2BMEA

High resolution structure of gppnhp-bound human rab4a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
176
structure length
176
Chain Sequence
b'SETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED PROTEIN RAB4A
molecule tags Protein transport
source organism Homo sapiens
publication title High Resolution Crystal Structures of Human Rab4A in its Active and Inactive Conformations.
pubmed doi rcsb
total genus 62
structure length 176
sequence length 176
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2005-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bmeA01
4EPRA 2SHKA 4JL5A 1XJQA 4UJ3A 4NHOA 3LNCA 1W4AA 1ZCAA 3CF2A 3LXXA 2DBYA 2YWEA 2QEQA 4PQFA 3B7GA 3W6OA 2DFNA 4KFSA 1SHKA 3FB4A 4B47A 2AWNA 4OL0A 4TMXA 5JJIA 4B71A 2J0UA 1M74A 3D6TB 4MQBA 3W8RA 2G0NA 1E9RA 3NBXX 3NEYA 5FL7D 4U00A 3UWOA 2G1JA 1YZNA 3CW2A 4BLRA 4YXWD 3AP3A 4LI0A 4YMWA 3PQCA 4TLCA 3BS4A 1FQKA 4NZYA 2RGDA 3GLGB 3A8TA 2QTFA 3X1YA 3WXMA 3PEVA 4HB3A 3A6PC 3DEFA 4HDQB 4TSFD 4CYMA 4A2QA 2BV3A 1VTKA 3MSXA 2RAPA 1SQ5A 2PEZA 3CR8A 4CIDA 4DUGA 1S8FA 2C03A 4KLZA 1RE0A 4Q00A 2ZRDA 3QBTA 4M2LA 1D2MA 2GCOA 3EZFA 4Q18A 4PC3A 4BECA 4DT1B 4B76A 2Q9CA 5CDFA 3DVLA 4JVLA 1GDDA 1DOAA 2ZJOA 3W6PA 1KO8A 2EQBA 1J70A 2AWOA 3KXKA 4H1VA 2QAJA 4TSFA 1AN0A 1K5GA 1JECA 1E1QA 4ASUA 1YQTA 3AVQA 2WIBA 2R6GA 3B1XA 1SXJE 2ZE6A 2CVFA 3TRFA 2VP6A 3SJCA 2IYSA 4Q1CA 4Z54A 4B3GA 4UNPA 1S3SA 1Z5ZA 5SZKB 1QG4A 1T6NA 5AR1A 2GF0A 2ZJ5A 4IDQA 5AUPB 5JHHB 3ZIAD 2H92A 2FN4A 4FXPA 3C8UA 2JLZA 4EJSA 4DB2A 4OHVA 4IFBA 1XXHB 1ZNWA 4Z1MA 1TF2A 3QEOA 5FI1B 1QVAA 1PUIA 2VYFA 2IXGA 3EPLA 4C0AC 2GCPA 5DLQC 3KQNA 3L82B 5KSPA 2WJVA 4PAOA 1KJWA 2CLSA 4BEJA 3C5CA 4G3XA 1KDTA 1GVNB 4QBGB 1NN5A 3GJ5A 4MYUA 5AJWA 2REOA 2CK3A 2O52A 1GWNA 5LD2B 2WWIA 2JAQA 1LY1A 2D74A 3TKLA 1W4BA 3AKYA 4AYWA 4HAWA 3ZIAA 3GP8A 4G01B 3AVUA 3IGFA 3UMRA 4OHXA 3OIVA 1NVVQ 4C7OA 3I5YA 3IILA 1Q20A 1OFIA 2PT5A 721PA 1VYVA 5EXTA 3F8TA 2DFLA 4OJKA 3ZVLA 5FBRB 3EPHA 1NI3A 1AK2A 4OHYA 3PEUA 1GM5A 3BH7A 2HYDA 4TZ0A 1GILA 3MJHA 2F3TA 1VYUA 1JQLB 3K9HA 4WXPA 4PC1A 2GCNA 2RH5A 4BFSA 1QHIA 5KHOC 4KLNA 1L8QA 3NBZC 5JMTA 3VKHA 4Q48A 1IBRA 2IWHA 4K81B 5CJPA 1MOZA 1ESMA 4XD7A 1UBFA 4F93B 2J45A 2IS2A 5F98A 4DSNA 4TYPA 3IHWA 2KWIA 2IXFA 3G5UA 5EE5B 2WJIA 2VIIA 1XTJA 2JDIA 4RVCA 1N6RA 3HP1A 3FPAA 4Z8XA 4KBFA 3B1WA 4Q4HB 1ZD1A 1UPTA 3RS3A 5IHPA 1CU1A 3BB1A 3BD9A 3O8CA 2FPLA 2RGBA 1G8GA 2GWHA 4DKXA 1XTQA 5JRJA 4QGGA 5CLLA 1KYIA 2QT0A 2OBLA 4CW7A 3KKPA 1W49A 2OAP1 4GDFA 2IT1A 2F7SA 1XPUA 1G3MA 1YZLA 4A2WA 4AG6A 1M6NA 2H1LA 4B74A 4AURA 3THYB 3TAHA 4AI6A 1ZIPA 2VTKA 4LRWA 2HT1A 2O8CB 5LPNA 3EA0A 1MABA 4MGZR 1JEDA 1HQCA 1WDTA 1XEWY 5IF9A 1E9BA 2IW3A 1US8B 5AUQA 3LVQE 4JL6A 2J0VA 4KFTA 2ONJA 5FBWB 1IONA 1F2UA 1TF5A 1TU3A 1U99A 2FGKA 2ZS8A 3SYKA 4BUJA 4AKEA 2ZQ5A 4MYCA 4DEXA 4AY2A 2A5GA 1E79D 2Z4SA 3VU9A 1JJ7A 5TXGA 1OB5A 4OKSA 2NOAA 2R65A 1D2EA 1G6HA 2Z5FA 1S3GA 1NMXA 4YLGA 4JLKA 2VSXA 2PT7A 2J41A 4CEIB 1VMAA 3SNHA 3E5HA 1AJEA 4HB4A 3PUWA 2WWXA 3MWKA 4IXMA 421PA 1EESA 1TEVA 2RGXA 3A1TA 2ZIAA 4R9UC 3SEAA 1O87A 3T5GA 3N2IA 2HLDD 4FWTA 2IEYA 1KK0A 1GAJA 2DWOA 1U0HC 2GHIA 2GEDA 4NBSA 5EZ6B 4JYBA 1HH4A 5EE3A 1N5LA 1P72A 1DAIA 3IDQA 2A2ZA 4IOLA 2ZR9A 5L3RA 4JJKA 1IJFA 2EFDB 2WWFA 4PQYA 3U61B 2NTYC 3PIRA 2NZJA 2ORWA 4OYHA 5GADl 3HU1A 2F9MA 3EAQA 1XPOA 1QVRA 2JA1A 1ZM4A 2C9CA 2IYLD 4PC7A 2ZJ8A 3BC1A 3K8YA 3VR2A 1E69A 4Z8YA 2GAAA 4A6XA 3Q9LA 4M1KA 5KDLA 4MKIA 2OILA 1YZQA 1R7RA 4DCNA 1VG0B 1KI9A 1TMKA 4NMMA 1D8TA 2ANBA 2VSOA 3SBEA 4B35A 2ZROA 2FFHA 2HYIC 2W83A 1Z0JA 2FWRA 4Q01A 1A1VA 4L9WA 4JSTA 3IUYA 2FGJA 1VPLA 1MKYA 2CE7A 1Q1EA 4EJSB 1E32A 3PG5A 4CEIA 2MSEB 3GFPA 3QF4B 4ZPXA 1E2GA 4TMZA 1AS2A 2VP0A 4TQUS 4WAUA 1BYUA 1K8RA 4MRVA 1Q1ZA 1QBKC 2P3SA 5TVKA 1ZCBA 2JLSA 1DAEA 2BBWA 3RS2A 1GOTA 4UXIA 3QKUA 4DT1A 3U44B 4IDHA 5G3ZA 4LJ4A 4OQXA 1F2UB 2OV2A 4C0QC 3CONA 4C30A 4MA4A 1QHNA 2DPXA 4ZKDA 2UKDA 4BZPA 4RFVA 1Z6AA 1XCPA 1PV4A 2ERXA 4LYJA 3E70C 4D82A 3B82A 2W6JA 2O8DB 3NEJA 1UF9A 3EASA 4DRZA 1KSFX 1D5CA 1W1WA 5BWMA 2AD5A 1X3SA 4LSGA 1E2QA 3KJIA 1KI3A 3TIFA 3AUXA 1L2TA 4D25A 3QBVA 1WXQA 2J0UB 2ZJYA 3RABA 2PMDA 3ZVRA 4F7WA 2C04A 2WIAA 2HDNB 3BRWD 1WQ1R 4OI4A 5BN3A 1KK3A 5KSZA 1RRGA 5JJKA 2OE2A 1Z0DA 4A8JA 3H86A 2GNOA 1ZD9A 2FFQA 4Q03A 2F43A 1WBDA 1BKDR 2XSZA 4DIEA 3U3JA 1Q22A 1J99A 4CDGA 2QL6A 2QTVB 4NE2A 1DO0A 3VR5A 3MMPA 1FTSA 3JVUA 3X1XA 3Q7PA 5DYGA 5L3QB 2FG5A 2XNSA 4HLDA 5M04A 2IEZA 4L4UA 3DKPA 3VX3A 3ICEA 4GZMA 3HR8A 3IQWA 4KV9A 5J4LA 5BYKA 1E9SA 3B9PA 2EYUA 3Q85A 4XOIA 3U7HB 2QORA 2O0JA 2DR3A 4G0NA 4S2EA 3SE0A 4KCGA 5E7IA 4PFSA 1ZBDA 3EXAA 4MRNA 3R9IA 1VCMA 1JAIA 2C2HA 3PITA 2QM8A 3FHOA 3KXIA 4M1WA 3WP0A 2C9OA 4LC0A 3LD9A 1QHSA 4QJ4A 4DLRA 2IK8A 1PJRA 2FMXA 2X19A 4KJZA 3KUDA 3Q7QA 1TX4B 3PXGA 3GLHB 2ECKA 3IIKA 2NIPA 3PUYA 4HAYA 3RRMA 3W8NA 3RLFA 2ZI9A 3WMFA 1G17A 1TUIA 3SBDA 3CUEF 5C2JB 4ZCMA 4LYAA 1DAGA 3ADCA 2ONKA 1FPMA 1XRJA 2A9KA 1RRCA 2R9VA 4B75A 2QAGC 2P6NA 1SVLA 2BEJA 4BLOA 3WYGA 4C9BA 2MSDB 3N5CA 2FF7A 1U81A 4ERNA 1YR9A 2XXAB 1RVDA 4EFNA 4W5WA 3RHFA 3KQKA 3T34A 2PCJA 1SKYE 3UMSA 3OAAD 3SU8A 2G6BA 3L43A 2D7CA 4LJ8A 2ODNA 3R9XA 1W44A 4P0TA 5FH9A 2OSBA 4W5HA 1KDPA 1OSNA 4PHTA 3U6KA 2AFHE 2CVHA 3ADBA 2ZPTX 2PCLA 2QZ4A 2Q9BA 2VHCA 1SXJB 4XSHA 2NG1A 2ZRIA 3GPLA 4NDZA 4FIDA 2A5YB 3K09C 4D4KA 3TMKA 3ADDA 2AFIE 1WB9A 1KHTA 4HAZA 3LFUA 3DZDA 5CK4A 4ZIRB 2ZI5A 4A8JB 1PLLA 4PZZA 4B34A 3T15A 1R8QA 1OH8A 1G41A 1EX6A 4D2IA 2V9PA 3A58B 3AV0B 2AR7A 4GRAA 1ANKA 1TADA 3TVTA 4QNMA 4C2UA 2VP2A 2O8BB 2ERYA 2RGNC 5HZHA 2PZGA 1MR3F 2FX3A 1FP7A 2E9SA 4CVNA 3QKSA 1Z28A 3GJ6A 3NH6A 3TJZA 1CIPA 1T0HB 5AK0A 3K0CC 1ZM9A 3WHKA 3OESA 3RWOA 5CM8B 1NY6A 3UIEA 4NYJR 1P3JA 1Z2CA 5EE9A 3TBKA 2ZJBA 1EX7A 4B2LA 1H8HD 1G19A 1Z8FA 3EA5A 4AC9A 2ODBA 2IL1A 4PAQA 1Z29A 4JMPA 4RKEA 4EPXA 4L16A 2ZI6A 621PA 5ANRB 3UK6A 3SI7A 1NLZA 4MRSA 4JYCA 1J8YF 4P3YA 4O3MA 2ORIA 1JEEA 3QVVA 2QN6A 2IF2A 2WKPA 1KI7A 4PHFA 2XITA 1ZNZA 4Q9IA 1SVSA 1IOZA 2Q0HA 3HPRA 2QQ0A 3A4MA 2A7QA 1COWD 2NO1A 1FL9A 4M53A 4OQNA 3C7KA 4GP6A 1AS3A 1E96A 5JZVA 3PUZA 3QXSA 5KTYA 2EFHB 2W0SA 2YWGA 4YMTA 3QUSA 4TMTA 4A6PA 3SFZA 2C8VA 3BH6A 2P5SA 3CNOA 1JBKA 2JIZD 3UATA 2GTPA 3TGPA 1E3MA 1P75A 2CL6X 4HLUC 3EIHA 3IQXA 5CDFE 2ZRGA 4JLOA 4WZ6A 2XAUA 2Q3HA 5EXPA 4DCVA 1Q1BA 1EG7A 1YZTA 1Q21A 2CLDX 1FZQA 4QBFA 2C95A 2BWJA 1G20E 3Q3JB 4QM6A 4RKFA 3DDCA 1N2CE 1E4YA 1XTRA 4HUQA 4WVFA 2ZI3A 3KX2A 1XMIA 2GBLA 1GL7A 3GQBA 2WAYA 1ZNXA 3SQWA 2BKEA 1J2JA 4TT3D 4CF7A 2OEPA 3U7GA 3Q5EA 2IS4A 2A30A 1IY2A 4A0GA 4NTZA 1NN0A 1U98A 3DHWC 4B73A 5JS8A 2IA5A 2J7PD 4RD1A 2AX4A 2QT1A 2G1KA 3DM5A 4DLUA 3TQFA 4F4IA 1IXSB 5IK2A 4GMDA 1F2TA 2O0HA 3OEED 2QRZA 4PXAA 4LV6A 2LWIA 3FHCB 3JZAA 1XEWX 4OI0A 4I81A 2YOFA 2ZR0A 4NONA 4HATA 1L4YA 3T1QA 4Z1MD 3SDZA 4TTRA 4DUGD 3AF1A 3GJXC 1G5TA 2GJ8A 3AF3A 5L3QA 1GRNA 3CPJB 4ARZA 4YDSA 3KQHA 1R0XA 5JHGB 4QG7A 1OFTA 4NCKA 3SQXA 2VRWA 3MGCA 2D4HA 3L8ZA 1M7HA 2CMKA 1H8EA 1KK2A 3VU9B 2JEOA 5CLQA 1NVWQ 3K0FB 1KI4A 3I3SR 3K09A 4FD2A 4B6EA 1AZTA 5DN6A 2QMOA 5JCPA 4LJAA 5H1YA 2D2EA 3GEHA 3L2OB 4TTQA 1IN7A 3ZS8A 3KQUA 4EJSC 1CLUA 5SZJA 4Q4HA 3ZDQA 1Z6GA 1UKVY 2WZQA 2XJ4A 2RGGA 1G3QA 2DFKB 2GZHA 3U3OA 3IBGA 4HZUA 2B7CA 1MRNA 3D3QA 3LH5A 4N3NA 4ZI2A 4V02A 2B8WA 1PVOA 2W58A 3A1UA 5P21A 1E9AA 2A5JA 3VAAA 3BB3A 2F43B 4HB0A 4C0SA 5EXXA 1XFAA 4FMCB 2H7VA 4PSVA 3CWZA 4EFLA 2YKGA 4M8NE 3NWJA 2ZRNA 2ANCA 1N6LA 4PR0A 1R5NA 4HZIA 2Q3MA 1ZM3A 1SHZA 3MWLA 4MKHA 4HAUA 4RD0A 3H1TA 1QHHB 3OE7D 1SKQA 2PBRA 2C77A 2BBSA 2V1UA 4MKFA 4J0QA 3U3KA 4LYHA 3AF4A 2UVQA 3MWJA 2XOKD 1OXUA 1DE0A 2WSMA 3REGA 4LJ7A 4D4MA 2O8DA 3BOSA 2HLDA 2HCBA 4F4CA 4M1YA 1DG3A 5FUWA 3BFVA 5KSYA 5JJLA 4JBXA 2CL7X 3SZRA 3EC1A 3ZZTA 4Q66C 1E9DA 3WHLA 3D31A 4HAXA 1IY1A 2V1XA 3T5DA 3UKDA 1CJVC 2V4ZA 6Q21A 1MT0A 5HE9A 4MDEA 1YRBA 2OFXA 3A1VA 3U44A 4PZYA 1NN1A 2ZJ2A 4EQ6A 1OV4A 2B7BA 1KK1A 1G9XA 1E2HA 1XXHA 3CIOA 3I32A 3IEUA 1Z0AA 1VG9B 3FMPB 4ACAA 1KKLA 1XB2A 4M1MA 3PUXA 1R6BX 2ZUCA 4EDHA 5DN6D 1P9WA 2GAOA 3LX8A 4US0R 4ACBA 4W9MC 3U4QA 5FPYA 3VKWA 2RGNA 3GJ3A 2DY1A 4BE7B 2AN9A 3GLIE 4OQMA 4BLSA 1A2BA 2RHDA 8OHMA 5TV2A 4DLSA 4DLYA 2EWVA 2HUPA 3L0PA 4C0JA 1IXRC 1OHHA 2CLCX 4ZV4A 3K0AB 2V55B 1Q1QA 3NVAA 4B33A 4GT1A 2BJWA 5GJWC 2P5TB 1J8MF 2FZLA 2GVZC 4I1OA 2F6RA 1G16A 2J1LA 2ZRLA 4P4UA 1COWA 1XTIA 1E9FA 1NBMA 3FWYA 5DHAA 2R6CA 3CZPA 3A4LA 4PSKA 4DCSA 4IDOA 2BMEA 2J7PA 4IEIA 4TYQA 5CK5A 4NL4H 5FUXA 3WNCA 1U8AA 1BYIA 3QNUA 1HTWA 2HT6A 1XTKA 2R6DA 1LF0A 4HLCA 3IIMA 1R5OA 3BB4A 521PA 4LJ5A 3VQTA 5HPYB 1GNRA 3RC3A 1M7GA 5JFGA 2X2EA 3FHTA 2P6UA 1D9ZA 3U7EB 2ZREA 4LPSA 3W9YA 2P2LA 5SZIA 1SKYB 4KO8A 1T8UA 1CR0A 3FMIA 3H4MA 3VR1A 1S2MA 3PEWA 3M4YA 3VR6A 1X1SA 1JPNA 2ZRAA 1YR8A 3AF2A 3N2EA 4R7ZA 4LPKA 3AGQA 2CDNA 2ZJAA 3TVDA 3BERA 3EARA 5AWFC 1G7CA 2FSIA 2HCJB 3HYRA 3HYTA 4AYTA 1HE1C 3FGNA 4C4PA 4BEBA 3QE0A 2QE7A 3CLVA 2ZUDA 2F1HA 1W7AA 2X77A 2JJ2A 3KZ1E 1OXXK 2ZYWX 1JNYA 4KYUA 4LYFA 4EIWA 1OKKD 2FEMA 2D06A 3P4YA 1B23P 1VCIA 1R0YA 2NO0A 1UDWA 4MGYR 1FX0B 4XIGS 3WNDA 1SVOA 4ON9A 4TN1A 3I1FA 4E07A 1MO5A 2QSYA 2FH5B 3RRYA 4A0RA 5KPDA 3O8RA 1Z6YA 1NVVR 1RYFA 1E2MA 2O8EB 4WZBE 1C1YA 2CJWB 5FPTA 4UXHA 1W36C 2ZU6A 3AVVA 4Z51A 4ILEA 3CR7A 1E2DA 1CEEA 4KODA 5AJXA 3BWDD 1RRPA 2IYWA 5E3HA 2FSGA 3QEJA 4MH0R 3LA6A 4ITRC 1WCV1 3IO5A 1QG2A 2LKCA 2HXYA 2KB0A 5CITA 3FDIA 5KDDA 2EFCB 3VHXA 2C9YA 2B92A 5F2EA 5LB2A 1ZYUA 1BMFD 1W48A 3O47A 1WA5A 4B32A 2ZS9A 2JLRA 1NN3A 4HUQB 4MITA 4MKGA 4LBZA 2RCNA 1F60A 1BO6A 3FTQA 1IN5A 2JJ1D 2ZEJA 3EX7C 3REFA 2WMNB 3SOPA 1M2OB 2RMKA 3WY9A 2FPKA 3M6AA 5DI3A 4FCTA 1N6IA 3KL4A 1NP6A 4DDWA 3QPUA 3I61A 4JVMA 2O5VA 1ZMXA 2B6HA 3LVRE 2QPAA 4KSBA 4HI0E 2J46A 1UEIA 5K8IA 3U5ZB 2HF9A 1OH6A 4U02A 2OESA 5TARA 2BCGY 4N0EA 2XX3A 1BS1A 1CJMA 1OLOA 4IRUB 5HE8A 4E22A 2OLKA 5KSOA 4CGZA 3NG1A 1AIPA 1LNZA 3CRVA 2WJGA 3O8DA 4WA7A 2R2AA 2ZANA 1KO7A 4QBHA 3LBNA 1F3OA 3T1OA 4MGIR 2ZSAA 2GF9A 2QG6A 2OBNA 4L9SA 2NPFA 3X1ZA 4LX0A 4QOSA 3HJNA 1ODFA 4A2PA 1T3HA 2H18A 4HYYA 3LQQA 5DHFA 1IN8A 1VHLA 5C18A 5EP2A 4UNQA 1P2TA 1M34E 1GUAA 5F9HA 4XVQA 2VP5A 1KDRA 2WPDD 2Z0MA 4XVRA 1Z22A 1OFHA 4PHHA 2RGCA 2BMJA 2QP3A 2ZU0C 1ZM7A 3K0EA 3OIWA 5GJVC 4TYYA 1DARA 1EWRA 2FPMA 5FOWA 1NBMD 1KTVA 2NZ8A 1N6PA 1BH2A 5J47A 2QQEA 1AKYA 1KI2A 5FTMA 1IM2A 2ZRBA 2ZI7A 4W7SA 4RJLA 4LY6A 3OFNA 1LS1A 2GJKA 2V7QA 1M8PA 2O0KA 2H16A 1CF4A 5IK2D 1YZGA 1J90A 4TL6A 2MSCB 4B3FX 1BMFA 2BMFA 2P0EA 4DSTA 2GCOB 2Z4RA 1E99A 3Q5DA 3R8FA 1T4GA 1G3IA 2ZRPA 3EZ7A 4D6PA 2O8FA 1EFHA 3D8BA 3K53A 3LBHA 3LDAA 4IW3B 1UM8A 3F5FA 2YYZA 1KI6B 1TEXA 3QOFA 3MFYA 4O25A 1NL3A 1QF9A 5TB5A 4BFZA 1AS0A 1NLFA 1GSIA 2Q3FA 2QMEA 2F9LA 5FTNA 5FR2A 4BLPA 4IOJA 1TQ6A 5CB6A 4LJ9A 4RY2A 1F5NA 4B3DA 1C9KA 1KDOA 1X6VA 4Q7MB 5KNCA 3B60A 2YOGA 1TUEA 2PJRA 1RC8A 2JLQA 1NNEA 3CKLA 1NSFA 2XTNA 3MD0A 2Z83A 1S9HA 3ETLA 4B43A 3CM0A 3ND8A 4MRPA 4PPFA 4R2HA 4FCWA 4FN5A 2ZYUX 3LLMA 4QFMA 4DWJA 2FOLA 4C0LA 2C99A 4GP7A 5FR1A 3W5IA 1KAOA 4ZIRA 1U0JA 4BFUA 3LBIA 2JLVA 4WOPA 1R0ZA 1AA9A 2WKRA 2VEDA 1W2GA 4URVR 2ASEA 1SXJA 1HT2E 1P9RA 1IN6A 4EPWA 4OHWA 5G53C 4QJ5A 5JI3E 3NC1C 4F4JA 4QC2A 1KSJA 2WWGA 5FOUA 1AKEA 3C16C 1P9NA 4UNSA 1HA3A 5AJZA 1UFQA 3WP1B 3LWNA 3DPUA 1W5TA 1KMHA 3GLHA 2CCJA 4V0MA 4OJQA 1GRRA 4IDNA 2AK2A 1VCOA 3PUVA 2F1RA 3TUZC 2FDCA 1JJVA 4JL8A 2XZLA 1JAHA 3GLFB 2O8EA 3NC0C 4JVNA 1OJLA 4JLJA 1CR2A 3QQ5A 2WM9B 4JVSB 1E79A 1J7KA 4HB2A 3CH4B 3LY5A 3DOEA 3RSOA 5DNYB 3OAAA 3B85A 4NKRA 3LRPA 4B2IA 2IUUA 1ZC4A 3CWQA 3AGPA 3I4LA 4D81A 4O2LA 4LHYA 4FMDB 2OUKA 3KFVA 4N1AA 4V0OA 4A15A 3PENA 2FE4A 2N1BA 1EFCA 2BM0A 1T3SA 5E7JA 5GVSA 4CEHB 3A1SA 3V4RA 3PCRB 3G0HA 2BIFA 1Q57A 4Q4AB 4KXFB 1KZGB 1W0JA 1ZU5A 1JI0A 5JLJA 2D2FA 2ATXA 1K5DA 4A0FA 1UBCA 3B9QA 2YWHA 1XXHE 121PA 2G3YA 4TMWA 4LBWA 1XEXB 1NLYA 5F9FA 3AH8A 4E03A 2CK3D 1Y3AA 2CL0X 4YQFA 2EWWA 2HF8A 4Q4LA 4YDHB 2GXUA 2Q9AA 5D3QA 4DVGA 1N5KA 4ZI3A 1II9A 2GXAA 5G3YA 4LHXA 1Q44A 2ZVQX 2VH5R 3E1SA 4LWZA 5C46F 1JR3A 1JB1A 1TQ4A 3QG5A 2Y8EA 5EUMA 1ZUIA 4L8GA 2JLYA 4AD8A 4L15A 3QKRA 2PL3A 3EIQA 3NHBA 4PO1A 1A4RA 5JBQA 1DG1G 5B57C 3UG7A 1ZVQA 2ODWA 3B2EA 2QRNA 1TNDA 3Q72A 2ZRJA 1R10A 1GITA 3RYTC 1F48A 3AKEA 3OEHA 2IS1A 1KJZA 4QM7A 4CEJA 2QY9A 2N42A 3KXLA 221PA 2AXNA 2R8RA 3IKJA 5BXQC 4IFEA 2BVNA 2J7KA 1MV5A 4AG5A 5AUOB 2VF8A 4XTRA 2I1VB 4NYIQ 1Q12A 1DVRA 2IYQA 3B1ZA 4GI7A 2A5DA 3ZVNA 1EFRA 1Q3TA 2A3RA 2VHUA 2FFAA 4ZO4A 5KPJA 1II8A 1ZNYA 1E4VA 3NH9A 1L4UA 1U2RA 4XTCS 4Q9HA 4NU0A 4OI1A 4G5QA 1W2HA 2C98A 2J5XA 5K8LA 3AP1A 4WBSA 5DSZA 4B44A 2YZ2A 1VYTA 4IXNA 5H68A 3KTAB 1QZXA 2ZE5A 3ZYCA 1N0WA 2L0XA 4TL9A 3K0AA 4EQ6B 2YOHA 4G5SA 5EP3A 4XJXA 1T5LA 3H0KA 1QHGA 2KI5A 2JASA 3R20A 4PZLA 1U9IA 1OE0A 2GK7A 4HEJA 1NY5A 2W6IA 4II7A 5H70A 2P6RA 1A2KC 1E9CA 1KI1A 2PZEA 1ZW6A 4Q21A 4QL3A 5EP1A 1GRQA 3LO5A 1NJGA 3GCGA 4FW9A 3QG1A 4TTPA 1ZP6A 1UKEA 5KU1A 3CNNA 1AQUA 3KFXA 1E0JA 3KTAA 4JS0A 2J87A 2QPOA 4EFMA 3WYAA 4F92B 3DMDA 4P4TA 1NIPA 3G82C 5BN4A 2CNWA 2GESA 1OH7A 5EZ5A 4JSYA 1H8HA 1GG2A 1XBTA 1XD2A 1XD8A 1YZUA 4H1UA 4JKIA 1Z2AA 4PAMA 3TK1A 3IEVA 4D26A 2QTHA 2A78A 5FPKA 4XVUA 1T3LA 4A0HA 1YR7A 4XWAA 1FW6A 2W6JD 1HEIA 4LV8B 3THWA 4XSGA 1EWQA 1FX0A 1OT3A 2ORVA 2CHVA 3A36A 1EFUA 1G18A 4QHTA 4CT5A 2F1JA 2ODEA 1N0VC 4B3BA 1G8FA 1OXSC 1CXZA 2FJUA 1LVGA 1DADA 4MUBA 2ZXUA 2O8CA 4RFSB 2W00A 2VHTA 1WP9A 5DISB 3THYA 3GEIA 1VDZA 2OFOA 2ZRKA 3AVOA 3OFND 3I8XA 4I1VA 3B8HA 3WRXC 4YMVA 1RRFA 3T1VA 1G3UA 4BFTA 2V7QD 4JBWA 5BQ5A 2C96A 3TSZA 4DDVA 4KI0A 2J59A 1P7CA 1N0UA 2KBEA 2WVJA 3UMFA 1S4QA 4FMDF 4LJ6A 2FA9A 2OM2A 5B64A 1Z63A 2XEXA 4EUNA 4LZZA 1XX6A 2OT3B 3UWKA 1KGDA 3WMEA 3AQ4A 1Z08A 5EE1A 3LLUA 1KY2A 4QGAA 3ZQJA 4G5OA 1RPZA 2C5LA 4Q9LA 1MABB 2FZ4A 4RZUA 1OB2A 4RFSA 4LV5B 5K8TA 2YC2C 1U8ZA 4NYMQ 4A8JC 2REBA 2H8KA 3BIFA 3PV0A 1SVMA 4NPHA 2ZAOA 5FTJA 1UAAA 4BFXA 1ELOA 2ZETA 4BFVA 5LDDC 2Z43A 5H8WA 1ZINA 3THWB 2FNAA 4ESVA 1S9DA 1GNPA 1BOFA 4JLAA 3MRSA 4PO8A 5EP4A 3KQLA 1I4TD 3E2IA 2Q6TA 2KE5A 1XJCA 1OFUX 5L8VA 4AYXA 1XWIA 1U90A 1RJ9B 3OF5A 5DO9A 2R6FA 3TLXA 2ZS7A 1IY0A 2AHOA 3PVSA 1ZUHA 4LBVA 1OW3B 3BJIC 5K8UA 1I2DA 2H5EA 5J5CA 2GA8A 2IYVA 3KKQA 4DLZA 4GOJA 2IYUA 2VF7A 4LJYA 3VMFA 4C3ZA 2AD1A 1MO3A 1Z6TA 3GLHE 4XWKA 3I73A 2J3EA 5FL3A 5FOSA 1SZPA 2CHQA 2LKDA 1R0WA 3WBKA 3X1WA 4C0KA 4URXR 5KUTA 1OIXA 2WAXA 3P27A 3O8BA 1YVDA 4Q47A 4ZDKA 1H65A 3CRRA 3AB3A 5DGXA 3OHMA 1QDEA 2X8AA 5BW8A 1FFHA 2BHRA 2IYRA 3C4JA 3QPVA 1EK0A 1GNQA 3TW4A 4C7OB 3EWSA 4BZXA 4QXAA 2GZAA 3EZ2A 3NBFA 1OXVA 4G1UC 1I4LD 4NCIA 4TQ9A 1D6JA 2XGJA 2I1QA 4HAVA 2FEOA 2NO9A 5CIWA 2DYKA 4A4DA 3UXMA 2ZUBA 5DE3A 1HURA 2BCJQ 4RZ3A 4IDPA 4V03A 3GLGE 1KZ7B 5C4GB 1K6MA 3EW9A 5FPHA 2OG2A 1E2JA 4Q5IA 5UKDA 3ZLJA 1XU4A 2WWHA 3SYLA 2I4IA 5CYPA 2CCGA 2D62A 3NIBA 2ZYVX 3AEZA 2QM7A 1I2MA 4CEJB 1G1MA 1TAGA 2WOJA 2XNDA 1WE2A 3DL0A 1R5BA 4RD2A 2J9RA 5L3SB 4Q1AA 3P32A 3P4XA 3K1JA 3L0OA 1ETUA 5DIFA 5IDVA 3FFAA 4IOMA 4JLMA 2EW1A 5AJVB 2XTMA 2ZSEA 2QU8A 4LOAA 1IXZA 3KJEA 3CF0A 1US8A 4FMCF 5TDHA 2BMDA 1ZAKA 1LTQA 2BKUA 1X8KA 2AKYA 5A0FA 2E87A 4QGHA 2DHRA 4M21A 1E98A 4V0ME 2GKSA 4W5JA 5C1BA 4I99A 3AM1A 2QENA 1KI6A 2QUZA 3U7FB 1ZRHA 1TL7C 4MUAA 2REXB 3X2SA 4M0LA 5A5GA 1FP6A 4UKDA 2OXRA 4TLBA 4X8MA 3SN6A 2O8BA 1LF5A 5D3MA 4QJ3A 3FYHA 4KITB 5FTLA 1RZ3A 1M1YE 2IX3A 3M0EA 5E95A 3QXCA 4GFDA 4URWR 3I72A 3ONWA 1P61B 3CRQA 3CX8A 2Q21A 3K0FA 4BRWA 2G88A 1WRBA 1DAHA 3UPUA 4JLNA 1CRQA 1G5PA 5AJYA 3L8YA 3ZJYA 2J0QA 4NCJA 4ARZB 3IPXA 1DPFA 2RB4A 1G7RA 4HLQB 4C0BA 2CEAA 4P31A 2QPTA 1G64A 1JXMA 1XEXA 1MO6A 1Z6XA 1XMSA 2HV8A 2WBLC 3LQRA 5HCIA 3TQCA 3TSOA 3QXHA 2CNWD 2ZRCA 4Q7LA 5EE0A 4XWOA 2EFEB 2KBFA 2YNMA 4PTLA 4IOKA 3KJGA 1UEJA 1W4CA 3OIYA 3VKGA 2AKAB 3I5XA 1RKBA 3C14C 5FL7A 4CEHA 4RZXA 2CCKA 4Q1BA 3MWYW 4DZZA 1G291 2VHQA 1N6NA 2ZAMA 1W0KD 2G9NA 1LS6A 5TMPA 2NPIA 3U2QA 4YONB 1XNJA 3AVWA 3QY0A 3AVYA 2ZI4A 4Q1DA 5CIQA 1ESNA 2WOOA 1I4DD 1RIFA 5FOXA 1YZKA 3DZ8A 4TMVA 1N5IA 1JR3D 3K70C 2YV5A 5JS7A 1P2UA 3PFIA 2A5FA 1YU9A 1N5JA 1XCMA 4URZR 2ZTSA 5HKKD 1W5SA 3HDTA 1E2FA 1UDXA 2GZDA 4D0NA 2QNRA 2NO6A 5J4YA 3GLFA 4MGKR 1GTVA 2IYYA 4OBEA 1L7VC 1T9HA 2XXAA 3RS7A 1GL6A 3MUFA 4X8OA 4FWIB 2YVUA 4OK5A 4TMKA 3SC3A 1CP2A 2HJVA 3CH5A 4PSAA 3PJRA 4M1TA 4I4LA 2OBMA 4URYR 1SVKA 1KMHB 4PHGA 1N25A 2N46A 1JXOA 4R2IA 4DC9A 3ADKA 1Q3HA 1DEKA 3W6NA 4NYMR 1XP8A 3NDPA 4B3CA 3NDBB 4POAA 3AVXA 3CB4A 4Q4JA 1YJ5A 1E0KA 4Q7JB 5FUYA 3ZZ0A 4JT4A 1D2NA 3GFTA 4N0DA 1MRSA 4RD6A 4E5UA 4R71A 3ZH9B 4PQRA 5FOTA 3WBJA 3C5HA 2ZM5A 1A5TA 1NF3A 3TUIC 2QMHA 1P62B 5TY0A 3L0SA 5FBQB 2JDID 5KO2A 4C2TA 1AGRA 5LB4A 3HU2A 4DXAA 1DAKA 5E4FA 3PR1A 2NQ2C 3ECCA 4KSCA 4P33A 4BZQA 4QHSA 2BJVA 3KKMA 1NIJA 5FPSA 3FKSD 1DTSA 2QAGB 2CE2X 4Q1EA 4JJZA 5G40A 1T8TA 2K5UA 2EYQA 4JIMA 2IUSA 5BYJA 3KB1A 4DCUA 3PEYA 2WV9A 5JWRA 2JLXA 1W36D 1XD9A 5JSZA 4TLAA 2EFGA 3S1AB 3RRNA 3K70D 3R8CA 821PA 3VHLB 2R6AA 1G4UR 3RANA 1NKTA 2NO7A 1P60A 4X8LA 2VHJA 1Z07A 4GZLA 4IVRA 2JJ8A 2IYZA 4Q19A 4TL8A 4PPNA 3IBYA 2QI9C 1NMYA 4U5XA 3THXB 5FBLB 5JCZA 1IJEA 1G6OA 1XTSA 2ZSDA 3QXXA 1NKSA 3AKDA 2IHYA 3AVPA 4F38A 3OEHD 1OYWA 1X1RA 1ZIOA 4I1UA 5GJBA 5JWOA 4Q4AA 1TTTA 1Z0IA 5JECA 3D7MA 4GPTA 3VFDA 5IT5A 2CXXA 4ZCIA 1NBME 4Q1FA 5G41A 1AQYA 2BBOA 2HXSA 2AK3A 2D3WA 4PPQA 5A4JA 1M7BA 3DOFA 4UNRA 3FKQA 5DI9A 3SYNA 1E1RA 1XZQA 4PX9A 1GZSA 4UQOA 2IXEA 3THOA 3UANA 2XB4A 3CPEA 5JEEA 2OO7A 1UJ2A 3VR3A 4Q9KA 1GKYA 2WJYA 5E7MA 4OK3A 4E09A 1Q0UA 3GLFE 2H57A 1G7SA 1DBSA 1OIWA 2JCSA 4TZ6A 2HJGA 3I8SA 1P73A 4LUCA 4X8HA 4ZKEA 1E94E 4RSGA 3UG6A 1VG8A 2QSZA 2WSSA 3B13B 4AK9A 1DS6A 3ASYA 2UZIR 1UBGA 2R62A 5EQTA 4GOXA 4M1OA 1NMZA 3IPYA 3QF7A 2YJTD 5L3VA 2DWQA 1S1CA 1VIYA 4M4SA 4EPTA 4Q4JB 3GJ7A 1R4AA 3ND9A 3DMNA 2GXQA 3LV8A 1S96A 3SS8A 1CKEA 1HE8B 2JJ2D 3CNLA 3FFBA 2B8TA 1IAQA 3JVVA 3W3ZB 5KOYA 2EVWX 2W2VA 3ZQ6A 1T91A 4GNKA 1W4RA 3LW7A 4HDCA 4JLVA 4LC1A 3U3MA 1Z06A 2YHSA 3BFXA 2CHGA 5DI3B 2JGNA 3TW8B 1GIAA 2GJSA 5IRCD 4WIAA 1U0LA 5EUQB 3WMGA 1DAFA 5HKKA 3EWAA 2DB3A 2XSZD 1JPJA 4LCBA 2GJAA 1E0SA 2HEIA 4OQFA 2DWPA 4P4SA 2KSQA 1YE8A 1KO4A 3BK7A 4HUTA 1OYYA 3TE6A 3H84A 5KNBA 1A82A 1KO1A 3LAWA 4D0LB 4UNNA 1R2QA 4K46A 1P2SA 4XH9B 5FFMA 3CBQA 3X1DA 4TYNA 2OXCA 5LBIA 1N3BA 4GSYA 1P2VA 2NMVA 2YINC 2ZRFA 1FTNA 3RDPA 1CJKC 4PANA 3AKCA 3DM9B 5F3WB 3RAPR 4DBLC 2GVDC 1PUJA 1FNMA 2VA8A 4BFWA 4G5RA 4KBGA 1WBBA 1NG1A 4P32A 2FFBA 1KJYA 3CO5A 2QROA 4BASA 4BQSA 4IHQA 1E2KA 2X1VA 3F0TA 1RFLA 4QGFA 3SR0A 5BN5A 2ZJZA 2O8FB 3FMFA 1NG9A 4GOKA 3N70A 3CZQA 1P5ZB 2WHXA 2WSSD 5D3MB 4B2PA 1AGPA 1R8SA 3GD7A 3TAUA 4DSOA 4IKEA 4MYHA 3RSLA 1CRPA 3B78A 4FCVA 3FE2A 2IUTA 2WICA 5J4KA 2TMKA 1OPXA 2F1IA 3FKSA 4YXWA 3LXRA 2ZRMA 4DLTA 4IVQA 4V0NA 1UBEA 4LK2A 2R44A 4TT3A 1EXMA 3QJYA 4JKYA 1CTQA 1CJUC 1GKIA 4JLDA 3HR7A 3NTUA 4BPBA 2IS6A 3BFKA 3V4FA 4DLVA 2RGEA 2IBMA 3B5JA 1G8HA 3M1IA 2W6ID 4GMXA 2GEVA 4RCYA 4DHEA 2PX3A 4CRWB 2PLRA 3R7WB 3JZMA 4A9AA 4A92A 3B1YA 3CRW1 4OI2A 4QNRA 5FBVB 3K9GA 3NBYC 1W0KA 4OHZA 4AKIA 3KB2A 3TH5A 4L5BA 2BDTA 4A82A 4RD3A 4DSUA 4O0MA 3GJ0A 4UXJA 3ZZUA 4ESHA 1YKSA 1LB1B 1V43A 5KDOA 5B58C 1NSTA 2VL7A 2W0MA 1RYHA 2GBLC 4GBMA 4P4SB 2GRJA 1XD2B 2P67A 4MRRA 4PC2A 3LX5A 5L3SA 1DO2A 1EFRD 1NVXQ 1KMQA 1XZPA 2IF0A 1SXJD 3GMTA 4US2R 1HV8A 1OXTA 5DH9A 2ZE7A 5CM9C 2PH1A 2XTZA 3ICQB 1FNNA 4KVGA 3I92A 1II8B 2V3CC 3AP2A 1WF3A 4A1FA 2GK6A 4A36A 1VG1A 5HZKA 1CBUA 1JALA 1KY3A 4KVAA 2JLWA 4QHYA 4NYJQ 4DIDA 2IYTA 3EZ6A 4FINA 4Y0AA 2YWFA 2GDJA 1XF9A 1WMSA 2OCAA 1PLJA 1G8PA 2PMKA 3U4QB 2MMGA 2OFWA 1SGWA 4JLPA 3W90A 1AZSC 1TQ2A 3CF6R 3IO3A 3MAAC 2GETA 1XPRA 2OCBA 3RRZA 3IHLA 3K70B 3T35A 3QSYA 4RD4A 3ZS9A 4YMUA 1G7TA 1GP2A 3NXSA 4IVPA 5DYIA 1S0UA 2B21A 3H2YA 3OE7A 4EPYA 1XMVA 4CZ2A 2OLJA 1P6XA 3FVQA 3BE4A 5FUVA 1BIFA 1T0JB 1OH5A 1W47A 1E6CA 4KHZA 1E2PA 4V0LA 1SVIA 2QE7D 3OEEA 2PJZA 4RCZA 3KKNA 3SJBA 3V9PA 3U60B 4TYWA 4BRUA 2GJ9A 4DDUA 2G77B 4K8OA 3HU3A 3R7WA 2VLIA 4NP6A 2ZR7A 4ZDJA 3K9NA 2FV8A 2WMOB 3OIUA 3BH0A 3GJ4A 3NHAA 1RJ9A 4WW0A 2IWRA 3TSWA 4XD7D 1DAMA 1KSGA 2V8OA 1KIMA 1YR6A 2XB2A 1N6OA 1FMLA 1VCNA 1W36B 4TLEA 1ZUNB 5JRZA 1A7JA 1LV7A 2JLUA 1IQPA 3RC8A 4FI3C 3AVTA 1CJTC 4WZAE 1IN4A 1E2EA 1E2LA 2F3RA 1GFIA 2ZE8A 3T1TA 3GLIA 1Z47A 2VSFA 1SXJC 4MYTA 4UJ5A 1ZM2A 3S1AA 3GLGA 1ZC3A 5LD2C 2XJ9A 4B6FA 2VP4A 4LGMA 3QKSB 2IC5A 1XCGB 1KO5A 4HDOB 3QI2A 4KAXA 3QPWA 3EIEA 1UKZA 1AM4D 1E2IA 3EPJA 1B0UA 3BXZA 3VTKA 3MLEA 4BFYA 4DCTA 1UKYA 4HLUA 2ZRHA 4G5GA 1HY3A 5J4HA 4LDJA 4ABYA 2I3BA 4OQLA 5CYOA 2GEUA 5GJCA 3EC2A 2QMUA 2E1RA 1HYQA 3CRMA 4S35A 2GXSA 3SHFA 3WRYC 1IHUA 3RS5A 2IYXA 3NKVA 4DJTA 2QBYB 1Z83A 1OF1A 4ZCLA 1YHNA 2PLFA 3FMOB 2CBZA 3KDSE 2JJ1A 1HT1E 2PEYA 2FSHA 2PZFA 4IEEA 2D7DA 4RZ2A 5KYKA 3W34A 4JT2A 4DLXA 1ZJ6A 3QKTA 4PC6A 2BBTA 3ASZA 1FOEB 4AIIA 2XZOA 2Z6VA 2G0TA 3BAFA 3F3YA 4QKQA 3A4NA 3KJHA 2KJQA 1P4SA 3C15C 1T5IA 5SZHB 3RS4A 2W2XA 4D0GA 2F55A 3QENA 5FI0B 1LFDB 5ELXA 4B3XA 1Z0FA 1O3YA 1SULA 3SFVA 4ZDIA 1QHXA 4CT4B 1HQYE 5FOVA 1MO4A 4KYIB 3TUJC 4TLDA 3ZVMA 5HTKA 1V5WA 2QGZA 2WKQA 3Q8XB 1CR1A 2OZEA 1E1RD 5AUNB 2RGAA 2RKOA 4MDFA 4D4LA 3VX4A 4WXRA 4EPVA 4KU4A 2WJHA 5CJ2A 1FUUA 1YRAA 4TQAA 4QRHA 5CB8A 3U6BA 2PX0A 2V54A 2OHFA 5FTKA 4LHVA 3MJRA 5JWHA 1F6BA 3SJAA 4BWYA 4PPGA 3HWSA 3K0CA 3EPKA 1C4OA 1OKKA 4Q9JA 4EAQA 4OK6A 1W0JD 3BGWA 1ZD8A 1PLKA 1Y63A 5HR5A 4LBYA 4YC7A 4M1SA 1G3RA 3R9WA 4URUR 2BOVA 4HSEA 3IIJA 2XNDD 2X2FA 1KSHA 1G21E 1QHHA 4ZDWA 2J0SA 1S1MA 1NRJB 4JLBA 4DLWA 4BLQA 1NVUQ 2ZYTX 1QHYA 4Q7KA 1VKJA 4TL7A 3T12A 1GL9B 1NJFA 2MMCA 4M22A 2RHMA 2LCFA 2QGNA 2VBCA 1D9XA 4PO9A 1E0AA 1G8YA 4C0HA 1EFTA 3P26A 2ZSFA 1TPZA 4US1R 3L0IB 4HZUB 2VP9A 1RW4A 3V00A 4KFUA 1G4AE 4YMSA 1VHTA 2BEKA 4NH0A 4DEYA 2OCPA 1ONBA 3QKRB 3AUYA 1JR3E 2ZITA 1XDBA 1KNQA 2V6IA 1XEFA 3J81k 3GFOA 3THXA 2AXPA 1X8LA 1ZU4A 1FUKA 4F91B 3EZ9A 3T06B 2FU5C 2G83A 2BM1A 2P65A 1KI8A 3QIAA 2OAQ1 4JZKA 4DB4A 3CPHA 5GVRA 2NGRA 3K9LA 2YC4C 4KFRA 1TQDA 5JSZB 1KNXA 1U9IC 1OHHD 2OCYC 5JEDA 3TR5A 1CR4A 1G5RA 1Z0KA 3A1WA 4NYIR 2XOKA 1E9EA 1KAGA 3K0SA 1H8ED 2JATA 2XZPA 1VIAA 2QAGA 2IHBA 4H9GA 3AF0A 1FMJA 4AWXA 2FSFA 3W3AA 5EJEA 1JQJC 2DCUA 5KNDA 1JR6A 3A37A 2GILA 1N6HA 2C78A 2ATVA 4B48A 1QRAA 2QP9X 2VQSA 1KOFA 3TNFA 3W5JA 1XJ0A 4BGDA 4EKDA 3GJ8A 1TU4A 3WYFA 5B30A 1F2TB 1II0A 1N6KA 3KUCA 4BLTA 4GL2A 3QF4A 3B6EA 3P20A 3TR0A 3RS0A 3CX6A 4AKGA 2WJJA 4Q02A 3QVUA 1CULC 4M9SA 2AL7A 1EGAA 4FMBB 5C4MA 1W46A 2WTUA 2WPDA 1LW7A 3ZD6A 3RWMB 3GEEA 1FQJA 4IJMA 2V6JA 3I62A 3VR4A 4D80A 3VNUA 1OIVA 2WWWA 1SVWA 3SHWA 3MG9A 1KKMA 4V0KA 4NCNA 2W2TA 4Y0VA 3C41J 3WNBA 1TF7A 2WWYA 1U8YA 2ZSBA 3CX7A 3BBPA 3EG5A 4I1SA 4R98A 1MH1A 2ZVPX 4DDTA 4LHWA 5B2ZA 2QP4A 2JIZA 4NCHA 5JI2E 2CJWA 3SJZA 3MCAA 4M9QA 3B1VA 3OZXA 3T61A 3FOZA 1CS4C 1XMJA 3LW8A 1E1QD 4LHZA 4O2RA 4QBIA 1U94A 4ASUD 3DKVA 4U7DA 1VECA 2QBYA 2VO1A 3HPQA 5EXSA 2UZ3A 2DFTA 3VNVA 1E2NA 1Z3IX 1GKUB 5J40A 3ZD7A 1PZNA 5HCNA 3DO6A 2VPPA 3U3RA 5J4VA 3KKOA 3RVBA 4D4JA 1X8JA 4M9XA 3RNLA 4JBYA 1DELA 4M9ZA 4AKHA 2QA5A 4TWZA 3QXJA 2H17A 2EU8A 3BORA 1X86B 1UADA 2BC9A 1HUQA 3P1JA 3GLIB 3ZGXA
chains in the Genus database with same CATH superfamily
1J9ZA 2QU7A 1XJQA 2CNLA 2DM6A 1EZ4A 3LNCA 4IS3A 2JLCA 4NHOA 4ARVA 3UMMA 4L5AA 3D4BA 1UKCA 3GFQA 4PQFA 2HRZA 4OB6A 2V74B 4JGBA 1SHKA 3GY0A 4WTOA 4OL0A 5GONB 5JQGF 1AXGA 1T2CA 2J0UA 1HKHA 2PPVA 2ZW9A 1PSWA 3D6TB 4MQBA 3RT1A 3W8RA 1PWHA 5IABA 4HD8A 2PU5A 4U00A 1ZOSA 3DONA 3UWOA 5E6RA 3HMQA 1HGXA 1VJ5A 2BY4A 3MWEB 5K45A 4DNOA 4LI0A 2EX4A 1BX0A 4ENPA 4ZTUB 1WXWA 3G7SA 3ZWDA 4MQ6A 1PFQA 1Y8AA 4JEIA 3PEVA 2HHCA 2ZB7A 1R3DA 3S3TA 5HX7A 2BV3A 3REQB 3MSXA 5CH3A 2LR0A 4J0FA 3VDMA 1SQ5A 3M6FA 1N3IA 1RM4A 4PBSA 3P9SA 3I5UA 3CR8A 3CZAA 3OJCA 4O4IF 4FHCA 1N0IA 4RK6A 4A0QA 4CWAA 4M37A 5IZCA 3EEBA 3ZU3A 1YOVA 2NNLD 1JLKA 3UV6A 1M0EA 4PC3A 3QYFA 5EJ9A 3F5QA 3NOVA 2WD7B 5LQKA 2NUTB 2YZKA 4LDPA 5CDFA 1TQHA 3SQMA 3IBTA 4JVLA 4NK5A 1HDCA 5ALOA 4IM7A 2DRIA 1DOAA 2ZJOA 3VYVA 3W6PA 3MINB 2HM7A 2XYVA 1F0NA 1U0SY 2QAJA 3T7DA 1CUCA 1OU0A 5A4IS 1P2GA 3AB8A 3AL3A 1O8CA 1F9AA 1BDBA 5E1MA 5FWXB 3TRFA 2VP6A 1HYBA 4LDRA 2IYSA 4Q1CA 3HDHA 1IHOA 2L18A 4UZFA 5BV7A 4B3GA 2HW8A 1Z25A 3GFSA 5BSGA 5LZ2A 2XQFA 4WOJA 4X85A 2J8ZA 2WR8A 2DETA 3MJTA 1QCCA 1X74A 1EQUA 4BEVA 5JYEA 2GF0A 2D6FA 3WWZA 2H92A 3VSCA 3ZWKA 2QN9A 3E18A 3OZCA 2FN4A 5AKYA 5IDXA 3S2UA 2JLZA 4EJSA 1Q19A 3GLTA 4B1FA 1QIDA 1JFLA 1U04A 2AZTA 2PLWA 3G3EA 1XXHB 3MPOA 4QOEA 4RESA 4LIPD 3QE9Y 2R25B 3U4AA 3VTZA 1TF2A 2ZDHA 1O08A 3HZRA 1P0CA 3KCQA 1QVAA 3BRWA 2IXGA 1KA9H 1LWNA 5AW5A 3EPLA 1JKFA 3Q8LA 1NGSA 2GCPA 1JHOA 5ICFA 3L82B 3NWOA 5KSPA 2WJVA 5MHTA 5FAXA 1KDTA 2IPXA 3GJ5A 3KTFA 2F64A 4FZJA 3V55A 3VH2A 2I7VA 3IJ5A 1GWNA 2FPPB 2WWIA 1LY1A 5LZ8A 3VPHA 4LRSB 3AKZA 2AFHB 1W4BA 5K0BA 3VHRA 2H4XA 3AKYA 4XD2A 3P96A 4F04A 3F2IA 1S8AA 5LQMA 4R01A 3QE2A 4Y6GB 3OOJA 2O23A 2C2OA 3D7RA 4KWEA 2JD1A 2PV0A 2LNDA 3IILA 4YRCA 1MORA 5BUZA 4FB4A 3V1KA 2Q5EA 721PA 1OWMA 1HKUA 4YT5A 1P81A 5EXTA 4B3HA 1KIAA 2BDEA 3KDPA 4FDVA 4E3ZA 3R0ZA 4OJKA 1PGNA 3BZWA 3C3KA 5FBRB 1JHRA 3RF7A 2VATA 3K1AB 4TTVA 5J2UB 3BMOA 3ZNPA 2JFBA 4O2AB 2PKQP 4TZ0A 3GQVA 5EJIA 4U3JB 2QXUA 1LSUA 1QSGA 3W5SA 5HKAA 2BGGA 1NNI1 2I22A 4BFSA 4F1JA 1QHIA 5CUQA 2OOKA 4EJMA 3R5FA 1L8QA 3F6SA 5DFAA 5JCJA 5KHOC 2PS0A 4Q48A 1MIOA 3QU4A 1G8JA 3VH3A 4K81B 1MOZA 1WXXA 4XD7A 2YWBA 2C4VA 4G5FA 1W8IA 1HLGA 4P93A 4TYPA 3KQYA 4UAVA 4WMLA 3V3KA 4DSNA 3G5UA 4Y2YA 5C5EA 2I3GA 2V4MA 4EELA 1DAOA 1N57A 2VPTA 4U0KA 5DNUA 1N6RA 4RF3A 1Z2NX 4NFYA 4KXXA 1KU6A 1ZUWA 3BWVA 3SHQA 3OF2A 4KBFA 3B1WA 2ZATA 2N0SA 4AZ3A 4ZAZA 5IHPA 2XQJA 2OY0A 4G63A 3BD9A 3BDVA 4IMRA 2FPLA 3O8CA 2JAUA 1G8GA 2GWHA 5LLTA 4KQFA 5CCDA 3MJEA 5BXYA 3QX7A 2ZP1A 2HEGA 3CCCA 3GCXA 2SCUB 1G3MA 1WXGA 2AUMA 3HTXA 1JDJA 4RE5A 3ABRB 2AYXA 3YASA 4B74A 1I1OA 1UBMS 1UANA 3TAHA 3OTHA 3EIXA 2O8CB 4HRVA 4EHNA 4MGZR 3ZNQA 3GXOA 3OZBA 2I65A 1HQCA 3UJPA 1XU9A 1Y9DA 3F47A 1DKOA 5IF9A 2HA2A 2O5RA 3AFOA 3FNRA 1E9BA 3MF4A 1YIAA 1DX9A 3MJCA 3DVAB 3BMOB 5FBWB 1NONA 4B4WA 1F2UA 5LKAA 1UC5B 4LRXA 1ZW1A 3PT5A 5JDIC 3H05A 4HH4A 4DEXA 3U7JA 3KZNA 2WFAA 1KAHA 1IBLB 1PN3A 4WK6A 1E79D 5TXGA 3ZHOA 5IMSA 1BW9A 1XZHA 2RONA 3N7UA 4OKSA 2PHZA 3ANYB 4C29A 3OU7A 4HH1A 4QEKA 3F8WA 1NMXA 1XZLA 2XGOA 3PWZA 4LDNA 4X00A 3AEXA 4YLGA 4Y3UA 1YDWA 2E49A 3OJFA 3KG2A 1NQOA 3G0IA 3AU9A 1XQWA 2WWXA 4IXMA 1R12A 3QE4A 1C8BA 3DFZA 4XAQA 4ZANA 4TV9B 3LHKA 2OZPA 2Q5QA 4HQOA 3T3IA 1MEEA 2P62A 2QNBA 2JHFA 2E5FA 3NBQA 2OHJA 4H08A 4BNDB 4EGAA 3HUUA 4FWTA 1Q7CA 4RVGA 1WWKA 3P9IA 1Y7PA 2YV4A 3BMNA 5I9NA 5ULLA 1TC2A 2I2XB 2YIJA 3BUSA 2B61A 3IMGA 3LOUA 2XB6A 1JMVA 1HH4A 1PJTA 3BXEA 1P72A 4B7AA 2YR0A 3Q5GA 1YB7A 1EMDA 3DBOB 2BFNA 3SE7A 4J29A 5ICSA 2F2TA 2O2GA 4F5DA 3KB8A 1V7ZA 2NZJA 4N12A 5GADl 3KVRA 3CVVA 1TJ3A 3FZEA 4RENA 4RPKA 1QVRA 3DUFA 5ED0A 1ZM4A 4MKRA 3RQIA 5J3JA 2ZJ8A 2JCBA 3JQ8B 3K8YA 4RMIA 2QLMA 4Z8YA 2GAAA 4ZAXA 4A6XA 1V5EA 5KJ1A 2HJHA 4MW6A 1DKPA 2V65A 4MKIA 3NRBA 3A9SA 4BO8A 1YZQA 4Q05A 3QHQA 4DCNA 4GGMX 1XAGA 4MZXA 3QU2A 5COAA 3ZLVA 4RTKA 1TVCA 3PQEA 1LX7A 4CQLA 4ZTZB 3CNEA 3A27A 3E48A 2HYIC 1U2EA 3UUFA 4K05A 2QRGA 2DPMA 3HHEA 4JB2A 4OFWA 1XRNA 5ALDA 3FOFC 1XMPA 1JHYA 1ZH0A 3V6MA 1ZDMA 4NDAA 4XDHA 3WRWA 1PT8A 4GNRA 3BRSA 2VRCD 4XIYA 4EATA 1NLUA 3IAM6 3DR3A 5LA6B 3O38A 4FEAA 1K8RA 3NV9A 3QPAA 1MZVA 1XTPA 2HFJA 5TPZA 4PLYA 1K75A 1RJDA 2BBWA 5AXDA 4QPDA 1HLPA 3RS2A 3HYNA 3QKUA 4ONEA 4MOWA 3U44B 3AB7A 1WY7A 1HNZB 1X1TA 5G3ZA 3PA8A 4UASA 4X95A 5K0LA 3MOSA 2YHIA 2OV2A 3QEMA 4C0QC 4PIPA 4RNDB 4KPUA 4RPIA 3FY4A 1NR5A 4MA4A 1RM3A 2Q8NA 2DPXA 1SURA 2UKDA 3KTDA 3PKJA 1UPFA 4PYLA 1Z6AA 1XCPA 3DWIA 1SQ0A 3AF5A 5LLSA 1EU1A 4D82A 2PTGA 3REQA 3DMYA 4JZYA 3OKCA 2W6JA 4EYSA 5HS4A 1VXRA 3NDIA 1KOLA 1KSFX 3DMTC 4P0QB 3HCDA 3MMSA 3GPDG 2JI6A 1P7VA 3RVLA 1S7GA 2O3SA 5BMOA 3KJIA 1E60A 2XUQA 3RU9A 4NBUA 2DMRA 2AUNA 3CMMA 5HMLA 5FBHA 1K08A 3QBVA 2GM9A 3HKBA 4BV3A 3W04A 1WXQA 2J0UB 3RABA 1CZLA 4YUAA 3FTEA 2UYQA 1H5NA 3ZVRA 2C04A 3WFJA 4PF1A 2IODA 3MT9A 2HHAA 5GPBA 1KDVA 3BRWD 5BN3A 1P5RA 1R74A 1NXTA 1VE5A 2OE2A 2P0AA 1WZCA 2Z9DA 2GNOA 1ZD9A 4RELA 4OXYA 4RKWA 2ZFUA 3PRHA 3EUWA 2NTVA 2XSZA 5F2KA 5K3FB 1O89A 1J99A 3K94A 2QL6A 2C97A 4NE2A 4PCVA 1EB9A 1ULSA 4HGYA 4IGEA 1FTSA 2XKKA 1JH8A 2QOEA 4W9RA 4QELA 3WYEA 4HLDA 1ML3A 1BWQA 5TGDA 2CV1A 4UD2A 3BRCA 2KLBA 4U7PB 2WDZA 4OAQA 3RJZA 4KV9A 5J4LA 4HAIA 1YAHA 3Q85A 2EYUA 2ZVJA 4OHBA 1DJNA 5CX1B 1ZIDA 4ZD6A 4AKSA 4YT8A 3SE0A 3KPYA 4UEJA 1QFMA 1ZBDA 2JH9A 1PJ4A 2MSKA 2Q1XA 3R9IA 2PMWB 4FYVA 4ER6A 1M33A 1JAIA 1PHRA 4XJVA 3WIVA 2QM8A 2Y1FA 3GROA 3IPCA 1TEZA 1T3TA 1VLVA 3VDXA 3JYQA 2ES4A 3LD9A 4DLRA 4LMAA 3TDKA 1PJRA 3OQPA 1L8OA 1UK6A 1JIIA 4G0QA 4EUFA 2WQZA 3GC6A 3Q7QA 3GLHB 1JLLB 4MV3A 4R0NA 3W8NA 4K9NA 5AKJA 2GGSA 3RLFA 4D3XA 5DP1A 1TIKA 3CUEF 1FP4A 3R40A 3SBDA 2JLBA 5IKXA 1DAGA 3ADCA 2FPSA 3LNTA 4R6WA 3D3WA 1QANA 2R9VA 2XH8A 4FZ3A 1SVLA 3SG0A 4WGFA 3RBXA 1JE1A 2YN0A 4BLOA 3WYGA 2UZ4A 2XUHA 2IUEA 3RVNA 2EC5A 2FF7A 1N3LA 1UBSB 4RIEA 5I8WA 4BB9A 1U81A 4ERNA 1O77A 2N47A 3HA3A 2CVPA 5LMCA 1YR9A 4H6XA 1H0HA 1ECGA 5FLKA 4W5WA 1Z75A 5C0OE 3S6JA 4F2GA 2CB0A 5C7OO 3QVSA 3RHFA 1FYFA 5F1KA 2R6HA 2Z1NA 3RSCA 4ZCRA 3OAAD 4KP7A 2ISCA 4YAKA 2G6BA 3L43A 2D7CA 5LN1A 1E8MA 4GI2A 5J59A 2F8LA 2WT9A 1PEKE 2BEUA 5DM2A 3ZV6A 3QWFA 5FH9A 3A6FA 3JWIA 4JBIA 4W5HA 1OSNA 1QGUA 2JGKA 5COQA 2FWMX 2OD9A 4AMGA 3ADBA 3TS1A 1TT7A 2QZ4A 2Q9BA 5HYVA 2EFYA 2NG1A 2ZRIA 5DZSA 3FPHA 1A4XA 1W87A 3MCTA 5KQRA 4YI5A 3A11A 4JROA 3H5WA 4DLBA 1MOQA 1QH8A 3A6HA 4HAZA 2G04A 1ONOA 1YQDA 4ALIA 4A8JB 2XE7A 4B34A 2E4VA 4PZZA 5BVHB 4UDNA 3CF4G 4MS3A 4ED9A 5FLYA 1EX6A 3DEIA 2V9PA 4LMRA 3AEQA 1DIOB 2BSXA 4CUZA 4O8CA 3ZXIA 2Y0BA 1TADA 3TVTA 3PXAA 5FNZA 1YTUA 3CX3A 3U1TA 4RV4A 3WJ1A 4AROA 1IZYA 3A2MA 2NUBA 1OLUA 2IZ6A 2AXEA 2V7GA 3MSCA 4YUVA 2EKPA 5TQ0A 2FX3A 1K89A 3ZV7A 2VJNA 1XMOB 2P0YA 3UPTA 4CVNA 5JXGA 5H59A 1ZZGA 2DKFA 3G8YA 2R1TA 1IIBA 3GJ6A 3GLSA 3NH6A 3U3ZA 2AZMA 2VG8A 3L8MA 6ABPA 1T0HB 3C6MA 1IXKA 1XCLA 3H9GA 4YPOA 3HXKA 3JWHA 1Z6ZA 5LSAA 3P8ZA 4H6WA 5IVIA 1P3JA 5EE9A 3NUQA 3UAYA 1T6XA 3I9NA 5G4KA 1NQVA 2I4NA 5BUQA 2Q2NA 4OCZA 4JI4B 1K9SA 4AC9A 5E9QA 4C20A 3KUXA 1RRMA 2FUCA 2IFTA 4KI7A 4PBRA 2IE0A 2FW7A 2WZBA 4Y0NA 1TECE 2VTBA 3CKKA 2R5FA 2I6QA 3V32A 3PC8A 3RFUA 4JOQA 5HP4A 1QK3A 3O1HB 4FGUA 1CQJA 2IF2A 3W2EA 1CZKA 2Y0PA 4PHFA 2GD0A 1T29A 3DE4X 4MJXA 4G2NA 3HMKA 4QYMA 1ZISA 2CEKA 2DECA 3JX9A 3PUZA 3KOZA 3O6VA 3QXSA 2W0SA 5HJ7A 1JDBC 2B1RA 3A14A 3E61A 4PHCA 3ESQA 1KP9A 2WHPA 3IR6A 3N0RA 3R3ZA 4MHTA 2G4VA 4TMTA 4JHXA 4CMGA 4Y2PA 1PJQA 1JEQB 2C8VA 2KMLA 1U28A 3BH6A 1ZD3A 2AT1A 3X1KA 3LYUA 4G1MB 3VDQA 1KC3A 3H3FA 4Y2HA 2VDUE 2GPNA 4KXLA 2IDZA 1R9JA 3TGPA 3JU3A 2CL6X 3N8GA 3ED5A 3IQXA 2G7ZA 1RKUA 1W5EA 4WZ6A 5CDFE 3SC4A 1A50B 1GNLA 3EDQA 3GZJA 3BTSA 3LY7A 1KU0A 4QJBA 2C4KA 3DEJA 4Y67A 3RYIA 4DCVA 2IYFA 4ZMBA 2WJAA 1HDEA 2BFPA 1EG7A 3TQOA 5KYTA 2JAWA 3I12A 3NZEA 1WCYA 4CV0A 1QIFA 3EISA 1NHWA 2Z9BA 2C95A 4HGPA 2V8BA 1G20E 4RHUA 1L5KA 4QM6A 4PINA 4PYKA 5DMXA 2HKIA 3G23A 5GAJA 2EW8A 3RUIA 1N2CE 1E6EA 4WVFA 1ACJA 1ICEA 2ZI3A 1WMFA 2W2MA 3FNBA 5E0KB 1CWUA 2Q7OE 1SBHA 2GUGA 2ZJ1A 5E2AA 3RJ5A 1JJAA 3GQBA 4D98A 2O2ZA 1XQ1A 5IC5A 3CRNA 2BKEA 4RIFA 3U7GA 1Q2XA 3KVVA 3V2UA 1Y6RA 4A0GA 2NV0A 2YNMC 3M5WA 1DHRA 5D1NA 4ZJPA 4ZZ3A 1T25A 1FC0A 4CV2A 4MW1A 3U9LA 2FWIA 1ES9A 2VKQA 2CLMB 3LCRA 5JS8A 2Z6AA 4X62B 2CWDA 3HY3A 2AX4A 4RD1A 1QZUA 2OYCA 1N7HA 2G1KA 2YV2A 3TQFA 4DV3B 1B3RA 3FLAA 3L6EA 4C6TB 3H2HA 5AHKA 4F3CA 2K2WA 3V7YA 2DVMA 3Q1KA 1JIXA 1F2TA 5C35A 1CVRA 4YIHA 2AXQA 2QRZA 4JWKA 2VH1A 1E5QA 3JXEA 2OKGA 4KAJA 4OP2A 4F4DA 5JNVA 3HB4X 2IIBA 3QTLA 1I9GA 2YOFA 4NONA 3O2NA 1BE6A 1LDGA 1KAMA 2HF2A 3WHIA 3I8OA 2K2QB 4BGVA 2XBMA 4ARZA 4B87A 2O2IA 2G40A 4WY8A 3QOYA 4QG7A 1OFTA 1O95A 4EA8A 1JFRA 3O73A 4HH0A 1DWOA 1M7HA 1UOOA 2NVOA 5K3FA 3IMEA 3VU9B 3KWJA 1NVWQ 1R16A 3STWA 3I3SR 2IEIA 3K09A 1F8FA 2XLCA 4FJ0A 3DGFC 1Y3BE 3HL4A 1MAHA 2GFIA 3RTBA 1Z9BA 2CLOB 3RVSA 5JH7B 3O1LA 3DOIA 1QG0A 3ZLTA 1DIAA 2V6BA 3CEMA 3DBRB 3W2TA 5BSHA 4Q4HA 3ABOB 1UKVY 3KAQA 4V0SA 3UYLA 4E1VA 2XJ4A 5B2FA 2RGGA 1YJAA 2AMVA 3HACA 4XRRA 1NUUA 2IXTA 4HZUA 5CCBA 3A26A 3K72B 3LH5A 4N3NA 4ND4A 4ZI2A 3R3UA 1PVOA 3T3OA 3OPNA 5MN4A 4YO7A 4YCNA 1A77A 2A5JA 2EGGA 3BB3A 3DD1A 4UHFA 1DRVA 1IZ8A 3UAWA 3PXUA 1C50A 4JWTA 2YKGA 4M8NE 4NATA 5EQJB 2Z30A 4BQRA 1SU6A 1R5NA 2I7XA 4IFIA 3F49S 1B8UA 1SHZA 4MKHA 4HAUA 1UKBA 2G8LA 4WBNF 1ZVMA 3LG2A 3BX1A 5KWSA 5A4MS 3L4EA 3PGMA 2ZVDA 1I30A 2L82A 3I5MA 4K9RA 3OTQA 1NU6A 4MKFA 5EJ7A 4H3HB 1ZO8A 2ZB8A 4HWTA 1NKVA 2QTGA 3KVYA 2UVQA 4XQGA 5A2QA 9LDTA 3D1JA 1DE0A 2JI9A 2WSMA 1OWOA 2YBDA 4LJ7A 5C8YF 2QTWB 1A27A 5FUWA 4IMIB 2XHEA 4R1NA 5KSYA 4N7MA 3G5MA 2CL7X 2X5JO 4L4YA 1VP9A 3NHJA 4IX1A 4HAXA 5DM70 4G8CA 3LUCA 2V4ZA 2PIDA 3AFNA 5JPIA 3EEOA 1SUEA 1TLTA 4NFLA 4PZYA 1KGSA 4XI9A 1IUNA 2XUFA 3VU0A 1AKUA 2ZIUB 4RTJA 1PBTA 2FQ1A 3IEUA 3I32A 5TT1A 2O7SA 1KPIA 4HGQA 4DAOA 3EXFA 4ACAA 5FBKA 5KMGB 3A05A 3HXTA 5A5DA 1XB2A 4M1MA 3D4NA 3FNIA 3ZC3A 1Y1TA 4DMFA 2HTFA 3I30X 4TZKA 1NYTA 2H4JA 5D01A 4HDMA 2AJTA 3O4JA 4WNYA 1U0GA 2HC9A 5K8CA 1XA0A 4B17A 2HBQA 6CHYA 4QPCA 4RF5A 4F8YA 1EG2A 3LSYA 5IJZA 2XCSB 2PUGA 3GGCA 3PXEA 3W5BA 3U13A 3IRUA 1M54A 2RHDA 1T1SA 2FQYA 2AA3A 1E89A 2HBZA 2EWVA 3L0PA 3O93A 4TV9A 4C0JA 4QUEA 2PJDA 3PE4A 2BH2A 3I01M 1BVYF 3K0AB 1OAOA 3NVAA 2NU9B 1RBQA 5TMDA 4K9MA 4B33A 3ZDEA 2ECPA 2BJWA 3R5TA 2OHOA 2YHUA 4NY1A 2HZBA 1D2HA 2FZLA 5CVCA 1NVMB 1XVLA 2MHCA 4I1OA 2F6RA 3T7TA 5JFOA 2ZRLA 1GGFA 2ZYDA 4MVJH 2IVZA 2FP4A 2HNKA 1E9FA 3S70A 5DBGA 3WGGA 4D43A 3WAJA 2IHZA 2P1DA 1HDRA 3FWHA 4DCSA 3QOXA 5CK5A 4IEIA 1Y1LA 2C83A 1GO2A 1P1JA 1U8AA 1BYIA 2A9JA 1SUIA 3GRYA 4PRYA 3RU3A 4NOMA 4AY3A 4WN3A 3VJMA 1CT9A 2R6DA 4BQNA 1FRQA 1K63A 1U5AA 2PX2A 3IIMA 521PA 1UPXA 2B20A 2GRAA 3VKGA 5HPYB 1BA3A 5JVDF 4W5OA 3CZMA 3DCIA 1GVHA 4KO4S 5EHIA 4UBJA 2ZREA 1L4LA 5KOJB 1Z63A 1R1DA 5EYPA 2PZBA 1BGXT 2Y1GA 1T8UA 2PUJA 1EUDB 4RAQA 2ACEA 2Q5HA 4HPXB 3LHDA 3ZWPA 4YUWA 1JXQA 1X7HA 3M4YA 3ZXSA 1KOGA 1H4SA 5LP6C 3VR6A 1JPNA 3AF2A 1YR8A 1W75A 1PR6A 1I7SB 4LPKA 3AGQA 5I7VA 2CDNA 2RHWA 3E7DA 3GJRA 3L4SO 3FBTA 3EARA 5AWFC 4DREA 4YV7A 2CV0A 2FRVA 1JU3A 4W8GA 1HE1C 4BEBA 5B7NA 4RXTA 3E1GA 5KTPA 4XX0A 3CLVA 3TD6A 1J07A 2XODA 3WB2A 3FUCA 2FRDA 3Q4GA 5KZMB 1TM1E 2PT9A 3DBHA 1H1TA 5D84A 1XZEA 2RH9B 3PXCX 1MVLA 1SC4A 2FWPA 3DBIA 3VR4H 2YJ5A 2FEMA 1Y5LA 3IT3A 4ZYYA 2ZBUA 3P4YA 2VAVA 1ZSNA 2J0EA 4RKRA 2CLEB 4W7HA 2DPGA 5DVZA 2CUKA 4JGGA 1TCUA 4G37A 4U3JA 4ZK2A 2VP3A 2Q5IA 1OWNA 5T64A 3WOVA 4ZOQI 4AY6A 4E07A 3ET4A 2FH5B 3MPUA 1FYEA 1PW5A 4WZZA 1P3DA 2ENUA 2QUKA 3AOEC 3RJMA 3L6BA 1Z6YA 5CMLA 1NVVR 4G9GA 5KPDA 3W5AA 4M6WB 1LU9A 2Y2UA 4UXHA 1IBMB 1WPXA 4RY9A 3AVVA 3MW8A 4Z51A 3CR7A 1FFWA 4IV0A 4LCEA 1E2DA 2PX5A 4IHKA 3IAS6 1M10A 1XLTA 2I6TA 3IMFA 3MILA 4KODA 3N2KB 1QWOA 4X1KB 5AJXA 3SDBA 3QEJA 3SHVA 5JNLA 2PUBA 3PLNA 4MH0R 5AH0A 4ITRC 2PXXA 3IO5A 3PIDA 1L5GB 4O4HB 2KB0A 3LBYA 4MNTA 1DV2A 4XB2A 2Q49A 4F5ZA 3VHXA 3H7AA 3KKZA 5KB3A 3FFTA 3F5MA 4AG3A 5LU9A 4RLHA 2ZS9A 2JLRA 1NN3A 2WE7A 4IY1A 2BI4A 1A04A 4MKGA 2XA9A 2J9FB 1F60A 3ZQUA 1F6DA 3V46A 2JGDA 1WHSB 3RHZA 3G8BA 3B5EA 4CQJA 1ZQ1A 3O3OB 4E6PA 1ILWA 5ICMA 1JG3A 4UAGA 2WVGA 3SZGA 1NAHA 4F46A 1YDEA 1YGYA 4IL5A 4P0PB 3MAGA 3VSDA 1ISPA 1IK6A 1GAWA 2JRCA 3DOHA 1FFXA 4QDJA 5LZ5A 1DL5A 3E15A 4KSBA 4D8UA 3P5BA 4JIGA 1N8KA 1OH6A 4J1TC 1DEAA 4AJLA 4U02A 4UOQA 2Z8YA 3A1NA 5TARA 1PNVA 3E7XA 1LI7A 2FZCA 2XX3A 3H0CA 2D3TA 2PZAA 3O0TA 4NZMA 3WBFA 1U0OC 1M83A 3WL7A 4X44A 3D4LA 5KSOA 1AUVA 5MGBA 4BKUA 3MTBA 3WX0A 4LNUB 1B7GO 1BEEA 1R0SA 3OHPA 3LBNA 1F3OA 4QUJA 3OX3A 1ACLA 5U1PA 1NQ5A 3EGDA 1RHQA 1YJBA 4J0KA 4L9SA 1PR3A 3QLUA 4LX0A 4B3IA 4EW6A 2YJGA 3EQ7A 1B6GA 3WSWA 1RC0A 3JARA 4YJHA 4A2PA 1Y6FA 4PYMA 3IP1A 1UXJA 1VZ2A 1LRKA 2OQVA 5KBYA 3JD2A 3P2OA 2G4CA 3P52A 4Z9FA 2A59A 4F45A 5K09A 4D3FA 4XVQA 1UINA 2NSLA 2N9UA 2XUZA 3EYAA 4MW4A 3L4JA 4AS2A 1DBIA 3OA0A 4X20A 3ZWXA 4Q34A 4DY6A 3OZSA 2PSJA 3WKDA 5GJVC 4BQFA 1KBQA 3DV0B 4GG1A 3UQZA 4Z7JA 1G66A 1ECJA 1BH2A 4MCJA 1GAEO 2P69A 3DAPA 4OSEA 4Q1VA 2BFEB 4WBNA 2Q99A 2ZI7A 3P45A 3VZDA 5BUSA 5BV0A 4QQKA 2PZJA 1B76A 3H18A 3GBVA 3CIFA 3AJ8A 4PVCA 3SC2B 4BJ6A 4QBKA 2O3JA 4LZJA 4BMNA 4ZZ1A 2W2OA 4ZHQF 1EIZA 2H16A 1T5OA 4N3CA 3ZDYB 5CA1A 1CF4A 2F3QA 1I3LA 4KLRA 4NHEA 2EBFX 4J2HA 5DW3A 4E2WA 2GCIA 2X23A 2P0EA 3RJ9A 3UHFA 2Z4RA 2G9RA 4QFBA 2YYAA 3GK3A 2O8FA 4D6PA 2B4YA 1GZUA 4BJ1A 1KRHA 1NUSA 3D8BA 4IW3B 1UM8A 4ECAA 1QYDA 1LCIA 2Z3ZA 4ER5A 3DEZA 4FR0A 2KW5A 1ADJA 1V26A 3TN7A 4ETNA 5KVSA 2PKCA 2YYZA 4WPGA 1TEXA 5EXDA 4KMRA 5LZ9A 3Q11A 1HQDA 2DHDA 2FMIA 3AW9A 4BFZA 4MX8A 1RJGA 1EDZA 1XKXA 2Q3FA 2C8KA 2ZUSA 4HHEA 1UPCA 4ZQCB 3RVRA 4BLPA 5BSWA 3ONEA 1F5NA 3TEJA 1QH9A 4Q7MB 1ZL2A 3B60A 1Q5PA 1MXFA 3IUMA 1TUEA 1ZN9A 5JAOA 1RC8A 4HNGA 4Z4GA 3KWLA 1NSFA 2XTNA 2CXQA 4AN4A 3DZCA 4EARA 3HVIA 3DULA 4MRPA 3L8DA 4FCWA 4FN5A 2ZYUX 3LLMA 1V3QE 3VZCA 1Z5WA 1AF7A 2HMWA 4A5SA 2FOLA 4WSOA 4DWJA 5K7SA 2FOXA 2VUTA 1N2XA 5FR1A 2YS7A 3PNMA 3EEQA 2FVXA 4Q3AA 4RDCA 4ZIRA 3G7NA 5EMMA 1EQ2A 3V2GA 1B93A 3HLTA 2VJQA 4X94A 1F9EA 5K1ZA 1YR2A 3C3XA 5A2GA 1LBIA 4OGLA 1BVRA 1XRSB 4BZWA 1P2FA 3PF9A 2ISSD 3WYCA 2C61A 1SXJA 3H04A 3S44A 4URVR 3TSYA 4UTNA 1OAAA 3VI4B 3ZDBA 3B1JA 5AXAA 3V8PA 3VC3A 4ZKDA 4GRIA 4HDKA 3ZEAA 1QDUA 4RW0A 1TMYA 4QC2A 5EMLA 1GZ5A 4PZCA 2WWGA 5FOUA 3UMVA 3AM5A 4UAJA 3OO0A 1UFQA 3WP1B 1O0SA 3LWNA 4IV8A 4G4JA 1G5QA 1YJQA 1SKMA 1L5ZA 1WDMA 1ZK2A 2OB2A 4C4TA 4NXNB 4IFTA 1IUKA 2XCRB 2PQ0A 3Q98A 1HDOA 1GRRA 3JVEA 4IDNA 1VCOA 5F78A 1VGQA 3FRHA 3T54A 3VU8A 1MB2A 5LIPA 4I2NA 4P3PA 3F6PA 4QTTB 3LQYA 1A96A 5BWNA 3VSBA 3DOCA 2YYYA 3DL4A 1GTG1 1T5BA 3GP5A 4IF4A 1L4BA 2W6PA 3MS4A 4KXYA 3H5TA 4KAAA 3KLPX 1ZMTA 3TLAA 3WYBA 3GLFB 2P9HA 4E2XA 1OJLA 3K9CA 4FDTA 2Q6OA 3QQ5A 4IIJB 3RFFA 2FPWA 5H4HA 4BP9A 4OFXA 4PS1A 3JQDA 4GYKA 4MVJD 3ZHXA 3E1KA 2PVCA 3LY5A 3DOEA 3CT6A 3OAAA 3N75A 1ONPA 2W11A 4B7ZA 4DEVA 2IUUA 1ZC4A 3E22B 1OV6A 2ERCA 3E2PA 4D81A 2GFHA 4ZOEA 5B37A 4FMDB 2F17A 1XZBA 2WNIA 3T9DA 5GOZA 4V0OA 3FYCA 3V4SA 2ZT7A 1Q0LA 1SQ6A 3PENA 3RVMA 4LS3A 1GRVA 1EFCA 1KR2A 3D02A 3D0RA 1T3SA 4RNCA 5GVSA 1V39A 3A1SA 1HDIA 2Q29A 2YZ7A 2ZTVA 3FI0A 1Q57A 2I3AA 3CGWA 5CW1A 1W0JA 1ZU5A 5C1DA 5JQGA 4H0FA 1IG3A 1TAQA 2HWYA 3ONDA 5JLJA 1Q1AA 1K5DA 2YWHA 2G3YA 2NACA 1A9ZA 1C0IA 1UM9B 2H9AA 3ITKA 3UT6A 4L4SA 3F8SA 5IFKA 3BKXA 2ETXA 4LWQA 4DS3A 4DVGA 2GXUA 2XXJA 3INTA 4K2HA 1DC3A 1H2ZA 3TLCA 4JP1A 1N5KA 1T8RA 4I5IA 4K7JA 2GPYA 3K71B 3HG7A 2A5LA 4KMSA 1Q44A 2ZVQX 5EERA 5C51B 1ODCA 1E2UA 2MR5A 3T3DA 1GXSB 2BFFA 4AJ4A 1J9EA 4AUEA 5HXAA 4Y2JA 1D7OA 5FV7A 3NIDB 4FIZA 1TPYA 4L8GA 5BPFA 2JLYA 3L05A 3M49A 3QKRA 4UMEA 1NDQA 2PL3A 3EIQA 4PO1A 4WEQA 4ZYLA 1AKVA 1DG1G 5IM4A 3B2EA 2ODWA 4DWVA 4QWMA 1UP7A 4YRMA 1I0LA 1Z35A 2G8NA 2H2IA 2ZRJA 3MFQA 3Q72A 4TVOA 2OYRA 2H1OA 1XNQB 5EUBA 4TM7A 3L1JA 4L95C 5JD6A 2IS1A 1USUA 1KJZA 1WS6A 4QM7A 3IELA 2VJLA 1A9XB 1EK6A 4D8WA 2VYCA 3LXUX 3KYIB 2J7KA 2D8AA 1SVUA 1PNOA 2HLPA 2IUFA 3PEEA 4TS3A 3RU7A 2O2YA 3DWEX 3MOGA 3WWYA 4AP9A 1PO7A 3A2NA 3E3MA 2I1VB 4NJMB 2I99A 1R0RE 3QEBZ 1Q12A 4EG6A 3C87A 3B1ZA 3LF2A 3ZVNA 2EJUA 1WZ2A 3OT1B 1PR5A 4DCOA 3QVJA 5DTMA 1QV7A 2JZOA 5FUBA 3AK4A 4ZT7A 3LKVA 1II8A 5G0WA 1F5SA 1L4UA 4K6KA 3WG9A 1GSOA 2H1VA 2VEOA 2H1HA 3Q15C 2BHTA 3R77A 4XTCS 4KQCA 1G55A 1GLGA 4OI1A 2EP7A 1TM2A 1W2HA 2J5XA 3MTDA 1Z45A 1R37A 5ABPA 5K8LA 3C7DB 2VT3A 4B44A 1E63A 1RZVA 2Q9UA 4IXNA 1TVMA 1N0WA 2L0XA 5L53A 5CNMA 4Q3CA 2YOHA 4U6SA 1P4GA 3V48A 3R20A 2KI5A 2B8EA 3HUTA 1U9IA 2VYNA 2YVKA 2G72A 4F9EA 4XYEA 1ABEA 2W6IA 4AMVA 3AI3A 3A10A 4DLKA 1A2KC 3D3WB 3R7LA 4X97A 5CGQB 3C5WP 4DA7A 2COEA 5EP1A 1V1RB 5JAIA 3CW9A 2MYPA 1H6CA 1DQPA 5JPCA 1ZP6A 3Q41A 4RA6B 5DBFA 2FG7C 3CNNA 4AJJA 5KU1A 4OD0A 2G25A 2ZSKA 1HQKA 3FLMA 4O5OA 5DNWA 1LTKA 2J87A 2J9YB 2IH5A 4F92B 1LV8A 2JFFA 3ZQKA 4P4TA 1NIPA 5DGCA 2H9IA 4PU0A 1Y4SA 4INOA 2GESA 4PVDA 3C3PA 1NUQA 3F1LA 4ZHSA 4JSYA 4L02A 1INLA 1PJ2A 1XD2A 4JITA 1YZUA 1XD8A 4PAMA 1Z2AA 2B2XA 4YTEA 2J30A 3CVJA 2CC2A 4N4AA 5FPKA 2R2GA 4MLPA 5K3OA 4H1HA 1PAUA 2EQAA 2LCIA 4LXQA 4KWHA 4XWAA 5IDYA 2Q7DA 4A0HA 4TGLA 4XSGA 4YASA 1FX0A 2YH2A 1RQLA 2D5BA 2VXYA 3A9WA 3UW3A 2JC3A 2DWUA 4GX5A 4CT5A 4QHTA 1BRMA 2F1JA 3BHJA 5A7GA 3VNBA 2G80A 4B3BA 1OXSC 3FM9A 3IPLA 4N54A 1DADA 3WVNA 4C7MA 3MBOA 1ZR4A 2XYQA 1MC1A 2YBEA 3THYA 2LTAA 2PGLA 2RGWA 3GEIA 3OFND 4IJQA 3N0WA 1DHTA 4DV4B 3B8HA 2OPBA 3GGDA 3IKLA 4P38A 3CVOA 1RRFA 3O90A 1U5CA 5AQEA 4CDNA 4YMVA 5C8XA 4QTYA 5BQ5A 2C2ZA 2HPHA 3FCSB 4G0YA 2WAMA 3SM3A 4G4SP 2KBEA 4O2BA 4F12A 4JLSA 2XCOA 4MI6A 2O7VA 2OM2A 4OSOA 5B64A 4HH3C 1Q77A 4RJJA 4EUNA 3C0KA 2J33A 3FNFA 3UWKA 3K4QA 2C4WA 2H7CA 3PUHA 4YROA 1Z08A 5EE1A 2UVPA 2VRNA 4QGAA 1L5HB 1AQJA 1GG8A 1C9YA 2Q1YA 4EENA 3UOWA 1MABB 3F1KA 2ONZA 3HBFA 2BFBB 3AFGA 3KYCA 5KIAA 2O8NA 4NYMQ 4YRIA 1VYHA 3DQQA 3CLSC 1L5RA 2W90A 3I6QA 1I51A 3M6WA 4IQ8A 1I10A 3FDFA 1HT3A 2BEWA 1GD1O 2H52A 2X1MA 4RIHA 2C9BA 3RHSA 1OAOC 5CA1B 5LDDC 1ZINA 2DJIA 1DJPA