2BMEA

High resolution structure of gppnhp-bound human rab4a
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
176
structure length
176
Chain Sequence
SETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Human Rab4A in its Active and Inactive Conformations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords RAS-RELATED PROTEIN RAB4A
total genus 62
structure length 176
sequence length 176
chains with identical sequence B, C, D
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2005-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bmeA01
1S2MA 3QKRB 1Z2CA 1OF1A 1NKSA 2FN4A 4QL3A 3TE6A 3EIEA 1KSJA 1UKVY 3R20A 4B2LA 1D6JA 2C96A 3IPXA 3RS3A 3DM5A 2R6GA 2R8RA 4IXMA 5JEDA 4CF7A 4Q7LA 1ZM2A 2F9LA 5KNDA 1E98A 3KDSE 1BOFA 2F1JA 4OQNA 1E4YA 3FPAA 1NMYA 2QE7D 2BV3A 4FIDA 5C1BA 4X8HA 1W0JA 2X1VA 1DS6A 4EFMA 3ZLJA 2EW1A 4XD7A 5AR1A 3GLGA 1TPZA 4D0GA 5JJIA 1G19A 5CDFA 5HE8A 3MJRA 4JLPA 3UWKA 3L2OB 3U61B 2JLXA 1D2MA 4F4IA 4PX9A 1U98A 1GFIA 1T0JB 3KX2A 3W9YA 4DDTA 3B85A 3QOFA 5A4JA 1T8UA 1KI4A 1CJTC 1N25A 1ZBDA 3P32A 4PQRA 3U3MA 1Z22A 3QKRA 2P5SA 1ZD1A 4JBYA 1LVGA 3U60B 1NN1A 1SULA 3IDQA 4BE7B 2PLRA 1W5SA 3TSOA 1TUEA 1DBSA 3PENA 2OCPA 2IS6A 1UBFA 2XJ9A 5G3ZA 4Y0VA 4HUTA 3E70C 2GXAA 3BS4A 1OXVA 3GMTA 2HYIC 2ZVPX 1EFRA 3B1ZA 3VX4A 5EQTA 4QRHA 2C78A 5DN6A 3Q7PA 4TL6A 1CU1A 1X8JA 4G1UC 5K8LA 1P60A 1VHTA 4KHZA 4LJ6A 2FU5C 2QORA 4HLDA 4M8NE 4TLDA 5TY0A 1BMFA 1N0WA 2BWJA 1R10A 3SEAA 3N2EA 1RIFA 3BRWD 5BYKA 1N6HA 3DZ8A 3FTQA 1Z28A 5LBIA 2G6BA 1U8ZA 2IUUA 2ZTSA 4DSUA 5JJKA 1J99A 1NY6A 1ZUIA 2Q9BA 2P0EA 3AF0A 5GJCA 1E6CA 5D3MB 4HI0E 4QBIA 2C8VA 4R7ZA 4A9AA 1KKLA 3ZS8A 3L0OA 5K8UA 3WNBA 3CW2A 5JHHB 4XTCS 1NRJB 5FI0B 3QKUA 2ZM5A 2QSZA 2JA1A 4A8JA 4A82A 2QUZA 4YQFA 1PV4A 1US8A 3EZ2A 1GL7A 1ZNWA 1HT1E 4DWJA 5JBQA 4WIAA 4CEIA 3SJBA 2OBMA 1H65A 2FF7A 4NYJQ 5BXQC 4DSNA 4E22A 4ZDJA 5EXPA 3GEIA 2W6JD 2ODBA 3A1VA 4TMWA 2I1QA 1Q1QA 4HEJA 3BWDD 1XTJA 5IRCD 2ZJBA 2FGJA 4HZUB 1ELOA 3F0TA 1P75A 1F2UB 1YQTA 2BC9A 3QKSA 5AJZA 4B2PA 2XJ4A 3H0KA 4PHFA 5FBRB 1R5NA 4KBFA 2DR3A 1C1YA 3SU8A 4KLNA 3VMFA 1ZIPA 1ZW6A 4I1VA 1ZM7A 2EYQA 3IIKA 4KCGA 5F9HA 1B0UA 1JQJC 2GZDA 2ZU0C 2W2TA 1VG9B 3CWQA 4NCHA 3K0CC 3TQFA 2IEYA 4NYMQ 1G64A 1NG9A 4WZAE 1KJWA 1P2SA 4PO1A 1XB2A 3TQCA 1JAHA 3TSWA 1QRAA 3LQRA 1EWQA 5G3YA 4LK2A 1XEXB 2AL7A 4PSVA 4EKDA 4ZV4A 1TU3A 3RRNA 2IW3A 3BB1A 4Q7MB 4B6FA 2J0UA 1OKKD 5IK2A 1NVVQ 1QHNA 1XTIA 3H84A 4CYMA 4A0RA 4UNSA 1UDWA 3PUVA 5CK5A 1QHYA 4HLCA 3A36A 4AKIA 3LDAA 2IF2A 5UKDA 1Z63A 2HT6A 2REOA 1CJMA 4R2HA 1S9DA 2DFTA 4LDJA 2QAGA 5FPHA 3RWOA 3W34A 1R2QA 2AN9A 1GTVA 2GJSA 4IHQA 2GXSA 3IEUA 221PA 2JEOA 4LHXA 5H70A 2ZR7A 3AUXA 1DAHA 4D26A 3CNLA 2XAUA 4B3CA 1JAIA 5EXXA 5LPNA 1EFUA 1DTSA 3ADBA 3I72A 2E9SA 1KSGA 3KXIA 4MYCA 4Z51A 1W46A 4HB2A 1U8AA 1U8YA 4PANA 1H8HD 2WJHA 4TMKA 4WAUA 2QA5A 2GA8A 4L8GA 4JLVA 3B82A 4M22A 3OF5A 4Q7KA 3R7WA 4BRWA 1GL9B 2A5FA 4B32A 1EK0A 1Z83A 5CM9C 3ZIAA 3B6EA 3CRQA 4C2TA 4TYWA 1GRQA 4C0BA 5AUQA 1VYTA 3CPJB 4Q5IA 2GILA 3NEJA 4U00A 2QBYB 2J41A 2W6JA 5J4LA 2HXSA 1S0UA 4G5QA 4DC9A 2IXFA 1NLFA 3J81k 1ZP6A 2AFHE 1KY2A 3HPRA 3ZZ0A 3QBTA 2KB0A 1WE2A 4C0SA 1ZD8A 1RRPA 1YRBA 1X3SA 4I1OA 4PTLA 1HY3A 5FTMA 1DARA 4BFYA 2ZYUX 3QXCA 1QZXA 4FWTA 2VHUA 4CT5A 1X86B 1JEEA 2ZQ5A 3EG5A 1M74A 2FV8A 4MYTA 1JNYA 3A1SA 3SE0A 5DI3A 4ASUA 4NH0A 3ZQJA 1VPLA 3GD7A 3LAWA 4FINA 3PR1A 3LNCA 5LDDC 4B33A 1ANKA 2MMCA 4NE2A 1CIPA 4LHWA 2O8CA 3ZVMA 3BB3A 3PIRA 2NIPA 2D74A 3AUYA 3MD0A 3QF4A 3QQ5A 1LY1A 2B7BA 3T35A 3MSXA 1BMFD 1OYWA 1E32A 3U7HB 3L82B 4L16A 2V1XA 3AVYA 2WWGA 1KSFX 2H16A 1VECA 1PLKA 2YOFA 2IHYA 5JI3E 2O8BB 1XEWY 3QXXA 1H8ED 2BCJQ 4JLKA 1DAMA 1AM4D 1E9SA 1KI7A 2K5UA 1D2NA 4ACBA 2CDNA 5AUOB 2Z4SA 1DAEA 5CK4A 1AS3A 5E3HA 4KI0A 3QXHA 5FOUA 1B23P 5H8WA 1W48A 2CK3A 2FZLA 3K0AB 3B1XA 4DCSA 5L3QA 4HSEA 2ZU6A 2BDTA 3TW8B 3DPUA 1DG1G 4GRAA 1YZGA 2DWOA 4JSTA 3KQHA 3T34A 4YLGA 1GDDA 1AZSC 1G5TA 1U94A 2V1UA 4PO9A 1BO6A 3DL0A 2NO6A 3SHWA 1GM5A 3F3YA 1EGAA 2GEDA 2FE4A 3TGPA 2BKEA 2CJWB 4BUJA 4LBZA 4NCIA 1Q44A 3R7WB 4H1VA 1E2EA 1AQUA 4XSGA 3I8SA 4E5UA 1AS2A 3FE2A 1K8RA 1P4SA 2ZROA 3T1VA 3EASA 3VKWA 3ONWA 4A0FA 1IN4A 1O3YA 2FX3A 2HJGA 2ZS8A 4Y0AA 1CS4C 3U2QA 4PZZA 2H17A 3WHKA 4WA7A 1W4CA 1KO5A 1U9IA 1U0LA 4GP6A 1E2PA 3OHMA 1W0JD 1WA5A 1AKYA 5L3SB 4CEJB 4FW9A 3EIHA 2VA8A 1VG0B 2ZETA 1QDEA 3UG6A 5CITA 2ZJOA 5BN4A 4G5SA 3RS2A 1Z0KA 3KL4A 2YZ2A 2QPOA 3WMEA 3IO3A 4Q19A 2KSQA 4QFMA 2FFBA 1P7CA 3KJHA 3WRYC 1K6MA 3CKLA 4M1MA 1G41A 2C9YA 3RS4A 8OHMA 4IJMA 4RD1A 4Q4LA 1GRNA 3WBJA 3X1ZA 4DLRA 4DLVA 1SKQA 2O8DA 3U5ZB 1GRRA 1VG1A 4LV6A 5J4KA 3KQKA 5DH9A 4JSYA 4N3NA 4LHZA 1VCIA 2EFHB 2WMOB 4A36A 4LOAA 4NCNA 1KI2A 4Q9IA 1N6IA 2GCNA 2OXRA 2JLWA 1UEJA 4DRZA 2PZGA 3OAAA 3TNFA 1MRNA 1G21E 5CM8B 3UXMA 1OXSC 1OH5A 1AA9A 3LW7A 4GOXA 2HJVA 3IGFA 4L15A 3H86A 4Q18A 1QBKC 4XWKA 5J5CA 5FBVB 1SQ5A 1S9HA 4JLOA 3QVVA 4BEBA 1DAKA 5JHGB 2OSBA 2QL6A 1P3JA 1II8B 2EVWX 2FFHA 5LB4A 4I1UA 3KKPA 4FCTA 4C4PA 1A4RA 1IONA 1MABB 4ZCIA 2WJYA 2IS4A 1VIAA 4PC6A 2SHKA 3MFYA 2V3CC 3B2EA 3LO5A 1G8HA 3K1JA 4C30A 4G0NA 3GLIB 5B57C 2IYTA 2KJQA 5SZHB 1R0WA 2JLZA 3R9XA 2GJAA 3MLEA 1ZC3A 2CL7X 3RS5A 4AG6A 1Z6TA 4LPSA 3PUXA 2BMDA 4AY2A 1NLZA 3PUZA 5JMTA 1MKYA 4IDQA 3K0FA 2KI5A 1JR6A 4HUQA 1FTSA 1GSIA 4US1R 4DLYA 1XX6A 2QM7A 4TMTA 1G8PA 1CR0A 2WICA 2H7VA 1G6OA 2O0JA 3U3RA 1RRGA 1X8KA 1E0SA 4LI0A 1G17A 2HLDD 3EC1A 4DLSA 3F5FA 3KFXA 4QXAA 5L3SA 1JJVA 1N5JA 1BS1A 2XZPA 1CTQA 3MWKA 1J2JA 1LTQA 3EZ7A 3TSZA 3DKVA 4LSGA 5FBLB 1KK2A 3QPUA 1HURA 2EQBA 1HV8A 3WYAA 3OEHD 2QQEA 1KY3A 1VIYA 1DVRA 2RGCA 3B78A 1F2TA 5F2EA 1FW6A 4CEHB 5B58C 4Q9JA 1T3LA 4TYPA 2AKYA 5AWFC 1XZQA 4RY2A 4MH0R 2A5YB 2G9NA 3CH4B 4Q00A 1Q3TA 3D8BA 1VCOA 4AK9A 1J7KA 5JCZA 1D9XA 1UDXA 1ZAKA 2WWIA 3SBDA 1KKMA 3SYNA 4ZDKA 5FUYA 3CR8A 3LBHA 2QT0A 4ZPXA 1CP2A 4M1YA 4F38A 1K5DA 2OCBA 4O2LA 4V0OA 2IWRA 4CT4B 3C5HA 3I8XA 4Z8XA 1Q1BA 5GADl 3OIYA 3GLGB 3M6AA 1M7HA 1TU4A 1TF2A 3NHBA 1EESA 1FPMA 4F93B 2KE5A 1FFHA 1Q22A 2P6RA 1NSFA 1LF5A 2LWIA 1KAGA 1YZNA 3Q7QA 3U44B 5TXGA 4IDPA 3LV8A 2W00A 3THWB 2YINC 4M1SA 2WWXA 3NKVA 3H4MA 4WOPA 4JMPA 1GWNA 1L2TA 4IOMA 3AKDA 4BWYA 5EE1A 2ZI4A 2QGZA 1SHKA 2JJ8A 4RZ3A 1FP6A 2XNDA 1KGDA 2GHIA 3TW4A 5DYIA 2LKCA 1SXJD 4A0HA 3FGNA 4RD0A 5TMPA 3P26A 2J0QA 5E95A 1L4YA 3GJ4A 5GJWC 1E2LA 1JR3D 1II9A 1CF4A 4MYUA 2J0SA 5C46F 3K9HA 4D4LA 1P9RA 2J7PD 2AK2A 4MRPA 4ZKEA 4WXRA 3EAQA 5AUPB 1TEXA 4ILEA 1DOAA 2ZRMA 4GMXA 4M9XA 3QY0A 1RYFA 2BVNA 4C9BA 3KJIA 5BW8A 3C41J 5CDFE 4A0GA 1R7RA 3I61A 3ZQ6A 1JB1A 2BBOA 2AHOA 2QNRA 5FTNA 2OAQ1 3WYFA 3UK6A 2FDCA 1RC8A 1RE0A 4Q7JB 2W58A 3B9PA 4URWR 2ZJZA 1Z29A 3EARA 4LZZA 2R6CA 1E2NA 3IBGA 2PMDA 2VO1A 4O0MA 1DEKA 1KDOA 1YHNA 3Q72A 2VF7A 3JVVA 3SOPA 3GEHA 1XTSA 5K8IA 2BHRA 2A2ZA 4MGYR 1QG4A 2VHTA 4RD3A 5IT5A 4XWAA 5IK2D 3QEJA 3UANA 3VAAA 2PEYA 2J9RA 3AVXA 1XPRA 1NLYA 4TYNA 4PZLA 3SFZA 1ZYUA 3CWZA 4OJQA 2V6JA 1W36D 2ZITA 1P9NA 1NMXA 4L4UA 1IQPA 3WY9A 3CLVA 2WKPA 4DCTA 4GOJA 1G3MA 1KK0A 4G3XA 4P4UA 3NWJA 5DO9A 5GVRA 4WZBE 2BCGY 2OCYC 2Q9CA 1G8YA 2OAP1 1HA3A 2ZRIA 3Q5EA 3L0SA 3KTAA 5EP1A 2YWGA 5HTKA 3ADDA 1PLLA 4DDUA 4KSCA 1QVRA 4LJ7A 3W6OA 5M04A 3CNNA 5EXSA 4YMVA 4PQFA 1E0AA 1SVLA 2CLSA 3K0CA 1OFUX 4RFSA 4P0TA 3I62A 2ATVA 1CJVC 1XU4A 2ZSAA 4RD6A 2WKRA 2IHBA 1T0HB 1SXJC 2ONJA 5F98A 3M0EA 3A4MA 3LBIA 5JRZA 3A1TA 4Q66C 2XXAA 2OEPA 2QMUA 3ADCA 2XOKA 3OE7A 4OHVA 3RS0A 2C5LA 2ZXUA 2FFQA 3NDBB 4LY6A 3WYGA 4HDCA 2IEZA 3AKEA 4JYBA 2J0UB 2WIBA 2ORWA 1NIJA 3MAAC 4ZI3A 1W49A 4UQOA 2Z6VA 4UJ3A 2PX0A 4OK3A 4D2IA 1D2EA 4OHWA 1OXTA 4WVFA 3EWSA 1OLOA 3FYHA 1XMIA 3A1UA 2DWQA 4YXWA 1IXZA 2XSZA 1FZQA 3FVQA 1P6XA 4EPVA 1E1QA 1E9AA 3N5CA 4TLEA 1FNNA 4IDOA 4Z1MD 3EW9A 1Q57A 3I5XA 3QSYA 2MSDB 3KTAB 1XMSA 3SZRA 3KXLA 4HB4A 3RRMA 3KFVA 5EE0A 4Q9KA 1QHHA 2LKDA 4V0LA 1CXZA 2VTKA 5FPYA 2VPPA 3PQCA 2VP9A 4LCBA 5FBWB 1MT0A 4AURA 4G5OA 4YMTA 2HCBA 1Z2AA 4XH9B 4JLBA 4PSKA 2NTYC 4QBFA 2J7PA 2C9CA 2ZSDA 3LBNA 2ZRNA 1ZD9A 4XJXA 1FL9A 1OFHA 3OEEA 2I4IA 2VH5R 1YJ5A 3IILA 1P73A 1R6BX 5JRJA 4LPKA 2HEIA 4I1SA 3CUEF 2VYFA 2G83A 4U7DA 4EQ6A 3BC1A 4DUGA 5HKKD 2IUSA 3N70A 1WB9A 4YDSA 3QE0A 3K70D 2AFIE 4NP6A 2CXXA 4I99A 3NH9A 1LS6A 5EP4A 1NVWQ 2NPIA 2DPXA 4TMVA 1Z0DA 2WWYA 4BLSA 1IY1A 1SVSA 3AGQA 1NJFA 3BJIC 3AB3A 3C5CA 1LNZA 4HZIA 3SBEA 4OYHA 3GLHA 1UM8A 2TMKA 3QKSB 4QM6A 2YOGA 4QJ5A 3AGPA 3DOEA 4KFTA 3BFVA 4DIDA 2Q3MA 5FPTA 3VHLB 4NYMR 4PFSA 1NBMA 4B3XA 2WWHA 2XXAB 4B73A 1XCMA 4NONA 4C7OA 2ZI6A 2AWNA 1M7BA 2QRNA 2VSOA 3K53A 1YZLA 3U7EB 4JJZA 4ABYA 2VEDA 1OJLA 1YVDA 4B6EA 1CR1A 1MH1A 2ZJ5A 2F3RA 1Q1EA 1TQ4A 3VFDA 6Q21A 5C4GB 3GPLA 1PZNA 4MGZR 4W5WA 5KOYA 3ZIAD 2YYZA 4Z1MA 1A5TA 2FSGA 1BYIA 3O8DA 4LYFA 3O8BA 1COWD 1PJRA 3T1OA 1EFHA 4Q1DA 4YXWD 3B1VA 2OESA 5E7IA 3TRFA 3CO5A 4ESVA 4Q4JA 5EE3A 1NI3A 3A58B 3CH5A 4QKQA 3TUZC 4RCZA 3RRYA 1FMJA 4D4MA 2QENA 2LCFA 3OIWA 3CX6A 4JLDA 3AVWA 4OI2A 1TQ2A 1OB5A 1U0JA 2EU8A 4LBWA 2CNWD 1I4TD 1RFLA 3PUYA 4D0NA 3VTKA 4DDWA 1TMKA 3FHCB 1W47A 4TLAA 2O8DB 1AN0A 3ND8A 3NG1A 4F7WA 3VU9A 3SJCA 3DOFA 4B44A 1J70A 4TL9A 1LV7A 3IO5A 4QC2A 2WAYA 2ZUDA 4C3ZA 2OFXA 1KIMA 3HJNA 2GVZC 1TQDA 4UNRA 2BM1A 4NYIR 1TADA 1TUIA 2ZRCA 3VNVA 5FOWA 3QG5A 5FL3A 2BM0A 5LD2B 1OIVA 3LLUA 1G291 2O8FA 2AD1A 3NBYC 2GBLA 1GOTA 1UFQA 3B9QA 2FSHA 4NTZA 5KSPA 2ZRLA 4BLTA 4C0JA 1RRFA 1N6KA 4KJZA 4R9UC 1UKZA 1TNDA 2NPFA 1BYUA 2D7DA 1M7GA 3PFIA 1XEFA 2JLQA 4CDGA 3U6KA 1J8MF 3ZVLA 2OUKA 2Z83A 4LRWA 3KUDA 3GLHB 2GEVA 2NO7A 1GP2A 5CJPA 5FOXA 4W7SA 4M4SA 3GLIA 4DCVA 1IAQA 3TVTA 3MGCA 2NZJA 2PJRA 3R9IA 2J87A 2H5EA 1RVDA 2EFGA 2R2AA 3ASZA 3BFXA 4MRRA 3I3SR 1ZUNB 2GTPA 2F6RA 1OH6A 2IXEA 4QBHA 4TMXA 4B3FX 1DAIA 4R98A 4MKIA 3TH5A 5GJVC 5TDHA 4A15A 3SQWA 4M9QA 4PC1A 1PVOA 1YZTA 2AK3A 1FUKA 1LW7A 1RJ9A 1N6NA 2JAQA 4X8MA 4F92B 4XWOA 2QU8A 2ZYVX 4B43A 3VKGA 4HB3A 3SS8A 3VR6A 4Q1CA 2WZQA 1SKYB 1R0YA 1NNEA 2RHDA 3NXSA 4QHTA 1G20E 2PZFA 1G4UR 5AUNB 5KYKA 1KK3A 5JS8A 4MDFA 1Q0UA 5H1YA 5C18A 3TIFA 2Q3HA 3A6PC 2IS2A 3UMFA 2GWHA 3SN6A 3QPVA 3K0AA 4A6PA 1W2HA 2XEXA 4AIIA 3I1FA 1XCPA 2OBNA 4CZ2A 2GAAA 3N2IA 3K8YA 3KKQA 4NU0A 2V7QD 1P62B 1VKJA 2HXYA 2IBMA 5AJXA 5DI3B 2EFDB 1W7AA 2VSFA 4A2QA 5CIWA 3M1IA 4RZXA 3RLFA 2V55B 3W6PA 2RGBA 3ZDQA 2ZSEA 2XNDD 4ITRC 3SR0A 2ZS9A 3RABA 1XD8A 1ZNYA 1UKYA 3MWLA 4MA4A 1DO2A 1S96A 3IHLA 4PAQA 2ATXA 4PQYA 3VX3A 3AQ4A 5SZKB 1GG2A 1Z06A 3AVPA 1Z6XA 3C4JA 1LFDB 2QY9A 4JVNA 4UXJA 1G3RA 5J4VA 2HF9A 3LXRA 1PUIA 2BEKA 2QP4A 3W5IA 1V43A 2QPTA 4FMBB 4DUGD 1Z6AA 3K0SA 621PA 2ODNA 4DJTA 3PEWA 3L0PA 2BBTA 2O52A 2QMOA 4W5HA 1Z8FA 1JXOA 4KFUA 2PH1A 2HLDA 3LH5A 3OEED 1OW3B 4LYHA 4RZUA 3AP3A 4XVQA 3AF2A 1F2TB 2GRJA 2NOAA 3AM1A 1QHXA 2ZRDA 2IWHA 3G82C 2A9KA 5KHOC 3UPUA 1DG3A 2P67A 1VDZA 3DVLA 5L3VA 4OI1A 4RVCA 1F60A 2ZRJA 3LY5A 1BKDR 5C2JB 1XXHE 4RFVA 3UMSA 1UJ2A 3RVBA 2C04A 3L8ZA 4Q1EA 4PPGA 2ZAMA 1XMVA 4QNMA 1W4AA 3PEUA 5KDLA 4XIGS 2C2HA 4JL6A 1XWIA 3O47A 2JDID 2CHVA 3GJXC 1SKYE 3KZ1E 3DDCA 1U9IC 2H57A 1JBKA 3AVTA 2QZ4A 1XD2B 2QMEA 4EPWA 3SJZA 1OXUA 4E03A 1RKBA 4HAYA 3UMRA 1YU9A 2ZSBA 1Q21A 2GZHA 2ZI3A 3LWNA 4RCYA 2A5JA 1NN3A 3LXXA 4URXR 3FFBA 1HUQA 4QJ3A 1X1SA 2Q3FA 5HCIA 1IM2A 4HDQB 2P3SA 3PUWA 3WP1B 5JSZB 3A37A 4M1OA 3RNLA 2P6UA 5A5GA 4RZ2A 1MOZA 4P3YA 3JZMA 4GFDA 4PXAA 1G1MA 3WNCA 1DAGA 4QGHA 1S3SA 4BLQA 4KXFB 5BN5A 2J3EA 2FPKA 4BECA 3KJEA 1P2TA 2OV2A 4C0AC 5J47A 2YV5A 3WP0A 4FMCB 3QEOA 5EZ5A 1RW4A 1IY2A 2QTFA 4YDHB 1N0UA 4X8LA 3KKMA 2JATA 1CRQA 2IXGA 3S1AA 2E87A 3HDTA 5EJEA 2CNWA 4M9ZA 4BFTA 4KO8A 4ERNA 3EPHA 2PX3A 4FWIB 2BOVA 2WWFA 1IN8A 1JPNA 2PLFA 2FGKA 1E0KA 2IYRA 5EXTA 3TAUA 4B71A 1QHSA 3SYKA 3OAAD 2GJKA 521PA 3HU2A 4TL7A 5J4YA 1Q12A 2DY1A 4YC7A 4WW0A 1W5TA 4HAVA 1CLUA 3U6BA 3KUCA 3GLIE 1E0JA 4AC9A 2GF0A 1COWA 4EAQA 2FOLA 2VBCA 4C0KA 4JLNA 3GJ3A 2WHXA 1HYQA 4QJ4A 3TR5A 1PUJA 4KU4A 1NMZA 4US2R 1VTKA 1XXHB 4P4SB 4KITB 3D7MA 4P4TA 2W0SA 4RKFA 1SVMA 1ZIOA 3PVSA 1OHHA 4JZKA 2B21A 2RCNA 1E9CA 2IX3A 1QF9A 1G5RA 2L0XA 2NO0A 4OQXA 2FG5A 1E2IA 4QOSA 1UPTA 1W0KD 2ORIA 2V6IA 4LV8B 4OK6A 1HE1C 3ZS9A 3GJ5A 4C0HA 1CRPA 2PL3A 4Z8YA 5FTKA 1E79D 4LWZA 2D4HA 1RZ3A 1GUAA 1OPXA 3LX8A 4LUCA 4Q9HA 1KI1A 1IXRC 1E69A 2RGAA 5JS7A 2HV8A 2WSSD 4MRNA 1XJQA 1UBEA 1Y63A 1KI8A 5DN6D 3ASYA 4LJ5A 2O0HA 4ZDWA 2PCLA 4CIDA 5E7MA 4JVLA 1ZNZA 2CL6X 1GITA 2OILA 2OO7A 1OIWA 1KO7A 2JJ2A 4G5RA 3FOZA 1Q1ZA 4Q1BA 4BEJA 3B1WA 1E2GA 2UKDA 1XZPA 4TL8A 1ZUHA 4HAZA 1P2VA 3EXAA 4HLUA 4JT2A 5G41A 4A8JC 4KVGA 4JYCA 4YONB 4YMUA 5HKKA 3CRVA 1G6HA 1GNPA 1G4AE 1US8B 2VL7A 3BAFA 3SJAA 4PAMA 3KQLA 1DELA 1JEDA 3VR1A 4ASUD 4BFWA 1HTWA 1XMJA 2BIFA 2DFLA 3AKYA 3LRPA 1L4UA 4KBGA 3WHLA 1IXSB 1GIAA 2VIIA 2GK6A 4FCVA 2C98A 2QP9X 3DM9B 5DNYB 1TF5A 3QJYA 4B3GA 1BIFA 4RD4A 1N0VC 1EFRD 5KTYA 1HE8B 3P20A 5FH9A 1WP9A 2B8TA 4DBLC 1YKSA 1D9ZA 1EG7A 4IOJA 1KJYA 4D81A 3O8RA 3KJGA 3RANA 1T6NA 1OXXK 3PEVA 4KSBA 3LX5A 4A4DA 3W3ZB 3NDPA 2EWVA 2IYXA 3CX8A 1N6OA 1KI6A 1SXJE 1XEWX 2OBLA 2WWWA 1IJFA 1AKEA 4EQ6B 5JWRA 1Z6YA 3ICEA 1J8YF 1T3HA 2JJ2D 1XXHA 4EIWA 2YWFA 3FMOB 5P21A 2QM8A 2V4ZA 4LHYA 1DO0A 4JKIA 1I4DD 3I5YA 3W5JA 1FQKA 2BKUA 1N5LA 2CCJA 2NG1A 4R2IA 1DADA 2NZ8A 4OI4A 2CCGA 3IPYA 2QBYA 2RGGA 2C9OA 4XSHA 1W2GA 2PMKA 3LVQE 3KQNA 1NVXQ 4OHYA 1VG8A 4M0LA 2QRZA 4Q4AA 4N0DA 2DCUA 5CYOA 4Q4JB 4OHXA 3PJRA 5FPKA 1TL7C 3SDZA 1JPJA 3OZXA 4OK5A 4QHYA 1GAJA 2JLSA 1SGWA 2XB2A 1YRAA 1GL6A 3AVUA 2HUPA 3G5UA 3QXSA 1ODFA 2J0VA 1G7CA 2C77A 5KSZA 2QE7A 2MSEB 2G3YA 3QIAA 1HQCA 4QBGB 2FPMA 2D2EA 2Q0HA 3PV0A 1G7SA 4C0QC 4HLQB 1YZQA 1T9HA 2V8OA 4B75A 4ESHA 1WBBA 4W9MC 3IKJA 3UIEA 2WPDD 1W36C 2YC2C 3HYRA 2CHGA 2R65A 3GLFB 4TTQA 1JR3E 2GXQA 3CM0A 2V9PA 2NQ2C 1KNQA 3GJ8A 5AJWA 3IQXA 3EZ6A 1ZINA 2QT1A 5DHAA 5DGXA 5FUVA 1VYVA 3CR7A 4B2IA 3GLFE 2FSIA 4A6XA 1X8LA 4KFRA 2QAJA 2FEMA 4HYYA 1NSTA 3BBPA 1JI0A 2N42A 3WBKA 4MGIR 5TVKA 3UKDA 2RGNC 3Q5DA 5DSZA 2F9MA 4BLOA 4TWZA 4LC0A 2GJ8A 1A82A 3GLHE 4IDNA 2UVQA 4HZUA 3TK1A 4Q4HB 2R9VA 1E9DA 2YWEA 3OIVA 5EP3A 2A78A 2FFAA 4V0MA 3WMGA 3QG1A 3R8CA 3B60A 4P31A 4HATA 1KAOA 1P5ZB 2GCOB 2Z43A 3TVDA 1OFTA 4GOKA 421PA 1N2CE 4URUR 4KYUA 1FMLA 4ZO4A 4A92A 3FDIA 3MG9A 3ICQB 4HAUA 3NIBA 2CEAA 4KV9A 5D3MA 1XRJA 2IF0A 3AKCA 2HYDA 5IDVA 3X2SA 1KNXA 4M2LA 1OIXA 3TMKA 2W6ID 2N1BA 4LC1A 2GXUA 4TQAA 4NCJA 5KSYA 1NY5A 4A8JB 4TYYA 3BE4A 1E99A 2ZRHA 3CPEA 3BK7A 1WXQA 2GJ9A 4U5XA 1YR7A 4OL0A 3UWOA 1E96A 2ZI5A 1VHLA 2RGDA 1SVKA 4LJAA 1ETUA 5AK0A 1LB1B 3KQUA 2OE2A 4CEJA 1R8QA 5JWHA 2J46A 1W1WA 2OHFA 4MRVA 1UAAA 1E2MA 5B64A 1JQLB 3AP1A 1KI9A 1F2UA 3IEVA 4IW3B 1P2UA 4M21A 4DVGA 2JLRA 4Q21A 2JIZA 1II0A 4V03A 5H68A 4DLZA 4FI3C 3C15C 5E4FA 4O2RA 4GT1A 4IEEA 5F3WB 4LGMA 4MKHA 1JECA 5JI2E 4DHEA 1GKUB 4IXNA 4NCKA 1UADA 2ZE8A 1OE0A 1OYYA 4DT1A 1Z6GA 4AKGA 2JIZD 4RD2A 3EZFA 3DMDA 3KKOA 1FX0A 4BQSA 1Z0AA 1Q20A 1TEVA 2ZE7A 3WNDA 1LF0A 4MKGA 3IBYA 2ONKA 4IVPA 3V00A 2QTHA 2QTVB 5FL7A 3W6NA 5KPJA 4GZMA 1E2DA 3K09A 3QKTA 2GVDC 1F5NA 3PG5A 5CJ2A 1Y3AA 3DO6A 1MR3F 1GZSA 3A4LA 4L9WA 4AI6A 1R4AA 2VP6A 2PCJA 4B35A 4D80A 4GL2A 1AZTA 2VHQA 4BZQA 4CVNA 3U3OA 5GVSA 2D7CA 1XPOA 5GJBA 3AF1A 3FKSA 2Q6TA 3K09C 3H1TA 3JVUA 1W0KA 3X1WA 5FTLA 3ECCA 1XF9A 4MGKR 2W6IA 2C99A 4M1WA 5HR5A 2DBYA 2GCOA 4DKXA 4M9SA 1T8TA 5ELXA 4OI0A 2XX3A 5CB8A 2X2FA 4IVQA 1E9FA 1VCNA 1XJCA 2ZRBA 3HPQA 4GI7A 3G0HA 1YZUA 2IL1A 4C7OB 4AG5A 2ANBA 2YKGA 3Q3JB 2FMXA 4KAXA 4AKEA 4PHHA 3VQTA 4Q1AA 1NN0A 1E79A 1TX4B 3VR3A 4KODA 5KUTA 1KZGB 3D31A 1X6VA 1II8A 2QI9C 4WZ6A 2B7CA 1ZM3A 2IT1A 3CF0A 3UATA 3MRSA 1UBGA 4KYIB 4AWXA 4Q48A 4G01B 1XDBA 3MUFA 4BFXA 4EJSA 1NVVR 3NBZC 3GQBA 4URZR 4IFBA 2D06A 3AVQA 2WKQA 3HP1A 2FJUA 3HR7A 4IRUB 1G7RA 2UZ3A 5A0FA 3ETLA 1AQYA 1W4BA 2H1LA 4BLPA 5JSZA 5KDOA 4RKEA 3DZDA 2WBLC 1XNJA 2RGNA 1ZVQA 4ON9A 3GP8A 3GFOA 5DLQC 2WOJA 3TLXA 3A4NA 1OV4A 1Q3HA 3QBVA 2RH5A 1WQ1R 4JLAA 2ZJAA 3LFUA 3WRXC 1M6NA 2NO9A 4LJYA 3MWJA 4TT3D 2F55A 4BPBA 5EUQB 1N5IA 2O5VA 4QHSA 1SVOA 2A30A 4ZDIA 2IYUA 2CL0X 1OB2A 2VQSA 1OKKA 2VLIA 1QHIA 5JCPA 2NO1A 4L9SA 1F6BA 3S1AB 1F48A 3THYA 4BFZA 1G8GA 2CE2X 2ECKA 4XVRA 4IDHA 2ZJ8A 5G53C 1PLJA 2C95A 2AWOA 3AH8A 2B92A 4TZ0A 3CRRA 1SZPA 1L7VC 1R0XA 4IKEA 1VYUA 4LBVA 3EA0A 4OJKA 4Q03A 2QROA 1E9RA 2R44A 3A1WA 3DMNA 4H1UA 4GP7A 4DZZA 5JEEA 3EZ9A 2JDIA 3QNUA 4RSGA 5DE3A 5EE5B 4ZIRB 4B47A 3HR8A 1KMQA 2BEJA 2W2XA 1ZU5A 3SHFA 2GBLC 4GSYA 1KDTA 2DFNA 3GFPA 3U3JA 2XGJA 1E2KA 3GJ6A 3VHXA 4EFNA 2AD5A 3W3AA 2F7SA 2RGXA 1AK2A 1L8QA 3OESA 2ZIAA 3X1YA 1A1VA 4JLJA 3V4RA 2QGNA 2ZS7A 3K9LA 4CRWB 2F1HA 4A2PA 4YMSA 4O3MA 1WRBA 3EWAA 2WV9A 4RJLA 3TBKA 4UXIA 2X8AA 2DWPA 4NL4H 2HF8A 4OQFA 1Z5ZA 3K9NA 5DYGA 3T15A 3SQXA 3EPKA 1XTKA 4O25A 1Z07A 5KPDA 1F3OA 2PT5A 3FMPB 2FWRA 1S8FA 1S1CA 3K9GA 3CRW1 3U44A 3F8TA 3VKHA 2ZAOA 2WM9B 2ZI7A 3CNOA 1UKEA 2OFWA 2XB4A 1MABA 2DFKB 4R71A 4P33A 4IOLA 4JL8A 3BXZA 3QUSA 5CLLA 2QPAA 3DHWC 1XPUA 5HZKA 1E2FA 3ZVRA 1E2HA 2G88A 1VCMA 1WF3A 1E1RD 3EX7C 4MQBA 3QXJA 4B3BA 2ZYWX 3HU3A 3SC3A 3HU1A 2VHCA 3K0FB 1TQ6A 5KU1A 2CVFA 4PC2A 4HUQB 1KTVA 2CCKA 1IBRA 1T4GA 2H92A 4IVRA 4L5BA 721PA 4MUBA 1J90A 3AVVA 2AXPA 2YJTD 4GNKA 4LV5B 2BBWA 3FKQA 2ANCA 2V7QA 3NVAA 3MCAA 5SZJA 4BZPA 3RC8A 1HEIA 2XTMA 4HB0A 4GDFA 1GKYA 1ONBA 4Q1FA 3L0IB 5IHPA 3CBQA 4HDOB 3L8YA 4JVMA 3Q85A 5FFMA 2ZRGA 3W90A 5FR1A 1E1RA 2YOHA 1OSNA 4F91B 2BJVA 2ERXA 2FPLA 2WJVA 4EDHA 1KSHA 2AXNA 2BMFA 2ZPTX 5JJLA 4D82A 1A2BA 1AGPA 2YWHA 2ZREA 3BD9A 4QGFA 2J45A 2R6AA 3I73A 1Z0FA 4PPQA 1DAFA 2DHRA 4CEHA 1ESNA 2WSSA 4C0LA 1XD9A 4D4JA 3CONA 1P72A 3X1DA 1YZKA 2XZOA 3U7FB 4AYTA 4DEXA 1KDRA 2QP3A 4GBMA 3EPJA 1T5IA 5JZVA 3FB4A 4QNRA 2BMEA 2VP4A 2DB3A 3K70C 4B74A 4TSFA 2OFOA 3FFAA 4IEIA 3CIOA 5E7JA 4QGAA 2WIAA 2JJ1A 2JCSA 2H8KA 3P4YA 2P6NA 3BH6A 1I2DA 2XOKD 3OE7D 4E09A 3TUIC 4ARZB 2OXCA 1H8HA 1ZM9A 4BFSA 2J59A 1FP7A 2NGRA 4CEIB 1KZ7B 1P61B 3QENA 4Q4AB 4Q9LA 4JS0A 5KNBA 2KWIA 4TQ9A 4LJ9A 4FCWA 1U0HC 1XCGB 4UJ5A 2A3RA 2G1JA 2F3TA 4NPHA 5FUXA 1TTTA 1QHHB 4JBXA 2G1KA 3MWYW 3E2IA 2W83A 2RB4A 1T5LA 4LHVA 1QVAA 1FUUA 2ZANA 3RDPA 3VR5A 4UKDA 3V4FA 2Q21A 4BLRA 4H9GA 2ZEJA 2A5GA 2I1VB 2YHSA 1M2OB 3NEYA 5CIQA 5FOTA 3RYTC 2QAGC 4JJKA 4TQUS 1N6PA 5EZ6B 2HT1A 5F9FA 3GLGE 5L8VA 1KJZA 3EC2A 2W2VA 5KO2A 2X2EA 1G9XA 1GVNB 2VP5A 4DLUA 4DSTA 2WPDA 2W0MA 2X19A 1P9WA 4I4LA 3RRZA 1T91A 5DHFA 2ZVQX 3CRMA 5FR2A 4D0LB 3BERA 4QM7A 5LD2C 3AEZA 4U02A 2IS1A 1CBUA 1E4VA 1ZCAA 1FQJA 3THWA 1V5WA 1ZM4A 1KOFA 5JECA 2CMKA 2IYVA 3RSOA 5G40A 3REFA 1I2MA 2WVJA 3NH6A 4MUAA 5TV2A 4AYWA 5KSOA 2JASA 1Z08A 2PT7A 4FMDF 1EXMA 5EUMA 2AKAB 5HCNA 1M8PA 2ZRAA 1AS0A 3GCGA 3GLFA 4PR0A 2Q9AA 1HQYE 1XP8A 3A8TA 4AYXA 821PA 3BORA 1MV5A 1JALA 2XNSA 4PC7A 1YR6A 2ASEA 1EFCA 3LW8A 4V0KA 1CJKC 3EIQA 4LJ8A 4GMDA 4F4JA 3THXB 1ZJ6A 2JGNA 4OBEA 1E94E 1X1RA 1XTQA 3SI7A 3ZD6A 2GAOA 2P5TB 5CLQA 1M1YE 1R5OA 1G7TA 4M53A 2REXB 1R5BA 4PPFA 2ZRPA 1VMAA 3T1QA 3IIMA 2FA9A 4ACAA 4CW7A 3ZH9B 4EFLA 1E9EA 2WJIA 4K8OA 1IJEA 2QAGB 2J7KA 2QSYA 3EPLA 2C03A 4TTRA 3CZPA 3I4LA 2R6DA 1HH4A 2DYKA 1NJGA 4ZI2A 4NYIQ 1WCV1 5KDDA 2FH5B 1D8TA 1I4LD 2WAXA 2B6HA 2JJ1D 5C4MA 3D3QA 2HDNB 3OFNA 4P32A 4KFSA 2CLDX 3RS7A 1UEIA 3C14C 1N3BA 4TSFD 2ORVA 1C4OA 1DE0A 1JJ7A 4JIMA 2GCPA 1S4QA 1O87A 4II7A 2FSFA 3CB4A 4ZKDA 3TKLA 5JFGA 1U90A 5L3RA 3BH7A 4I81A 3SFVA 4PHTA 2Z5FA 3JZAA 3NHAA 2VHJA 1IN7A 4V02A 4ZCMA 3THXA 1U99A 1AIPA 3B8HA 4PO8A 3PXGA 2VRWA 3WMFA 4FD2A 1MO3A 5B2ZA 4JLMA 2J1LA 2ZI9A 4NKRA 4XTRA 4AKHA 1G8FA 3T1TA 121PA 1Z0IA 1ZC4A 2F43B 1GNRA 2ODWA 2BMJA 3OEHA 3ZVNA 2PZEA 1GILA 5CYPA 1NVUQ 3BIFA 4NMMA 4TLBA 3O8CA 3QI2A 2XSZD 4PAOA 4J0QA 3L43A 4F4CA 2ERYA 4RFSB 5HZHA 3FMFA 4HAXA 4NHOA 3P1JA 4K81B 4A2WA 3TJZA 2CE7A 4BZXA 3P4XA 2YNMA 1CULC 2ZUBA 5DIFA 1JXMA 1OH7A 3QF4B 3OFND 3KKNA 3I32A 3PCRB 2GK7A 4OHZA 5ANRB 2CBZA 3TAHA 4DT1B 2Y8EA 1KI6B 4X8OA 4DCUA 1G3UA 3AF4A 4MRSA 1ESMA 3RWMB 5FPSA 2XTNA 4B3DA 4EPXA 5IF9A 5BQ5A 4DSOA 5BYJA 2J5XA 1G5PA 1CKEA 1W44A 4Q47A 1R0ZA 2O8FB 2IC5A 1UF9A 3AVOA 2VF8A 3D6TB 5J40A 2HCJB 1ZMXA 4OQMA 1KO1A 4FN5A 1IY0A 1W36B 1IN5A 2QEQA 1XBTA 5AJVB 4DLTA 3R8FA 3LD9A 2GZAA 2P2LA 3AV0B 3BH0A 5DI9A 4NZYA 1N6RA 4LJ4A 2X77A 2KBFA 3BGWA 5TARA 2MSCB 5FOVA 4B76A 4DLXA 4EPYA 3QVUA 2V54A 3CPHA 4S2EA 5B30A 5FI1B 4US0R 5KNCA 2AX4A 2FNAA 3FHOA 4LX0A 4M1KA 5AJYA 3RSLA 2EWWA 2CHQA 3CF2A 1IN6A 3GEEA 2CJWA 3WXMA 4URVR 4DIEA 3GJ7A 1OH8A 3CX7A 1YR9A 2I3BA 1EWRA 1UBCA 1KMHB 4PC3A 4ZCLA 1RJ9B 2RKOA 1XEXA 5HPYB 1N6LA 2G0TA 1ZU4A 2O8EA 1WDTA 1NF3A 3REGA 4TYQA 4S35A 3UG7A 1MO4A 3C8UA 4PZYA 2IYWA 3PITA 3W8RA 2XTZA 2RGEA 3IQWA 3T06B 2IYQA 3NBXX 3THYB 3B5JA 4GPTA 3FHTA 4PHGA 2F43A 2OCAA 5FUWA 1GKIA 4D4KA 2VSXA 3ZZTA 2ZRKA 1CEEA 1U81A 4Q4HA 3BOSA 4BRUA 2XITA 3V9PA 2D3WA 1ZNXA 4UXHA 1GNQA 1MO5A 3X1XA 1XTRA 3TR0A 3E5HA 1U2RA 1NL3A 5LB2A 1RRCA 1CR4A 2GKSA 1G16A 3SYLA 2VP2A 2O8CB 5JLJA 4TZ6A 2JLYA 2PBRA 3HWSA 1WBDA 4V0NA 2UZIR 4WBSA 4DEYA 2GF9A 4TTPA 5D3QA 2ZRFA 1SXJA 3B13B 3NBFA 3BB4A 2ZR9A 1KMHA 1S1MA 4JT4A 3ZJYA 3H2YA 4D25A 2H18A 4LBYA 3CZQA 4UNNA 4AD8A 1FX0B 1TF7A 2R62A 3CF6R 1Z3IX 2WTUA 3IHWA 3DKPA 2OM2A 2YVUA 2EFEB 4B48A 3RAPR 1KO8A 3ZGXA 5EE9A 4BFUA 1E9BA 2D62A 1XD2A 4B34A 2RMKA 3MMPA 4CGZA 3TUJC 4D6PA 3U4QA 5FTJA 4EPTA 1BH2A 1D5CA 4POAA 5L3QB 4MKFA 1NBMD 2IUTA 4DXAA 1YR8A 3C7KA 1JR3A 3ZZUA 3NC0C 3SNHA 1W4RA 4C2UA 4PPNA 2NMVA 2CK3D 2OZEA 2ZJYA 3BFKA 4PSAA 2BBSA 2ZYTX 2RAPA 4HLUC 3Q9LA 3P27A 2OG2A 1N5KA 3VU9B 2A7QA 5FL7D 1SVIA 3Q8XB 3I92A 3C16C 4FMDB 4WXPA 1H8EA 2WMNB 2OLJA 3IUYA 2QQ0A 3ZD7A 4YMWA 4DB4A 1KK1A 2O8EB 4DDVA 2AR7A 2O8BA 3ZYCA 1MRSA 2G0NA 2VP0A 1A2KC 4M1TA 4NBSA 1E1QD 4NDZA 5HE9A 2GNOA 1YE8A 4NYJR 4URYR 3OIUA 4V0ME 1IOZA 3FKSD 2QMHA 3VR4A 2WOOA 4EUNA 2WJJA 1LS1A 2O0KA 4LYJA 1G3QA 1NN5A 4UNQA 3U4QB 1FTNA 1WMSA 2WSMA 1RPZA 2OT3B 1R8SA 3T5GA 4EJSB 3E1SA 2QG6A 1KDPA 2E1RA 1KO4A 4DCNA 1G18A 4BASA 2G77B 5J4HA 1OFIA 2Z0MA 4TLCA 1EX7A 1K5GA 3QPWA 3K70B 5FOSA 1QHGA 2N46A 3EA5A 3FWYA 4OQLA 1FOEB 4A1FA 4Z54A 2IA5A 2PJZA 4LYAA 2OLKA 2CLCX 2MMGA 2F1IA 3GFTA 2GETA 3ADKA 4XD7D 3T5DA 3PEYA 2F1RA 1S3GA 1SXJB 1T3SA 1NIPA 2YC4C 4E07A 2FZ4A 3LQQA 1Z0JA 3M4YA 1NKTA 4QGGA 4TMZA 4Q02A 3ND9A 4BGDA 2P65A 4BFVA 4QG7A 4MDEA 4JVSB 1OHHD 3RC3A 2GESA 2CVHA 2ZJ2A 2IYLD 3AP2A 4JL5A 3VNUA 3QF7A 5TB5A 2D2FA 2B8WA 1FNMA 3K0EA 4KVAA 4KLZA 2RHMA 5CB6A 4MITA 4XVUA 1OT3A 1EFTA 2ODEA 4FMCF 4FXPA 2IYSA 4OKSA 5BWMA 5SZIA 1TAGA 3KB2A 1CR2A 1MO6A 3T61A 5DISB 3AF3A 3U3KA 3VR2A 1EX6A 2R6FA 4MYHA 3W8NA 2IYYA 1Z47A 4ZIRA 4JBWA 3LLMA 3R9WA 3KB1A 4W5JA 1G3IA 1A7JA 2ZSFA 2JLVA 4G5GA 1KYIA 2GEUA 1AJEA 2WJGA 2A5DA 2ZE6A 1NG1A 2ZUCA 3MJHA 3NC1C 4GZLA 4P4SA 4UNPA 4DLWA 1XFAA 3FMIA 1QG2A 1E2JA 3KXKA 3NTUA 1ZCBA 1E2QA 4EJSC 2ZR0A 3HYTA 1ZRHA 4K46A 4N0EA 4ARZA 2BJWA 4XOIA 1E3MA 2GDJA 1DPFA 2Z4RA 2ZE5A 3LVRE 2FEOA 3IIJA 3THOA 2JLUA 4N1AA 2QN6A 5EP2A 2REBA 4DB2A 4Q01A 3B1YA 4HAWA 1NP6A 3U7GA 3GJ0A 4JKYA 3RHFA 1SHZA 1CJUC 2IK8A 2PEZA 4IOKA 5K8TA 2KBEA 4TT3A 4TN1A 2XZLA 1HT2E 1M34E 1C9KA 2EFCB 1AGRA 3DEFA 5FBQB 3LA6A 3T12A 1IHUA 3B7GA 4EPRA 2IYZA 5BN3A 1SVWA 2EYUA 4IFEA 1KHTA 5JWOA 1RYHA 1XJ0A 1KI3A 1NBME
chains in the Genus database with same CATH superfamily
1X9GA 4RPLA 1S2MA 1Z2CA 1K4YA 2M1XA 4QL3A 3TZHA 1S2IA 1O5TA 4B2LA 3TR6A 2ZYRA 1W9HA 3IUJA 2C96A 1I6LA 4XIYA 3S8YA 3T4PA 4I9GA 4TZKA 3UMMA 3P97A 4YRJA 4IXMA 5K3AA 3ZX4A 4UZSA 4DCOA 4K6HA 3TD9A 3A05A 1NU6A 1ZM2A 1B43A 4Q7LA 1U5BB 5JBIA 1E98A 1KL7A 1GGFA 1IHYA 1PG2A 3HCOA 3KDSE 5JZOA 1ULZA 1ZMRA 3FPAA 2II6A 4FEEA 4YPFA 4RY9A 2BV3A 2JFBA 2R4UA 3AESB 1DS6A 4F2WA 2DF8A 3DW3X 4LRTB 4G0PA 2VATA 2COEA 1W25A 2EW1A 3QVGB 2VT6A 5I8PA 2N75A 4M1ZA 4KX3A 1BX0A 2VWQA 4HF7A 4D0GA 1Q3KA 2E4XA 2HMYB 1OI4A 4G5HA 5HE8A 1C7ZA 3L2OB 1KDZA 1DJMA 2JLXA 4X62B 4C21A 3VZQA 1T0JB 1AUVA 4G4GA 1YBVA 4KE9A 4KRXA 4DDTA 4EATA 1LNQA 3K4HA 4J9UE 1MFZA 1N9GB 1FBTA 1FQWA 3OCVA 3IUQA 3KIPA 5D7NA 2C61A 2JEYA 2XVYA 1U2SA 3ZHTA 4KSYA 1OUMA 5AI9A 1V47A 5KQRA 2DQYA 4LC9A 1AGXA 4JBYA 3EQ8A 3O4VA 4P22A 2ZDQA 3L40A 1FXWA 2ZKIA 4DV7B 1NN1A 2R48A 1SULA 3DTVA 3GZTB 4BE7B 4G0WA 1W5SA 3PD0A 1DBSA 2ECOA 2DPYA 3BGOS 4ER7A 3D59A 1YCHA 2GT1A 3WTBA 2IS6A 3E53A 1UBFA 3CN9A 2BPOA 1R27A 4QPNA 4OQQA 3GEBA 3BS4A 4CL3A 1LZLA 3D4NA 3GMTA 5I4BA 4HXGA 1Z4OA 2JGIA 4BFLA 5ECWA 1EFRA 1Y8RA 5KB3A 1OWNA 2B4QA 3E8MA 1M54A 3I12A 5IP5A 3BSFA 3FUTA 5LU9A 2C78A 2IXAA 1O54A 4WT7A 1KFKB 2OGZA 1YZVA 3Q7PA 3KUKA 1H69A 2P9TA 2FQXA 3WL4A 3JD4A 4JT9A 1GYQA 1C8VB 1TO6A 3DP9A 1XTUA 4PW0A 3CR3C 5BYBA 4LJ6A 4HLDA 2ZKLA 4M8NE 3SEAA 1BMFA 1SIBE 4IS3A 1R10A 4MJ7A 4NZ9A 1B76A 4U7WA 4Q9AA 1ZG3A 4KRGA 4RVOA 5ICSA 4HRAA 1N6HA 3L8FA 3PI6A 1Z28A 1U0RA 3ETGA 3L4BA 5U4QA 1GTL1 1U8ZA 5IMBA 9ATCA 1RBMA 2P0EA 4ZT6A 1KS9A 3BMNB 3C3CA 5D3MB 4QBIA 1JFFA 2VVTA 2C8VA 4MRMB 1KKLA 4ZRMA 1ZZGA 3ITDA 4K26A 3WNBA 1XA3A 1JE1A 2QZPA 1U2GA 3CW2A 1VGVA 3ZC3A 4J4TA 3AFMA 2QJRA 4MNTA 5B3JC 4OA5A 5I47A 2ZSKA 3AV3A 2YVKA 2WYHA 4YRZA 1QQAA 2QSZA 4AO6A 1DTWA 1DMSA 3I9LA 2J8ZA 3ORYA 3H8WA 2ZUWA 1Z12A 3PDCA 4YGXB 2C7QA 2W6CX 1QRDA 3A14A 4LCJA 1JYEA 1MC5A 2H54A 3ZY4A 4UAJA 4HAIA 2RAVA 5AK4A 3PGLA 2AYYA 2G4CA 2FF7A 1EDBA 4IH9A 4UHHA 3UNXA 4DLKA 4N03A 2I1QA 1HNNA 7ADHA 3SMVA 2ZJBA 1WU7A 2NAPA 4DG9A 5CB0A 3RC2A 2BC9A 4M9UA 4EF5A 4B2PA 1N9KA 3GA7A 3H0KA 2EZUA 4PHFA 1IL0A 1HL3A 1Y8CA 2DR3A 1C1YA 3NWBA 5DRTA 3SU8A 2G40A 1NLUA 1ZW6A 1ZM7A 3JQDA 4DRXA 3MBKA 4KUHA 3DOOA 2CXRA 1FP4B 3OE5A 1B0UA 3DHEA 4HJXA 2GZDA 5F9HA 3E3NA 4PCVA 1IWPB 3Q3CA 3L0BA 4R0MA 1VG9B 3M9WA 2ECQA 3K0CC 3NIWA 3FYUA 1D09A 2FK8A 1NATA 2HRCA 2YIJA 4OY3A 4B8ZA 1NG9A 2CVPA 1J8FA 1KJWA 4BQIA 3KSAC 3TQCA 1PG0A 1EWQA 4WXYB 5A62A 4PSVA 2AL7A 4BCDA 4YRTA 4F21A 3FTPA 2Q6KA 2CUNA 2WNIA 4XJVA 1NVVQ 3F47A 2C83A 3KWFA 2IOFK 1WULS 1XLUA 1QCYA 3GRPA 5CW2A 3A3NA 1XTIA 1EINA 1L0BA 3NBAA 4CYMA 2RK3A 1Y7TA 4XCQA 2ZWAA 3CWCA 2Z2JA 5IM4A 4HLCA 3A36A 2G28A 2XQKA 5REQB 3NTQA 3ANXA 1QP7A 4E51A 1L1RA 5J2UB 3MTBA 3MWEA 2HT6A 4LEIA 3KYIB 1CJMA 5JH7F 5FUBA 2HRQA 2AN9A 1GTVA 1L5YA 2B2NA 2GJSA 2FQQA 5FQOA 4C4YA 4DQDA 3CNLA 3VVMA 5JIBA 1JQAA 3GCDA 4IJWA 4MHOA 3L4JA 4MXDA 4ZMRA 1H93A 3PGKA 3WX0A 4MR9B 4EL0A 4HDSB 3F67A 4MYCA 4Z51A 5BWBA 4TTAA 3QPCA 4LYYA 1FP2A 3M7IA 3UGTA 4D96A 1G8JA 2FPRA 1RQ2A 4Q6BA 4Z53A 2GA8A 1KQNA 3ZTYA 4CMAA 4Q7KA 5TGDA 1EVLA 4L4YA 3R7WA 4EHHA 3NPAA 1KBOA 3ABQB 2A5FA 3DS8A 1SC6A 1FFEA 1GLVA 2NSDA 3K7EA 1WB4A 2F17A 1MAVA 2AOTA 2YMLA 5EKTA 2NZUG 3CRQA 3DP7A 1P4RA 3FUXA 3IUSA 4C0BA 2EHDA 1VYTA 4WLUA 4LSZA 1BJKA 4IZHA 3LTEA 4Q5IA 5CA0B 1O7JA 5L7TA 1ZK2A 4HEA1 4DC9A 5FOQA 2AFHE 3ZZ0A 4PG6A 1KYXA 4L57A 2Z1DA 1WU8A 2ZJ7A 5TMBA 4U1RA 5FTMA 2P1RA 1XJWA 1DARA 3ZV5A 1SCUB 4E5DA 4FWTA 1OI7A 1ZGAA 2TS1A 4GU5A 3G5LA 3EG5A 4EUKA 1P1HA 3OTOB 5KYWA 1MPXA 4RLFA 4KQHA 3SE0A 4XWTA 3TZEA 3GD7A 1UDCA 1FDOA 2HV9A 3EDCA 1TC2A 3IRUA 3M89A 2P6OA 2VNSA 4MZDA 3UUFA 4E15A 4I9UA 2PWAA 1ANKA 2MMCA 4UC0A 1HLFA 3KYDB 4HFRA 4B81A 5TMDA 3HWX1 2X0DA 2NIPA 3V4LA 1OMOA 3O3CA 1MHTA 1LY1A 2QY6A 1RQLA 5IXYA 3MSXA 2X8BA 2FUKA 4FDTA 1E32A 1GA6A 4BO9A 1J25A 1J8QA 4CV0A 3NBUA 3EG9A 3I9V1 2V1XA 2IZ1A 5C53B 1E8MA 3TG8A 1HDRA 2GYYA 2DT8A 1IEVA 3LTNC 3W77A 1C4WA 3IR7A 1AKNA 4BKUA 3OQIA 1E9SA 1KI7A 3EXHA 3FWPA 4RLQA 2JIBA 1GFSA 2CDNA 4RZSA 2Z4SA 4ACBA 4OFXA 3FCSB 1QF7A 1CIVA 2CUZA 2ONZA 1AS3A 5BWNA 4KI0A 4CM5A 1IHOA 5FOUA 4E1AA 3OQVA 5H8WA 1W48A 1RRKA 3CU5A 4HSGA 1CD5A 2W22A 2VTBB 5B1HA 2FZLA 5JD5A 1BVRA 3WISA 4HSEA 3RTCA 4EJFA 3ZW8A 4TKZA 2ZIUB 5K0CA 4YALA 1OAKA 2BDTA 2JI9A 3LUFA 4ZTBA 3DBLB 3AETA 3GVHA 3MTAA 2NUAB 4JSTA 1SU8A 1T1EA 3I2KA 4RIHA 2BTOA 3O83A 2A35A 4YLGA 1JHRA 1GDDA 1TPYA 5EHIA 4IIFA 5J63A 1YCGA 4Y9SA 5F35A 3S29A 4CQJA 1U94A 4DIUA 4XYBA 5F78A 5L51A 1YZHA 4PO9A 3SVZA 1V7CA 4UM8B 3DL0A 1B2RA 1NXTA 4G65A 5IC6A 2CZCA 3ZHOA 4Q4CA 2ICAA 4BB9A 1DO8A 3DTTA 3F97A 3TGPA 3FNEA 1SHLA 4U2CA 1W85B 1QV9A 4LBZA 2HQOA 5HF5A 4Y98A 2I7TA 1JLLB 4CIYA 3GR6A 1N4DA 2V4MA 1E2EA 1U63A 1AQUA 1P1KA 4E5UA 4CU2A 1NDUA 3AY0A 2RCYA 4YAJA 3ONWA 4L3WA 2ASVA 1IN4A 3ZE0B 4E7PA 5ARBA 2ZS8A 4Y0AA 3C5EA 5AI4A 3SR3A 1J56A 1JEOA 1N1EA 3R74A 3Q0TA 3R5FA 5EMMA 3UFBA 2RKBA 4WA7A 1KO5A 4MA5A 1U0LA 2X1MA 3B51X 5F73A 5C80A 1E2PA 3H1GA 3OHMA 4RK5A 4CNQA 5CGQB 1GAWA 2Y1DA 3LP6A 2VA8A 1E3EA 1ZI6A 2ZETA 4TV8A 1WKVA 5CITA 4ZV7A 4TMYA 1MOQA 2G8LA 2ZJOA 3JR7A 1WM1A 3ND7A 4PCUA 3T95A 5BN4A 3COJA 1Z0KA 5EI5A 3UICA 3ML1A 3IO3A 1ONOA 2CXOA 2Z58A 3E27A 3GRUA 4TTVA 1U7OA 3QVKA 4QFMA 4ARIA 1P7CA 1W88B 3CKLA 1G41A 2VDKB 4PZEA 5EMNA 1OVGA 5HF6A 4AY3A 1GRNA 3WBJA 3PPYA 1P0IA 3Q10A 5J4KA 8MHTA 1DC5A 1YJCA 4ZCPA 1Z6PA 4ROTA 3VYTB 1CG6A 2EFHB 4LOAA 1O0CA 3PDUA 2ADMA 1YV9A 4Q9IA 2EAUA 4Z9YA 2GCNA 2OXRA 2Q45A 4YREA 3WRYA 4BYGA 1UEJA 2JLWA 2PZGA 3C70A 2Z3WA 3EZYA 3N75A 3OAAA 4PYQA 4R68A 4YBZA 3KVNA 3TNFA 1G21E 5CM8B 5CLIA 1AUOA 5AKHA 3UXMA 5ADUS 5IFLA 3G1WA 5TNXA 3RJZA 4AJOA 4GOXA 4XSVA 3BILA 3MGBA 4G5XA 3KLMX 3I9JA 1XZIA 1QBKC 4OSEA 4Q18A 1L7XA 4BIIA 4XUEA 4P80A 5JXJA 4LVOA 4BO6A 3T9BA 1DAKA 3DEAA 5JHGB 3IE1A 4E5KA 4WK4B 1P3JA 4UEWA 4GPEA 4P3KA 3ONEA 2HHHB 1RAIA 2IUYA 5EY5B 2FFHA 3GXOA 3VISA 4GXNA 1K3FA 1PHPA 1Z7WA 2RBGA 3RAEC 3NUGA 2ZYAA 1FLNA 4M0FA 2WM3A 3USCS 2CB0A 1YNSA 4AF8A 1VIAA 4PC6A 2SHKA 3HKCB 2JPDA 1G8HA 4C4RA 4F2PA 3K1JA 2WFMA 3L7JA 3TJMA 1P1IA 2IYTA 1R0WA 4IQGA 1LSOA 2GJAA 4MAFA 2CL7X 2CUTA 1EX1A 2E49A 1Y5RA 2JK1A 4LPSA 4OQDA 4YROA 5CRIA 5IAOA 1ECBA 4MW5A 2O59A 3JRNA 1RWQA 5E3JA 8AT1A 5L6LB 5KYXA 4ER3A 2KI5A 3LYAA 2ZYIA 3H04A 1LQUA 4FUTA 1ML3A 1XX6A 1D7OA 3DLHA 1UBSB 3CW9A 5A1JA 1X2BA 2BRUC 2Q4BA 4N5NA 4YJHA 2HU5A 2PKRA 2VPWA 1ESCA 1C3LA 6AT1A 1D2RA 1G6OA 1DJQA 2YRWA 2CSUA 1M1YB 3P9KA 1X8KA 3U3RA 3ZW9A 3EDYA 3OLZA 2ZQYA 2HBQA 4DLSA 4BLWA 4N7MA 4MHSA 4QXAA 1ECJA 1JJVA 1WNTA 4EW2A 1BS1A 3GVCA 2WDPA 2G8NA 4R05A 4I9FA 4CIVA 5GOTA 3J7AC 1OTXA 4AP6A 5C8XA 1JR4A 3IEPA 5ESXA 2C88A 3VDMA 5FBLB 4UBNA 5JY1A 2EG9A 2ZTHA 2RGCA 1KY3A 1FW6A 1CVLA 1F2TA 1I1NA 2EW2A 2B4KA 1BXZA 3B89A 1M6VA 5B37A 1V8FA 1NJ6A 4MKZA 4Q9JA 4BP9A 2PRSA 3A10A 3IMCA 2A5YB 1A97A 2G9NA 4EB0A 4EMBA 3T1YB 4W6QA 2A1UB 3OIFA 3DVSX 2OFFA 3EUFA 3CG0A 5JCZA 5B55A 3GJZA 4GEKA 1ZAKA 3SBDA 2WWIA 4E14A 3MMXA 1TK9A 2IYNA 1PQUA 4ZDKA 2AN3A 1OCEA 5FUYA 1DGQA 3NV9A 1XK7A 3LBHA 5I6DA 1WY5A 3I2HA 1HEYA 4O02B 1QHFA 3EOAI 1ZJYA 3DUFA 3TCNA 1O95D 4H2DA 1NVFA 2HNAA 4CU5A 2K87A 2VF4X 1M7HA 1TU4A 1TF2A 3CT4A 3D4BA 1D0IA 3JARB 1Y6QA 5EUBA 4GC9A 4WL0A 5TJHA 3VU0A 1EI9A 4G37A 4DR7B 1O03A 1QONA 2FR8A 1HDCA 3ZUGA 1KAGA 2LWIA 4F6LA 2J3MA 5TXGA 5T41A 4OJMX 2W00A 3THWB 2E5WA 2YINC 4L50A 3ESRA 4HS4A 1RYEA 2ACEA 4BO2A 1JE0A 3GPIA 1KQOA 4XUCA 3ZDRA 5HQ3A 3BDIA 3VR6D 2QLTA 1DAPA 4YRBA 1T1GA 3SF8B 1I32A 3A04A 5K2MA 3RSGA 2QGZA 4DDMA 2AT1A 1YFKA 4RZ3A 1GADO 2NPOA 5HX7A 1E5VA 3M6FA 1PO7A 1SXJD 5JCOA 1NQWA 2OVFA 4RD0A 3P26A 2XXBA 3C97A 4PNZA 1QGUA 1A0OA 1PAUA 1NVGA 1BVYF 1RCUA 1BROA 1CUWA 2H3EA 1XAHA 3CGGA 3KJXA 1JR3D 3R4VA 5GJWC 2R11A 2FTKE 4ALJA 2ZDGA 4D8UA 3IL2A 1A9RA 5BN5B 5CTAA 1T9AA 2AK2A 1WUHS 13PKA 3KTFA 1E63A 4DILA 1HYBA 2H1VA 2H9YA 1GO2A 3WYNA 1U7DA 3OWHA 1JFLA 1IY8A 1CZNA 4X7RA 4WLVA 4D0SA 3DBRA 4M9XA 3TDKA 3CSUA 1TM3E 1KJIA 2JCXA 4ES6A 3PPVA 3UV6A 3C41J 2QTZA 4HQ0A 3GO4A 3EODA 3QA3E 4K9MA 3H5TA 3KU1A 1CY0A 5ITWA 2OAQ1 2RHRA 2GN8A 2Y66A 1JVNA 1N2ZA 2A92A 2RJ3A 2VXBA 3MCVA 3OHPA 3EF0A 4Q7JB 5CX1A 1XR3A 2IYFA 3B9PA 4URWR 1CUDA 1OGJA 2VA9A 3LDFA 2YJGA 2FEPA 4JC5A 4HS9A 2OQIA 3S3TA 1Z2EA 3IBGA 1E2NA 5JH7A 2BKXA 4EITA 2VO1A 3P2YA 3IH5A 5EC8A 4GWLA 1H2FA 1UJ5A 1VYHA 5TX7A 3SPXA 3SOPA 3N76A 5GM2A 3GEHA 1GQOA 3G6WA 2BHRA 3QLJA 5BV0A 2JG3A 3W4KA 1G6KA 2EZ4A 3K72B 1DIGA 3QEJA 1YI8A 3UANA 2O0LA 3ZR4B 3WL6A 4ALMA 2X4LA 4CKBA 1XPRA 3CUWA 3AVXA 3L79A 4R9NA 2WILA 2FQ1A 1NDHA 1NLYA 1QKKA 1TCVA 4H7DA 5BWLA 3N07A 3SVLA 1LU9A 1H9AA 1ZYUA 3CWZA 5FPQA 1TJ3A 1W36D 2X8WA 5BUQA 4WJZA 5CNIA 1Q0TA 1NMXA 2XCSB 2I2DA 2QN2A 4G3XA 5DO9A 2I5PO 3QVXA 5GVRA 3O2NA 1IBMB 2JLBA 1HA3A 2GKGA 2ZRIA 1HNWB 3KYCB 4Z0PA 3EPRA 4RTQA 1VLVA 1LDMA 2OFPA 1ZXXA 4KSCA 1MG5A 2HSEA 4LJ7A 4MWOA 4B83A 5EXSA 4YMVA 2EDCA 4PQFA 4Q9NA 4X1YB 3L7BA 1QU2A 2CLSA 3I62A 1N7GA 1H85A 1RVV1 4P0TA 5EQFA 2ATVA 2OK7A 2ZSAA 4XW2A 2H07A 4A2CA 1C7JA 4CWAA 4DA7A 3VOBA 5DZSA 1K7XB 4JC0A 5BSRA 1T0HB 1Z3CA 1I36A 2VPZA 1JHDA 2UXCB 3O4JA 4KMMA 2YHAA 5JRZA 4J75A 3TCKA 3LJKA 4Q66C 2XXAA 5KAPA 3OE7A 5HGJA 5IT9A 1Z15A 2ZXUA 4Y30A 4AY4A 2CNOA 4RKWA 1TM4E 3W9UA 4I4TA 4WLOA 4AUEA 2MSKA 2HD4A 2ORWA 1G0OA 3PTZA 3ZW7A 3MJDA 1OQAA 4L6IA 4IJUA 2BHSA 1XTBA 4V3BA 4B6PA 2H4JA 1F8UA 1UPUA 2JBWA 5A4AA 2Z4TA 2AMLA 4OHWA 4L74A 5KQMA 4PLGA 2IPLA 4WVFA 5L4LA 1LWNA 1K8YB 1OLOA 2GFHA 2FPSA 4U7PB 4WNIA 3A1UA 4G24A 1C30A 2DWQA 2LVBA 2ZCUA 1FZQA 4FXOA 4DJFC 1P6XA 3GEGA 8ATCA 1K3TA 4EPVA 2JD2A 4FGUA 1FNNA 1XQ6A 4MMZB 4L0MA 4OFZA 2VQ6A 3K1AA 3IJ5A 2WB4A 5K6AC 4X24A 5LZ4A 4M0CA 2N47A 2H2DA 4QPPA 4Q9KA 2LKDA 3DL7A 1JEQA 2YXBA 4RVGA 4EHJA 2XMCA 1U8FO 3C5VA 1M2EA 4NZZA 4LCBA 2HW8A 1R74A 5DX0A 4XH9B 1UH5A 3LBNA 2YICA 2B7LA 1MG0A 1ZD9A 5F21A 2W7TA 6ADHA 3KR9A 5IUJC 1WPRA 3KPVA 4DNQA 1OZ0A 2VH5R 2FEWB 1P73A 4O4IA 5CCBA 5JRJA 3TOSA 3NIDB 2DH5A 4KR9A 3KSBC 2M6SA 2OORA 3CUEF 2VYFA 4I1SA 4DFDA 1H2HA 1SBQA 4D79A 3I9MA 4EQ6A 4WBXC 1F7VA 1K2WA 4AZVA 1NC3A 1XMPA 1XL1A 1QM5A 2X2OA 1C9JA 1M66A 3MCTA 3N70A 2PUJA 3QFSA 3R3UA 4FKZA 4HY3A 4CV3A 5HUJA 1JHZA 1UC8A 2J08A 3L7NA 1KFJB 4I99A 1WXWA 2AYXA 5EP4A 3RUFA 4FDVA 3FUWA 2BHTA 3CO0S 5JDIA 4R3NA 3S7ZA 5JY6A 3VDRA 1DT5A 3DOIA 3VZPA 1DWOA 2H5JA 2G1PA 2HRZA 2JA2A 3V2IA 1SVSA 1NJFA 2IDJA 4P4GA 1FS5A 2P4HX 2FXIA 5CR9A 3MQ4A 2AUMA 1KYVA 1PJBA 5HGXA 1Q77A 3IE2A 2P1DA 4E13A 4R6WA 3WDMA 3W5AA 4JBGA 3LMKA 3DKRA 2WQ7A 4B85A 2GUWA 5EIOA 3K32A 4QM6A 3RK0A 2RHHA 3WIBA 2Q1UA 3DOEA 4NV3A 3FF4A 1YL5A 4NFLA 1JKJA 4OQPA 2BGRA 4BJ1A 1JZTA 1ILWA 3KPYA 3VHLB 3A0RB 1UFVA 3TLBA 4NYMR 3I0ZA 5DLEA 1TZBA 4I1RA 3BHMA 1GCGA 2YXNA 3TPCA 2BR4A 1NBMA 4B3XA 4OP2A 5AW2A 1PJ8A 4O2BB 2OR3A 1QLJA 3K9CA 2A8YA 4NABA 5F77A 2E37A 1IUNA 5FA5A 4EL5A 1ISPA 4XM0A 3K53A 2ZTMA 1I6WA 1FIUA 1OJLA 2GYUA 4ZOBA 5CAEB 2YXEA 1AHIA 1DCFA 2VAPA 2JC3A 3SEFA 2ZIWB 4D46A 1OXKB 4FE7A 2OGTA 2C4VA 2YQ4A 1Y4AE 2QTVA 4Z4HA 5JD6A 1I2BA 4MGZR 4W5WA 2FFRA 1QQ6A 4Z1MA 5EWLB 5AW4A 5PNTA 3VC1A 1QG6A 4LYFA 2YUTA 4J76A 4RVDA 4WESA 2W42A 5ULLA 1UJ4A 1PJRA 4JP5A 3OZDA 2D1SA 4Q1DA 4ZVQA 4ESVA 5E7IA 4B87A 1SVUA 3CO5A 1BRTA 4HNRA 4Q4JA 4DE5A 1MVOA 2FR1A 1JQKA 3QFFA 3TUZC 4RCZA 3W8DA 5A4DA 4EGQA 2GNPA 2QENA 3OIWA 4MIOA 1ZOIA 3MINB 3H1BA 4JLDA 3ICCA 2ZIEA 4CEIB 4IQ8A 3STWA 3QVJA 4PR3A 1TQ2A 5B6PA 2IDZA 3HWWA 1U0JA 2B69A 1V5EA 3RSCA 1GGNA 3ZU2A 3W6ZA 4D0NA 3TE7A 3EGEA 1W47A 4KR0A 3VJKA 1AN0A 1XDZA 3ND8A 2O8DB 3WWCA 2ZJ6A 4KMSA 1O0SA 3KXPA 1IPEA 3QNMA 4IY1A 4GF5A 4B44A 1K08A 4D4IA 4C3ZA 4QC2A 1NJ8A 2WAYA 3EXIB 2J3IA 5TR9A 3RYHA 3U40A 1F0PA 4LF8B 4CUJA 3L07A 1TQDA 1XRLA 2F8SA 1C29B 2ZRCA 2OKGA 4WGFA 5CAEA 1NUQA 3QG5A 4FJ2A 1NVTA 2BM0A 3OM9A 4QUEA 4H31A 5FL3A 5M29A 4RTNA 2DHEA 4FILA 1QPGA 2O8FA 4JUDX 4Z4EA 2WPNA 1CY7A 1H22A 5EINA 3IP3A 2RJNA 4FQ8A 3UJAA 3W2IA 4BLTA 2DY0A 2NXJA 1WOMA 2X3FA 1QIJA 1UXJA 1YBAA 2XVZA 1M5TA 1NT4A 3PFIA 1NLMA 3TTWA 1XEFA 2QUJA 3MJTA 3QU2A 2X4GA 4GQIA 1K5PA 2XMBA 3U6KA 2C2OA 1SA0B 4KE7A 4M0PA 4KWIA 4EH1A 2RH8A 3F5QA 2EQ5A 1E3WB 2GEVA 5IT4A 4P84A 3AERA 4TKUB 3L6RA 3IA7A 1O6BA 3CSDA 5CJPA 5FOXA 4C3VA 1P44A 4JB3A 4JT8A 4M4SA 5MN6A 5NULA 2L42A 3GLIA 5FXMA 1V3QE 1ISHA 2Q6IA 4JBIA 1DXOA 3S68A 2EFGA 2HIAA 2R2AA 3AHJA 3BFXA 3HFSA 3HXTA 1DEHA 1SCBA 4QBHA 4Y2VA 1Q74A 2C2GA 4IWYA 4LWQA 1ZSYA 3TH5A 1QGDA 5TDHA 3WR5A 4E2ZA 1CSEE 4PC1A 5DGIA 1YZTA 4A15A 3SQWA 5JZMA 1FUKA 3GMDA 3LUCA 4QLAA 3T4UA 2PBZA 3FDFA 1L4EA 1SKBA 2XNJA 4LXYA 2XVAA 2QU8A 1E60A 2ZYVX 5BR4A 1DFHA 1VA5A 1CB0A 4PNPA 1FFBA 1WCXA 3DD1A 1UDRA 2GZMA 3EXFA 3INRA 5LYJA 1SG0A 1SKYB 2QRLA 1R0YA 3SJUA 2J3JA 3WGOA 3ZY2A 1NNEA 2RHDA 3NXSA 1YB7A 2R8XA 4QHTA 5AUNB 5HIMA 3L9WA 3GRAA 5KYKA 1CY4A 1K06A 4TKLA 4ECAA 4ENPA 1Q0UA 3MHTA 5H1YA 3TIFA 3HFRA 5EAIA 4B4KA 3A6PC 1YF3A 3SN6A 2DWUA 2B98A 3E0XA 4YCLA 3QPVA 4A6PA 1W2HA 3AL3A 2V9CA 4AIIA 3V1NA 3I1FA 4DQ0A 3K8YA 3KKQA 3NCHA 4NU0A 5DI3B 2HXYA 4RF2A 2QL5A 1PZGA 1AUPA 2EFDB 3M8KA 4KXNA 2VSFA 3PDWA 1GTMA 3ZQUA 4QUJA 5A2GA 5ERYA 4WFIA 4RZXA 2GEFA 2JHGA 3W6PA 5K8VA 1RXCA 3ZDQA 3PQ7A 1V1JA 3EJ6A 2ZSEA 2V3WA 1WUKS 2XNDD 3LQ2A 4REQB 4ITRC 2IV2X 2ZLBA 1QTRA 1P1RA 3RABA 4YJ3A 1W8IA 2I66A 2DGDA 3TNJA 4E2FA 2A9RA 4TVSA 1ZNYA 1UKYA 1KHHA 3MWLA 5ESDA 4YY3B 1A5SB 5CBPB 4L6AA 1TJNA 4QT4A 1PW7A 1GG2A 3NNSA 4JGIA 3V1UA 3AUJB 3L93A 3I83A 4J3JA 3M1LA 2R5FA 3AHHA 3C4JA 3UOWA 5B53A 4PS1A 4FFRA 3QNWA 4LQ4A 2OQ2A 2QN1A 1ZITA 5SYNA 4CTJA 1Z8HA 3LXRA 5J4VA 2JFWA 3I28A 4O0LA 3WB0A 2HF7A 2VHVA 621PA 1Q15A 3L0PA 1PWXA 2BBTA 2O52A 4I3GA 3A31A 2QMOA 3SS7X 4FC7A 4R1OA 4W5HA 1BRMA 2W37A 3DL4A 3FOWA 4GS5A 4KFUA 1Q7BA 2PH1A 2HLDA 3ESQA 3D3EA 1OW3B 3LQKA 3OEED 5DHSA 7ABPA 4TWRA 3AF2A 3HQ4O 3IT0A 4BDSA 1SB9A 1XXLA 3UCXA 2NOAA 3HV0A 2XTJA 4O4JB 3G3EA 3ZCTA 3AM1A 3HMKA 3A0UA 3C7TA 4EBBA 4K3UA 1CFZA 3E22B 3DO8A 5HF8A 3UPUA 2DBQA 4QWMA 3NX4A 1Y5LA 3JQ7B 5L3VA 4RVCA 4GECA 2DEUA 2O0MA 2ZRJA 1UK7A 4PLFA 3VO2A 3BX1A 3LY5A 4BEWA 1H0KA 3GDFA 1WDLA 1I7DA 1C3VA 3VNBA 3WBBA 1GAXA 4WERA 4DIFA 4JU9A 3EY4A 3FOAA 1XA0A 1PQPA 2O1SA 3KC2A 1RWNA 3KWLA 4IDCA 4MVYA 1NVBA 1LC0A 1G6Q1 4N65A 4TV8F 4CF3A 1XWIA 3O47A 2JDID 3PXAA 1MX5A 1ZHHA 1IIBA 4FGKA 1CHNA 3QE2A 4JR2A 4LRXA 3RBAA 5DNCA 2C7PA 5LP6F 3DDCA 3FKJA 2H57A 5JPIA 3KVRA 1XD2B 1Z4JA 4EPWA 3NW9A 1Z73A 3OCZA 3N8IA 4A16A 5A7HA 3KHKA 5K3EA 1S01A 4NK5A 3VOSA 1F8XA 1U8TA 1YU9A 2DKOA 3C7CB 1BCSA 1Q21A 2HIGA 2ZI3A 3D4IA 3UMCA 3BMCA 2VJMA 3WQBA 3P2KA 3BQMB 4CL2A 1V37A 5CT9A 1BCRA 1NN3A 1RYBA 1JKXA 3FFBA 3LZDA 3ONDA 5BVHA 4GX2A 1GAQA 2Q8PA 3AY6A 4LRUA 4HDQB 1EWYA 5HCIA 1CR6A 3TVYA 2P3SA 4MJ3A 2Z8YM 3H3JA 1M2VA 3QV2A 4J07A 1M1UA 1WW2A 4WLFA 3W04A 1C4XA 4X64B 4OAOA 4LDAA 4DAOA 1BKYA 3D54D 2P6UA 5A5GA 2XYVA 1JSLA 2YVQA 3QU4A 3COPA 2YMPA 1S3SA 5G4KA 3OOYA 4KXFB 3L8GA 2Q2NA 2X0JA 1C5KA 3GFSA 4XJSA 2O2CA 2V45A 2X9GA 2GLTA 2OV2A 3GRKA 1E7RA 2YV5A 2J5RA 3K5PA 4FMCB 4JP8A 3ZU5A 4B3TB 5I7UA 2DAPA 1GVHA 1IY2A 1HOTA 2ADOA 2QTFA 1N0UA 1RQPA 1XDDA 2WJAA 3HJTA 4IDGA 4X8LA 4E2YA 2IXGA 2NSYA 4KWTA 4LJLA 3M3DA 3U4DA 3ZBQA 3N8KA 3SX0A 1UAYA 5JQWA 4IJQA 1I33A 5KSWB 4B8YA 2FN3A 4DJJA 4ERNA 2I65A 3B12A 5COBA 2PAFA 1AMUA 1AUQA 4E7OA 2XNHA 2BOVA 2WWFA 2H2HA 3BQ9A 3C6ZA 4FFNA 2PLFA 2FGKA 3CEAA 2PWBA 4W9NC 1BHO1 4NICA 3TAUA 4D9JA 2GJKA 4HNGA 1I5RA 4QGSA 1SOUA 5H7XA 3BE6A 2X0FA 2DM6A 2ZB2A 4V1CI 1W5TA 3OPYB 4HAVA 3WAKA 5ESWA 1T34A 3IQGX 4AC9A 4MJLA 2GF0A 1TT5A 2VBCA 4BQEA 3S2IA 2P9EA 2GLUA 1TJYA 3GJ3A 3ABSB 3KOZA 2VCEA 2WF6A 1U0GA 3SP1A 5CVCA 5KVCA 1E8DA 2AMVA 4UVDA 2JIMA 4G5YA 1KP2A 4UVGA 1EP9A 5FLKA 5LP1A 3A6JA 1UXOA 2I7VA 3MUEA 3D1VA 1PQ4A 3F9RA 4P4TA 4Y2QA 3UFXB 3SD7A 1YNOA 1U28C 1ZIOA 4RJTA 3PVSA 1DMRA 5CFLA 3DB1A 1GZUA 1OHHA 3WL3A 1XI2A 2EKDA 1I7SB 2GPBA 2VUIB 5C8YF 3A6HA 2IX3A 2NO0A 3N0TA 3GAAA 3I1YA 4QOSA 5C37A 2ORIA 4LV8B 3IB6A 3TOZA 4C22A 4Y1GA 4OK6A 4FFSA 3GJ5A 5CMLA 3INTA 2PL3A 5LC1A 3BRQA 3NHRA 1E79D 3A9CA 4LWZA 4RK7A 4EG6A 2SECE 4RU1A 1D2CA 1LVHA 2ATEA 3LX8A 1J5PA 4LUCA 4OSOA 5CVUA 5IJ0A 5HVNA 5LMZA 3R7NA 4MRNA 1XJQA 4PBRA 1ZQ1A 1UBEA 2J85A 3HCPA 2P1ZA 3LPLA 4ZXPA 3V8RA 5CIYA 2VDQB 2PCLA 4MW9A 3WGYA 1U9ZA 2YVLA 5E7MA 3F98A 5I7VA 4OUDB 2JJMA 3RARA 2OO7A 4KV7A 4QATA 7GPBA 1ZMBA 1CEQA 1QDUA 2JRLA 3BMOB 2P6MA 2EWMA 1XZPA 3F8SA 2DLDA 5CLGA 2PH5A 1TYZA 4NG5A 5C5EA 3ERCA 3L6CA 4CF4A 1ZUHA 2HBYA 2XKJE 1NTOA 3EXAA 5HKKA 1XDUA 1ZJJA 4HQKA 1V7QA 4YACA 4YMUA 2UUCB 1MGOA 1QAMA 3UW3A 1GNPA 2PKEA 3BAFA 2VL7A 3NYIA 4RABA 4AN4A 4W5OA 3KQLA 2EXXA 1JEDA 1TUGA 2Q5EA 2BIFA 2OZKA 1OTHA 3R40A 1VLMA 4KBGA 3ABZA 4ZOCA 4NH4A 2P40A 1M2KA 1Y1SA 3UV7A 1WEKA 1UQRA 3VNQA 2P9ZA 1EFAA 5AVYA 4H1WA 2GK6A 4RHTA 4FCVA 2PRIA 1NC1A 1X42A 1BXRA 2WDZA 3BAZA 3QJYA 1BIFA 4RD4A 1N0VC 1EFRD 4BGEA 4C6RA 1VOTA 3GH3A 3VC3A 5EZQA 4C0XA 3ESDA 1D9ZA 1EG7A 4IOJA 1OX4A 4RV9A 4IP0A 2BKLA 1MLDA 2OCGA 3FYUC 4LW8A 1Z2NX 1A95A 1T6NA 3BDVA 4P7GA 3NGMA 4A4DA 4CKEB 3W3ZB 4DQXA 5JCOC 3NDPA 3N8NA 2EWVA 4B45A 3WDLA 2H4FA 1SXJE 1XEWX 4IDFA 1ORTA 4EW3A 3PFHA 2C94A 2JJ2D 4UMFA 3FMOB 4KGDA 2NV0A 4UAVA 3W2EA 1QIEA 1DSSG 4PM4A 3W5JA 2BKUA 4DXDA 3S2EA 3CNQS 3NOVA 3OOSA 4YUAA 1M2NA 1DADA 2NZ8A 2YUIA 3I2IA 1S4MA 5KYTA 2CCGA 2E48A 2QBYA 2C9OA 3AM5A 4XSHA 3V7YA 4MUIA 1Q95A 2VPIA 4CHTA 1NVXQ 2IIQA 4BKQA 5JPDA 3OJCA 5LMUB 1T0UA 2BW0A 3GIWA 3CA8A 3QU9A 2DCUA 1SCIA 5CYOA 4MYSA 2WHPA 2WUGA 4MUFA 5C5IA 2PGIA 4K9LA 3ZWOA 3OZCA 3SNKA 1U5CA 1Q2XA 2L19A 5CW1A 1C41A 1SGWA 3ZVKA 1GL6A 2XHEA 5KSZA 2MSEB 2AF4C 1RHJA 1YMVA 3BL8A 4RJKA 1QYDA 2GM9A 4WQMA 3WSWA 2FPMA 1QKJA 2Q0HA 1C1XB 3MTQA 1G7SA 1VSVA 4C0QC 4J0KA 3UJ3X 1T9HA 4IG4A 5LU8A 4ECEA 1WV1A 2P5UA 2ZP1A 3HA3A 3ROKA 4DKJA 4GKBA 4ND3A 3L4SO 5JSUA 1GAEO 2YC2C 3HYRA 1H5UA 1W36C 1W76A 4TTQA 3CM0A 3E4DA 2V9PA 1I3OA 5AJWA 1KNQA 2CMGA 1U3FA 2C4NA 5HOEA 1QYXA 3MW8A 4RGVA 3LKVA 3T1NA 1RQNA 3EZ6A 5FUVA 3WOVA 2PDAA 1U7XA 4J03A 3GLFE 2V58A 1BE8A 2GSWA 2X6QA 1QG0A 3ED1A 3LCJA 3TDNA 2FDXA 1CS0B 1UM9A 3TRDA 2P2CA 1EDOA 1U7TA 1NSTA 3U7JA 3BBPA 1FXSA 1EVJA 1