3LZ6A

Guinea pig 11beta hydroxysteroid dehydrogenase with pf-877423
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
b'KFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title The development and SAR of pyrrolidine carboxamide 11beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 97
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3lz6A00
3IIEA 2PD3A 3BMOB 1CIVA 1UZLA 5BSFA 3R3JA 2B4RO 5CFZA 4XKJA 2XF8A 5JXWA 1B0AA 1P77A 2XPCA 4IZHA 4Y6SA 1WZIA 3LLSA 2W2KA 4A03A 1W8DA 4CR6A 1I0ZA 2DTDA 3F3SA 3FHLA 3N58A 4DA9A 1M75A 1G0NA 4B3JA 1PJTA 3DBLA 1E77A 3I9JA 2HU2A 3HG7A 3CMMA 3ZV4A 4Q3DA 2JCYA 4XCVA 1VL8A 1Y8QB 3WGIA 1PGJA 2X6TA 5CEJA 3HQ4O 2I3GA 3DZGA 3M2TA 3B20A 3GMDA 4WJZA 3V2GA 8LDHA 2Y1CA 2RAFA 1KIFA 3KXDA 1S7CA 2CZCA 1QYDA 3OIFA 3RASA 3HB5X 3JD3A 3TZQA 1GZ4A 2Z95A 2GZ1A 3IP3A 1X15A 3U5TA 1DIBA 1E7MA 4X54A 2SCUA 2IXBA 2VOEA 4RZHA 4Y67A 1ZXLA 3D3EA 3JSAA 5DDIP 3RBZA 4OJNA 2IRWA 4W6ZA 3WGZA 4M1QA 3H7AA 1D8AA 1UDBA 4OSOA 5IDWA 4QXMA 3UICA 1MXFA 1XWFA 4D0SA 5IJZA 3ZV6A 3VZPA 1MG0A 1GQQA 1NYTA 2DBRA 4ZGWA 1MUUA 1YWGO 2NQTA 2PH5A 1DRUA 3AM5A 3HDQA 1XSEA 1ZW1A 3VVCA 1DFGA 4BNMA 1ZSNA 3SX2A 3W4JA 5G0UA 3DOCA 2NM0A 4ZQBA 1HETA 3D3WA 1T4BA 2X9GA 3B6ZA 4E2XA 4YTEA 3VZSA 4W7HA 5COBA 4YQZA 2VCYA 3D5QA 3LDHA 4J9UE 1CRWG 2HUNA 4CV3A 1UXJA 3CE6A 1PJ3A 3H9EO 2OL4A 5IFLA 4KTVE 4ND2A 3QA9A 3DBLB 4NBWA 1I2ZA 1GCOA 2HQ1A 4E31A 2E37A 3GVXA 1CF2O 2BRUA 1GPDG 1GTMA 4CLOB 2EW2A 1EDZA 2HSDA 4NFHA 4F46A 5L53A 4ZN6A 4IS3A 3OIDA 4IZIA 1F17A 3PEFA 1LRKA 2VZ9A 5GZ6A 4DMLA 3DHNA 4R5MA 3OJ0A 2C2YA 1KEUA 4IS2A 1Z75A 4CMIB 3UW3A 1Y1PA 4UUNA 4IDCA 3DFZA 1BXGA 2EIHA 1Z6ZA 4WECA 5AXCA 1P33A 5FI5A 4QO8A 1F0YA 1MP0A 1E3WA 3EYWA 4J7UA 4CMBA 4N54A 3DQPA 2ZK7A 3KB6A 3FD8A 1JKFA 2XXJA 3PWKA 1N5DA 1Y81A 2P5UA 2JHFA 1HE3A 2QYSA 4EW6A 4ZJUA 4H3VA 2Z5LA 1IHYA 3K31A 1H9BA 4YRDA 3DONA 1YXMA 2H1SA 4AJPA 3PTZA 4URFA 4Z9XA 4MOWA 3RUAA 4IDEA 5IXSA 1Q7CA 1E7WA 4NFSA 5T8KA 1UXIA 3GN2A 1JAYA 1SAYA 2EV9A 1DXYA 1R12A 3FBGA 4D3DA 1IZ0A 3VHRA 2VTEA 1Q7BA 4BKPA 3ITKA 3ZHBA 4AJEA 2NQ8A 1T1SA 5BNIA 2BGMA 5FF9A 3CPSA 2VT2A 4XYGA 3UAGA 4EITA 2GN9A 3WJAA 5IXYA 1BXZA 4M8SA 5H81A 1B15A 3V1UA 1UUFA 1R0LA 4AJHA 3KV3O 5EN4A 4ND4A 1GV0A 3PJEA 5CPFA 3OIGA 4Z9YA 5EQDA 4J2OA 4DWVA 1FXSA 4IDBA 4BNTA 4EUFA 1U2DA 3GEMA 5MDHA 3E8XA 1Y8RA 3GVHA 3MOGA 4CV1A 4Z0PA 3OF2A 3HN2A 4IUYA 3P2OA 2Y1FA 5TRTA 5KJ1A 4J0FA 5ENVA 2RHRA 1ISGA 5ER6A 1Z74A 3HADA 4DLLA 5T6BA 3EVNA 1QXSA 4H16A 4E0BA 3NTQA 1Q1NA 4D7AA 3D4OA 5TJ9A 3IKVA 4FS3A 4ZHSA 2BKAA 4IGEA 1E5LA 2QYTA 2TMDA 1QKIA 3GAZA 4FSHA 4WOJA 5HBRA 5I9MA 4MVJM 5TX7A 3RUIA 2ZTLA 4ND5A 4F3YA 3OM9A 4BIIA 1I5RA 2O3SA 4RLHA 1NFQA 1U4SA 1HTBA 2ZTMA 3FI9A 4YT5A 2HK7A 2OP0A 5TLSA 5GY7A 1JWAB 3BMNA 1T4DA 1H9AA 5TJHA 1YBAA 4QTZA 4XX0A 4KP7A 4Q3EA 4P22A 4CM9A 3ZNQA 4LW8A 4BO5A 1U3TA 1NNUA 4J2HA 1HYHA 1QYXA 1CQIA 5L4SA 2G0TA 1N7HA 4M54A 4EZBA 5BNTA 2ZB3A 3R3SA 1UP7A 1O5IA 2UYYA 4NG5A 1B8VA 3OECA 3WIDA 2EEZA 3K6JA 3RAJA 2Y1GA 1PGNA 4KWHA 4K9DA 2WEKA 3ZHXA 4OL9A 1QYCA 4TVBA 4R9SA 1EZ4A 5IDYA 5C7IO 5L4LA 4HV4A 3MJTA 4U5QA 1DFIA 3LT0A 4MVJP 1R4NB 1HRDA 1YRLA 1K89A 5I9NA 1O95A 3KSDO 1LNQA 4N5LA 1DHRA 1Y6JA 1YL5A 3K73O 3ZZNA 2EKQA 3VPHA 3RUCA 2FZEA 1NFFA 2YV1A 1QYWA 1UJMA 1ZXBA 3TOXA 3DBHA 4PZDA 3WQRA 2BGKA 4NMHA 1GUZA 3LSYA 1H0KA 1VJTA 2W2LA 3QIVA 3GOHA 3GRPA 4IY1A 1BTOA 2QZ9A 3NT2A 3WR5A 1K5HA 3IKTA 2G76A 1WMBA 3F5QA 1YVEI 3UF0A 4YJGB 3ZU2A 4OXKA 2DBZA 4IMPA 1HE5A 2EW8A 3PP8A 3BMCA 2GASA 5HWSA 5KTKA 1U3VA 4JIGA 5HS6A 1NAIA 1M76A 3ZHZA 3ICCA 3ONDA 2Y1DA 3V2HA 1X7GA 4LCJA 2ZQZA 3WB9A 4XD2A 1KC3A 3AW9A 1M6WA 4OSPA 3WTBA 3VKUA 5IZCC 5AYVA 1HLPA 1QSGA 3DBVO 1O0SA 5T67A 1NASA 1PTJA 1P44A 4MIEA 1C0IA 1Q2XA 2YQ5A 4ZQHA 3BXXA 3LC2O 4S3MA 4MVJD 4WLVA 1ADFA 3F6YA 3KETA 3R0IA 2DVMA 1YBVA 4XJTA 4NDNE 4GX2A 3WYBA 2ILTA 2JD2A 4MPDA 2RHCA 3F47A 3NTRA 1S6YA 1SBYA 5BQFA 2B83A 4I9NA 4EJMA 1ZNQO 3KYCA 2JAPA 1U4OA 4II2A 1H5QA 3ETEA 2EERA 3T4EA 3W6UA 3PYXA 1D3AA 2HJSA 1U7TA 4XDZA 4IQGA 2I76A 1KVUA 3JQAB 3OICA 1QORA 3AU8A 4CUJA 4P4GA 1EEHA 4PVCA 2NU7A 1PGPA 3GY0A 2P4QA 3AOEC 5AOVA 1BGVA 5JFOA 3W4IA 3V2UA 3HNPA 4MVJF 4YAEA 3O38A 4CLRB 1J5PA 3BMCB 4AVYA 2VHVA 1P0CA 1C0PA 2NVUA 2V6GA 3B1KA 3ENNA 3OJLA 3OSUA 4JGBA 3AI3A 3H9QA 4Q9NA 3K2EA 4W9NC 1P1KA 2DKNA 2AQ8A 4J0EA 4XRRA 1R4MB 3C3XA 4CQLA 4CQMD 1ZUD1 2UVDA 1IHXA 3I9NA 4G81A 3ZHYA 3WWZA 1WDLA 4L74A 4N7RA 3QSGA 9LDTA 2C2XA 4FN4A 2OBNA 2GD1O 5H83A 1RPNA 3KLPX 3G17A 2E49A 2I3AA 3DZHA 3KO8A 4A26A 1RJWA 3KYDB 3F4LA 3D5TA 3JQ6A 1NPDA 4BKOA 3D4NA 1RWBA 2EP7A 3BAZA 2JKVA 4U6SA 2YV3A 1IULA 1LDEA 3PQEA 2O7SA 2YJZA 1CEQA 2H6EA 5DBIA 4J1TA 1TXGA 1Y9EA 5CHEA 3WOHA 1P31A 4LGVA 4U8GA 1XG5A 4UEOA 3A1NA 4QSMA 5A9SA 4JJIA 3RU7A 5JS6A 1X14A 4B7CA 1I3NA 3H2ZA 3WMXA 5KIAA 1HE4A 1DOHA 5JY6A 4PLCA 1U7HA 3RVDA 2VNSA 3WSWA 2OHXA 4IJKA 3WYEA 4IJUA 3TRIA 3INTA 2ZB4A 3TN7A 3LK7A 2Q1WA 2AE2A 2PGJA 2Y0CA 3AFNA 2JCVA 4FJ2A 1OAAA 1TI7A 1F06A 1Z7EA 2NVUB 2C0CA 1XEAA 2PNFA 4JLWA 5I8WA 3COSA 1FDTA 3PDUA 2TMGA 1UZMA 5IF3A 3H2SA 4MP8A 1WWKA 4LRSB 1NHGA 2VYNA 3NKLA 4CQLB 1BWSA 4HBGA 1GFSA 1UAGA 4G65A 4IDAA 2ZIZA 3ENKA 4UUMA 4AL4A 5B4VA 2B5WA 4WK6A 2H9IA 2JFFA 3BTUA 3MJ4A 3EZYA 3FWZA 1IL0A 3I52A 1ISMA 4TRRA 3GA0A 2WM3A 1BXKA 1NP3A 4Z6KA 1KEWA 3I9MA 2GN6A 3C1TA 1UH5A 1GUFA 4JP3A 1I3MA 1HDCA 1QMGA 1UP6A 3MTGA 4QFDA 5L7YA 3NDRA 3ZWMA 2RCYA 1ISJA 2WMDA 4IXWA 1PS0A 5DOVA 3KHUA 4NBRA 3KSUA 1SO8A 4R3NA 4EUEA 4TROA 2D5AA 3ROQA 4J4HA 2O2YA 1LLUA 1E3SA 3UKOA 1GQ2A 4J1QA 5JW6A 4BO1A 1VRWA 2P2SA 4R51A 1C1DB 1LSSA 3A28A 2V6BA 2PFGA 1TT5B 3JV7A 3DZKA 2HCTA 1DJQA 2VN8A 2AHRA 2NTNA 4HXYA 4XGNA 3RFXA 1BW9B 2CVQA 1NPYA 4FB5A 1PJLA 3NT5A 1GL3A 5U1PA 2UDPA 4CR7A 3X2FA 1SC6A 5JAMA 1WP4A 4E33A 4HADA 5CG1A 4IIVA 4PCVA 3DXFA 1LLDA 2CNBA 2ZATA 2WYWA 1K0UA 1ULUA 5IZCA 1WVGA 1OZAA 1N92A 3MJSA 5KKCA 7ADHA 4B4UA 4NBUA 5CDYA 3F46A 2PKQO 2ZJ0A 5F3RA 5KWEA 2NTVA 3GG9A 4UULA 3G0OA 3PLRA 2CVZA 1LBEA 3VH3A 2DTXA 3PFFA 3VKVA 4D0RA 3H5RA 1B3BA 2IZZA 1J49A 2HMTA 4I5GA 4N5NA 3DZFA 4YB8A 4GMFA 4EEZA 3L0DA 5JLAA 4ND1A 1UDAA 3RKUA 2VHYA 3CIFA 4WASA 3SLGA 3SXPA 4AJIA 2D8AA 3QJ5A 4TVOA 4WLOA 1SZJG 1WMAA 3RROA 3WMWA 1YGYA 1E1KA 4RCVA 5KVSA 1JVSA 1QYVA 1XQ6A 2QHXA 1PU2A 2IZ0A 2VYVD 2GDZA 3Q11A 1MC5A 2NV6A 3ZCXA 1YB5A 5LC1A 1NQTA 1QP8A 3OA0A 1YQXA 4GX0A 2RIRA 4TRJA 1KYQA 2J5RA 1MGOA 5CG2A 2QZZA 3AFMA 3AJRA 3AOEA 1HT0A 4PLYA 3NAQA 1WLYA 3M1AA 3AM4A 3RWBA 4E21A 4WLEA 1Y5MA 2DQ4A 4WCDA 5IZ4A 3KM0A 1HDOA 4JQCA 5CDTA 1XIVA 2GPTA 2X23A 2X7HA 4JCOA 4W9NA 4BKRA 1ZEJA 4XRGA 4J43A 4CM3A 2VHZA 3OQ6A 3IC5A 4FDAA 3K9QO 1DC4A 3WBBA 5A4DA 3MJCA 1I32A 3PWSA 4DQUA 3PPIA 3H65A 1LDYA 1WW8A 4PG4A 3U4HA 2CDCA 1YKFA 3WGGA 2A92A 1FDWA 3GAFA 1C1XA 3BZUA 4NK5A 2PTGA 3IQDB 5CDSA 3L9XA 2P9GA 2VWGA 1LC3A 3GHHA 5DNAA 1FK8A 2AW5A 3OJOA 2OZPA 5C5IA 5FEUA 2O3RA 3CINA 3SEFA 1W6UA 3NGLA 2GUGA 1BMDA 3TZCA 4R5HA 4OO3A 3WX0A 3JQEA 1PR9A 1DSSG 4ZD6A 2BFOA 2EP5A 4NBTA 3GR6A 2ZB8A 2X9VA 2YQ4A 1V35A 4I9HA 5KVCA 3BMQA 1D1SA 5EPOA 1XHLA 3JCZA 1JWBB 5FWNA 4GQAA 2XOXA 1ISFA 3WQQA 2O3JA 3G3EA 4NJMA 3K30A 1XA0A 5TS3A 2IZ1A 4BGEA 4B7UA 3ZU5A 4OHUA 1KETA 5G0WA 2DT5A 1ID1A 4II3A 1SOVA 1LX6A 1YJQA 1ADCA 1NTOA 2Q4BA 4YJHA 3W6ZA 1ARZA 1IE3A 3C85A 1UAYA 3UCXA 4L4RA 3WFJA 1NQ5A 2BGLA 2DAPA 1O89A 2B5VA 3PLNA 1LUAA 3Q2IA 4A7PA 2E48A 3BHMA 2FPPA 3KEOA 5IG2A 4ZA2A 4DC0A 1C3VA 4P4NA 2OGUA 4FFOA 2EKPA 3ON5A 2D59A 3E03A 5U4QA 1P1IA 2D3TA 2IEDA 1ZFNA 4QUKA 5EIOA 3EY4A 3C24A 3H5NA 3JQGA 3LC1O 4ALMA 3CZMA 1CDOA 1UDCA 3I6QA 5DOZA 3VOSA 2A94A 6ADHA 2YW9A 4W7IA 2Q1UA 3PQDA 1LRLA 1I3KA 2HLPA 4NIMA 5COQA 2HMVA 4J49A 4RPLA 1YH3A 3MCVA 1F8FA 1U2GA 1YL7A 2WD7B 5C7OO 3GGPA 3PIIA 1YJ8A 4DYDA 3A4VA 3VDQA 4BOYA 5EMHA 3MTJA 5EQFA 4UVDA 1X13A 4LCEA 5G4KB 2FRDA 3ROKA 1HXHA 3RU9A 2FR0A 2C20A 1SNYA 4EDFA 3JYLA 4YBZA 1E1MA 1PGOA 4E5KA 4W4TA 3WGQA 1A4IA 4ZU3A 3AK4A 1UZNA 2QRLA 1EUDA 1GYPA 3IL2A 4LISA 3DBRA 3KBOA 4MVJG 4CODB 1LSJA 1E1NA 4GL4A 4BNNA 3DC2A 1YB1A 4BO0A 1JKIA 1ULSA 2FPIA 1B8UA 4PLFA 5JE8A 4CR8A 4YRBA 1LTHR 1RKXA 2O3UA 3ASVA 1MFZA 4WE3A 4C4OA 2C5EA 4CM4A 5ITWA 5DBFA 1DLIA 3LYLA 4KQWA 3EGOA 2I65A 4BQRA 2I66A 2W2KB 4O0LA 6LDHA 2GCGA 3H3JA 1BDMA 3L4SO 4C7JA 3HJAA 1LEHA 4PZCA 7MDHA 1R0SA 2O2SA 3VTZA 4D79A 4JBHA 2WYVA 4XB1A 4UEJA 1CJCA 4I5FA 3PZRA 3PWZA 3GEDA 4JX8A 4U0JA 4KDFA 1NWHA 1PS9A 3H6KA 4RV9A 5F1PA 2XAAA 4OIMA 3CTMA 4L8VA 4BV9A 2X22A 2EF1A 4CLDA 4GSLA 5B4UA 4FC7A 1DAPA 1I30A 1PQPA 3WFIA 5KJCA 1U28A 5DN9A 4BNHA 3QQPA 4E30A 4JBGA 3BHIA 4JBIA 3OQBA 5A02A 3UGKA 1G6KA 4IDFA 3PI7A 3QWFA 3HWRA 4CMJA 3V8BA 4I8XA 3ZWCA 4DLBA 5B1YA 4J1SA 1BRMA 1WDMA 1B16A 2GERA 3PJDA 3ROPA 2PGLA 3E5RA 4L73A 4YQYA 2WTBA 3DZJA 4RF2A 2ZCUA 2YDYA 1HDXA 4DPMA 5C3MA 5K6AC 3U9LA 1NQOA 1OC2A 3OMLA 4HFJA 1ZIDA 1YE3A 4U0KA 1D7OA 2O4CA 2DPGA 1B26A 2G82A 2J3IA 1N8KA 5FYDA 3D3WB 1LSUA 3S1LA 1XR3A 4DPKA 4NK4A 4F6LA 3U0BA 3R6DA 4QEDA 5B37A 4QQRA 2GNAA 4BB5A 1H94A 1UXHA 2C5AA 3HDYA 2Q50A 2PD4A 1UR5A 2BD0A 2YFQA 4D45A 5JY1A 1A5ZA 2PWZA 2YUTA 3CH6A 2H5LA 2HDHA 4NR0A 4EI2A 1E3JA 2VNAA 4DRYA 1NBOA 3ZWAA 1E5QA 3DZIA 4MIYA 4RVUA 3IDSA 5THKA 4CLEA 5CEEA 2C7VA 3GF4A 3I6IA 1BSVA 3B1FA 4J1NA 3T7EA 3I4CA 1EE2A 1N1EA 2JD1A 1K3TA 1YOVA 3TWOA 1ENYA 4RQUA 3FNFA 1BXGB 1YQDA 5C7LO 4J90A 1I01A 3HFGA 3FBTA 2FR1A 1E3WB 5TIIA 3AUUA 4Q3CA 5TGDA 2F1KA 2C7GA 4UVIA 4FIZA 3PJFA 2WJPA 3UUWA 2E4AA 3RIHA 1FDUA 2BHLA 3VH4A 3JD2A 4BKUA 1GD1O 2AQHA 2R00C 3ZGYA 3ADPA 3TL2A 3MJVA 4CLXA 1XU9A 4OKNA 2O23A 4PG6A 5JO9A 4YVFA 4ZQGA 4TKMA 3CSDA 4IM7A 2G17A 2DUWA 3ZWPA 2EHDA 2C54A 4D3SA 1YS4A 2E6UX 2AEMA 3LZ6A 2DFDA 2ZCVA 3FNEA 5KOIA 1J6UA 3PK0A 4CJXA 3LT1A 2BFMA 1X0VA 4DVJA 1GY8A 1M67A 4XIJA 3WIEA 1PX0A 3BTSA 4LRTB 1VKOA 2VRCD 1IZ9A 1D1TA 3C1AA 1VC2A 3F9IA 4PG8A 1P74A 3JD1A 5A1TA 5JMWA 3RJ5A 1EE9A 1WZEA 5A9RA 3IJRA 3RUFA 5CPBA 3AI2A 1EUZA 1CWUA 3L9WA 3ONFA 3O8QA 4PLWA 1DHTA 2JFGA 4YDRA 1Y8RB 4L0QA 2JHGA 3IJPA 4TWRA 4MVJA 1GADO 2DUUA 4JNKA 5KVVA 4B3IA 2Y67A 1DO8A 3RBXA 3VZQA 4RVHA 3UFXA 2NVBA 3N74A 4IBOA 4ALLA 1YDEA 3E9NA 1KVRA 3AWDA 4IJWA 2YHUA 3GDOA 3M2PA 4NQZA 3DOOA 3L6EA 4IQ8A 1P0FA 2E82A 2FR8A 3PGXA 2I99A 1GUYA 1JU9A 4E3ZA 3JYQA 3G1TA 1E7QA 3ZNNA 1E0DA 5A06A 4HP8A 4CM5A 2FHSA 3WLFA 5TNXA 4CV2A 2JCXA 2ZTVA 1UXGA 3B70A 4YAJA 2EJWA 5EESA 2OOSA 4MIOA 1U8FO 3Q3CA 5JYEA 5ENDA 2CSUA 4J4BA 4LN1A 4B8ZA 5CDUA 3BMNB 2WE7A 3NX4A 4AJOA 4KDEA 1OOEA 3EDMA 5JDIC 1ZMTA 2PD6A 4DBVO 3IOYA 4P38A 4CMGA 4TSKA 5L3ZA 3H3FA 3RFVA 1E92A 1ORRA 4OMUA 4IDDA 4CQMA 2V6MA 1OFGA 5F21A 1JKJA 2OUIA 3Q6IA 3RC9A 4TZTA 2GF2A 1IPFA 3O8QB 1DAOA 4MDHA 4NH4A 3G79A 4UVGA 1L7DA 4NJOA 4FFNA 1ZKMA 2JL1A 3AUSA 5TC4A 5C37A 4UVHA 3AY3A 4PLHA 4GSKA 1HZJA 4R01A 3WNQA 2XXBA 1IOLA 1TB4A 2FP4A 4HFMA 1LLCA 3I83A 4GWKA 1T2FA 1E6UA 1B14A 1DEHA 5K6AA 4B4WA 4RGBA 4MVJE 3U49A 4GKVA 4W99A 4UUPA 1Q0LA 1WPQA 2IE0A 3H8VA 4D41A 1ZZEA 4FFLA 4HY3A 1OBFO 2QRJA 3PQFA 3JQ7A 4L76A 1JQBA 4Z3DA 2NSDA 4XQCA 3DL2A 2PKQP 5B4TA 2HAEA 1TEHA 2BH9A 4H15A 4RF3A 4BO8A 2FSVA 4OOEA 2V6FA 3DBHB 4EJ0A 4BO2A 4E5MA 2P9EA 4B79A 3UN1A 3PFWO 4QX6A 3INRA 4K26A 4OGWA 1Q7GA 1JLLA 3NT4A 2X0IA 3ZH2A 2Q3EA 4BNXA 1DRVA 1EBUA 1I8TA 3A14A 2CFCA 1NVTA 4RO0A 2WYUA 2HRBA 4O59O 2AEJA 5T64A 4ND3A 4WLUA 1XGKA 4A5OA 4B4OA 3B1JA 1X7HA 4BUCA 2AEFA 4UEKA 3DMTC 3U4DA 2B0JA 4CQMB 5JNLA 3NRCA 1ZK2A 2R2GA 3ZU4A 1PQWA 4BB6A 1M6HA 3O26A 4BNGA 5IAAA 1XU7A 1TVEA 4RJTA 3EZLA 4TRMA 3W4KA 4EEXA 5JO0A 1P1JA 4DIFA 1MV8A 3GPDG 4PLZA 1MC4A 1NQAO 3LVFO 4OXNA 2OO5A 3P5SA 1KEPA 1B3RA 2Z1MA 1SPXA 4FCCA 1T2AA 3BA1A 5EJ2A 4DIOA 1VKNA 4JK3A 3PXXA 3VVBA 2Y68A 1Q0QA 3VDRA 3NV9A 2G5CA 4XIYA 2R00A 4R1SA 1V6AA 1LDGA 4L75A 2IODA 1DBVO 3H4VA 5COAA 2JJYA 2Y0EA 4CLHA 3L77A 1N9GA 2I6TA 3KYCB 1GEGA 1A9ZA 4GLLA 5I8ZA 4YT8A 1ADGA 3ROMA 1EFLA 2X5JO 1YONA 4KWIA 3GZNA 3FF4A 2YHIA 1LJ8A 3BHJA 5F1KA 3DB2A 3L6DA 2NU9A 3FRJA 3RJ9A 4YPOA 2FMUA 4NFYA 9LDBA 1KVQA 2EWMA 1LQUA 3DOJA 3L4BC 4BKQA 5J23A 4PLVA 1LSOA 5I9LA 1C0KA 3C1OA 2X8LA 4PLTA 4EUHA 2EKLA 5G0TA 4DPLA 3WS7A 4MKZA 4Z9FA 4R68A 4CL3A 1OC4A 4OQZA 2QIOA 4J7XA 1K6IA 3PRJA 5CEFA 4OAQA 4WEQA 1YL6A 2Y05A 4A2CA 3E18A 4M87A 1IB6A 1NXQA 2Y0DA 4LMRA 3UOGA 2YV2A 2HO5A 5ICSA 1TA4A 4M55A 1HZZA 3ONEA 2VZ0A 4NZ9A 3H9GA 3MJEA 4YA6A 1W73A 1AUPA 4IGFA 3OETA 3DTYA 3QVOA 4DIBA 3K92A 2VYVA 4H7PA 3VH2A 1XELA 1PJCA 1HLDA 4GGOA 1I2CA 3UHAA 1NHWA 2VOJA 1EVJA 4WEOA 1HDGO 3DHYA 2J5QA 4XEHA 3SLKA 2OORA 5JCJD 4IINA 3ANNA 5BT9A 5A9SB 1BDBA 4I5DA 3Q9NA 2PY6A 3HFSA 5H82A 3ETDA 3QWAA 5IN4A 1YDWA 4JN6B 5JC8A 3W8EA 1V3UA 2ZJ1A 4LK3A 3SBOA 5JDIA 5ADHA 3I3OA 1LU9A 1PR3A 1PWXA 1PWZA 2IXAA 4CMKA 3BTOA 1P1FA 3OP4A 4GAEA 3VC7A 3PGJA 4BL5A 3I23A 5A5FA 3TOZA 4YAIA 3FTNA 4PIVA 4BNIA 3HHPA 4BO3A 2VUUA 5F5LA 4J4TA 4GWGA 2ZYAA 1KY5A 3ZWBA 3DAGA 3V1YA 4BV8A 1EVIA 5EL0A 2VUTA 1DC6A 3DEYX 3NGXA 3K2BA 1XDWA 2HK8A 4ALNA 1OI7A 3SJ7A 4KUEA 4I5EA 3PVZA 1RM3A 4MKRA 4BO7A 4XYLA 1O94A 3GDGA 4KMSA 4BNZA 1E7RA 4AG3A 4K28A 4R41A 1B7GO 1NM5A 3GUYA 4HX5A 4R69A 4FJ0A 1R16A 1AHHA 3RUHA 1LI4A 3WTCA 1PJ2A 1ZK3A 1UXKA 2A4KA 4KUHA 4RF4A 4R1NA 1AGNA 1LDNA 1EFKA 2NADA 2Y66A 2ZB7A 2OFPA 1JW9B 5JSFA 3QRWA 4YT2A 5JCXA 3NTOA 4W82A 1IYZA 4BO6A 4O5OA 5F5NA 4Y6RA 2A35A 1A72A 1ENZA 3VPSA 3VZRA 4Z3KA 1MX3A 3C7AA 1KVSA 1W4ZA 3PZBA 1ISIA 2IEBA 1F12A 4QFCA 3ZV5A 1ZVMA 3NDIA 4XZ3A 1O8CA 4YJFA 3RC1A 4LMPA 1D4FA 2VWPA 3DMTA 4BMSA 4PRKA 3SC6A 4ESOA 3A9WA 1WAMA 3ZWNA 5HA5A 1V3TA 4OOFA 3E1KA 4WNCA 3D7LA 3GGGA 4FR5A 4HKTA 1BG6A 2C59A 4HUJA 3RC7A 2BFAA 1Q0HA 4BMVA 2P9CA 1NAHA 2OMEA 3RUEA 5DT9A 3UCEA 4RVFA 4RL6A 3C8MA 1DPGA 4XYMA 3ZN2A 1GDHA 4YRAA 4R16A 3JQCA 3BMOA 2YDXA 1QV6A 1PIWA 3FN4A 3O03A 1PJBA 2FPGA 4TRNA 1GU7A 2QRKA 4TQGA 4DXHA 3E6AA 1P1RA 4KOAA 4YYZA 5JAIA 2B4QA 2BFPA 5HM8A 5KVQA 2AA3A 4FBGA 1QLHA 1X7DA 3ST7A 2IDZA 1ONNA 1PZGA 3EUWA 4BNWA 3SVTA 2DLDA 1JVBA 4CUZA 1ENPA 4AFNA 3I9OA 3FR8A 3VH1A 4EGFA 1VSUA 3E48A 5BR7A 3PJGA 1DLJA 1Y8QA 3JYNA 3L4BA 4XJSA 2YFHA 1K6XA 2D4AA 3AY6A 4E2ZA 3ZDFA 2NWQA 5A5EA 4WLFA 4A10A 2GLXA 1T2DA 2X4GA 3NJ4A 3WGYA 1ML3A 4XYEA 1I3LA 4YJFB 3PHIA 4YWJA 2Q1TA 1EK6A 2PA3A 3WICA 5CDGA 1OMOA 2EXXA 1VM6A 3TFOA 4Q3NA 3V5NA 1PS8A 4TMFA 1VJ0A 1HDYA 2GRAA 1C1XB 3HDJA 4O1MA 1JDJA 3QLJA 4BNFA 2EG9A 2P68A 2CVOA 4PLPA 4J6FA 1I2BA 3T4XA 2WD8A 4O63O 2ET6A 2NLOA 2Q99A 2EJVA 3D4PA 1ZSYA 3ZW8A 4IPTA 3VPFA 3WJ7A 4XQ9A 3GNTA 1MB4A 2B69A 4XB2A 4MKXA 1GYRA 4A0SA 3H9UA 2B4TO 3AUAA 3GFGA 3PDJA 1P45A 5U9CA 2O4UX 1JA9A 4NHEA 2FN7A 5BNFA 1F8GA 2Q2VA 4ID9A 4YJDA 2UUOA 3BMQB 4J7CA 1T26A 4E5PA 4ZRNA 1RYEA 2D2IA 4FJ1A 3VAZA 5DULA 4BGVA 5A3JA 4CLOA 4BNUA 1AHIA 1Z73A 2X0NA 1E3LA 3CUKA 3JD0A 4NJMB 3WYCA 2HMSA 4PLGA 4EYEA 4E13A 3EMKA 1Z45A 3C7DB 1JN0A 1GR0A 4KUGA 5BSEA 1R0KA 4M89A 5A03A 2Q2WA 1EQUA 3JYPA 2J8ZA 1GYQA 4TKLA 4GMGA 1U5AA 4L9RA 4YJHB 1E6WA 4M86A 4CMIA 2X0RA 3ASUA 2X58A 4HFRA 1E7YA 4HNHA 4P4LA 1DRWA 5MGBA 3ITDA 3I5MA 4PFJA 2W8ZA 3AI1A 2UAGA 1BVRA 3KYBA 4ZVVA 1CYDA 1ZJYA 5AXDA 3ZW9A 3DHEA 3P2YA 4BNVA 2D0IA 5G0SA 4D43A 5GZ1A 2IYOA 2PK3A 3WGTA 3OQ1A 2YZ7A 4CM8A 2O3TA 4J16A 3DR3A 1H6AA 3EK2A 3LU1A 3JQGB 4BNJA 1C14A 4ITUA 3U62A 4CMHA 1GZ3A 4CMAA 4CPDA 1XCBA 1R37A 3RBVA 3WDSA 2AE1A 2Y1EA 2HMUA 3GG2A 3OH8A 2DU8A 1RM4A 4EJ6A 4E5NA 3ADOA 1MA0A 1V9LA 3F1KA 4WOKA 1U5CA 3LT4A 1DC3A 1HDRA 4Y98A 3TL3A 3AOGA 4AJ1A 3RQSA 4E5YA 4XGKA 1V3VA 3P19A 1VE9A 1G1AA 3GC6A 3S2IA 3ZWVA 1I10A 4BNYA 4XR9A 1ZBQA 4AJKA 1XKQA 2PZMA 3EAGA 4Z0TA 4K6FA 2OBYA 4OYRA 4TZKA 1DIAA 5L7TA 3DBRB 3NJ8A 1Z82A 4UAGA 4D3FA 2RH4A 3QHAA 2AG8A 5L7WA 3TPCA 1J0XO 2Q1SA 4RPJA 3TF5A 2VRBA 3GQVA 2BMAA 1DIRA 2VWQA 3OJEA 3JQ9C 3ZWXA 2WWRA 1CERA 2IYPA 2DTEA 4HWKA 1ADBA 1WXDA 4CM4B 4IDGA 2VQ3A 4DGSA 4D44A 4YEDA 1FDSA 2NU8A 4R1UA 5T5QA 3R1IA 4BO4A 1ISHA 1FMCA 3PHJA 3Q9UA 4K6CA 2JD0A 5L4NA 2VRCA 3MWEB 2I9PA 1N7GA 3QVWA 3K5PA 3S2GA 4CM8B 1U1IA 1N2SA 4QT0A 4AJLA 1PJQA 4WCFC 3JQ8A 4LVUA 1NX6A 2DBQA 4MVJI 3CEAA 5A9TA 3OFSA 1DIGA 3FNHA 1H6DA 3CZRA 5G2OA 5A3VA 3ULKA 2GZ3A 2WSBA 3ETGA 3U4CA 2EGHA 1KOLA 5HS4A 1X0XA 1A4UA 5IN5A 5CAEA 2I67A 4YAKA 3ABIA 1IUKA 1U3UA 1QG6A 4NNJA 3SJUA 3QE3A 4MVJH 2O7QA 5CP8A 2FZWA 1LDMA 4LVCA 4OM8A 4WKGA 5JMPA 1G0OA 3ANMA 3ZU3A 5IDQA 2PKRA 3FPLA 4FC6A 4BNKA 2UUPA 2DPHA 3L6OO 3KUXA 4B3HA 1VL0A 5DCWA 1P3DA 3ICPA 1U9JA 4INAA 3GPIA 1U3WA 1R66A 2YY7A 1Y5RA 5ER9A 4MP3A 4DREA 5IDXA 2VTDA 2VUSA 3JYOA 3BIOA 4FW8A 3RCBA 1PL7A 4FPXA 1GCUA 4ALJA 4DBZA 1HEUA 1LLQA 1PEDA 2NTJA 1B8PA 4GLOA 4GX5A 2GN4A 3I4FA 2BF7A 3DAPA 5LDHA 1WNTA 1U8XX 4PRLA 3VTFA 3QVSA 1EDOA 2ZQYA 1SOWA 3JQDA 3ZI0A 1R4NA 2W90A 4BVAA 4GVLA 4EBFA 4QO7A 3S55A 3FR7A 1EQ2A 4RORA 3ZNPA 1CQJA 3GNQA 2RBEA 4PGFA 2LDBA 4O6VA 5DCUA 3U09A 3JQ8B 2AMFA 1EMDA 5DBGA 4CM1A 1PZFA 4YR9A 4RDIA 1B2LA 5KNLA 3CMCO 3G1UA 3H5AA 3IAHA 4I08A 4R3WA 1DC5A 1MLDA 1Y7TA 2X5KO 1ONPA 3JTMA 3WGOA 3WWYA 2NACA 4GBJA 2ZYDA 4RPKA 3WBFA 4YJGA 1X1TA 5LDGA 4G2NA 2P5YA 4K1LA 1YOVB 2HMWA 4OKIA 1PZHA 3QVTA 4CUKA 5JAZA 4R4JA 5JDCC 2PGDA 1Y9AA 3GVPA 4BGIA 1AE1A 3GDFA 2VZ8A 3ANLA 2C29D 1DJNA 1FJHA 1R6DA 3GGOA 5KJEA 1JTVA 3WQSB 5ILOA 1ONOA 1GV1A 2FWMX 5I7VA 1ZCJA 2Y1OA 1ZMOA 4ALKA 3H9JA 1KS9A 4WGGA 3U4IA 2AXQA 3IS3A 1T25A 3NEPX 5BSHA 1PQUA 4YT4A 4B8WA 4DL9A 2GSDA 2J3JA 3HSKA 4DYVA 3LT2A 1SB8A 4Q3BA 5DZSA 2FOIA 1T2CA 1ZK0A 4OH1A 1VLLA 1X1EA 2AG5A 2J3KA 3PHLA 1LQTA 3GT0A 3OA2A 1I24A 3I9LA 4HFNA 5L40A 1C0LA 5L51A 3VPXA 5DP2A 3JQFC 3WSVA 2PR2A 3RD5A 3BTVA 4GH5A 2Q46A 5ILGA 3JQAA 5DCYA 3RFTA 4JJGA 1XYGA 3RKRA 3GZ4A 4BMNA 3LF1A 1QLJA 4JJFA 2B35A 2HJRA 3DO5A 4YXFA 5I7EA 2GN8A 2BI7A 4LSWA 5DF1A 1NPTO 4CLRA 4ZICA 2B37A 3TQHA 4AJJA 4U6QA 3S2EA 1BHSA 2H63A 2OXIA 4CM9D 3X2EA 2VHWA 1J4AA 1DB3A 3DAFA 1R4MA 3UH1A 4FOSA 1KC1A 4NPCA 3GH3A 4D42A 2OP1A 1K6JA 3F5SA 4R1TA 3GRKA 3JQ9A 3GEGA 2UV8A 3N7UA 1R15A 4F45A 2CMDA 1HDZA 1LC0A 4RQTA 1QRRA 1ZSVA 5TT1A 1GEEA 3GK3A 1E1LA 1I36A 3DMYA 2PZLA 3KVOA 3KYDA 5T57A 2HRZA 4NU5A 2WE8A 1A7AA 2GGSA 3FPCA 4CL8A 2JAHA 1AXEA 4N5MA 3D1LA 2DM6A 4DQVA 1T1RA 4RPHA 5BSGA 3QV1A 1NWCA 4FFMA 4WCFA 4A27A 3W8FA 3GN1A 1QR6A 2O3QA 3W8DA 3Q1LA 3AU9A 4I1IA 3IUPA 3S8MA 2FY8A 3BYZA 4PG7A 3WNVA 5TQVA 3OBBA 1VPDA 1EK5A 2B36A 3PHHA 5DP1A 3ZWWA 3E82A 3LF2A 3DWFA 1HKUA 5KJ6A 2I5PO 2CD9A 2X86A 4PZEA 3OEYA 1LXCA 1P9LA 3E5MA 3JQAD 4DTIA 2X5OA 4B4VA 4CV0A 5K9ZA 2X9NA 4C7KA 2Q2QA 2R6JA 1NR7A 2W2LD 1P1HA 3Q0EA 3NUGA 1LDBA 4F6CA 2NVWA 5L45A 1KBZA 3HDHA 1HSOA 1T24A 1EVZA 1MFPA 4GKBA 3QWBA 1AN9A 1RYDA 2QX7A 1L1FA 1ZK4A 4BHTA 4E6PA 2QW8A 1A27A 4PN3A 1PJSA 3MWDB 3PYMA 2CF5A 1DDOA 1KVTA 4AICA 5FI3A 5I7FA 4DC1A 3EC7A 4KTTE 1YB4A 2CF6A 1SCUA 3HE3A 5TF4A 2AQKA 1M66A 3JQBC 2ZTUA 1E3EA 5JCJA 4L4SA 2NUAA 5KKAA 2Q45A 3HB4X 3EHEA 3JQ7B 3KRTA 4XA8A 4UVEA 1QV7A 4MO2A 4XGIA 3LLVA 3T7CA 2GR9A 3ZWYA 3AUTA 5F1OA 4ONEA 1HSZA 2Z1NA 3TZ6A 1KERA 3DZBA 4Y9DA 2F00A 2P4HX 1MXHA 3Q2KA 1EUCA 2P91A 4FQ8A 4GPD1 4RDHA 4WCFB 4AJ2A 1LA2A 4CM7A 3QWHA 1BVUA 3INGA 3ORFA 4RZIA 5G0VA 2VHXA 3WLEA 3RI3A 1YBMA 3W1VA 3WG9A 1C1DA 2RH8A 4Z0HO 2X0JA 4Q39A 2J3HA 4CMCA 1TT5A 3CKYA 4IMRA 3F4BA 3MZ0A 2PH3A 4P8RA 4KQXA 4ILKA 2CY0A 1BW9A 3KOUA 4PG5A 3PHGA 3EVTA 1ZJZA 1H2BA 1WDKA 1NVGA 1ZH8A 4R54A 5AXBA 5JDCA 1ZEMA 1VL6A 4I9UA 1UP4A 3M1LA 2CDBA 4CMEC 4DMMA 2ZKLA 3E9MA 3HN7A 4JP2A 4MJLA 1E6EA 1F14A 1HYEA 3O4RA 2POQX 3HUDA 4UREA 5THQA 5A04A 3UVEA 4BNLA 1MG5A 4IIUA 1H6BA 4YACA 4GX1A 3QP9A 1GZ6A 2AQIA 3A06A 5G4LA 5AQ1A 1CETA 1K2WA 1GQYA 3GMSA 2J6IA 4ZQFA 1XLTA 1N9GB 3K96A 3NYWA 2PZJA 5EERA 3GZNB 2YHIB 1FF9A 3MEQA 5JAQA 4HNGA 4DUPA 3IUSA 2EGGA 1TLTA 3P7MA 5L9AA 3QW2A 5JYDA 1I33A 3M6IA 1TT7A 5FFFA 2YYYA 5HTOA 4RPGA 4OQYA 2D5CA 3JQFA 4E4YA 4J3FA 2BELA 4FOOA 4Q3AA 3RSHA 1HE2A 4N18A 3GFBA 3UXYA 1PL6A 4RVDA 1PGQA 3WXBA 4IQ0A 1V8BA 2NNLD 4AJNA 1HYGA 2BLLA 1IY8A 3IP1A 1H2HA 1VSVA 4RVGA 4FGWA 4J91A 1GAEO 1T2EA 3CXRA 4YCAA 3U3XA 2BI8A 3KZVA 1HF3A 1PSDA 1HL3A 3TZHA 1EVYA 2LDXA 2G1UA 3ZWOA 3KEQA 3NDJA 1SMKA 1LRJA 4ALIA 1PZEA 4ZRMA 4WNIA 4OXYA 3MOIA 3STHA 2D1YA 1H93A 1V0JA 2GZ2A 3KSZO 3PIDA 2Q49A 2HKIA 3VPGA 3OEWA 4XQEA 4CM6A 4WPGA 5L95A 4DQXA 5GZ3A 4YAGA 4R9RA 4ROSA 1RM5A 2CUKA 5KCZA 2VYND 4XYBA 4E2WA 3FCOA 2GYYA 3G49A 2O48X 4IJVA 4J9VA 2PLAA 4IXTA 4QECA 4XDYA 3RUDA 1FDVA 1L7EA 4PVDA 4GI2A 2C82A 2ZYGA 2VT3A 3QWIA 5A05A 1VJ1A 4E32A 2W4QA 2W98A 1N1GA 1SEVA 3K8ZA 4NBVA 2NU6A 5I7SA 4FD3A 3FWNA 5ES3A 1ENOA 1IPEA 1AXGA 3TSCA 4Y8VA 2X1HA 3V1TC 3TNLA 2V7PA 2O50A 4MP6A 2Y99A 3D0OA 4AJ4A 4JXKA 4WUVA 4U7WA 3RC2A 4LSMA 3QVXA 2DFVA 1W0CA 4B7XA 2PZKA 4E2YA 4BGUA 1ZO8A 3QY9A 5HRUA 4GGPA 3LQFA 4KZPA 3OHSX 3PYLA 3S2FA 1RM0A 1KY4A 2Y93A 4M49A 4WLNA 2Q4EA 3L07A 5JPIA 2QG4A 1H6CA 3FTPA 5ICMA 1HWYA 1E7SA 3ZNOA 3IMFA 3GLQA 4XR4A 4GVXA 5AVOA 5TT0A 1YO6A 4FFPA 3JD4A 4RVSA 1NVMB 3TFQA 4E12A 1KEVA 5KJFA 3GVIA 4NI5A 4XQGA 3GHYA 3E9QA 3GVCA 1Z7BA 3JQBA 3I1JA 3SC4A 1DIHA 3GNSA 5AXAA 4ZQEA 1O6ZA 3DFUA 1EBFA 1A7KA 1O9BA 3FNGA 5T8KC 3ZV3A 1E3IA 3DDNA 5B12A 1PJ4A 2QQ5A 2VWHA 4D46A 4RLSA 2WDZA 2A9FA 1M2WA 3AM3A 3F1LA 3WGHA 5ITVA 3UCFA 2PV7A 1DFHA 1JAXA 4JROA 1NFRA 3GUCA 4L4XA 4S1VA 8ADHA 3KLMX 2V65A 3KTDA 1YQGA 4FGSA 1ZK1A 2HK9A 3O9ZA 1PL8A 4XWYA 5EINA 5TSDA 4DLAA 5LCXA 3LC7O 3TDKA 2CDAA 2J5KA 2WD7A 5K0ZA 3DTTA 4G5HA 1A71A 5JBIA 2GO1A 4BQPA 4BO9A 5JC1A 3EW7A 4NU6A 2C07A 2DC1A 5G4KA 4A73A 3C7CB 3D64A 1XQ1A 2FSSA 1A9YA 3HZZA 1GPJA 1NR1A 4FFRA 5GMOA 4CMEA 2DBVO 3I9KA 4MINA 1VI2A 4RF5A 4BS9A 1SB9A 3TZKA 3AY7A 3OJFA 2JFHA 1SEPA 4UUOA 3FSRA 3TJRA 4Y6PA
chains in the Genus database with same CATH superfamily
2NV2B 3S3TA 2PQMA 2NYAA 3O90A 3F3MA 3SZGA 5JNWA 2NO6A 4KRXA 5CFZA 1ZJ5A 3GROA 4MULA 3DXZA 4POOA 1UKCA 2OMKA 4MQEB 5L3ZA 1WABA 2JC3A 3H11B 1IUOA 4QJ4A 1P77A 1V95A 2GUWA 2HV9A 4AB1A 1AQIA 3AH8A 4FM9A 1WZIA 3LLSA 1NOJA 2Q0QA 5CB8A 4CR6A 3FHLA 2O8NA 3ECAA 3HB9A 5E7JA 1Y4DE 4L8LA 4P81A 1PJTA 5F78A 3CLUD 2HU2A 2B1IA 5BUCA 4XCVA 5I7AA 1I80A 1NBWB 3MIIA 4K81B 2QTRA 4PFKA 3PPWA 4ME6A 2X6TA 1ZUNA 3DHWC 3KR0A 2WHXA 5AVQA 3KG2A 1X7WB 4DJTA 2ZETA 5I7HA 3ROEA 1WXHA 2I3GA 1O7JA 3CTPA 4Q1CA 1MZVA 2OV2A 4XCQA 4Z99A 4MNTA 1OIWA 4CG0A 8LDHA 3UOWA 1JJIA 3CLHA 1S89A 1Z07A 2P6UA 3P94A 3KXDA 1S7CA 4OQEA 5K09A 1NNEA 1QYDA 4IX9A 4H27A 3NP7A 2R5NA 1GZ4A 1NRIA 1Z17A 3TZQA 3VR2A 4GOKA 2I34A 3U5TA 2NO4A 4ZOLA 4GHWA 1ZXLA 3ZG6A 3ZX4A 5DDIP 2HIHA 1T15A 4OJNA 1N1MA 4B40A 3RJMA 1E2GA 5BV7A 3U1TA 2J0QA 2Y6VA 3OF3A 4YH1A 4HQRA 3H7AA 1UDBA 3OPQA 5G1OA 4B5LA 5IDWA 4CFSA 4QXMA 5IJZA 5C81A 1Q84A 1JEYB 4HNTA 1Z08A 2ZS9A 2A1TS 4KJXA 4FWIB 1MG0A 1XX6A 4EENA 3J81k 1W49A 3IKMB 2CYAA 2IYRA 2QUIA 1HL7A 4JLOA 2IYVA 4CDGA 1XSEA 4HNAB 4J0KA 4WKBA 3L7IA 5ESWA 1QH0A 3SIRA 5B7GA 4ENPA 1IOWA 3PJRA 2N42A 2NM0A 4ZQBA 4DIKA 4GQIA 1HETA 1PT6A 3GCWA 3KXIA 4E2XA 4L02A 2ACVA 2TECE 4RIIA 4W7HA 3VZSA 4Y7DA 3RKSA 3L0BA 2JFVA 3ESQA 1JJBA 2F3PA 3QXHA 4J9UE 2HUNA 2IXTA 5FV4A 1QOZA 5E7QA 3D0QA 3I2IA 2P9QA 4JIMA 1I14A 3H9EO 2OL4A 4BWGA 1CV2A 4C03A 4KTVE 3QA9A 2HQ1A 3WB1A 2C94A 3HKBA 3ROZA 5KO2A 1RYBA 5AJXA 5KNDA 1DZIA 1GTMA 1MIOB 1QFJA 3RS8A 4CLOB 5ICFA 3T1OA 3M6WA 5KC8A 4AZVA 1S8NA 2X3UA 1UBOS 2EBWA 3AESA 2JARA 1I6LA 2VJMB 3MBOA 4EG1A 4IZIA 4M46A 2ZVPX 1LBSA 4R5MA 2VP9A 2A8YA 2CMHA 4HPJB 5KKNB 1OPXA 1NW7A 2PJUA 1YKGA 3DE4X 4CMIB 1ZM2A 5EYPB 4D02A 2IYEA 4K8OA 4LF5B 1XRSB 4DCTA 3DB1A 1JQKA 5AXCA 4EMBA 2ZWOA 5FI5A 5H7XA 5DW0A 2Z04A 1OXUA 3WFZA 3DXXA 1YOBA 1YAHA 4J7UA 2GPYA 5HNKA 3AEUB 4LXIA 3DQPA 4IFIA 4N54A 2OG1A 3KB6A 2EZ8A 1RBZA 2XXJA 1H42A 5EWMA 4Q1DA 2N46A 2BY4A 2HDWA 3V7NA 4RTSA 2JHFA 1HE3A 5F2KA 3X1DA 3HMKA 5HX7A 4ZJUA 2XGOA 4YRTA 4NHOA 3OZEA 2RI6A 4ZZ1A 3IFSA 3K31A 4ZARA 3RLIA 1WZ2A 2TYSB 4EAAA 4D3XA 1YXMA 2H1SA 2FG6C 4PF1A 3PTZA 4ROTA 3UV6A 1ZHHA 1CRQA 2J0VA 4MOWA 3LVBA 5C8YB 3SR3A 3K9WA 5IXSA 3CZCA 3K70D 3DEKA 1F2DA 1Y0BA 3FB4A 2IZ5A 1JKMA 3FBGA 3GEPA 3AB3A 3N2LA 1ZCAA 1X7YA 4OGFA 2MU1A 1TZKA 4BKPA 5EKXA 1W1UA 4IJQA 1OR8A 1TO1E 5AK4A 5K51A 5JYBA 1OSNA 5KYVA 1OHHD 1Y5IA 5BNIA 3U7RA 3BB3A 3O1IC 3TTVA 5FF9A 1PCXA 2A2ZA 4RH1A 4IVNA 5MN5A 1XA3A 1D0IA 1H85A 4CTNA 1VGVA 1I94B 3MRXA 3WJAA 5HUJA 3TZEA 4QU9A 3VKWA 3G2IA 4R7GA 2HGSA 3EZFA 1EVKA 1FLVA 1GV0A 1T9HA 3GFPA 3QEKA 2OCKA 4ND4A 4J2OA 5EQDA 3TNYA 1HR0B 4IDBA 1WUHS 1DAIA 2C5HA 4R0VA 3WB0A 2C2MA 3A05A 2BCEA 4ZVQA 3GVHA 4CV1A 3FMGA 4Z0PA 3OF2A 3M81A 2H4WA 2Y1FA 3QENA 2V7UA 4PRZA 4QYSA 5K99A 3KOYA 3F3YA 3HL0A 3FDIA 2FVXA 3V6LA 1ISGA 2GN2A 2OESA 4PM4A 5ER6A 1WA5A 2LIVA 4WVFA 2V45A 4YMLA 1SU6A 3AKZA 1VCNA 4H16A 4RZXA 2JF0A 2CMFA 2PMCA 4M0EA 1KAGA 3O8DA 5ABPA 2BSAA 3D4OA 3DOIA 4EB3A 1D9XA 1Z47A 1GG5A 4KXXA 4ZHSA 3MT7A 1T13A 3MUNA 3BRSA 5C4GB 4RD1A 2GEJA 4IGEA 3K35A 3R3YA 3GAZA 1QKIA 3DLAA 4MVJM 3RVPA 1A0OA 4F06A 5JTUA 1VBFA 3CV3A 4X1OA 1XNHA 1VYTA 2ZTLA 3OM9A 4IOKA 1I5RA 2OZEA 3V4VB 1FXUA 1KOFA 3NHUA 3MINB 4PBSA 2F4VB 1GTZA 5GADl 2OV6A 1HTBA 1U0SY 2ZTMA 3L4JA 1PD1A 2C8KA 3FI9A 5LVAA 1ZY2A 5TMDA 3OQJA 2AKYA 4WK2B 3C8ZA 4RTJA 1K4YA 1JWAB 1OZFA 1T4DA 4FDLA 4A2PA 1TQ2A 1XD9A 4KP7A 4F96A 2OXRA 4OP3A 1KZ6A 3PB3A 1ZC3A 3R4VA 4G85A 1RCUA 2QNRA 1B73A 4LW8A 3AVVA 2I7TA 3SQMA 4QC2A 1A8QA 1KFKB 1UC4B 1VGRA 2BFDB 1G8AA 1UFVA 3A4NA 3NCTA 3P4YA 2NOAA 2XT6A 3OSZA 1JLSA 4IRMA 4JJ6A 3T3MB 4EZBA 1GL6A 3LY5A 3BL5A 4MI3A 2ZB3A 2GHTA 3DCIA 3UXMA 5DTMA 5CMLA 4YMSA 1U90A 4NG5A 4ZVOA 5MFPA 3QH4A 4C2AA 3D7RA 3IEIA 1UPBA 3OECA 5LZ5A 2C9YA 4G0ZA 5FWYB 2EEZA 4RQBA 3BRWD 2Q0SA 3DTVD 3OLVA 3BXPA 1PGNA 2HV8A 4K9DA 1E32A 3BDVA 1VCMA 2FFQA 1TNDA 4FYPA 3L3BA 1VJRA 1YZQA 2QRNA 3N8IA 1U8ZA 2O57A 1EZ4A 4R9SA 4HV4A 2F1IA 5HF9A 4AX8A 4HVCA 1AQLA 1X86B 3ADCA 4CF5A 1FJXA 2P0EA 3QVVA 1ZRMA 5IWAB 2QXTA 1SVMA 5I9NA 5KNCH 2ZI4A 3KSDO 1CRLA 2M98A 2BONA 4N5LA 1XTQA 2J9FA 1SD1A 2FXIA 4O4HA 2IUTA 3R3HA 2Q5IA 2VLBA 3RUCA 3VPHA 5TV2A 1NFFA 5LQJA 5DI3A 3TOXA 2A78A 3WQRA 4NMHA 5J2UF 1K7CA 2XF2A 4UM9B 1DPFA 3PD1A 4RPIA 4KPGA 5JQGA 2ERXA 4MYTA 2C2BA 2B1RA 2Q3LA 1JIVA 3C39A 3SDBA 1SXJC 4QRHA 1KYTA 3RIXA 3IKTA 3T7KA 3F5QA 3IVXA 5ALLA 3QM1A 4YRQA 4OXKA 3ZU2A 3ELDA 1JNYA 2XQIA 1RCTE 1TZCA 2GASA 4CEJA 2P67A 1XVIA 2I4NA 4MLPA 1FQOA 3FVRA 1XTPA 1M76A 4IWNA 4JD5A 2OGTA 1M6VB 2FUKA 1NYQA 4DMGA 5DBHX 1S3SA 1U1FA 2YWCA 1QZUA 3QLVC 2PMFA 2RHDA 5LJIA 4WY5A 3B1VA 2Z3WA 1WHSB 3QHPA 4OSPA 3WTBA 5D01A 2XUZA 1HT1E 4QXOA 1HLPA 3IAM1 1RQ2A 3FAZA 4LYEA 3DLPX 2OB2A 4HGQA 4YJ2B 1NJGA 1KKLA 5JRZA 2I8AA 1P44A 1E4EB 3SZUA 5AOCA 4E11A 2JK1A 1QCDA 1MAVA 4J2TA 2NXJA 1N4AA 5DTIA 3BXXA 2GVNA 4G63A 3AF0A 2WSIA 1ADFA 3GUUA 4HGZA 3T7TA 5DRTA 3U3DA 1FSSA 3KJGA 3O2QB 2ZJFA 4M7OA 4XLZA 5JTTA 5KDOA 1P18A 4KB5A 1XJWA 2VH1A 3DEZA 3NTRA 1D0VA 2RFLA 2OCLA 2JAWA 3U48A 1V1RA 1XEXA 4F86A 3WKCA 4RZSA 1OV4A 2QTVB 4MV5A 4MI1A 5DLDA 1ZNQO 3GLKA 1C7ZA 4KGXA 1U4OA 2PZGA 5H3LA 3T0IA 5D3ZA 3T4EA 1LNZA 2J4CA 3W6UA 3PYXA 2AVDA 1D3AA 3P9PA 2HJSA 4DZRA 4IQGA 2QT9A 4F5YA 4CF3A 2D0PB 1VOTA 2CWDA 1QORA 3NHSA 3HVUA 4MQLA 4C0LA 1EEHA 4LMAA 2NU7A 1RFGE 1EM6A 3OVMA 4AWAA 4R81A 1UBTS 2P2GA 5AOVA 5TDHA 1K7YA 1K27A 3FPBA 1R0CA 1DKMA 3C70A 1LLFA 1YVRA 4PC6A 3RV3A 3ZGOA 4PXYA 2CLSA 2B1GA 4N6OA 3B1KA 3OSUA 3OJLA 1TAGA 1E3MA 3W9UA 1H66A 1SBNE 4Q9NA 1QCCA 1LFAA 1P1KA 3UJAA 2V6JA 3GRVA 1ZZGA 4LDPA 4CQLA 1GOTA 3LQRA 4TQAA 5DASA 4WK4B 3SBEA 2UVDA 1MTOA 1N5JA 3I9NA 2OYRA 4A6XA 3KXPA 2ZRAA 4IO1A 3CRW1 4UU8A 2C2XA 2OBNA 1THZA 2KBEA 4RHUA 2HIMA 3SGLA 4B4DA 2GD1O 5IFKA 3T9AA 3KLPX 1L7BA 3DZHA 3F5DA 3KO8A 3NEJA 1UK7A 3CLUC 3VNAA 3D5TA 2R3SA 2RKOA 4G84A 2WHYA 5FR2A 3DUFB 1WVIA 1NPDA 2V7EA 1JMKC 2VP6A 2WU3A 4MO9A 1PI3A 3FTQA 2QIPA 2YV3A 1IULA 4MW0A 2ZJ2A 3ZK9A 3KKEA 2AC2A 3ZZMA 621PA 2YJZA 2WU1A 2H6EA 4BVBA 2EC5A 4KO1S 4ZOEA 2A0XA 1G2IA 1KL7A 1M5UA 2EWWA 5FPQA 1E79A 1T1IA 3T9FA 3Q3VA 3IIIA 5C8DA 3ITEA 4JJZA 4K05A 2J0SA 2XUQA 4JJIA 1XXHA 4TXNA 3RTCA 3T5CA 3EFEA 5HILA 3OQIA 3WMXA 5M2QA 3BSWA 1SKQA 4LJSA 4I4TA 4PLCA 4RYDA 5DNDA 3RVDA 2MYNA 4EHNA 1DIOB 4GUAA 3R2JA 5C4MA 2OHXA 3HCWA 4RD2A 4AMVA 3ENWA 2XUHA 2EL9A 4IJUA 3TRIA 4WX2B 4IHJF 2ZB4A 4A0RA 2WKPA 4JQOA 4FJ2A 4F8JA 5EZ5A 1OT5A 4BP9A 2D54A 3NIDB 1Z7EA 3CWZA 4GYYA 1II0A 3OI7A 1XEAA 5FORA 5LIPA 1VLQA 2PNFA 3W2GA 3COSA 4FDVA 1QJCA 4CGZA 5A6VA 3PDUA 2TMGA 1WXEA 3V2IA 3CX3A 4MUHA 1RHRA 1F2TA 1JR3D 4ZU6X 4IDAA 5B4VA 2GMWA 4AL4A 4BFYA 3SHOA 4X7RA 2H9IA 2X42A 3BTUA 4L72A 4R83A 4JB8A 5IYZA 3ZDDA 5CGZA 3VUEA 1Y8ZA 3N3AC 1H0HA 3LRTA 4RGQA 4AT1A 5BV8A 3NO4A 1W2GA 2QTAA 1EX6A 1U7OA 2PRKA 5BW6B 2QN2A 1BXKA 5DV9A 4DUGA 3GRAA 1P7PA 1KEWA 3I9MA 2GN6A 1GGFA 4R2XA 2GCPA 3TAHA 1RHJA 2BBSA 3T9CA 4ZYXA 5FWAA 1VIYA 1JPUA 1ZGCA 1HDCA 3L7DA 3TRHA 5IM4A 3NDRA 1IQ0A 2FF5A 4NYMR 2ZXUA 1QQTA 2LBPA 2BSQA 4ZOBA 2X1VA 5I6DA 2FG5A 2FMKA 2GSWA 4IXWA 8ABPA 1EUCB 1PS0A 5DOVA 4NBRA 5HIJA 3ZZTA 4ZCIA 4LHSA 1SO8A 4EUEA 1EP3B 5BSWA 1KEKA 1RLMA 1KZYC 4J4HA 5F33A 1K68A 1EDDA 3JS5A 4NCNA 1GQ2A 4HNQA 3Q7QA 5BRAA 5JW6A 1REQB 3LOQA 4R51A 1U2GC 4HAZA 3NHWA 2P69A 2WWFA 2Q5CA 1SXJA 2CCKA 4ZZ0A 2PU5A 1XMXA 2JFZA 2VAWA 1CR1A 2YINC 2WNSA 1LQ2A 3LRPA 1Y8AA 1MOSA 3PC4A 5HMMA 2G25A 1WB5A 2HF9A 2VN8A 4E1BA 4P7BA 4BKMA 5F98A 3RFXA 1YULA 4YNBA 4FB5A 8ATCA 1C4WA 2QUBA 2DLCX 3NT5A 1GL3A 2RGRA 4G6ZA 3HR7A 4HH1A 5JAMA 1LCIA 4E33A 3CRMA 3ETNA 3QVLA 1AKTA 1GQFA 1YACA 4IIVA 4PCVA 4WKCA 5K8JB 4RA6A 3QLVA 3VR6A 1TMYA 1W9HA 3IVMA 5AFSA 3WE7A 4EHBA 3FPEA 5DPMA 2G40A 4MA4A 3K70C 4JEUA 4V2UA 2V98A 1JRLA 1YHNA 3ORSA 5KKCA 1D4AA 4LYJA 4M88A 4WZ6A 3EVZA 1XZ8A 3K1ZA 3QW4B 4NBUA 5F51A 3X1ZA 2ZRIA 1KTIA 1JFSA 1E2HA 1V5EA 4N65A 4DV6B 5KWEA 2CL6X 3GG9A 3B6MA 1SBTA 3D3NA 4AY6A 5ALEA 4C0HA 1WG8A 2PYZA 3Q12A 4D57A 2ZBFA 5IPFA 1WVMA 1RNLA 2NYRA 1NVKA 3HR4A 2IZZA 3N2GA 3LQ1A 2ZYTX 3DZFA 2PHZA 3FF1A 4YB8A 3W5SA 4B6SA 3BWBA 4Q24A 1PG2A 3L0DA 5JLAA 3V7YA 5KYUA 1QBGA 3GLRA 2VHYA 3SLGA 5CA1A 2HRCA 2D8AA 1S02A 2W5UA 3E9YA 4WLOA 5IVDA 1RAAA 3CU5A 3EGIA 4RD3A 2MSLA 2PS3A 3G9UA 5KVSA 1XQ6A 2QHXA 5K0FA 4JQZA 3O1LA 3EWSA 1KU0A 1W88B 1Q95A 2AFIB 3O92A 4MCAA 4OSEA 4V2IA 4X1IA 3NWPA 3F67A 4K9RA 3FDZA 3GRYA 3OKFA 2R1TB 3KFXA 5C1IA 1KYQA 4YRRA 3OZGA 3AJRA 1WR8A 2WTEA 3LP5A 4CIWA 2O8DB 1OGIA 1E4OA 1DKQA 1YA4A 3RUPA 4MPPA 2FJ0A 3NAQA 1AO0A 2HA4A 1BVYF 3AM4A 3RWBA 2HHHB 3O83A 1O77A 1QFYA 2WAOA 3E8MA 4JUIA 1FQWA 4UE6A 4BPRA 4R71A 1PO7A 3EZGA 1XIVA 2O0HA 4JCOA 2X7HA 3TEFA 2O05A 3LWBA 3ZHQA 1IJEA 1TVKB 4WNYA 1UOQA 3VR5H 2XYRA 2GK6A 3K9QO 4N5HX 3BC1A 3OCWA 3PWSA 4OBXA 3R7NA 4DQUA 1XROA 1A5SB 1GZ7A 1E69A 2BEKA 1WW8A 1ELOA 3U4HA 3IEVA 5MFZA 2QGNA 2A92A 1FDWA 1Z3CA 3KQTA 1EZ1A 3A2LA 1C1XA 3KOMA 1TPZA 2RHGB 3ZGXA 5CDSA 4X66B 2DR2A 2P9GA 3VAYA 2VWGA 4KQ6A 4IO0A 1CUGA 2OHOA 5LMUB 5C5IA 2XMPA 1ZM4A 2C2HA 3HJGA 2G5PA 3O8OB 1JU4A 3PFKA 4PBRA 4HZUB 1MR3F 3VQTA 7AT1A 1TC1A 1Z2EA 4B17A 2XNDA 4ENTA 2Z2JA 3Q4GA 1GNLA 1K98A 4MS3B 3WX0A 2LCIA 3GLIA 1W29A 2BPOA 2GRJA 2NU6B 4DNFA 4ZD6A 5BSMA 4DARA 4NBTA 2XZDA 2X9VA 5KYGA 1Q7TA 2QTMA 2Y1WA 1RVDA 4I4NA 4JC8A 1UM9B 5KVCA 3BMQA 3HMQA 4HPWA 3JAKB 4OCZA 3AIMA 3HACA 1U7ZA 4L28A 5CTAA 3LBAA 1IJKA 4IZ6A 4GQAA 4YC7A 4YONB 3CYFA 3W5JA 1KYVA 2X0KA 2VPQA 2XWQA 3RK0A 1SVNA 2QYOA 1L8AA 1DDGA 1T9GR 1GRVA 2OCXA 3L0YA 2V74B 3X1MA 1XMIA 3IODA 4FYXA 4ZOAA 4BGEA 1ZJ4A 4YI5A 4N7MA 3IVAA 4ODIA 5JS2A 3ZU5A 4NRDA 1APBA 3HLKA 2DT5A 3U3RA 3VSEA 4II3A 3AZOA 4W5JA 3D4BA 5F7JA 3ADBA 2JLXA 4RHEA 1FTSA 3LY7A 1S2IA 2AW3A 1IE3A 4GG1A 5LSAA 4HR7A 2IDJA 4L4RA 1JSRA 1G7RA 1C7IA 1NQ5A 2WFMA 1XK6A 3N1UA 4XDHA 4F5DA 2R1VB 4LZWA 3HUTA 1E5TA 4MXDA 4LC1A 2FPPA 4OLJA 1USUA 1E9SA 4X6UA 4ZA2A 3STVA 3H42B 3D8BA 4ZV9A 1II8B 4AP5A 3QI7A 1U8EA 3TVYA 4BQNA 1JHOA 1FXWF 2R6R1 4LJ6A 2O07A 4Q4HB 5AK0A 4XIFA 4QPJC 4P7KA 2DUNA 4L7QA 4B43A 2VVTA 2CFOA 2XDQB 4Z2YA 5JSHA 3LC1O 3N8GA 4D4KA 4LFAB 1K97A 2YVKA 3IE1A 3QELB 1W35A 4LYYA 1UDCA 3I6QA 2Z5FA 5DOZA 3CUYA 3VOSA 3GOQA 3FKSD 2YW9A 1P75A 2IDMA 5HKOA 3D2LA 1E2KA 4EX6A 4HQOA 5COQA 3ZK7A 2RGNC 3MN1A 1PBNA 3MCVA 2ZITA 5FHRA 1F8FA 1U2GA 5LP6C 1BDHA 2IT1A 3PIIA 1KF0A 2RH9B 4A8JC 3A4VA 4P3NA 1E2DA 1GN9A 5EC8A 3A1TA 4V39A 3CHYA 4GRDA 3U39A 1JSCA 2JIQA 5ETJA 3VX3A 3THXA 4TTPA 2Q3DA 4JVOA 3H0EA 4YBZA 2OHHA 2J1LA 2Z08A 3C6KA 4W4TA 4P34A 3WGQA 1EUDA 3DBRA 4YMGA 5J1SB 2IK8A 1NJ8A 1P8JA 4ZYVA 5EXPA 3FFWA 3DVLA 4GL4A 4EIWA 1SXQA 1B8UA 3KUKA 3H4TA 2FLWA 2JIOA 4U5XA 3U26A 2FR8C 1ODKA 2Z4SA 2O3UA 1WEKA 4C4OA 3H75A 1G64A 2HY7A 3R5KA 3TB4A 1DLIA 5FEMA 5DXJA 2VK2A 4BQRA 4TMVA 2I66A 3EZ9A 3BN3A 4O0LA 2IIVA 2GCGA 1OHHA 2XRFA 1BDMA 3H3JA 3EFBA 3HJAA 3HYSA 1LEHA 2BFCA 3SWWA 2WUEA 4PZCA 4ZYLA 1XEFA 3QKSB 1G20A 2H1CA 2J33A 1WMFA 4CG1A 1GPMA 3WRWA 1RC8A 2PU7A 2XA2A 1CJCA 3PNYA 3PZRA 1DOAA 3KC2A 3WLTA 1E2LA 4EKIA 5CK5A 4KDFA 2IEYA 2F9FA 1ZUNB 3H6KA 2C2KA 1LPMA 1P2BA 3BGSA 3OF5A 2XAAA 3MD0A 4HQFA 3E4CA 4BV9A 2X22A 2FWBA 3PFBA 2PSJA 1UJ4A 4J0HA 4F21A 5BOVA 4V0QA 2P2DA 2C5FA 3IBYA 3MC1A 1P3JA 2F62A 4JBGA 5LQDA 4E7PA 1PR4A 3H1PA 4JBIA 3PTAA 2R7AA 1SHTX 1UEXC 2YW2A 3HDTA 4ENQA 1RRMA 2HNAA 3OCVA 3PKJA 3HWRA 1V9SA 3CX6A 4CKEA 4D98A 4EF5A 3T0FA 2IS4A 5DGXA 4PYIA 3RTEA 1E20A 2E7ZA 3WAGA 4BAZA 5B1YA 1WDMA 4C2BA 3KEMA 4FP9A 2ZWAA 2PGLA 2WIBA 1PL0A 3KE8A 3OCUA 3HL4A 5EP2A 2HA0A 3OZUA 3DZJA 1ZLYA 2X40A 4D9CA 5IRCD 4KNYA 4GO1A 1USWA 4IUCS 5ECWA 5LWQA 1HDXA 4DANA 4DPMA 2QM0A 4DQKA 5C3MA 3V4RA 4UNSA 5FULA 3L8CA 4QNNA 1J1ZA 1ZIDA 4HOYA 1XKXA 3C3EA 5FTWA 2C42A 4Q4AA 2KPOA 1YS6A 5M04A 4UBNA 1KK2A 5E9AA 1B26A 1TADA 4HC4A 4NIMA 3MYRA 2HJGA 2Q6KA 5LMZA 4DSNA 1H3NA 1XR3A 1VKJA 1SKBA 1M0SA 2OGWA 2HXYA 2V58A 4NK4A 4R9VA 4TT8A 3E3OA 5ESRA 521PA 1H5UA 1ULAA 5KTMA 1EH5A 1NP6A 2GNAA 4QQRA 4BB5A 1JQDA 1FTGA 3DNPA 1JHDA 2ZI5A 3B8HA 3K9CA 3ZGNA 3X0DA 3HDYA 4G86A 1L4UA 1U0FA 2I3ZA 4L6IA 5F7OA 3N2EA 3TR6A 3WV4A 1HK7A 2TMKA 4MUKA 1N32B 5JJKA 1R7RA 3HKBB 2YFQA 5JY1A 3FROA 1O0CA 1E3DA 1TPYA 1U63A 1JDBC 4Z4GA 1JEDA 3B5JA 1UPCA 2H5LA 1FQJA 4GBMA 1DXQA 4NR0A 2WIAA 3QOFA 2VNAA 3TPFA 5K0LA 1NBOA 3AKEA 1TJ5A 2HWKA 2JZCA 5AW2A 2A9KA 5AW4A 1RZ3A 5H8WA 3LYUA 2ORWA 1QIIA 3BRWA 1AK2A 1YU9A 4MUMA 5THKA 3DTVA 3QF7A 3TSYA 1SHLA 3ZEIA 3BXEA 1QB8A 1YZFA 4J1NA 4M36A 3T7EA 2D62A 2I91A 4URWR 2J48A 1BWPA 1EE2A 1N1EA 3I4CA 3TNJA 2JD1A 1K3TA 1YOVA 3REGA 1ENYA 3IP9A 4RQUA 3EZ2A 3FNFA 4BTLA 3EODA 1M6NA 1E1RD 1B1AA 1ZS9A 2K2WA 2QLMA 3FTEA 3DOFA 1P9NA 4CCYA 1CRPA 1D2NA 3BQ9A 4J0IA 2OC9A 1NX9A 4ZCRA 1JYFA 1QIDA 3RVLA 4Q3CA 4E15A 3JVEA 1LWOA 3D2AA 1VIDA 1ODIA 3FUWA 4UVIA 4ZQIA 3FMIA 1SC4A 5T4FA 5AW6A 4S0XA 2E4AA 2VTBA 3SXUA 5SV2A 4BKUA 4D81A 1LPNA 2ZBEA 1PDVA 3ADPA 1U02A 3N59A 4CLXA 2ANBA 2FP3A 3KPWA 4OKNA 3AR9A 4CTJA 5JO9A 4YVFA 2RHWA 1Y7HA 1HT3A 1YDFA 1R0BA 1EU1A 5HJ7A 2DUWA 3QJYA 3V8MA 2RHMA 1E6CA 4S04A 3OZTA 2H92A 1WETA 5H5JA 3LUCA 1DADA 5A2QA 1X7YB 2DQZA 2FG7C 2IUFA 1DL5A 2ZCVA 4NKRA 2EFYA 1NMSA 3WI7A 2O8EA 1U6JA 3HHEA 1X0VA 1Z5VA 3VOBA 4C4ZA 1FLAA 4XIJA 2QKYA 1U0LA 5E4TA 4NAVA 1PX0A 2IY8A 3O8LA 1DBSA 3IO3A 1D1TA 821PA 3C1AA 1VC2A 3F9IA 2KJQA 3O74A 3ZY3A 1WEHA 3WNCA 2RGNA 3F49S 3L7MA 4C7OA 1NW3A 6Q21A 4D6YA 1JLMA 4UHBA 1JLHA 5EA2A 5LP6A 4Y2GA 1GU1A 3Q3GE 2L2QA 1GFIA 5CPBA 2ZT6A 4H1VA 4FVTA 1CWUA 1EVQA 2A0KA 4A8JA 1FNNA 4MS4A 3AI7A 5ITZB 1DHTA 1YRAA 4R2WA 1L5WA 2Y2VA 5ALZA 4MWTA 4YDRA 1OH5A 2B21A 1F38A 3MWGA 4OHFA 4GI3A 4D0LB 1I9GA 4I6JA 3IJPA 3AVTA 4D25A 2FQXA 1VLVA 5DEIA 3SZMA 1W48A 3RBXA 1ECCA 1H2XA 3W2HA 4RVHA 5J47A 3O31A 1QVVA 1SUEA 3LIPA 1YNOA 3N0RA 4ALLA 2C9CA 4DR6B 1KVRA 3WMRA 1GGVA 4INPA 2AT1A 2J6CA 3M2PA 3P9XA 5NLLA 5KNBH 4NBNA 3GRCA 2EIXA 3L6EA 5GGXA 4B3GA 4D8VA 3QVGA 4YASA 3CSUA 1P0FA 4EPTA 2FR8A 2IHUA 2BL4A 3RGWS 2YIJA 4QLOA 5K8IA 5SYNA 5A4AA 2F8MA 3LKZA 3VGJA 1BO6A 3I01M 2JASA 4WOPA 3KFVA 2O14A 1SUSA 4NS4A 4QG7A 5AOAA 3RE1A 3TPZA 1JXQA 4OG2A 4MUFA 4EA8A 5KZMB 3TIFA 2WI8A 1NZDA 3AT1A 1AZWA 4MWDA 5DJ5A 3I32A 3OESA 1T9CA 4UCQA 4B6FA 2EJWA 4Q9KA 2ZYRA 2OOSA 4PX9A 3BFXA 3F6SA 3OZDA 3KZMA 3GFOA 2OZLA 1X1AA 4RY0A 4MDEA 4CF4A 2VZEA 3NX4A 2P6MA 3Q1KA 1T9KA 1MF7A 4UNPA 3EWAA 5JDIC 4ICIA 3M7IA 1ZMTA 4KAXA 4O2BF 4UHEA 3TM5A 2QY9A 2N1MA 1VLJA 5G40A 3PIRA 4OMUA 2CL0X 1JJFA 1B2RA 4B3TB 5E6UA 5HOEA 4KI7A 1R6BX 3UAVA 3KWFA 3F8TA 1DMRA 3ND8A 1Z2PX 1J90A 1DAOA 1T9GS 2HWYA 2RARA 4MDHA 4NH4A 4DM7A 4B83A 5EJ4A 1OROA 2WJ6A 4D4LA 2PSFA 1ZKMA 1IN8A 3DOHA 4I4CA 5F76A 1NBEA 1HE1C 1WZUA 2ZULA 1CIJA 1HI9A 2GJKA 2PLRA 2ZAIA 5FFMA 3SU8A 2JA1A 3WNQA 3GLGA 2XE4A 1LVHA 3E15A 3TNDA 1RDFA 5JBNA 3G5AA 2X3YA 3OPXA 4LYHA 1OYVA 1UOEA 4QWWA 4R1OA 4CCSA 1DEHA 2RBGA 4B4WA 1WCYA 3OWXA 3QE2A 1UBHS 4MVJE 5KCZA 2X6RA 4GKVA 3ILHA 2VJCA 1XK7A 4AS1A 1Q0LA 2G88A 2GZMA 4HRYA 3MUFA 1KI6A 1ZZEA 5CVJA 4MMZB 4N8DA 3AHEA 3JWPA 4Y1GA 5F2EA 4KQHA 2J9FB 2REBA 3ZDRA 3JQ7A 1QAQA 4O4HB 4PO9A 4D8XA 2WUGA 4RKWA 5IMSA 3DDOA 2ZT7A 1RCFA 2QUAA 3DL2A 1V1JA 3HKCA 4FONA 3ZD8A 4ECEA 5A9SB 2BH9A 1FW8A 4H15A 1V8PA 4BO8A 5DI3B 4DYHA 2V6FA 3JQRA 1N7JA 4EJ0A 4CNBA 4E5MA 3W6OA 5HFJA 1M1NA 1VJGA 1VTKA 3MWFA 1CVLA 3O8BA 4L9SA 1MU0A 4TS3A 3UN1A 4E03A 1SC1A 2VAPA 5JQGB 1XVAA 2RK6A 2W22A 3EA4A 3W34A 4BNXA 2PXHA 1VA5A 1WV1A 3VDXA 1F8YA 2QLLA 2QRMA 1DU4A 2GT1A 4OXRA 1EBUA 1EQAA 1I8TA 1C8LA 3UAXA 1WB6A 3DM9B 3G5UA 1FFGA 3QOXA 4YAUA 1Z16A 1ES9A 2G3YA 4R9NA 3DDSA 2JLWA 1MO2A 3U2QA 4O4LA 3DQQA 2D7DA 2AEFA 3WL3A 1BEZA 1JR3A 3ZU4A 3UUGA 3A0RB 4BNGA 5CB4A 1K6MA 3KFLA 3O7WA 1U31A 4TRMA 5JO0A 2CC2A 3KS9A 2I6QA 5TPZD 4QM7A 1MV8A 1JHXA 4QXPA 4L57A 4HWSA 2Y0PA 1P4RA 1WKCA 2D2FA 1TA0A 3DULA 4IDNA 2Z1MA 2YWDA 2EU8A 4Y2RA 3ZHSA 5A3RA 4ARVA 3TGPA 4E07A 3HWX1 3BCSA 1ZD8A 3I3SR 3AVOA 4ER6A 1C4OA 1ZRSA 2FWNA 1NXVA 3VDRA 1D04A 4HDNB 4ZVKA 3REFA 3NV9A 4HVTA 4OBWA 2G5CA 2IYZA 2D2EA 1EG2A 1GT6A 3EUAA 1A76A 1Z0AA 1WSDA 1B6TA 2CN1A 1DAFA 5CA0A 1V1RB 1DBVO 1OGYA 1XEXB 3E1SA 4OBBA 3TIIA 3UWPA 3L77A 3IUJA 3TCKA 3K9BA 2NG1A 5BO5A 2PUJA 2JIDA 1Z7WA 5HTKA 4GLLA 4RZ2A 1I51A 3SHFA 1ADGA 2PKXA 3HU1A 3VU1A 1KQ3A 1TRKA 1RU3A 3P32A 1M6EX 3FF4A 2YHIA 1IN7A 1GFZA 1SUPA 3V4LA 3VVLA 2G72A 3PDCA 3AUFA 5JECA 1LJ8A 2HF7A 3BHJA 3DB2A 4YPOA 3RJ9A 2H7YA 3G2MA 2NU7B 2CCGA 2O1EA 3ZE0B 3DXYA 1NKSA 1C0KA 2CJFA 1DZ3A 3FPKA 3MS2A 1M8PA 5G0TA 1QHSA 2AK2A 3EC1A 4A16A 2W6OA 4M1TA 4OQZA 2QIOA 3FCAA 4UAJA 4J7XA 1K6IA 3HY6A 1L7VC 3AJDA 4Z7QB 1QGAA 2W70A 2V0NA 2ZUDA 4FWBA 2NGRA 1Y89A 4PTZA 3KXLA 2JGEA 1ODJA 1Z4JA 4FI3F 1JLRA 3CNBA 1YVPA 4PSCA 1ESZA 2XYQA 4UOEA 4C0XA 2Q5LA 3PVSA 4Y2QA 4KDCA 2WABA 3MJEA 2J07A 1P2VA 2R6GA 1NLZA 1W73A 4QYTA 4X94A 4ZANA 1NU8A 4HAVA 2CHVA 4UDYX 5K6AC 1D4ZA 2RAUA 2BFWA 4RGYA 1IEWA 1QFZA 4F9GA 3DO8A 4P7JA 4K2AA 1I2DA 4G5GA 5BWOA 4BMXA 3WK4A 5CTJA 2UZIR 1XELA 5ULLA 3VH2A 4Z51A 1ECFA 1HLDA 5HHTA 2GM4A 1L8OA 1WKVA 2IIBA 4M7PA 4CGYA 2VOJA 4C4YA 3I1FA 3VYTB 3RTGA 1PWEA 3DHYA 2NUTA 4Y6LA 2J5QA 5E3JA 2VFAA 3SLKA 2CUZA 1W2HA 2YWHA 3C98A 4IINA 4HYTA 3ANNA 3JRXA 5ED0A 5BT9A 3REQA 5HZHA 2JLYA 4UNRA 4ZEXA 3HFSA 1E5DA 3OQIB 2BKVA 4GBED 4V0RA 2NU9B 3EEOA 1JV2B 3CUWA 4I4TB 5AVYA 4Q00A 1RT9A 1UJ2A 2DJIA 2PS1A 4LK3A 4YRNA 1PK8A 1EFRD 1WUIS 5JDIA 2IP4A 1V2GA 3I3OA 2GRUA 1PR3A 2IIQA 2HJHA 4Q7JB 3R23A 4XGRA 3TI7A 4CMKA 1NNLA 1OYWA 2B61A 2YJ3A 2ID4A 4DDUA 5HIKA 1QRSA 1IZZA 2CZGA 3QZUA 3PNOA 2CHUA 4PC7A 3ZXSA 4NABA 3H8JA 6NULA 4BPBA 3LS2A 1SRQA 4BZQA 4HVLA 2EF0A 2H0QA 3I23A 3OD1A 3WWCA 2EWVA 2BHNA 3SZLA 4YAIA 1JEJA 1QG0A 2ZBRA 3L04A 4PIVA 1UPUA 3A6HA 4BO3A 1F2TB 4TXJA 5F5LA 3N86A 2JAXA 1M2NA 1IOVA 4M98A 2YMQA 1XVLA 3DOUA 5KCMA 4BV8A 1EVIA 1CY7A 1C30A 1Y1QA 2V8BA 3FE2A 1DC6A 3P9SA 4LXYA 1U9IC 1HNWB 1HQCA 2HK8A 1OI7A 3IUNA 2CXXA 2WA2A 4V0MA 3PVZA 3K9GA 5DM60 2A0UA 4KMSA 4Q9LA 1B7GO 3GUYA 5FP0A 4HX5A 2DQSA 4FJ0A 2YFYA 4MR7B 1R16A 3HCNA 4UMVA 1AHHA 3G82C 1Q17A 1KEEA 1E2BA 3NTVA 2VCEA 1UXKA 3KKQA 2K87A 4ZDIA 1SIWA 2GX6A 4LJAA 4R1NA 5JMTA 1NZJA 5F2NA 2Y66A 1EFKA 2NADA 2JI9A 4HDRB 5TEVA 2DWPA 1BOFA 2WU4A 4CN9A 5HCUA 1Z0SA 2YOFA 2YZNA 2IV3A 2E5LB 3QRWA 3C3WA 721PA 2TMYA 1XE3A 1RHQA 3OE4A 4MYSA 3INYA 4O5OA 5C52B 2QU7A 1JZSA 1PV2A 4QYIA 1SXJB 3KKMA 2O8BA 4BNTA 1XMQB 3VPSA 3VZRA 4Z3KA 1MX3A 4FLEA 3ZV5A 1W4ZA 4QFCA 3RO7A 4PAMA 3QFSA 2B20A 3WWEA 3NBXX 4X8HA 2C84A 1UADA 1N3LA 1UJBA 4YJFA 1TW3A 2H1VA 3U7EB 1D4FA 5IHXA 2PE5A 1AMNA 1GT91 4RA6B 3R76A 4C43A 2H1WA 3GWGA 1MQAA 5T4HA 3TOCA 2JRLA 4XTCS 3A9WA 1WAMA 1WULS 3ZWNA 4QTYA 1J0BA 2GK3A 1L5ZA 1VMEA 2OEPA 2XMCA 4AXXA 3E1KA 4WNCA 1PKEA 3D7LA 3GGGA 3IDFA 4HKTA 4M8IA 5AJVB 2A7XA 3U19A 4PQYA 2QZSA 3A4MA 1F1BA 4GOMD 2DECA 4LHVA 2GKGA 1K92A 1SHUX 5HDQA 5A5GA 1A9PA 1TCCA 5I7OA 1W2WB 3N2GB 3AM1A 1QV6A 3OTWA 3PICA 1PJBA 2NUBA 2CXRA 2BBOA 1PRYA 3CFYA 4TQGA 5IBQA 3SD7A 4DXHA 3OFND 2CV0A 3D8NA 3PQ7A 4KOAA 3RM3A 4YYZA 1ZQ9A 5JAIA 5KYUB 1PHRA 3CZ4A 1GNTA 2AYYA 4UJ5A 5DW3A 5CDFE 1H2WA 4IX1A 2XQFA 2C4VA 2PKWA 4MICA 1QLHA 4MEBA 3HO6A 3ISVA 4EB0A 2RJNA 2Q4RA 3EUWA 1MEJA 1TK2A 3Q3IA 4H7IA 1JVBA 4CUZA 3UMRA 2PPLA 1EKXA 2JJ2D 4ZYTA 4AFNA 2ZIEA 2OGSA 3I9OA 4DJ5X 3AF3A 3DEAA 3OC6A 5FUQA 1QX3A 1VSUA 3U7IA 3K9FC 2PQ2A 5JALA 4W5OA 3WLHA 1RAHA 5C2JB 3JYNA 4KVGA 2AB0A 2B7BA 2RGXA 3ICEA 2BKUA 3DKPA 2WAYA 3L40A 1NW9B 2WPDD 1BWRA 4ZAGA 1N8NA 1Y4SA 3AY6A 4E2ZA 1FFEA 1J21A 1GDDA 4C6SA 4WLFA 4A10A 3LNCA 2SNIE 4UXHA 2MHCA 1ML3A 1TMGE 1WD5A 2UZ0A 1I3LA 4URZR 5EXTA 3VC1A