3LZ6A

Guinea pig 11beta hydroxysteroid dehydrogenase with pf-877423
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
KFRPEMLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVARCLELGAASAHYIAGSMEDMTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVNVSITLCILGLIDTETAIKATSGIYLGPASPKEECALEIIKGTALRQDEMYYVGSRWVPYLLGNPGRKIMEFLSAAEYNWDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Corticosteroid 11-beta-dehydrogenase isozyme 1
publication title The development and SAR of pyrrolidine carboxamide 11beta-HSD1 inhibitors.
pubmed doi rcsb
source organism Cavia porcellus
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 97
structure length 263
sequence length 263
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2010-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3lz6A00
3HJAA 1P1KA 4EZBA 1EUZA 3JYLA 4WECA 5CPBA 4CLOB 4CMIA 3WS7A 3WNVA 4TMFA 2WYVA 4M1QA 3F4BA 3M2PA 3L6DA 3ZV3A 5L95A 3OECA 4MDHA 4BL5A 5ITVA 4QECA 1OI7A 1R0SA 3WBFA 5L4SA 4H7PA 4JROA 1H2HA 2DPHA 2BELA 3QY9A 1PU2A 2DM6A 2YDXA 4XZ3A 5F5NA 1E5LA 4BNTA 1M6WA 4O59O 5FFFA 3C7AA 4X54A 2ZIZA 2Y0EA 3ONEA 1BDMA 2G5CA 3C1AA 3O8QB 4KOAA 3HN2A 4B7CA 8LDHA 3PDJA 5C5IA 4A5OA 1I33A 3K92A 4G2NA 4WLOA 1SOWA 1X0XA 2GYYA 4DWVA 4YJGB 1TVEA 2HMTA 5DCUA 2A4KA 2FY8A 3JQAB 3NJ4A 4NMHA 2D2IA 3WJAA 2I66A 2E4AA 4BNWA 2GN9A 1E3JA 4RGBA 1MUUA 1PX0A 1JKFA 1HEUA 3A4VA 3JQGB 5JMWA 2GD1O 4NBUA 2AA3A 2WSBA 3KLPX 4BNNA 4GKBA 4YJDA 1ADGA 4CM7A 2Q45A 3KUXA 1NTOA 3I9LA 3WYEA 4BQRA 1H2BA 4B3JA 3FRJA 3EZLA 1XU9A 5KJFA 4Y9DA 1JKJA 1A4IA 3NUGA 2JAHA 3PHHA 3OEWA 4BNHA 5I9MA 1A9ZA 1K2WA 2QYTA 3LU1A 1Q7GA 1RM3A 3KEOA 4DGSA 2EP7A 5ITWA 4XD2A 2CVQA 5JAQA 4PLCA 3I83A 5DF1A 1PGQA 3I4CA 1VSVA 5DP1A 1C0LA 2YV3A 4J7UA 1QYVA 4CLRA 3TZKA 3WSVA 2O50A 1IOLA 4GWKA 3WMWA 4WCDA 3INRA 1LTHR 3BMOA 5U9CA 2AE2A 4UREA 1FF9A 1NPTO 4L76A 2GN8A 2I6TA 5DCWA 2YUTA 4Z0PA 3DBRB 4I5EA 2I67A 3C7CB 3PIDA 3KLMX 1Y8QB 4NH4A 1JVSA 4EUEA 5BNTA 3JSAA 3DDNA 3MJEA 4JCOA 4E2XA 1YBAA 2YQ4A 3JQEA 2X5OA 1ZEMA 2OBNA 3DMTC 2ZTMA 3DONA 4JP3A 4NK5A 4L0QA 3WMXA 3HDJA 5MGBA 1PIWA 1TI7A 1YO6A 2HK7A 2PD4A 3HFSA 3PGXA 5FYDA 2HCTA 1T26A 4EUHA 2Y66A 5LCXA 3PTZA 1QV6A 5ES3A 4CM1A 1PSDA 4TSKA 1E7QA 4K28A 1VRWA 1SCUA 3GR6A 1NR1A 1EQUA 3BIOA 4PRKA 1QV7A 1GUZA 1DAOA 2VTDA 3ZU4A 4BIIA 4YVFA 2X0JA 1B16A 5LC1A 3GDGA 4J2OA 1Y9AA 1LSJA 2PH5A 4P22A 4BMSA 3LK7A 3QIVA 1KEUA 2R00C 4OGWA 3WGTA 5JLAA 2OP0A 4XYLA 4OO3A 4XX0A 2PD3A 1I3MA 4KQXA 2X5KO 1X1TA 2D59A 1F14A 3RBVA 1NM5A 3U5TA 1T2DA 2BMAA 1QLHA 3QWIA 3GMDA 1J0XO 2BFPA 1ZFNA 4PVCA 4P8RA 2HU2A 3VDQA 3H5RA 4CQMB 2FZWA 4CR8A 2XOXA 2AG5A 3AUAA 3FTNA 3P5SA 3D4OA 3JQCA 1Z45A 1T2EA 1U9JA 4Y8VA 3V1YA 4BNKA 4BS9A 4YACA 4LN1A 1DRUA 3OJ0A 2DC1A 4G5HA 5TT1A 4LMRA 3ZH2A 4BNJA 3NTOA 3G0OA 1UDCA 3OJLA 4ND4A 2O4CA 4GVXA 1CEQA 2VT2A 5AOVA 2YDYA 4YCAA 2RH8A 2HLPA 2X0IA 1UP6A 1ZIDA 2ZYAA 2V65A 3QW2A 5L53A 1BDBA 1FMCA 3JQ9A 4XB1A 3INGA 4Y6RA 4XWYA 4EEXA 4FJ2A 5K6AA 3OBBA 4U8GA 4UEKA 1DIHA 4L74A 4O5OA 4NJOA 4ZA2A 4ID9A 8ADHA 2EERA 3MJTA 1V9LA 4PLVA 4O63O 2DBQA 1MXFA 3QVTA 4E2YA 2VTEA 4Z0TA 2OHXA 1IYZA 4BV9A 1HSZA 3GC6A 4O1MA 3QQPA 4D46A 9LDTA 4JJGA 2R6JA 4YT8A 4R68A 3ETDA 5JMPA 1LXCA 4PG6A 2IXAA 3R0IA 4DTIA 4EW6A 1KVSA 5HS4A 3KEQA 2B5WA 4GSLA 1MP0A 2VYND 3EAGA 2P9GA 4HFJA 4R54A 5COBA 4I08A 4MPDA 2BFAA 5GZ3A 1I2ZA 1M2WA 3CTMA 1VL0A 4FQ8A 4Z6KA 3E03A 2DBRA 3BYZA 2P2SA 1D8AA 2VWHA 4RZIA 4AICA 2W2LA 5H81A 2C07A 1YQDA 3LYLA 3W1VA 3B70A 1H94A 3ITKA 1GUYA 3WIDA 1N8KA 2O3TA 1DOHA 4BNGA 1U3WA 1C1XB 4MVJP 3RU7A 5IFLA 1QXSA 4BVAA 3DZIA 1E7RA 1JTVA 3NGLA 1DFHA 1F8GA 1V6AA 2PD6A 2ILTA 2YFQA 3PYXA 3FNGA 4NZ9A 4CV1A 3OETA 1EBUA 1LC0A 1X0VA 3AOEA 1HE2A 1X7HA 4NI5A 3I9OA 4DLBA 2WE8A 5J23A 9LDBA 1UZMA 4PLWA 4CM4B 5AQ1A 4NFHA 1YBVA 2W8ZA 2UV8A 1ISHA 1YBMA 4U5QA 4R1UA 3HWRA 1U7HA 1XELA 2WJPA 4GLLA 2B0JA 2BKAA 5HTOA 3RKUA 1ID1A 1NQ5A 4PLHA 1PQUA 2FOIA 2CVZA 4M86A 5KVCA 5DBFA 3RC1A 4CMHA 1ADFA 3NV9A 1B0AA 1KS9A 5A05A 4CL3A 2VWPA 3UUWA 1YQXA 3WLFA 3NT2A 4URFA 3PRJA 1R4NA 3ZCXA 4ALKA 1KOLA 3WG9A 5KVVA 2HMWA 4RJTA 5G4KB 3TWOA 3UCEA 4NFYA 4Q39A 2J5QA 5TGDA 2CF6A 4FDAA 3WX0A 2NQ8A 4MVJD 5THQA 1DC4A 2FP4A 4CM3A 5KTKA 3JYNA 3JQAD 2Q1TA 3BTVA 1DFGA 1M75A 5B12A 3WB9A 5C7OO 3JQGA 4Z0HO 4OYRA 3EVTA 2TMGA 4GX5A 3RIHA 4DIOA 2JD0A 3WBBA 5IZ4A 4R5MA 3DAPA 4Q3EA 1TB4A 5BSEA 1T2AA 1IPFA 3KZVA 3AW9A 2PKQO 3BTOA 3W8DA 1K5HA 5DNAA 3PHIA 5T6BA 3RJ9A 4C7JA 4YT4A 3PP8A 1HDXA 4TVBA 3ZWOA 1TT5B 1GADO 4I1IA 3P7MA 1HXHA 4MKXA 4MVJE 4CLDA 2GN4A 5C7IO 1HETA 2CY0A 4YJFB 1MFZA 3TQHA 2O23A 4P38A 1NXQA 2Q4EA 2CDAA 5T57A 1S6YA 3ZV5A 4CR7A 4AJKA 1KVQA 2B4QA 2XAAA 1UJMA 2JL1A 2AEFA 1XR3A 4K9DA 3S1LA 1ZK2A 4D0SA 1BXKA 4BNLA 1B2LA 4RF5A 4AJOA 4BO2A 5A5FA 5I7FA 1A9YA 2X0NA 2HJSA 3UGKA 3FI9A 2H5LA 3DBRA 4TWRA 1Y8QA 3GF4A 2DU8A 3UFXA 4CMBA 2O2SA 4UVHA 4ALNA 3PDUA 1E3WB 1UP4A 1LDGA 3RCBA 5CG2A 4NU6A 2G76A 3BAZA 2NSDA 3OHSX 2W4QA 3LC7O 2FPGA 2P91A 4JBGA 1NBOA 3GN1A 4N5MA 1YXMA 4IS2A 1C0PA 1I0ZA 2VZ8A 3S2GA 1G0OA 4HADA 4CMCA 5ER6A 4K26A 3SEFA 3RU9A 1CF2O 3JTMA 1ZSYA 2Z95A 4BNXA 3FD8A 1RYDA 4E5PA 2EP5A 3H9EO 4PGFA 4NU5A 4RPJA 4RPGA 1UAYA 3JQ9C 4E21A 1ML3A 2NTVA 3GHYA 5K6AC 2EW2A 3PFFA 3H3JA 5ER9A 1LDNA 1B14A 2DFVA 5ILOA 4YT5A 1HYHA 3B1JA 3U4HA 3D5TA 4I5FA 5BT9A 1PTJA 1FJHA 2UAGA 1VKOA 3C7DB 2DLDA 1ONOA 3F4LA 4BKUA 2ET6A 2YHIA 1KYQA 1WDLA 3NDIA 2WYWA 3QWFA 5DOZA 3IOYA 3UF0A 5CEFA 3QVWA 1JA9A 3V2GA 3DAFA 5T67A 3S2EA 2PR2A 4HFNA 4RQTA 4WOJA 1QRRA 4OHUA 4QEDA 1E7WA 3B1KA 3BMNB 5A5EA 3B1FA 1M76A 2QQ5A 4BB6A 4CQMD 4IJKA 4GQAA 3I3OA 1DXYA 3D3WB 4ZQEA 2GZ2A 4AJHA 1HL3A 3VTFA 2J3KA 3QRWA 4A03A 5L7WA 1PJ2A 3INTA 3I9JA 1UXHA 4CM5A 5TIIA 3BZUA 1XDWA 1ZBQA 4KDEA 4YEDA 3GNQA 3U4CA 1C0KA 2QRLA 4MVJM 1X13A 4ND2A 4D44A 1LC3A 1J49A 2X8LA 4FOOA 1BXZA 3H2SA 5JBIA 4D3SA 4J4TA 1MG0A 4GKVA 1H0KA 4D41A 3WGYA 6ADHA 1LEHA 1PZHA 1PGPA 2J5RA 1QYWA 4J9UE 4QO8A 3GGPA 3LDHA 3D4NA 2Q2QA 5A3VA 4AJIA 4BO5A 2NUAA 3TZHA 4RVHA 3D64A 3X2EA 2X4GA 5CEJA 4JK3A 1XEAA 1AE1A 1NASA 2O3QA 1DRVA 5GMOA 5AYVA 1JVBA 3ONFA 3QVXA 3A1NA 2WD7B 3JYPA 4RF2A 2PZLA 3QSGA 3VPXA 4CPDA 3LLSA 5JO0A 1N9GB 2AQKA 3AY3A 2X86A 3GRKA 3IMFA 4YWJA 3IDSA 2Y05A 3DOCA 2PH3A 3LT2A 1WMAA 3JCZA 2X0RA 5GZ1A 3CIFA 2PNFA 3OIGA 4GMFA 4LSMA 3CZRA 1F17A 5H82A 3DBHB 4JIGA 1Z74A 4WEOA 3LF1A 4J7CA 1QKIA 4TRMA 1PQPA 2IEBA 2XXBA 4UUOA 5ENVA 4E33A 5B37A 2Z5LA 3FWNA 1PWXA 1HDYA 3PGJA 3PHJA 1PS0A 3BMCB 3L07A 3DMYA 5TLSA 3F3SA 2ZCUA 2ZB4A 4PG7A 1H6DA 1I30A 1ULSA 5CPFA 4JN6B 1PJTA 2H9IA 5A04A 4EI2A 4KWHA 4EJ6A 2B4RO 4KUEA 5TS3A 3E18A 3JQ6A 3KYCA 1U28A 1GCUA 4GVLA 3ZNPA 4IDBA 1EK5A 1PJ3A 2PK3A 3F47A 1D4FA 3ZZNA 4JX8A 2B37A 3DEYX 3OFSA 4CM4A 4M87A 1JQBA 3DAGA 2AQ8A 2X22A 3SJ7A 4N54A 3GVPA 2P68A 2A94A 1P1JA 2C29D 2EJVA 4NQZA 3DZGA 4B7UA 4P4NA 3DTYA 3GVCA 1U8FO 4JLWA 4LMPA 1R0LA 3BHMA 4R9SA 1ONNA 4W4TA 1PZFA 1YQGA 1PR3A 1H6AA 3GZNA 3QVSA 4DPMA 3H6KA 1SZJG 2CMDA 3G17A 4I8XA 1YRLA 1ZK1A 2PTGA 2X9VA 3AI2A 3WSWA 2FRDA 5CFZA 1XKQA 3PLNA 3MCVA 1HE4A 2FHSA 3PYMA 3U3XA 4N18A 4E2WA 2XF8A 5L40A 3DZKA 2QHXA 3JQ8B 5EMHA 2DAPA 1GCOA 3CKYA 4HNHA 3DHNA 3DHYA 4U0KA 1R0KA 5H83A 3DBVO 3I6QA 1LDMA 3V2UA 4IDFA 1EQ2A 1LQUA 2QYSA 4CM9D 4M8SA 1DIBA 1U3UA 4II3A 2HDHA 2W2KA 1P1FA 4MP6A 5EL0A 1LSUA 2VRCA 1AXEA 4WLNA 1NVMB 2X23A 1JKIA 4RDIA 3MEQA 2D0IA 4EEZA 1J6UA 1LSOA 4MJLA 5IDXA 1P1IA 4YJFA 3AI1A 2PKQP 1I36A 2NU9A 3D1LA 3AM5A 5EINA 4ND5A 1N92A 1E7YA 4ZD6A 1B26A 4XCVA 2VN8A 4L73A 5AXAA 1N1EA 1QP8A 3DTTA 3NTQA 1ZSVA 4ZHSA 5JW6A 4Z3KA 3FBGA 2WDZA 4J0EA 5F3RA 4H15A 1AN9A 3K73O 3PQFA 5CP8A 1QSGA 3GEMA 1DLJA 1GQYA 1KVTA 3ZDFA 2YYYA 1E3WA 1MC5A 4YAIA 1Q0HA 5JDIA 5JYDA 5KVSA 1RYEA 2D5AA 3KSZO 4R3WA 3V5NA 1HWYA 5EERA 3KRTA 4GLOA 4NIMA 3WGGA 2I9PA 4BO3A 3HZZA 2AXQA 1HYEA 3E48A 1Q1NA 3G3EA 2QZ9A 2YV1A 3PZBA 1VPDA 5CG1A 2AW5A 5U1PA 2NQTA 1OMOA 2XXJA 3NJ8A 2IODA 3GRPA 1UXJA 4DYDA 1E1LA 4XB2A 4NBWA 3DL2A 1PJBA 4FS3A 3WGQA 5A06A 3AJRA 1DHRA 4MIOA 1EVZA 2JHGA 1O94A 2UUPA 2EW8A 3DFZA 4LRTB 5JO9A 2FN7A 5A9SB 3OJEA 1E7MA 1Y5MA 2V6BA 4LK3A 5TC4A 3TZ6A 5IDWA 5I9NA 3GQVA 2WD8A 4ITUA 5BSGA 5KKAA 3G1TA 4JJFA 1OOEA 4Q3BA 1CIVA 4B79A 1H6BA 2AQIA 3DR3A 2ZB3A 3PI7A 1HE5A 5C7LO 1K6IA 5FEUA 5KCZA 1A71A 2UVDA 2BGKA 3GGGA 1Y8RA 2Q4BA 3KYDB 2ZYGA 3ZWAA 1GFSA 3BMNA 4QSMA 5F1PA 4IMRA 1O0SA 4ND3A 1K3TA 2G1UA 3FNHA 1G1AA 2HRBA 1EVIA 2OGUA 3D3WA 3U62A 1A72A 4YRAA 3MJVA 1W4ZA 1VI2A 3BMQB 4S3MA 3DFUA 1W0CA 3QP9A 5CDUA 3L9WA 2EKLA 4JGBA 1BXGA 2NVUB 1PWZA 1GYQA 1UXKA 1NPYA 4D79A 2FZEA 2J6IA 3V1UA 3ULKA 3UH1A 3JYQA 3ZGYA 3P2YA 1ZMTA 1B7GO 4BKPA 4XIYA 3UVEA 1T4DA 2PWZA 3ZWPA 1MX3A 4BNVA 1DEHA 3Q2KA 3LC2O 1XU7A 3WTCA 4KTTE 1SB9A 4RLSA 4IGEA 1L1FA 4XJSA 2VHXA 1Y81A 4BUCA 4TRNA 4XDYA 2C7GA 2P9EA 3OF2A 1LA2A 3HDQA 2CDCA 2PFGA 1GUFA 5EPOA 1KERA 1LRLA 3TOXA 5EN4A 1MFPA 1GYPA 3HUDA 3HADA 2WD7A 1RJWA 2OXIA 3VAZA 2CD9A 1Z7EA 1C1DA 1HDCA 4CUJA 4DC1A 3W6UA 5B4TA 2UUOA 2EG9A 1XIVA 4ESOA 4FW8A 4NK4A 3NRCA 1LUAA 2GLXA 1PJSA 2ZB8A 4J3FA 5IXYA 4ZRNA 2VYVD 4WUVA 1DIRA 3LVFO 1WAMA 3ON5A 2EGHA 4AG3A 3U49A 4CQLB 2FPIA 2CZCA 3IP3A 4RZHA 4BO9A 1LLUA 1Q0QA 1N2SA 1ISFA 2IRWA 1GQ2A 3TZQA 3W4JA 3OEYA 3BMCA 3RC7A 4GPD1 4HUJA 2Y1OA 1WDKA 3VVCA 1KIFA 1U4OA 4W7HA 1VJ1A 3S2IA 4OL9A 1ISIA 3IKTA 1ZUD1 1PQWA 2IYPA 2Q1SA 3N58A 2RAFA 1U3TA 1ENYA 2DUWA 3IUPA 2CF5A 1P0FA 2B4TO 4NPCA 4YQYA 2QIOA 4PLFA 1OZAA 2Y0CA 4KUGA 5T5QA 2E37A 3I9NA 1QYCA 1EVYA 5BR7A 2PKRA 4EBFA 2JFGA 4WNIA 3B20A 5ICMA 4YAKA 1FDTA 3U9LA 3CUKA 1CETA 4DVJA 1B15A 1OC4A 2CDBA 3H2ZA 3RVDA 4AJ1A 3KB6A 2RH4A 5JE8A 4ALMA 1NP3A 3GY0A 2Q99A 3WQQA 4E30A 1E6EA 2C20A 1E6UA 4ZN6A 1I8TA 1U2GA 1HSOA 4MKRA 1BMDA 1SC6A 2WE7A 1K0UA 1DIGA 5JY1A 3BTUA 4RVGA 3M1LA 3TFQA 3UAGA 3PJGA 2B36A 5JDIC 3PK0A 3PYLA 3QWBA 2EGGA 1R12A 1PEDA 4A10A 2OZPA 1SO8A 4J4BA 4QTZA 3H9UA 2I65A 1CWUA 1DJNA 4DPKA 1BW9B 1E1MA 5A4DA 2F1KA 1EK6A 1ZCJA 2ZTLA 4LCEA 4E32A 2HAEA 3ANNA 1EUDA 3S8MA 1YDWA 4IZIA 3QV1A 3NDRA 1DO8A 2Q50A 1YONA 3NGXA 4PCVA 4RVDA 4IJUA 1PGJA 1NVTA 1PL8A 4RPKA 3RASA 4MIYA 1UUFA 2D5CA 2FPPA 3OIDA 1IE3A 2HMUA 2C0CA 1N5DA 4PLGA 4WNCA 3LT0A 1AGNA 2H63A 3HE3A 4M89A 1XWFA 3DZHA 5KJEA 3G1UA 1Z75A 4OXKA 4OKIA 1CERA 3UN1A 4W6ZA 5DN9A 1B8UA 2WMDA 1DC3A 1GYRA 2Y1CA 3E9QA 2ZTUA 1JWBB 5EQDA 2WM3A 5HS6A 4C4OA 2DUUA 3T7EA 1YDEA 3BXXA 3QWAA 2VYNA 5EJ2A 5LDGA 1EFLA 3EDMA 2Q2VA 3CEAA 4IPTA 2O3UA 2A35A 3MZ0A 3QLJA 3W8EA 1WLYA 4IQGA 4YRBA 3AM4A 3WWYA 4KDFA 3ITDA 4XGNA 3OJFA 2GDZA 3C3XA 4ZGWA 4UVGA 4PG8A 2Q2WA 4E5KA 1R4MB 1SOVA 2EWMA 1JU9A 1LJ8A 3KYBA 3Q9NA 2GR9A 4R9RA 1O95A 2Y1EA 3ABIA 1YJQA 3GUCA 2Y67A 2AMFA 3RI3A 2E6UX 3CSDA 3ZHZA 3VHRA 1I2CA 4AJ2A 5COAA 2JJYA 4Q3DA 2BHLA 4BKQA 1YL5A 3ENNA 4Q3CA 4CLOA 1YB5A 3DQPA 1H6CA 2CFCA 4DRYA 4W82A 1NFRA 3G49A 2VUUA 3F1KA 2GUGA 5A9SA 4PG4A 2PLAA 1WW8A 3RFTA 4WCFB 2VCYA 1JAYA 2GCGA 4PRLA 4MKZA 4RPLA 5A9TA 1U5CA 4OAQA 2C5AA 4EUFA 3ROMA 4IM7A 5DP2A 2JKVA 1ENPA 5FI3A 5IG2A 1YOVB 4FGWA 2P5YA 2PGLA 3HDYA 1ISMA 5F1OA 1ZXLA 3DWFA 1KBZA 3T7CA 3C1OA 4CM6A 4CV0A 1E5QA 3O8QA 2X7HA 4FB5A 3AK4A 5JNLA 2FR0A 3I9KA 4MVJA 3JD4A 4PZDA 3TJRA 1Y1PA 4RVSA 4YJGA 1OFGA 4FFNA 4NJMB 4L4RA 3K31A 3SXPA 3JQAA 3WWZA 3ST7A 4H3VA 1PR9A 2RHCA 4OKNA 4IY1A 4B3IA 3TN7A 1VE9A 5B1YA 1K89A 1A7AA 3EZYA 1D7OA 3KXDA 1I5RA 2UDPA 4ALLA 4UULA 4AJ4A 1RPNA 2DVMA 3UKOA 1P44A 1F06A 1NVGA 4FFOA 4HBGA 4JXKA 1W8DA 2A9FA 4YRDA 4CM8B 5K0ZA 1FDVA 3HQ4O 4XGIA 4YTEA 3QHAA 1LNQA 2I5PO 4J1QA 2AE1A 3TRIA 3ZWWA 1ZXBA 3EMKA 3C85A 3FWZA 1ZEJA 3FTPA 1MA0A 2JCYA 2OORA 3KVOA 5G4LA 2QG4A 5I7EA 1FK8A 4JP2A 4UUMA 1F12A 1IY8A 5TJ9A 3H3FA 4RO0A 3RSHA 3W8FA 3CH6A 2NTNA 4YB8A 3TL2A 4PN3A 1C3VA 2O3JA 1DAPA 3EUWA 1P0CA 4O6VA 1E0DA 4FR5A 2X6TA 3IL2A 4BO4A 4IQ0A 3HNPA 1DB3A 3AM3A 4YT2A 5ILGA 4OOEA 3OM9A 4MP3A 4R69A 5IZCA 3GNTA 3F1LA 3ADOA 3Q0EA 2WYUA 3IC5A 1BVRA 1V3VA 3AUTA 1VL8A 5IDQA 4J1TA 4BHTA 5FWNA 4RL6A 3I6IA 3GMSA 2Y68A 4IXWA 1RKXA 2AHRA 3TNLA 2DQ4A 3JQ7B 5THKA 3ZNOA 3HHPA 3AU8A 3OA2A 5L4NA 4F6CA 2B5VA 1U8XX 1DIAA 1NWHA 1CDOA 2YY7A 1YE3A 3S2FA 4FC6A 4N5NA 1FDSA 4L4XA 4G65A 3AFMA 4RF4A 2C54A 5TNXA 1UDBA 4RORA 1DSSG 1NX6A 2PGDA 4WLVA 4D0RA 1W73A 2BI7A 4BQPA 1SBYA 1YWGO 5DCYA 2V6FA 5G2OA 3R6DA 4E12A 3WGOA 3IAHA 5G0VA 1E3SA 1N7GA 1T24A 2VRBA 4BGEA 1WWKA 3M1AA 4YYZA 1UH5A 1P31A 2GPTA 4DIBA 2Y99A 4AJPA 5K9ZA 3VC7A 3EVNA 2W98A 5HBRA 1SEVA 4JJIA 2WTBA 4Q9NA 2BGLA 4CMIB 2IZZA 1B8VA 4DC0A 1XSEA 2VOJA 1PJ4A 3NAQA 4DQUA 3AWDA 4CQMA 5MDHA 1D3AA 3Q3CA 2FSVA 1P1RA 4Z9FA 3NT5A 4CLHA 3RUAA 1ULUA 1O89A 5IAAA 1CYDA 1IZ0A 5JCJD 4W9NA 3C1TA 1Y7TA 2V6MA 4HKTA 4I5GA 3M2TA 5AXBA 3R3SA 1F8FA 3E8XA 4WGGA 4MINA 5L9AA 4QUKA 4DL9A 4B4WA 2EIHA 3F5SA 4TROA 3WQRA 5BQFA 1KC3A 5JFOA 4ND1A 3AY6A 4DLLA 4CR6A 2X1HA 2CNBA 3LZ6A 4Y6SA 1WXDA 1FDWA 1IL0A 1PL6A 4CLEA 4M54A 1U3VA 1DFIA 4KMSA 3VVBA 3FR7A 2WWRA 3A14A 3BA1A 3C24A 3ICPA 3PQEA 3KETA 2DTDA 3MJSA 1EE9A 4LSWA 4RV9A 1KEWA 1E3IA 3RROA 5COQA 2NU7A 3WNQA 4BMNA 1GU7A 3E6AA 3LT4A 4PG5A 1MB4A 1ZNQO 4FD3A 4YR9A 3H5NA 1LDYA 3VH2A 4KQWA 4JBIA 3DBLB 5A03A 3RBXA 5EIOA 3K5PA 1UXIA 4BGUA 1IPEA 3ROQA 1DRWA 1HDOA 4L9RA 4RF3A 1VJTA 1WVGA 5CAEA 1YS4A 4ZQFA 1UR5A 4CMJA 2EKPA 4OXNA 1LDEA 4YJHB 3SLKA 2ZJ1A 1V3TA 5CHEA 2OBYA 2BD0A 5G0SA 1Y5RA 1LX6A 3VPGA 3A9WA 2CVOA 3N7UA 4XQ9A 3VZQA 2I3AA 3BMOB 2C2YA 4DBZA 2AQHA 3TL3A 2H6EA 3O9ZA 2JCVA 3H7AA 1M6HA 4GX1A 3RJ5A 4A26A 4Q3NA 4A0SA 4CMAA 4E4YA 4HNGA 3F6YA 5JAIA 4OXYA 6LDHA 2ZCVA 1C1XA 1BVUA 1V35A 3ZNQA 3OSUA 1PJQA 4U0JA 4MP8A 5TF4A 3SJUA 4E5MA 2BGMA 3WFIA 3RQSA 4IZHA 4BMVA 3JV7A 3ONDA 1ZJZA 1E77A 2GO1A 3EK2A 4ALIA 1MC4A 5T64A 2DBVO 1GD1O 4LISA 4E0BA 4TKMA 3QWHA 2VNSA 2GZ3A 4B8WA 4J4HA 5BNFA 2H1SA 2SCUA 1T25A 3AI3A 4B3HA 3E82A 4FFPA 1DC5A 1YOVA 1P45A 4XQEA 1JDJA 5IZCC 4B4OA 3IP1A 2A92A 3GFBA 5IJZA 5G4KA 4JQCA 4OH1A 1GL3A 1P1HA 4WLEA 3WDSA 3FCOA 4MVJH 4GX0A 4YAJA 1DJQA 3PHLA 1GQQA 4KTVE 4LCJA 2IZ1A 1YL6A 3VKUA 3VZSA 1I32A 2ZATA 1BGVA 4GGOA 4CM9A 3A06A 4IGFA 4R3NA 1HF3A 4I5DA 3KV3O 4R01A 5F21A 1VC2A 4QXMA 2BFOA 4IUYA 4Y98A 3ZWCA 1JW9B 2G0TA 1LSSA 4TRJA 4E2ZA 5JC1A 2YJZA 2ZKLA 4EDFA 3OICA 4R1TA 3GDFA 4LRSB 4W99A 4XIJA 1PJCA 1NPDA 1TT5A 4U6QA 2I99A 5IDYA 1R37A 3PWSA 4KUHA 3ROPA 2VUTA 3GK3A 5I9LA 3SVTA 4IMPA 4MVJF 4BNMA 4F45A 2ZTVA 3DZFA 3E1KA 1HT0A 1Q7BA 2C5EA 1GR0A 3AU9A 5DDIP 3GNSA 3I5MA 1DC6A 1P33A 4HWKA 4ZQGA 4B7XA 1Z7BA 4J1SA 3I1JA 3LC1O 2GERA 1C0IA 3WGIA 1QMGA 2ZQYA 1B3RA 3ASUA 4XGKA 4BOYA 4WPGA 2D1YA 4A7PA 4XDZA 4W9NC 2I76A 1HLPA 2VT3A 1GV0A 5L51A 3GDOA 3OQ6A 3RFVA 3O4RA 1ORRA 2P4HX 3RC2A 3CMCO 4DA9A 1IB6A 1EMDA 3RUIA 4UVIA 3RUCA 2Q1UA 4U6SA 2VZ9A 2OUIA 2AG8A 3GGOA 3LT1A 4J91A 3R3JA 1RM4A 4MVJG 4ZQHA 2FWMX 2NV6A 4BV8A 3ETEA 4QFCA 1FXSA 3NT4A 4GAEA 3VTZA 4CUZA 1SMKA 3GEDA 5AVOA 3I4FA 1NWCA 3KHUA 4PLTA 2ZK7A 4TKLA 3K9QO 3ZWNA 1TXGA 1BHSA 2E48A 2PV7A 3KSDO 4J7XA 4DBVO 1YB1A 4R4JA 1UXGA 2IYOA 1NFQA 3H9GA 4IDEA 3O38A 4QX6A 3FNFA 4IDDA 4YQZA 1VJ0A 5B4VA 1J4AA 1GZ4A 3GAFA 3ZWBA 4H16A 1UZNA 3H9JA 4CLXA 3OQ1A 5A1TA 3VOSA 2JCXA 3JQBA 2WEKA 4EJMA 4UVEA 4PLZA 2Q46A 4IDGA 3H9QA 4L4SA 1T2CA 1I2BA 3GH3A 1K6XA 4ROSA 1MG5A 2VQ3A 3FBTA 2Y1FA 1ZJYA 1NHGA 1AUPA 1HZJA 3AOGA 3KBOA 3PHGA 1LI4A 4A27A 3MTJA 3WLEA 1P74A 4TZKA 3ANMA 4Y6PA 3IJRA 3RFXA 1V0JA 5F5LA 4A73A 1EEHA 4QFDA 3Q2IA 4EJ0A 5L7TA 4XRGA 5IN5A 1R4NB 5CDGA 5ENDA 4XA8A 2E49A 1LRKA 1E7SA 4R1SA 3IJPA 2P5UA 1UZLA 2VHVA 1BWSA 3D0OA 1DBVO 1X1EA 4FGSA 1O8CA 4I9NA 2X5JO 4TZTA 3K96A 3JQFA 3VPFA 5I7SA 4CV3A 3L0DA 1LRJA 4OSOA 1OBFO 2X58A 4AJJA 3HN7A 3PZRA 4J9VA 2HSDA 2JFFA 1LLQA 1Z6ZA 3OIFA 1HZZA 2NACA 4WCFC 2JHFA 2OL4A 3HFGA 3L77A 3AUUA 5KKCA 3MTGA 5DULA 1GEGA 2C2XA 2GN6A 2DT5A 1NFFA 2P4QA 3JYOA 4J43A 3DBLA 1ENZA 1U7TA 3CINA 3VH3A 2NVWA 3NX4A 5LDHA 1TLTA 3AY7A 1N9GA 4TVOA 1WZIA 1XA0A 1QLJA 3V8BA 2HK8A 1SPXA 3SC4A 1YL7A 3PQDA 4WOKA 4PFJA 1WPQA 4N5LA 4I9UA 2VYVA 4YJHA 1ZO8A 3GOHA 2VNAA 2VWGA 4ZICA 5HM8A 1DDOA 4YAEA 3GPDG 1ZKMA 3DBHA 4NBRA 1H9AA 3EGOA 4JBHA 4XR9A 1YKFA 1XLTA 4YXFA 2GNAA 1ISJA 2AEMA 3L4BA 1HDGO 4BO7A 2IDZA 1DLIA 3SBOA 5JYEA 3JD3A 3I52A 3FPCA 2NWQA 4TRRA 3OA0A 4MOWA 4FJ0A 5CDYA 3ZN2A 3U4IA 3P19A 5KJ1A 4E5YA 3MWEB 4E6PA 5TT0A 1PZGA 4J90A 4EGFA 1GY8A 3CE6A 4E31A 3H5AA 1TT7A 1NQAO 4BKOA 2B69A 4Z9XA 3ZNNA 1YB4A 1K6JA 1I3KA 3JD0A 5F1KA 4AJNA 4AJLA 1IULA 4K1LA 3D4PA 4E5NA 5JDCC 5KJCA 4S1VA 1IUKA 1HTBA 3QE3A 3H8VA 4RDHA 5C37A 3PJDA 4UEOA 3DC2A 1UAGA 5ADHA 2BLLA 4IDAA 4GBJA 4HV4A 1KVUA 5C3MA 1HE3A 5JC8A 1EBFA 3C8MA 3WICA 4K6FA 3GEGA 1NQTA 2C59A 4RVFA 5IXSA 4QO7A 3GHHA 4FFLA 5KJ6A 3MWDB 3VZPA 2EF1A 2YHIB 1EVJA 5JS6A 4J16A 2VZ0A 1PS9A 3JQ8A 3RAJA 2HMSA 4AJEA 2VHWA 1CQIA 1OAAA 2XPCA 4D42A 3PWZA 3DHEA 3QJ5A 1R15A 5FF9A 1A27A 4XYGA 5GY7A 3ZHBA 4B4VA 5KOIA 1I3NA 3WGZA 4DQVA 3MOGA 3V2HA 5KVQA 3DOOA 4ONEA 1V3UA 4ZQBA 4NHEA 1VM6A 2NU6A 1BTOA 3B6ZA 4CMEA 4O0LA 5BSFA 2Y1DA 3G79A 2VHYA 3GLQA 3E5MA 1WMBA 2OOSA 3TZCA 1VSUA 3SX2A 4E13A 4OMUA 1I10A 3ZW8A 2HUNA 2J3IA 3RC9A 1XQ1A 1ZK3A 2G17A 4DQXA 3EHEA 2LDXA 2OMEA 1U2DA 1H93A 4QT0A 2Q49A 2FMUA 1T4BA 2VOEA 4MO2A 3D7LA 3D3EA 5CDTA 2LDBA 1U5AA 3ORFA 5L3ZA 2NU8A 1A4UA 1O6ZA 5JAMA 3O26A 5DBGA 3L9XA 1P3DA 3JQBC 3UHAA 1AXGA 3PIIA 4XJTA 1Q0LA 3VH4A 4K6CA 2X9GA 2B83A 2NTJA 1QR6A 3CMMA 4J2HA 4OSPA 4RCVA 3W6ZA 4QQRA 2C7VA 1ARZA 2DTEA 2RHRA 4INAA 3UW3A 4U7WA 3T4EA 3EYWA 4LW8A 5CEEA 4A2CA 2O4UX 4I9HA 3VH1A 3ZHXA 2PA3A 5FI5A 2VWQA 1NR7A 1WDMA 4R1NA 2P9CA 5ICSA 3FN4A 1KC1A 2QX7A 1NHWA 1PGOA 3MOIA 1NQOA 2G82A 4PLYA 3ZHYA 3GUYA 5HRUA 1H5QA 2YW9A 3I23A 4Z9YA 1LLDA 3EC7A 4UEJA 1R6DA 2OO5A 3JQFC 3DZBA 3E9NA 4F46A 4MIEA 2FSSA 3TSCA 2AEJA 1P77A 3K2EA 3F5QA 2IXBA 3GVXA 3HB5X 1TEHA 4XQGA 3QVOA 3WXBA 1SB8A 1GPJA 3ROKA 2W2LD 4DUPA 3EY4A 3PJFA 3ZWYA 2O3SA 1GZ3A 1HDZA 4FFMA 4IIUA 4BNIA 2RBEA 4KWIA 1EFKA 2HQ1A 3IKVA 1QYDA 3HDHA 2F00A 1X7GA 3JD2A 3JD1A 4OIMA 5AXCA 2BFMA 2ZYDA 3F9IA 3FNEA 4D43A 1BSVA 2TMDA 1T1RA 2HO5A 1WP4A 1M67A 4EYEA 1I3LA 3KYCB 2BF7A 3BHJA 1AHIA 4J6FA 1ZSNA 2QZZA 2NADA 3WOHA 3VDRA 3FF4A 4YA6A 3ZWMA 1NNUA 2NNLD 3WYCA 3U09A 3QA9A 3WIEA 1PL7A 3DO5A 1JWAB 1RM0A 3KYDA 4GH5A 4II2A 3TOZA 1EE2A 3W4KA 3GT0A 2O7SA 3BHIA 4UVDA 3LSYA 3L4SO 4XYBA 1ZZEA 2HJRA 4FCCA 2GZ1A 3SC6A 1JAXA 2HRZA 3GA0A 4FOSA 4RPHA 4GL4A 1I01A 4RQUA 4D7AA 3BMQA 2J8ZA 1IZ9A 3GZ4A 4CV2A 5DOVA 1E3EA 5EQFA 1UDAA 2DPGA 2NVUA 3GZNB 2FR8A 3L4BC 3KTDA 4HX5A 1TA4A 5JY6A 1KVRA 1X15A 2BI8A 2QW8A 1XHLA 1U4SA 1ADBA 2GASA 1EUCA 4PIVA 4CJXA 1BG6A 2IZ0A 2DFDA 4BNZA 3W4IA 1PGNA 2GSDA 2NVBA 1SEPA 4HFRA 3K8ZA 1QORA 5TRTA 3LLVA 4NBVA 3WYBA 1MV8A 5JXWA 1NAHA 1L7DA 3F46A 4AL4A 3IUSA 2RIRA 1CJCA 1E6WA 1WNTA 4BNYA 1XCBA 5A3JA 4WLFA 2W2KB 3PPIA 2PZKA 1ENOA 2O2YA 1RWBA 1KEVA 3OJOA 4WKGA 1PZEA 3NKLA 4Y67A 3LF2A 1VKNA 4XRRA 4D45A 1L7EA 1G6KA 1T1SA 4FBGA 3HSKA 4JNKA 5I8WA 5JCXA 2Y0DA 5KIAA 2J5KA 5IF3A 4GSKA 4LVUA 5G0TA 1HLDA 2EV9A 4ZVVA 2VHZA 4CODB 1YH3A 1SAYA 2D8AA 3E5RA 3TFOA 1ZVMA 2PGJA 3LQFA 4C7KA 4PVDA 2C82A 4DIFA 4KP7A 4CQLA 2X9NA 3ZWVA 3U0BA 4EITA 5I7VA 2YV2A 4DLAA 3VZRA 4ZU3A 3PVZA 2Z1NA 2BH9A 2YQ5A 1LDBA 4XYEA 4CMEC 1E1NA 3ZV4A 4UUPA 5T8KA 4IJVA 4UAGA 3ASVA 4BO8A 3ETGA 1V8BA 3Q9UA 1XYGA 3L6OO 4M55A 4R5HA 4AFNA 3ZW9A 3HG7A 2OP1A 2YHUA 2D4AA 2IEDA 4W7IA 1KEPA 1I24A 2Z1MA 1ZK4A 4LVCA 4CUKA 4F3YA 1EDOA 4N7RA 4OQYA 2ZJ0A 1Q2XA 2EXXA 1PS8A 3Q6IA 3OMLA 5EESA 1ZW1A 4WEQA 4IBOA 2DTXA 3UCXA 3KSUA 1GZ6A 1P9LA 3STHA 2YZ7A 4J1NA 2VUSA 3GAZA 4BO0A 1ISGA 3UCFA 3H65A 4DMMA 4NBTA 2NLOA 1MXHA 2R2GA 2PY6A 4J49A 4BGIA 5JCJA 3PLRA 3VKVA 3HB4X 3RBZA 4B8ZA 4BGVA 5JAZA 7MDHA 1U1IA 1E92A 4XYMA 4CL8A 3ANLA 4LGVA 1HDRA 1YJ8A 3ZU2A 4OQZA 1LU9A 2V7PA 4Q3AA 4NR0A 2CUKA 2UYYA 4WASA 1BW9A 5B4UA 1Y8RB 4J0FA 1JN0A 1T2FA 3GG2A 4OM8A 3WJ7A 1PJLA 3O03A 2DBZA 4D3DA 1EZ4A 1D1TA 1FDUA 1MGOA 2E82A 4E3ZA 3MJ4A 3BTSA 4GI2A 2HK9A 2HMVA 4M49A 4NNJA 5JSFA 1SNYA 4NG5A 1ONPA 3Q11A 5G0WA 2PZMA 4FIZA 1W6UA 3PWKA 2BRUA 3NYWA 2POQX 4YDRA 1BXGB 4FPXA 1LBEA 3RWBA 4G81A 4XR4A 2IE0A 2JAPA 3AUSA 3RUDA 3WFJA 2D3TA 3A28A 2PZJA 3RUEA 5L7YA 4GGPA 2JD2A 2JD1A 4BB5A 3UXYA 4RLHA 4BNUA 3T4XA 3PJEA 1BRMA 4BO1A 4RVUA 1ADCA 3AOEC 1Y9EA 5TX7A 4HFMA 4KZPA 1X7DA 3GPIA 3SLGA 2Y93A 4WLUA 5AXDA 3FHLA 1AHHA 3TDKA 1MLDA 1HRDA 4CLRB 4BO6A 2J3HA 4CMKA 5DBIA 1CQJA 4D3FA 4YBZA 3OQBA 1Z82A 3IS3A 2QRKA 4GX2A 2J3JA 1D1SA 1H9BA 3NTRA 1KY4A 1R4MA 2B35A 3H4VA 3ZU5A 1GAEO 2I3GA 1UP7A 3GVHA 3K2BA 3NEPX 1C1DB 3UOGA 3EW7A 1ZK0A 5I8ZA 1KETA 4DYVA 2O7QA 5G0UA 4XEHA 3WTBA 4L75A 4ZJUA 1XG5A 4F6LA 4YPOA 1Z73A 1JLLA 1HKUA 1O9BA 3ZU3A 1E1KA 3FSRA 4XKJA 2CSUA 5BNIA 4BKRA 3AFNA 3GFGA 5DZSA 4WE3A 1CRWG 3COSA 4WCFA 4IQ8A 1EDZA 4ALJA 1IHYA 4YAGA 3I9MA 1G0NA 1NAIA 3JQDA 3ENKA 4IJWA 4OOFA 4B4UA 3CXRA 2QRJA 1B8PA 3GVIA 3ICCA 4NFSA 2HKIA 1HYGA 3ZWXA 3RD5A 5TSDA 3FPLA 3GG9A 7ADHA 2GRAA 1OC2A 3IIEA 3S55A 3VPSA 4P4GA 3RUFA 4FFRA 1KY5A 5A02A 1NYTA 1O5IA 4NJMA 5CDSA 5TJHA 2EJWA 4PZEA 1M66A 3IQDB 3KO8A 5U4QA 4CMGA 3X2FA 3M6IA 3V1TC 1J5PA 3KOUA 3ZV6A 1R16A 1RM5A 1B3BA 4IINA 1N1GA 5GZ6A 4FC7A 4GWGA 3TF5A 2EKQA 3N74A 1E3LA 4XQCA 2EEZA 5DT9A 3MJCA 1A7KA 2OFPA 4BNFA 2EHDA 3DZJA 5HWSA 4R16A 5L4LA 4CM8A 4AVYA 3CPSA 1A5ZA 5KWEA 4DXHA 4R41A 3DMTA 3R1IA 4IDCA 3WQSB 2ZQZA 2O48X 4Z3DA 5T8KC 4NDNE 2RCYA 1XQ6A 3ADPA 1N7HA 4HY3A 1YVEI 1ZMOA 1C14A 5TQVA 3TPCA 1LQTA 1ZH8A 2JFHA 3VPHA 3K6JA 1DHTA 1VLLA 4IIVA 2Q1WA 5JDCA 3PEFA 4WJZA 4WK6A 3WGHA 1IHXA 4ZRMA 3P2OA 3PFWO 4FSHA 1GPDG 4GMGA 2NM0A 1GEEA 2VRCD 3OP4A 4PLPA 5BSHA 1X14A 5A9RA 3DB2A 3GN2A 3Q1LA 3KM0A 3NDJA 2R00A 2Q3EA 1R66A 2Y1GA 4TQGA 3D5QA 4P4LA 3WR5A 2DKNA 3RKRA 3DXFA 1QG6A 1QYXA 1XGKA 4L8VA 1GTMA 1LLCA 3JQ7A 1GV1A 5KNLA 4ILKA 4DMLA 5IN4A 3DOJA 5HA5A 5L45A 4HP8A 4OJNA 3RUHA 3PXXA 4IXTA 1Q7CA 2W90A 1WZEA 2GF2A 1GDHA 1S7CA 2GGSA 4R51A 3E9MA 3UICA 4IS3A 2ZB7A 5JPIA 3L6EA 1DPGA 3ZI0A 3FR8A 1VL6A 1Y6JA 1F0YA 3OH8A 4UUNA 2FR1A 4DREA 3K30A 4HXYA 4FN4A 2O3RA 4MVJI 4DPLA 3CZMA 4PZCA 1YGYA 3U4DA 2YFHA 2V6GA 4FJ1A
chains in the Genus database with same CATH superfamily
1G2PA 3EIXA 1UBOS 1V7ZA 3IXLA 4QBKA 1GT91 1WQ4A 2JAWA 1OX5A 3NBYC 3IOCA 2Q4TA 3NHYA 4CLOB 1OGJA 1CUJA 3B38A 5JECA 3ANXA 2CNNA 4M1QA 1W47A 4QVGA 5E4TA 2CXOA 3JALB 4X3OA 3ROGA 4GS5A 3M2PA 4Y2UA 3ZIAD 1G18A 3KVNA 2YS7A 4OYYA 1IC6A 4DLUA 5ITVA 1O94D 1EDDA 1KZYC 2ZRCA 3MUFA 3VU0A 3WBFA 5HKKA 2C5BA 4B3FX 4H7PA 2WR8A 3KWJA 4JROA 4FK8A 5SZHB 4CW7A 2DPHA 1PF7E 5FTMA 1AQIA 1K92A 4AQDA 3EULA 1F0NA 1T4CB 3NOQA 2X19A 4YRLA 3V8NA 4BNTA 3UO8B 3NGMA 1M10A 5HGXA 4R1OA 1RRMA 2ZIZA 4G0PA 2WJAA 4X66B 2Y0EA 4V0SA 3NETA 4KOAA 1U98A 8LDHA 3CRVA 1T3TA 3RLFA 4H18A 3PDJA 1G59A 5C5IA 4ZYXA 2FNAA 2CT8A 1PT7A 4EGJA 1SOWA 4ZJZA 1X0XA 1TKCA 2FN3A 2GYYA 2JIDA 1QF9A 2HMTA 1JIUA 2FY8A 3BGIA 4TMZA 1KFJB 1BHJA 1OWNA 3NBZC 4HNQA 4NBNA 2Z83A 1MUUA 3LUKA 2ECFA 3C2QA 1JKFA 1HEUA 2YFKA 4J75A 4RGQA 5DPMA 3COVA 2AA3A 1I1QB 2HWWA 2WSBA 2B25A 4N7BA 1E0AA 1ADGA 1X8KA 3L0YA 3OM0A 2QY6A 1DAEA 1OFUX 1I7DA 3WRYC 5KQRA 3IBYA 1NA5A 3L4JA 1A4IA 5JS7A 5CFOA 2JAHA 2PX0A 5DGXA 1K2WA 2QYTA 2WWFA 3HM2A 3SXUB 3OPYI 5KHAA 3W2HA 5JAOA 3GLIB 1QHXA 3A6PC 4RENA 3OM8A 1IY9A 5H7XA 3RSZA 3QTBA 1R5NA 4LJYA 2YL2A 2Z4RA 3HL4A 2PANA 1RWWA 4XD2A 1ZVVA 1UPAA 1RQGA 2CVQA 4MKHA 4U5XA 1M54A 1P9RA 1BH2A 1XZFA 4W5NA 1GLGA 3FPFA 3I83A 3EC1A 2JLQA 3I4CA 3L7NA 4JLJA 3HY3A 1OWMA 2YV3A 2XD4A 1YZLA 1ODJA 1Q22A 1QYVA 1SVNA 2Z2YA 5D3KA 4EMBA 4R1MA 4CLRA 3OZXA 1GAQA 2O50A 1VCIA 4GWKA 2ORVA 3KAKA 1NMXA 1SC1A 4D98A 3LP8A 5I7HA 4UDXX 2G0NA 2AE2A 4GT1A 4L76A 3ZIUA 3FA2A 5KC8A 3SNHA 3FRHA 2OKGA 3BZBA 4Z0PA 3AVPA 3T5PA 2FZ4A 2CXXA 2ZFUA 1WY7A 1JVSA 1XMXA 1MDFA 4HX9A 4AZTA 1STOA 2B4KA 4G8CA 3P2JA 3BGVA 5CNIA 3U3MA 1PVOA 4GVPA 5EKUA 2PUFA 1J39A 4KLCA 1OX6A 5BWNA 4Q05A 2WF5A 1XFAA 2I6XA 3N2GB 1C9YA 2F4NA 2HCBA 3DCJA 2AVNA 1E4YA 4RH0A 1QH1B 2ZTMA 3EA0A 3HFJA 3EQ6A 1FW8A 3Q41A 1L4HA 3H0CA 4NK5A 4YH1A 3DTVB 2HMYB 3UAXA 3PCRB 5LKRA 3RSOA 5MGBA 4HMPA 1PIWA 3OPYB 4A16A 3PGXA 4Q9KA 2VA8A 1RS0A 2HCTA 1JBEA 2C2KA 4XCXA 3W6PA 1ICIA 4I3HA 4KR3A 4EUHA 1NMQA 4OQXA 2XNCA 1YR2A 4BN4A 3V32A 3PTZA 3H97A 2DQYA 2G07A 1YI0A 3HCCA 1E7QA 3B13B 1SCUA 1JFVA 3PQ2A 4F71A 1M2VA 5EY5B 1FTQA 3DPSA 2CHUA 1X87A 4EH1A 2CHGA 2BT4A 4PRKA 5JD5A 2CK3D 1P7WA 5KX5A 3I9V6 4YVFA 5LC1A 1Y9AA 3SCZA 3RS9A 1FUKA 3QIVA 1QPZA 3A3KA 5MN4A 1ZGZA 3A2MA 2IEZA 3HKEA 1UZAA 2QLFA 4YMIA 2BMWA 2F1JA 1ZCFA 1ZUHA 3EIHA 4O2AB 1N0WA 1PNOA 4KQXA 3JQPA 5FI0B 1X1TA 2IXEA 5HEKA 3VU9A 3KFXA 1SUBA 1EM8B 3G0CA 5JADA 1A9PA 2CYBA 1QVRA 4K9MA 1CB7A 1YI8A 3C4QA 3KJHA 1RHMA 2YNMD 4Z4QA 4RTSA 1ODSA 2BFPA 3L2OB 3N5CA 3ZJVA 1QZ3A 1RAEA 4PVCA 3UB3A 1ODCA 1NW5A 3H5RA 3EPRA 4CR8A 2GYUA 3AUAA 1NI4B 3FTNA 1RW4A 2CMKA 4EKDA 3OU7A 3JQCA 1Z45A 5F3WB 5DNEA 1U1FA 4IH1A 3V1YA 4LN1A 5DLYA 4EYKA 3SYNA 4CTJA 4RTRA 3THWA 4JBXA 5C1DA 4UW9A 1QFSA 1GPUA 2HV9A 1YDMA 1CYEA 1X19A 3EH2A 2OBFA 4G5HA 3O74A 3N9IA 2XMCA 3KQLA 1TUEA 1LZLA 3E5HA 4KNVA 5KYXB 2C9YA 1CEQA 1M7GA 1PUJA 3NS7A 3O0DA 2RH8A 1VXRA 3AWIA 5AOVA 3RNLA 1N6KA 5JSZB 5ALWA 1VBMA 2BWJA 3UXMA 1L7QA 2W6ID 4M9CA 3CURA 2QL7A 4Q7LA 1SKAA 2RJ3A 2VHUA 3H1FA 1NOIA 3OBBA 3R5HA 5ALNA 3S4YA 2HYIC 1QZZA 4PO1A 2WFLA 5HF8A 1JEJA 4ID9A 6PFKA 8ADHA 5EHXA 2JARA 1VLJA 5CB4A 1YRWA 3KKKA 4B17A 1O94C 5B3LA 1T5IA 3OEHD 4O63O 1QHHB 4XPZA 2DBQA 5AR1A 2IYYA 2NUTB 3GCZA 5JUWA 2F67A 2P6MA 4IV0A 2VTEA 1RHJA 3DMHA 1N6OA 1XKXA 1GL7A 2OHXA 2OFWA 1IYZA 4BV9A 4JDUA 1HQDA 3H0EA 4D46A 1XBTA 1OXBB 4OHZA 2R6JA 2F9LA 4K8OA 1MJNA 2A1IA 3DV2A 4L08A 4PGHA 3PF9A 4WCVA 2PHZA 3A4LA 5E4YA 4B2YA 1MH9A 2IIBA 3C14C 2PUBA 1G9XA 4JX9A 4MQLA 3QPBA 1UDRA 2L42A 3IUYA 4PG6A 3D2AA 2DKFA 1WUTA 3NBMA 4MR9A 3VOTA 5K8CA 1KO8A 1JVNA 5HS4A 3KEQA 4GRIA 2A8YA 2AF4C 4HDSA 4GSLA 4GYWA 3TKAA 4B3CA 1UBRS 4G1UC 2IDKA 2Q3JA 4FYIA 4KR2A 1THMA 3CRNA 2PRKA 4G8DA 1FP2A 5ALXA 3D8UA 4DLRA 1JFFB 4Z6KA 1VL0A 1W1WA 4E5UA 5DI3A 1D8AA 4JI1B 4TKVA 1Q2UA 3R23A 4QFMA 4B0OA 4B3MB 4LF8B 3DOHA 4RXUA 2I4OA 3QVLA 2ZJ6A 3KSBC 3W1VA 1FFGA 3GGCA 3H04A 4YUZA 1N8KA 2JGKA 3ZR4B 3FNQA 3RYFA 3NFRA 1XZAA 1E7RA 5AK6A 4B34A 1DFHA 2YR0A 2PD6A 3VPDA 5JAPA 4OV6B 5IAOA 5JZVA 3U1TA 1ZCAA 3GI1A 1W4RA 1GCAA 2XQJA 2WIBA 3W5AA 5LMNB 4UFNA 4RTQA 1Z47A 2PPLA 1HE2A 1X7HA 3AOEA 4PQFA 2XGMA 2WE8A 1Q57A 5DGCA 4DLBA 9LDBA 1MAHA 3EIOA 4PLWA 4F91B 2DPMA 4RA6B 4ZQCB 2E85A 2W8ZA 1N2JA 1NTRA 2WLSA 3CFYA 5KB3A 2D1RA 2WJPA 4XARA 3RKUA 3UM9A 2SCUB 1T29A 3V1NA 1Q6YA 4GIBA 4BYMA 5HIKA 4NZZA 2G4CA 3RC1A 3EIQA 3EEBA 4X0EA 5AM2A 3WGVA 3A1FA 3KXLA 1P4RA 4HHEA 1C1YA 1JIXA 2WMNB 4P6VF 2WICA 4URFA 3R5XA 3AVOA 1LTQA 4Q66C 4I4IA 4EY3A 3VZBA 4BOYA 4ZXPA 4RJTA 1JIIA 1ILEA 2QSUA 3KQNA 1QPGA 1JQDA 3KPJA 5EAIA 5TGDA 1O4VA 2CWWA 2JGNA 5DT2A 2NQ8A 3SKXA 3DKIA 3PA8A 3ZD6A 4CZ2A 1H05A 5KDOA 4IGAA 3W5BA 1YR9A 3JYNA 4HH0A 4MPPA 4NULA 2JC3A 3CF4A 4YMGA 2GHQA 3MJHA 3TK1A 2BPOA 1JSZA 4LDQA 5NULA 4BWVA 3A8TA 3CA8A 4GX5A 4KBYA 1FP6A 5IZ4A 1UJ5A 3IEMA 1I0LA 4PYMA 2OC9A 4Q3EA 4HD8A 1QLWA 2O8FA 4CIXA 3WK9A 4CIWA 3HYNA 1KA9H 2XDQB 3FUCA 3AW9A 3KJFA 4O4IA 2IL1A 4ZHQB 3RJ9A 4C7JA 3A7DA 1LVGA 3UZUA 4EYSA 1VL2A 4GR4A 4TVBA 1BXRB 3ROFA 1CQXA 1GADO 3ZW7A 5KO2A 5IJ9A 1VPVA 1HORA 1M2GA 2GN4A 2EARA 2QUKA 3EF3A 2X6QA 3HABA 1MX9A 4ZC8A 2FF5A 4OMFG 3TRDA 3TQHA 1OX4B 4C0XA 5FL7D 4K87A 5E6SB 1IAQA 3TUIC 2GQ0A 1NXQA 1NT2A 5T57A 1S6YA 3ZV5A 5E9JA 1ETHA 1EA7A 3ND5A 2HXSA 3F98A 2J3MA 3IGFA 3T4PA 2IXFA 1UJMA 3MUNA 2YNMC 4K9DA 3BXFA 4D0SA 4RF5A 4BO2A 1UK9A 4OQQA 1A9YA 1ODLA 1A4XA 4GMXA 3FI9A 4TTRA 2JGJA 1VBKA 4KHPB 3HKCB 3Q7SA 2DU8A 2PUEA 3UFXA 5HZKA 2O2SA 3ENWA 1VKHA 1UP4A 1LDGA 1Y1QA 3NAMA 3SY8A 2XLCA 1BVHA 2R97A 2YASA 1REQB 3BAZA 3N0VA 5EG5A 2JLVA 1FFHA 3TGLA 1D2GA 1N4DA 3MN1A 1OVGA 5CYPA 1NBOA 1XTUA 3RK0A 4N5MA 4DC9A 4IS2A 3PUYA 1BJTA 2OZVA 1GWNA 5F73A 2VDQB 4KPEC 1SUCA 2JFWA 3S2GA 3AH8A 4ODIA 3A27A 4F4JA 2AFHE 3G8YA 4Q01A 4CMCA 5CIWA 1KFCB 4F60A 1PV1A 2NV2B 2XQGA 4B43A 621PA 3BQMB 1ZSYA 2W2TA 4BNXA 3QE0A 2AMLA 2ASVA 4Z1MA 1QF6A 3E9RA 3OX1A 2FMFA 1UPTA 2JAXA 1H4VB 4PGFA 2VDWB 2B78A 2OV2A 1FU4A 2WF7A 2WAMA 3H1PA 4RPGA 3T5BA 3GHYA 2QL5A 2C7PA 1Q50A 3EWAA 5DN6D 3LQQA 5K6AC 1CNMA 2I4LA 4WXHA 3U40A 3VM6A 2EW2A 3SYLA 4HDQB 3WBKA 4AYWA 3LFTA 1VZ2A 1B14A 2DFVA 4MYUA 4OATA 2PQMA 1AKWA 1VBNA 3PGA1 4LHVA 2PJDA 3IVRA 2OHVA 4I5FA 5TB5A 3DB1A 1W85B 2P40A 2IP2A 3DH0A 3LRXA 5CLLA 5K7SA 3OQOA 3C7DB 2H7YA 2E4WA 3H5IA 3IH5A 2OK8A 3MHTA 5K3CA 3F4LA 2W48A 3ZTYA 1HTWA 3LDAA 2NP6A 3NDIA 1N0VC 3QWFA 3SJAA 3C8HA 5DOZA 3IOYA 5E4JA 1JA9A 4EY4A 5T4HA 5T67A 3TW0A 4GDFA 1G9TA 2XTNA 2V55B 3CUVA 4RQTA 4EUKA 1QRRA 2X0KA 1WCYA 5DYYA 4X62B 1TYAE 2FPWA 1E7WA 4QEDA 5LUBA 3BQ9A 1IB0A 5JIBA 2QQ5A 4CQMD 1U3GA 2J46A 4FINA 4IJKA 1A96A 1DXYA 1LF0A 3D3WB 2GZ2A 4M8IA 1HL3A 2JJMA 5DYWA 4AJHA 2ZBFA 2J3KA 4JLUA 3O0TA 4LGYA 3F96A 5JWOA 3HYSA 1ZBQA 4K9PA 3U4CA 3NVKI 1UMCB 4RFVA 4O4LF 1Z8DA 2ADMA 1X13A 3H11A 3TNDA 4MMXB 4ND2A 5IU6A 4E46A 3VKHA 1S89A 1UIMA 4C4XA 2X8LA 3L7OA 5REQA 3TXAA 1BXZA 2XTJA 1V1JA 3H2SA 3LIIA 4EFMA 4YMHA 2GD6A 2UUCB 2WABA 3WK6A 4J4TA 4ZEVA 1X2EA 4ALKA 1LEHA 1DDIA 1JDZA 4TLMB 2O54A 3ME5A 5G1NA 1E2JA 3JPWA 4J9UE 3LDHA 1J00A 3PC6A 4QIHA 2Q2QA 1XMQB 3AG5A 4NEGA 4PXSA 4BO5A 1YIAA 5JTUA 3HEAA 3O8RA 3KTAA 4D25A 4E5VA 3NHBA 1UWLA 3GPLA 4JK3A 1PP4A 5E0KB 4A23A 4D9CA 1RLUA 4D9KA 5HXAA 3D0QA 4HZUA 3U44A 3VDMA 5AYVA 1JVBA 1JEYA 2Q5QA 2Z6UA 3CEPB 1CY2A 4MI6A 1SG9A 1VCHA 1AQYA 2H92A 2FB9A 1XPJA 2ODAA 2WD7B 3SYKA 1C50A 4RF2A 4C5BA 2VJLA 1OROA 1PNQA 4H3HB 4ZFNA 1IOZA 3V48A 2CNWD 2DHRA 1EYZA 1U9CA 1UBEA 4TPKA 3T5TA 3HCNA 4YWJA 5CT6A 2VXYA 3BGDA 2YMQA 3FPSA 2LE0A 3LT2A 3QLTA 3JCZA 2Q1XA 2QP9X 3CIFA 3EXIA 2PFSA 2D1QA 2PNFA 3OIGA 4N12A 3SIRA 1ADJA 1MEEA 1RR6A 3T0FA 2FN8A 4LMAA 2ATCA 5IABA 5JSYA 3JVUA 1Z74A 2HJHA 1QIIA 4ZAFA 2IEBA 1NI5A 4D8TA 2REBA 2IY9A 3V7UA 4TTIA 1K3UB 1FDOA 4CVNA 4K86A 1KDTA 4X1IB 1FNMA 1PS0A 2LXNA 3BMCB 5TLSA 5JTTA 4PQYA 3F3SA 4P34A 3KKLA 4LVOA 1KAHA 2CNLA 2ZB4A 5IMSA 1ULSA 1H4SA 5KWVA 2CLFB 1MQAA 1PJTA 1TVMA 5JXGA 3IULA 3J81A 4EI2A 1XJQA 4PCAA 2HN9A 4KUEA 1M5RA 3JQ6A 5IAKA 1XZQA 2BMJA 3PV0A 4Y2YA 3RSLA 2PZEA 1N5MA 2EJCA 3ZNPA 1R3DA 2YYAA 1PJ3A 2IF0A 2VJKA 1UCFA 5JFGA 1O7JA 5KYYA 2YXNA 3B7GA 2KE5A 1N9KA 1ZD1A 1ESZA 3O47A 4LDAA 4CM4A 3QHPA 1JQBA 4RIHA 3URKA 4ARAA 1ZWKA 4N54A 3DG9A 4EL0A 1MABB 2A94A 2C29D 4Q6BA 1MIOA 2YZKA 3S8YA 1DVRA 2I0FA 2NZ2A 1D2MA 4A3SA 4BQIA 2ZRFA 5JS8A 3VU1A 2W6PA 1R0LA 3IMCA 3HEBA 5F7JA 4KGVA 1O6FA 1PZFA 4M1YA 1YQGA 2ATXA 1PR3A 4OB7A 2FN4A 2XT6A 1KJZA 4XUEA 1KE1A 1P5RA 4C20A 5K99A 1PAUA 4I8XA 1SN7A 4URWR 3WZ2A 3ZYCA 2X9VA 1E1RD 1RWXA 1UFQA 2FRDA 4QU9A 5A7FA 4FM9A 1XKQA 2C4KA 1CE8B 3JQQA 4LTMA 3VUEA 3MCVA 5E6RB 4J76A 1G8KA 1XHEA 3THOA 3U3XA 4BEWA 4PZZA 4PX2A 2Z8ZA 1FFXB 2BZ1A 3KQKA 4KYVA 3F78A 3VSCA 2A5JA 2DAPA 4BPBA 4MDEA 2H4XA 3TSYA 3CKYA 4HNHA 2C9ZA 1A8UA 2WFAA 5DX0A 4LQLA 3EGDB 3LY8A 4Q4LA 2EWVA 5GM1A 4IDFA 1QNLA 4PC7A 1USIA 3QUAA 4EB8A 4II3A 3EMDA 3UYKA 3KPYA 4ICIA 5K8LA 4PPNA 3AVXA 1LSUA 4H7HA 3UV3A 2R1TA 1XD2A 1SBCA 1P4AA 1JLMA 3KXPA 3FYUB 4KO3S 4OHKA 2HBQA 3LY5A 5BY2A 4AIRA 1BU5A 4JI4B 2Z2KA 1JKIA 3DF7A 3NBXX 4G4SO 3U5ZB 1DKLA 5IH3A 1YOBA 2FPPB 4D1YA 5IDXA 3GLHE 3ZJ5A 3KV1A 4FFDA 4MW6A 2C2WA 4YJFA 4JBWA 2C3PA 2HYDA 1I36A 2NU9A 2CMHA 3BN3A 3AM5A 5HF6A 4C0SA 1FZTA 4ZD6A 4HN9A 2PKXA 4ZZIA 4Q9AA 1PTJC 3L6CA 4H0FA 4XCVA 4YRJA 2GPWA 4L73A 1KDVA 1G20B 4PFSA 5EWLA 4EFLA 1VP9A 2X2FA 2WLTA 4X6UA 1A7UA 3CX3A 2R68A 3B2EA 1ZSVA 4XB6B 1EI9A 4FVTA 3AR6A 5HRCA 5J3JA 3FBGA 2WDZA 4FB4A 5GWXA 2H2WA 1X9GA 3NXKA 1COWD 2WI8A 2QDXA 3K73O 4RHTA 3IIKA 1FQJA 3HJHA 1QSGA 4L4UA 4LDPA 3ZI7A 2Z08A 1P2DA 1KVTA 3DKPA 5TE9A 3CX7A 4X00A 4LDNA 2UZ1A 5JDIA 1Q0HA 1ZD2P 4FBLA 5JYDA 1NQXA 3FETA 1RYHA 3V5NA 4CKWB 1WTCA 3VYTB 1NBMD 2WY2D 3OUZA 4P7GA 3SP1A 1E4OA 3VVLA 4NIMA 1TECE 2I9PA 4OUDB 4P3KA 2MTBA 2P9YA 3ELYA 1E2QA 2FETA 3ANYB 3M5DA 3N2KB 5EPEA 3TB4A 4A0GA 2NZYA 1XL0A 3SDSA 1UJ4A 1ELOA 3FKQA 4PGGA 2YV1A 2ODPA 4LJ6A 1T6ZA 3V4VB 1SRRA 5J1TB 5CG1A 1WUHS 2BISA 3IP7A 4FSXA 2CXPA 3UKDA 1D0SA 3ZK7A 2XMBA 3O82A 5BN5A 1OMOA 1YUBA 3FTCA 2I8CA 1FRVA 2IODA 2YVKA 4N76A 4KQFA 4YROA 2BMEA 3DHVA 3M4NA 1NSYA 3OZAA 10MHA 1ZKDA 1CY8A 3CUYA 5BWCA 4XB2A 3RAPR 5LUAA 2GKSA 4KCGA 4EKIA 1M0WA 3AJRA 3QEBZ 2J3QA 2WHEA 2QVLA 4ZU1X 4QTYA 5JV5A 2VATA 3UPTA 1YDHA 4N0EA 4TS4A 5JO9A 4WKCA 5BV2P 1PJAA 2ZJYA 2ZRIA 3OFVA 3U17A 2LBPA 4JI2B 4KRGA 2R7NA 1RYZA 4O0MA 2O5VA 1J90A 4B33A 1F5NA 4EPWA 3CH5A 4MYTA 2Q6IA 3C5CA 3AEUA 2Q1YA 5TS2A 3SC3A 3UUGA 3W34A 5ALGA 4Q3BA 1ONBA 1Y37A 3NHZA 3T7KA 3WK4A 1H6BA 1XNGA 2AQIA 3U1VA 1V39A 1KAEA 3PCXA 3UWKA 5C7LO 2H2HA 4HWOA 1HKHA 5FEUA 5KCZA 4DV1B 3LQ1A 3C3KA 3WRWA 1NN5A 4Z54A 4ZDWA 2PXXA 3KYDB 4HZIA 1PDWA 3W8NA 3KCNA 2OGTA 2QN9A 3DNFA 4NF2A 2DB3A 3Q85A 1P6XA 4FMBB 4MK4A 1SXPA 2HRBA 1HEIA 5CU7A 3UTCA 1IZZA 1CR1A 2OGUA 1JBKA 2FX2A 2ZDQA 4ARSA 2D1TA 2OPBA 3W1EA 2CXHA 4YRAA 2YY5A 3UK1A 1N36B 5ALMA 5C1BA 3L43A 3L9WA 2EKLA 3KWMA 4ND6A 1OV4A 1GYQA 1NPYA 5ELMA 3V1UA 3BRWD 1ZHFA 1T15A 1G3MA 3C74A 3G2KA 4GF5A 4IOJA 5ED0A 4YP7A 5HFNA 1FZQA 3JAWA 4ZYVA 1OIVA 4NJEB 1ZVKA 3ZWPA 4D3XA 2C4WA 5AVSA 4BNVA 1C3EA 2C2MA 3R4VA 1EG2A 5TQ0A 1XU7A 3GJ8A 3WTCA 2IBTA 1LD3A 4G1CA 2YBEA 1HK7A 1Z25A 4JAVC 1WB4A 4E7OA 2DOKA 1ZIPA 5E38A 2C7GA 2P9EA 1U2PA 1IBMB 3VNSA 2ZT8A 1ZI6A 4RIIA 4L9AA 1JT9A 1T9GR 1KERA 5AHRA 1HURA 2YIJA 2ECPA 1A76A 1WJGA 1YJBA 1EK0A 3E22B 4N9WA 2E18A 4EPRA 1QQAA 1GYPA 1QZTA 4AP9A 2FPSA 5HMLA 3RTAA 5B6IA 4BBAA 5LU9A 2UXBB 1XZGA 4YLYA 1Z18A 4LJ5A 2Y8EA 2XJ9A 5AHKA 3ZZMA 1LV7A 3VAZA 4P7JA 2B6NA 4UC0A 2CHVA 1Z0ZA 2QD5A 1NRJB 4IHJF 4IJ5A 1ZW6A 3QF4B 2I71A 2UYQA 5B4TA 5B57C 2UUOA 3Q7IA 1XD9A 3CX6A 1TIKA 1QWSA 4ESOA 1VJRA 1T5HX 1NVFA 3HDGA 4ZQIA 4IG9A 4GL2A 4CF3A 2QTBA 4QHSA 5MFPA 1WLSA 5AVJA 3K7EA 2I87A 4CCWA 2PUAA 1CUSA 4CI0B 1MD9A 4RK4A 1NW8A 2V54A 2O6LA 2X8JB 4G1BA 4RZHA 2OG2A 4BO9A 1ISFA 3S44A 4Q93A 3W4JA 1BGXT 1N9ZA 3OEYA 3QUQA 3T61A 2P9HA 4FFVA 4B9AA 3PXEA 3T7RA 2I4TA 4LE0A 4L27A 1V2GA 2EZTA 4W7HA 1VJ1A 2NO7A 3L1VA 3WIVA 1V8DA 4AIIA 4CEIB 2AGVA 4OL9A 4L9SA 2Z04A 5B2EA 1P9NA 3R8FA 1VE7A 5AI5A 3IKTA 1DV2A 2BW0A 3LBIA 4DSNA 1ZUD1 3H86A 5E7IA 2Q1SA 4M1EA 4WT7A 2PG3A 3ESYA 4YGXB 1JEQA 2C57A 1CUGA 1DMSA 1YRAA 1F3OA 2RGAA 2VK8A 3IUPA 4MQFB 3T3DA 4G4IA 4RZXA 4HQFA 1ZZGA 3HCOA 3KETA 1Z39A 1XDSA 3BK1A 3HJGA 1A97A 3COZA 3GUHA 4B6JA 2PX4A 4YCBA 2EEPA 1K08A 3B20A 1UBLS 2WIAA 2NVOA 3L5OA 1K5DA 1ABBA 5ICMA 5KS2A 4DJEC 2MYUA 3OZ7A 2Q5HA 2RB4A 3HB7A 3RANA 5K3FB 3ZWKA 4WDRA 2BTQA 3C16C 3C3DA 1X7ZA 4M7WA 4QOHA 5JE8A 2PZFA 5JNUA 1NP3A 3GY0A 3HCBA 3R6WA 2I33A 4HDRB 1SOUA 1XZNA 1ODTC 2H2IA 4NCXA 4QUHA 4Z0NA 3WL5A 2QNBA 3RSQA 4LI0A 4ZN6A 2BEVA 1U2GA 2C1EA 1O6BA 3L1IA 4R9UC 3F6PA 2XNKA 4QRHA 4MYSA 1U2EA 3V33A 3TFQA 2VP0A 4MVWA 3LO5A 2AFIB 4RH1A 4A6PA 3HVKA 4F8YA 2EGGA 3CM0A 2C98A 3LSTA 8ABPA 1PTKA 2Q2OA 4A10A 3VNQA 4OTZA 1KGDA 4WY2A 2FMTA 1KR5A 3ECCA 4FP9A 4D8XA 4R05A 2QMOA 1CUHA 5GONA 2X5NA 1EXNA 3E35A 2F1KA 3AQ4A 3M6MD 2CHEA 2IS2A 4MV9A 3A1CA 4B3RB 2ZT7A 4PR0A 4CF5A 4IZIA 1KZ4A 3R2JA 1SHZA 3IO5A 4FYMA 4KFUA 3E2PA 1UANA 1YONA 3EW9A 4PCVA 4ZJPA 2XADA 1G41A 1OJLA 1LW6E 2PDAA 3B53X 4ZV9A 2D5CA 4LJ9A 4C88A 1KY2A 2HMUA 5A0TA 4M9SA 1EZZA 1YZGA 1AGNA 1M8PA 1MMFB 2H63A 4L50A 4M89A 5B2ZA 4BX8A 2PNJA 1OFVA 3DZHA 2HF9A 2A67A 1Z75A 6ABPA 1IY2A 4OKIA 3V55A 4W6ZA 4Y9SA 2XWJI 1Y63A 2VDMB 1T4GA 5BYBA 1UC4B 3V2IA 5LD2B 1M83A 2ZTUA 2WJHA 4FHCA 1JWBB 2YWJA 3DEZA 1UT5A 4L4YA 3L8FA 1G8PA 2KM1A 5TMBA 3BXXA 4XXHA 2CXUA 1QE3A 1UADA 3QWAA 2VYNA 2Q4RA 4BQFA 1CZLA 3KZOA 2LIVA 4KXXA 5KINB 2TS1A 4S2EA 2QTRA 4IPTA 1NNEA 4PXYA 1CW2B 3MZ0A 3W8EA 4DLWA 1S02A 1JHYA 4IH9A 3RRNA 1NJGA 1Z4LA 3S2UA 4H7DA 1T9CA 2W83A 1V1MA 1Z36A 4OAPA 1K2VN 2R8BA 4KHZA 2C8LA 4XGNA 4LNUA 2AOTB 5C18A 4A8JC 4ZGWA 4C04A 2EOAA 2E1RA 3OCCA 2Q2WA 4FT2A 4ZIRB 5JD3A 4E5KA 3FBWA 1G3RA 4L22A 1I4DD 1LJ8A 1L7NA 4Y9TA 3RS8A 4Z53A 1M6EX 1YMQA 3O95A 2P0EA 1ZWLA 2C5HA 4R9RA 1QE0A 2K7ZA 3THYA 2BP7A 2ZVDA 5B1IA 2AMFA 2J0EA 4WN9A 4G37A 4ENRA 4AMZA 1Y3HA 1JNYA 1ONSA 1X1BA 1TE2A 3GJ5A 2BHLA 3ENNA 2WKQA 2Y3IA 3RYCA 3A1WA 4UASA 4LYAA 4L5YA 2WU8A 1CUDA 3NBUA 2CFCA 5C3UA 4DRYA 3JAMA 1NFRA 3G49A 2GAOA 3CXUA 2Q3BA 2GUGA 5A9SA 2FSIA 5ARCA 3TDNA 4UHEA 4GZLA 4CHGA 2VCYA 2Q0XA 4PRLA 1FQOA 4IX9A 4MKZA 4RPLA 5IJWA 3Q9SA 1IOWA 5AVVA 5EA2A 5EC8A 3TBKA 2JKVA 2OAEA 3RS5A 2RHLA 3H5OA 4FGWA 2PGLA 1G17A 1NQUA 2WOJA 5AW7A 3DWFA 3T7CA 4BP3A 4CM6A 5FBVB 2O8CB 4CV0A 3O8QA 2BBOA 1TA9A 5DM70 4FMDB 4ENWA 4FB5A 3AK4A 2Q41A 5JNLA 4MVJA 2F43A 3CLKA 5B2FA 1Y1PA 1M2HA 2AVDA 3BE8A 2CXNA 4MEJA 4RVSA 4YJGA 3E3LA 2VH2A 1OKKA 3K31A 3JQAA 3QLEA 4X94A 5FH9A 3E0QA 3ST7A 1PR9A 2Y9PB 5B7GA 1T91A 1DBSA 3GRYA 4PR3A 1ZIOA 1YCHA 3AEKB 2DWUA 4JWKA 1VE9A 5D5QA 1JXAA 1GPAA 5EHZA 5TPWB 5KZMB 1QIJA 3U4QA 1D7OA 2XGJA 3VGPA 3IVXA 1MGPA 5FHRA 1E9AA 1U0SY 2DVMA 2M98A 3ZE2B 3UKOA 1F06A 1P6UA 1W8DA 3A9VA 4QWWA 4ZKEA 1NYRA 1S3SA 1Y33E 3FKSD 1DOZA 1UWVA 4G25A 3RK4A 2WHQA 5KQSA 1YDGA 5LP6A 3MPOA 2Z4SA 1D4ZA 2I5PO 2CJFA 2OXRA 4J1QA 5AKYA 3CLUD 1ZXBA 2FG6C 4OI4A 3ZI4A 4BCCA 1M2FA 1ZEJA 3FTPA 1PW5A 1WO8A 3TD2A 2JCYA 5G4LA 1ND6A 5FDFA 1KARA 1CUWA 1FK8A 4JP2A 4NPHA 4UUMA 3HLKA 5CXSA 4AZ3A 1F12A 2ZSBA 1RP1A 1KNXA 3A0UA 4YB8A 2QN2A 3TL2A 4PN3A 3U60B 1DAPA 4IIJA 4KWCA 3FI0A 1BJRE 3U13A 5LZ9A 1J8FA 4GOOD 4ZDJA 3K5WA 1BFKA 3OF3A 4INPA 1V4NA 4JLOA 4PTZA 4YHBA 3R9XB 3V4ZA 4PZUA 5G1PA 1AF4A 3AM3A 4GP6A 3WIBA 3FY4A 4MWOA 3DE2X 3M3DA 5KAPA 4GECA 3TB6A 3TGWA 3UFBA 1JG3A 3I2YX 5JCPA 1EFAA 3Q0EA 2WYUA 1V6SA 1B6SA 3AUTA 2X0DA 5IDQA 1X9IA 2ZETA 3GLIE 4MYDA 2C1ZA 2WVJA 4IXWA 1RKXA 2A9PA 2FRXA 1ZXXA 2X14A 3ZNOA 2ZR8A 4OBWA 2QTLA 2Z6VA 3AU8A 3EMVA 3IAAA 3G5UA 1O97D 3HCAA 1M1YA 3MINA 4RMGA 4U3JB 2VQFB 3D31A 2VJBA 3OKCA 3LVQE 1F4PA 1QG2A 1W4BA 3LPAA 1YE3A 2ICAA 1MB0A 4UHFA 4YJ2F 3S2FA 1CY7A 2RAUA 3RV4A 4UTVA 2BM8A 3KQVA 5JVDF 2G70A 2HBZA 3BFPA 3AVQA 2GJ8A 2NXEA 4IIBA 4RHCA 2HOQA 1V8ZA 5AESA 4QDZA 1E58A 2C54A 2RHGB 4PS0A 3EZXA 4PXAA 2Q5LA 1K66A 1UDBA 2QRMA 3TLYA 4LV5B 2WWWA 3UT6A 3P8ZA 3ESRA 3KTOA 2K2QB 2QRUA 5LQMA 2BC9A 4U2BA 2BI7A 4TS9A 1YWGO 3K4HA 4TT8A 2PS9A 2XGSA 4H2DA 1XMPA 2ZPAA 4F7WA 2OGWA 3OY7A 4E12A 1YCGA 1Q77A 2OHGA 5BYKA 1P60A 1QVVA 1N2IA 1SD1A 2PXAA 2VH5R 5GPBA 4O3MA 1HE8B 3L93A 2O07A 3RU2A 1WV0A 5CD1A 4AJPA 4E08A 3LUDA 1M6NA 1R9JA 4AYXA 1EWQA 4W5HA 4GXRA 4S1NA 2HGSA 2QAIA 3ICOA 3BORA 4IHAA 2R0QC 2X1VA 3DTNA 3Q5DA 5IVIA 4Q9NA 5FLYA 3FFTA 4DSAA 4PPQA 1N3BA 4S1WA 3CLRD 3V6LA 2AYZA 3GZTB 2IZZA 2JB9A 3REQA 4MVCA 2CXTA 3PVSA 2YOHA 1X92A 2ZG6A 4DQUA 2QMUA 2W7TA 4TWZA 2FEAA 3T54A 1PEAA 3NMUF 2FSVA 3U31A 1P1RA 1MEJA 2QWXA 1AC5A 1Y4DE 2VS1A 3A25A 4GQIA 4JVMA 4Q00A 1GPNA 3ZY6A 1ULUA 5F78A 1HDEA 5B58T 3OP1A 3I5UA 4BZXA 5IAAA 3ICQB 1XPOA 2ZIXB 1IZ0A 1AB5A 2GEUA 3C1TA 3DL7A 2V6MA 4Q7QA 1J42A 4NNOA 4DV5B 5AXBA 4I66A 2BFDB 3ANSA 1CZNA 4LTDA 4X5OA 5LKAA 3MERA 4WADA 5B3JA 4EKYA 1MH1A 1MNAA 3G02A 4MINA 5AWFC 4LYDA 3WC4A 5L9AA 2OENG 3UJ6A 1O95C 4B4WA 4DL9A 4EA8A 2JA1A 2B1QA 3WQRA 3FUVA 2RKWA 5JFOA 1WB5A 4ND1A 5EUBA 4DLLA 5KOYA 1L1QA 1QZXA 3LZ6A 3FZNA 1FYWA 3ESQA 2ZGVA 1JQLB 1SU6A 3KFLA 1G5FA 4R2LA 4M54A 5ALDA 2I7VA 4KMSA 5KVAA 3DZCA 2JKZA 4H7FA 3GT4A 2WWRA 4ISCA 3BA1A 1D1PA 2QR2A 1J07A 1V11B 5HHTA 3WNQA 3WLIA 2AJCA 1Z5UA 2SNIE 4PG5A 1ZNQO 4FD3A 2R85A 2QRVB 1XVUA 1M2OA 4F3RA 1E0JA 3FDZB 3LQRA 3HC7A 1NGSA 1ECBA 3FVVA 5A03A 5DH9A 1VG9B 2QT1A 3ROQA 2GM5A 1MRZA 1QJCA 1VJTA 1OLOA 5ALKA 1X86B 3ORQA 1SQ0A 2FEMA 4QNMA 2ZSEA 3EDQA 2C3MA 1S8NA 5FIUA 3WKAA 5CCBA 4CMJA 1W0JD 4KWTA 4YJHB 2ONKA 2JCBA 2H2GA 4BIMA 1KI6A 1IZ8A 5G0SA 3C6ZA 3ZXXA 4AK9A 2Q3HA 3TPZA 3UJHA 1CVIA 2L82A 5LYJF 3FWKA 4XQ9A 5KKNB 4GZ6A 3PC2A 2C2YA 5ICEA 3LH5A 1Y7IA 221PA 4I1UA 4HAXA 4IKEA 1KYWA 2P8JA 3GIDA 4GX1A 4A26A 3TTYA 3NIWA 4A0SA 4FLFA 5JAIA 3C7KA 2ZCVA 2JFUA 4D92A 2II6A 3ZNQA 4OK3A 3ADCA 1N77A 2C4MA 1UBGA 3VKFA 2IGTA 4RELA 1Q1BA 3N2EA 4E5MA 3G7NA 2ST1A 1DDGA 2BGMA 4LZNA 3TPFA 4BLUA 3RQSA 3OUUA 1PBTA 1WETA 2HLHA 3BH0A 3ONDA 4I14A 4JZYA 3E9EA 2DQSA 1E77A 2M6SA 3O3CA 3B82A 4NATA 5EIBD 4ALIA 2HA3A 4D4JA 1P6QA 3GP5A 2X6RA 5DKFA 3GUUA 4TKMA 3T7SA 2ZRLA 3P4YA 3RAFC 2PWYA 3FLAA 3WNDA 5BNFA 4LRYA 4OB6A 2RGXA 2GN1A 1PLKA 3E82A 4ZVTA 1U2RA 5IDVA 2A58A 3PNLA 4NENB 3VPAA 3ZHTA 3PS9A 2IYZA 5K3EA 1YOVA 2XB4A 4NCHA 1OPRA 5LQUA 1DIOB 4UXIA 3TAXA 2RGCA 1JDJA 3LQYA 3ORSA 1WRBA 3P9CA 2I3DA 2MR5A 3X1WA 4A0RA 1OT5A 5IZCC 2O14A 2XRZA 2JDID 4N48A 1IG3A 3GFBA 5IJZA 2J9RA 1Z62A 3PC7A 3HKEB 4X64B 4J1TC 4DM7A 4GUDA 3I01A 5IWAB 3WDSA 2HJGA 4BVHA 1O97C 3SSMA 4ARZB 4EF5A 3FCOA 1RXYA 3QKSA 5BW4A 5AW3A 3VU9B 1Y3AA 1JDNA 5TDHA 1GQQA 4QGBA 5B1SA 1FVOA 1KQOA 2IZ1A 2WIGA 5DM2A 3EA4A 3VKUA 3VZSA 4G0MA 1BGVA 3CUWA 3QE2A 4CM9A 4I5DA 3MLAA 4UM9B 4M88A 4ER0A 4Y98A 4JI3B 3ZWCA 3A6FA 1J2UA 4E2ZA 2FFQA 3T9EA 1J5EB 3X1ZA 2CJXA 4W99A 5KUTA 2A84A 3LE8A 2PX2A 1PJCA 3AB8A 2R5NA 4EY7A 1ZOOA 1K06A 2J48A 5FQOA 4DV0B 3PD0A 1R37A 1AO0A 4B6RA 4DQDA 1BE8A 3ROPA 1ZL0A 4YBRA 2OCPA 1T8UA 4AECA 1G38A 3ZBUA 1FE8A 1TCBA 4IMPA 1DARA 5ICCA 3IE0A 3BT7A 1YNOA 1YZVA 2ZTVA 4POOA 3DZFA 3E1KA 1L5MA 1L4GA 4KGZA 4RXTA 2IZ5A 4N7JA 4HF7A 1DC6A 4JB8A 5DTQA 4CF6A 1EP9A 4ENQA 3AB7A 1WW3A 2ORED 4HRYA 3KAJA 3EMBA 3V00A 4Y2TA 5ARDA 1X39A 2Q5FA 1SVWA 2GERA 2H4YA 2H8GA 3LHFA 3LC1O 3DAOA 1UFVA 4P9NA 2DHEA 4DLYA 1JR3A 1CS0A 1WXWA 2IY7A 1QO7A 2W2OA 3F8TA 5LBTA 4QOSA 3SG0A 3U3DA 1MOPA 4XGKA 4DLZA 1BKYA 3FJ1A 1M7BA 3BWDD 4UHBA 5H9VA 4ZVSA 3T41A 1TF5A 2B9EA 3CEHA 1MQ8B 1M6VA 4XDZA 4ZO4A 3OCYA 4UTOA 4PWYA 3TLGA 1WD5A 2VT3A