3IIJA

The structure of hcinap-adp complex at 1.76 angstroms resolution.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
175
structure length
175
Chain Sequence
PEFMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coilin-interacting nuclear ATPase protein
publication title hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, transferase
total genus 67
structure length 175
sequence length 175
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iijA00
2N1BA 1CR0A 3LW7A 4DLWA 3RRYA 2W58A 2WICA 4LHYA 3UWKA 3FMFA 4KSCA 1KK3A 1OXVA 5FL7A 4A4DA 1V5WA 1QZXA 1UADA 2QUZA 2D62A 1MO6A 2MSEB 2OBMA 1P2VA 2HCJB 3V00A 3OIVA 5KPJA 5J4LA 1Y3AA 1NP6A 2QP4A 3HU1A 1A1VA 1E94E 3GQBA 2XXAA 4UXJA 1R7RA 4G0NA 3PEYA 2P3SA 3OFND 1CU1A 3R7WB 1KDPA 4M9SA 2AR7A 4HDCA 3GJ8A 2Q9CA 1HUQA 1NVXQ 3WRYC 3TR0A 1GITA 3AF1A 4V0MA 2FGJA 1AN0A 1GL6A 4MYCA 4GDFA 3KKNA 5DN6D 4HATA 1EWRA 4R98A 5FL3A 4CVNA 3V9PA 2DBYA 2ODEA 2F9MA 2VO1A 4GPTA 1E9RA 3CW2A 2PH1A 1UKEA 1N6OA 2OILA 5AR1A 3AVPA 2JJ2D 4JZKA 3R20A 3LX8A 2FFHA 4WXRA 4CEIB 3U3KA 4RJLA 3BH0A 3B60A 4NTZA 3WHLA 2OG2A 3AGQA 4Q1FA 1TU3A 2B21A 3UPUA 2YWGA 2AKYA 5TB5A 5LD2B 2IWRA 4MKFA 4P4TA 4LPKA 3KJGA 2ZSDA 4QC2A 2ZS8A 4GOKA 1P2TA 1OH5A 2O8FA 3WMFA 4M1TA 1GSIA 4PC3A 3DVLA 3QKSA 4TT3D 5JZVA 2BIFA 3C41J 2GCNA 3KJEA 2WJYA 3BOSA 3QG5A 1DAEA 1U0HC 4D26A 3EIQA 1E2LA 5G53C 3U44A 3GJ6A 2OBNA 2I1VB 3B1VA 3MMPA 3DZ8A 5DHAA 2QSYA 1BKDR 2EW1A 3CIOA 3ZZTA 3AVVA 2RH5A 1ZUIA 4EIWA 2V1UA 1OXTA 1OIXA 4M9XA 2JAQA 3W5JA 5JECA 1AJEA 5GADl 3SBEA 4LHWA 1U8YA 3WXMA 2XNDD 4V0OA 3NBYC 1XZQA 2PT7A 2EFGA 1JR3E 5HE9A 3BJIC 3MSXA 3HWSA 1Q21A 4OHWA 3B13B 4Q4AA 2VYFA 1D2NA 4KXFB 4UNPA 1KSFX 5HE8A 1IM2A 3ICQB 1K8RA 2CJWA 1XWIA 1IHUA 5FUXA 3RHFA 4BLRA 3SDZA 5H8WA 4DHEA 1NMYA 1SVOA 4Q21A 1W4BA 5CIQA 1F2UA 1DELA 2VLIA 4M21A 4OJQA 1IN7A 2XZOA 4LV5B 1XMJA 1OKKD 2CL6X 3BFVA 2ZYUX 3DMDA 5AJVB 3WP1B 1HA3A 3B5JA 4A6XA 4TL8A 4B6FA 4ZPXA 3MWKA 1JQLB 1EXMA 1Z0FA 4B3DA 2JGNA 5HZKA 2IYVA 3Q3JB 4QM7A 5C18A 4XVUA 3MG9A 5TV2A 1X86B 3WP0A 2IL1A 5DLQC 2QZ4A 5FTKA 3ZS9A 5SZIA 4TYQA 2W00A 4LHVA 4PPQA 1E3MA 3I8XA 4URVR 1XTIA 2QL6A 1GNPA 4ESVA 1TUEA 2BV3A 3AKCA 1QVRA 5DIFA 2C95A 4I1UA 1U8AA 4NYMR 5HTKA 4QGGA 5AUOB 2ZRCA 2DFKB 3U6KA 4FMCB 2ZXUA 2CK3D 221PA 3GMTA 3ZDQA 1ZC4A 3QSYA 3HYRA 3AVTA 2ZJ2A 1IQPA 5UKDA 4PZLA 2QGNA 5D3MA 2QQ0A 1VCIA 1FP6A 3ADBA 2JLSA 2WHXA 3RRNA 2O8DB 4TL7A 2NOAA 2R2AA 3MJHA 3SR0A 1DAHA 4P4UA 1FQKA 1G8HA 4PZZA 2ZRJA 1F2TB 3QEOA 1E9AA 3EZ2A 3OESA 2BBTA 4UNNA 1NG1A 1TADA 4BFWA 1QHSA 4IOMA 3BE4A 2ECKA 3FMIA 1KK2A 2AXNA 2P67A 3SHFA 1G41A 1VYVA 4C7OA 2ZRPA 4LK2A 1G3QA 4A0GA 4KLZA 4C0QC 4KBFA 2QU8A 4O25A 2IYWA 5L3RA 1LVGA 5KPDA 3B2EA 5DE3A 4BFVA 1X1RA 5AUPB 4PSAA 1XD8A 3NDBB 2J9RA 2FA9A 5DI3A 5C4GB 1ZM4A 1RVDA 5F2EA 1S8FA 2OAP1 2X77A 1I4LD 1OSNA 3F8TA 1XMVA 2YWHA 4N3NA 3U2QA 1MR3F 3VHXA 521PA 2G0NA 2GKSA 1E99A 4FINA 3SYNA 2XXAB 4ILEA 2K5UA 1A7JA 1DTSA 1EFTA 2H16A 4IDQA 5GJCA 4Q1DA 1S4QA 1JJ7A 2E87A 3L0IB 1XBTA 1AKEA 1VCOA 4AKEA 2GK7A 3N2EA 2JLXA 2HCBA 2G6BA 1ZP6A 1KDTA 1JR3D 2FH5B 2Z43A 1UFQA 5AUNB 4LX0A 3BH7A 4Q00A 4RD2A 3EZ9A 2WAXA 1M34E 2ONJA 3MRSA 1I4DD 1U99A 2WJJA 4Q66C 4BZPA 2O0JA 3B1WA 3UIEA 4B33A 1GL7A 1I4TD 4LCBA 2WWHA 5CDFA 3WYAA 4BEBA 2ERYA 4Z54A 4RKFA 3P27A 2ONKA 4L4UA 4R9UC 4F7WA 4XD7D 2G1JA 3QPUA 4Y0VA 3K0FA 3SYLA 4NONA 5F3WB 2JJ1A 4QBGB 4ZI2A 1VHLA 3OIUA 4A15A 4HAUA 2BBSA 1XTSA 1G5RA 3IIJA 1E2FA 1J8MF 4OHVA 4JLMA 2CBZA 3A1UA 2OFWA 2AFIE 2O8FB 3TW8B 3KZ1E 1G8PA 1BOFA 2R62A 1KI4A 3BIFA 2WWIA 1NMXA 1XMSA 3KKMA 4HSEA 4B3FX 1T4GA 5CM9C 4BZQA 2DYKA 4TTPA 5FR2A 1R0ZA 2ZUBA 1W36B 3A6PC 1NL3A 3RLFA 3U44B 4H1VA 1P9WA 2SHKA 3CONA 5DGXA 3OE7A 4ZV4A 3AVOA 2OCPA 3H1TA 2J59A 2HYDA 3QENA 4DJTA 4IDNA 4JJKA 1N25A 1LF5A 1N0WA 1IJFA 2BMDA 1RRPA 5FUVA 3TRFA 4ASUA 4IFBA 4X8LA 3KQUA 1RYFA 2RGCA 3H86A 3B1YA 3W3ZB 3K70C 3MWJA 4Q4AB 1W44A 4LJ5A 4FCTA 3NEYA 3NEJA 4W5HA 2RGGA 5EXXA 1X8JA 4URYR 4GNKA 2CJWB 3RABA 5CB6A 3CZPA 1QG4A 2F43A 2FSGA 1R5OA 3EZ6A 5A0FA 4MGYR 1T3LA 1F2UB 2FG5A 1PLJA 5KNCA 5L8VA 2IS1A 1KI2A 4D0GA 2HJVA 1KJWA 2UVQA 5JS7A 1XEXA 4OQFA 5F9HA 3R9IA 1RJ9A 4RD3A 4GFDA 1G291 1LFDB 1Q0UA 1VG9B 2EWVA 3D31A 421PA 2FU5C 1UKZA 3LVRE 1BYIA 2CLCX 4LHXA 2C96A 2O52A 3TSOA 4JBYA 3UANA 3PUZA 1ZIPA 1RC8A 2ZI9A 1VCNA 3TVTA 4EFNA 2HLDA 1A5TA 2IYZA 3VFDA 3DZDA 1NVWQ 4MKHA 2FOLA 2OCBA 3QEJA 1R2QA 1M7BA 4XVQA 3EG5A 2OZEA 2QI9C 3H2YA 2Z4SA 1Z6XA 1F60A 3SJZA 1XJCA 1XJQA 2JIZD 2IXFA 2YC4C 2BVNA 2B8WA 2ZYTX 1L4UA 2GJ9A 2GJAA 2EYQA 1LS6A 3TVDA 3RDPA 1OHHA 3VNVA 2ZTSA 2YJTD 5D3MB 1ZNXA 2PJZA 3QIAA 4BFYA 4KFSA 1H65A 5H68A 3RVBA 1G17A 1L8QA 1EFCA 2P5SA 1IONA 2N42A 2VHJA 4D0NA 4O2RA 4P33A 1Z5ZA 3C7KA 4M0LA 2BEKA 3WYFA 1PLLA 4LJ4A 2G83A 4A36A 4NYIR 1KGDA 5JI3E 3LQQA 4C7OB 1DOAA 5HZHA 1P6XA 5G41A 3WHKA 3T1TA 4KFTA 3T1VA 1W5SA 2WSSD 2GAAA 2ZJ8A 4ZDJA 2W6JD 3QXSA 2ZUDA 1L2TA 5L3QA 3M6AA 4ESHA 5C4MA 2H7VA 2LCFA 5DI3B 2YC2C 1M7GA 3LBIA 2IS6A 4R2IA 4FIDA 4I1VA 1FOEB 4M53A 2ZE5A 2FX3A 1EX6A 3PEVA 3PXGA 4U7DA 2QAGC 1DAMA 1CJVC 2I4IA 3AF2A 5FPSA 2HT6A 3KUDA 1E0KA 1VYTA 3VR1A 1VECA 5EQTA 3AM1A 4C0LA 4HLCA 2OXRA 3CNNA 3H0KA 4TYNA 2BMFA 4WIAA 2GK6A 1AQUA 1W47A 3THOA 2CCJA 4RCYA 2XOKD 5IT5A 2EFHB 4M22A 1XCGB 5F9FA 3PUXA 2XGJA 4TTQA 1U81A 1XTQA 4B34A 4D0LB 3GLGA 2G9NA 1CJKC 1N6NA 2JJ2A 2IXEA 2PJRA 4NMMA 1NBMA 1EFUA 2WIAA 2ZS9A 1CR2A 1CLUA 3EW9A 3LLMA 1G8YA 3A4LA 4DLYA 4UKDA 1KK1A 5EXTA 1G8FA 3K0FB 2GXUA 4NCJA 1RKBA 4B75A 3DDCA 1QF9A 5JCPA 2CE2X 3BB1A 3IO5A 3B78A 5AJXA 2R65A 4Q4JB 1XTRA 3RWOA 2ZROA 4POAA 3THXA 4UXIA 3I73A 5B64A 5IDVA 4HLDA 4FMCF 3SEAA 1SVWA 4BQSA 2XTMA 2F6RA 3QE0A 2VHUA 3NBXX 3W8NA 3ICEA 3RNLA 1X3SA 4AY2A 2GILA 2VP5A 1FMJA 5JSZA 3PUVA 4KAXA 3LO5A 3J81k 5FI1B 2WMOB 4KVAA 4HB3A 3U61B 1CR4A 1N6HA 1GG2A 1FUUA 2XNDA 3OF5A 4MGKR 1OT3A 2WWGA 5IHPA 3A1TA 2JCSA 1EFRD 5JWOA 1P73A 1TTTA 3DO6A 3QPVA 1UAAA 1W4CA 4DCNA 3QY0A 3IQXA 5EP1A 4C2TA 2GCOA 3BS4A 1W4AA 1YR6A 4LZZA 2CLSA 3ZJYA 1TEXA 2F43B 1Q20A 3CF6R 3FE2A 1ZM7A 2BMEA 1HV8A 3E1SA 2DB3A 5FOWA 3VNUA 1TNDA 2QQEA 2BMJA 1E2DA 2YYZA 4NYIQ 1O87A 3NDPA 4XWKA 3GLHA 4RD0A 4TL6A 1BMFD 1LF0A 2QG6A 1OKKA 1ZINA 2QP9X 2ZJOA 3ASYA 1XEXB 4Z8XA 1RJ9B 2BCJQ 4WVFA 1YR7A 3NXSA 1QG2A 1SHZA 4Q9JA 1CULC 2QTVB 2JLWA 1NSFA 4CT4B 1R10A 2VA8A 4JJZA 2CE7A 3AB3A 2FFBA 1GRQA 2DWQA 4G5OA 4FMBB 4X8HA 2HXYA 2MMGA 5GVSA 2AHOA 2G0TA 5DYGA 3CPJB 2QPOA 1Q3HA 4M8NE 3D3QA 4KSBA 3V4RA 3UMRA 8OHMA 1SXJD 5KO2A 4ARZB 3GLIA 1U0LA 4KHZA 2PZGA 3CRW1 1Q3TA 2VTKA 2ZI5A 5B2ZA 4BFXA 3DHWC 1KDOA 3HPQA 2UZ3A 1SKQA 3THYA 1GUAA 2ATXA 4W5JA 3ZQJA 1C9KA 3RRZA 4HUTA 1XXHE 4DDTA 1D2MA 4LJYA 1MO3A 2GHIA 1JPJA 3P4XA 3PUWA 4MRVA 1XX6A 1WA5A 3QNUA 4DUGD 1E9DA 4JKYA 2GCPA 4DXAA 4XOIA 3PV0A 1E2EA 5CLLA 3CRVA 2AXPA 4M1MA 4BLOA 2V8OA 4TLEA 2PL3A 2NO6A 4L5BA 3JZAA 4HB0A 1JXMA 4DEXA 2ZSFA 2DWPA 4AURA 4B74A 3W90A 2VF7A 4JT2A 3GLFE 3CH5A 2QM7A 2CNWD 4Q7MB 1E79D 1S1MA 4NYJR 1CTQA 1KO4A 1WQ1R 4B44A 3TW4A 3SZRA 2V55B 5L3QB 3UMFA 3ZZUA 3FPAA 2WPDD 3DM5A 3OAAA 5FBWB 3W5IA 3AVYA 2P6UA 4NCNA 3K0AA 4CZ2A 4DC9A 2PLFA 2QPAA 1G7SA 1KKMA 1VMAA 3EASA 3CLVA 2EWWA 2GZHA 3EC2A 1SVKA 2J0SA 2OE2A 2HDNB 2QEQA 3H84A 2WJGA 3MD0A 1KSHA 2KI5A 1GZSA 4AYWA 2ZRMA 4DLSA 4WZAE 4ZDKA 4P32A 3ND9A 1W46A 3IDQA 3GPLA 3SHWA 1R8SA 4OI1A 1IJEA 4EFMA 1XJ0A 3EZ7A 5L3VA 1D2EA 1GVNB 3T5GA 1NBME 4CRWB 1EGAA 3FHTA 1MKYA 2DWOA 4D81A 4HB4A 2Q9AA 1CIPA 2D74A 3GLGB 1KMQA 1Q44A 2QRZA 2RMKA 1GRNA 3BFXA 1J2JA 1GILA 4L9SA 4MQBA 2YNMA 1UEJA 4LDJA 4C0SA 2KE5A 1QHGA 2CMKA 3QVUA 1NSTA 4GRAA 4KVGA 2J0VA 2QORA 5H1YA 2RGBA 1KI6A 3NH6A 4XD7A 4YMUA 1KOFA 3TUJC 1LV7A 1Z0KA 4CDGA 2ORWA 2WV9A 4EJSC 1KAOA 4LWZA 4W9MC 3QPWA 3TE6A 4EJSA 1CRPA 3SU8A 2R6DA 4LY6A 4TZ6A 1ANKA 1ZM2A 1U90A 1P60A 2GXSA 2QMOA 2ZJZA 3HP1A 3ZGXA 4BLTA 4ZCLA 4P4SA 4DZZA 3SFVA 1WDTA 3S1AA 2IYSA 2ANCA 2ZANA 3THXB 4GSYA 1CJUC 4Z8YA 2P6RA 2B8TA 3Q5DA 2OO7A 1EWQA 1JQJC 4KO8A 4ERNA 2IW3A 2GESA 4YMWA 1M74A 3A1WA 5J5CA 4GMXA 4MRSA 5EZ5A 2GRJA 5EXSA 3BRWD 3HDTA 4IJMA 4YMTA 4NH0A 1AIPA 1J90A 2OFXA 3TQCA 3GP8A 5JSZB 2IUUA 1SVLA 2NO1A 3T35A 2AFHE 2HJGA 2F3RA 2REBA 5DNYB 1CBUA 5LDDC 2GBLC 3E70C 2GBLA 1DPFA 4PPNA 1H8HD 3NHBA 4DRZA 1JECA 2F3TA 4B3CA 1P3JA 4EAQA 2JJ8A 4Q02A 4DB2A 2KBEA 1ZUNB 1W49A 3QBTA 4IHQA 4JSYA 4LV8B 1E69A 5BQ5A 4DLZA 4JL5A 1JXOA 3X1YA 5AJYA 4UNRA 2JDID 4DDVA 1JAIA 4OK6A 4URWR 1KI7A 2GCOB 5M04A 2QBYA 4OI0A 3F0TA 4PHFA 1VG1A 1E9EA 4B2LA 3K0EA 4R71A 2ODBA 3I72A 2OV2A 1W0KD 1OE0A 5EUQB 4MUAA 2DR3A 2WBLC 2LKCA 3VKWA 1OB2A 3N2IA 5SZJA 3X2SA 1XPUA 3GLHB 2P6NA 4NYJQ 2VHQA 4EUNA 3I4LA 4QBFA 1DAKA 1Z0IA 1TX4B 2JLRA 2PMDA 4MRNA 3G0HA 4JBXA 4PZYA 3B8HA 1MRSA 1YKSA 3Q9LA 3ADDA 1E9FA 4LJ9A 1VG8A 3LAWA 1YJ5A 4YDSA 3SC3A 3CPHA 5BXQC 1OF1A 3U5ZB 1OYYA 4KODA 1CJMA 2IT1A 3SN6A 4TYYA 2BM1A 1SZPA 2PMKA 1T91A 4C4PA 5SZKB 2ZRNA 5FUYA 2OESA 2WWWA 1FL9A 3HU3A 2D7DA 3GLIB 1U9IC 4RZ3A 4FCVA 4URZR 1U9IA 1TQ2A 2BBWA 2DFTA 5G3YA 2GF0A 2WAYA 3JZMA 2JIZA 1YZQA 3T1QA 1G4AE 2BBOA 5K8IA 3THYB 4DCTA 1CRQA 2YKGA 5J47A 1ZM9A 3CR7A 3K0CC 4PAMA 5FBVB 2ZSEA 3K0CA 1GTVA 1UF9A 3P20A 2WZQA 2ODWA 1XCPA 4GZMA 5TY0A 3BERA 5KDOA 2NO7A 2O8CA 3GJ4A 2FMXA 2FZ4A 4UJ5A 3G5UA 1XZPA 5JMTA 1IN8A 4XJXA 3KXKA 1UJ2A 3P26A 1Q22A 1T5LA 2GTPA 3PCRB 5EZ6B 3BB4A 4LHZA 1AGRA 3LV8A 3LWNA 3QJYA 2WSSA 3KJHA 1TMKA 2FEOA 4QHTA 2QAJA 1IY1A 1G5PA 3GFOA 4ZCIA 5BN4A 5KSZA 2J5XA 2RGXA 4IVPA 1SVIA 4HLQB 4B71A 3W6OA 2JLYA 1KNXA 3I3SR 2DHRA 4IEIA 4Q1CA 3SJAA 3EIHA 2GZAA 1E2JA 1UDWA 3K0AB 1NIPA 1DO0A 1NI3A 3IO3A 1JR6A 3QKRA 3ZZ0A 4RFSA 4HI0E 5EUMA 2ZI4A 2WWXA 1N6KA 2B7CA 4LBVA 5EXPA 4Q03A 2ZQ5A 3EAQA 3UK6A 3ZQ6A 1FTSA 2VRWA 4EQ6A 1R8QA 5BN3A 1C4OA 4RY2A 5C1BA 2JLUA 4PX9A 4Q4HA 4F38A 2XOKA 3KUCA 4A9AA 4GMDA 4JLDA 1FUKA 2NZ8A 4YLGA 3CKLA 1EFHA 3EC1A 4TMWA 2EFEB 1QHIA 4TN1A 4GOJA 1FW6A 1W0JD 3PENA 2C99A 4KYIB 3RS7A 2BCGY 3K9GA 3FWYA 4NZYA 5FBRB 5FOUA 4O3MA 5KSOA 5E4FA 1US8A 3D6TB 1RRCA 3QI2A 4GP7A 1E9SA 3CO5A 2A30A 1F3OA 3KTAA 3L82B 1KI6B 5HKKD 5FR1A 4KI0A 4KJZA 3KJIA 1N5KA 4JVSB 5AK0A 3REGA 4YQFA 4EJSB 1S96A 1RYHA 2H8KA 2VL7A 4S2EA 1KSGA 4PPGA 1XRJA 4QJ5A 1XNJA 3VKHA 4P4SB 1X1SA 2NIPA 3FKSD 4G5GA 4JL6A 1ZW6A 5P21A 2FPLA 2WOOA 3S1AB 4PTLA 4QXAA 4JYBA 2IF0A 2MMCA 3I5XA 5E3HA 4IFEA 1F5NA 3BBPA 1OH7A 1YVDA 1TQ4A 5F98A 3A1SA 1QHYA 3MAAC 3QBVA 2WKRA 4NU0A 2XSZD 3FTQA 4IKEA 4D2IA 2IA5A 2V54A 3GJXC 3GFPA 5TARA 1NY5A 3A4MA 1OIWA 4Z51A 2XNSA 3A36A 4ZDWA 1VDZA 1QHXA 4JIMA 4KFRA 3W8RA 1ONBA 4I1OA 4V0ME 1LW7A 3OHMA 3B1ZA 3U7HB 1HQCA 1EFRA 3BWDD 2R6CA 4D80A 621PA 5J4HA 4MUBA 1KMHA 1JALA 1N6RA 4BRWA 2H1LA 2ZRFA 3QXJA 2QENA 2VSOA 4XWAA 1GKUB 5IRCD 3SJBA 2HF8A 2OUKA 4I1SA 4IOLA 2FSIA 4TMVA 1VTKA 1ZCAA 2R9VA 4PSKA 1E2GA 1DS6A 1G21E 1HQYE 2BM0A 3GEHA 1G20E 4MRPA 1OW3B 3TLXA 4N1AA 2QROA 4OK3A 3W34A 1J99A 2XZLA 3EWAA 3KDSE 1ZIOA 4HDQB 4JS0A 5KU1A 1KO5A 4B47A 1W2HA 3KKPA 3QKTA 2DY1A 5CM8B 1SHKA 3ZIAD 4A1FA 1E32A 3TGPA 2VP4A 4LV6A 2VQSA 1Z63A 1W2GA 1E2HA 2WWFA 1RPZA 5CYPA 2REOA 1E0JA 4ACBA 1SXJC 4WA7A 4JLVA 4RSGA 1UM8A 1SXJA 3KQNA 1NKSA 2QE7D 2AL7A 3GCGA 4BRUA 1BO6A 3QKSB 2QPTA 5FTMA 4EFLA 1V43A 4Q18A 1KZ7B 4A2QA 4FD2A 1BH2A 2XJ9A 2KB0A 5J4VA 2AK2A 1HURA 4US1R 4DSOA 3SE0A 3SQWA 4PO9A 5FH9A 4D25A 4AI6A 4A0HA 4DUGA 5K8LA 4JLNA 4TLBA 1E2QA 3B9PA 4XSGA 2O8CB 1PUIA 5DI9A 4NP6A 1E4YA 4OQXA 1NVUQ 4NYMQ 1JAHA 2GJSA 2AK3A 2W2XA 3GEIA 3T34A 2R6FA 2GDJA 4TMXA 2ZRHA 2QTHA 4DDUA 2C78A 1Z2CA 3SFZA 2H17A 1UBGA 3RANA 4TMKA 3TNFA 5JS8A 3UXMA 2NGRA 3NBFA 3QF7A 2D2FA 5LBIA 1E79A 3FMOB 4B73A 2VP6A 5EE5B 4LYHA 1OFUX 2NO0A 4KBGA 2ZRKA 2OM2A 4C30A 4LC1A 5JCZA 3L0PA 2P0EA 2PLRA 3Q85A 4X8MA 1M6NA 1LS1A 3T15A 2W6IA 3CBQA 2WPDA 3K9HA 4FN5A 1N0VC 2G3YA 2O0KA 1II8A 4TYPA 1Q1ZA 3QXHA 1T9HA 4DSUA 2FNAA 3U4QA 3R8FA 1KDRA 4HAXA 3QKRB 4RFSB 1ZNZA 2QP3A 3U3RA 4A0RA 2WWYA 5CYOA 2Z83A 4EDHA 4EPYA 1XU4A 4EQ6B 1R5BA 3IIKA 3PQCA 2HYIC 1HT2E 3TH5A 4RVCA 2BWJA 3EA5A 2O8EA 3CX8A 2FZLA 4Q4HB 1U0JA 3TK1A 4XSHA 4GOXA 3C8UA 3WMGA 4FMDB 3QKUA 1PLKA 4QG7A 2EFCB 3GJ7A 1UEIA 1Z6TA 1G3UA 2WSMA 2I3BA 4XIGS 3GJ5A 4DLVA 2PT5A 3VU9A 1ESNA 1NF3A 3FKQA 1NN3A 1KNQA 4XVRA 1NLFA 4C0AC 5JBQA 3SQXA 3RWMB 5DH9A 3MJRA 3KTAB 4BLSA 3AF3A 4JVLA 5GJWC 1KIMA 2ZJBA 5DHFA 3K1JA 3M0EA 1ZUHA 4FCWA 1YZTA 2IYRA 4NHOA 1Q1BA 1XD2A 4DCSA 5DSZA 1P4SA 4A92A 1A2BA 1T5IA 1NN0A 2O0HA 2QM8A 2C9OA 3FHOA 2H18A 3R9WA 4LSGA 2ZETA 2J46A 3LXXA 3AV0B 3CNLA 3IPXA 3ZD6A 4RZUA 4LPSA 1W36D 3CRQA 3HYTA 3E2IA 4TTRA 2J7PD 1SULA 1EX7A 1YE8A 3W6PA 5FTLA 4ABYA 2NG1A 4F91B 1Z2AA 1W48A 1P62B 3PEUA 2ZEJA 1QBKC 4AD8A 1AKYA 4DT1A 4OI4A 4DDWA 1H8HA 4PC2A 4X8OA 2QTFA 1AA9A 3HR8A 3EPKA 2QAGA 3AKDA 3DKVA 3OFNA 1DG3A 4GBMA 4MYHA 2WIBA 4LGMA 3WNDA 1S3GA 2GA8A 4NCIA 4D4JA 1ZMXA 4FI3C 1D8TA 1KMHB 3QF4A 2E1RA 3PIRA 1RW4A 3PEWA 4UNQA 2VP2A 1ZD1A 1TUIA 4YONB 1D9XA 5DN6A 5CDFE 1W0KA 2OBLA 2J45A 1OXXK 2C9YA 4EKDA 5C2JB 1XMIA 3LY5A 3D8BA 4M1OA 5KDLA 2MSDB 2YV5A 1EESA 1XPOA 4BLPA 2WM9B 5JRZA 1FFHA 1OXSC 5CJ2A 2ZE7A 3IIMA 4LJAA 3SS8A 2FWRA 4TMZA 3BK7A 4CW7A 2PZEA 4BFSA 1P7CA 2C5LA 2CLDX 4E09A 5J40A 3RS0A 3IHWA 1G3RA 1XEFA 1YR9A 1Z07A 1NNEA 4MKIA 1BYUA 3WNCA 1SXJB 4Q01A 5AJWA 2OLJA 4UXHA 2I1QA 4TT3A 1N6IA 1E2MA 4P31A 4PQRA 2CCGA 2GEVA 4ACAA 4EPVA 1E2NA 3QXXA 4MRRA 1G6HA 1OV4A 3CRRA 3MUFA 4HUQA 3TSZA 3LLUA 4DLUA 4YDHB 2BKUA 1P9NA 1RIFA 4LJ7A 4E22A 4MKGA 1DG1G 1FNNA 1XF9A 1DEKA 4MITA 3W9YA 2F1IA 4W7SA 1FZQA 2A5YB 3D7MA 4ZKDA 1CKEA 1UBCA 2ORVA 3NHAA 5ANRB 3EARA 3QUSA 4E03A 3AUXA 3GJ0A 2Z6VA 2IEYA 4F4IA 5KHOC 1ZJ6A 3ND8A 1OH6A 1Z6GA 3KB2A 2BJVA 1S9DA 1VPLA 2P5TB 5FTNA 2RHDA 1ZAKA 2KSQA 3PVSA 2J0QA 4B32A 2DFNA 2Q3MA 2GNOA 4F4CA 3K70B 5FPYA 3IHLA 1OYWA 3FGNA 3O47A 4PQYA 1Q1QA 2CXXA 5E7MA 3RS5A 3RAPR 1EK0A 1IY2A 2ASEA 3WYGA 5FPKA 3A37A 1II9A 1Z0AA 4V03A 1SVMA 3UG7A 3I62A 1II8B 4NBSA 3H4MA 3AQ4A 2G1KA 5CK5A 4KLNA 3U4QB 3U60B 2Q0HA 2FFQA 4G5SA 2FDCA 5HPYB 1BIFA 1DAFA 1XTJA 3DOEA 3FDIA 3K0SA 4OQNA 3WBKA 2BEJA 2O8EB 2FE4A 5E7IA 3OEHD 1CP2A 1E1RD 4LJ8A 4LYFA 5KDDA 4LRWA 1DARA 3CF2A 4PFSA 1W0JA 1E9BA 4G5RA 1WRBA 3VAAA 3BAFA 2ZR7A 3Q8XB 1PV4A 1HH4A 3TR5A 3SYKA 4WAUA 1COWD 4TQAA 4GI7A 2BC9A 4OHYA 4H1UA 5HCIA 4AIIA 2CK3A 3L0SA 4ON9A 1E2IA 5HKKA 1W1WA 3FVQA 2EFDB 5KNDA 3KX2A 5DYIA 1N6LA 4UQOA 1Z08A 4WBSA 4AKHA 1ZBDA 3MLEA 4M4SA 1XD2B 4A2PA 1G7CA 3L0OA 4TLDA 3OZXA 1G1MA 4M9QA 1KHTA 2YOGA 1G7RA 5JJLA 1XPRA 1OFHA 5FPTA 2HF9A 2AX4A 2D06A 3U6BA 3JVUA 4ZDIA 3I8SA 1FQJA 2RGNC 5KNBA 2G88A 2QMHA 3U7GA 2RGNA 4A6PA 2ZR9A 2A7QA 3NBZC 2QMEA 4PC6A 4QNRA 1A4RA 4S35A 1E96A 2XSZA 4XH9B 1S9HA 3B6EA 2GVZC 2BDTA 3TJZA 5BW8A 3A8TA 1C1YA 4BFZA 1ESMA 4DT1B 1TQDA 3SJCA 1HT1E 1JPNA 4G01B 5FUWA 1R0WA 1ZYUA 4B2IA 4DIEA 1KKLA 3AP2A 4IVRA 4MDFA 2QAGB 4ASUD 1P5ZB 4MYTA 3UMSA 1ZU4A 4DEYA 5ELXA 1YZKA 4QRHA 2XB2A 1T0HB 2GXAA 4LYJA 1RRGA 4M9ZA 3GLGE 2P2LA 1XFAA 3QF4B 1M8PA 1OXUA 1QHNA 1JR3A 1FX0A 4LYAA 3WY9A 3P32A 1GRRA 2VF8A 4PPFA 2XAUA 1N3BA 1U8ZA 3THWA 2FF7A 5HCNA 1KI9A 1OLOA 5EP4A 3DPUA 4CEJA 3CX7A 3AGPA 3WNBA 1T3SA 1G3IA 4L16A 2Q21A 2YWEA 4MA4A 1WXQA 4FWIB 3O8BA 4L8GA 1IN6A 3VX3A 2IS4A 4D4LA 5TXGA 4OHZA 3P1JA 5JWRA 2H5EA 4LOAA 2X19A 3KB1A 1AZSC 2W2TA 5CLQA 3ZIAA 3W6NA 3EX7C 2IX3A 821PA 4IW3B 4FMDF 2B7BA 1PUJA 3AKYA 5JFGA 4PSVA 5FPHA 5J4YA 3OEED 1N5JA 2HLDD 2ATVA 1NVVR 2GETA 3BB3A 5FOTA 1PJRA 3GEEA 1GDDA 4ZIRA 2QRNA 4NCKA 2QE7A 1PZNA 3IBYA 1WF3A 1R0YA 2QN6A 3HU2A 3QXCA 1HY3A 4HLUC 4MGIR 2WJVA 2VSXA 3B85A 4HUQB 2ZE6A 2NTYC 2V6JA 3R8CA 2AWNA 4K46A 1XP8A 3Q7PA 4HAZA 1MO4A 1KI1A 5AUQA 1LB1B 3CR8A 1IBRA 4K81B 1FTNA 3VKGA 3FFAA 4OJKA 3ZD7A 2J7KA 1U2RA 4Q1AA 1YZGA 4B76A 3KKQA 4QGHA 4EPWA 4LJ6A 3L43A 4D4KA 5KSYA 4PC7A 1E1QD 2FSHA 3EWSA 4PO8A 5JWHA 3F3YA 2UKDA 4YXWD 1VKJA 2XEXA 5FOVA 2WVJA 4RZXA 5GVRA 5KUTA 1HE8B 3GLHE 1QVAA 5TMPA 4Q48A 2E9SA 3BD9A 5CK4A 3VR2A 5J4KA 1HE1C 2ODNA 1AS0A 4Q4LA 1B23P 2CCKA 2GEUA 1ZM3A 1E0SA 1QDEA 3RYTC 4C0KA 2NPIA 5CB8A 2N46A 3I61A 1Z06A 4Q9IA 5GJVC 2AD5A 3AP1A 4C3ZA 2ZRLA 2V1XA 4Q9LA 1FNMA 1JB1A 3A58B 3GJ3A 3LXRA 3O8DA 1N6PA 4ZO4A 2XITA 2D2EA 1B0UA 3DMNA 5A5GA 5LPNA 4JLKA 3GLIE 1OH8A 4BE7B 3K09C 2ZYVX 3RC3A 4F92B 1X8LA 1KI8A 2X2EA 3K09A 5LB2A 3LFUA 4M2LA 4M1KA 2YZ2A 2NMVA 3TUIC 3ETLA 4KYUA 4OK5A 1ZD8A 5CITA 2FFAA 4Z1MD 1Z8FA 5FOSA 4B48A 2V7QD 3NKVA 4LI0A 1DADA 2ZR0A 4C9BA 4JLJA 1NBMD 2VEDA 3KXIA 1RFLA 2ZJYA 2YVUA 1CS4C 3I32A 4HZIA 5KSPA 2IYYA 4TSFD 3FFBA 4IXNA 3T5DA 5B30A 1YRAA 2WOJA 3ECCA 4R2HA 3PJRA 4IDOA 4TWZA 1DAGA 1JNYA 2JLZA 1Q1EA 3EXAA 4WXPA 1OB5A 2A3RA 4TQ9A 5B57C 3Q5EA 4EPRA 4TLCA 3GD7A 2JA1A 1SQ5A 1W36C 4GL2A 1P2UA 1TF5A 4PAQA 4RZ2A 3CF0A 1NVVQ 2J7PA 2QNRA 1TF2A 1LNZA 1R5NA 2F1JA 2F9LA 2W6JA 3IEUA 4LBWA 3TKLA 2IEZA 3CZQA 1OIVA 5BYJA 4F4JA 1UKYA 2OCYC 1XB2A 1XCMA 4GP6A 3TBKA 2J87A 4KFUA 4PAOA 1NLZA 1RZ3A 1UBFA 2ZVQX 1KY3A 1IXSB 3IPYA 3K9NA 4QHSA 4BZXA 1II0A 2W83A 1J8YF 1OPXA 4ITRC 1M1YE 2R44A 2ZRBA 4JYCA 1G5TA 4V02A 4RKEA 3OIWA 2AD1A 4EPTA 2X2FA 5FBLB 4WZ6A 2W0SA 4JVMA 2HEIA 1G8GA 1GFIA 1QHHA 1FX0B 4ZI3A 2JLQA 1N0UA 5AWFC 1YZUA 1FP7A 2H92A 4P0TA 3THWB 1F48A 4QBIA 2KJQA 4BPBA 2DCUA 4QL3A 3M4YA 2C9CA 4CEJB 1UDXA 2WMNB 3KXLA 4V0NA 2RB4A 2D3WA 1CJTC 4URXR 5IK2D 2Q3FA 5G3ZA 4OKSA 1JI0A 2FJUA 3QQ5A 2F55A 2QY9A 4LBZA 2ERXA 1ZNWA 2ZI6A 3ZVMA 1TF7A 4MDEA 4MH0R 1VHTA 2A9KA 4JVNA 5SZHB 1MRNA 1KO7A 1Q57A 2NQ2C 3TAUA 3VR5A 4DWJA 4NL4H 3VR6A 3A1VA 2BJWA 3DKPA 4A8JC 4J0QA 3I5YA 1CEEA 1D9ZA 4A8JA 4ZIRB 2FEMA 2X1VA 1Z0DA 2IK8A 3AH8A 4K8OA 2GEDA 2BKEA 3F5FA 3NVAA 4B43A 4RFVA 1R6BX 4US2R 2Q3HA 5KOYA 1TL7C 2D4HA 2IYTA 3TIFA 2WTUA 3RC8A 1TU4A 4PO1A 2AWOA 1F6BA 1FMLA 4AYTA 4D6PA 3V4FA 5CIWA 3GFTA 5E95A 1WB9A 1G19A 3LBHA 3LNCA 2FPMA 4N0EA 5TDHA 1H8ED 1DVRA 4TMTA 3QG1A 4Q9HA 1AK2A 5EP3A 3T61A 2F1HA 4CYMA 3LQRA 1SVSA 4BASA 4DCUA 2C03A 4QHYA 1E0AA 1VG0B 4ZCMA 5FOXA 3KFXA 4WOPA 3U7EB 3W3AA 3U3JA 1XEWX 2EVWX 3BGWA 4Q7JB 5EE0A 2C98A 3SNHA 2QT1A 5JJIA 4DBLC 2FPKA 3NG1A 2OFOA 4MGZR 2F1RA 2ZM5A 3ZVNA 4KCGA 3R9XA 1KK0A 2FGKA 2GVDC 4NPHA 3DOFA 2BOVA 1G18A 1NMZA 1WP9A 1OFIA 2PCJA 1CF4A 4B3BA 1Z29A 1TAGA 2QBYB 2IBMA 4I81A 2VH5R 4UJ3A 1YR8A 1DE0A 4U5XA 2XTNA 1G6OA 3L8ZA 2GWHA 3OAAD 4UNSA 2ZVPX 4A0FA 4BFUA 5JLJA 1MO5A 1SKYE 1VYUA 1BMFA 4HB2A 2ZIAA 4ZKEA 2FN4A 3IEVA 1DO2A 4JLBA 4JT4A 4TLAA 5FFMA 3BH6A 4B2PA 1ZRHA 4E5UA 3FHCB 3NC1C 3NC0C 1GAJA 1ETUA 1KJYA 2A5DA 2OXCA 1TQ6A 4A2WA 1HEIA 1S0UA 1ZCBA 1NN5A 1MOZA 3B82A 1SKYB 4TYWA 3AUYA 4HDOB 3OEHA 1GWNA 1E1RA 3T12A 4DLTA 1VCMA 2CL7X 4BECA 2VPPA 3NWJA 4O0MA 1IOZA 2R8RA 2Z4RA 1Q12A 1L7VC 4DSTA 1WCV1 2RKOA 5L3SA 3RS3A 2VSFA 4IDHA 4KV9A 1COWA 3BFKA 5A4JA 1KO1A 3BXZA 3O8CA 3RRMA 4A82A 3KQLA 4L9WA 5LB4A 2NZJA 1KTVA 1DAIA 4YMSA 4QM6A 4WW0A 3MGCA 1W7AA 1IXZA 4CEHA 2HXSA 4OI2A 3BC1A 2IUTA 1GL9B 2B6HA 2GJKA 1G7TA 1WBDA 1KJZA 1P9RA 3AVWA 4JLAA 2PCLA 3X1DA 3G82C 2OAQ1 4Q19A 4Q4JA 2O5VA 4OL0A 3C5HA 1K5DA 3CNOA 1RRFA 2NPFA 4PC1A 3PUYA 1J7KA 1O3YA 4B6EA 3T1OA 2A78A 2CNWA 4DVGA 5JEDA 4QJ4A 2CHVA 5FL7D 4QGFA 2GF9A 4C0HA 1AS3A 1A2KC 4KU4A 4CGZA 4HAWA 3MCAA 2ANBA 4JLPA 1D5CA 2G77B 2ZSBA 4OBEA 1OJLA 3HR7A 3UATA 1ZNYA 1GKIA 2REXB 2CEAA 1AGPA 3LH5A 4OHXA 1X8KA 3NTUA 4GT1A 1IAQA 4JKIA 4DB4A 1NN1A 4QOSA 4OQLA 5GJBA 2DPXA 4HZUA 3X1XA 3X1WA 4AC9A 4QKQA 4B3XA 2IF2A 2EYUA 3DL0A 5DO9A 2PZFA 2XZPA 4XTCS 3TAHA 2X8AA 5KTYA 2XX3A 2CVHA 3P4YA 1QHHB 4JL8A 1YU9A 1GNRA 5EE3A 1BS1A 3UG6A 1ELOA 2V6IA 1GNQA 4WZBE 3VX4A 1MT0A 3CX6A 1E4VA 1YRBA 3EA0A 3ASZA 1US8B 1KYIA 1KI3A 1MH1A 4U02A 2QMUA 4D4MA 4Y0AA 2ZI3A 2UZIR 3SOPA 3B9QA 1AM4D 1WE2A 4AWXA 1JEEA 2IHBA 1N2CE 3OEEA 1NLYA 121PA 4V0KA 4JLOA 1Z0JA 3VMFA 1NG9A 1TEVA 2JLVA 5H70A 2MSCB 4DSNA 1T6NA 5G40A 4ARZA 1YZNA 2W0MA 1W4RA 4A8JB 5AJZA 3NH9A 2VHCA 1M7HA 3MWYW 1Z3IX 2IWHA 4W5WA 2HV8A 4CIDA 3VR4A 1NJFA 2V4ZA 2ZU0C 5BN5A 4QJ3A 2GZDA 2BHRA 1E2KA 4PANA 2B92A 3EPLA 3DM9B 1OFTA 1KO8A 3WRXC 1K6MA 2QSZA 1N5LA 4KITB 2YOFA 3N5CA 2WJHA 4B35A 1IXRC 1CR1A 2P65A 1XDBA 1XXHA 3RS4A 5KYKA 1HTWA 1MABA 3ZVLA 2XB4A 4LBYA 2O8BA 2OT3B 3N70A 3AVQA 4I99A 3OIYA 1YZLA 2L0XA 3LX5A 4G5QA 1E1QA 2ZITA 3IQWA 2JDIA 4YXWA 3C14C 2IC5A 2QA5A 3A4NA 4HAVA 2OSBA 2ZRDA 6Q21A 4TZ0A 4IRUB 4HYYA 1FPMA 1S1CA 5JI2E 1NJGA 1NY6A 2RGEA 5C46F 2IYLD 4F93B 3GLFA 5E7JA 2A5FA 3C15C 5JJKA 3BORA 4PHTA 4QGAA 1M2OB 2YINC 4OYHA 2A2ZA 2C8VA 3ZYCA 2QGZA 2ORIA 2F7SA 3M1IA 4US0R 3I92A 3ADCA 4GZLA 4BLQA 1ODFA 3L2OB 1G9XA 2JEOA 4H9GA 3TSWA 4IDPA 2PX3A 1ZC3A 4RD4A 2J41A 2IYQA 2V9PA 4M1SA 1JEDA 1SXJE 1KZGB 4QNMA 3JVVA 3U7FB 3CUEF 1Z28A 3RSOA 2ZAOA 2YWFA 3C16C 4IXMA 4M1YA 1KSJA 2R6GA 1T0JB 3HJNA 4MYUA 3TMKA 3C5CA 4Z1MA 1IY0A 1Z6AA 3E5HA 2V7QA 5L3SB 4R7ZA 2ZRAA 1E2PA 3CRMA 4NE2A 4C0JA 2W2VA 1E98A 4IOKA 2J0UA 3CB4A 4IVQA 2IS2A 3IGFA 3WMEA 1Z6YA 4LC0A 3PR1A 1YQTA 3Q7QA 2VIIA 1GOTA 5BYKA 2VBCA 2RCNA 5EE1A 2IYXA 2PEZA 4C2UA 4CEHB 5DISB 2CHGA 3AEZA 2ZI7A 2CDNA 4Q5IA 4TSFA 4V0LA 4NKRA 2FV8A 3EIEA 4HAYA 4DCVA 1KAGA 4CT5A 1Y63A 1I2DA 3VHLB 3KQKA 1GKYA 1HYQA 3NIBA 1R4AA 1JJVA 4CF7A 1SGWA 3HPRA 3IILA 1J70A 4L15A 721PA 4AKIA 1Z22A 4RCZA 3ZS8A 3Q72A 1EG7A 1JBKA 1NRJB 4PR0A 5CJPA 1MV5A 1UBEA 2FSFA 4BFTA 3L8YA 4Q47A 4N0DA 3FB4A 2A5JA 3PFIA 3REFA 2D7CA 1GP2A 5JRJA 3U3MA 2HT1A 2AKAB 4URUR 2CVFA 3SI7A 1Z83A 1P2SA 5TVKA 4M1WA 2GXQA 2HUPA 4LUCA 1IN4A 4E07A 1UKVY 3R7WA 4Q1BA 4HEJA 4HZUB 1X6VA 2Q6TA 4Q9KA 3UWOA 1P72A 3QOFA 3K9LA 3LRPA 4XWOA 3VTKA 4YMVA 1NIJA 2CL0X 5HR5A 3EPJA 2R6AA 4FW9A 1RE0A 1GM5A 1N5IA 3TQFA 2C77A 5B58C 1UPTA 4P3YA 3IKJA 2J1LA 1QRAA 1S2MA 4FXPA 1WMSA 2KWIA 3CWQA 3IBGA 3AF0A 2YOHA 4G3XA 2ZAMA 2IXGA 1ZVQA 4PHGA 5IK2A 4CEIA 3PITA 3KL4A 2JASA 3VU9B 2RGAA 2WKQA 4NCHA 2ZE8A 4DKXA 2RAPA 2RGDA 4OQMA 4PHHA 5FBQB 5LD2C 3CWZA 1DBSA 4QFMA 2J3EA 3QVVA 2JJ1D 5JEEA 4Q1EA 3K8YA 3AVUA 1E9CA 2YHSA 3WBJA 3LD9A 2IUSA 2ZUCA 1K5GA 4PQFA 4YC7A 1AZTA 3FKSA 2ZSAA 3LVQE 3RS2A 3EZFA 5BWMA 4TL9A 2ZS7A 2VHTA 5JHGB 1TPZA 1T3HA 1H8EA 4BUJA 1XTKA 2IYUA 1U98A 2LWIA 2RHMA 1T8UA 5JHHB 2ZREA 4RD6A 3RSLA 3SBDA 3OE7D 3AVXA 1R0XA 2JATA 2VP9A 1L4YA 4JMPA 3LBNA 4JSTA 1YHNA 4Q7LA 1WBBA 1PVOA 2PEYA 1G64A 3IUYA 1XXHB 4Q7KA 2A5GA 4IEEA 1AS2A 1MABB 4BGDA 3ZVRA 2AN9A 1E6CA 2VP0A 4I4LA 2O8BB 2C04A 1XD9A 1T8TA 1U94A 2NO9A 3CH4B 5EJEA 3FYHA 3FOZA 2C2HA 4TQUS 2OHFA 3K70D 4XTRA 4PXAA 3CM0A 2OLKA 1ZD9A 2Z0MA 2Z5FA 3ADKA 4FWTA 1G4UR 5FI0B 2CHQA 3MFYA 3ZLJA 1XEWY 3KKOA 5D3QA 3UKDA 1S3SA 1G3MA 4U00A 2GJ8A 2ZPTX 4DLRA 2W6ID 1GIAA 3GLFB 1G16A 2OCAA 4QBHA 1W5TA 5IF9A 2Y8EA 3LDAA 1NKTA 5FTJA 2XTZA 2ZU6A 4D82A 2V3CC 3VQTA 3C4JA 3CPEA 3TUZC 3B7GA 5K8UA 2DFLA 1ZU5A 5EP2A 4IOJA 2ZJAA 2QT0A 4AG5A 4BEJA 4NDZA 2WKPA 3AF4A 1P75A 2OEPA 3MWLA 3U3OA 3EPHA 3AP3A 1LY1A 3I1FA 4AKGA 3T06B 2GAOA 3O8RA 1VIYA 4II7A 2KBFA 4B3GA 1LTQA 2ZJ5A 2LKDA 5EE9A 1VIAA 1KY2A 3KQHA 2PBRA 3FMPB 3AKEA 2Q9BA 2TMKA 3DEFA 4JBWA 4EPXA 2ZRGA 3LA6A 2EU8A 4DIDA 1P61B 2H57A 4O2LA 4AG6A 3PG5A 2J0UB 4HLUA 4RD1A 4C0BA 3X1ZA 2EQBA 1CXZA 1OHHD 1Z47A 2WJIA 2IHYA 1IN5A 5K8TA 2O8DA 3KFVA 3VR3A 1A82A 4AYXA 2ZYWX 1AQYA 3ONWA 3K53A 1F2TA 2XJ4A 4AK9A 3LW8A 4BWYA 4DLXA 1D6JA 1I2MA 3B1XA 4G1UC 2ZRIA 2PX0A 3ZH9B
chains in the Genus database with same CATH superfamily
3FVWA 4PSDA 1HFKA 2JIPA 3DEAA 3PHJA 4F3CA 1KZ1A 2ZBUA 2D0IA 3URKA 1Y6JA 1V1RB 1KYXA 2HO5A 2IUEA 4K28A 3GYBA 4A4DA 1SHUX 2IBTA 1EWVA 2WF8A 3PGXA 1AT1A 2OBMA 4W1RA 2OD7A 1CIJA 2HCJB 5IYZA 5KPJA 4BMOB 2J9ZB 4A16A 1F4PA 3MB8A 3ZWMA 4QECA 3LUJA 2QP4A 3N2NA 3M5DA 2G06A 4GAEA 4I8DA 3N6RA 4ZVTA 2HJ9A 3VHQA 1ISSA 4WLFA 4N5IX 4G0NA 3JD1A 3VSEA 4D74A 2P3SA 2DC1A 3AJAA 3QQPA 3I9MA 3WLHA 3PFHA 5KMGA 3G9TA 4I50F 3VVMA 4F86A 4CETA 2B1RA 2JFBA 4LEIA 3B20A 3RC7A 5CFNA 3GJ8A 4QUDA 2HLPA 3TR0A 1LLCA 1CJBA 1X19A 3E9YA 4V0MA 3V2UA 5CXQA 4HRXA 4NJEA 4K6FA 2FW8A 5LYJF 1I6MA 3F5SA 3DDUA 5LIPA 2JD0A 4TRNA 5LQKA 2G1AA 5INTA 3TTSA 3ZXIA 3H9JA 4BE9A 1L7NA 1MMFB 2F9MA 4GPTA 4JJ7A 3CW2A 3IJ5A 4TVOA 2I67A 1N6OA 1IG3A 3GVHA 5C3UA 1M5RA 3S2ZA 1GAWA 2JJ2D 5ILQA 3D8RA 1GZ4A 2IXAA 3INRA 5B3JA 3WLPA 3NPAA 4NZ9A 2PH5A 4UAGA 5H83A 4NZMA 2PQ0A 4MEAA 3D1JA 4O4LF 4CEIB 1EHYA 4DABA 2XQIA 2MDTA 5AOVA 2HI0A 4FYXA 1E3JA 2JGEA 4YACA 4A2CA 4FFNA 1TU3A 2O0LA 2FW0A 3FCOA 5JS6A 2CXHA 4ARZA 2J6HA 1Z35A 2GO7A 2XUPA 1NLMA 3SIWA 4YMGA 3RODA 1N36B 1CFJA 4PN3A 3SEZA 3ENQA 4RM3A 3GAMA 3COPA 1OH5A 1Z7EA 1KH1A 3KR1A 3TW8A 1U8EA 1I51A 4M1TA 1DC8A 4RF4A 2C4MA 3DVLA 3HA7A 4TT3D 4HDRB 4ZYVA 4HQ0A 3OT1A 1JFSA 1SUWA 3UC9A 4M9CA 4ENVA 4JGBA 5H3HA 3FWPA 1CE8A 1DAEA 4IP0A 1U0HC 4MCIA 3KKZA 3EIQA 5HJEA 1L5WA 1A9XA 3QEMB 3N8HA 4YALA 5ARCA 2M1ZA 3L7YA 1KQNA 5HKOA 1DIAA 3NB0A 2EW1A 4RWZA 5E4JA 4WDRA 5EIOA 4MNTA 3UGTA 3JQAA 3ZZTA 1RHUA 1ZRMA 4C6RA 1REQA 2WTEA 2H5LA 3EXFA 4FDUA 4M9XA 3EFEA 2FP4B 4EA8A 2NV2B 1AJEA 3PQ5A 3OEWA 3SBEA 1FSFA 2R8EA 2Y1XA 4RHEA 1WEHA 4YP7A 3KYCA 1TQ8A 1VLZA 2B5WA 2PT6A 5ISMA 1OGJA 5HE9A 4N5DA 4OHWA 4AN0A 1MTOA 1EFAA 2VYFA 2DUJA 4UNPA 1KSFX 1IM2A 4WTOA 1JG6A 1Y6RA 2CJWA 4OB8A 1IHUA 2IHNA 2JAPA 4O2BB 2QYHA 4LRUA 5H8WA 1H5QA 1RLTA 2OUIA 3BMNB 2XB6A 1F2UA 4X6UA 1PQWA 5C5IA 2IGTA 3ETEA 4OJQA 1FTWA 1L4NA 1Y34E 4KQ1A 5FEMA 3AJEA 3TN7A 4DRXB 5CMLA 4UOQA 3FPGA 2UUAB 1SQ6A 1JIXA 2VJMA 3DMDA 2PWYA 4ZD6A 1A5BB 3WP1B 1XLUA 1N2ZA 4DXDA 4OKIA 1RP1A 4NDAA 1TCVA 3U80A 4OLAA 3CJQA 1LV8A 4XM1A 2JFVA 4DLBA 3C3MA 4U7JA 4XVUA 1FB5A 3K6KA 2B4TO 1RZRD 3MG9A 1JLLA 1LQ2A 1NQAO 1YSCA 2WIKA 2IL1A 3BCSA 1U8CB 5ALQA 3YASA 4U7GA 3MTIA 1HFWA 2O7SA 4TS3A 4BAZA 5CYFA 2NXJA 2EOAA 3M9WA 3NV7A 3DMGA 1AKNA 3CVXA 3OFSA 1KJJA 1YCFA 3I8XA 2QL6A 4UFPA 3C97A 1E92A 1D1QA 3AKCA 3B7WA 3IELA 3DV2A 3GRFA 1AQ6A 2ZUFA 3DW1X 5BUZA 1NXPA 4QGGA 5AUOB 3I6QA 4OH1A 4OUDB 3ROEA 4JVOA 4RVDA 4V39A 3OC6A 3ZDQA 1FDWA 3MBIA 3QSYA 2VUTA 1QUEA 5D3MA 2QGNA 3VJKA 2QQ0A 5EINA 5D87A 3RBVA 1FP6A 4WE3A 2C4KA 2WHXA 3R23A 3VOBA 3HZHA 4HWSA 2NOAA 2R2AA 3MJHA 1QRUA 1DAHA 2WJ3A 2XHEA 4P4UA 1DHTA 1E6WA 1TLTA 4PZZA 4BFCA 2F8TA 2ZRJA 5JAHA 1QVVA 4IMRA 3LOUA 2YWBA 1EWKA 1MIOB 2GEJA 1Q91A 3HNPA 3OO0A 2B25A 4IIUA 1M9NA 4BB6A 4BFWA 4AROA 4Z4FA 3BE4A 3SHFA 1KK2A 2VJKA 4IVNA 1VYVA 1LLUA 2IZ0A 3MF4A 3GZNA 2Q3DA 3Q3VA 4M7OA 3FGPA 3PWTA 4JUAA 2ZB2A 3OZFA 4O25A 5L3RA 3ZX4A 3B2EA 4HDSA 4RVUA 4BFVA 4YV2A 4PSAA 5A9RA 2I78A 2D1QA 3MSCA 5F3RA 1XO1A 1ZM4A 5F2EA 1CEYA 1NNLA 1ZD3A 3LE8A 4MYDA 4LJRA 1OSNA 2NNLD 4N3NA 3A7EA 2GBIA 1KQOA 1M6VB 6NULA 2GKSA 4RHCA 4B17A 2NTVA 4HGYA 2K5UA 1DTSA 2XWJI 1C80A 1FSGA 2K4MA 3OOHA 5GJCA 2QLTA 1H6CA 1PGPA 4MVJP 2AMFA 1OLUB 4QUKA 4OM8A 1JJ7A 2E87A 4WK6A 1SXGA 4ME6A 4MHSA 2YUTA 1XBTA 4BN0A 2FR0A 2JLXA 2QIPA 4UHKA 4EZIA 2Z43A 3QYFA 4WINA 2XA1A 1EJ0A 1PU2A 5AUNB 1GUYA 2PKQP 1T9KA 2PMFA 4LTNA 4Q00A 2B82A 1M34E 4RD2A 2WUDA 1E59A 3MBKA 4RA9A 4ZXFA 4D9BA 1QP4A 1I4DD 5JNVA 3H9QA 4JB3A 3DZKA 2HL6A 4JN6B 4P3NA 3B1WA 5IKXA 5C7OO 1KS2A 1N2HA 3UIEA 4B33A 1GL7A 1I4TD 2WWHA 2YNMD 2CXOA 4FJ1A 3RAGA 3AR6A 5F1OA 4JEHA 1RWBA 5C31A 1P5FA 4BEBA 5BMVA 5JTUA 4R9UC 3WXBA 3DVAB 1VFNA 1QR2A 2G1JA 5ICEA 4F5WA 2XVAA 3QPUA 3WGVA 3SYLA 4D98A 4I4IA 4QBGB 1Z18A 1G8MA 2VWQA 3EVDA 3F7TA 1L1RA 1XTSA 1Q2UA 2VQDA 1UBTS 2GFHA 2JGJA 2NU8B 3GA7A 1WLSA 4KMSA 1ZN9A 1DWOA 2P2YA 3PA6A 3AI1A 1G8PA 2OD2A 1JFFB 5D5HA 5AKKA 1XMSA 3KKMA 3F9RA 5DDIP 4B3FX 1T4GA 4B7XA 5CNKA 3DHYA 3FDFA 1NPDA 4BCDA 3A6PC 1ISFA 3BTUA 1Q5PA 3C7CB 2A1TR 4KACA 1NL3A 1XA4A 2JVJA 4IG9A 1GCOA 1F8FA 1D6SA 2XOEA 2R1VA 2YY7A 4Z9BA 1ULZA 2OCPA 2OXEA 3H3FA 1WCYA 4M3NA 5DN9A 4DA7A 3QENA 3VGJA 1QE0A 2QRLA 2AN1A 1INLA 4IDNA 4JJKA 2PUJA 1N0WA 1XDWA 3ZV7A 1UJCA 2CFRA 2G5GX 1RRPA 3TRFA 2GFQA 1RWQA 3D3JA 4EG3A 5ED4A 3KQUA 3C8MA 3H86A 3ZHYA 5JVDA 3I2KA 2CZCA 1WHSA 3BTSA 4HNQA 4ALMA 2CLIB 1C9JA 3DZGA 4FCTA 4W5HA 3DUFB 5EXXA 1WZNA 1X8JA 2QD4A 3IDSA 2D1RA 2W6PA 2ZUSA 1QYCA 1EQ2A 1T1SA 2A33A 2LP4Y 3K9WA 3RABA 4EF5A 2C1ZA 1Z5NA 4DM7A 3FRJA 5A0FA 4B6RA 3H0EA 4QDOA 1T9BA 4TKMA 2X5XA 2FG5A 4HGZA 3V8NA 3GEPA 5L8VA 4P4GA 3ZHOA 4TMYA 1K88A 4LMPA 1KI2A 1ECJA 2HJVA 5A62A 4M0PA 4OQFA 3R9IA 1M2GA 1TKBA 1VHJA 4RD3A 1LFDB 3WNVA 4P7FA 3LVRE 4HMQA 4X1IA 1NE7A 3LWBA 4LHXA 3TSOA 3OM9A 4IIBA 3NRJA 1K7SN 3UT5B 4D41A 2QQ5A 4LWQA 1W9HA 2JK1A 3PUZA 1CQIB 2ZI9A 1VCNA 3TVTA 3HO6A 1A5TA 1JU3A 3VFDA 1B73A 1NVWQ 3QWAA 1K98A 1NRIA 5JSYA 4Z0TA 2B35A 1R2QA 2JFWA 1GG5A 3TEFA 3NHZA 3KU4A 3AEUB 2EKZA 4C4AA 3HZZA 2Z4SA 1P0IA 5JO9A 3P94A 3SJZA 1XJQA 3UHPA 1ODLA 2JIZD 3AEYA 3W8EA 3CNQS 4G1MB 2B8WA 2QVLA 4N0MA 1MQSA 1LD3A 2JAHA 3AZPA 4BB5A 2LTAA 1EK6A 1CY2A 4RHYA 4OVKA 4I2NA 5JNUA 3OY7A 1KVSA 4Z4IA 3D8NA 4JT8A 4RTLA 2ZTSA 4MVJI 2GBPA 1ZNXA 3QIAA 2H4YA 4KFSA 2UYHA 2A4KA 4I5EA 3TZKA 5H68A 2XD9A 1F0PA 4FHCA 1P4GA 4CNBA 2JGAA 4DNFA 1EFCA 3ROZA 2VHJA 2N42A 3L07A 4DBLE 4NBWA 3Q3IA 2W9XA 5BYAA 5IDQA 4YAKA 3ETNA 1TFRA 1FYWA 1QAOA 2BKVA 3L1UA 3Q3HA 3OPVA 1WV1A 4JJEA 4F06A 2G83A 3LG2A 4ITUA 4V0RA 1MJHA 4V3BA 3LQQA 1L5SA 3KVNA 2DF8A 4RBNA 1P3Y1 4ZHQA 1W5SA 1NJ1A 3I2YX 4XVHA 1OX6A 5A7HA 1Q0QA 3F71A 5CEFA 1W0CA 3CVVA 3IKTA 4XB2A 2AJCA 1ZICA 3RYHA 1XSEA 2B94A 3I9OA 3M6AA 2QYOA 2LCFA 5DI3B 2YC2C 4EHBA 2H31A 3LBIA 2IS6A 1XHEA 3MQFA 4OSEA 3S29A 1VLVA 2JIMA 2HLHA 3A9RA 4I1VA 2FX3A 3PEVA 4MLDA 4BVEA 1DDIA 2QAGC 3GBSA 5C8YA 5BSVA 4CM9A 4C06A 1SRQA 3I6MA 2I4IA 3AF2A 1QIKA 3H9BA 3HP7A 4L4SA 2DUNA 2R48A 2FWBA 1IZ7A 1AV6A 1VECA 1EK1A 2DPGA 4HLCA 3S99A 4Z6KA 3CNNA 3A9SA 2OV3A 2Y1DA 4L07A 1JR2A 1O9GA 2OCIA 3VH3A 2KHZA 1W47A 3BIOA 3PQ4A 5BPFA 3IP5A 3ESQA 2AQHA 3OF3A 2XOKD 1N3YA 4MCHA 4KZKA 5IT5A 3S6JA 2HMUA 5AVJA 1PWZA 2XCSB 2OMEA 3HBNA 2NX2A 1A8HA 1J07A 1UM9B 3PUXA 3RVLA 3WGQA 5F9FA 4IAOA 3IQGX 4MW4A 4ROSA 5KWVA 2PQ2A 3FDXA 4TTQA 2PWZA 1ZR4A 4B4WA 2YY6A 3GLGA 4KQEA 1XZHA 3Q3GE 1ILWA 1UH5A 2QLNA 3SXJA 3R3JA 2WLTA 2BI4A 2Y9PB 1HLGA 3RTGA 4FR5A 4N3GA 1B00A 1GNSA 4L0CA 3S3TA 4UVGA 2HY7A 2A14A 4CL3A 2PYIA 2ZS9A 2X8WA 4JHLA 2WYHA 3T3DA 1QGED 2Q5EA 3LLMA 3TXXA 1CC1S 4UKDA 1P6UA 1EM6A 2IEGA 4NX2A 3U62A 5FNVF 1QQ7A 2NTNA 5MN4A 4KR7A 3NHLA 4OX9Y 3ILSA 4B75A 2AJBA 4GVXA 4WCFC 1GFZA 3WFIA 5JCPA 1B8NA 1G1AA 3BB1A 4WCFA 2EHDA 1MJGM 1I8TA 3U9LA 2QKYA 4HFMA 4D4IA 1ESDA 1T35A 3T3IA 3PWKA 3Q6MA 1JZQA 4UXIA 5B64A 1H05A 4Y2QA 5JCJA 3RU9A 3NO4A 3SEAA 1Q0TA 1SVWA 2L82A 4WESA 3MJVA 2XTMA 2VSYA 5FRDA 3W8NA 3NBXX 2ODAA 4ER3A 4GD3Q 3ZDAA 1E3SA 2QW0X 3LUAA 2X5JO 3IVGA 4CG1A 4ZYWA 2OGSA 4Q37A 1XIVA 3ZQUA 3OOEA 5JSZA 1FUYB 3QP9A 3FPFA 4F4UA 5K0ZA 2CHEA 5D2CA 2VCEA 3TKAA 4B87A 4HB3A 1UODA 1P17A 1RMYA 2H54A 3B89A 1RQGA 2C8JA 4KIFA 3U7QB 4D3SA 4F6CA 3OF5A 1C41A 1P3DA 2ENWA 2RKBA 4MR8A 4OJYA 5G0VA 4XFKA 4UDOA 2PFGA 3HJFA 2ADOA 4FFBA 3DXXA 4YT4A 4MW6A 3W9UA 2RHHA 3VRHA 5EP1A 1ATZA 2H29A 2QLMA 4C2TA 1SOMA 4A10A 5KYVA 2CLSA 4XOUA 3ZJYA 3LX4A 4CKEA 4DIOA 1N8NA 3CF4G 4O8CA 4X92A 1D4FA 4AB1A 1DIRA 2BFDB 2RGWA 2Y68A 2BMEA 3E7FA 3E1SA 5HDQA 2QD1A 5CVEA 2QQEA 2V58A 2ZWPA 5B58T 4YFVA 2VVTA 1I0LA 1XZKA 1RWWA 1O6GA 1Q7EA 3EIOA 3PGKA 4KUEA 2QG6A 2XGSA 3SIXA 1OKKA 3KBOA 5F2KA 1EUZA 1KFBB 4KUHA 4MWCA 2ZUTA 1XEXB 1KC3A 3MCTA 1D4ZA 1RJ9B 2BCJQ 3BKWA 4RK1A 1DBIA 1PFUA 4QLOA 4OGKA 1Z2PX 2XB8A 3PGJA 4CT4B 5JW6A 3EQ8A 1AKRA 4YX9A 2H7XA 4LXGA 2MMGA 4X8HA 1G42A 1EG2A 1RFGE 4BRSA 4J0CA 5DYGA 2Q1TA 3P4UA 2WTMA 1CRWG 4J0DA 3QWFA 2BZ0A 3D3QA 3D81A 2PFSA 3WGGA 2V59A 4EARA 4MW0A 3V1YA 4CL0A 7REQA 3PTAA 3AJDA 3ZDCA 1DV1A 3R5XA 1KL7A 3TQQA 3ON5A 4CIVA 2PZGA 1WDLA 3IJEB 2X6RA 1Q3TA 2QIOA 1HQKA 4JP8A 5CT9A 4BBPA 4RACA 5KTNA 1JQAA 1PNVA 1E3LA 2I3AA 4C14A 3H8SA 3M89A 1C9EA 1C9KA 3T7JA 3ZQJA 4CMKA 3D8SA 4DDTA 3HKBB 4DR5B 1D2MA 3QOYA 4X63A 4QUGA 4MRVA 1XX6A 5JSQA 1UBUS 5TEWA 1E9DA 2XAAA 3PNKA 3CZCA 5K3SA 1BU8A 4XOIA 3PV0A 2AOTB 3F9IA 5CLLA 4MW5A 4D3XA 4DA9A 2B2XA 3P2OA 2WYOA 5CDSA 3C3PA 2PUCA 1A1SA 1BWRA 2Y93A 1P5JA 4L5BA 1ZEJA 4I2VA 2BFBA 1SBTA 3DEZA 3LKBA 2ZSFA 4UU0A 1XFDA 5DTRA 3TNJA 3S81A 2BGGA 2D7JA 3LX6A 5IM4F 2R5WA 3WJ7A 3CH5A 2O3QA 1O95D 1U0SY 2CNWD 4Q7MB 4NCAA 2FPPB 1S1MA 3A3PA 4NYJR 4M0FA 4UARA 1RTKA 1PWYE 1KZHA 4C03A 3R3SA 1WQ1R 3UWMA 4KN9S 4LY0A 4B44A 1SA0B 3GLUA 5AVZA 2P1DA 1UFVA 5L3QB 4JNKA 3PB3A 1PW7A 2NXEA 4PGMA 3AVYA 5KQSA 2NZYA 2QLBA 3L7JA 3Q2IA 4NCNA 1QHFA 1Y3HA 1CHDA 4Y6RA 2H1RA 4ZV9A 4UPEA 5IN4A 4LRTB 3ZE8A 5AYVA 3ER9A 1U0TA 3D5TA 2GZHA 2QR2A 4YCJA 5EIXA 3EC2A 1SVKA 3ETHA 3HM9A 3SMVA 1U3VA 2QEQA 3H84A 3TLYA 3MD0A 4FN4A 2Q3EA 3STUA 2WFLB 2XUOA 2ZJ0A 4GF5A 4WZAE 3U4AA 4D8YA 4OIFA 2L17A 2ON6A 3IDQA 2DEUA 1YHZA 1A5SB 3II6X 1R8SA 4J0FA 4OI1A 2O5EA 2O1WA 4MWBA 1XL0A 1D2EA 5KBYA 3TLJA 2F3QA 3T5GA 1NBME 4R3NA 3TVYA 2WY2D 3HYLA 5EG5A 5TT1A 1XVAA 5CX1A 4HB4A 2Q9AA 2WMDA 1Y9AA 2D74A 3VZPA 3ABQB 1KMQA 2PSFA 1Q44A 2QRZA 1T1GA 2WB4A 5I7RA 3IJRA 4OLFA 5AKZA 5JV5A 4UM5A 2PS3A 1SKUA 4PG6A 3EFBA 5LZ2A 5I7HA 1XYYA 5B4UA 1IB6A 2CMKA 3QVUA 4MW9A 1OWOA 4MI9A 4WK0B 4AWBA 2RGBA 1KI6A 4XDGA 1Q0PA 4J4BA 3QV1A 4YMUA 5E1DA 1TA9A 1LV7A 1CRZA 2FWPA 3T7DA 4CDGA 4W9MC 4LWZA 3A04A 3OH8A 4YJHB 4K3VA 2GB4A 1A4UA 3JZFA 4TV9A 2QDXA 2FRXA 2R6DA 4LY6A 4BXOB 4NFHA 1ZM2A 1A8PA 4HPJB 3SP1A 2WM8A 4RXTA 5GINE 1GTSA 5EAIA 3HDHA 2YXNA 3S1AA 3CNHA 3OUTA 4LF4B 3KLPX 3VJLA 2ANCA 2ZANA 2J4DA 2P6RA 3GT4A 4GBJA 3E9ZA 1JQJC 2IW3A 2GESA 3ELYA 1PV2A 3C3KA 3NHYA 1NDQA 2D1FA 4NECA 5EXSA 3MUEA 3HDTA 4UVHA 4IJMA 4MVJF 4YS6A 4NH0A 2PK3A 2Y1LA 4FVTA 5CHEA 1RWKA 2C3YA 2HJGA 5DNYB 3GCZA 3KT0A 1IEVA 1CBUA 1SY7A 2O6HA 1E8NA 3LHSA 1YL7A 4JUDX 1N32B 3Q7SA 2DP4E 3WLSA 1U0GA 3NHBA 1ZA2A 3MRTA 1P8JA 3N3AC 5HA5A 2F3TA 4NXNB 4KH1A 1P3JA 1R8JA 5HOQA 1WVGA 4Q02A 5BR4A 5LLSA 5JCOC 1X7XB 2O5RA 3QBTA 4JSYA 4W1QA 1E69A 5JCOA 5BQ5A 4JL5A 4RO0A 1JXOA 4JGGA 4U7HA 4YECA 3DE6X 5F5NA 1GPJA 3AOGA 5DJ5A 3EVBA 5K99A 1JAIA 1XAJA 3QWIA 1KI7A 2AV6A 1SOVA 3N74A 1H9BA 1EUQA 2ECFA 4P58A 4Z3KA 4PHFA 3VPSA 1CX9B 3DBRB 3K0EA 2I62A 2OVBA 5F52A 5BRNA 5A6SB 4FFPA 3SC4A 1PJBA 5E3IA 2BGLA 2ZXFA 2LKCA 1H1DA 2HA3A 1OB2A 1CB0A 2ZBFA 3X2SA 3SEQA 1PJ4A 3GLHB 4FC6A 2WG2A 4HK4A 3WIEA 2VHQA 3PJEA 3I4LA 4QREA 3LUBA 3QMWA 3K20A 1L7PA 2B36A 4MLPA 3U0VA 5JXGA 4OAQA 4JBXA 5K3DA 1L5ZA 5E6RA 1HDXA 1MRSA 5CD1A 1PG0A 1YS4A 2R25B 4LJ9A 1APBA 3WKAA 4YDSA 1WB6A 2ZTVA 3ELBA 3U5ZB 1WD5A 4J6FA 4KODA 1W76A 3L49A 4TYYA 3RIEA 2D00A 3WGTA 5DTMA 2DJ5A 3VXKA 3OJXA 3RV4A 3JYPA 3S2FA 5CT4A 5EFOA 4B9EA 5JNRA 1VXRA 5FUYA 1ACLA 1BDJA 3CU5A 3L9XA 1FL9A 2G7MC 4ZARA 3WHPA 3D6HA 3DBVO 3HU3A 4PGFA 4NZOA 2B37A 3I9V6 4PTYA 2DFTA 2BBWA 1VP9A 5KAPA 1ONNA 4X60A 3N2GA 4C5CA 5J2TA 4K0KB 1YZQA 4UU1A 1G4AE 3KLOA 1Y4SA 3THYB 4DCTA 4YXFA 1EVKA 1SCKA 1MDFA 3LQ4A 1ZM9A 3CR7A 1FA9A 3QVLA 4K6OA 1IJKA 4LA4A 4XVCA 1DJNA 4CIWA 1I7SB 1HORA 1GTVA 2P3OA 1KYYA 2WZQA 2PYDA 2ZULA 1IDOA 4QRDA 3ZH2A 2AOWA 3N6XA 4HEHA 4YP0A 3GJ4A 1GJRA 1Y89A 4UJ5A 4BMSA 4EEXA 3G5UA 1A8IA 4KO1S 3G13A 2MSLA 3JW8A 2WZDA 3S40A 1UJ2A 5AM3A 1Z2EA 3VUEA 5EIAA 3KB6A 3ZI7A 1EZZA 1T3TA 4TZTA 2KPOA 3BWYA 3ULKA 3WZ2A 4BIIA 4UTRA 5G0UA 3PCRB 4BLWA 4EM6A 2AG0A 3R75A 4IDFA 2CY0A 3QXGA 4DS3A 2RONA 2FZWA 4E33A 1EGHA 1OI7A 1ZQ9A 3GMSA 2QZZA 3NASA 1JBQA 4RVNA 2CDBA 3HBLA 5EXEA 3AUJB 4HLQB 3W79A 1UQTA 3H5RA 4KMOA 4WBNF 2CT8A 1QH1A 5KKAA 5DBGA 4EHIA 4KVFA 3KUKA 5JANA 1NIPA 4JDUA 3OP1A 1DO0A 1F14A 2XQFA 4NZNA 3KSBC 4D9GA 4HI0E 1AO3A 4CKCB 2ZI4A 1NQOA 2C5GA 2B7CA 3ID6C 4DNXA 1U2QA 3PC8C 3AILA 2VRWA 1MGOA 4PBTA 3PC8A 2M6SA 1LXCA 3D3WB 3E6AA 1C4OA 1CVRA 2NPOA 4K2HA 4RY2A 2X7HA 3K9FC 2JLUA 1ZMOA 5E9WA 2C4NA 2OYRA 1XDZA 4X85A 3KEMA 4DTIA 1AQLA 2FX5A 2NZ8A 1NQVA 1M1YB 1EFHA 3FJYA 1NZDA 3MOGA 3IT1A 2ZBRA 4HXFB 1XQ9A 5HFNA 4KYIB 4F5EA 5AQ1A 4Z4GA 4OHRA 1AB6A 5DPMA 3TPZA 1K4KA 1PSDA 1Q14A 5KSOA 4WY5A 1GZHB 4GE3A 3ZCTA 4LY3A 3VO2A 3ZVKA 2YHIA 2H51A 1ODIA 1P2GA 2C2BA 4WZBA 3E5NA 4P83A 4FZVA 4ZANA 2EATA 4XDYA 5FR1A 1G8AA 1M54A 2DPYA 1SB9A 3OJOA 3KJIA 1D04A 3BZWA 4EJSB 1RBZA 4S2EA 2WU0A 1KSGA 1TJ3A 4K6CA 4NU6A 3RSHA 1AF7A 3PFWO 3HDQA 1DZ3A 4C7MA 1P1BA 4IZHA 3JRWA 4K88A 1X1SA 4JL6A 2JEZA 2FPLA 4ZQFA 1S3IA 1PFQA 4X20B 3D0QA 1G59A 2SKEA 2IF0A 4FKMA 3VH2A 5E3HA 4IFEA 1OH7A 1TECE 1ZSYA 4QAQA 2CHUA 1NW7A 2PQ6A 2JFYA 4CUJA 3FUXA 3UHJA 3MB5A 5IXSA 1YUMA 3EDCA 1QHYA 3MAAC 3WIOA 2WDZA 3MT0A 3H2SA 4R2XA 4TV8B 1ECCA 4IKEA 4PHCA 5T3UA 5A1TA 2X7XA 1RCTE 3D7RA 4D2IA 5J3JA 5TARA 1ZCJA 3PGMA 1NY5A 3PHLA 1O6CA 4XIYA 3IAFA 4ICIA 1M8JA 1GPUA 1I14A 1GNVA 5F7ZA 4EJ6A 3R6DA 4KFRA 2IY7A 4QO8A 3W8RA 2AN5A 2PN1A 4X66B 1LW7A 4JI4B 4MUEA 1PD0A 3BWDD 4F2PA 5HJ7A 5LLTA 4GX5A 4D80A 3HKDA 621PA 3PQ6A 5LN1A 5J4HA 4DR6B 3M33A 1W9MA 3QE2A 4MQMA 3MRVA 4OFWA 4MQEB 4UCWA 3QXJA 2QENA 1DWPA 4N65A 2VSOA 3WJ2A 5CG1A 1NUSA 5CH5A 3HCWA 2ZJ3A 3NRCA 2AOUA 2VK8A 1PFVA 2IYPA 2WR8A 5JMPA 3SJBA 4DR3B 3A4IA 1PJAA 4ZA2A 5AW0A 2H9YA 3W8DA 1ZCAA 3H16A 1EXDA 1T4BA 2H2IA 4P86A 2AZTA 1G21E 1HQYE 1LTKA 1RXWA 1G20E 3TAXA 3TLXA 4ZGBA 3D59A 3OIDA 1HE3A 1T5HX 2QROA 4UDNA 4ZU1X 2XZLA 2ZZNA 4UZFA 3EXG2 5AW3A 2JAXA 1NTRA 1ZIOA 1J0XO 4B3JA 5JAPA 2AKEA 1PVDA 1KO5A 1E5TA 3G02A 4MB0A 3UAWA 3WLKX 1W2HA 2LNDA 1O89A 3HJCA 1DTEA 2N0SA 3ITNA 4N7JA 4A1FA 1E1DA 3PD7A 3SZGA 1MENA 3LPMA 4O4JF 2VP4A 2ZBQA 4QUJA 1E2HA 2HHJA 2WWFA 4GVLA 5CYPA 4K1XA 4Q3LA 2WWVD 4MV8A 4UHEA 2NUAB 3LCJA 3K8ZA 2ZT6A 1DEAA 1SXJC 4JLVA 4AXBA 1Q2XA 1SXJA 3O2NA 1ISMA 3SPXA 3N8IA 2QE7D 3RQSA 2BI7A 4PYOA 1BO6A 1EFKA 4TWJA 4IJWA 4UM9B 3HRKA 4Q18A 2R11A 3AHFA 5EQFA 2XMBA 3TZBA 1BH2A 2XJ9A 3PJDA 2KB0A 3LL7A 4FBMA 5J4VA 1YMQA 3SE0A 3M2TA 3OM8A 4QQRA 5FH9A 1LX6A 1QTQA 1E64A 1POXA 2OOSA 4ZCQA 3G9UA 4NOJA 2NO5A 3IHTA 4DUGA 2BR4A 4OX9B 2P75A 3G3EA 1ZPDA 4TLBA 1E2QA 2O8CB 4UTZA 5DI9A 2CD9A 3HI6A 3ZLTA 4AVYA 3E18A 3L0BA 4DKJA 2AK3A 5I48A 1QO0A 2GDJA 3JARA 4UPVA 4WN9A 3OPYB 1CDEA 4P35A 5DBHX 3GELA 4Q0MA 5I45A 2GAIA 4ZZ3A 3F1KA 2H17A 1OA1A 1C81A 1UBGA 3NAZA 3BMXA 3RANA 4RTOA 3WWCA 3OZTA 3QELB 3WS7A 1SCUA 4EKNB 4ERXA 1KYWA 4BV8A 1NVEA 3NBFA 1O7JA 1E79A 1FRZA 1Q74A 3FMOB 1V8OA 4Q3DA 5EE5B 1UP6A 3G2MA 1SRRA 3U4GA 4QOFA 2QB5A 4QDJA 3RAJA 5BWNA 1RD4A 5HK8A 4JU9A 2P0EA 2D1YA 2H11A 4RX1A 3MJFA 5DASA 3ORFA 3PFNA 1PNQA 2W6IA 4C3UA 2WPDA 2FWJA 1L5RA 1LWNA 5G0WA 3DL4A 4WPGA 2OR3A 3B3FA 5FLEX 5EVCA 3QXHA 3L4SO 4IIXA 3FOEC 4X61A 5GV7A 3R8FA 3ZW7A 1WMEA 4HAXA 4RU1A 1B1AA 1U5BB 2JFUA 3DFIA 2QP3A 1Z62A 1XN1A 5CYOA 4RGBA 5CPFA 1EYZA 4EDHA 1EXVA 1OGYA 4EG1A 4MCAA 3KHSA 1WMAA 4EPYA 5FBKA 4FFWA 3TWOA 5HYVA 1R5BA 3IIKA 4OYLA 3EEOA 3G17A 4R9SA 4U7WA 2VJOA 2AJ8A 1ZFNA 3OEYA 3KEGA 1USKA 5AKGA 5LVAA 4Q4HB 3HDGA 3CY6A 4GOXA 3WMGA 3OFKA 3VGPA 4FMDB 3QKUA 1XR3A 5ALVA 2OCKA 3GN1A 4QG7A 4N41A 1UEIA 3T3EA 4RZHA 2IP2A 4LQDA 3TL2A 3LCUA 2OCLA 2W4IA 2XBUA 1EDDA 4L5IA 1CUEA 1CDOA 1OFUA 4BO3A 2DGDA 4DLVA 4MVJE 3OCWA 3VU9A 5JBQA 3ISJA 4LDNA 4OHCA 1IBCA 4LNHA 3SQXA 3T54A 4RADA 4JVLA 3ZNPA 3DF9A 4PYMA 4RCVA 3THRA 3WA6A 2FOXA 3M0EA 1CHNA 4FCWA 1YZTA 3DO8A 3ZQKA 5HQ3A 2V0GA 2BFEA 5EWJA 1JVSA 5ARDA 4KK4A 2EQAA 2ISSD 1T5IA 2O0HA 2QM8A 4N6OA 4BMXA 3KOZA 2V3WA 3VHRA 3ZLUA 1F8GA 1KRHA 3R9WA 2OORC 2J46A 4DF3A 1QIEA 2OORA 3HO1A 1HL7A 1Z2DA 3AV0B 2H7YA 3PXBA 3ZD6A 1MPTA 1P2BA 4LPSA 2HWYA 3P0EA 4KN5A 4BBZA 3LDGA 3TZLA 3GD5A 2XUFA 3E82A 1JKFA 4K03A 2PG3A 3U37A 4EDFA 1ZLYA 3G2KA 4G0VA 1HDEA 1XZDA 2SBTA 4FQ8A 2ZB8A 3BSFA 1P62B 4HTFB 1UAGA 2EZTA 3CQ9A 1BXGA 4RV4A 1OX4B 3MPUA 2CUZA 4DT1A 5K0GA 2XMCA 3KWMA 3NIWA 4ZAVA 3DMTA 1H8HA 5F2OA 2EIXA 3UJ3X 3DA8A 3CPSA 3DKVA 2JAUA 3IQZA 5C81A 2ZIXB 1DG3A 3PC4A 5ALTA 4MYHA 4PX5A 3VH1A 4N4AA 2WIBA 1Y1SA 3WNDA 5LUAA 3ZV5A 1I0ZA 2GA8A 1N78A 1ZMXA 1PR3A 1X7HA 2IVFA 1DXQA 2E1RA 4GX0A 4BNDB 2UZ1B 4U2GA 3F6RA 1NYLA 3JXEA 5AI6A 3EGWA 1K4YA 1QJCA 5CDFE 5FIUA 1YT5A 3OQMA 1PZFA 2AC2A 1XXLA 5JBIA 1SWVA 1DNPA 4ILKA 3LOQA 2NV0A 5CH3A 5DTIA 1FNCA 1KAMA 3A6ZA 1PRYA 4EKDA 3PCTA 5C2JB 1ZWKA 3BIWA 3V46A 4CN9A 3LY5A 3D8BA 4N39A 1UKCA 4N8SA 2MSDB 1I5RA 4P5DA 2YV5A 1EESA 3K92A 4HRVA 1SH7A 3R3VA 2IYOA 5BSMA 3WYBA 5ALWA 4BLPA 1XPOA 2IE8A 1OXSC 5P8WA 4RKYA 3O1LA 3O4JA 1DJPA 3SS8A 2YASA 3D7NA 4TMZA 2EKPA 4M55A 4Q16A 3QV2A 4B3IA 4TKLA 3JTMA 1J2RA 3VR6D 2H3EA 2CLDX 5LOVA 3RS0A 2X9VA 4L4XA 1B3BA 3P9QA 4YUAA 5KYUB 3IP9A 3MUNA 3EGCA 1BYUA 3VJRA 3HXLA 4Q01A 3I6ZA 3AFOA 3LPLA 3GLRA 4UXHA 3ZYZA 5CA1B 4TT3A 4Q82A 3OM1A 1E2MA 2BTEA 3IODA 1WUIS 4UATA 4P31A 2QVCA 3T3OA 2GEVA 3IXLA 5B4TA 3TSZA 2HCFA 5SICE 1V1MB 3I04M 2Z2ZA 3LLUA 2WHPA 3TNDA 1Q16A 2XA9A 4QJBA 2YQ5A 4LJ7A 3RSSA 1L7EA 1DG1G 2G5CA 4RLFA 5ICFA 1XF9A 1KVQA 2R1TA 3W9YA 3WL5A 2NUPA 2P11A 4ZI7F 2F1IA 2XIJA 4W7SA 2FQWA 4BZWA 1EIZA 1CKEA 1UBCA 3GRAA 3G2PA 3NHAA 5ANRB 4F4DA 4V1CB 1ABBA 3CEMA 3AUXA 3OTIA 1M33A 4L7QA 3EXEB 3AHHA 4CMJA 3TI9A 4EBFA 4NNJA 3W3AD 2C3UA 1ZJ6A 2KYRA 4GI3A 3GCXA 1L9KA 1BOOA 1Z6GA 2BJVA 3KB2A 1S9DA 3F6EX 4NG4A 2P5TB 4N7RA 2CW5A 2G70A 1I1HA 3GUCA 4L08A 4PTZA 1ZAKA 3U4IA 5AK6A 3LT1A 4BB9A 2Q3MA 5JVDB 5EIWA 3O8QA 2JBAA 3R5FA 4G1VA 2DH5A 3GRVA 4KZPA 2JVIA 1T9GS 1EB8A 2P9EA 2NU9A 3M5CA 3KHKA 3O47A 4MO9A 3URMA 2VAWA 3V7YA 4EUSA 3RS5A 3UFXB 8ABPA 2I9KA 5CTJA 3RAPR 1WZCA 3TOVA 2CXSA 1NFRA 4QO7A 4D0SA 5AXCA 1Z0AA 1SVMA 4C08A 4FZRA 3U1BA 1XL1A 2Z1NA 1K7EB 3N59A 3AQ4A 3QKIA 3BJEA 3SVTA 4P7JA 3U60B 3H1GA 1PWXA 2Q0HA 1B0ZA 1UPFA 2HSDA 4G5SA 1BIFA 1DDOA 3HKCB 4C4RA 3C0KA 1RLIA 2D0OB 2DSTA 4DM3A 4BJ3A 5D00A 2CJXA 2HMSA 3CYFA 3IT0A 3PKIA 2VRCD 3WBKA 2BZ1A 2Q5LA 4R9RA 2FE4A 2F3SA 4AF8A 2VDKB 4UDYX 1E1RD 1KMIY 2F9FA 1B8PA 1WL8A 4LJ8A 4LYFA 4O63O 5FWDA 4AQ7A