3LZ6A

Guinea pig 11beta hydroxysteroid dehydrogenase with pf-877423
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
KFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title The development and SAR of pyrrolidine carboxamide 11beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Cavia porcellus
total genus 97
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3lz6A00
1ENOA 3JV7A 1O0SA 1MFPA 3DZHA 3Q2IA 4J4HA 4GWKA 4PVDA 5IXYA 4C7JA 5KJ1A 1T26A 5A9RA 3P2OA 1GADO 2YFQA 4BGVA 1BHSA 1G1AA 4PGFA 5IDWA 2WWRA 1XEAA 2C20A 3K30A 3V1YA 1MGOA 3E03A 2Y05A 3H5NA 3B1KA 1Y1PA 4URFA 3LT1A 1NYTA 3QVWA 4IZHA 1K0UA 1P0FA 2OBNA 3GAFA 4YTEA 4MVJD 4NU5A 2IODA 3QVOA 4LRSB 7MDHA 4BKOA 1EFKA 4PLCA 3RUDA 3ENKA 4BS9A 3ROQA 1JWBB 2DC1A 2CVQA 2HK9A 2WMDA 4WE3A 4CJXA 5HM8A 4WLOA 2BFPA 4QX6A 4FN4A 3U62A 4Z9FA 5JNLA 2Y1FA 3INTA 4FFNA 2GZ2A 3UF0A 4FC7A 4EW6A 5JC1A 3OHSX 3INGA 1YH3A 4FDAA 3SC4A 1UAYA 4FCCA 3WJAA 3GG9A 4HFJA 4QSMA 1IB6A 4NK4A 3WLEA 4CM7A 2I66A 4NJOA 1PR9A 4I9NA 4UVEA 1V3TA 3ZV4A 2WD8A 1AHHA 3EZYA 1AE1A 2G5CA 4QTZA 4NBRA 3B70A 4ALIA 4CMHA 5JCXA 4IS3A 3JD4A 1V3VA 3KRTA 1DIAA 4E12A 4GX5A 3UUWA 3ZV5A 1MUUA 1YVEI 3LF2A 2P68A 1BVUA 2P9EA 1I01A 1D3AA 3DZIA 4XIYA 1FDWA 5AQ1A 1BG6A 2DU8A 3RASA 3GRPA 1PEDA 3UVEA 2DKNA 3F47A 5TT0A 4J2HA 1PJ3A 5AXAA 3CSDA 4Q3AA 4U0JA 1YS4A 4NBUA 4WCFB 2O3QA 3PWZA 3W1VA 4N54A 4GAEA 3MWEB 1KBZA 3C3XA 2HCTA 4LK3A 3EYWA 4XZ3A 3LT2A 2O3TA 1X7HA 1XR3A 1DHTA 1I2CA 1P1IA 4R51A 2J3JA 2ZB3A 3ZWXA 2V6FA 1O95A 5TJ9A 4NDNE 3KETA 1QXSA 1UZLA 5JSFA 1CJCA 4B4UA 1P74A 3JD0A 4D3SA 1A4UA 1NVGA 3KYDB 1T2EA 4YT5A 4HBGA 1DRWA 2FR0A 1BTOA 4JP3A 4XQCA 4UUNA 2VZ0A 5GMOA 4XR4A 1YL7A 1ZSNA 2JL1A 3NT5A 1C3VA 1LDBA 2WYUA 3DZBA 3BTVA 4RQUA 1SOWA 1CDOA 3JQ7A 5A5FA 3PK0A 4ZQHA 1A7KA 3GUYA 4QFDA 1BSVA 3FF4A 4AJJA 4XB2A 5ADHA 5FF9A 1VE9A 4TKLA 4U6SA 1NAHA 2RH4A 2WD7A 2IZ1A 4PZCA 1ISFA 1GU7A 1B14A 5ILGA 1PQWA 3AI2A 3QVXA 2GR9A 2HJRA 1H2HA 3I52A 4BB6A 1SB8A 1EVYA 2C2XA 3DFZA 1Y9AA 3QV1A 4NIMA 3RUHA 1R37A 1AHIA 3DMTC 5KJCA 1WW8A 1ZW1A 3H9QA 1E7RA 3IS3A 3QSGA 4Y8VA 2O3JA 4D0RA 5H81A 1R4MA 4IY1A 2J5QA 2Y67A 5IN5A 5EJ2A 3FNHA 4BNJA 5BR7A 5L51A 3HUDA 3NV9A 3OFSA 2VHVA 2JKVA 1ZEJA 3D4PA 4LGVA 1OZAA 4FFOA 2PTGA 1E77A 4ZICA 5AYVA 5L7TA 4MKXA 3I83A 5IDQA 4R01A 5LC1A 4W99A 1YDWA 2V6MA 4FBGA 2E4AA 3FNGA 4O5OA 2YHIB 1HDCA 3JD2A 4FJ0A 1YKFA 3EHEA 3L6OO 3RQSA 2HMWA 4GPD1 4FOOA 2BRUA 4I5EA 1LQUA 1PQPA 5F1OA 3QA9A 2EGGA 5DCYA 3TZHA 1T1SA 2ZQZA 1LXCA 1WDMA 3S8MA 2BFAA 5THQA 1NFRA 1ISHA 3EY4A 4MIYA 1OC4A 1Y9EA 4TRRA 5IAAA 1DXYA 5I9LA 2H5LA 1UP4A 4ALJA 3ANMA 4D7AA 4E2YA 2GN4A 3E5MA 3DMTA 1Y5RA 3GT0A 1QMGA 2CVZA 2JD0A 2WDZA 4L76A 1S6YA 1YQXA 5C7LO 1DDOA 1U9JA 1Z73A 4NU6A 4YJDA 3HADA 1DC3A 3IKTA 3HB5X 3DO5A 5I7SA 4G5HA 1DB3A 2IZ0A 1VSUA 3H4VA 2YQ4A 2O7SA 3PEFA 2P9CA 1C0KA 2QG4A 4J7CA 4MP8A 5L4LA 4W9NA 2X4GA 5JS6A 3RUFA 3ETGA 1L7EA 4RGBA 4CL8A 1NQTA 1VL0A 1ZXLA 2PD4A 3VDRA 4DIBA 2PKQP 3GGGA 1O8CA 5JO0A 2X6TA 1RM4A 2I6TA 3L0DA 3UICA 4BMNA 4ALNA 2YV1A 3JYQA 3NDJA 3JQ6A 3TOZA 4RVDA 4YRAA 3H9UA 2Y99A 4YPOA 3QE3A 3DFUA 2IDZA 5CHEA 5FYDA 1HKUA 2NWQA 5CG1A 1LI4A 2Y1GA 4Q3EA 1F8GA 4YAEA 4J7XA 4JCOA 4CMEC 3RFVA 1PR3A 4J90A 5CDUA 3JYPA 4K6FA 4BNIA 4XJSA 1SEVA 3VH2A 4FOSA 2NVWA 5A3JA 3GFGA 2PZKA 4MJLA 4PLWA 3HDYA 2ZTVA 4WOKA 4BV8A 2WYWA 3KSUA 1HYGA 1V3UA 3X2FA 5ES3A 4YEDA 3CE6A 1P1FA 2WEKA 3GDFA 2FSSA 1J4AA 3WWYA 1N7HA 4HADA 3S1LA 1GR0A 5ER9A 5G0WA 3WYCA 1YOVB 4AJOA 2NACA 4BNWA 1O5IA 1PJLA 2X0IA 3K2EA 3DOOA 1U8FO 4I5DA 1NHWA 2BI8A 4BO2A 2VUUA 2AE1A 4DGSA 4ZQEA 4MVJH 2EV9A 3WWZA 2ZB8A 4RPLA 4ND3A 2E37A 3IP3A 3JQ8B 3ZNOA 1B7GO 2HU2A 4D44A 3TQHA 5L53A 1XCBA 4RF2A 1PGPA 1PWXA 3WSVA 5COBA 2OL4A 3D5QA 4EZBA 3FCOA 4YQYA 4D3DA 2JHFA 5CDYA 2F00A 2JCXA 1D1TA 3WDSA 4XRGA 4FGWA 4EI2A 5A05A 1TI7A 1HDZA 5DDIP 1HE5A 3PJEA 2IZZA 4RVFA 5C7OO 3DBHA 4CMEA 2VUSA 1YGYA 5DCWA 1M6WA 2EERA 1Z74A 4I08A 2X23A 1QV6A 4Q3NA 3N74A 2HMTA 5F5NA 3MCVA 1KVTA 4U0KA 5C3MA 3O26A 1XDWA 2QIOA 1ZSVA 2R00C 1YBAA 4OKNA 4L0QA 4NBWA 4XYLA 1HEUA 4B3JA 4GWGA 2EF1A 4BNKA 3GZNB 3JQAD 2IYPA 1GYRA 3RI3A 1DC5A 4BNTA 2HMSA 2GZ3A 5EQDA 2OP1A 4BO4A 5EIOA 2W2KB 4D41A 2EHDA 5GY7A 3DQPA 3UFXA 4ZN6A 1B8UA 3V1UA 1E1NA 4NMHA 4I9HA 1MG5A 1YXMA 2DBRA 3KOUA 2QRJA 4U6QA 3OEYA 2BGLA 1U28A 4KWIA 1Z82A 3KYCB 5GZ1A 1NR7A 2EXXA 2NVUA 2YHUA 1T4DA 4TQGA 1G0OA 1I3MA 1YDEA 3GNQA 3I4CA 4HKTA 4OO3A 2X7HA 3BA1A 3AU8A 4J1NA 4NQZA 2JAHA 1E6WA 4HUJA 3I1JA 3R3SA 4DXHA 2EKPA 1WVGA 2AG8A 2WE8A 3P2YA 4OL9A 5JE8A 1XLTA 2VZ9A 3AWDA 3DTTA 1T1RA 5KTKA 3WS7A 1O89A 5JDCC 1JDJA 4R16A 3LSYA 1JKFA 3KM0A 4NJMA 4Y98A 7ADHA 3WFJA 3JQAA 3PHHA 2R00A 1V35A 4II3A 3H3JA 2Q1UA 3OJLA 4M89A 1YQGA 1Z75A 3S2GA 2HRZA 1N9GB 3RU7A 1B2LA 2FPGA 3ANLA 5CPBA 4OHUA 3RSHA 2GN6A 1R16A 3GGOA 3TPCA 4FJ1A 1VL8A 1Z7EA 5MGBA 1PIWA 3D64A 2O3UA 4C7KA 3U4DA 1F14A 1MB4A 3FBTA 3L9WA 1R4NB 1NQ5A 3P7MA 4JBHA 4RLSA 1QYWA 3SXPA 1P31A 4P4NA 4K9DA 2XPCA 1E3JA 5EL0A 1UR5A 1BRMA 4IS2A 3UW3A 3H65A 1MP0A 1JU9A 4BNGA 1XIVA 3Q0EA 2ZJ1A 5H83A 4A0SA 3NTQA 4GGPA 4IDBA 4WOJA 1WP4A 4RZHA 2B69A 3V5NA 3PQEA 3QQPA 4CODB 4JJFA 4N5MA 4AJNA 3R1IA 4DLLA 1GD1O 4YACA 5AXCA 4BNXA 4ZQBA 5A03A 3ETEA 1SNYA 5L4NA 5G0VA 4Z3DA 1YL6A 2ZTUA 3A06A 5JCJA 3ZWMA 5JDCA 1NM5A 1KEUA 1M2WA 1AGNA 1VJ0A 2C82A 3HE3A 4DBZA 1YBMA 5A06A 1AXGA 1IPEA 2C2YA 5TSDA 4PLZA 3UCXA 3OETA 5B4TA 3GVPA 3Q3CA 5K6AA 3BAZA 3PWSA 2W90A 4J9UE 1C1DB 3H7AA 4GSLA 3W6ZA 4PLVA 4J6FA 2C5EA 1O6ZA 1HSOA 2IXAA 4PLGA 1VJTA 3FNFA 1IHXA 2RHCA 3ZWPA 1P1JA 1D4FA 1BW9B 4ZRMA 4H3VA 3KLPX 5A9TA 4DLBA 5JY1A 2ZKLA 3SC6A 4IMPA 5CDGA 2FHSA 4RJTA 1VSVA 4JK3A 2ZTLA 2PGLA 2CF5A 4P4LA 2B4RO 1VC2A 1GV1A 1OC2A 3NDIA 3HNPA 1DHRA 2IYOA 4KDEA 5AXDA 2EKLA 1T2CA 4FFMA 2CZCA 4I5FA 1RKXA 3GVCA 4ND4A 3SBOA 2CFCA 5A9SA 4BKQA 3BMQA 5I8ZA 1ZVMA 1E7MA 1AXEA 9LDBA 2WTBA 4XGNA 1KVRA 2BGKA 1MC4A 4PG4A 3ZHYA 2PZLA 3HWRA 4ESOA 1HDXA 1GQQA 5ENDA 4HNGA 4TZTA 1A71A 2X5KO 3LU1A 3RD5A 2JCYA 3MJVA 2NU7A 4LMRA 3O8QA 4QUKA 4RF5A 3R3JA 4CLRA 2GCGA 5G2OA 2QW8A 4WCDA 3ZU2A 4YRDA 3DWFA 1GEEA 1HTBA 4KP7A 4NH4A 3TDKA 4NNJA 1U4SA 3M1AA 2CSUA 5JAZA 1P44A 2CF6A 3O9ZA 1NFQA 3QVTA 3LQFA 3W4IA 4BV9A 3WTBA 1T2FA 5H82A 3UXYA 3ONEA 5TT1A 3L6EA 5K0ZA 2D8AA 2X58A 1E1LA 2CD9A 3MTJA 3UCEA 5TF4A 4YYZA 3MJSA 3DHEA 3MWDB 3ORFA 5EINA 3ZHXA 1O9BA 1NX6A 1NNUA 2BFOA 2XAAA 2OUIA 4OYRA 3V2GA 2EKQA 1HSZA 4OMUA 1LNQA 4AJHA 1MV8A 4XYEA 3FTPA 3WLFA 3E6AA 4JGBA 1S7CA 4S3MA 2FY8A 4WNCA 3DZJA 4KDFA 3WYEA 1LUAA 1LBEA 4CM4A 3DBVO 4XGKA 3JQDA 4K6CA 3ZWAA 1BWSA 1VJ1A 4OKIA 4A03A 1IZ0A 2FN7A 3ADPA 5L7WA 3IDSA 3ULKA 2I3AA 3F4BA 3E9QA 3BZUA 3QY9A 4HFRA 4BHTA 4CM1A 1RM3A 4Q3DA 4E5KA 1H6BA 5HS6A 1YL5A 3PHLA 4DC0A 3RUCA 4AL4A 3RVDA 1IOLA 3OQBA 3VVCA 2VHXA 3SJ7A 2Q1TA 1I0ZA 1JVSA 1ZZEA 5JYEA 1HE2A 5IDXA 4EUEA 1MLDA 3ZV6A 3B20A 4PZEA 4WJZA 4CMGA 1E5LA 1Z6ZA 5TX7A 5COAA 5ICSA 1IYZA 3DOJA 4DPMA 5C5IA 3KBOA 3DHYA 4IPTA 2ZYGA 2JCVA 3WGQA 3PZRA 3AW9A 3GVIA 2X0RA 3N7UA 1Q0LA 4E6PA 5IDYA 1F06A 3PP8A 4EJ6A 2VNAA 2Q4BA 4R9SA 5FWNA 2A9FA 1YWGO 3OA0A 3AM4A 4CLEA 3S2FA 3I9OA 4FS3A 4WECA 2FPIA 4WASA 4CUZA 4R1NA 2C54A 5CEEA 4J43A 4XGIA 4UULA 4U7WA 3ZH2A 1HDGO 4EGFA 5F21A 4JIGA 1ZEMA 3LYLA 3RUIA 3OIDA 2I3GA 1JTVA 4BNVA 5G4LA 4DVJA 2PD3A 1KVSA 3T4EA 4NI5A 1ZH8A 2GDZA 3CH6A 3G79A 3LT0A 2E82A 3GRKA 2NTVA 1GUYA 2A4KA 3HSKA 3JQGB 1GYQA 2EEZA 4CMAA 1EK6A 3A1NA 3IL2A 1Y8QB 5KCZA 5IF3A 3G49A 3GMDA 4J4TA 3GG2A 4R68A 4E2WA 2HMVA 3GVXA 2E49A 3HHPA 5EQFA 3LT4A 4CM8A 1BXZA 2NTNA 3RFTA 3GDOA 1V8BA 1RM0A 3ZNQA 1DC6A 1M66A 1UDBA 3E1KA 4E31A 3CKYA 3DZFA 2NQ8A 3VH4A 2DTXA 1ADFA 1ZKMA 1TT5A 2Q2QA 2SCUA 2ZK7A 4TRJA 3S2IA 1CIVA 1G6KA 8LDHA 5IJZA 4IUYA 2Q2VA 4ZRNA 3H6KA 4MP3A 5ITVA 4YJGA 4TVOA 3D3WB 2DAPA 1E3WA 2HUNA 1R66A 1NWHA 1U2GA 3OJFA 1LLQA 2D5CA 2XF8A 4RDIA 1ADBA 3W8DA 4HNHA 1QP8A 4Y9DA 2PR2A 2B5VA 1JQBA 4GMGA 4MP6A 3JQFC 3FWZA 3IP1A 1ZK2A 4BNLA 4KTVE 4MO2A 5T64A 1I30A 3WBFA 1R15A 4PIVA 1NASA 3PHJA 3L9XA 4J7UA 3QLJA 2OBYA 2PNFA 5DCUA 4J16A 1D1SA 3KEOA 5F3RA 4Z0HO 1DLJA 4NHEA 5C7IO 1PGQA 3RFXA 1LLDA 2C7GA 2JAPA 1EDOA 4Y67A 2CDCA 2JJYA 5HA5A 3DAGA 1BXKA 1HF3A 2VWPA 4L73A 3G1TA 4MVJA 4TRNA 2NV6A 4TWRA 4F46A 1KEVA 1EVIA 1V6AA 3ZI0A 3H9JA 4FR5A 4CV3A 3D1LA 4PN3A 1HE3A 2EW2A 1XYGA 3K9QO 1CF2O 2EIHA 1P3DA 3F1KA 4IINA 3VPXA 4LRTB 1OMOA 4XX0A 3FR7A 4KOAA 2X86A 4ALMA 1ZJZA 2UYYA 5TRTA 4A73A 1NPDA 4AJPA 2NTJA 4CLHA 2DUUA 1QV7A 4H15A 4XRRA 3WG9A 3M2PA 4M55A 4DLAA 4IQ8A 4HP8A 5B37A 3WQSB 1HL3A 4J91A 3O03A 1LC3A 3JQFA 4AJLA 2Q46A 3IC5A 1EVZA 5EPOA 3PLRA 4O6VA 1JKJA 4OGWA 2GD1O 1E1KA 5AVOA 2TMDA 1CQJA 4NR0A 3FPCA 4Q9NA 4BVAA 3GEMA 4F6LA 4B4VA 5I7FA 5ILOA 3W8FA 3TFQA 3NGLA 2DPGA 3V2UA 1QKIA 2GNAA 3COSA 3ROKA 4DC1A 2OOSA 1Y8RB 3WOHA 2AE2A 3IJPA 2FZEA 3QHAA 3OQ1A 1J49A 1PS0A 2NM0A 3Q2KA 2JFHA 2PZMA 1FXSA 5A1TA 4IIVA 4DPKA 4D79A 3RKRA 4TKMA 2NUAA 1RYEA 1W0CA 3K5PA 5TIIA 4CMKA 2AQKA 4HXYA 4II2A 2H63A 1N1EA 1IZ9A 1YBVA 2Q1WA 1PZEA 2YFHA 3D5TA 3ITDA 4FFPA 4I1IA 2VWGA 4Q3CA 4QO7A 4F6CA 4CM6A 4OIMA 2D5AA 3QW2A 2YW9A 1H93A 4OXKA 1SOVA 4YDRA 4GKVA 4MVJE 1MA0A 2ZYDA 1SEPA 2PKQO 4I9UA 5EESA 1R6DA 3ROMA 3PI7A 3AY3A 3JYOA 4FC6A 3FWNA 4XYMA 2D2IA 4EUFA 5JPIA 4P4GA 1NVTA 4JLWA 4DIOA 1WZIA 5EERA 2Q2WA 3UN1A 3WQRA 1TVEA 3W8EA 4E32A 2G0TA 1FK8A 4CLDA 4MVJM 2Y1OA 3V1TC 3FTNA 2EG9A 3GEGA 1VLLA 3IUPA 4GI2A 4CM9D 2VQ3A 4J49A 4IDEA 1WNTA 4JX8A 3WYBA 4LVUA 4AJ1A 3DBRB 3AOEC 4FPXA 1EUDA 5G0TA 2B0JA 4NFYA 3GC6A 4IMRA 4XQ9A 3RCBA 3T7CA 5FEUA 2VT2A 3E48A 4IGEA 5U4QA 2QYTA 1AUPA 1EK5A 4KUEA 4GBJA 4BIIA 4CMIB 4QQRA 3A9WA 1HDOA 2YYYA 1H6DA 2PWZA 1IPFA 3FN4A 2NU9A 4RPHA 1DFHA 3H3FA 1EZ4A 2FR8A 1X7DA 4CPDA 1FMCA 3WQQA 1I5RA 3U49A 4P22A 3LC7O 5B4VA 4BO6A 2A94A 3CUKA 2P9GA 3GN1A 3PGJA 2J5KA 4JJGA 2C7VA 2NADA 3GN2A 4JNKA 4YCAA 3NJ4A 3RJ9A 3DR3A 5JFOA 2VTEA 2VT3A 4FFRA 1SBYA 1SO8A 1W4ZA 3CZMA 4Z9YA 2AHRA 2EW8A 1UXIA 4JJIA 3FRJA 5HWSA 2X9GA 5ITWA 2W2LD 4CM9A 4NG5A 3DONA 3E82A 1SZJG 3OBBA 2Y1DA 4XDYA 4Z3KA 3BHJA 5JBIA 3RAJA 2CY0A 1F8FA 3OJOA 4YAKA 3O8QB 1QR6A 3GOHA 4TSKA 4PRLA 4CQMB 3LC2O 3VPHA 5J23A 2Z5LA 3T4XA 1VM6A 4PLHA 1B8PA 4BNMA 4WK6A 2QZ9A 3L4BC 3OA2A 4L9RA 5T8KC 4RPGA 3MEQA 1U5AA 1LDNA 3W4JA 2JFGA 4YR9A 1LX6A 2PGDA 1GDHA 3ROPA 5IN4A 3DTYA 1KEWA 4E33A 1X1TA 4YJFA 1O94A 3Q11A 4QFCA 1N1GA 1IY8A 1Z7BA 3PVZA 4CLOA 2I99A 1Q2XA 1BDMA 2B83A 3TZCA 4A10A 4O63O 1DOHA 5L9AA 2J3HA 1K6XA 2OZPA 5TQVA 1NPTO 2AG5A 5DULA 1KS9A 1PZHA 2NSDA 1Y81A 3JQ9C 4EEXA 2YZ7A 5I7VA 3WGTA 4QEDA 3TRIA 3PJGA 3ITKA 2X5JO 1GFSA 4WGGA 3E9NA 2BKAA 3KVOA 4OH1A 2ZCVA 1XU9A 3BMOA 4UEKA 5KVQA 3WNVA 2C07A 1BXGA 4AJIA 1W73A 5JY6A 4YJHA 1ADGA 1QLJA 4DTIA 3WXBA 4E4YA 4CM3A 3BMNB 4G81A 3ONFA 4PG6A 3RC1A 3JQBC 1XA0A 5T8KA 3WGIA 3VPSA 2IXBA 3UOGA 3VZSA 3D4OA 5A5EA 1PL7A 1XG5A 2AMFA 4GH5A 3K31A 2R2GA 2VYND 4E2XA 3ZHZA 1DAOA 3RC9A 1ZO8A 3KXDA 1T25A 2AQHA 4E2ZA 1P0CA 4G65A 3RIHA 1KIFA 3RBXA 3JYLA 3OQ6A 3V2HA 3R6DA 1PJBA 3AU9A 3PLNA 4WCFC 2X0JA 4H16A 4YAJA 1EMDA 2QZZA 3DBLA 3FNEA 3JQ9A 4MOWA 1LEHA 3ZWNA 3OEWA 2DFVA 4J9VA 1ZK3A 5JXWA 4BO5A 2P2SA 3WICA 3W6UA 2Y0EA 1QG6A 1DSSG 3NDRA 4DRYA 2VN8A 2DT5A 3GNSA 1WDLA 2BFMA 3PZBA 3CMCO 4LCEA 4WKGA 1TEHA 2PH5A 1GV0A 3DZGA 3TZQA 4MIOA 2X8LA 5F1KA 2EP5A 1LSJA 4JP2A 3GZ4A 4YA6A 2D0IA 2PFGA 4BUCA 4ILKA 3IAHA 4O59O 4YBZA 4J1SA 3BTSA 4J1QA 2I65A 2W8ZA 3JQBA 5CEFA 4WEOA 3K73O 5I9MA 1EBUA 2PH3A 4AG3A 3PWKA 1FDVA 4GQAA 2RHRA 2VOEA 3JQCA 4M54A 3PQFA 4KQXA 1CQIA 1ENYA 3STHA 4IDCA 5DNAA 3UCFA 2E6UX 1UXHA 4OQZA 4DWVA 1E7QA 1UJMA 1WXDA 3F4LA 2DBVO 1GY8A 3GR6A 3I9MA 4I8XA 5ICMA 1PZFA 4NFHA 3BTUA 4WCFA 5HRUA 2X0NA 4H7PA 2WYVA 3WGZA 1TT5B 3QWIA 2Y66A 5TS3A 1M76A 5BSGA 3ZNNA 4CM5A 5IZCC 4ITUA 4XYBA 3TZKA 2HSDA 1EE2A 3BIOA 5L45A 4IJUA 3EAGA 2H9IA 2I67A 2UV8A 4YJGB 5L3ZA 4RDHA 3G3EA 4C4OA 1PWZA 1A7AA 1SC6A 3ASVA 1LSSA 4UUPA 4XWYA 2Y0CA 2QX7A 3KYDA 1CYDA 4LMPA 2YDYA 1CWUA 1PZGA 4RQTA 3ZU4A 2PKRA 3CIFA 1DBVO 4R1UA 3ZDFA 4IBOA 1Q0QA 5TLSA 3Q9UA 5IG2A 3ZWOA 4A5OA 3TSCA 1B3BA 1H9AA 1ISJA 1X7GA 4BO9A 3DMYA 2OO5A 2ZB4A 4GKBA 3O38A 4GGOA 1SB9A 5T6BA 4CV1A 1ULSA 3WIEA 2LDXA 3AFMA 1EDZA 3NKLA 4XQEA 1NXQA 4M8SA 1ISMA 1GQ2A 2ZB7A 4WNIA 3C7AA 2PGJA 1IE3A 3WBBA 4DA9A 4XQGA 1E1MA 4IXWA 3AI1A 2BELA 1NTOA 2O50A 3C1AA 2YV3A 4QXMA 1UDCA 5DOZA 2VYVD 3PPIA 1HE4A 1LLCA 3X2EA 3WSWA 4BQPA 3WB9A 4DREA 1LTHR 1HDRA 3NEPX 3NTOA 3PDJA 4OXNA 2DM6A 1QSGA 3FSRA 4AICA 2VZ8A 4J2OA 5JLAA 2J5RA 2ZTMA 4BGEA 1U7HA 4QECA 3VKVA 3I9LA 4E21A 2DVMA 1HWYA 5DT9A 2ET6A 4PLPA 3L6DA 2DTDA 4J0EA 1E3EA 1LDGA 5TGDA 1FJHA 1MG0A 3C24A 1YJQA 3WJ7A 4IJKA 3PJFA 3PYXA 4W7IA 3MJ4A 3H5RA 4MDHA 2GO1A 4YAGA 4YT8A 4TVBA 3WX0A 4E5YA 4DQXA 1H5QA 2YHIA 5K9ZA 2YUTA 3HDJA 3PGXA 4ONEA 4J4BA 4TZKA 2FWMX 1NQAO 3A28A 5B12A 4CQLA 3SJUA 4PG8A 2WE7A 3EW7A 4CUKA 2PY6A 3G0OA 5ENVA 1LDMA 1W6UA 3GK3A 5A3VA 1LJ8A 4MKZA 3DB2A 4YT4A 1HXHA 2VYVA 1Y6JA 3SX2A 3DL2A 3OECA 1N2SA 4O1MA 4N7RA 4Q3BA 3N58A 2FR1A 1WDKA 4ZGWA 3OICA 5HTOA 1RWBA 3JQ7B 1UXKA 2IRWA 4PCVA 1I36A 4WLNA 1OI7A 1U4OA 2WD7B 1M75A 3QWAA 5KVSA 4R5MA 1A27A 4CV0A 2Q99A 4U5QA 2ZCUA 5KVCA 5KNLA 2VRCD 4WPGA 3GGPA 3HQ4O 4CMCA 3MJTA 4PZDA 2VHWA 2BLLA 4EYEA 3AY6A 1P1RA 3I6QA 4XD2A 3U09A 4M87A 5BNIA 1DO8A 3AUSA 3TNLA 2G1UA 1GUZA 4PLTA 1MC5A 5DBGA 1R4MB 3TL3A 3KO8A 2PA3A 3EC7A 5LDGA 4BNHA 4UREA 2I76A 4DL9A 2Z95A 1K3TA 2GUGA 4GL4A 1BGVA 4A26A 3CPSA 3MTGA 1NBOA 3WIDA 3ZWBA 1H9BA 1U3TA 4Y6PA 1RM5A 1HYHA 1GPJA 4DQVA 3SEFA 1WPQA 3ZZNA 4FGSA 3EMKA 3PXXA 2GF2A 1I3LA 2DBQA 1H94A 1ZXBA 3H9EO 4NZ9A 4R9RA 3I4FA 3GHYA 3TL2A 3HDQA 1HZJA 4D3FA 1B0AA 1CERA 2P5UA 3GHHA 4R1TA 2HKIA 2O4CA 4WUVA 3ZU5A 4ND1A 2DLDA 5TC4A 4AJ2A 4EDFA 1A72A 1E92A 3TWOA 5DBFA 5L95A 2PK3A 1DIHA 3D0OA 3KSDO 2NVBA 4EJ0A 2VRCA 1XELA 2AQ8A 1TA4A 2Y93A 5COQA 4JQCA 2AEJA 2H6EA 4HWKA 1YOVA 4QT0A 3P19A 1L7DA 4FFLA 3I9JA 4EJMA 1C14A 1XGKA 3QJ5A 5GZ3A 1P9LA 5U9CA 1EFLA 4E13A 4UVIA 1B3RA 1ZNQO 3BHIA 1I3KA 1H0KA 4ND2A 4JN6B 2PZJA 5JC8A 4OJNA 1GPDG 4BNZA 4BNYA 1U3WA 3RC7A 1LDYA 1TB4A 4YRBA 1DIBA 2GPTA 2G17A 5DZSA 3VHRA 4BB5A 5BSHA 2YDXA 3ABIA 3F5QA 1I3NA 4D46A 3VAZA 4GX1A 3WNQA 4ZD6A 4B3IA 4IDFA 4PLYA 2YV2A 3H8VA 3I3OA 2B35A 3JYNA 4YB8A 3GH3A 4B7CA 3PHGA 2B5WA 1B15A 1PL6A 3KEQA 1T2AA 3GVHA 2IEDA 1QYXA 3ADOA 1HT0A 2HRBA 3OMLA 3W4KA 2YJZA 3MOGA 1ZK0A 3VPGA 1LDEA 2O7QA 4LSWA 3HN2A 2G76A 3DAFA 3JTMA 4E0BA 6ADHA 4R69A 1X14A 3GZNA 4YWJA 3PIDA 3U4IA 4ZVVA 2P5YA 3R0IA 4ZQGA 3VTZA 4IM7A 1Y5MA 2FSVA 4FSHA 2W2KA 3BYZA 3C8MA 3I23A 1E7WA 3BMCA 4KQWA 3LF1A 2OGUA 4OQYA 4E5NA 3HN7A 1KEPA 3ONDA 1JVBA 4PRKA 2Q3EA 4BO7A 1HETA 1H6CA 1CEQA 1A9YA 4CMBA 1A4IA 5T67A 3AM3A 2G82A 4LISA 4L4RA 4A27A 4BKPA 4MPDA 1X15A 1M6HA 1IUKA 5JMPA 3EVTA 1BXGB 2OHXA 5CDTA 1AN9A 1B8VA 4YJHB 2HMUA 3ASUA 2RAFA 4M49A 1HDYA 2BD0A 3JSAA 3G17A 2DFDA 3QWFA 5JDIC 3F9IA 3HB4X 1WLYA 2ZIZA 1PU2A 1HLDA 2EGHA 3PIIA 4BMSA 1NPYA 4B7UA 1C0LA 1Q1NA 2D59A 5JAQA 1DRVA 1PJCA 2A92A 1K89A 3NGXA 4MVJI 3DBHB 1N9GA 1YB5A 3SLKA 1GCOA 4BMVA 4R3NA 4UEOA 2PV7A 2UUPA 2D1YA 2RBEA 3DBLB 1ZK4A 5CEJA 4IDGA 2AEMA 1NVMB 5FFFA 4TRMA 3UKOA 3RROA 1R4NA 1H6AA 1YE3A 1LA2A 1UUFA 2B37A 2EWMA 4DQUA 5C37A 4DYDA 1GL3A 2R6JA 5MDHA 5I7EA 1K5HA 3ENNA 3K92A 1U1IA 1YO6A 4A2CA 4IIUA 4BO3A 1IULA 1E3IA 3RU9A 4AJKA 1DIRA 4K1LA 1XKQA 1G0NA 2ZATA 1HLPA 2FOIA 1E7SA 3PRJA 1DEHA 1EQ2A 3GEDA 3M1LA 5JDIA 1Y7TA 3BXXA 3QP9A 3UHAA 1ARZA 3ZWVA 3GDGA 2OXIA 2FMUA 1LRKA 2NVUB 4UUMA 2B36A 2BGMA 5IZ4A 2OORA 1VPDA 4E30A 4R1SA 2I5PO 1GCUA 1RYDA 1JA9A 1RPNA 1C1DA 2X1HA 3EUWA 1FDTA 2QQ5A 4IDDA 2QHXA 4HFMA 5G4KB 2RH8A 2Y1CA 1N7GA 3G1UA 1QORA 1PJ2A 3DOCA 1I8TA 5G0SA 3ZN2A 4NJMB 1ZCJA 2CUKA 1BW9A 3JQAB 1EUCA 3NTRA 2XXBA 4EITA 3KB6A 3OSUA 1SAYA 3H2SA 3HG7A 3QRWA 2VNSA 2HK8A 4KWHA 2DTEA 2HDHA 1KETA 1YONA 4L4XA 2V6GA 3IKVA 4CR8A 2Y1EA 4YT2A 2CDAA 1OOEA 1OFGA 1KC1A 4L74A 3OH8A 1I2ZA 1DPGA 3F1LA 1CRWG 2IEBA 3ST7A 3HZZA 4WLUA 3ZWYA 1GZ4A 1PGNA 3U4CA 4I5GA 3NYWA 4NPCA 4EUHA 2VCYA 2AEFA 4B7XA 2RCYA 1U3UA 3B1JA 1QLHA 1ID1A 5DBIA 5T5QA 2VHYA 3OJ0A 4N5LA 1VI2A 4CR6A 1HZZA 1MX3A 1GZ3A 3GAZA 2EP7A 2OFPA 4ZQFA 1CETA 3GA0A 5BNTA 3E5RA 4ZA2A 3NT2A 3PFWO 2PD6A 3IMFA 3ZWWA 4Y6SA 3C7DB 2HJSA 2VTDA 4XIJA 1SCUA 2FRDA 2VRBA 4IZIA 4AVYA 1UP7A 2VWQA 4K26A 5EN4A 1WAMA 5BNFA 3CMMA 3F46A 4JBIA 3ZCXA 3ZU3A 1ONPA 3TZ6A 1PJ4A 4Z0PA 4OSOA 3EVNA 1DJNA 3U3XA 3RBVA 1Q7BA 2P4HX 3ZW8A 3NJ8A 3KSZO 3L4SO 3I5MA 3NUGA 4W9NC 5IFLA 3LC1O 3ICPA 1PGOA 5I8WA 4XYGA 5JYDA 1I10A 1WMBA 3AOGA 3WGGA 1P1KA 1Q0HA 1NWCA 3FI9A 1ADCA 1GUFA 1UAGA 2XXJA 1D8AA 2Z1MA 1RJWA 3PYLA 2CDBA 2V65A 4HY3A 4AJ4A 2J3KA 3LLVA 1I32A 1EE9A 3JQEA 4BGUA 4CQLB 1NFFA 3CINA 5TNXA 2QRKA 2VUTA 1UDAA 3I9NA 3KTDA 1C1XA 1Q7CA 5A9SB 4IQGA 1FDSA 3BMQB 4B4WA 2O3RA 1R0LA 3OJEA 2JFFA 2V7PA 4XCVA 5ER6A 3CXRA 3K96A 4IGFA 4DBVO 2J3IA 1VKOA 3U5TA 3KZVA 4M86A 4CLRB 5LDHA 3HFSA 1E5QA 1LC0A 3AOEA 5L40A 4RLHA 2UVDA 1L1FA 2GSDA 4Z6KA 2DUWA 5T57A 4D0SA 1UZNA 2GYYA 4W4TA 1N5DA 2W4QA 2FZWA 1SPXA 4UVDA 4EBFA 5THKA 2Q4EA 3H5AA 5DP1A 3VKUA 1ENPA 3D3EA 1DFGA 3L07A 3BHMA 4DMMA 2V6BA 3ZNPA 2QYSA 4PG7A 3K2BA 1F12A 1HRDA 1I24A 1J5PA 1R12A 2WJPA 4XA8A 2X9NA 4MVJG 3HDHA 1LU9A 1Z45A 5KKCA 4UVHA 3RUAA 4XJTA 2X5OA 4IJWA 4BNUA 1EBFA 1IL0A 1H2BA 3FR8A 3VZQA 3Q1LA 1XWFA 4BNNA 4DPLA 3JD3A 1JKIA 3TFOA 3GQVA 1YB1A 4RORA 1YQDA 3PDUA 4NFSA 4CMJA 3JQGA 4NK5A 3C7CB 4J3FA 1R0SA 5AOVA 4GMFA 5HS4A 3TF5A 2W2LA 1B26A 1K6IA 2GERA 3UGKA 4CM4B 1PJQA 1ONNA 3AK4A 1Y8QA 3E9MA 2IE0A 5JO9A 4CL3A 2CMDA 3ETDA 2NU6A 4LW8A 1YRLA 4E5PA 2Z1NA 1NQOA 2GGSA 2J6IA 1LSUA 3NT4A 3EZLA 2AW5A 1MXFA 4XEHA 2NQTA 3K8ZA 4RL6A 3FBGA 4P8RA 3A4VA 4XDZA 3L4BA 1ZFNA 1JWAB 4F45A 4WEQA 5A4DA 4XKJA 4OOFA 3M2TA 2AXQA 3VDQA 1EVJA 1UP6A 2VOJA 3C1OA 5TJHA 1DJQA 2JHGA 4O0LA 2C29D 1VL6A 4CV2A 1E3LA 3D3WA 2X22A 4GVXA 1PS9A 1ML3A 4FIZA 3GPIA 3VVBA 4RF4A 2HQ1A 1NR1A 3Q6IA 4ZHSA 4FB5A 3QWHA 1NP3A 4OSPA 1BDBA 1PS8A 3F5SA 1X1EA 3TN7A 3HJAA 2UUOA 3MJCA 4DYVA 3HFGA 1UXGA 4S1VA 3DDNA 3PQDA 1F17A 3AUAA 3KHUA 4RCVA 2ZYAA 1LSOA 3ZW9A 4IXTA 2F1KA 1U2DA 1QRRA 4W6ZA 4HV4A 1GQYA 3TJRA 3IOYA 2D3TA 2GASA 4BGIA 3DAPA 2JD1A 2Q45A 5KJFA 1W8DA 1ZUD1 3IQDB 4P38A 3PJDA 4PG5A 1TXGA 4NBTA 2VYNA 5KWEA 4JROA 2C0CA 3PYMA 5FI5A 4CM8B 3BMCB 3OP4A 4DIFA 3SVTA 1DRUA 4FQ8A 3VOSA 4Z9XA 4UAGA 4B4OA 4KTTE 2HAEA 4CLXA 3F3SA 1GAEO 5CPFA 3U0BA 5KOIA 2O3SA 3VPFA 1K2WA 4KMSA 2P91A 4ZU3A 3SLGA 3WMWA 3E18A 3EDMA 3WGHA 3AM5A 4G2NA 3ZWCA 1OBFO 1E0DA 3MOIA 4LVCA 4BO8A 4N5NA 4EEZA 1F0YA 4WLVA 3ON5A 1OAAA 5KJEA 3PFFA 3DZKA 4RVUA 2YY7A 2DBZA 3AI3A 3U9LA 3PTZA 2ILTA 3VH1A 1ZBQA 1XQ1A 2E48A 2I9PA 4MVJF 4TMFA 5DOVA 4BNFA 1E3WB 2OMEA 4RPJA 3GMSA 4OM8A 4B8WA 3ICCA 2C59A 3UH1A 1ZMTA 4YVFA 4AJEA 4IQ0A 4MVJP 5JAMA 4OXYA 4LN1A 3WFIA 3KLMX 1X0XA 5JCJD 3H9GA 4M1QA 1Y8RA 3EK2A 1JAXA 1XU7A 3IJRA 5K6AC 2O23A 4ND5A 1C0PA 3I6IA 3RC2A 4L8VA 1ISIA 1UXJA 4RVSA 3CEAA 3DEYX 3O4RA 1U5CA 1DC4A 5F1PA 4Q39A 5CP8A 2NU8A 4WLEA 1EEHA 2YQ5A 2O48X 4W7HA 5B4UA 1XSEA 1ZMOA 2WSBA 2X9VA 1GYPA 1M67A 5G4KA 4OAQA 2O2SA 2Q1SA 1X0VA 3GY0A 4FJ2A 2EJVA 4GVLA 2NLOA 1JN0A 1Q7GA 3L77A 3WMXA 5IZCA 1ZSYA 1LQTA 4R3WA 4BO1A 5B1YA 3GNTA 3GLQA 9LDTA 1P77A 3AUTA 2TMGA 4GSKA 1PSDA 4GX2A 1LLUA 4PLFA 5FI3A 5F5LA 3E8XA 3D7LA 5KJ6A 4WLFA 3M6IA 5CDSA 1P1HA 4CR7A 2ZJ0A 5U1PA 4FW8A 2CNBA 3FPLA 2BF7A 4R5HA 5A02A 2BMAA 2VHZA 2O4UX 5BT9A 3JD1A 2XOXA 4IJVA 4RV9A 1C0IA 3WGYA 1DLIA 4OOEA 3WTCA 1KVUA 3DBRA 1GZ6A 1HYEA 3LK7A 2D4AA 1ONOA 2Q50A 5LCXA 4CQMD 4F3YA 1ZJYA 3BTOA 2Q49A 4LSMA 1GTMA 1QYCA 5JAIA 3B1FA 2WM3A 2C5AA 3FD8A 1E7YA 1FDUA 4BQRA 4KZPA 4AFNA 4BKRA 3IIEA 3MZ0A 4CMIA 3JCZA 3FHLA 4E3ZA 4KUHA 2BHLA 5CG2A 4J1TA 5I9NA 5KVVA 5DF1A 2Y0DA 1QYDA 2VWHA 1DFIA 4ALLA 4D42A 1ULUA 4ALKA 1J6UA 4W82A 1DAPA 3VZRA 2LDBA 3KUXA 3QWBA 1KERA 4KUGA 1I2BA 4NBVA 1DIGA 3C1TA 5HBRA 1PJTA 4R41A 1JAYA 4XB1A 5EMHA 3NRCA 1JLLA 3S2EA 2HO5A 3H2ZA 4N18A 3AY7A 3RUEA 5BSFA 2AA3A 4HX5A 3TOXA 3QIVA 4J0FA 4YQZA 4E5MA 1IHYA 1GEGA 4DUPA 4D45A 1I33A 4A7PA 4CQMA 1EQUA 1WWKA 1R0KA 4MKRA 4RO0A 4BOYA 3LZ6A 2PLAA 3AUUA 3U4HA 3KYBA 2NNLD 3GUCA 3PHIA 4GX0A 1LRLA 1MFZA 1T4BA 4R4JA 1U7TA 2FP4A 5AXBA 4RVGA 1P45A 3WR5A 3OIGA 1T2DA 1JW9B 2B4TO 4YAIA 2DPHA 1ISGA 2UAGA 4RPKA 3S55A 5BQFA 3C85A 4B3HA 3T7EA 3D4NA 2P4QA 3ZV3A 2J8ZA 1P33A 1KY4A 2Y68A 1FF9A 1NAIA 4INAA 2HK7A 1MXHA 1KC3A 1XHLA 3MJEA 2H1SA 4BKUA 3LLSA 1KVQA 2A35A 4UVGA 2EJWA 1XQ6A 1E6EA 2QRLA 4LCJA 2UDPA 3EGOA 4XR9A 1V9LA 3ANNA 1U8XX 4ZJUA 4BL5A 1ENZA 3GF4A 4K28A 3VH3A 1U3VA 1BMDA 1A9ZA 1TT7A 3CZRA 1D7OA 5CFZA 1PJSA 4B79A 3RJ5A 2GZ1A 5JW6A 1X13A 2W98A 4R54A 1A5ZA 5CAEA 4RVHA 1T24A 2GN8A 5JMWA 3V8BA 1C1XB 1J0XO 1ORRA 3ZGYA 4UUOA 3BMNA 5KKAA 3JQ8A 3QVSA 4IDAA 4UEJA 5GZ6A 3RBZA 4CUJA 2O2YA 1K6JA 4PFJA 6LDHA 4GLOA 4L4SA 3LVFO 2GRAA 1N8KA 3AJRA 4JBGA 2FPPA 5G0UA 4L75A 3Q9NA 2B4QA 3B6ZA 4B8ZA 2GLXA 4TROA 1LRJA 4MINA 2RIRA 1UH5A 4PVCA 1WZEA 1PX0A 3VZPA 4Y6RA 3VTFA 3DHNA 2GN9A 3OIFA 1KYQA 1E6UA 3GFBA 1V0JA 2AQIA 1NHGA 3NX4A 3K6JA 3WGOA 3UAGA 1YJ8A 4GLLA 3I9KA 1KOLA 4HFNA 3RWBA 3GPDG 5L7YA 3LDHA 4RZIA 3ZHBA 1WMAA 3VC7A 1ZK1A 4YJFB 4BO0A 4Z0TA 1PTJA 5L4SA 3OF2A 1YB4A 4CLOB 5BSEA 1BVRA 2CVOA 8ADHA 1B16A 4U8GA 1VKNA 2DQ4A 1SMKA 2ZQYA 4RF3A 2OP0A 3INRA 3DC2A 4ROSA 4X54A 5KIAA 1PGJA 3OM9A 4ID9A 5DN9A 3DXFA 3IUSA 3P5SA 1TLTA 1PL8A 5IXSA 1EUZA 4FD3A 5DP2A 4QO8A 3F6YA 5A04A 1UZMA 3CTMA 3KV3O 1N92A 2BI7A 2HLPA 4D43A 3KYCA 4DMLA 2POQX 2BH9A 4JXKA 4YXFA 3AFNA 3BMOB 3RKUA 1ZIDA 2JD2A 1QYVA 1E3SA 3A14A 1VRWA 4MIEA 1KY5A 3NAQA 1PQUA
chains in the Genus database with same CATH superfamily
1OYVA 1ENOA 1QHXA 1O0SA 3Q2IA 4MR7A 3QYPA 3UOAB 4GWKA 1N0IA 4MUFA 3DMFA 4FINA 2P2NA 5J58A 1O0BA 4HD8A 4IFTA 1PD1A 4KO1S 2Q5OA 1GADO 5DGTA 2HRRA 1RPAA 3A2LA 4RU1A 3VMFA 4RYLA 4PGFA 2A84A 2C20A 3D0RA 2Y05A 2OCKA 1JJAA 3B1KA 3H5NA 1ZAKA 3HVKA 2Q4TA 2QD1A 2RHMA 3QVWA 4MVCA 2ZULA 1VHWA 5DEOA 3LGXA 2JKYA 1K0UA 3PQ8A 4JKIA 1B8OA 4MV5A 4DPKA 1U0FA 1VA4A 2C8JA 3NAMA 1N6KA 4PLCA 2BEWB 2J0UA 4FHDA 4GXTA 3A4LA 1DAIA 2DC1A 2CVQA 2I4IA 2BPOA 2WMDA 5E1DA 5L3VA 1A8HA 5F9MA 2VDPB 10MHA 2ZJFA 4JU8A 4QX6A 5K8IA 4FDVA 2W2TA 1FS5A 4FN4A 3U62A 1GLGA 1XMVA 1EUYA 3CQ9A 4YH1A 4CCYB 1PT7A 1AKRA 4RKWA 4D80A 2P67A 1A8PA 2KYRA 2RDMA 4MI6A 3EZ7A 3IUNA 4FDAA 4YRGA 1QRAA 4QDJA 4Q3KA 3EIQA 5DYTA 4DCCA 2AFHB 1Q14A 3GG9A 3O4JA 4HFJA 1F60A 4JYMA 4QSMA 5FORA 1IB6A 3DMHA 2OGTA 4CM7A 1B42A 3WLNA 5LWHA 3KD2A 5B2EA 5C18A 1XTPA 5FPQA 1QHEA 4IDOA 2ZRHA 5LB2A 3ZV4A 1VLZA 3OKCA 1FTYA 2BMJA 2WD8A 3NBKA 2VJPA 3G2PA 1X1QA 5K3FA 4ALIA 1QF6A 3URMA 2ZETA 2OV1A 5LD2B 1M6YA 1AHPA 5A6SA 3B7PA 1V3VA 3KRTA 4E12A 1I2DA 2VSYA 1YVEI 3LF2A 1N2CA 4F8YA 1BVUA 2R4QA 4WBSA 1FDWA 4RESA 1PSZA 5AKEA 3RASA 3TR0A 2ID4A 1PYOA 3OPYB 2PZAA 2PWAA 2V8BA 1PEDA 1XCLA 4MGEA 1D03A 1FVOA 1M8FA 2DKNA 5TT0A 4O08A 2D5BA 3T7AA 4P3KA 1J8YF 1Z34A 1CR0A 1ODIA 3TEFA 1Q2UA 4K9PA 5AXAA 1M83A 3CSDA 2OXIA 1P2FA 1YS4A 2O3QA 4JXJA 5FV7A 2Z4RA 3EZGA 3MWEB 4GAEA 1PR1A 5B3JC 2HA3A 1SG0A 5ALDA 1FP1D 2BTQA 3AETA 4HNAA 2WLSA 4Y1RA 5CNIA 4A16A 3L4JA 1N1DA 3BEOA 4N49A 2Q7DA 4R51A 3LD9A 2J3JA 2ZB3A 4RJ2A 4OHOA 4KWTA 4QBGB 4XOIA 3ZWXA 3MD0A 3SBEA 1TQ4A 3QF7A 1DAEA 4JGIA 4C7BA 2HCJB 2XMBA 5TJ9A 4FDUA 1KMHA 1QXSA 4P6VF 4ZIRA 5JSFA 1L1QA 3LK6A 4UATA 5KQLA 4N9QA 1U0BB 5AJXA 1MX1A 4YRIA 4U2GA 2AOTB 5LQUA 1NVGA 1X92A 3EUFA 1M0SA 1T2EA 2R7LA 2V55B 4H31A 4R6WA 2J07A 2FYTA 1OIVA 3IYLW 1DRWA 1K9SA 1RWNA 2NG1A 3UMGA 1ZM4A 4DE5A 3R9XB 1YU9A 4JSTA 1MJFA 3B5JA 2X3FA 3L8YA 4XLLA 4ANFA 3M6UA 3L6BA 1ZSNA 4GOND 1MT0A 4GI5A 5ICCA 2WSSD 3NT5A 2J0SA 1Q44A 2C3PA 2JGFA 2H4HA 3I6BA 3LXUX 2WYUA 1MAHA 4ZCLA 2E0IA 3KUCA 1PW5A 3U19A 2O19A 3SWWA 3HGMA 4EM6A 3JQ7A 3KXKA 1GN8A 3JASA 2F7SA 2BC9A 3A6FA 3I2JA 3NOOA 1VE9A 3QZUA 5FF9A 3RRFA 1ZVKA 2RH4A 2G70A 2PQ0A 4JWKA 3BFXA 1GU7A 2JHAA 2H1FA 2I03A 2QTGA 5ILGA 5D01A 1RXVA 3AI2A 1JHOA 5IHPA 1N6RA 2C9YA 2WRZA 4KZKA 4TM7A 3GP3A 4XH9B 3TQFA 5JROA 5DB4A 3DFZA 1TYEB 4FYHA 5FOTA 1AHIA 2GZHA 3DMTC 1WW8A 3RSGA 3BQ9A 4KRGA 3LW7A 4QA9A 2W0MA 4XWTA 2N47A 4R0VA 2J5QA 5IN5A 3A1VA 5EJ2A 4AKTA 5BR7A 3LUBA 2WUVA 1P9NA 5L51A 4HSGA 3IAUA 2QN6A 1QIEA 3OFSA 1XTJA 5BN3B 1OZAA 3GFRA 1FSZA 1R0CA 1EAYA 2C9OA 2NO5A 4AQ7A 4MKXA 2VXYA 1M8GA 4P84A 1NBAA 2OK7A 1CR2A 2XMSA 2H7YA 4W99A 4L8WB 2P2LA 2A6PA 2V6MA 4M1YA 5J5VA 3DMPA 3VHLB 5IKMA 2E4AA 3R7WA 2YKGA 5E3IA 3O4FA 4L7QA 1OIXA 3CV3A 4R6XA 3EWNA 5DNCA 3HNOA 4ISBA 3L46A 3EHEA 3DDUA 5ALLA 2OXRA 4GPD1 4B3DA 4I5EA 4DB4A 3NM6B 2WHQA 1N75A 4EO9A 4KQEA 2VAVA 5ALVA 3TZHA 2FSHA 4ZVUA 2BFAA 4HYYA 1NFRA 1ISHA 3H19A 1DXYA 3M7IA 5I9LA 4H3KB 2GETA 3T0GA 5I9IA 4RIGA 1JQKA 1YE5A 1BX0A 1O9GA 3A25A 1PE0A 1DTWA 3EEIA 1VCHA 5JVDB 4ALJA 4D7AA 4E2YA 4GOMD 1MO3A 1TMKA 3AKZA 5CNKA 3LCVB 2OZVA 4FCTA 2IU0A 1Q74A 2JD0A 3AR7A 3O7MA 2XRMA 1KI9A 1YQXA 4MV9A 2PXCA 3K0FA 5C7LO 4X93A 3ODGA 5CIWA 1DC3A 4QNRA 1N2HA 5HGJA 4KQMA 1Y37A 5I7SA 4G5HA 2PJUA 2C31A 3OOHA 3EF3A 1L4MA 2O7SA 3PEFA 2LVBA 2Z56A 1QGUA 2G4CA 4TTRA 4X91A 3D8TA 1D0VA 5JR3A 3M6AA 3IPYA 9GPBA 4L51A 4RGBA 5AVJA 4C0LA 4CL8A 5AI8A 2HIHA 4CETA 1ZI9A 2A0WA 2B34A 2JATA 3AEXA 4PXSA 1JG7A 3TFWA 2PD4A 1Z33A 2XADA 5IJ9A 2WMYA 1RJ9B 3NBFA 5K4AA 2H1LA 5IJAA 1VSTA 3TLYA 5BR1A 2X6TA 1E4OA 2VF2A 3GAAA 2I6TA 4DB2A 4M21A 5JNWA 3OX2A 4I99A 4OB7A 4TX1A 5AWFC 3T9BA 4BMNA 2Q41A 2LWIA 1PQ4A 1TYCA 2LUOA 1L5MA 3H5IA 3JQ6A 3UJDA 4C1BA 4CHGA 1ECFA 1UT8A 1GPAA 4YPOA 3GCGA 1Q0RA 3K16A 3DFUA 3IUBA 3EZNA 4MO9A 5BMOA 1QLWA 4MV3A 2UXCB 2PGAA 2QY9A 3A10A 4ZAYA 4KSBA 4IEFB 1IN8A 2ECQA 4EKEA 1IN5A 1N2ZA 1EFRD 1F8UA 3EIOA 1E60A 1R9GA 3Q3JB 2ZS9A 4YMUA 5B30A 4JCOA 5C4MA 3KR2A 3C8HA 2IXGA 1E9VA 3CC8A 1QNFA 5CDUA 3F6RA 1E9SA 1GLVA 4M8KA 4BNIA 3BXHA 4BFLA 4FOSA 3DR5A 2RJOA 1GGVA 1OTYA 1YQEA 5DJ5A 5EC8A 1KE2A 4C3VA 5A3JA 1W5SA 4PLWA 1JG2A 1UBNA 4G09A 2VHTA 3HCEA 4I4TA 5KHOC 2WYWA 5B5SA 5BP7A 2WG0A 3BB3A 4JJ6A 2Y6VA 2GD6A 2DFLA 1ESMA 1HYGA 1TGYA 2XUGA 4ZZ2A 1KOGA 4L27A 1P1FA 2FSSA 4RK5A 4HADA 1O77A 4G8CA 1O0CA 1TZKA 2ZI3A 3WYCA 3VC3A 4CKWB 2P4SA 3RS9A 4BNWA 2JBHA 2B6HA 1PJLA 2I1LA 2X0IA 1OZFA 3DOOA 3B8HA 4U7DA 2BI8A 3KE8A 5KOHB 4AKGA 4K6OA 3B6IA 2VUUA 2AE1A 4R2JA 5HILA 2F6RA 2PXAA 4X66B 4DGSA 4X20A 4MVJH 2VUHB 2B0CA 1G7CA 2IIBA 3MT8A 1U28C 2G07A 1NULA 3IP3A 3SQMA 3JQ8B 3AW8A 3ZNOA 2V6IA 5EIHA 3TQHA 4B1FA 5LA6F 4DLRA 4RELA 1PWXA 4KX5A 2J9GA 2OL4A 3D5QA 3S5UA 4BU0A 1SKQA 2YCLA 4BYMA 1CQZA 2GB4A 2J9FA 4YQYA 5BSMA 5IKPA 2YBEA 2JHFA 1BA2A 1KJ8A 1NE7A 1A88A 3H5LA 3NH6A 4OLJA 3VOTA 3L8DA 3VR2D 1ZGJA 4D8YA 2W6CX 1YK0A 1TI7A 3B2QA 3K0EA 4I8IA 4KQIA 6Q21A 3PJEA 2IZZA 4UDNA 4RVFA 4ZT4A 1LBIA 3OZTA 2A30A 4EFMA 3B52X 3BZBA 3C45A 3ZHRA 2OHIA 1WTAA 2RCNA 1M6WA 1XLTC 1Z74A 2DSTA 2EERA 3EMVA 4Q3NA 1A9QA 2GKGA 2FOLA 3CUUA 3N76A 2ZQ5A 3SGLA 1E4EB 4HVAA 1XP5A 5C3MA 2MYUA 4MPJA 3P4YA 2AS0A 3D3QA 4FK8A 4R9UC 5ADWA 2JFZA 3A7EA 2EF1A 3GLIE 2BEVA 4ABTA 3QXJA 4NPAA 5T4FA 1T6XA 1QGED 1GVNB 2AOUA 5EIOA 4RHTA 1I2AA 2IP4A 1KH1A 2WJWA 4K81B 4O4HF 9MHTA 2JVJA 3KKMA 1PN3A 3PFNA 1XBTA 5EP2A 3RRNA 3VYRB 3R3HA 2FWIA 1B8UA 3COWA 1E1NA 3OIVA 5AVTA 3IPRA 4XWAA 2CEAA 3JR3A 2Z4SA 3VKWA 6PFKA 1MAWA 3VR6A 1WQ1R 3SR0A 3HACA 3UG6A 1G2QA 3PQ4A 3OWOA 4KWIA 3NPMA 1R9MA 4D1YA 4EA8A 5JD5A 5KYXA 3KYCB 4H17A 1JQEA 2HREA 5LL6P 4GP6A 4V03A 3TZBA 5LZ2A 5HF8A 1DX6A 4GR9A 2Q3HA 3M6WA 3BA1A 4O4LA 5BV0A 1VPTA 2V98A 3A9VA 2C2OA 3B6EA 4DV5B 2PXHA 2JJ1A 3HSYA 3KQTA 4I55A 3AR3A 4S12A 1ZZGA 3RYCA 3E2MA 2EKPA 2VH5R 1WVGA 1U11A 2PAFA 2WE8A 3O4IA 4FDMA 4HAYA 4ZV7A 3NHPA 1KKUA 3AR5A 1YS2X 2BFBA 3DTTA 2YJNA 4IIXA 5JDCC 4PAOA 4GXRA 1JKFA 1T3LA 4NJMA 2J3QA 3AYZB 3W06A 2DB3A 1H9CA 1RABA 4D8TA 4GECA 3P9SA 1NRJB 3HL0A 1PAUA 3DEZA 3PUKA 4KBFA 4RABA 5F76A 3EDYA 3WAKA 2GM3A 2OAEA 2PPVA 4MQ5A 2E21A 1NOJA 2WJZB 5CPBA 4AZ0A 4D99A 5MN5A 4I1RA 1GAJA 1AQNA 4EVQA 2JC3A 1U65A 2BVNA 1SUPA 2R1VB 1FLDA 4G25A 4LDJA 5ICFA 1E2MA 1G1MA 2WOOA 2WVHA 1I6WA 3TEMA 4EB6A 4YP9A 1HOXA 3D64A 4R2LA 5CJPA 3FF1A 4JAVC 4XUCA 1MB4A 3L9WA 1R4NB 2YOFA 3P7MA 4M37A 4RLSA 4JU9A 5CJ2A 5GOTA 4QIHA 4GPZA 1GT91 2O5CA 2VP0A 4GSYA 2MTBA 3NEAA 5J59A 1A9TA 2XGMA 2WU4A 2MIIA 1RWVA 4IS2A 4MGYR 1PNRA 4BNGA 2H4FA 1AQUA 1KIAA 1PSWA 5H83A 2QAJA 5I7UA 3RHSA 2GD0A 4F93B 1FDRA 2BFFA 3JVUA 4G1UC 5ELMA 2DECA 1P0PA 1P1CA 4JJFA 1SG9A 4AJNA 1GD1O 1S9DA 3KIPA 3RVRA 4ED9A 4EMUA 4EP1A 4YCMA 5AXCA 3FWHA 3V7YA 2K7ZA 1MJGA 4GZLA 3L8HA 4BNXA 5A03A 1SNYA 5JD3A 3IKMB 4Z3DA 1XRLA 2DQZA 1ORDA 3KR1A 1MKYA 3HXKA 1UJ5A 1P4RA 3AEUB 3OD1A 4YS6A 2OBXA 3ZQUA 2PQ2A 1AXGA 3SU8A 5D3MB 1RSZA 3MT7A 5F2OA 3FA2A 3SBXA 3W05A 3UCXA 4EPTA 5K6AA 1OLOA 4ZXFA 2Z5GA 4TT3A 3NHKA 3RAPR 3RVSA 1C1DB 2CE2X 4UBNA 1KDVA 4J6FA 5LUBA 2R8YA 1XZIA 3DCNA 5LOVB 2GM4A 3A1CA 5AK0A 4DLSA 3PF8A 5CB6A 1P1JA 1CY2A 4NESA 1EUCB 3NDPA 4K9NA 4P82A 2QOEA 3GJSA 1C29B 3A1FA 1M1XB 4MVXA 1NVFA 4IMPA 1KY3A 5KDOA 4ME6A 3RRZA 3FRHA 4EUSA 4JK3A 3KOWA 3WWCA 3PC3A 5AVUA 2ZTLA 2PGLA 2CF5A 1UFOA 1ZOOA 2G5GX 1SUFA 4C7OB 1VC2A 1GGJA 3ZI4A 4GLJA 1UOPA 3NDIA 3HNPA 3A8TA 4ZREA 1DHRA 2IYOA 2DR0A 3E4DA 2BI4A 3R5HA 1JAZA 3AL0C 1IZ8A 3DBOB 3C41J 1RWMA 3DE4X 4PSKA 1YZKA 2GMWA 4QTYA 3RG2A 3WB2A 4JLKA 3E58A 4UKDA 3BMQA 5I8ZA 4FGJA 2BFCB 4LDAA 4LNUB 3A6DA 3UK1A 3F8WA 4W9RA 2OG2A 1E9BA 1KVRA 1QHGA 2NPOA 4PG4A 1C9JA 1TC1A 1HT1E 1FNBA 3L2OB 1SHJA 1HDXA 1GQQA 1MEJA 1EXMA 1O08A 1ZICA 4TZTA 4X85A 3I0ZA 3SYMA 4BZZA 3MJVA 4LHVA 4DMKA 3Q10A 4ZZ1A 3R3JA 4IICA 3E53A 1E63A 2QW8A 3HFRA 2BR5A 2HA2A 4OBBA 5AJVB 4WCDA 4AIRA 3A1TA 5CBKA 5CTAA 3S28A 3U17A 2A1UA 2JJ2A 1B74A 1J25A 1GEEA 4NH4A 3KCNA 2ERXA 4DJJA 4HSEA 4NNJA 3ZLJA 4YCDA 5EY5B 1E1RA 5AHWA 4EHDA 2CSUA 1FPMA 5JXIA 3NHSA 3NHMA 5EXTA 2WJ3A 3A6KA 3QVTA 3UB2A 2PIDA 2QZ4A 5FBVB 2ZUUA 4Q48A 2A1TR 5KTSA 3L6EA 1PFUA 3TQCA 4HDMB 2RK3A 5CITA 1CF9A 4J8PA 1V48A 2XEXA 4UJ3A 2XMQA 4NABA 5TF4A 3UCEA 2CMFA 4EKNB 1RC1A 4WBNF 4YRMA 3MWDB 2WJJA 1O6FA 3RIMA 1GTRA 4RZ3A 2PH7A 4MR9A 4MS1A 3EFBA 2LTAA 3H7IA 5K0CA 3A9UA 4U3JA 4HUTA 5ITZB 1MB9A 3OQMA 2PUJA 2HK6A 1T8UA 4RTJA 4AJHA 4QBTA 3DXXA 1TFRA 4RIFA 4UQLA 2W11A 4XYEA 3S3TA 4ZTZB 3JWHA 1H8ED 2PX4A 5B6JA 1UQTA 3QELB 1R0WA 3TDNA 2PL3A 2G5PA 4WNCA 3Q9SA 1SUEA 3G88A 4CM4A 1LBEA 4DNOA 3DBVO 1JR2A 3FVQA 1W5AA 3JQDA 1XMIA 3ZIAA 3ZWAA 1VJ1A 5HKOA 4DARA 2C4MA 2LBPA 1Y4UA 1GTZA 2ORYA 3B1XA 1FTGA 1FVFA 2I3AA 1WBDA 3K70B 3OPNA 2BDUA 2O8EA 2HNAA 3NS7A 3QY9A 2R5WA 5HCIA 3UEOA 3VA7A 5IRCD 4WL0A 1Z25A 1N2OA 2CV2A 4DC0A 4WXYB 1MRZA 3CISA 3RUCA 2X9QA 2Q6KA 4AL4A 4KQ2A 3R6TA 3VSAA 2VG8A 4ZRDA 5IDXA 4HCJA 1MLDA 2J7PA 3OZCA 4GNKA 4PZEA 3VZDA 5CVCA 1Z6ZA 4CL0A 2HU5A 3VSEA 5ICSA 2PTHA 1CR4A 1U3CA 4DPMA 2YY6A 4JYBA 1TKCA 3PI6A 1HC7A 2IYNA 2ZYGA 3DHYA 4IPTA 3VGPA 3S8YA 1SHUX 3Q6MA 3WGQA 3IRUA 3AW9A 2QSYA 3D6FA 1DXQA 2X0RA 3GVIA 4HXGA 1QWSA 1Q0LA 1TQ2A 4GZMA 1X80A 2FN8A 1NZDA 5DTIA 3IE2A 4CG2A 2VNAA 4YK7A 4BXOB 1KK3A 3D59A 4PZPA 2IP1A 1JHPA 1HDEA 2A9FA 2OFXA 4CLEA 3KSAC 3UK7A 1QKKA 3PNLA 4QM6A 1SD2A 1U2QA 2VUIB 1ZN9A 3R41A 5C0OE 1KI1A 4R1NA 2VAXA 4XCXA 2Z9CA 1R8JA 4J43A 4XGIA 4KV7A 2XY4A 4H7HA 2ODEA 1HDGO 4U7WA 2D7CA 4UULA 1XVLA 4EGFA 5M5BA 1XJQA 2AWNA 4M1SA 2AX3A 2PBZA 3PR2B 4RS4A 4AC9A 5IVKA 1JTVA 3CA8A 4QVGA 5F33A 1X87A 4BNVA 4ZMBA 4O8CA 1H66A 4MRVA 4DLYA 1I5OA 5EE0A 2PD3A 5ERXA 1KVSA 2E87A 3M34A 4YP5A 2V7XA 5BSTA 3ZY5A 2BDEA 1N25A 1ZH8A 2GDZA 4IIBA 1JU3A 2C9DA 3NBZC 3CH6A 3G79A 3ROGA 3UMJA 3AKYA 1TLLA 3FCYA 3AF3A 4V3CA 2V3WA 5M29A 3GD7A 1K88A 2A4KA 3JQGB 1JBEA 3W5AA 3V7UA 2GPNA 3UV7A 2Z8YM 4XEUA 5AVWA 1PVDA 2EBWA 4BFWA 4NCAA 4EPXA 2VPQA 2VQDA 4OKSA 4A0GA 4XGQA 2ZYWX 3G49A 4N12A 5IF3A 1RLUA 2BM9A 5GIPE 4EYKA 5KYGA 2E49A 1ZKDA 3E3AA 2ID8A 4QJ4A 3LT4A 4WZAE 5IVDA 3OCYA 1BXZA 3H1AA 2JGDA 5U4XA 3IELA 4R1PA 2W6JD 4C43A 1JR3D 3C1UA 3ERCA 3QBVA 2ZGVA 1Z07A 4QOFA 1KZ6A 3DMDA 2C58A 2B4AA 2FSGA 1NF2A 3JVIA 2QJFA 3ZNQA 2FJUA 4IOLA 4KH0A 4E31A 1EVEA 3W5HA 3KJNA 4JEMA 2WZQA 1VHJA 2NQ8A 5HJ5A 2A2ZA 5CVJA 2J41A 2QX6A 1ADFA 4DM7A 1CD5A 1QQTA 2D0DA 3L40A 1W59A 1BX1A 4TRJA 4O4JA 5BQOA 4YPFA 2A9QA 1JHRA 1UMBB 3I61A 3H0EA 1QGOA 3FCXA 2BMDA 3T15A 4MP3A 2R6FA 5ITVA 4OAOA 3D3WB 3C5CA 3CUWA 3PDIA 3L79A 3J81A 2OLEA 1Z3IX 5BSRA 1L5OA 2XF8A 4GYYA 4OBWA 1FFGA 2QENA 3NKFA 5TY0A 2GZDA 2CYAA 2P3LA 3LHSA 2H52A 1FFHA 4TPKA 4Y9DA 2PR2A 2IHJA 1JQBA 4K5QA 4MP6A 2GXSA 2IW3A 3OIYA 3UAXA 5KNDD 2NP6A 2IELA 3OFKA 2G8LA 3IP1A 2WY2D 4BKMA 4BNLA 4RD3A 4MO2A 821PA 5HMMA 5T64A 1LI7A 3ZGZA 4TMWA 4DQLA 4YHHB 1Z4PX 1NASA 3PHJA 2ASVA 2PSFA 4H0CA 3HCDA 4KMOA 5BWNA 4MB2A 4OHVA 4QRHA 1EK1A 4MITA 4GR5A 5IYZA 2JLUA 4LMAA 1S2GA 2WIKA 3IHTA 4Q5IA 4Z2YA 4I50B 5C34B 5IKEA 4IZ6A 4BLPA 1QK4A 2OC4A 4DJDC 1IIRA 3SVZA 4CW7A 2DP4E 2F9MA 4DABA 1GU0A 3ZLVA 1CJBA 9ATCA 3EZ2A 5IH7A 5GV8A 2C7GA 4TGLA 3PFIA 1DJOA 3ONWA 4Y67A 4Y9TA 1B6SA 3DAGA 3I5YA 3JZIA 3KWMA 1IUOA 2FLWA 1UBCA 3BK2A 2HWYA 4K9KA 2VP5A 4TWRA 5DYGA 5FFNA 4YJ3B 2NP7A 4FR5A 1DBQA 3KEFA 3D1LA 4K9OA 5DBEX 1FX1A 1P6QA 4BAGA 4EY3A 3MS4A 5AM4A 3MRTA 2HM7A 3B7GA 1KXJA 1CIJA 1YASA 2DSNA 2OESA 4HQLA 1Y4ZA 3P9NA 4KR9A 4PTLA 4LDPA 5CFNA 4Y2UA 4KPUB 1G18A 1QV7A 2Z2YA 3PHCA 4H15A 4MPTA 2PRYA 3WG9A 1YDFA 4UASA 4IQ8A 1Z4LA 5B37A 4C0QC 5K6TA 1RPJA 1UPBA 3ETNA 1UJNA 5L3QA 3O03A 3JQFA 1OBVA 4MROA 4AJLA 3C6BA 1TZMA 1KJQA 2C0PA 2K87A 3IC5A 3PXAA 4L3OA 4P54A 1BS9A 2XTJA 2PQMA 3GQBA 3PLRA 4QUGA 3TYXA 3VPBA 4DY6A 1GGMA 5IEJA 2O2HA 3R5XA 4L6AA 4P1ZA 1G8FA 2IHNA 4NR0A 3FPCA 2VPYA 3GEMA 3SYNA 4U2BA 2WF9A 3DW1X 1OI3A 1H65A 1Y34E 1YR7A 2DPGA 1Q0TA 4JUBA 1XZJA 1UWCA 2RI6A 3FVTA 4Q4JA 3UQZA 2AE2A 2VNIA 2XGOA 1S8AA 1GFWA 1YB7A 2FGJA 4W5QA 3IJPA 1K1EA 3SNHA 5PNTA 3SXUB 3HJBA 1K7YA 2BIFA 1RAEA 1YR1A 3QHAA 3WKEA 1N6LA 2KM1A 2REQA 2HI0A 1J49A 3WIUA 1I14A 2HFKA 5AVKA 2NM0A 1MPXA 1RZRA 2JFHA 5E3HA 4B09A 3KSBC 2E55A 2OTCA 3LQ4A 1VG8A 1DG9A 4C76A 5IMBA 5AHOA 2DETA 2W2XA 1CBUA 1KZ4A 1MAAA 4IIVA 4HNQA 2VDUE 1IOVA 1ORVA 2GKOA 3G9UA 3KG2A 4TKMA 4U7PB 2Q29A 4Q7EA 4BEWA 2VNJA 5TIIA 3MQ4A 2J09A 4PSCA 1XMXA 2AQKA 2GBIA 4GUDA 4II2A 4P4TA 1N1EA 1YBVA 4AYXA 3ZK9A 2LCFA 4ARZB 4MUHA 2YNMA 2CDRA 5E6UB 2XLBA 5P8WA 2D5AA 2BKVA 3TIGA 4DQKA 1H93A 1BGXT 4OXKA 4URHA 4H7EA 5AUPB 4AQDA 3BQNB 3QKIA 4G0ZA 2ZYDA 2QY6A 1MRNA 4A0RA 4I9UA 5EESA 4S0XA 3I8SA 1NXXA 4KFUA 3AY3A 2AG1A 3PG5A 1VLVA 5HE9A 4F5EA 3AI7A 4EY6A 2P9BA 4EGCB 2J3DA 3DE1X 5LQKA 1Z35A 3NWEA 4K9QA 4LQCA 3AEKA 4MZXA 4DIOA 3IAXA 2HRQA 3Q98A 4H1HA 3UN1A 2OMKA 5MHTA 2H00A 1FB5A 3A0UA 3E3MA 1FK8A 1QV9A 4RFSA 5FRDA 4FD2A 2NV2B 4FX2A 1NSYA 3FTNA 3K9WA 4HQFA 2QLLA 3GEGA 4B0OA 3ESRA 3VHQA 2IC5A 3AYXB 4LWPA 4ZKEA 4CM9D 3EGEA 2VQ3A 2QTAA 4IDEA 4AJ1A 4JX8A 3WYBA 3FGZA 1QRTA 4FTWA 2WK1A 1P19A 4FPXA 3E5NA 3A70A 2Y27A 4PHCA 3UWOA 1EUDA 2Q27A 3H1FA 1YCDA 4ZYUA 5JLJA 4QBFA 4ZI7B 5FEUA 4GDMA 2VT2A 3E48A 1N8SA 1XL1A 1QFSA 4KUEA 1F2TB 1JH9A 4QQRA 5GJCA 1HDOA 2ZJ7A 4YP0A 1TZBA 1H6DA 3TD9A 4FKMA 3IVCA 2NU9A 2FWBA 3GJRA 3P9IA 4FIDA 4GE3A 4CF4A 3SX4A 3GARA 1QVRA 3GWZA 3Q3GE 4JITA 4OL0A 1X7DA 3AUKA 1FMCA 4K6MA 4LNHA 4WFKA 1I5RA 3RRXA 1BYUA 4P22A 2C7BA 4UZFA 2Z5FA 3ZVNA 1OYOA 4XGRA 5AFSA 3AP2A 1ZNXA 3RFCA 1KJNA 3IPXA 1VFPA 3LY7A 1QIHA 3B1ZA 3FWPA 3FSGD 4W1QA 3PGJA 1IHPA 1YC2A 3VPDA 4RH3A 1YC5A 4OX9Y 3BJMA 4HL6A 3NJ4A 3TLMA 1W85A 1GKYA 3S8EA 3GBPA 3MS2A 5T6MA 4RSRA 2VT3A 1Y3DE 4HRYA 1SBYA 5TPZD 1FDIA 1FNSA 7ABPA 2O2JA 3NTLA 3RVJA 1IJBA 4WH0A 3B78A 2CD7A 4Y6QA 3QBEA 1AF7A 1XQYA 5F2KA 3V8MA 3LXMA 4EW3A 1ESNA 4NG5A 3GI1A 5D8DA 1AO3A 2HPZA 2Y1DA 2HLDD 3BHJA 2NO1A 4MW5A 3RAJA 2IPXA 1WUIS 5HBGA 3N2ZB 4NZOA 1QR6A 5LKAA 4TSKA 4PRLA 2R11A 3IIIA 2GAIA 1J90A 2GJSA 2YMQA 1A98A 1TTQB 4NCBA 1V7CA 3G5MA 3KKOA 1XZFA 1A8UA 2QZ9A 3L4BC 4L9RA 4HXFB 3MEQA 4REQB 1R0XA 1HFKA 2JFGA 3W4JA 3NEJA 2R48A 3GBSA 3C6YA 3IP7A 3WHPA 4RX1A 1LX6A 3HH8A 3GUZA 4ZYLA 1YBHA 1PHRA 4KAFA 4E33A 2WPNA 4OP2A 1AGPA 1UKZA 4QFCA 2H2GA 3AVVA 1KIMA 1SQFA 2I99A 3P2IA 3CW8X 1Z47A 4WK0B 3PKJA 1NUSA 4QC2A 5JTUA 3PXDA 1IZYA 2BL4A 2F1RA 4H1TA 1DKQA 1MAUA 2EJBA 4D3XA 4OH7A 4CIYA 2AG5A 1INLA 1IBLB 4IIJB 2PMWB 3HB0A 2AC2A 4W63A 4EEXA 5KCMA 1TU3A 3H2KA 5H02A 4QEDA 2FPXA 3DD1A 4DQ0A 1BD3A 2DMRA 2X5JO 3VQTA 3O8OB 4MV6A 4Q4AA 1ZGGA 1M5RA 4N7JA 1W75A 2A9RA 2W2OA 1C9KA 3B13B 1WPRA 4NMMA 4OH1A 2CBXA 1UFKA 3PGLA 1C0EA 1JSXA 2XZTA 3QG1A 5KVQA 2OKCA 1JFVA 4NENA 3CX7A 4N0EA 5LU8A 4BDSA 1QLJA 3DDWA 3BIJA 3LWNA 4H08A 1GJRA 1HRKA 3VXKA 2ODBA 2V7EA 4G81A 4PG6A 3WGLA 4RW0A 1XA0A 4FGKA 5HM6A 5JRDS 3JQPA 1EK0A 4MUIA 4W5RA 1D04A 4EUKA 3L1HA 3LO8A 5HUQA 1RLJA 1JPJA 2FPPB 1AJEA 4QAJA 1BU5A 3DDOA 2QUZA 2Z6AA 1NX9A 3PUWA 1XPUA 2VYND 3ZHZA 2HIMA 1RYHA 5J2TF 4GOOD 2XLCA 3O3NB 5ALMA 2Z98A 3CLTC 4JI8B 2BCJQ 4FBMA 3CNBA 1P0CA 1ZMBA 2BEWA 1W4CA 4G65A 4IQFA 2B8TA 3I6YA 2WWGA 5DHFA 3T9AA 3CLTD 2A1IA 4JI3B 3R6DA 1PJBA 4PZAA 2X0JA 5I9BA 1HDIA 3RVOA 3TW6A 4WJKB 5K4HA 4YI5A 4KXVA 1LEHA 3GRZA 4YMVA 2NV0A 3IUMA 3OEWA 2DFVA 2ZBVA 3PD0A 3TR5A 1UXOA 2EZ4A 3I6ZA 3ZLTA 4CCYA 3T12A 4BO5A 2DULA 3FUUA 5JXWA 1FJXA 3GB9A 3OT4A 2I62A 2BJWA 2Q62A 2I4RA 1DRKA 2YMLA 1DQRA 2XHZA 3LP5A 4NZPA 3NDRA 1ZWLA 2G71A 2WHEA 4DRYA 3GNSA 1GTG1 2G36A 2E7ZA 3KJHA 4WKGA 1CULC 1TEHA 2PH5A 4GOJA 3DZGA 5IU6A 2X8LA 5F1KA 3MUNA 4JP2A 4YP7A 2D0IA 4KGDA 3SZ3A 1F0PA 3USES 5IS2A 3NEYA 1T0IA 4U7FA 2C2WA 1JIKA 1FE8A 4YRKA 4F5ZA 4E5VA 5BUCA 1KJJA 4OM7A 4OMCA 3IP5A 1ZHOA 3S81A 3K73O 1SHZA 2EWVA 1NUQA 1EBUA 3ZGLA 1W25A 3ZIDA 2ZDGA 1HA3A 3M83A 4UTNA 1FDVA 4LI0A 2RHRA 4Z4HA 3JQCA 1KDPA 3BWMA 2WYOA 1MH9A 3PQFA 4KQXA 5H3HA 3DEHA 3U7IA 1ENYA 2BEJA 2PV0A 3OPYA 3MWJA 4G1CA 3STHA 4MQLA 4TTQA 1NG9A 1UXHA 3QVJA 1Y8CA 3Q6NA 1UJMA 1WXDA 4JR0A 5KS2A 1VL2A 3TX2A 3CF0A 3OIUA 4I1VA 2DBVO 3ILSA 3LH5A 3UK6A 1PI3A 2AOWA 2OAQ1 2WSLA 2ZRBA 4NFHA 5ICMA 3BTUA 3GGSA 3Q8LA 2PE5A 3MWEA 5D7NA 1Y6QA 2F67A 2FZ5A 2JCBA 1FUIA 4H7PA 2WYVA 1PR6A 2XCUA 2B6NA 4BJHB 2K5UA 2I55A 2NZYA 3MILA 4FZ3A 4CM5A 3ND9A 4OGLA 1SULA 1SUBA 1GZDA 1BNCA 4EY5A 3SEAA 1F4LA 5CTJA 3GELA 3I64A 4ATNA 1YCGA 4RTMA 1X38A 4IJUA 3HK2A 3EA0A 4UHFA 2UV8A 4YJGB 1ZH0A 3UT5B 3G3EA 2E5LB 4Z4GA 3UJCA 1L7BA 1U5BB 1RLOA 1TQHA 2AOTA 2ZSHA 2QX7A 3B3AA 3SFVA 4F1JA 5B3KA 4LMPA 1A95A 4QYMA 1PZGA 4L07A 3EXAA 2PKRA 1DBVO 4R1UA 1XRSB 3HEMA 2UYQA 3WL4A 1QDEA 3ZDFA 2K7FA 3R9XA 1L7MA 1V2GA 3BCUA 2HJ9A 4I0WB 5IG2A 1B23P 1N2BA 3TSCA 1B3BA 2QVCA 2XI4A 1ISJA 4B76A 2A86A 1T3TA 3GPCA 4TXNA 4IVRA 2OO5A 4QOHA 1GUDA 4G4SP 3AHHA 4GKBA 3B53X 3F98A 5IKXA 3LTEA 1ULSA 5ITSA 1QHYA 1F5NA 1OROA 4PTYA 2AJBA 1G5RA 1Z22A 2LDXA 3TNJA 2NUPB 3B1VA 1IIBA 1ISMA 1FP4B 1GKLA 1GQ2A 2ZB7A 3PXBA 2PPLA 3A3NA 3C7AA 1NUUA 3B3FA 1SQSA 3OZDA 3TTYA 1YQUA 4P92A 3QPVA 2R8PA 4TMXA 4XQGA 1Y3CE 3E0XA 2YV3A 1VG0B 1HYQA 1TM7E 3UPTA 1UDCA 4NAUA 3EA5A 4Q19A 4CU5A 3FX2A 3N2YA 4F12A 3QM1A 1NVXQ 4RDCA 5F73A 3X2EA 1N34B 7AT1A 3NTOA 3JAKB 3PDJA 2FZGA 4ER6A 3LP6A 3FSRA 4PAMA 4NXMB 5CLQA 2VZ8A 1Q83A 3KQLA 2DPXA 2VVTA 4DA4A 2GEVA 3HKCB 2CHEA 3SOZA 3MTAA 1HV8A 4MICA 5BN3A 4FYPA 1D2RA 3QUSA 5HIIA 3K9BA 1J2EA 4OI2A 1IVSA 3HO1A 1RP1A 3A6ZA 5KYTA 4KDCA 4X61A 1LDGA 3PJRA 4X7RA 1RE0A 2QF7A 3EYAA 3KKNA 3LQRA 5JEEA 4MKFA 3AF4A 4W7IA 1G8JA 3NIWA 2M32A 3R7AA 3H5RA 3EH1A 3AIKA 5INTA 4OJTA 3V4LA 2WI8A 1NVDA 4Q9HA 2IUUA 3WE7A 2QTTA 4DQXA 3DGEC 3WQHA 3EPLA 3T3NA 2GSWA 2P4UA 3A9SA 4ONEA 4TZKA 1FLVA 2AYYA 1NQAO 2FWMX 2ZI5A 2ZU0C 3DM5A 4WESB 4I1OA 4NVRA 5KSYA 3P8ZA 3RVQA 4I1SA 4PG8A 3EW7A 4KFRA 4CUKA 3F5FA 2PY6A 4FE3A 1W6UA 3GK3A 2Q3JA 3NBMA 2YC2C 4NECA 2NXCA 3GFTA 2HDOA 4MKZA 5CFRA 1UIRA 1NBMD 2PAAA 4DMGA 3GLUA 5HCUA 5TARA 4UE6A 1ZD2P 5DHUA 4DA0A 1MBZA 2VXOA 3AT1A 1Y6JA 3SX2A 5A4IS 4RXTA 4UNNA 1VIDA 2XB6A 1GAQA 4O1MA 5JVDA 5K8TA 5JCOA 1F51E 4Z4IA 4RENA 4ZGWA 1WDKA 4BV2A 4PRYA 3S5JA 2IRWA 2J33A 1BIFA 5UKDA 3WKCA 5CT6A 1I36A 3C6QA 1EH5A 1SQ0A 4WLNA 3LUHA 5JU6A 3FHCB 3MT9A 4R5MA 4CV0A 5BV7A 1IU9A 4XUEA 4M1TA 2ZCUA 5JYBA 1DCTA 1YJ5A 3ZTTA 5KNLA 4WPGA 5FADA 5LMZA 5JXHA 1QHIA 2F3UA 1W19A 2VHWA 4ZDWA 4EYEA 4EQ6B 1JYFA 1GO2A 2PUVA 3TNLA 2G1UA 2IPLA 4LV5B 1RJ9A 3VMMA 1R4MB 4YALA 1UWLA 3EVBA 1V3QE 2PA3A 3EC7A 3K2QA 5C51B 4W5NA 1VDZA 3EIFA 1OFTA 4LKRA 1W36C 4N3NA 1P61B 4CI0B 1R10A 1K3TA 1QGYA 2GUGA 4PQYA 1ECBA 2QE7D 3CZ9A 1QH9A 1KSHA 4X9XA 1E18A 1W36D 5EWMB 5CB0A 3WIDA 4JHXA 1AKVA 3AF5A 4GLBA 3U4GA 2WJGA 3DFFA 2NZXA 1SURA 4BVFA 4WOBA 4ZAWA 3SEFA 3LGSA 1WPQA 3OUTA 5DSZA 4HVLA 1GKKA 1L4BA 1I3LA 2VYFA 4UW9A 2GFHA 3TIFA 1KKLA 4Q21A 4JA2A 3V3TA 4CTNA 4F9TA 1ZXBA 1DBRA 2RHGB 3I4FA 3O31A 3KB8A 4GNRA 3HDQA 4EO4A 4E51A 1T36B 1PEAA 1RWWA 3ZLBA 1B0AA 2A5DA 1A2QA 1Y1LA 2A5LA 4NEHB 5ALTA 4MUJA 1FUEA 4KKVA 4OQDA 4C4ZA 4MRAA 3K8OE 1RXUA 3FBWA 1Z56C 4F4HA 3HLYA 3TWOA 5L95A 2FFQA 4DV1B 2QTZA 3EG9B 1VE5A 1K08A 1S2MA 1NL3A 2AEJA 4B7ZA 4DDTA 4CKWA 5CM9C 4U6NA 5ED4A 3BM5A 3K0SA 3G2LA 3DE7X 3D8UA 3BD8A 4COKA 2RHHA 4EJMA 1P9LA 1W5BA 1EFLA 4E13A 1ZNQO 2VJBA 4ZV9A 2GM9A 1BMQA 2OV3A 2PM8A 5JC8A 2OLKA 2PZJA 4OJNA 4WAUA 4TLDA 3GJ5A 1NDUA 2FVXA 1V45E 1U3WA 4BNZA 4BNYA 5F9FA 3EJWA 1WZNA 3RC7A 1TOAA 3COPA 1DIBA 2R84A 2G17A 5DZSA 4BE4A 5BSHA 1TEVA 4L8GA 1RWOA 4UM7A 4C7XA 4URXR 4JVMA 1I3NA 2JEZA 4D46A 1HR0B 3PCRB 4GX1A 4P5EA 3WNQA 1IN7A 4ZD6A 2J30A 2XUAA 4B3IA 3B89A 1HEIA