RA 1JSCA 3OFND 4TS4A 4WBSA 3D7RA 1SB9A 5EJ4A 3EEBA 2AFIE 6ABPA 1NNEA 4E2ZA 4UM7A 1O0BA 3GDOA 3UMRA 1WR8A 3HUEA 3NIWA 5EUMA 5EIWA 1AKRA 2B8WA 3GEHA 5DGXA 1ZK4A 3GFTA 2V6MA 3I5UA 5YASA 2AK3A 5EUBA 1I5RA 3TH5A 2R1TB 3Q0IA 4YCJA 3UJBA 4LY3A 2PSSA 1K63A 1YZKA 5HQTA 2XQFA 4EYQA 3DSRA 1UMBA 1T6BY 3T4UA 3EDCA 2NYVA 4ZT4A 1UMDB 2W0SA 1DXHA 1ISRA 1F8GA 4HDKA 2WUWE 5E3IA 2V4MA 4B1FA 5E4TA 2O59A 2E5FA 4AC9A 1W5BA 5HS6A 4BMXA 2JFYA 4Q47A 3ELWA 4J1QA 1P9RA 3I8SA 3IULA 4EY8A 3S8MA 2OOSA 5CDTA 1CZHA 1RWBA 3Q87B 3NHLA 2YOHA 3N7TA 1IEXA 3L82B 3N1UA 4E5DA 1CR1A 1LRLA 4U8GA 2EXXA 3CKMA 2FP4B 4OBBA 4Q48A 4S1OA 3TSAA 5CYGA 4BZQA 1BE6A 5AUNB 1QYXA 1N2HA 3QE2A 3QUQA 2C9MA 2RHLA 3NRBA 5LQCA 1DJMA 5IABA 3DH0A 3LBNA 3S0JA 3IAHA 1MEEA 1E7MA 1Y7IA 3W8EA 1M67A 4YJ3F 2A3RA 2EAUA 4GUDA 4PYQA 3T6KA 4PCVA 4B3TB 1ES9A 2ADMA 3E9NA 2IYRA 4MIEA 1TPZA 1X9IA 2AN5A 3SLRA 1TKRA 4NOJA 1DKNA 1J0DA 4IMPA 1IN6A 4B0PA 4AD8A 4NRDA 4BLOA 4IWYA 3WLTA 4GR9A 2HBYA 3NHFA 4LE1A 4YUVA 2EW2A 5JRJA 1SHTX 1JSLA 3KLMX 3I6BA 2DH5A 2CVFA 3OZTA 5KTPA 3VPXA 5JVDB 3V8NA 4N82A 2KYRA 2PGAA 4LYEA 1AMNA 2C2OA 1OBFO 2DKNA 1FSSA 4TRMA 3R7WA 5TX7A 1T8PA 4CF7A 5IH3A 4DYHA 4WXYB 3T7RA 4F1KA 4AULA 2Y76A 1ZK3A 2XNDD 2D0PB 1GRRA 4Z2YA 4KE6A 3ORHA 1JLRA 3L05A 3U4CA 2FQ1A 2VDVE 5LQMA 2JFVA 1TCBA 1E69A 1GNSA 2JI4A 1ULHA 1D1TA 2DR0A 4GZ5A 2XY4A 3C98A 4IM7A 5LB2A 5M04A 1PNQA 4AY4A 3BIJA 3IIIA 2HPAA 1OWLA 5EPEA 5AW1A 1UAGA 4NFSA 2XCUA 2E37A 1QHNA 2WLSA 2X8AA 2HRQA 2V97A 2VVTA 3IH5A 4PIVA 4AZ0A 4NR0A 2BSQA 3WQBA 2H65A 3EVNA 1OXTA 4I4LA 3BJMA 4H4CA 2ANBA 1NRIA 3HJAA 3EZ9A 4YLEA 2JC3A 3TB4A 4BB9A 4MGKR 3SBEA 4JVSB 1UBOS 3WB0A 4KWHA 1BC5A 3ZWWA 2EP5A 2X1MA 1JVSA 1L4FA 3L8YA 2OXIA 3AVYA 4BGIA 2PL9A 3VMFA 1ULUA 3IXLA 4MDFA 2BEJA 3JD2A 4LYJA 2XNCA 4TTQA 3FTDA 5BVGB 5CVCA 2H8KA 2QN3A 2OV1A 1CUYA 2D00A 1L4NA 3Q8MA 4C2UA 1L4HA 3X2SA 3FDJA 4G0QA 4TWIA 2R2GA 5K01A 2GT1A 1JFRA 1C3XA 1PJAA 3CMMA 5ABPA 4M7WA 2XYPA 1Z0IA 1AJEA 4KIGA 2X2OA 5U4XA 3BK7A 1N57A 3PKJA 1SC6A 3UXMA 2BFAA 5EJMA 3QXHA 3OT1A 2GM9A 1IVNA 1B76A 2Q5JA 5EZ5A 5J2TF 3WL5A 2L17A 3R3ZA 4OI4A 4PPFA 4WY2A 1BEEA 1DRWA 4G1MB 3BE6A 1QFZA 3ZK8A 2GEFA 4R1LA 5G3YA 2WJVA 2PD4A 2FRVA 1V5EA 3HBJA 3IDFA 4U3JA 1Z6TA 3WGZA 3ZTYA 4PR0A 4O4IB 1RRKA 4UHKA 4YRBA 5A5DA 3L01A 1U2SA 4TTJA 3USES 5ALMA 4AJPA 3DZHA 4LVNA 4QYIA 4RIIA 3R5FA 4X5OA 1UKEA 2IZ5A 2FEXA 4Q4CA 2NVBA 2A9QA 3PXEA 4DMRA 5CDSA 1IG3A 4NZ9A 2EDCA 3JZFA 1WABA 4PSDA 3V1KA 1AA6A 3EIFA 1JH9A 1ZVMA 4S24A 4BN0A 4JXKA 4Y9SA 5K8CA 1ZSNA 3LX4A 3TNYA 3KPWA 2EJCA 1D04A 1L4GA 4X65B 4P0QB 1YVPA 4RZIA 3ONDA 3DF7A 2Z3WA 2H00A 4P84A 2OP0A 4XUCA 3R9KA 4QGSA 2Q5OA 2X8BA 5CGQB 4K88A 2R84A 4PZYA 3D0KA 5ICEA 2DU8A 1H0RA 2V5AA 2J3EA 5PNTA 5KHLB 2PS9A 4XDYA 4XR9A 2GCGA 5AMXA 3ZCRA 4AJIA 1UPAA 5I8PA 1EFTA 4AIRA 2HFJA 1RMTA 3LLCA 2DP4E 4HNRA 4F9FA 4ER5A 2A5FA 1UPTA 3N59A 4N0MA 4CPDA 3T4PA 3GFRA 4LX8A 5ALLA 4B35A 1N78A 1CF4A 4X7RA 1NASA 3AF5A 3U7FB 3DB1A 1NVTA 3L8HA 2ENUA 2KBEA 4M7PA 4RKRA 4TLCA 5HQ3B 4G01B 1KPIA 2RGEA 2WHPA 1OH8A 4RULA 2ZDHA 3U44B 1A9RA 1M0TA 1NF8A 2JJ1D 3B9PA 1YGPA 1KEZA 2NT3A 4Q16A 5LOVB 2YWRA 1YA8A 2ZE5A 3V4ZA 4B85A 1IDOA 2RHTA 4KXYA 4WKOA 4B6GA 6AT1A 2J85A 1MDBA 2W22A 4AF6A 1WB9A 2FGKA 4BIMA 4HAWA 2Q5CA 4GSYA 3B6KA 2E21A 1MTZA 2CEAA 3TUZC 3TOSA 2VPZA 1MRNA 1W1IA 1V2GA 3L18A 3SJCA 1U9IC 2RHHA 4MYDA 4R1TA 1V1MB 1WCYA 4UAJA 2BZ0A 5KQRA 1W93A 4D9KA 3DD5A 3OE7A 4R1SA 4YCCA 1DBSA 3P9IA 3F5DA 3E3OA 4YMWA 3TLBA 5A03A 3M6WA 4EHBA 2R86A 4B74A 1UWKA 2XYRA 4IZ6A 1FX0A 1DZIA 2BR5A 4TVOA 5CLJA 1W0KD 3GRUA 5EXSA 5CFNA 2BSXA 2HJRA 5KAMA 3MJDA 4RV9A 1GPLA 3R7FA 5LA6A 5E4FA 1A27A 1CY1A 3CWQA 2AEEA 3KAQA 3LDAA 3O84A 1LBIA 5AXBA 3QPDA 3R75A 3WGQA 2UU9B 1I4TD 4O59O 3TRKA 2ZEJA 4KNVA 4S1NA 4Q9JA 4FS3A 1WNFA 4ARZB 3OZAA 2IHVA 4AKEA 4PZPA 1BN7A 3KALA 5E3HA 1RLOA 1ZM7A 1NUAA 2PGJA 4WKNA 2Q9BA 1PZNA 3VR4A 3HV0A 3PS9A 1GCOA 1YRYE 4DA9A 3NKLA 1XLTC 3I05A 5JO0A 5ELXA 3IVCA 4M1ZA 4E7PA 3JQAD 1G0NA 3A4MA 4JGGA 2NLOA 3KKLA 4XD7A 3COSA 1E2BA 4EQZA 2P8SA 2ID4A 1YRLA 5C2JB 1VJ1A 1QLWA 3GAZA 5DYNA 4G9GA 3AVOA 3DB2A 1A9ZA 4F72A 1VPTA 2J8ZA 1J2UA 1Q1EA 4TPKA 1C30B 4OHBA 5GY7A 3W05A 4BJ3A 4UM9B 4ZVOA 3VSCA 3JAMA 2R6GA 1KEKA 1DX4A 1T29A 1EVQA 2JJ2A 1J0AA 3GGSA 4JBHA 3RSFA 3UUFA 2XD4A 3AEQB 3SMQA 4XPIA 4BE4A 3FCEA 3LPAA 3O9MA 4YDRA 5BN4B 2GM4A 2V3CC 2A0UA 3DP7A 3Q88A 4B31A 3KQLA 5ARBA 1JRLA 3GDHA 5HDQA 4GOKA 3GLFA 4K6KA 1DQYA 4MR8B 2TECE 3FWZA 3HE3A 1S0UA 4ZQCB 4DR1B 4ARCA 2GCOB 3NFRA 2D06A 4XRRA 3ZVRA 4XWOA 3TZCA 1P0MA 2HUPA 2DHDA 3W2GA 3SS7X 1QIKA 1GU0A 5BWCA 2X41A 2IDKA 1DC4A 3NDJA 4UBNA 4YJFB 3X1XA 3QPBA 1JHAA 3PKIA 5BSGA 4YMLA 2XPCA 3PR3A 4V02A 3CLSD 1P9OA 3DA8A 5KB3A 5DOZA 4WLFA 4CF6A 1V3VA 5LR6A 5BMVB 3H86A 3U7IA 1KPGA 4ZKDA 3DWIA 1NSFA 5M3BA 1FFXA 4C87A 1YS4A 3D8NA 2AFVA 2BBOA 1U8CB 1GR0A 2VBCA 3O92A 3E03A 4MINA 2E18A 4KWIA 3CKKA 5DX0A 5FLKA 1YR2A 3GX1A 3TS1A 2WV7A 5AK3A 3WIDA 1GZUA 3CLRD 3MGKA 3P2YA 3FNGA 4IDDA 5CLLA 4XM0A 4NK4A 2XZOA 5GQSA 2GPTA 1SK9A 5FUYA 3IC5A 2GHTA 5D2CA 4NPHA 5HJEA 3T54A 1TJ3A 4OHYA 1WA5A 3HEMA 3HLKA 4ND3A 5IZCA 2CXSA 2OOKA 5U4QA 3GLHA 2CNLA 5J2TA 4CQLB 3PFNA 4A7PA 1UQUA 1Z5WA 2BHSA 2ZRQA 1CQIA 2WJWA 3IOEA 3OCUA 4HDSB 4NZZA 4UMEA 4C06A 1YIAA 2R4TA 4U63A 1W36B 4CUZA 1XTQA 2O1XA 1YIDA 3PQ4A 2QPTA 3G02A 1K0UA 3LVFO 1W76A 1YZYA 4R1UA 4TS3A 4PGGA 4KIJA 4B6RA 2VQFB 1KMHB 1FP2A 1T2FA 2IU0A 4J1TA 3QKRB 3ZWQA 2ODEA 1UZLA 4R2KA 4DLRA 2BP7A 2OILA 2NUAB 1FUIA 2OB1A 4PQEA 1JDNA 2C54A 3KFXA 4MQBA 5EZYF 4O4JA 1QGYA 2BI7A 4G63A 5C8DA 1EZ4A 4MQ4A 4ACBA 1COWA 1TIBA 2WSMA 5FDFA 2XQVA 4HAYA 4C4SA 4RH3A 5JBNA 3MJVA 1SWVA 2GRJA 4ENRA 4E5PA 5K8JB 4QJ5A 2UXDB 1QGUB 4YDQA 2IXFA 4R41A 2QVYX 4YFYA 5G41A 2HXSA 1FFDA 2B8NA 2HMTA 1RBZA 3JQ6A 3A4IA 3A9TA 4YUYA 1HNNA 5EIBC 2ZUSA 2R1VA 3IQEA 4MVJF 2Q9UA 3PEWA 3O26A 1JMVA 2AGVA 1NQ5A 1U63A 3K9QO 3ZEIA 3GJYA 3GQBB 3I09A 5H8WA 3RIEA 1E2PA 4Y2PA 4HTFB 4HNHA 1J21A 1PDVA 3BL5A 1D7AA 2XV1A 3GFFA 5DX1A 1K8RA 4LGVA 2FPRA 3Q3VA 5L4LA 2ES4A 2VYND 5IARA 1RHUA 3TVYA 2MJLA 1BCRA 3D6TB 1H0HA 3PSAA 5ECDA 1HETA 3AM3A 4LSGA 3WHPA 5IANA 2C94A 3FPJA 2PUFA 2WZCA 2ZSAA 3AI7A 5CEFA 4YP0A 2ZB2A 3VPCA 1EFCA 3VX4A 3C8UA 4GE0A 4C0WA 4H7JA 5F9FA 2ZYUX 5MGNA 1PJ4A 1Z17A 1E66A 2VNHA 4B4DA 2DQ4A 4DV3B 1BD4A 2CVHA 2ZJ8A 1MAWA 5JD6A 1U9JA 3DKPA 3AIOA 1U1EA 2ZRAA 4NCAA 3CINA 4O4HB 4GYYA 2Z6AA 2ZU0C 4RHCA 1IVSA 1GFIA 3TSWA 3UBTA 1FDOA 1EFPA 1G1AA 1JQ3A 1KZYC 1P31A 4JP3A 4KW7A 2PANA 4E5UA 1WLSA 4LXTA 2PKRA 3G8AA 3FHLA 4Q3DA 4ZYYA 4ZOLF 2IDMA 3ZNQA 1HI9A 5GPBA 1EUZA 5LDGA 1E0DA 1UPCA 3H9EO 1K92A 2F1KA 4B4WA 5IJ0B 2X2FA 2TS1A 1BX1A 4HQOA 1SUSA 4V2UA 3JQEA 4GX0A 2NU9A 3U9LA 5CD9A 1VJ5A 1U0TA 4PV7A 2PMBA 4ANFA 4BBZA 4V0RA 1YTLA 2DTEA 1GTL1 2DY0A 2HTEA 3RKUA 2FW0A 1MORA 3I45A 3QYAA 5F21A 1NPTO 3WLRA 3ESAA 5H80A 3TTWA 3UJ9A 4Q1CA 4GICA 4B75A 3NVAA 2PZ8A 1KDRA 3B13B 1KOLA 3W5IA 1KDZA 4HXEB 1HDCA 5LBTA 3DTVA 3WWPA 4YRDA 3MCUA 3HKBA 2I87A 3IP1A 3N86A 2M1XA 2HR1A 2JIRA 4FHGA 5ICSA 3BIXA 4MUBA 3FWPA 2GN4A 3SSNA 1HYGA 2K2WA 5F9HA 3F6EX 3MRSA 4YK7A 2QD2A 4N01A 3L7LA 4HDMA 4H1WA 1TYAE 3Q3JB 4RCVA 4RKYA 1KQGA 1JSRA 5DYYA 3ANSA 1B16A 5CA0B 2XGJA 3D6MA 3LUCA 2YS6A 4ENPA 4EY5A 1YI0A 9ABPA 1JDUA 5L7WA 1FOEB 3TZBA 2RJ3A 2GF2A 4YC7A 5I7OA 1K2WA 3GHYA 2FN8A 3C1AA 1GTG1 3OP1A 2YOFA 1N0WA 3ZKWA 5EJ9A 1J8DA 1JQDA 2OMEA 1OTXA 5KJEA 1HE2A 4UZSA 4GDFA 3W8RA 3WP0A 2Z1NA 1EU1A 1RJ9A 1XO1A 1KTIA 4ATNA 1JR2A 3QMVA 2C9YA 5CCBA 4CGZA 4MPRA 2E85A 2P77A 3IBGA 2I6UA 3NBYC 1IWOA 2ATXA 3OY7A 3UT6A 2OAP1 1S8NA 4GHWA 5FWXB 1KO8A 1W1UA 1VHDA 3GG2A 3PL1A 3QPCA 4R2JA 2WP0A 1I7DA 3QBJA 3V8EA 3H0CA 1GV0A 3F5MA 1M76A 3VZBA 4CQNA 1U3DA 3CRRA 4OGKA 1P3Y1 1NRWA 4DDWA 3SLKA 3UJ3X 5GV8A 3X2EA 2REQB 3W5UA 2RJNA 2OQIA 1NULA 2YW9A 5JH7A 2H52A 3SYLA 5KVAA 1Y8QB 2XRMA 1YZLA 1NBME 2YWDA 3QFFA 4QTUB 3AR9A 1P0IA 3K30A 1BMQA 4OH7A 5IG2A 1SCAA 4UATA 2HWUA 3OJOA 1FUKA 4FWBA 5DYTA 2X8JA 4FINA 2Z5VA 3ABIA 4RJLA 5LQDA 5JD4A 2FWMX 3AH8A 3UFXA 1OBCA 1SD2A 3PUWA 2OWDA 4FHEA 2G70A 4XSGA 5AKIA 2PAFA 3CZAA 3TZEA 2IV7A 4IGFA 3ILSA 3EGXA 4Z7OB 1LTKA 2HHJA 2QRZA 2XVYA 4QTZA 3T8YA 1QLJA 4DC1A 4EKEA 3AF6A 4K9OA 3GP5A 2JGKA 1VCMA 4GKAA 1I9CA 4TXMA 1SIUA 5E6SA 3IE0A 3JYLA 1RABA 2BEWA 2VHYA 2X0NA 3O5AA 4MKZA 4EZIA 2IXAA 3WAKA 8AT1A 3A6LA 2VRWA 4OHMA 4AWBA 4E46A 2J6CA 2XOXA 1DIGA 2LDXA 1DCTA 3DFIA 1M54A 2D0IA 1T0HB 1JA0A 4GXTA 5GJWC 1XJQA 2GZHA 1IN1A 1FNDA 4AP5A 1D7OA 3RC8A 2GBGA 1GZ5A 3KNZA 3OEYA 3SQMA 1DC5A 1P39A 4W9NC 2OCLA 4E5KA 4GXNA 4BJHB 1X7GA 2JHCA 2W2KA 3K31A 4UTXA 1TO1E 3MCTA 5CFMA 4HRXA 4DHEA 3SQXA 1FNMA 4ZI7A 3LL7A 4UHJA 2V65A 4CV1A 2VDPB 3W5JA 5J1TB 2ONYA 5G1PA 1LWOA 1NP3A 2P0AA 2W2TA 4ZYVA 2V8BA 2YNMA 3H9GA 1QIIA 1TAGA 1TTHA 4IZOA 4BNHA 4DLAA 1YL5A 3EODA 2B7BA 1HA3A 4IV0A 4UW9A 4D9GA 3QEAZ 3P2EA 2JVIA 2IJGX 1RZVA 3MINA 4WD3A 1G17A 1OX5A 4IW3B 5JCJD 2FDXA 3N8KA 5BQ3A 3FHOA 2QE7D 1ILEA 2IOHA 2APJA 3L8FA 1NBIA 3HU3A 4G0MA 4RHXA 4XEUA 1R9JA 2PE5A 2YWFA 3DVRX 1M3SA 1LPPA 2HJWA 2R11A 1S7CA 3ZWPA 4TWZA 2AFRA 2OVFA 2Q4RA 2I4LA 1MRZA 2Y67A 3ONFA 2I22A 4NFLA 3VYRB 1ORTA 3E81A 4FN4A 4MR7A 1SUEA 2OD2A 3THWB 4BJ1A 2QNBA 3FIUA 3LUPA 4UBJA 2B6NA 3LCUA 1L3IA 4HNUA 4QOEA 3LUFA 3EWNA 1CUEA 3F7MA 5L8VA 4J1SA 1X87A 1HLDA 2HNBA 3G2PA 3HB1A 1PHRA 4G1EB 5LLTA 4IGIA 5FEMA 1Z6GA 5K0FA 5K09A 1V6SA 4H1UA 2PUGA 4U2BA 1BDIA 3JCZA 1JPUA 2PFKA 4Y2TA 3S3TA 1GGMA 3F49S 2E6UX 2X6TA 5LP6A 2JZCA 2FEAA 3QNUA 1E2GA 3HVUA 3LY8A 4KN9S 1IBCA 3KT0A 2QZSA 4HN9A 4WNAB 1Z63A 2O3UA 3LCCA 2JL1A 4KGDA 3W2EA 5DYIA 2IYNA 2Z2IA 3EY4A 3QE0A 4RLQA 4RZ2A 4B79A 5HP4A 2Y9MB 1L5GB 1PQYA 3G1UA 4IY1A 1CULC 5FFFA 3W1VA 4DABA 4W5HA 3SC3A 4H6PA 4O2BB 3BOSA 2C7GA 2EG9A 3LUHA 5AO9A 1JDSA 4AJHA 1WQ4A 1U3VA 3CC8A 7ADHA 1ANKA 2P40A 4YYZA 3A2KA 4DDMA 2OFOA 1FJXA 2WF5A 1RAAA 1ZCFA 4X63A 5JW6A 1S1CA 2H1RA 3QP9A 4B2IA 1QO9A 4FE3A 2EJWA 4HVAA 1IEVA 3RC7A 2CLMB 4MKIA 2BYTA 2DTDA 4N9WA 4YFVA 3WGJA 1NP7A 3KEQA 1V48A 2HRCA 2H7YA 4GI5A 4QGHA 2Q6VA 1GTVA 3QU5A 4JCOA 4MAFA 1V71A 4GVLA 3DUFB 2Y0CA 2C29D 3DO6A 2HO5A 2W6CX 2ZQZA 4ID3A 2CHFA 1GKYA 3MJTA 1XP8A 3L8CA 1RJWA 1SBCA 1SBNE 2VWHA 3HGTA 1C0KA 3VVLA 1EK5A 2DSTA 4PQYA 4AZVA 2D1RA 2AVNA 4MP3A 4YAJA 4L75A 3ZWMA 5DVZA 3OBBA 2B4RO 3MWDB 4ZARA 3WQHA 1SQFA 2YBDA 3AQ4A 3SM3A 1TJNA 3NDRA 2FSHA 4QXPA 1B0UA 2PVSA 1R8SA 3JVIA 5KAPA 3O94A 4A2WA 1S1MA 4ZOCA 1PJ2A 1A71A 1TK3A 1NU8A 2V6FA 1HQYE 4I2NA 3S2FA 4YT8A 4RZUA 1XVIA 5KEIA 5HG0A 1E2MA 4US0R 3T38A 4PM4A 4D4JA 2A9PA 2XUGA 3PE6A 5CM8B 4GNKA 3QWIA 4WE3A 2Z2ZA 2GAOA 3A1CA 5AKJA 2V7TA 3GT7A 4X6YA 1WVGA 5G0UA 1VMAA 4ICIA 3WLKX 1AKTA 2PL1A 3CX4A 3JQFC 5D3MA 4JJFA 2IITA 2NP7A 4PGMA 1Y6QA 4KR0A 3FZYA 5BQOA 2JJ1A 3E61A 2NO6A 2PRZA 2AC4A 3KD2A 1I2DA 2X4DA 1E96A 1DUVG 1RI5A 4PSCA 3A06A 1SPBS 1ZKDA 2X0FA 5B6JA 5AW3A 2GZMA 3PJRA 1A8SA 1HFEL 3EFOA 3ZE0B 2I54A 2E55A 2D59A 1WMDA 4HQKA 2G17A 4PLPA 4RAOA 4L5BA 3M83A 4LA4A 2QW0X 4GO1A 2B5VA 2QORA 1BKYA 3SE0A 1WXQA 2I6QA 4XX1A 1AKEA 4CQMD 1NNSA 2YWBA 5IAEA 5K0SA 1P7PA 3RWMB 2JCBA 4KU4A 2SNIE 4HT3B 1X1RA 4UU1A 4CMHA 1AGNA 5AHXA 3V48A 2Q3CA 4A8PA 4LQCA 5IC5A 5K3EA 3L1IA 3M9XA 3HJTA 2REXB 1W0KA 3HR4A 4V38A 1SQSA 3IJPA 5CTAA 5BV2P 2EWMA 2GZAA 3MFQA 3PWKA 1HBJA 3UB4A 5GZ1A 2B1QA 3S5JA 3OCZA 5LM3A