2BMEA

High resolution structure of gppnhp-bound human rab4a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
176
structure length
176
Chain Sequence
SETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Human Rab4A in its Active and Inactive Conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords RAS-RELATED PROTEIN RAB4A
total genus 62
structure length 176
sequence length 176
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2005-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bmeA01
1XRJA 5DE3A 2IYWA 4QBHA 4Y0VA 1MO3A 1G5PA 1DAKA 2F3TA 3A1WA 2DYKA 1T0HB 2KWIA 5FTLA 3TE6A 2HCBA 4BRUA 3O8DA 4GMXA 1ZMXA 1KO1A 2IF0A 4H1VA 4NDZA 3MWYW 3U3OA 1IN8A 5AUPB 5B58C 1IM2A 5JECA 5AUQA 3DKPA 1QHSA 3W6NA 4AY2A 3W90A 5C46F 3CPEA 4AYTA 3QKRA 3ND9A 1Q0UA 2PCJA 1HV8A 4FMCF 3AQ4A 1WB9A 2F43A 1CJTC 4DLZA 2J7PA 3U60B 2Z6VA 4C0KA 3QKTA 2AXPA 2OZEA 1E96A 3QG1A 3P1JA 1Y63A 4B43A 4N1AA 2J87A 1RIFA 1OHHA 4A0RA 4ON9A 4I99A 1AS2A 4RSGA 1RFLA 2MMGA 5FL7A 1KZ7B 5IK2A 1EGAA 1G6OA 1OH5A 1T3HA 4I1UA 1XEWY 2OCYC 1E2IA 4Q21A 3IPXA 4KXFB 1HH4A 2KE5A 4KFUA 2J3EA 1R5NA 4LYAA 1R8QA 3B1ZA 2PJRA 2RGGA 8OHMA 2GJ8A 3T12A 3L0IB 2BDTA 1QVAA 5JWHA 4JYBA 3A4MA 3TNFA 5HE9A 3IHWA 1E2KA 4TMZA 2JGNA 2O8DA 2KB0A 1ZAKA 1A4RA 1I4DD 3W6PA 4Q1BA 4OI2A 5FOVA 5TXGA 3WHKA 4Z54A 4FI3C 1KOFA 3WMFA 3GJ7A 1WA5A 2BCGY 3G82C 1RYHA 2IXEA 1COWD 5AJVB 2QMOA 4Q4AA 5SZIA 4NYMR 4LYFA 1Q3HA 1KY2A 1NVUQ 1Z6TA 1QF9A 2HF9A 4CDGA 2IYSA 5F3WB 4FMBB 1NP6A 5J4LA 4L9SA 4PFSA 4P4TA 3A4LA 1UKEA 3DM5A 4TMVA 3C16C 2QGZA 2RCNA 1YRBA 5DLQC 1G17A 4Q00A 4DCTA 1D2NA 1UBEA 2TMKA 2XTMA 1F2UB 4UNRA 2GVDC 1E94E 1NVVR 2FEOA 2ODWA 4Q18A 5DISB 4C0AC 1XD8A 4LV5B 3AP2A 3T61A 3WBJA 3CNLA 2ZI5A 2EW1A 4IVPA 4KLNA 4D0GA 1Z22A 2H92A 3F5FA 3VU9A 1W44A 3BFVA 1G8GA 4IHQA 3AVWA 4QJ4A 4D25A 4O3MA 2YZ2A 4LHZA 4B76A 2QUZA 3LQQA 4MQBA 2ZSAA 1IJFA 2JIZD 1GRQA 2ZRIA 3IKJA 3THWA 2FDCA 3C15C 5DHAA 4LHWA 5KYKA 2QNRA 2XJ9A 4I1OA 3TK1A 4BFTA 2J7KA 1DAMA 1NJFA 4Q9KA 3VMFA 5BW8A 2JLVA 1SHKA 4NTZA 4PQYA 4F7WA 3GLIE 3ADDA 2OM2A 3AP1A 2NO9A 2VHQA 2QQEA 5G41A 1OKKA 2IS4A 1Z63A 3A37A 4M9SA 1KDPA 4PHFA 4D82A 2QI9C 3NC0C 5JEEA 2GCPA 4JT4A 3UKDA 3EPHA 2J9RA 2QAGC 2Y8EA 3ZZUA 4GP7A 5KNDA 2PZEA 1E6CA 2XJ4A 4V03A 3FE2A 5E3HA 1J8YF 2C2HA 4S2EA 4PR0A 3CR8A 1IY2A 1TEVA 4TLBA 2BOVA 3TIFA 5M04A 5GADl 3UXMA 4C3ZA 2R9VA 4WXRA 3EA5A 3D8BA 1A2BA 1CU1A 1KJYA 3CF0A 3CH5A 4L8GA 4YDHB 4B2PA 2IS6A 4JVMA 3PENA 2CHGA 1KJZA 3ND8A 2F43B 1Q57A 3MUFA 3GLHE 3LWNA 4IFBA 3TAHA 2Z5FA 1XB2A 3X1DA 3FHOA 2XXAA 3TR0A 5CIWA 1JEDA 1XMSA 3A36A 3QENA 2CVFA 2R6GA 3K70D 2WM9B 3RAPR 2CEAA 1CKEA 5FPSA 3Q3JB 2IYXA 1DO2A 3AGQA 3ZH9B 2ERYA 1E2NA 1A7JA 4TLEA 1KHTA 4ABYA 1VHLA 4B32A 2Q21A 2YOGA 4BEJA 1T91A 2N46A 3LAWA 4A8JC 2RKOA 2QMEA 1AGRA 1BKDR 3FB4A 1X1RA 4M1YA 2O8CA 4JLVA 4HB3A 4MYUA 3GQBA 3THYB 1FQKA 2K5UA 3RS4A 2Z83A 2F6RA 4OJQA 1P2TA 2PBRA 3BERA 1OT3A 3RYTC 3ZS9A 2X8AA 5F9HA 3U3MA 1N0VC 2IXGA 3QKSA 4MRRA 1NY6A 5L3VA 1EWRA 2A30A 2ZRGA 3NHAA 3CZPA 2BCJQ 3X2SA 4O0MA 1G7TA 5CB8A 3U7HB 1AIPA 3ZGXA 1MABB 3M6AA 4M1SA 2GZDA 3E1SA 4UQOA 3KQLA 4E09A 2FH5B 2ODEA 4RD0A 2IS2A 2FZLA 4CEHA 2O52A 2AX4A 1NVXQ 2C9CA 1FZQA 1Z0JA 4DCVA 3TUIC 4DLXA 1YJ5A 3OEHA 2QQ0A 1BIFA 2IYYA 5B64A 1ZVQA 2HF8A 2ZRFA 1E0JA 2AN9A 1NG1A 3NH9A 4OQLA 4PSVA 5CJ2A 3H4MA 1VCOA 1N0UA 3O47A 1NVWQ 4Z51A 1OB5A 2NO6A 4QKQA 4RCZA 4HAUA 1E2MA 1ELOA 5JHHB 2O0KA 1CJKC 2OHFA 2P6NA 4EJSA 3GLFA 2XITA 3MAAC 3VU9B 3VR6A 3K09C 3QVVA 3CO5A 1XF9A 5J47A 4IDPA 1LY1A 1YR6A 4V02A 4E03A 5KDLA 2HCJB 1W46A 2ZTSA 4JBWA 5H68A 4FCWA 4JLBA 4ZDJA 4QNRA 1MRSA 3MRSA 5F98A 5UKDA 2GJ9A 5EXXA 4V0OA 4DDWA 4AKEA 2FWRA 3CLVA 1GRRA 4RFSA 1RRPA 4I1VA 3K09A 4EDHA 2ZYTX 4RJLA 3DL0A 1HUQA 1AQYA 4HEJA 5EE1A 2F1JA 1Q20A 4PSKA 4QJ5A 1ZC4A 1ZD9A 3ZZTA 5KSZA 4LC0A 2C04A 1BYUA 1D5CA 1GDDA 1OYYA 1ZYUA 3HYRA 3KJGA 3QQ5A 3SZRA 1KAOA 2XB4A 4ZKDA 4P32A 1TX4B 3IGFA 3H1TA 4TTQA 3EC2A 3NXSA 2XNDD 4ACBA 2ZJ2A 4NYMQ 3CX8A 2WPDA 4B2IA 4B71A 4W7SA 1G4AE 5G3ZA 1EESA 1TNDA 5FOWA 1NBME 1SVWA 4XTRA 3ZIAA 4KFSA 3QBVA 1D8TA 3U7EB 5FI1B 2WJJA 1AZTA 2I1QA 2JDIA 4KV9A 3MG9A 1EFHA 1KO8A 5FTMA 4IDQA 1L4YA 521PA 5DO9A 1F2TA 3CR7A 3M0EA 1M34E 3ONWA 1F60A 1IN5A 3CPHA 1GUAA 1PZNA 4YMTA 1T6NA 1E98A 1VCMA 3OAAA 1FNNA 2DY1A 1W4BA 3B1YA 4YONB 5DIFA 1FQJA 1KO4A 1QHIA 1VMAA 1V43A 4PHHA 5FTNA 3T1OA 5FH9A 4ITRC 3ZVNA 1Z47A 2E87A 4GRAA 3K0EA 5FOSA 4R2HA 1ZUNB 1GNQA 3M1IA 2IWRA 4EPWA 1A5TA 4RD3A 1WE2A 1XBTA 3GLHA 1ZCAA 3B1XA 1XTJA 4CW7A 1DPFA 2V54A 2B7BA 4JKIA 4PO1A 2O8CB 4LI0A 4FN5A 2FZ4A 4M9QA 4QNMA 4AKGA 1XCPA 3THYA 4PX9A 3K9HA 4O2RA 4PANA 1E1RD 1OXTA 3ZVMA 3QJYA 3RS2A 2YHSA 4GOXA 4D2IA 2WKQA 4LGMA 4KHZA 721PA 1XEFA 3R7WB 2N42A 1W5SA 4F4IA 1YU9A 2WJIA 1M7BA 4JVLA 2CCJA 4LCBA 3DVLA 2ZSFA 4F4CA 2QTHA 4EUNA 4OQFA 4LOAA 3SJZA 3H2YA 3K70B 4CEHB 4RD4A 4B48A 4TTRA 2FG5A 4PC3A 4C0JA 4PPFA 621PA 1JR3D 1Q1BA 1GILA 2CBZA 3ZD6A 1P75A 3EZ6A 1Z83A 1N6IA 3QXJA 4LPKA 2HLDA 5DHFA 5HKKA 4LX0A 2P67A 2VRWA 3GLIA 2FSIA 5CLQA 3IIJA 4EPVA 2YC4C 1U98A 2ZPTX 5C4MA 1PUIA 2QAGA 5JS8A 3GLFE 1W4CA 1NN5A 3B8HA 2CLDX 4DCSA 2ZR0A 4DSUA 4AIIA 3TGPA 1Z0FA 3I73A 1GVNB 2GAOA 3MLEA 4IJMA 4EJSB 5E95A 4TN1A 2GVZC 5KUTA 2WV9A 2BWJA 3FHTA 3EIQA 4NL4H 5DI9A 3R9WA 3I62A 4WVFA 3RC8A 5EUMA 2PJZA 3DHWC 2FSGA 2GEDA 1QHHA 3KX2A 2HV8A 2UZIR 2GETA 3AUYA 4TWZA 5AK0A 5TDHA 4ZCIA 5GJBA 4A6PA 1ZU4A 1VPLA 1BMFA 1Z08A 2CL7X 5JHGB 1Q12A 2VHUA 5AR1A 3GJ0A 4BFYA 4PQRA 2ONJA 1KYIA 1SVLA 3SI7A 2PEYA 4QM7A 4KODA 2OG2A 4OHVA 2NOAA 2QENA 3HU2A 1MO6A 2OILA 3RLFA 2VYFA 1X3SA 2VPPA 4TT3D 4BQSA 1M2OB 2ZRJA 3VX4A 1EK0A 3KKPA 4DUGD 3ECCA 1CR0A 4HATA 2ZU6A 1E99A 3KQKA 3BK7A 4MITA 3C5CA 1QHGA 3AVPA 4C0LA 4HYYA 4BFWA 3A1VA 1N6LA 1ZD1A 5C1BA 1UDWA 4YXWD 4ZDKA 1CEEA 3OEED 3LLMA 3RWMB 2YC2C 3QF7A 3KJEA 2P0EA 3UWOA 2GA8A 3E70C 2GEVA 4LHVA 5FOTA 3BFKA 1ZM7A 3LRPA 3R8CA 1NSTA 2R2AA 5FL3A 4F38A 3HWSA 4KVGA 4M9XA 1QBKC 1VKJA 5FTKA 1SXJD 1R7RA 3W34A 1DO0A 2BBOA 3CW2A 1RRFA 1E9RA 4CEIB 2JLWA 3EARA 4K81B 2QSYA 4Q7KA 5IT5A 4WZBE 3R8FA 3EXAA 2QROA 1AN0A 2BJVA 1BYIA 3BH6A 3DMNA 3VFDA 3GLGE 2G77B 2A78A 2ZETA 3W8NA 3GLHB 1AS0A 4LYJA 5HTKA 4YMVA 2VEDA 2WJYA 3I92A 4TL6A 1KSHA 5KNCA 5AJYA 2OUKA 3L0SA 4E22A 3C4JA 1E69A 2ATVA 3RC3A 5JJLA 2WTUA 1IN6A 4RKEA 3TUZC 5CK5A 1DG3A 1U81A 1H8HD 2BKEA 4UJ3A 5JEDA 4NPHA 4PAOA 1E9SA 1P9RA 1S9HA 2EU8A 2OBMA 2V4ZA 4R98A 2GHIA 3WMEA 1G8PA 2IK8A 1R6BX 1JI0A 4GOJA 4M22A 5CIQA 1OB2A 1PLJA 2AWOA 1UJ2A 3TH5A 3T06B 2IUUA 3NBFA 1GNRA 4DEXA 2GK6A 2GNOA 1MOZA 3IPYA 1E1QA 4LZZA 3BJIC 3CRRA 2AL7A 3DZ8A 4IW3B 1RVDA 2QORA 4S35A 4Q03A 2ZYUX 2ZI4A 2GZAA 1E2DA 2O8FA 2QAGB 1N5IA 2BMJA 1U8ZA 2IYTA 2CMKA 2E1RA 4AD8A 3PEWA 1G1MA 2ODNA 4BRWA 1WDTA 3C41J 5HE8A 1Z6GA 2EFGA 3FKQA 3HJNA 2ONKA 5DGXA 4BLPA 4X8OA 2WSMA 4ILEA 4EFNA 3CONA 2V55B 1XWIA 1HE8B 2C96A 4L9WA 2BIFA 1YZNA 1GL9B 2PEZA 3QPWA 4RY2A 2IC5A 3QF4A 2Q6TA 3JVUA 4F92B 1Z8FA 3KFXA 3C8UA 5JRZA 3TW8B 2ZSBA 1ETUA 4LRWA 2VP6A 1CRQA 3GJ8A 4QC2A 1JXOA 2F7SA 3MMPA 4YDSA 4B3DA 2IX3A 3K0FB 2NMVA 1A82A 1QHHB 3AKCA 1KTVA 1N6KA 1U94A 1YQTA 3NWJA 4ASUD 5CYOA 1GKYA 1LW7A 4OK6A 4MRSA 2GZHA 1F3OA 3DEFA 4XWOA 3K0SA 4Z8YA 1FUUA 2WWIA 1GWNA 4HLUA 1P60A 4LUCA 4EPXA 1KI3A 2W6JA 2RH5A 3EPKA 4CF7A 1XTQA 4M1MA 1XZPA 1N6PA 3EWSA 1FP6A 3R9IA 5K8LA 3L43A 2ZE7A 3AH8A 1JAHA 4DSNA 1DAFA 2C03A 2FGKA 3TKLA 3WHLA 2QU8A 3WNCA 1B23P 1NF3A 2ZI6A 4XD7A 3GEEA 5E4FA 3A1UA 5EXPA 1JJ7A 1FOEB 1RRGA 2A7QA 2J5XA 4PC2A 1JPJA 1Q22A 2IBMA 2WVJA 2YV5A 1C4OA 5FTJA 5D3MB 2QBYA 1G8FA 3KB1A 2W2VA 4IXMA 3SQXA 1Q3TA 2GAAA 5E7JA 1UKVY 1U8YA 1UDXA 1GOTA 4OBEA 2D74A 6Q21A 2AKYA 4OJKA 1G5RA 1G7SA 3SJCA 2G83A 2ZE8A 2ZSEA 2GXUA 4P31A 3L0OA 2O8EB 2ZRCA 4H9GA 5EUQB 1E79D 1M1YE 2G88A 2XOKD 4JBXA 1FPMA 4A4DA 4EFMA 2F55A 2P3SA 4TQAA 2W6ID 1G9XA 1Z0KA 3A58B 4JLPA 4YLGA 1NVVQ 2LKCA 2VSXA 3J81k 1KO5A 2VH5R 4FW9A 3KKNA 2AKAB 3U5ZB 1ZRHA 4B6EA 3BC1A 1LF0A 4RFVA 1N5JA 1TEXA 4CRWB 2JAQA 5GJCA 1E4VA 4D4JA 3ZLJA 3IDQA 4JLAA 2JLYA 2JLUA 4FWIB 4A8JB 3QEOA 4DWJA 3BRWD 1GAJA 3MWJA 1FFHA 3QKUA 1VG0B 3N2EA 4DT1A 2IT1A 2WMOB 1EG7A 2Q0HA 2EFHB 2OLJA 3K0AB 2C98A 3OIVA 1NLYA 2AFIE 1OH6A 4FCTA 3UATA 1W7AA 3N2IA 3PV0A 4HZUA 4CEJB 3FWYA 3FVQA 3F0TA 3LXXA 3T35A 2JLSA 2X2FA 3MGCA 2IUTA 3JVVA 1VG8A 1JXMA 3NH6A 3QG5A 4XH9B 4JL8A 4LJ4A 2LCFA 1IONA 2VIIA 3BIFA 1NBMA 3LV8A 5H8WA 2WPDD 2ZRBA 4QBFA 1ZC3A 4MRPA 4DDUA 3RVBA 4MDFA 4DC9A 3CRW1 1HE1C 3BE4A 2J41A 3BWDD 1VYUA 2AD5A 1R4AA 2NG1A 4IOMA 4G3XA 4B2LA 2CCGA 4TMWA 4LY6A 4KITB 3UPUA 2C95A 1OV4A 2VSOA 2BEJA 1OLOA 4R9UC 1PLKA 4BPBA 3NEJA 4DCUA 1AS3A 1KK1A 2P5SA 5L3SA 1UM8A 2ZITA 1RE0A 2VQSA 5FUWA 3I3SR 1RZ3A 4FMDF 4QM6A 2Q9BA 2FPMA 3FKSD 4JKYA 4JIMA 3K0CC 2JJ1D 2ANCA 1KI7A 5J4YA 3DDCA 1E9CA 3BGWA 5TV2A 1EX6A 2IXFA 1DAEA 2ZANA 1ANKA 3EG5A 1J99A 4PHGA 1MRNA 2C77A 3GFOA 1AGPA 3QF4B 4M1WA 3KFVA 2AK3A 3RRZA 3SFZA 1QG4A 1W5TA 1WXQA 2QL6A 4RCYA 1KI4A 3DKVA 3DMDA 3RHFA 2QP9X 2IYRA 2RGAA 1YR8A 2GCNA 1U0JA 4QG7A 3X1ZA 4EQ6A 4Q9JA 3ICEA 3KTAB 2GXAA 4XTCS 5HPYB 3KZ1E 4IVRA 4JMPA 2ZRHA 2XSZA 2XTZA 2V3CC 4W9MC 1DAHA 2CK3A 4WZ6A 1T3SA 4W5WA 3N5CA 3HP1A 1C9KA 1N3BA 1FTSA 4U02A 4XSHA 3GEIA 5LDDC 1WCV1 2UVQA 2FU5C 2ZS8A 3E2IA 4NU0A 4B75A 1J2JA 1UF9A 1FX0B 2IYQA 1P2UA 3SYKA 4M4SA 4Z8XA 3VR3A 4NCIA 3FMPB 1XD9A 4BLTA 5SZKB 2PLFA 2YJTD 2WBLC 3TMKA 3NDPA 4NYJR 3SBEA 4LK2A 1NMYA 1LV7A 5B30A 5EZ5A 4NH0A 2DFKB 4PZLA 4NYIQ 3MWLA 4B73A 1COWA 1R0ZA 1VCNA 3Q7QA 4M1TA 5D3QA 5HR5A 1N6HA 3GCGA 3SS8A 4W5HA 4HUQB 4K8OA 5CM9C 3PXGA 1II9A 3ICQB 3LD9A 2PMKA 1ZBDA 2J45A 4I4LA 5SZHB 4DDTA 4Q1AA 3ZVLA 1MH1A 1P62B 3NBXX 4PSAA 1K5DA 4BFSA 2FOLA 4PZZA 1M8PA 4BUJA 4D4MA 4OK5A 3U44A 3SQWA 3KB2A 2DHRA 3AF3A 3RABA 4Z1MD 1QHYA 4B3BA 3Q72A 1NN3A 3WXMA 1JALA 1E9FA 3AVQA 4PAQA 3SJAA 3FDIA 4JT2A 4HAXA 1II0A 1G16A 1XEXA 3FOZA 2CVHA 2ZRPA 4X8HA 3AF0A 5FUVA 4JLDA 4A8JA 4N0DA 1W0KD 4URYR 4BZQA 1KK0A 4OHYA 1WBDA 1GM5A 4UKDA 4PC6A 4WAUA 1BMFD 1KGDA 1GL7A 1QG2A 121PA 2BJWA 4U7DA 2L0XA 1G3IA 2PH1A 3W3AA 3B6EA 4IDNA 2ZU0C 1IN4A 3G0HA 2D2FA 2AD1A 2ZUDA 3THOA 2RGXA 1T5LA 4CT4B 2ZAMA 5JSZA 1XXHB 3KKMA 3UG7A 1DTSA 2REXB 3PUXA 4POAA 3PEVA 1JBKA 1R0WA 3VHLB 2ZXUA 1S2MA 3W6OA 3LLUA 2YWEA 2O8DB 3FHCB 4AG5A 1OXSC 1V5WA 2N1BA 3IQWA 4C2UA 4HB0A 4Q7MB 2SHKA 2XZOA 1KI6B 3AVOA 3AF1A 3DZDA 4YXWA 4BLSA 1IXSB 5L3SB 2B8WA 3C5HA 3B2EA 2C8VA 4MRVA 3RSOA 4CIDA 5EE9A 4JZKA 5JI2E 2J0SA 3EW9A 1G41A 5E7IA 1TTTA 1PUJA 3IQXA 2UZ3A 4A2QA 4D0LB 2QPAA 4QHYA 3B1VA 3NHBA 1N5KA 4FWTA 3U61B 3PVSA 2IL1A 3GD7A 4WIAA 4B33A 1VYVA 3SOPA 4YMUA 1GIAA 4G0NA 1F2UA 1X8JA 4EQ6B 2J0UA 2A5YB 3KTAA 5DYGA 2WWHA 4Q1DA 2OESA 1T8TA 2G3YA 2PX0A 2ZR7A 4KBGA 5FUXA 2NO1A 3ADBA 2C9OA 2H5EA 1W36B 1YE8A 2YINC 1TU4A 2CLSA 2JIZA 4EAQA 1D9XA 3GMTA 4MGYR 2IW3A 4G5RA 5KPDA 4P4SB 4PC1A 3ZZ0A 2C99A 2J59A 4LJ6A 4IDHA 1E2PA 1KSFX 2OXCA 2GILA 3IO5A 4LSGA 3UIEA 4BFZA 1SXJC 1VG9B 2H7VA 3QBTA 5J4KA 4HAVA 3BBPA 4BZPA 3THWB 1IXRC 1G3UA 2OBLA 4LV8B 3RS5A 4G01B 2O8BA 2QM8A 4XWKA 4KO8A 4JS0A 4XJXA 3AEZA 2BEKA 4HSEA 4M0LA 4Q1FA 1DVRA 4D6PA 1EFTA 2G1JA 4TZ0A 3WY9A 3IEVA 4TQ9A 4K46A 3LH5A 4GMDA 4FMCB 1I4LD 1W49A 3V4FA 2WWYA 1IJEA 4DVGA 2J0QA 2FFHA 1A2KC 1WP9A 4HUQA 2A3RA 5DI3B 4ZDWA 4DSTA 1M74A 3LFUA 4C7OB 3U6KA 2QP4A 1P73A 1B0UA 1Y3AA 2WMNB 2IYLD 1ZM2A 4LJAA 4WOPA 4KFTA 3VKGA 1SVMA 2D7CA 4ACAA 3EPJA 4IOLA 4MGIR 2GXSA 4Q5IA 2IWHA 4GI7A 3X1YA 4XVRA 3MFYA 2CNWA 4LHXA 1P6XA 5EXTA 4KLZA 1AKYA 3GEHA 1OSNA 2ZRKA 3PEUA 4WW0A 1XFAA 2W2XA 1AA9A 2OCPA 3CM0A 3QE0A 5KU1A 4EPYA 4TL8A 1XEXB 2WOOA 1Z06A 1I2DA 4TLAA 1Z0DA 4MYHA 4AKIA 4V0MA 3BS4A 3ZD7A 4C0QC 2WWWA 3BB1A 4M53A 4F93B 3T1QA 2G6BA 3PEYA 1T3LA 1DG1G 1J90A 1G19A 2XEXA 4ZKEA 1OH7A 2FA9A 1MO4A 3ZQJA 4WBSA 5KHOC 1E2JA 2W58A 1SVKA 1XMJA 3L8YA 1ZNWA 4RZ3A 3T5GA 2XNSA 3IBGA 2XZPA 2KBEA 1XXHA 4L16A 3P4XA 1E0KA 5J4HA 1LVGA 1RW4A 4JJKA 2JEOA 1JNYA 4Q7JB 3ASYA 4TL7A 4XD7D 2I1VB 4UXJA 1CJVC 5TMPA 2FJUA 1U8AA 4NMMA 2XAUA 3QKSB 4GPTA 4NYIR 1OFIA 2REOA 1Z6AA 1YZUA 2F1HA 5BYKA 4KFRA 1TQ2A 3FTQA 2VL7A 3VQTA 2OCBA 2GBLA 3QIAA 4A9AA 3K70C 4Q9HA 2JLQA 2ZJOA 1ZNZA 4OHZA 3T15A 5JZVA 1ZUIA 1NKSA 5KNBA 2FFBA 3L82B 4QOSA 1L2TA 2BMDA 4BLOA 5DN6A 2NGRA 4KVAA 3HR8A 1OJLA 1ZD8A 2ORWA 1DELA 2W6IA 2ZSDA 3UANA 3WYGA 3EA0A 5JMTA 3P26A 3GJXC 2J0UB 4FCVA 421PA 2V8OA 3EIHA 1SZPA 1FP7A 3CRQA 3U7GA 2VP0A 4US0R 4HDOB 1WRBA 5B57C 2RGNC 3QVUA 3B78A 5FR2A 5CDFE 1ZM9A 1Z3IX 2ZR9A 5EP2A 1F48A 1NY5A 4HAWA 4PPQA 4GNKA 4B3XA 2WSSD 5BYJA 1W36C 5DNYB 4GZMA 2CHVA 1N5LA 4LHYA 5DYIA 3Q85A 5TVKA 4P4UA 4IXNA 5JWRA 1PLLA 4P4SA 5CDFA 4URWR 1KZGB 2F3RA 5L3QA 1GTVA 1I2MA 3LNCA 1E2HA 1S9DA 4BECA 4NHOA 3SYNA 1E1RA 2PMDA 2JJ2A 3EAQA 4RFSB 2QPTA 4X8LA 2O8BB 3PUVA 2FNAA 3GJ6A 2GDJA 1TU3A 4TQUS 1ZW6A 4MYTA 3KUCA 3T34A 2ZJZA 1CXZA 2GK7A 2DCUA 1E0SA 1U0HC 3BOSA 2OE2A 4XIGS 5DI3A 5JLJA 1KI9A 4NCHA 4NE2A 3A4NA 1JQLB 2Q3HA 1YHNA 1F5NA 2JASA 3WYFA 2V7QA 4QGHA 1SQ5A 1ZM4A 2QE7A 2HT6A 2FE4A 1AQUA 2GEUA 4GFDA 1G20E 1AJEA 1FNMA 3PFIA 4Q4HA 1OFHA 3RS7A 4D81A 1FL9A 3KQUA 2D62A 2ZRNA 5J40A 2D06A 3OE7D 4JLJA 3UK6A 1OFTA 2YNMA 1CR1A 1P72A 1ZNXA 2J7PD 3CWZA 5EE3A 2WAXA 4DSOA 5ELXA 2ERXA 2IEYA 2HEIA 3ADKA 4QHSA 3PIRA 3AF2A 4MYCA 1OFUX 1OKKD 2IF2A 1P2SA 3A8TA 4AWXA 2FPKA 5LB2A 1RYFA 2ORVA 2P2LA 2DB3A 3VHXA 3REFA 1CP2A 4Y0AA 1A1VA 4ERNA 1KJWA 2NPIA 3F8TA 3I5YA 4UNSA 1FTNA 4URVR 2OFOA 2EQBA 1ZNYA 3CUEF 2FF7A 2XTNA 5EJEA 1E9DA 2CXXA 1J7KA 4BFVA 4Q4JA 2DWQA 2A2ZA 1KDRA 2JJ8A 5DH9A 3MJRA 4DLWA 1YRAA 1UADA 2PZFA 3DO6A 3GJ4A 3GFTA 2EVWX 3IIKA 5J5CA 5JFGA 4GP6A 1ZUHA 2HXYA 1G6HA 2Z4SA 2QMUA 3O8BA 4NKRA 1LS6A 4LJ8A 3B9PA 4KSCA 1H8EA 4KU4A 3CX6A 4MKHA 4Q19A 4LBYA 4AYXA 5L8VA 2C9YA 1GL6A 1W47A 4OI1A 1U90A 5AUOB 1S3GA 3B13B 4IRUB 5CM8B 3NIBA 1KSGA 2QTVB 2GBLC 2X77A 4W5JA 3SFVA 4D0NA 2RGCA 5TB5A 3TAUA 4ARZA 3AV0B 5KSOA 1G64A 2GXQA 3AUXA 2ZJ5A 3LX8A 1TUIA 5AUNB 4KAXA 1JQJC 2FFAA 3CF6R 1WMSA 2RGNA 4F4JA 2MSEB 3Q8XB 3THXA 1SGWA 3GJ5A 1HT1E 2D7DA 4KI0A 4NBSA 4GBMA 1O3YA 4BZXA 3OFNA 2YVUA 5EE5B 4DLRA 3EZ2A 2ZUCA 4MUAA 3NDBB 4TYNA 1XX6A 4RD6A 1IY1A 3EWAA 1OYWA 1T0JB 2C78A 3VR1A 4DBLC 1Q1ZA 4AK9A 2KJQA 3KKOA 5L3QB 3CWQA 4F91B 3AP3A 3WP0A 4DEYA 2CL0X 1D9ZA 1PJRA 1U9IA 2HUPA 4GOKA 3ZVRA 2QM7A 1IBRA 1S8FA 3DOEA 5LBIA 4NONA 4TMXA 1T5IA 4G1UC 4IEIA 1K8RA 4G5SA 4M9ZA 3AKEA 1XCMA 1RRCA 4MA4A 5F9FA 3GP8A 1VHTA 2O0HA 2IEZA 3I1FA 1Z0IA 3D7MA 1T4GA 4P33A 2OSBA 2WWGA 1TADA 1ONBA 4M21A 4OHWA 1HURA 4HLCA 1VIAA 3NG1A 2IYVA 1W2GA 1DE0A 3JZAA 1OXXK 2Z0MA 1DOAA 4TZ6A 1W1WA 1W0JD 1S4QA 3F3YA 4QJ3A 3WYAA 5BXQC 3PR1A 4LBVA 2O0JA 2HT1A 2PL3A 1P3JA 4HB2A 5G53C 4Q4HB 2VSFA 4A82A 4Q7LA 3AVVA 2NIPA 2D2EA 4FIDA 4RZXA 4L15A 1SKYB 3BB4A 2AK2A 2B21A 1WQ1R 4YMSA 3I32A 2Z4RA 4R2IA 3U3KA 1CBUA 2EWWA 1P4SA 1NJGA 4LBZA 2QY9A 1DAIA 3K8YA 4A36A 3H84A 4V0ME 2CDNA 1JJVA 821PA 2GKSA 2ZJBA 1Z07A 4C4PA 2NO7A 2QRZA 4LV6A 4OL0A 5DSZA 3SNHA 1XTKA 2NZJA 1L8QA 3FYHA 4WA7A 2GJKA 4R71A 3Q5EA 4TL9A 3OHMA 2VLIA 5FBRB 1UBGA 3RS3A 2X1VA 1XD2B 3PJRA 1R10A 1NLZA 1CR2A 4DDVA 2W6JD 3TLXA 1M7GA 1KMHA 1CF4A 2ASEA 2F1RA 3VNUA 4IEEA 3QKRB 4XOIA 1ESNA 2R44A 3I8SA 1IQPA 1S96A 1LFDB 2HDNB 4PTLA 3O8RA 3HYTA 1E2LA 2W00A 4HI0E 3WRYC 2GWHA 2QTFA 2YYZA 2B8TA 3OF5A 5KSYA 5BN5A 2H17A 3CPJB 1E2EA 4NYJQ 1Z6YA 2P65A 2WKPA 4L4UA 2FEMA 1EFCA 2W2TA 1NRJB 1KDTA 5GJWC 2XB2A 4G5GA 3D6TB 5KTYA 5C4GB 1EFUA 2P5TB 3OEHD 4X8MA 4TLDA 3TQFA 2ZE5A 1OHHD 1TQ4A 1E4YA 3TBKA 3VKWA 1W4RA 1X1SA 4PZYA 5IK2D 1W48A 4HUTA 4C9BA 1R2QA 4PPNA 4AG6A 3U4QA 1Q1EA 4V0KA 2O8FB 4GSYA 1SHZA 3U6BA 3THXB 1OIWA 3KQNA 1YZTA 2BBWA 2IHBA 1UPTA 2CE7A 3IBYA 3QPVA 3VTKA 5FUYA 4P3YA 5G3YA 3RSLA 2Q9AA 3AVXA 3I61A 1QZXA 2A5DA 3K9LA 1UKZA 2WHXA 2QPOA 1GNPA 3RWOA 3MJHA 1G7CA 1XTRA 4CZ2A 5BN4A 4KCGA 1X8KA 4ASUA 1N0WA 2QGNA 1XTIA 4Q02A 4BLQA 3A1SA 4M8NE 1R5OA 4Q4AB 4GZLA 5CYPA 2XGJA 2W0SA 2RMKA 3FFBA 4IKEA 4QXAA 3CBQA 4JLOA 2IYZA 2I4IA 2VF8A 1GZSA 3BD9A 2OO7A 3SC3A 3LDAA 4FINA 4DIDA 4UXHA 1EWQA 2QAJA 3OIUA 1KSJA 2ZI9A 2MMCA 2QP3A 4DLVA 2WZQA 3X1XA 1S0UA 1YVDA 3K53A 5EP4A 1PV4A 2ZS9A 1US8A 1HT2E 4DRZA 1NBMD 5CB6A 4XWAA 1VIYA 2OFWA 1MT0A 3NEYA 4R7ZA 5FOUA 4OK3A 3KL4A 1OE0A 1U9IC 2WIAA 3ZIAD 5FL7D 3BH7A 1OXVA 4RKFA 5FFMA 1KNXA 4ZCLA 5D3MA 2ZE6A 4U00A 1G291 3P4YA 5DN6D 2JLRA 1SVIA 2GTPA 2CL6X 3LA6A 2H8KA 1LF5A 1VTKA 2VF7A 1R5BA 2JJ1A 2XOKA 1NI3A 3HU1A 4D26A 3CZQA 1JR3E 2VP5A 1AZSC 4A92A 1DBSA 3SE0A 2JA1A 3CRMA 2Q9CA 1XP8A 3RANA 1E32A 1E2FA 1CS4C 1GFIA 2KI5A 4TSFD 4AURA 4BASA 2AR7A 1XDBA 2ZQ5A 3MD0A 1KI2A 1AK2A 3QI2A 1D6JA 3L0PA 2PCLA 4LJYA 3TQCA 1W36D 2CLCX 4LDJA 3UWKA 5TY0A 1U99A 3WMGA 2HJVA 4PAMA 3AM1A 1E2QA 1UFQA 1P5ZB 1KO7A 1CR4A 1KKLA 2VHCA 3K1JA 5SZJA 4B74A 1XD2A 4PPGA 4EKDA 1W4AA 4A6XA 2CK3D 1FMLA 1KMHB 4QGGA 1FW6A 2CE2X 3EASA 1XJCA 2JCSA 1QDEA 1YZKA 4Q1EA 4HAYA 4DCNA 1P7CA 2QT0A 2FX3A 2QT1A 4QGFA 4CEJA 3Q5DA 1OIVA 1Z28A 2XXAB 2KBFA 4WXPA 4A2WA 3G5UA 3T1TA 4NZYA 3QXSA 2AWNA 4RD2A 1EFRD 3PUZA 1DS6A 1ESMA 3IHLA 4DZZA 3SEAA 3EZFA 2ZM5A 4KYIB 3EX7C 1JR3A 1Z2CA 4KYUA 5E7MA 4V0NA 4C0BA 2EFEB 1U2RA 2QE7D 1XTSA 2HLDD 5HKKD 4PO8A 4YMWA 3QXHA 5AWFC 3VNVA 3CF2A 4TMKA 2DWOA 2F9MA 2ZS7A 3U4QB 4BGDA 3KKQA 2JLZA 3OE7A 3W3ZB 2OXRA 3OIYA 3IO3A 4JL5A 4BFXA 3IUYA 3R20A 3N70A 4LYHA 1E0AA 1JB1A 3AVYA 5IRCD 2G9NA 3NBZC 5LPNA 2PZGA 3B60A 2A9KA 3A1TA 1SVOA 3UG6A 1NG9A 5FBQB 3W8RA 1PVOA 3RDPA 1JECA 5IHPA 1MABA 4HB4A 2QRNA 4B3GA 3EIEA 3KJIA 3ZYCA 3EPLA 1CJMA 1GP2A 2QG6A 2VA8A 4OQNA 1TUEA 4BEBA 4LPSA 4G5OA 5TARA 3SR0A 4FMDB 4LJ5A 4MUBA 2ZUBA 5EQTA 1HA3A 1GITA 2R62A 5HZKA 5L3RA 2FGJA 4B44A 5LB4A 3QSYA 1OIXA 4NP6A 2OAP1 5FI0B 1H8ED 4JLKA 3KDSE 4TT3A 1US8B 5FPKA 2DFTA 2OAQ1 3TSWA 2ZJAA 3SJBA 1FX0A 3RRMA 3GLFB 4CYMA 2V6IA 3CNOA 3IIMA 3OZXA 3U2QA 3SBDA 1AKEA 2VHTA 5CITA 4NCJA 4RD1A 3RRYA 2O5VA 4LBWA 4ZV4A 3ZS8A 4A15A 3WNDA 1S3SA 3I5XA 1XU4A 3H0KA 4OQXA 2QMHA 1SKQA 4DLYA 4A2PA 2ZROA 2ZAOA 1GRNA 2VP4A 2LWIA 1G4UR 2HYDA 1XCGB 4JBYA 4B35A 1II8A 1VYTA 3P32A 5AJXA 2R8RA 3W5IA 4UNPA 3WBKA 4TMTA 5EZ6B 1YR9A 5JS7A 2ZRDA 4ZI3A 4MDEA 2KSQA 5JI3E 4Q9LA 3LBHA 3KXKA 3HPQA 3D31A 3U44B 1UEJA 2FMXA 4CGZA 3RRNA 1NN1A 2YOHA 4HLUC 5KDDA 1W0KA 2EFCB 1SKYE 1OF1A 1C1YA 1ODFA 2CCKA 4P0TA 2WOJA 5J4VA 1YZGA 1DARA 2P6UA 3K9NA 2OCAA 2I3BA 1HEIA 3IILA 5JJKA 3CNNA 3HR7A 5H70A 4EIWA 5CLLA 2OT3B 4D4KA 2OBNA 4Q47A 2J0VA 3OESA 3NBYC 2NTYC 5P21A 1F2TB 1G18A 1ZINA 4XSGA 3IEUA 4E07A 3QNUA 1MR3F 1QHXA 2FPLA 4Q4LA 1KAGA 3FMOB 5GJVC 5LD2C 2JDID 1Z6XA 1K5GA 2EFDB 2IYUA 1X86B 4PQFA 3KXLA 4QHTA 1KK2A 1CULC 1IAQA 4A0GA 3HDTA 5IDVA 4MKFA 4LJ9A 4BWYA 2G0NA 5JSZB 4CVNA 1Z29A 3FMFA 2CJWA 4JLNA 1E1QD 3OAAD 1U0LA 5AJWA 1E2GA 2NO0A 3C14C 3SN6A 1SXJB 3UMFA 3LVRE 4RZ2A 4N0EA 2BMEA 1KI6A 3KJHA 1ZCBA 3GLGB 1L7VC 1UEIA 1TQDA 1SXJE 4A0FA 1FUKA 4AI6A 2BM0A 4DJTA 2REBA 1NKTA 4EPTA 3B82A 4MKGA 3R7WA 1BH2A 5KPJA 2HYIC 5EE0A 3L8ZA 3QXXA 1XPRA 1YR7A 2BMFA 3BH0A 4LJ7A 4Q66C 3TJZA 4OI4A 4OI0A 1RKBA 1OXUA 3T5DA 3REGA 1LNZA 4EFLA 5KDOA 1QRAA 2B92A 3JZMA 5K8UA 2OFXA 4Q01A 1NN0A 3ASZA 1WBBA 2YWHA 2V1UA 4C0SA 2ZJYA 3CRVA 4MRNA 3W5JA 3GLIB 2A5FA 3H86A 1BO6A 2RGEA 2R6AA 3AKDA 3LW7A 1HTWA 1CRPA 3TSZA 2ZREA 1KY3A 4OKSA 2C5LA 1XMIA 5BN3A 2ZI3A 2ZEJA 3B5JA 1P2VA 1RC8A 1GG2A 1YZQA 4JSTA 1HY3A 1W2HA 4QBIA 4ZO4A 4A0HA 4QBGB 2VP9A 2ZIAA 1AM4D 3CKLA 2DWPA 4HLDA 4TYQA 4ESHA 1G8YA 1NMZA 3V00A 3O8CA 2JLXA 1UAAA 2BVNA 2RGDA 3SU8A 2GF9A 3P27A 4NCKA 1IN7A 1ZJ6A 5BWMA 2YWGA 2W0MA 2GESA 2GCOB 4C7OA 1G3RA 1II8B 2D4HA 5JJIA 3B85A 1XNJA 4C2TA 5KO2A 3SYLA 1Z0AA 1IY0A 1GSIA 2NQ2C 5FR1A 1DADA 1TPZA 1N6OA 4IOJA 2CHQA 5FBVB 2MSCB 2VO1A 3C7KA 1N6RA 2ZRLA 4H1UA 3S1AB 1J8MF 3PUWA 2PLRA 3VR4A 2WKRA 2ECKA 2BV3A 1OH8A 2XX3A 5FOXA 1XJ0A 1Q21A 2V6JA 3KXIA 2A5GA 5G40A 2R6CA 3QUSA 2VTKA 2ZRMA 1ZIPA 3SHWA 1O87A 1T8UA 1E9BA 2WSSA 1P61B 4L5BA 3T1VA 1WF3A 3FGNA 5FBLB 3GPLA 4DUGA 2X2EA 4C30A 4UJ5A 1F6BA 1BOFA 2FFQA 1X8LA 4TLCA 2D3WA 1JPNA 2Q3MA 3AGPA 1R0YA 1XXHE 4US2R 3RNLA 1TQ6A 3Q9LA 1NNEA 1HQYE 2ZRAA 4IFEA 3OEEA 4MGKR 2EWVA 5FPTA 1XZQA 1NLFA 3AB3A 4I81A 4MH0R 2FSFA 4CEIA 3PCRB 4B6FA 3BXZA 2A5JA 4Z1MA 3RS0A 4BE7B 2J46A 4PO9A 1Q44A 2CJWB 3BAFA 4AC9A 1JR6A 3AVTA 2Z43A 5JCPA 1HQCA 1SXJA 4MGZR 3WRXC 2DR3A 5LD2B 2GJSA 2Q3FA 3LX5A 4YC7A 1XPUA 1TL7C 5AJZA 4OHXA 1R8SA 2V7QD 1RJ9A 1ZIOA 1TMKA 4PXAA 1VCIA 3GLGA 4HZIA 4ZDIA 3TVTA 2WICA 5CK4A 3UMSA 2B6HA 1G7RA 2J1LA 3FKSA 5F2EA 4ZI2A 5GVSA 4N3NA 3FFAA 1QVRA 4Q1CA 3MCAA 1SULA 4J0QA 2F9LA 4DKXA 1J70A 3QOFA 2QZ4A 1ZM3A 3D3QA 4TSFA 3LVQE 4URZR 4LWZA 4A1FA 2F1IA 4XVUA 1R0XA 2WAYA 1MO5A 4HDCA 1D2MA 4BFUA 3VR2A 4HDQB 4JLMA 4M1OA 3MSXA 4UNNA 4IVQA 3GJ3A 2PT5A 4OYHA 4OQMA 4JVSB 4ZPXA 2YOFA 3QXCA 3V4RA 1KIMA 4PHTA 2WJVA 5CJPA 1NIJA 1MV5A 2VHJA 1NIPA 1TF5A 2BHRA 3KUDA 4DB2A 2H1LA 5BQ5A 5K8IA 2W83A 4QL3A 4GDFA 5A0FA 2H57A 3HPRA 1HYQA 1CJUC 1UBFA 2YWFA 221PA 1GKUB 4UXIA 2HJGA 5H1YA 2QA5A 2QSZA 3B7GA 3QPUA 2PT7A 2ORIA 3AF4A 2WWFA 3NVAA 1UKYA 2AXNA 4B3CA 4DLTA 3LY5A 2YKGA 2PX3A 2ZYVX 3LXRA 4TYYA 4JJZA 1IXZA 2WJGA 1G5TA 1EFRA 3AKYA 4DHEA 2IHYA 1G8HA 4WZAE 5IF9A 2DFNA 4US1R 1GKIA 2WIBA 1P9NA 2QEQA 3U3RA 2BC9A 3L2OB 2G1KA 3K0FA 2X19A 4ZIRB 4KBFA 2GCOA 4Q48A 1LS1A 3NKVA 2V1XA 2R6DA 2H18A 2OEPA 1IHUA 2IUSA 3QEJA 3CIOA 4C0HA 2GF0A 5GVRA 4UNQA 2RHDA 2XZLA 2HXSA 4II7A 2NZ8A 4AKHA 2ZI7A 1G3QA 4MKIA 4BLRA 1M7HA 1H8HA 3PITA 3ZQ6A 3PG5A 1TAGA 1K6MA 1XPOA 5K8TA 2R65A 1KI8A 4U5XA 3M4YA 4JVNA 3S1AA 1VG1A 2BKUA 3TSOA 3SDZA 3TW4A 3VAAA 4I1SA 5EXSA 1N6NA 5KSPA 2RB4A 2ZVPX 2IA5A 1VDZA 1RPZA 3ETLA 5C2JB 4ZCMA 2VBCA 4DLSA 4XVQA 4IDOA 3EC1A 4E5UA 2P6RA 3E5HA 3PQCA 1ZP6A 2QBYB 1OW3B 1IOZA 5JCZA 5FBWB 2FSHA 4QGAA 1N25A 1SVSA 4NCNA 2ANBA 5A5GA 4URXR 3TVDA 1KI1A 2OV2A 5ANRB 1M6NA 1CIPA 2DBYA 4M2LA 1OPXA 2G0TA 4EJSC 1Z5ZA 2O8EA 4DIEA 4GL2A 5HCIA 4IOKA 1E9EA 4Q4JB 2FV8A 1MKYA 2EYUA 2IS1A 1NSFA 3CB4A 3CH4B 4GT1A 2AHOA 1XEWX 2CNWD 4DB4A 3DM9B 2RAPA 3ZDQA 3Q7PA 1CLUA 3R9XA 1G21E 3EZ7A 3GFPA 5B2ZA 1E79A 4TYPA 2UKDA 4G5QA 1I4TD 1XMVA 1RJ9B 1X6VA 4KJZA 3WP1B 4QFMA 5JBQA 1KK3A 3KQHA 1N2CE 4DT1B 4HAZA 4PC7A 1G3MA 5JWOA 3K0AA 4O25A 1P9WA 3U3JA 3WNBA 4HZUB 3FPAA 5EP3A 4EPRA 4ARZB 5FPYA 1S1MA 2VP2A 4QRHA 1S1CA 3I72A 2B7CA 4Q9IA 4CT5A 1NMXA 2RHMA 1D2EA 2ZYWX 3NC1C 3OFND 3TUJC 4RZUA 3W9YA 5A4JA 3K9GA 1TF7A 1JAIA 3TRFA 4URUR 3CX7A 5KOYA 2BBSA 3P20A 3V9PA 3ZJYA 2ODBA 4DLUA 4D80A 2GJAA 3ADCA 3HU3A 3OIWA 1H65A 3BB3A 2ATXA 1XJQA 4B3FX 2H16A 2MSDB 3K0CA 1ZU5A 4O2LA 1KNQA 1KMQA 3UMRA 2ZJ8A 1VECA 2FN4A 2XNDA 4B47A 3B9QA 2BM1A 3TR5A 1KKMA 3SHFA 2EYQA 2GRJA 4D4LA 4JYCA 3MWKA 4DXAA 1BS1A 1UBCA 3DPUA 2AFHE 1JEEA 3FMIA 4JSYA 2NPFA 3I4LA 4RVCA 4B34A 3LO5A 3LBIA 4TTPA 3A6PC 3BFXA 5JRJA 3LQRA 4JL6A 1QHNA 5C18A 1T9HA 1NL3A 3PUYA 3VX3A 1W0JA 5HZHA 1Z2AA 3VKHA 2V9PA 4ZIRA 1L4UA 1FMJA 3LBNA 3X1WA 2WWXA 2DPXA 3EZ9A 4FXPA 4YQFA 1EXMA 1E9AA 2OLKA 1DAGA 4ESVA 4TYWA 3DOFA 3BORA 3AVUA 3QY0A 2BBTA 1TF2A 2ZVQX 3VR5A 4M1KA 4KSBA 1CTQA 2RGBA 2DFLA 1YZLA 5EP1A 2R6FA 4LC1A 2XSZD 1DEKA 3LW8A 1Q1QA 4AYWA 2QN6A 4FD2A 1LB1B 3I8XA 2JJ2D 3U7FB 2JATA 1EX7A 2E9SA 4V0LA 5HCNA 3B1WA 1E3MA 5FPHA 1KDOA 1YKSA 2WJHA 2LKDA 1LTQA 3NTUA 4HLQB
chains in the Genus database with same CATH superfamily
1XRJA 4RYLA 5C7OO 1T8PA 3LF2A 2P9TA 3X43A 1CY2A 4QBHA 4M8IA 1BJRE 4RZQA 5GONF 1SCQA 1M34A 4EYQA 4OTZA 5J23A 2HPAA 3TE6A 4DV7B 3ONEA 2AQIA 3PIIA 3SS9X 2C7GA 1U28A 3D2AA 2JEYA 1DXYA 3JY6A 4H1VA 3MWYW 1Y8RA 4IH9A 3HNOA 3QFSA 3U3OA 1EVQA 1IM2A 5B1IA 5B7QA 1NJ1A 1C9NA 3ML1A 5GONA 1HLGA 2EZTA 3QHPA 3L8EA 4ANFA 1VM6A 2XUZA 3W6NA 5JCJD 1XCOA 4MWSA 4AYTA 1YQXA 3OIDA 3QKRA 1C5KA 1Q0UA 3NX4A 3VTFA 4C7MA 4ED9A 2VNIA 4DYHA 4I5FA 3IR6A 2F43A 4FNGA 1ESCA 1B41A 3C4VA 4DUPA 2J7PA 3U7IA 3OZTA 2Z6VA 2PGJA 4C0KA 1BJTA 1E96A 3FZNA 4ZYYA 1HWYA 2G5TA 4G8CA 2VJQA 4MWBA 7YASA 3FSJX 4DA8A 1E3LA 2J87A 1P44A 3GIWA 2P9BA 4ON9A 4I99A 1AS2A 1JX6A 1RFLA 2VJLA 3M2PA 2Z3VA 2VWGA 4DR1B 2Z6AA 5EN4A 2XRZA 4UEWA 2Z1DA 1R37A 4DDHA 1Z7WA 3TN7A 4FEGA 2OCYC 3ZH2A 1E2IA 2VUUA 3P0RA 1OBHA 1ZSVA 4HFRA 2NP6A 1BVUA 2J3EA 2UVDA 1HO3A 2RGGA 4W1RA 5BYBA 3HBMA 3QMVA 3RG2A 8OHMA 3T12A 5KTPA 2QLFA 5JNSA 2AGVA 3ZGOA 3A4MA 4KWEA 5DSTA 2UU9B 3LX6A 4DKJA 1UT8A 2JFBA 2JGNA 4N41A 2O8DA 1ZAKA 1I4DD 3G2LA 1K89A 3RGGA 1TJ4A 4ENVA 2QN1A 3DMHA 1AXRA 1YVUA 4P1ZA 2FEAA 5TXGA 4L22A 3U56A 3ENKA 4JB0A 3G7UA 2I4MA 3GJ7A 2PKEA 1TJ3A 1JG7A 2VDVE 1H2EA 2O7QA 5BN4B 2IE8A 1COWD 1AMNA 3WIUA 2QMOA 2IIVA 2NUPB 4M89A 1T26A 1KY2A 3EEYA 2YTZA 1LNQA 1VB5A 2GBPA 1K2WA 2HF9A 2Y6VA 3GYBA 3P5SA 5GMOA 3CT6A 4BVKA 5JYCA 3WLAA 4GRDA 5JAIA 1P3DA 2G06A 4FMBB 5LA6F 1XDGA 1EM8A 4L9SA 5B2EA 5J4LA 1WQ3A 2YXNA 4P4TA 4DR7B 1EINA 4MPPA 4QUBA 3D6AA 1E59A 4BQEA 1YRBA 4DZTA 2UZAA 4DCTA 1CDDA 4G6ZA 1SOAA 1D2NA 2Q6VA 2OC9A 1RM3A 4KACA 2CJXA 1AKQA 5CLGA 4IZHA 3Q3VA 4Q18A 5DISB 1XDWA 1XD8A 2VAMA 1NE2A 3KOOA 2R8PA 3CNLA 3R9KA 4IVPA 4OU5A 4YTEA 3WBJA 3IVAA 2RBEA 4C89A 1X80A 4D0GA 2C1EA 2H92A 3F5FA 5JXHA 3VI3B 2WJ4A 3ZE9A 4S05A 1Q11A 3ZW8A 3B7WA 1G8GA 4KPYA 4IHQA 3DZJA 1N9KA 2HMWA 1YJQA 1DEHA 4Y9UA 2NO4A 3T3MB 4HUJA 4D25A 3JZDA 1P1RA 4BQQA 1I7NA 4JOSA 5FH9A 4LHZA 3LL7A 4QNNA 4KIFA 3IKJA 2JIZD 1Y3HA 4ENSA 1SEVA 4UVIA 4LHWA 1S89A 2JFOA 3N2YA 3NJRA 3G0GA 2AMYA 1Y5LA 2D1TA 2E89A 4I1OA 4CQMB 4CTJA 2J7KA 2YHUA 1NJFA 4J0KA 3UUFA 1GTMA 4DQVA 1AQNA 4GQIA 1HQKA 3ILVA 2YJGA 2FW7A 2OM2A 3SHVA 4JXKA 3AHHA 3AP1A 1JDVA 1GO2A 3D8UA 1Z7BA 4TRMA 2OV4A 5DZSA 2IS4A 5DSZA 4U2EA 1KFEB 1Z63A 4CI0B 4M9SA 3AMVA 2WF5A 3HSYA 1U63A 4JT4A 6REQA 4UREA 3UKDA 3NB0A 2A88A 4XYBA 4O6VA 3EDRA 4ZO9A 8ATCA 3OT1B 4CG0A 3I9JA 1JKJB 4V03A 3SF0A 3E9MA 5E3HA 1JBEA 4H6WA 4L5CA 1R74A 1GT91 3TIFA 4YB8A 2BOVA 3I6ZA 3LRXA 3F46A 4GAEA 3T4PA 1CVRA 2VDWA 3EA5A 3G3EA 1CU1A 1KJYA 1QGDA 3A11A 3CH5A 4NE9A 4GXRA 5EFZA 3T3PB 5JD6A 5LWHA 2IS6A 4JVMA 2G67A 2NAFA 3K2IA 3IUPA 4MKXA 3A9WA 2CLKB 4YV2A 1RQ2A 1KJZA 2CHGA 2DQZA 3BWYA 4GUDA 1OXMA 3H04A 5IKMA 3KVNA 1TAUA 2H31A 1NNSA 4MJXA 3K0BA 4E7PA 1FFEA 2F43B 4NCBA 1Q57A 5EZYA 1H0HA 2AF4C 2BF7A 3VO9A 4QXPA 3QUQA 2EIXA 1X1BA 1XB2A 5GWXA 2IKQA 1DIRA 3BHJA 1CUIA 4IRXA 3TB4A 1KQNA 4Y9SA 1DCTA 2JZCA 1TJ5A 1K3FA 3DDHA 4J49A 2G36A 1T9CA 3QENA 2R6GA 2JFQA 3RAPR 4HNHA 3ZV4A 1KEKA 3CLKA 5JADA 1FTYA 4R81A 4C06A 2WE7A 2GEFA 3C6QA 4Z4HA 2Q21A 1KVUA 2YOGA 2DJ5A 3A4YA 2YIDA 4FB5A 3LAWA 3L8GA 4K86A 2PH7A 3GFRA 4U39A 1T0UA 3ZIUA 4E5PA 3H87A 1BKDR 3A9TA 4ND5A 5JSFA 3MGAA 4ZOEA 1CNEA 1J4AA 1FQKA 2K5UA 3RS4A 3SY8A 1HNZB 1P2TA 5TRTA 1Z4JA 5F9HA 3ZS9A 3U3MA 1UR5A 2VA9A 4YRIA 5IVDA 3A1DA 2AOXA 3CX3A 3FPCA 4HNAB 4MW1A 2TSYB 3PPYA 2BKLA 4ZT6A 1BX3A 4C3VA 1KVQA 4F8YA 1XVTA 5CFLA 5JT1A 4U0JA 4ZOLA 3CZPA 2BCJQ 3X2SA 2HMSA 2J4DA 4NPCA 3IP3A 2XIJA 1IU9A 3MINB 1E3IA 4M1SA 2XF8A 2C0CA 2C7PA 1SUIA 2NUPA 4EYOA 2HIHA 2CVQA 2XVMA 3LGSA 4Y98A 5FO1A 3TUIC 3KWJA 1X0VA 3HKDB 3Q10A 4K03A 4PPYA 4DLXA 3UPTA 3E23A 2K87A 2ZUUA 3VNBA 4BO9A 5BSHA 1S2LA 3T9BA 5A5EA 1CFJA 1RM5A 2ZRFA 3C39A 3OPMA 4RC9A 2H9IA 1NG1A 2Q5FA 1T2EA 3BICA 3NH9A 5CJ2A 4OLBA 3DT9A 3LUJA 2FJ0A 4I0WB 4KYVA 1MX5A 4KH1A 3EZGA 4Y2TA 4F46A 2NO6A 1D3AA 4Y1EA 2Q5IA 1OB5A 1J42A 2XYVA 1UP7A 2XOXA 4RCZA 1E2MA 1E7WA 2A9JA 2I99A 2OHFA 1X80B 1NRXA 5FFFA 4BO2A 3HVRA 4BXOB 3U9SA 4L0DA 1QP8A 5EVCA 3I5AA 4BTEA 4COKA 1GAEO 1LY1A 3JWGA 4PYKA 4RAOA 1L7XA 3ZXIA 3IQDB 5KDLA 2HCJB 1W46A 3LUAA 4WHMA 4Y1RA 1EVIA 2IODA 4TTVA 5B3KA 3PGMA 5AKLA 2DU8A 4QNRA 3MRSA 2XMQA 3WZLA 5UKDA 2EZ4A 2B4QA 5EXXA 3TJMA 5FT9A 5J1TB 3ZK7A 3V4OA 1BWRA 3CLVA 2WIJA 3D1LA 4XR9A 1K2VN 3SZGA 3K09A 4WE3A 5SYNA 4EDHA 4UUOA 1XWWA 3DKIA 1NONA 4RETA 4IDFA 2HQSA 4RJLA 3GEPA 4BVHA 5ENVA 5I4CA 3DL0A 1T36B 4E14A 1HUQA 1Y7TA 4RPKA 3N6RA 4HFJA 1AUOA 2G7MC 4HEJA 2F1JA 4QJ5A 3OQMA 2NUAA 2LE0A 1J0BA 5KSZA 2X8JA 6REQB 3QQ5A 3ZX4A 2HJHA 3LPAA 3OX2A 4OXNA 2AQKA 4X6UA 3DVSX 4RTPA 4YI3A 4HH3C 4TTQA 4Y9TA 2XNDD 5EHIA 2O2YA 2WPDA 3VPHA 1SCNE 4O4JB 2X0JA 4W7SA 1G4AE 1HEYA 3LU1A 1MOPA 4D46A 2VDWB 1A8QA 2VQ3A 2YWRA 5CVUA 1UXKA 1T6YA 1HT0A 2QL5A 4Q9AA 5FOWA 2JCXA 3UFXA 4FFVA 2H4ZA 5CDYA 1QHFA 1DAOA 2Y4NA 2YRFA 4I1PA 4KV9A 3MG9A 4W9NC 4E08A 5FTMA 2QHXA 1L4YA 1DDIA 1RI3A 3ANSA 4OJYA 521PA 5EZYB 4KLCA 4OYRA 3V8MA 4FYPA 2QVBA 3VPAA 4KMMA 1RBQA 3IPLA 3WNVA 4AU1A 5BNTA 1VLHA 4G9EA 3LM8A 4MV7A 5DIFA 3TLKA 1VMAA 4FDAA 1ZXBA 4K26A 2GKOA 4PHHA 4EW3A 3IAUA 5LDDC 1Z47A 2E87A 1LQTA 1FXWA 1WXGA 3H2SA 4G65A 2QRLA 3HDJA 2OB2A 5F23A 4QLAA 3VOAA 3NKFA 1GNQA 2XH8A 3Q3HA 1VSUA 4XM1A 1A5TA 1LBTA 2GGSA 1GT6A 2QDKA 5KJ6A 5IM4A 1LK7A 3QBJA 3B1XA 4HQRA 3KV1A 5AK3A 1GCAA 2Y1OA 4RY8A 3TEJA 1RXVA 1SA0A 2OP0A 2WTXA 3K9HA 3SBOA 4Y67A 4RMGA 2PSHA 3W8DA 2BMWA 2WR8A 4D2IA 2WKQA 3OY2A 4LGMA 1J9EA 2QX4A 1KJIA 5AJTA 4HNAA 2AX3A 2W6PA 5FO0A 4EYKA 4HDSA 2KMLA 1JLMA 1UT6A 3AHFA 3DQPA 3UH1A 4Z4IA 2W2OA 4LI3X 4HNGA 1VHJA 3L7IA 4HQ6A 3OTIA 2X9QA 4D9JA 4FXOA 1EB9A 3N7TA 3RRXA 4EUNA 1FRVA 1M76A 4XQEA 3SJZA 3TXYA 1HK7A 4NSNA 2FMHA 4TVOA 3K70B 1VSTA 1UMKA 3LCUA 4RD4A 4RNDB 1J33A 4J94A 4HYTA 5F9MA 3KJFA 3F67A 4MLCA 4PC3A 5F78A 4C0JA 4WBNF 1UPCA 1Q1BA 1P75A 2WJ6A 1Z83A 5JS2A 4A8TA 2IEGA 5KNCH 3WX0A 2HK8A 4GLFA 1QH8A 5CLQA 5KTMA 3LBAA 3JAWA 4UFPA 2H00A 2OXIA 3A3PA 1CERA 2ZPTX 3FFTA 2ZP1A 3M5WA 4WEOA 5TF4A 3GLFE 3ACDA 5LQMA 1HFKA 3WDKA 2R6R1 4EUHA 2HBZA 3BXHA 2ZR0A 4JLSA 1D7OA 3CEJA 4P7FA 3IDAA 1N2EA 1GVNB 1HDYA 2GAOA 5DV9A 3T7KA 2B1QA 1PSWA 4BC0A 5CG2A 4BXOA 4KNYA 4UVGA 2P2YA 2W71A 4S1PA 4UDOA 3DD1A 1FFXB 1N0HA 1VBMA 1QGUB 2R7LA 3EOZA 3M5DA 1B26A 1FU4A 2O1SA 4YXFA 5IKPA 4NL4H 4QDKA 3EVNA 4Y1RB 1L5LA 3RR2A 5TS2A 5ISMA 1XVIA 1QYCA 2I4OA 4XFJA 2VT6A 1KAMA 2Q7DA 4XUDA 5EC8A 5EUMA 2PUFA 3DHWC 2XDQA 2IYPA 2HHCA 1L5NA 4FDTA 3CTPA 5CCDA 3J81A 3KX2A 4KB5A 5CLFA 2XVZA 4RM2A 2GFQA 2GETA 1ILWA 4TWZA 5HF6A 3WBBA 1BX0A 5GJBA 5I7EA 5CDUA 1VPLA 3KZMA 1Q12A 5AKHA 5C8XA 2AJ8A 2VHUA 3AEUA 2CLMB 4G26A 4BNLA 1SOWA 3FFWA 4NBUA 2BFFB 1KYIA 1Y4DE 2P40A 4NESA 3ZY3A 3MHTA 3SI7A 2PEYA 4QM7A 4AS3A 1XMXA 1RHMA 2OG2A 2NUAB 2P5UA 1XR3A 2GLTA 3H99A 1T2DA 3WKAA 2NOAA 2AMLA 2X8JB 2Y9MB 5CFNA 1U11A 3HU2A 3E7PA 4RV9A 2OILA 5F12A 2VYFA 4LNAA 4TT3D 1O5IA 1M2OB 2WAOA 5JAZA 2C7BA 4RH1A 5TIIA 2R6JA 5CT5A 4DUGD 1UBNA 3E8SA 3NRCA 4F6RA 1NMSA 2QUIA 4HATA 2VYCA 4UUNA 1C1DB 3D2CA 1GDHA 2Z09A 1RWQA 2JPDA 3PFHA 4IVNA 4Q3AA 1O08A 4JJ7A 4UULA 3T7SA 3UFXB 1L1RA 3LO8A 5A0TA 4BFWA 4MX8A 4LDZA 1PX2A 1TCCA 2JI7A 1HFJA 1CEEA 2ONCA 3OEED 3LLMA 3C1OA 3P9YA 3ZCVA 2GA8A 2DEUA 2P62A 4Y8VA 2W9XA 1ISSA 2X2OA 4XEUA 3PUHA 3O74A 5JO0A 4DLNA 5FL3A 4F38A 3M9XA 1B8PA 5EGNA 4GGOA 5GV7A 5FV4A 4ARIA 1F8UA 1ZG3A 3FWZA 1WW8A 3Q5GA 3VXKA 3PE3A 5C1OA 4W6ZA 3DAGA 1DC5A 4O63O 2JLWA 4PHCA 4RHFA 1YA8A 3EARA 4MVJH 2LDXA 4K81B 2C2GA 1XL1A 3TZKA 3E3MA 2ZT5A 4E5VA 3EXAA 4UQLA 1AN0A 2BJVA 3BH6A 1KRWA 2ZETA 2FW6A 4JUDX 3FLEA 5LZ5A 4OP3A 5HTKA 5BSTA 2VEDA 1JHOA 3D7SA 3I92A 2R79A 3NHZA 5K7SA 1M5UA 1UFKA 3Q2OA 2Q8PA 3CZ9A 5F2NA 3L0SA 1I36A 1SA0B 2O6LA 1NC1A 3C4JA 3DXFA 3GGSA 2R1VA 3IP8A 4KLRA 4E22A 4S24A 2WTUA 2CV2A 4KVZA 5IVIA 5CK5A 4UJ3A 3HNRA 1DQPA 1IOVA 2G9ZA 1UT5A 3F3SA 5GZ6A 4M36A 1P9RA 1S9HA 1TO1E 1F4LA 1GARA 3CJTA 4R98A 3UWPA 3W5AA 1CETA 1G8PA 2FWPA 2IK8A 2OD7A 1UZUA 1E60A 2Y68A 3L7MA 2DY0A 4JLWA 3GT7A 3ZJ5A 3QA3E 3U1BA 5CIQA 3FZEA 3AW8A 1OB2A 1P4GA 4TTSA 1K6IA 3AM4A 1C80A 2XGOA 2Q4OA 1I6WA 1K7CA 1JH8A 3K8QA 2BZSA 2IUUA 2V7WA 4DCOA 1GNRA 1QOPB 4DEXA 2BFAA 3D4IA 1NUPA 1ZI9A 1RR6A 4JY7A 4QBKA 2O7NA 3BJIC 3EB9A 4IW3B 1E66A 2PZ8A 4QXMA 3W9BA 4MS4A 2P3LA 4L4SA 2HRBA 5GIOE 5J1SB 2A9QA 1AUPA 3HCAA 2C2XA 1PD1A 3K1YA 2ZBRA 1NOJA 2HQOA 2YVLA 1RAHA 2IYTA 3E5NA 2X0DA 2Q3DA 4D8VA 2CMKA 2EFJA 4UM7A 2YXBA 2Y9PB 1G1MA 4H3SA 1KFKB 2C4VA 1WDTA 3C41J 2G25A 1QYIA 3HJNA 2ONKA 2CBGA 5DGXA 4IWXA 4FOLA 1SU4A 3FPJA 4X8OA 1FDSA 3V9AA 2CNNA 3ZVNA 4L9WA 5A3VA 1B6GA 3MNFA 1U4OA 2FW9A 3D6NB 3X0DA 1NM5C 4NS1A 1T9DA 4GSLA 3RVJA 3FWHA 3IIIA 3RYIB 1S4MA 3IAM6 1TM2A 2VP6A 4LRWA 5J2TF 3RYFB 3S0JA 4QC2A 1JXOA 2CYAA 2R751 1IBCA 3FLAA 3IKLA 4DM3A 4N48A 2NZWA 3EBOA 3WFIA 5ECDA 3VSCA 4ASUD 3U09A 3P52A 2V7BA 1NXPA 1OAOA 2XQKA 3O8OB 4KW7A 4BV3A 2J30A 3A9RA 3AEUB 2WWIA 5BUCA 3F6RA 1G5IA 4MCJA 1MXHA 5EZSA 1QO9A 1YB6A 3N0WA 4MR8B 2W4MA 5BSVA 3OSZA 3FN4A 1SUBA 3KVOA 3P71T 1RD4A 1FP6A 3L43A 4N5HX 3AH8A 1N32B 1M2OA 3LHSA 2FGKA 4UCFA 3K6SB 1YA6A 4L3OA 1FSGA 4PEVA 3ENVA 4ZAGA 4PWZA 3FZGA 2J5XA 3K2BA 4NJEB 4M0CA 5EY5B 5IP5A 3SZ3A 1NYTA 1M10A 3STWA 2G17A 2WVJA 3LG2A 5FTJA 3NYIA 5D3MB 2Q2QA 4K2AA 1LPSA 3E9DA 3SQXA 1Q3TA 2GAAA 3ZLTA 1XLWA 2K7ZA 1N2JA 4YAOA 3RKSA 4ZYZA 1EK5A 1G5RA 1G7SA 1LRJA 2HY7A 5F4BA 3ED5A 1BDHA 2ZSEA 3MUNA 2QJWA 3KG2A 4P31A 5LU9A 5E6SB 3R8XA 4JT9A 4QVKA 1E4EB 1N2CB 1QAQA 4KAJA 5I7AA 5KNBD 3OQIB 2CB0A 4YUYA 3OO0A 2BI4A 4DA6A 1M1YE 3QW4B 3PNVA 1VLLA 4JBXA 1SQGA 3MJEA 1QM5A 2XQJA 1XZMA 1Y89A 3BL8A 4GYWA 4CLOB 4HVLA 3DEZA 2H52A 3B36A 1G9XA 3G5TA 3A58B 2RBGA 4YLGA 1X7YB 2EKQA 1U5BA 2W8BB 4NZNA 1EG2A 1KO5A 2VH5R 4FW9A 1U5CA 3C74A 5FWYA 2G9UA 1N2IA 1PGQA 1SNYA 3ZU2A 3BMNA 4DSZA 4RFVA 4WN3A 1TEXA 1MN6A 1OZHA 2XUKA 4A3SA 3KPJA 4D4JA 3ZLJA 3P2KA 5IUJC 2M1XA 1THGA 1KS2A 1MVLA 2QW8A 3GGOA 1GNTA 3NOQA 3ANYB 2R1VB 1T9GS 1V8DA 1U3GA 2HIAA 3PQ7A 3QEOA 2O8CB 2ZXUA 1VG0B 4GUAA 3H3JA 2OHXA 2J5QA 1WLYA 2IT1A 4NR0A 1Q6ZA 2WG1A 1MAAA 4TV9F 3WK4A 3RF6A 1IXYA 3OURA 4EITA 2AMFA 3FWYA 1M1XB 1VE6A 1PHRA 5FEUA 3NIFB 1CY8A 1STOA 3T35A 2B4RO 1H5UA 2X2FA 2H2DA 3FOBA 2PY6A 3MGCA 3CHYA 1Q7BA 1JXMA 4FUQA 3CJQA 3AI3A 3NH6A 4HNSA 4MP8A 4XI9A 4BLUA 4EKYA 4JL8A 5I7VA 4HTFA 3G23A 3KHTA 4LJ4A 3RT9A 2LCFA 2VWPA 1X7ZA 4GX2A 5DBGA 1UOEA 2WPDD 3PIDA 4QBFA 1ZC3A 1TW2A 4MRPA 4MDFA 4FZJA 2YHBA 1IDN1 2A3NA 2DHEA 2VATA 4XA8A 3E0QA 1VYUA 2PGAA 1H3NA 2NG1A 2WLSA 1P7YA 3PC3A 2WB4A 1XPJA 4TMWA 3UPUA 4JYMA 3G8YA 1E58A 3TWOA 2JFNA 2VSOA 2BEJA 1G5QA 3NEJA 1J7JA 4DCUA 1GTSA 3AUFA 4IQ0A 4XQ0A 1TECE 1FVOA 1RE0A 4WZBA 1AUVA 1RZ3A 1AZWA 3K0CC 1FRZA 2ID4A 1UDCA 4OYYA 2ANCA 4DBLE 5AM2A 2CUKA 3AJEA 2H7CA 5HZMA 5K05A 4RGQA 1EX6A 3A7EA 3TGWA 3U80A 2O7RA 2JK1A 1ANKA 2A0YA 4ZCRA 2Z5LA 5JY1A 3GFOA 5FRDA 4M1WA 3VTAA 3KFVA 1UK7A 1WF6A 3GVIA 2C7OA 1Y8ZA 3NV9A 1W5TA 1VJ0A 3AB8A 1YZVA 2NZVG 2X8WA 4YJKA 3UKOA 4CMEC 4D9KA 4YUZA 4QJBA 2CKMA 4UARA 2Q3JA 3DKVA 1GA4A 2QP9X 1NBOA 3DMDA 3JATB 4FLFA 4IJUA 5A4KA 3HN6A 3SD7A 5K0TA 3KTAB 4DLTA 2EXXA 1J09A 4GH5A 4BNWA 3SZUA 1KE1A 1Y48E 5HPYB 1B8OA 5DM60 4X1YB 5KX5B 2XTZA 5ENZA 1YUNA 2Q1UA 4HPJB 1DAHA 2CK3A 4WZ6A 3SEQA 1T3SA 2OGTA 3JASB 3E53A 3FYTA 3G85A 3N5CA 2AYYA 3PXDA 4JX9A 3HP1A 4MR8A 4ZYWA 5CA1A 1V16B 1C9KA 2Z8YA 2C1XA 5T67A 3UT6A 5C5CA 1WSBA 1MTZA 2Y71A 3VR4D 4M4SA 3K6SA 1XA4A 5AMXA 3JAKB 2NN3C 3E84A 4PIPA 1YS4A 3FBGA 2C5AA 2YJTD 3GYGA 4I4NA 1Z8DA 4RH3A 1XQXA 3P4UA 4UM5A 3TLGA 1HNWB 4NYJR 2J9FB 3PEEA 1QQ6A 4S1OA 2G1UA 2P1ZA 5BOVA 2ZB8A 4NH0A 2DFKB 1PJAA 1UDRA 4NYIQ 1B00A 5EMKA 5EZ5A 3WGYA 3Q7QA 4M1TA 4B73A 3LF1A 2HMYB 1AN9A 2J3MA 3GUZA 1EDDA 4ZQGA 5AQ1A 2ZB7A 2MHCA 5HOEA 1JU3A 3EEOA 4C7XA 2NU8A 4HUQB 4AUEA 1D2GA 1YBMA 3SYTA 4PZCA 1II9A 1NJ6A 4L85A 3LD9A 4X61A 2CVOA 4WLFA 5CA0B 4YJFB 1RRVA 2DPGA 1ZBDA 3KUUA 5ALGA 3OQIA 4N8SA 4QOFA 3OM9A 4MR9B 3BGDA 4RVNA 1P62B 3VR6H 3ZVLA 2ACKA 4OMCA 4BFSA 4HMOA 5E1DA 4D4MA 4OK5A 3N8IA 3MQ2A 2ZJ0A 4ID9A 1C3JA 4P22A 2XAAA 4B3BA 1X7YA 3LWBA 5U9CA 1U5BB 2C5BA 1JALA 1E9FA 2W8BA 2YV2A 3EA4A 5FPPA 3ZR4B 5DNUA 4E7OA 2BZ1A 4XWYA 4HAXA 1II0A 2GBGA 1G16A 1Z6ZA 4MIOA 3VVBA 5A4MS 2X4DA 1X9HA 3G5MA 2ONZA 4X8HA 2RKBA 3T0FA 5ICSA 1M5TA 3BGSA 4ZVMA 4N0DA 1W0KD 4URYR 5JD5A 1KK0A 2JGIA 4RQBA 3TX6A 4OHYA 1WBDA 4PG6A 4UKDA 5F33A 5AVYA 5TVGA 3O1IC 4WAUA 2PH3A 5F7OA 3TVYA 2OY0A 4NAVA 3OOYA 1UC9A 2X8LA 5F5XA 2I80A 2QUAA 1PR0A 1U7PA 1XJ5A 3G9TA 4PLZA 1QIMA 4K5QA 2PH1A 1G3IA 1XTVA 3IMGA 1ORRA 4J7CA 3ZXSA 5JNRA 3CXUA 3Q41A 3I8OA 1YDWA 1FSSA 2R84A 3B6EA 4IDNA 5ALEA 5D51S 2UYYA 4BWVA 4JI4B 4ZALA 5HG0A 2O3QA 2Q5LA 3FFXA 3THOA 4BMYA 2C2OA 4BQFA 2OHOA 3COYA 2FVYA 3QJ5A 3AKZA 4BC1A 1DTSA 1XAGA 3DEIA 3M6UA 3PUXA 1Z0ZA 4POAA 4YRTA 1JBKA 2J9YB 4QA9A 4U4AA 3HB1A 4K88A 5AKEA 3VHLB 3LLUA 3QWBA 5LQAA 5M5BA 2OGWA 1Q17A 2PIDA 4FFWA 4BYMA 1KH2A 1T1IA 1WUIS 2ODPA 3OP1A 2ZUWA 3IQWA 5DBHX 4Q7MB 4TKMA 2SHKA 2H4JA 3EXG2 4W4TA 1JDTA 2X3FA 4LC9A 1YKGA 4G0YA 4FE7A 4JEMA 1K6JA 5J2UB 3DFIA 3KAQA 3VGPA 4CUKA 1IXSB 4D6XA 4LZAA 2B8WA 2H0QA 3U37A 5AW0A 5IU6A 1S3FA 3QELB 3LK7A 2J0SA 4EMUA 3GHYA 3QVGB 3X1JA 3EVCA 4E30A 3PLAE 4NWIA 2QPAA 5BNWA 1CDEA 1MRZA 1MX1A 1SUAA 4CFSA 3DL4A 5GONB 2V7PA 4ER0A 3U61B 3PVSA 2IL1A 1VMKA 3E6AA 1HM5A 3QITA 2YHAA 3C98A 3WDMA 4B82A 3I1IA 2WT8A 4PYLA 2GRAA 3C3EA 4INPA 1EEHA 3AIKA 3SOPA 2VJCA 4ZOAA 4LZOA 1G98A 4G0PA 2IYFA 2DKOA 4M46A 1QO7A 3KTAA 3WZMA 1I2CA 4MDYA 4WFJA 3WB0A 1P7ZA 1P0IA 4DPLA 2ICAA 2OSVA 5BVGA 4X1YA 5JSYA 5FUXA 4B4OA 5KX5A 3ADBA 4ZHQF 2Q1TA 1VPWA 2FQWA 2Y0CA 2YINC 4N47A 3ZW7A 1PJ4A 3GMTA 1GXSB 2IW3A 1P1HA 5T4BA 5KPDA 3C8HA 3EE6A 3H83A 2H2GA 4PC1A 1FU8A 3ZZ0A 2C99A 3B9RA 1PT6A 4MROA 4EGSA 4CXMA 3P0EA 3SSNA 5DFAA 2HK9A 2GILA 1E3QA 1CDOA 1FSFA 2OXCA 4QICA 5CJJA 4ZQIA 5KAPA 3QBTA 3ZZMA 4AJEA 3QFTA 4BFZA 2HL6A 3BBPA 3QYPA 5J4KA 3THWB 5C8VA 2OBLA 1RMQA 4KPUB 1BCSB 1E89A 2PKRA 2QM8A 1F9EA 3HXPA 5E9WA 3GC6A 4JS0A 4XJXA 3UC5A 1JDZA 3AOEA 4HSEA 2I55A 4UHJA 1RKUA 1EFTA 3CC8A 4A6DA 5IDQA 2IH5A 2MYUA 5K99A 4K46A 3KS9A 1GZ5A 3M6MD 1EH5A 2WWYA 2LNDA 1H4QA 2OBBA 4DVGA 2J0QA 2FFHA 3ZDYB 4AULA 3B3AA 3C3PA 2Y3IA 4HUQA 5DI3B 5C1PA 3M1LA 1TMOA 2ZTLA 1Q19A 4YJFA 3MBOA 4NIMA 1DZ3A 1P0QA 4BB9A 1ZM2A 4KFTA 2D7CA 4P54A 1A69A 1JSZA 4IOLA 4MGIR 1Y1LA 3IT3A 4BNNA 2PX8A 4GI7A 5JCOA 1Q74A 4XVRA 3X1YA 2DERA 2PMFA 4NAHA 2CNKA 4YASA 3WGLA 2D5AA 4B9AA 4L75A 1DXQA 2EFYA 4Y2YA 2Z3ZA 3GEHA 1IN1A 4WOBA 4ZJYA 4FFPA 2CZCA 4O4LA 2O48X 2NYRA 2QIOA 3L8CA 4HQLA 1G20A 2OCPA 2GPNA 3CZAA 1TOAA 1RAFA 5AH0A 1ZUD1 1I2DA 4PLHA 3VPDA 2G1AA 2IXTA 4LVCA 1Z0DA 3LPMA 4MV9A 5DX1A 3QHAA 3SNKA 5TGDA 4HT3B 2DM6A 4V0MA 3BS4A 3ZD7A 5A4DA 2QRGA 2WWWA 4F93B 4LY3A 4M53A 2Q6KA 1Q7EA 3MCVA 4XQ9A 1SUSA 1U8TA 5JH7F 1V6AA 2PKQO 2XWJI 3X1MA 4RHXA 2ID9A 1YVPA 4HEHA 1EQ2A 4BLVA 4FFOA 5J58A 1OH7A 3ZQJA 1DJNA 1KJNA 3OZAA 5KHOC 3RM3A 1JSLA 3T9EA 4UFNA 1N2GA 2V8BA 2Q5OA 3LUHA 3LOUA 1QQ7A 5KOHB 4ZMRA 5ITVA 1QIKA 5E4JA 1LDYA 2KBEA 3T5MA 2WMYA 3F6YA 4L16A 2XXJA 4ZTUB 5E0KB 3P4XA 5J4HA 1A4IA 1LVGA 3PA6A 1TK2A 4G97A 1V7ZA 5DYIA 1HDZA 4MUKA 4CMGA 3KOUA 4CMCA 3WLKX 3QQPA 4CCAA 1HZJA 3PKJA 3DLAA 2OECA 4X64B 3EXG1 3BWBA 3MMXA 5JROA 4F1KA 2BLNA 5KYUA 4DWVA 5J2UA 1DU4A 1RPNA 1GAQA 2REOA 4P3NA 3GELA 3ZWMA 4HMPA 2CDRA 1YTLA 2FPWA 2VL7A 3CEAA 3FTQA 4D3SA 4PGHA 3K70C 2WYOA 4UNIA 2GD0A 1MPXA 1CF9A 3PGVA 4HH0A 4YN3A 1NXWA 4IKOA 1TAQA 4UW9A 3MSCA 2A58A 4KSYA 4OA8A 3BQNB 1I3MA 1EAMA 2QR2A 2FFBA 3KKLA 3L82B 4KXWA 4MMZB 2CXQA 4UD6A 2WNSA 3OH8A 5LC1A 1YR3A 2BFCA 5EPUA 5JASA 1CUUA 4FTWA 1ADGA 3T4XA 3OTOB 2ZSDA 1J5XA 3DE0X 1EUCA 1QE5A 5TPWB 3UANA 1MG0A 1T8SA 5EFOA 1GGFA 1NVKA 3R0QA 5JMTA 2BELA 3I9NA 3ITEA 1YAJA 3OJOA 2V8OA 3DOCA 4ZI5A 1U9CA 1GAXA 3CRQA 4E5MA 2VP0A 3WGNA 4OHCA 3QVUA 3JV7A 4X7RA 2B5VA 4ZC8A 3HI4A 1IK6A 2G40A 3FNGA 2IV2X 1ZK0A 3A14A 1SXHA 4PPQA 4AJKA 5JMOA 2RG7A 5KC8A 3RGWS 4QRDA 3VR5D 3WYDA 3ZDAA 1H69A 2MINA 1PLLA 5MGBA 4QODA 3HL0A 3TI7A 3ROMA 5FORA 2F3RA 2D13A 3F5DA 4N5DA 5D3KA 2JI8A 1LPBB 3RUAA 4TX1A 1ZGAA 2JJ2A 2DT8A 2D0PB 3F2VA 3KSUA 3PUVA 1X77A 3V42A 1T5TA 3GJ6A 2BTQB 2PU7A 5DJ5A 2GDJA 3QKIA 1F20A 1TU3A 3L6OO 4MYTA 1IWPB 1PX0A 1Y0BA 3LT1A 3PI7A 1LPMA 2DCUA 2BT4A 2OE2A 3PXEA 4EARA 5IMBA 4OGLA 3TLEA 3WLHA 3JWJA 5C7YA 1NPTO 1WW2A 5DI3A 2DRIA 5KTNA 1M2HA 1ORHA 3A4NA 4D4IA 3IC5A 1MFPA 2C4UA 1GV1A 4QQ8A 3HR4A 4IS2A 4Z4GA 3H2HA 3KDPA 3Q8KA 1L5MA 1P2GA 2P2GA 5E8JA 3HUUA 4RMHA 4B6SA 2GEUA 2BKVA 3TTYA 4R0MA 4L0CA 1CYEA 4GXQA 3WA7A 2VQFB 3RS7A 1HOXA 2AQHA 2D62A 4E1AA 1NXXA 2D06A 1OMOA 3OE7D 3UK6A 2ETVA 1DKLA 1NBAA 1ZOLA 3GRVA 4K9OA 4O4LB 5ESDA 5FUQA 3LS2A 2XUJA 2I4LA 3KTOA 3UPDA 5IX8A 1UMDB 1ZNXA 4FHEA 2WAXA 3VR2D 2BPOA 1OH8A 2ERXA 2HEIA 4QHSA 3COSA 4G9GA 1I5RA 1MNAA 4I9NA 4KV7A 4MYCA 4BVAA 4Q39A 3HEAA 3OZFA 1TVMA 5LQNA 5HSGA 3RSOA 1QKJA 4XARA 5KNDD 5JZSA 1K7EB 2P8JA 2NPIA 2P0YA 3F8TA 5EJ2A 4AWBA 1SUCA 5IAGA 5C7IO 4URVR 1I4OA 1Y8AA 3CUEF 2FF7A 3PGLA 3W2GA 3NJ8A 5DT2A 3KEMA 1M8KA 3DE1X 4GPBA 1KDRA 1YRHA 1I9CA 4IXDA 5L6LB 1FUYB 1L7RA 1YRQA 1JFFA 3BJRA 1ZGGA 5CFPA 2A59A 2IDJA 3ETHA 2PH5A 1V1MA 4RDIA 5J5CA 2J4CA 4X84A 5G0VA 2JJQA 2Z4SA 1UM9B 1UQRA 1C1HA 3W04A 1Q50A 4CR7A 3KB8A 3AZPA 4BNDA 1CNFA 5AM3A 2E6KA 3ESQA 2DOKA 4KU4A 4MKHA 3JX9A 2B1IA 1OLSB 4CLHA 4DMRA 5CAEB 3ABIA 4EW2A 2CSXA 2AZXA 1JLLA 4OI1A 4B6PA 3U5TA 1U90A 1NT4A 4XE5A 1QRRA 3C3MA 1S3GA 1ZITA 4PGGA 5CM8B 2G82A 3UCEA 5ICEA 2GBLC 2XEDA 3LKDA 5G2OA 5TS3A 4DR3B 4D0NA 1PJSA 1X39A 4OUKX 1U8FO 1LDGA 1Z6QA 4NATA 4QSHA 5KSOA 2GXQA 2FMFA 2WIKA 3AUXA 4QWMA 4IIVA 3TPFA 4M98A 2IY7A 2BFCB 3LX8A 3DWFA 1TUIA 4L6AA 5SY9A 4KAXA 4DDMA 5AUNB 2V6FA 1RXEA 8ABPA 5JTTA 1Y3CE 5AOCA 4KPFC 4CDMA 2O19A 3FNQA 1AK9A 3DDWA 3FMGA 2YHIA 3Q8XB 1I0ZA 1X7XA 4LOLA 4RX1A 1XOIA 3GFBA 4CLRA 2L19A 5ICMA 1SBZA 2R6HA 2CVPA 4IZIA 3FI9A 1Z56C 4CTMA 4MUXA 1X1DA 3DH0A 4ECAA 1P45A 1VPTA 3DCJA 2X0FA 3ICCA 5KVAA 4UVEA 3D8TA 1P0FA 3KYCA 2IOHA 2BD0A 1G8JA 1M54A 6AT1A 3ZDEA 4MW9A 1EFDN 1PI3A 2MINB 2OHIA 3L18A 4I2NA 4IGIA 5BN1A 1ODJA 2