3IIJA

The structure of hcinap-adp complex at 1.76 angstroms resolution.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
175
structure length
175
Chain Sequence
PEFMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, transferase
molecule keywords Coilin-interacting nuclear ATPase protein
total genus 67
structure length 175
sequence length 175
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iijA00
2JGNA 2FFAA 1KK2A 2ONJA 4AKEA 1SVMA 2ZROA 1WF3A 1YZQA 4V0LA 5FL3A 5FPSA 3EZ9A 3D6TB 1DAHA 2VP5A 4DSTA 3L0OA 4JL5A 4PHHA 5HPYB 2XTZA 2V6IA 3IBGA 5AJWA 1N0UA 1RRGA 3TK1A 1SHKA 4QM7A 2N1BA 3KXIA 5CIQA 2F43B 4CVNA 1PVOA 4UNQA 2IHBA 4NYIQ 1Z28A 2LWIA 4MUBA 3M4YA 3Q8XB 3R9XA 2ZS9A 1YE8A 4HAZA 2FSIA 2PZGA 1VHLA 3KUDA 3UANA 3T15A 4WBSA 2C96A 5CM9C 2O8FB 5FTJA 2CNWA 1LB1B 4LX0A 4JKIA 3THOA 4TSFD 5FBVB 4Q5IA 4DB4A 1GRNA 2W2XA 1R6BX 1JR3E 1W49A 5B57C 3H0KA 5FUWA 4TLBA 4KVAA 1NVWQ 2VHUA 3IILA 4PZZA 2RGCA 2YWHA 4XVRA 3OIWA 4YXWA 2HYIC 4RSGA 3P32A 1WXQA 4MYCA 1Z0DA 3LBNA 4D80A 4W7SA 4A2QA 1ZJ6A 2PT7A 4V03A 1ZM3A 3KQUA 2IYVA 3BFKA 1V5WA 3RHFA 4PQFA 3MWJA 1IONA 1NBMD 1YZLA 3WP1B 1MABB 5FR2A 4B3CA 2RCNA 2BM1A 4KU4A 4D25A 2R2AA 4E5UA 4OYHA 4Z8XA 1MABA 2QPAA 1H65A 1SHZA 4BLSA 1JXOA 3M6AA 3C4JA 1XTKA 4MGYR 4MRSA 3K9LA 4M22A 4GMDA 4Q00A 1ELOA 3LQRA 4AG6A 2V4ZA 2WPDD 3QF7A 4TTQA 4AURA 4XVUA 4KODA 4CGZA 3FWYA 3B9QA 2QSZA 2W6JA 3ND8A 3MCAA 5C2JB 3MG9A 2XX3A 4WOPA 2D2FA 3QOFA 4OK3A 1CU1A 4QG7A 3RRZA 1TF5A 2FEOA 1KSFX 4HB0A 1N6RA 1T3SA 3FPAA 4QJ5A 1FX0B 1P2TA 2R6CA 4MRVA 1T8TA 2BBSA 4PX9A 3C16C 5M04A 1XPRA 4OI0A 1Z2AA 3GFOA 1OXSC 2C9OA 4TMZA 2WMOB 4P4TA 1XCPA 3CH4B 4Q7MB 1ZNWA 3CLVA 3ADCA 4ASUA 4A8JC 3BC1A 4DVGA 5EXSA 1I2MA 1ZAKA 1RKBA 3WHKA 5FTNA 2GBLC 1Z0JA 2QE7D 2IUSA 3B1YA 3VHLB 1YVDA 4HSEA 1N5IA 4LPSA 4LV6A 3W6OA 1BH2A 1JQLB 4A36A 3FHTA 4LCBA 3WXMA 3RS4A 1DPFA 1I4TD 2ZI3A 2WWWA 3RS0A 3BH6A 2R9VA 4WAUA 4CEIA 4FXPA 4W5WA 4QC2A 2A5JA 2ZJ8A 3H84A 2PEYA 3AV0B 3SZRA 4PZLA 4BQSA 4B2IA 4GDFA 3B60A 3ETLA 5CYOA 1KGDA 5DYGA 1JPNA 1Z63A 2GCOB 1WA5A 3NWJA 5CDFA 3NHAA 2GTPA 3QEOA 2AL7A 2XAUA 1W0KD 2F1RA 2QP4A 4JLMA 4M2LA 3CIOA 3PEUA 2ZJOA 2J3EA 3KDSE 4F4IA 1OH6A 4JSTA 5KYKA 2GHIA 3SJZA 4C2UA 2BBOA 2EYUA 5DISB 3LAWA 3CZPA 2JLRA 3HP1A 2QN6A 1KSGA 2QG6A 3FKQA 1G5PA 1CBUA 1X1RA 2EFDB 1KSJA 2ZRCA 5KDOA 3CB4A 4MGIR 3VQTA 5EP2A 2WWHA 2GZAA 5EP4A 1HURA 4IDPA 4JMPA 5FOWA 3E2IA 4GOJA 2FDCA 2YOGA 1T3LA 5GVRA 1FFHA 3QUSA 1NNEA 5IK2D 1S2MA 2H7VA 2ODEA 3U4QB 3NBYC 2GEDA 3CF0A 2QTVB 1U8YA 3KL4A 4IFBA 5AJYA 3A4NA 5HZHA 3KTAA 1HA3A 3DPUA 4A8JA 1PJRA 3I8XA 2XZLA 3GLGB 3IIMA 3PITA 1G20E 4AYTA 3TRFA 1OF1A 3RAPR 1NLZA 3CF6R 1P73A 3JVUA 5CB6A 3BE4A 4M1YA 4JLNA 4QGHA 1ESNA 2ZE8A 5FPTA 1NSTA 5F2EA 3A1SA 1QRAA 2VTKA 1ZM7A 3SE0A 3SYKA 1BYIA 2F6RA 2BEKA 5FOUA 2DPXA 2ODNA 2VLIA 4QHSA 4US1R 2R8RA 4LHXA 1Z47A 1PUIA 1UKZA 1IN6A 2OCBA 2QENA 4CF7A 1NG9A 1W4RA 5JRZA 4Z54A 1G4AE 3T1VA 4QNRA 3I3SR 3SYLA 2GXAA 4AYWA 1XDBA 2OCPA 4YDSA 5JHGB 1CKEA 4M1TA 2ZE6A 4Q01A 2PLFA 3O47A 2ORVA 2CVFA 1PUJA 4DRZA 3FOZA 1HT1E 1OPXA 2IS2A 4Q1AA 2RGGA 4MDEA 4D0NA 2A7QA 1XTJA 4G1UC 2DYKA 5A0FA 4JLBA 2J9RA 3GMTA 2P2LA 1HT2E 4C3ZA 1N5LA 3IO5A 1U9IC 2H16A 5CDFE 1VG8A 2CL7X 1DG1G 1QHXA 3CR8A 3QKTA 4NBSA 4Q03A 4CDGA 1DBSA 2OM2A 4MRRA 3VHXA 4DLWA 3GP8A 1P2UA 1TEXA 4PPNA 4CT4B 2G0TA 2ZAOA 2GCNA 3BS4A 2Z83A 3FGNA 3IHWA 1S96A 1AM4D 2QI9C 2JIZD 2FZLA 2BM0A 3QPUA 4ZCMA 1ZP6A 4PFSA 1H8HA 1UBCA 4XVQA 2VBCA 1H8EA 1AZSC 1ZUHA 1M7GA 3CRMA 2ZSFA 2RGEA 4HLUA 4JZKA 3ZDQA 4EFNA 2ZYWX 3LVQE 3ZYCA 4QM6A 1TUEA 2HCBA 4U7DA 4F92B 3NH6A 2OSBA 3D7MA 5HKKD 2FSGA 1E4VA 1E2MA 3AP1A 2QT1A 1T5LA 2GJSA 1U98A 4A2WA 4KYIB 3SDZA 1U0HC 4U02A 4YLGA 2WWGA 1MKYA 4EPXA 4M1WA 1KAGA 2IF2A 2H92A 1OH7A 2W6ID 5EE9A 4AY2A 1DEKA 2R6GA 3CWZA 4P4UA 4ZCLA 5TB5A 3U3OA 4CYMA 3X2SA 2ZJZA 2JASA 4EQ6A 1ZM4A 3FKSD 4YONB 4UJ5A 2ZEJA 4DT1A 3N5CA 1E1QA 2IYRA 3BH0A 4R2HA 5FL7D 2PZFA 2IUUA 2WIAA 1LF0A 3A1WA 3NBFA 2Q21A 3RS2A 5JS7A 2GETA 1E2GA 5HR5A 2I1QA 1HQYE 4FCTA 4C30A 5B2ZA 3IPYA 4BLOA 1M6NA 1GTVA 4X8HA 4PC7A 3OE7A 4UXHA 3C5CA 3MUFA 3NC0C 4QXAA 3NHBA 4B44A 4ZIRA 2FF7A 2OBLA 3GFPA 5EZ6B 1MO4A 3EIEA 4LRWA 5KSZA 1E2IA 2I1VB 2DFTA 1NP6A 4KYUA 1S9DA 3KUCA 2OV2A 3RRYA 1DAEA 1NIJA 1W4AA 5EP1A 3RVBA 1DTSA 2REOA 3DZ8A 4IFEA 4BGDA 3L0IB 4DCNA 3GJ0A 4CEHB 2R6AA 1CR0A 2G6BA 3QENA 1X8JA 2EVWX 4LJ7A 4Q18A 2XB2A 1SVWA 2GCPA 3FVQA 4DLRA 1XEWX 3UMFA 3VR3A 2B7BA 1UBEA 1AS3A 2ZR7A 1YZNA 4NCKA 3AF1A 3U3JA 1KO7A 1P9RA 2IYWA 4ERNA 4ZDKA 1TTTA 4IVPA 2BDTA 5DLQC 1S3SA 4IJMA 2VHJA 3TVDA 1GILA 3RRNA 1C4OA 2RGXA 2JEOA 4FI3C 3HDTA 1G7TA 3N2IA 4IOKA 4UJ3A 4WIAA 4OQLA 4MDFA 3FDIA 3WNBA 3QG5A 2ZRDA 4LC1A 3T1QA 2PH1A 3KQNA 1GITA 1CR4A 2QSYA 3RC3A 2DHRA 4F4CA 5FOXA 1G3UA 2G9NA 5DI9A 4HB4A 1EX6A 4BRUA 2A5FA 1S0UA 3CZQA 1ZM9A 1CIPA 3BAFA 4J0QA 5EJEA 1AK2A 1XTQA 2JLWA 3TQCA 2A5GA 3IHLA 1FQKA 4V0NA 4OJQA 4DT1B 3ADDA 3PUXA 3CNLA 2RHMA 4Q4AA 3IQXA 1G5TA 1RZ3A 5FBWB 2IYZA 1NY5A 4LYFA 4DLYA 2IS1A 1I4LD 2ZI6A 2P5SA 1GNRA 5EP3A 1OXUA 4OBEA 5AJXA 3TH5A 1W2HA 3GD7A 1ZM2A 1G19A 3L8ZA 1N2CE 2WHXA 1GL9B 3ICEA 3GQBA 3EXAA 3W5IA 3PR1A 2O8CB 2ZRGA 3LO5A 5L3SB 2VL7A 1UBGA 2FNAA 5FH9A 1G4UR 3DHWC 5KDDA 1Z3IX 4DHEA 3C14C 3KZ1E 2VHQA 4EPRA 2CXXA 2ZRMA 3R8CA 4C0LA 2VEDA 721PA 5JLJA 1G64A 4FWIB 2EFEB 2EFCB 4FINA 1Q1QA 4N3NA 2R6DA 4PPGA 4LBWA 1ZC4A 4R7ZA 4C0HA 4MKGA 1VCMA 4PO1A 2B21A 1EFTA 5KPDA 1QHSA 4IXNA 2BMJA 5L3SA 2DBYA 4Q4JA 1FQJA 3K0EA 4NHOA 5J4VA 4B2PA 3LBIA 1R7RA 3MLEA 2IUTA 2NZJA 1N5KA 2CJWA 4KCGA 1WE2A 3CX7A 1MH1A 5EZ5A 5BQ5A 1K5DA 4K8OA 3LX5A 2ZSDA 5HTKA 1G8PA 3N2EA 4DLVA 2O0KA 2X2EA 3AF2A 3BOSA 3ZLJA 4B3GA 1G3QA 1MR3F 4AIIA 3IEVA 2J0UA 4K81B 3AEZA 2JLQA 4Q4AB 1N6HA 4TT3D 3TKLA 4LJ8A 1P2VA 2JJ8A 1XFAA 1D9ZA 2ZR0A 3FB4A 5DGXA 2FPMA 5H8WA 1PZNA 5ANRB 1E2FA 3OF5A 2FE4A 4W5JA 5C1BA 1NIPA 3Q7QA 1Z29A 1Q0UA 1CJTC 2NPIA 1B23P 3NEJA 2ZUBA 1O87A 2W2TA 3PIRA 2WAXA 2YWGA 4B43A 2X8AA 2QRNA 4OQFA 1RJ9A 4JL6A 4M4SA 1UBFA 5FUXA 4NU0A 3TJZA 4TMVA 3EASA 1IY1A 1OSNA 2BJVA 1IM2A 1TF2A 1D2NA 1MOZA 1VYVA 3W8RA 2CL6X 2O8EA 1D5CA 4QJ4A 2P6UA 4L4UA 3JVVA 3O8BA 1GM5A 1FPMA 3AGPA 1EFRD 4LV8B 5KPJA 2JLVA 1UF9A 1E9AA 2DWQA 1ZUIA 5JJIA 2REBA 1W1WA 2JLSA 2NZ8A 1KDRA 2KB0A 4KO8A 3SBDA 3TSOA 1DAIA 1QF9A 1SVLA 2VPPA 5CM8B 3BERA 4Z8YA 4BFZA 3B1WA 5J4YA 3J81k 2ZU6A 1M7BA 2ODWA 4BZQA 3THXA 4CT5A 3W6NA 5KTYA 1C1YA 3AH8A 2EU8A 3I4LA 1US8B 4GT1A 5G3YA 2OT3B 2V3CC 1E2NA 1SXJC 1ZD1A 4MGKR 2IL1A 2IBMA 2QAGC 3SN6A 4EKDA 1YR6A 4TMXA 5SZHB 4FN5A 1FMJA 1W0JA 3LBHA 4RY2A 2D7DA 4ZCIA 2QMUA 4BPBA 2F43A 3AB3A 2H8KA 1G7CA 1X8KA 1AJEA 2CEAA 3MFYA 2E87A 1JEEA 1F3OA 4S2EA 3A4MA 1XXHE 1UJ2A 2B6HA 2ZM5A 2GCOA 5GJBA 4HI0E 3SJBA 1Z08A 4Q4HB 2HLDA 1P7CA 4FW9A 3X1DA 5K8IA 4KAXA 1TL7C 4IOLA 2X77A 2D4HA 4DCUA 1OH8A 3S1AA 4ESHA 2EQBA 1TMKA 3K0AA 3ECCA 1PLKA 1EX7A 4JBYA 1W47A 5FBRB 2X1VA 221PA 4N0DA 4FIDA 4BWYA 2QMHA 4BUJA 3NDPA 1JALA 1XZPA 1GL6A 2N42A 3F5FA 4RCZA 1G6HA 1OFIA 2QP3A 3MRSA 3GLGE 3QSYA 5SZKB 4MYTA 3UIEA 1MRNA 1II0A 2EYQA 5KNCA 2A5YB 4N1AA 1J2JA 1SVSA 2MSCB 3BH7A 4V0ME 2NO6A 3TR0A 3VKWA 1JQJC 3NEYA 4NCHA 4PSKA 2BMFA 2UVQA 2GJAA 5EE1A 1QG2A 2PX0A 2LKCA 2DFKB 5GJCA 3WYFA 4O25A 3T34A 4PAOA 1G6OA 1XEFA 2RAPA 3TQFA 2FZ4A 3OAAD 1ETUA 3A36A 3M0EA 3LV8A 1G8FA 3K09A 5HCIA 1VTKA 3KB2A 1CULC 3SJCA 3NBXX 1X86B 1K6MA 3UMSA 1VHTA 3PCRB 1KI1A 3AVQA 2HV8A 5FTKA 3P4YA 2GILA 3A8TA 5P21A 3UWKA 1CRPA 3QBVA 2GNOA 2GZHA 1NF3A 1OHHA 4BFVA 3KFXA 1OLOA 4DDVA 1IN8A 3EIQA 3LD9A 5KSOA 4X8OA 3T35A 521PA 1NVVR 5LBIA 1E96A 2HDNB 1XZQA 3EC2A 3HU1A 3ZZUA 2IYSA 2QY9A 2WSMA 2DWOA 2CCKA 3I5YA 5CJ2A 2YINC 4GFDA 2WM9B 4QGAA 2IXFA 3BFXA 4ZI3A 2XB4A 5GJWC 4CZ2A 4UXJA 1P9WA 4FCVA 2JJ1D 1JB1A 3FHCB 5JWHA 1GKYA 1G1MA 2G1KA 1VPLA 1IXRC 3EA0A 3GLGA 4IDOA 1HH4A 3DO6A 3MGCA 1TQDA 3WHLA 5JI2E 5DN6A 1N0WA 5J5CA 2NTYC 4UXIA 4AK9A 2ODBA 1GVNB 2XOKA 3MMPA 4MITA 4B35A 2HLDD 1KK1A 2ZUDA 2I3BA 1YR7A 3GLFA 2AR7A 5EUMA 1IXZA 2QNRA 4ZDWA 3BBPA 5AUNB 1NKSA 4LDJA 3Q7PA 3KX2A 1Q3HA 4RD4A 4RZXA 5EE0A 4QNMA 4BLTA 1C9KA 3GEEA 4XSHA 5DIFA 2QL6A 5BW8A 3TW8B 1JJ7A 4IKEA 3RABA 4D4KA 5KDLA 4TN1A 4HLQB 2V1UA 4DDWA 3KJHA 2Z0MA 4C0SA 3G82C 1BMFA 1GP2A 2GXUA 2J59A 2QZ4A 4D0LB 3GJ4A 3OEED 2JLZA 1E2HA 3DOFA 4G01B 1ZNYA 2WJIA 4EPVA 1W36C 2GF0A 4GNKA 1E9CA 3L82B 5G41A 4HAXA 1P61B 5BN3A 3OEHD 1L4UA 4WZ6A 3THWB 4Q1EA 4TTPA 4IVQA 1G291 4ARZA 5B58C 2ZUCA 1ZC3A 3NTUA 4KBFA 4FMBB 1R2QA 1XCMA 2FFBA 1R0WA 1E0JA 1LF5A 1N6PA 3LH5A 4B33A 4LV5B 3U61B 1D9XA 3PUVA 4FMCF 3TBKA 1Z0KA 1SGWA 4TL6A 5AUPB 4HDQB 2J41A 1T91A 4OL0A 3LLUA 3UK6A 4A0HA 4BFYA 3RNLA 1D6JA 1KDPA 1KZ7B 4Q7KA 2BV3A 2IWHA 4BEBA 5JJKA 4GPTA 5CK4A 4PC2A 3PVSA 2IEYA 2OZEA 4O2LA 3VX3A 5FTLA 2NOAA 3VR1A 4URWR 1KJWA 1E9RA 2WJVA 4KITB 3TUZC 4U00A 1I2DA 1ZVQA 4LI0A 1FUKA 4E07A 3AKEA 1WQ1R 4WXRA 1OE0A 5DO9A 3TUIC 4P33A 3A6PC 2ATVA 4WW0A 2PCJA 1S9HA 5DYIA 1CR1A 3LXRA 2ZITA 4JBWA 4ILEA 4URYR 4B34A 4RKEA 3IGFA 4R71A 1ANKA 3FHOA 3ADBA 3ND9A 3PFIA 2OCYC 3I62A 3A4LA 2ERXA 2WOOA 3I92A 4G0NA 2ZTSA 2DFNA 4HATA 4QBIA 4AKGA 2EWVA 3GJ8A 2GAOA 3SNHA 1N25A 1JR6A 4I1UA 3SHFA 2FG5A 2J7KA 2QBYB 5FOVA 1E9DA 1JEDA 1A4RA 3QKSA 4JJZA 2ZQ5A 3MJHA 2PL3A 3LLMA 4LJ9A 4B73A 3VKHA 3GLIA 4O2RA 1E0AA 2UKDA 2HXYA 1KOFA 3HU2A 4AG5A 1BYUA 4PZYA 3WRYC 1N3BA 5D3MA 2WWYA 2XXAA 2YYZA 3MWLA 1AGPA 3WYGA 1R0ZA 4CW7A 4IXMA 3T1TA 1HTWA 2BCGY 2P5TB 3THYB 1XJQA 2OLKA 1Z0FA 2UZ3A 3SBEA 2YKGA 1RC8A 2O8EB 5DH9A 3GCGA 1KNQA 1IXSB 1UM8A 2A5DA 2W6JD 2YNMA 4F93B 3QE0A 2GF9A 4D82A 4PHFA 1F2TA 3AVXA 4IDHA 3W5JA 2XNSA 1QHYA 2IXGA 1GKIA 3C5HA 2WMNB 3HU3A 2FPKA 4JT4A 4PC1A 3L43A 3MJRA 3QNUA 3EPJA 4BFUA 4PHTA 1E3MA 2C99A 5J4HA 4LBVA 4Z1MA 2GRJA 5CB8A 3I8SA 2W6IA 3IUYA 4NDZA 2GJ8A 1JI0A 4R9UC 5JI3E 3RC8A 1ZUNB 4UNNA 4XWOA 4NYMQ 3PEVA 5J4KA 5FI1B 1SXJD 3VR2A 3PJRA 5JSZA 1XEXA 3EWSA 1R10A 2XZOA 1L4YA 4GSYA 4CEJB 4PSAA 1AA9A 2J0UB 3VR5A 2VRWA 3K8YA 1ESMA 1R4AA 1KI9A 1GOTA 1YZGA 1NBME 4BRWA 2G77B 1E2LA 1VIAA 2BC9A 2PCLA 2IHYA 1COWD 1U99A 4A9AA 3OE7D 1OXXK 1HEIA 1HE8B 1SVOA 1LS1A 1KZGB 1XD2A 3E70C 2W0MA 3CNOA 5FBQB 2QE7A 2IK8A 4DEYA 2YOFA 1SXJB 2ANCA 4M9QA 1MRSA 1UDWA 3M1IA 1CR2A 4RD0A 2C9YA 2PMDA 2NG1A 2WKQA 4TTRA 5TXGA 5IF9A 1HE1C 4W9MC 1W36B 3HR7A 2PJRA 4P4SA 4EJSB 3FKSA 4KV9A 1E9FA 2ZRHA 2ZU0C 3AUXA 3CO5A 2XGJA 4XD7D 3Q9LA 3WY9A 2F1JA 1K5GA 3FFBA 1NN1A 1J7KA 4D81A 1CP2A 5CJPA 1AS0A 2MSDB 4YMUA 4AYXA 5HZKA 2ZI9A 1U81A 3VR4A 2XNDD 4AD8A 1M2OB 4LYAA 1X3SA 3KXKA 4V02A 2CVHA 1QHNA 2QU8A 3B8HA 1KO4A 2PJZA 4KXFB 2HF8A 5L3RA 4C0AC 1XXHA 2VF8A 1JAIA 5CK5A 4XOIA 1G7RA 5JHHB 5G40A 1XTRA 5DSZA 3UMRA 5JBQA 1GNQA 3EPLA 2ZETA 3W6PA 2CE2X 2W58A 1Z6TA 2WAYA 4DLZA 3G0HA 2JLXA 3EPHA 1VMAA 1D8TA 1CJUC 2F3RA 4BFTA 4M53A 3U5ZB 5DE3A 4TQAA 1UEIA 1W5SA 4M1SA 1NMYA 2JJ2D 4LY6A 4DCSA 2OUKA 2A3RA 2KBFA 2QORA 4PHGA 4RZ2A 4B3DA 4P3YA 2DB3A 1XF9A 1RVDA 2OFXA 4NYJR 1OJLA 1A7JA 1ZYUA 2OBMA 1Z0AA 2BVNA 5C4GB 1BMFD 1WP9A 2WKPA 3U6BA 1ZNXA 3W3ZB 1LW7A 2BIFA 4Q1FA 4BLPA 4GL2A 3MD0A 4GZMA 4TYQA 3ZH9B 2OE2A 2G88A 4X8LA 3C8UA 4B3XA 3ZS8A 5G3ZA 821PA 2BMEA 2Q3FA 1DO0A 3K70B 5FUYA 2QROA 1P4SA 4ZKDA 5JEEA 1JR3A 3HPRA 1G8YA 2O8DA 4I4LA 4NH0A 3Q5DA 4URXR 1GRQA 1XMVA 3VNUA 4TMKA 2IYLD 4D4LA 3T1OA 1Q1EA 4A0GA 4F38A 4O3MA 2AFIE 2G0NA 4URZR 2DCUA 1H8HD 4HLCA 2O8DB 1KKMA 4DSOA 2Q3MA 4BFSA 3OAAA 3RSOA 2PBRA 1KDTA 3R8FA 1VG9B 1FP6A 1A5TA 3LA6A 3QKSB 4TQUS 5LD2B 3IDQA 3PUYA 3U3RA 2VA8A 3QEJA 4AKHA 4HUQA 3KFVA 4TL9A 3W8NA 1G3IA 1JPJA 2MMCA 1AIPA 3P27A 3KQHA 4Q7LA 3DMNA 2V1XA 3SQXA 2VIIA 5F9FA 1DG3A 1CEEA 4P32A 1XD9A 2ZE5A 4OHWA 4GMXA 1KIMA 3ZJYA 3GEHA 1NY6A 2NGRA 4I1SA 2Z4SA 3NBZC 1GUAA 3OFNA 4M21A 1F5NA 1X8LA 2GXSA 1U8ZA 3EA5A 1QHHB 3MWKA 3B82A 1TU4A 3EZ2A 1KKLA 2Z5FA 3K53A 3GPLA 2QAGA 4NMMA 5L8VA 4JYCA 3BIFA 4B3BA 5C4MA 4FCWA 5TMPA 5F9HA 1E1RA 5JEDA 4MYUA 3P4XA 1FUUA 4TMWA 2HT6A 1U90A 3HR8A 4DEXA 2P65A 3LQQA 2KE5A 3SYNA 4TYWA 3DEFA 1CLUA 5SZIA 1QBKC 1AQYA 2C5LA 2OG2A 4UQOA 2JLUA 2H18A 3R9IA 3AP2A 4HAWA 4I1VA 5CIWA 4Q7JB 3QBTA 5DI3A 3ZVNA 3SR0A 2D74A 2OXRA 4LJ6A 2IC5A 3ZVMA 1GSIA 4L8GA 1RPZA 1DO2A 1S1MA 1W48A 1EG7A 1X1SA 2ORWA 2CK3A 1AS2A 1R5NA 2CL0X 3H86A 1G17A 1LS6A 3C41J 3IQWA 4A6XA 2YOHA 5A5GA 4JLDA 4DKXA 3UPUA 2RH5A 2OESA 2VP4A 3CPHA 5AJVB 3CRW1 3OESA 5J47A 2QPOA 1JECA 3TSZA 1CXZA 5EE5B 2AWNA 4Q4JB 5E7IA 4A1FA 1N6OA 2BMDA 2FFQA 4IVRA 2ZRKA 5IK2A 1E2DA 3OEHA 1XMSA 1YU9A 1E2QA 1YRAA 4I99A 5K8TA 1R5BA 3W34A 3P1JA 4IEEA 2O8BB 2WOJA 3QXHA 3ASZA 1NVVQ 3WP0A 3BRWD 1A2BA 1S3GA 2ZIAA 4B75A 1OKKD 4WVFA 3L0SA 2WBLC 1N5JA 1NSFA 2IYTA 2GBLA 1XNJA 4LHWA 1U94A 5JSZB 1W44A 1DVRA 4WZAE 3F8TA 2GEVA 3VU9A 1E1RD 5LPNA 2V7QA 5EQTA 1FTNA 3Q3JB 4D2IA 4TZ0A 4L15A 2WWFA 2VSXA 4OQMA 5LDDC 1VG0B 4LWZA 2FFHA 2CHGA 4JS0A 3FE2A 4XTCS 4MRPA 2WJGA 4KSBA 4RVCA 4X8MA 1OIXA 2GXQA 2XTMA 4P0TA 5TVKA 3QXXA 1G8HA 3R9WA 4L16A 3QY0A 2O8FA 3PXGA 1XCGB 4LC0A 5B30A 2XTNA 4C0QC 2CCJA 2GZDA 3L8YA 3DOEA 1AQUA 1OKKA 4EJSC 4RFVA 4Q1BA 1T0HB 3KJEA 1J8YF 3CPJB 3CW2A 4WA7A 4EPWA 4DUGD 4CIDA 4PO9A 5JWRA 2OCAA 3CRVA 3DKVA 3V4FA 4OI2A 1KK0A 4K46A 5FTMA 5KSPA 3SJAA 2G3YA 2WZQA 2QM8A 3GEIA 5AWFC 1TUIA 4Q9LA 5KNBA 4YMSA 2QTHA 2OBNA 4EFLA 4Q66C 5KHOC 2RGNC 3B85A 4HUQB 1KI7A 1P60A 2QAJA 3BK7A 4V0MA 4IHQA 2FV8A 3GLIE 3AQ4A 1UFQA 3H4MA 2D62A 1SVIA 5C46F 2ZRNA 4PO8A 2XEXA 3LY5A 3V9PA 2RHDA 3IIKA 3BJIC 2VF7A 2ZSBA 3GLFE 2VHTA 1F2UB 4Q9HA 4M1OA 1N6NA 3NH9A 2GK7A 3RS3A 4TYNA 421PA 1WB9A 1KHTA 1G16A 1SZPA 3NXSA 1Z83A 4MA4A 4Q9IA 2ZS8A 3P26A 4BFWA 1W36D 2HEIA 2IT1A 3R20A 5CLQA 1E9BA 1FNNA 2ATXA 1V43A 1UKVY 2JA1A 4ZIRB 3SFZA 4JLPA 2QGNA 1JNYA 2REXB 1LNZA 4FMCB 5JJLA 5H68A 1AGRA 3CX6A 4G5GA 5GADl 1NLFA 4UNPA 1Z06A 1ZD8A 3W90A 4YMWA 2QGZA 3ZIAA 1J90A 4EJSA 5BN5A 4JLKA 4TLAA 2E1RA 2EFGA 6Q21A 2NO7A 1ZD9A 4IDNA 3A58B 4CEIB 1QDEA 2XJ4A 2F7SA 1SXJA 3IKJA 3TAUA 2FSFA 5KO2A 1PLLA 3SOPA 1II8A 4G3XA 3AVVA 1KAOA 3CBQA 1E0KA 1YHNA 1JAHA 1II9A 1U0LA 4QGGA 4YXWD 5TV2A 4BLRA 4XIGS 5FPKA 3IBYA 4R98A 3P20A 1W5TA 2A9KA 3CM0A 2XSZD 4LPKA 3VR6A 1D2MA 4JL8A 1ZCBA 4NP6A 3RANA 4UNRA 2IYUA 1D2EA 4DLSA 5DN6D 2OEPA 4D6PA 3JZAA 2RGNA 5HCNA 3RYTC 2PLRA 4URVR 2ZANA 2QQ0A 5CLLA 4DSUA 4JLOA 1OFUX 4KFTA 4QJ3A 3GLHA 4YC7A 3QKUA 2B92A 1FL9A 3LWNA 4KLNA 3BORA 4A92A 3AF3A 1EWRA 1FMLA 2WPDA 2ZPTX 3FMIA 4L9SA 1IHUA 4YDHB 1G8GA 4P4SB 2CHVA 5AUOB 3THWA 2PEZA 5H1YA 2VYFA 1VCIA 1VYTA 4DXAA 2IYQA 2LCFA 1GWNA 3THXB 1E2JA 3X1XA 1VCOA 4DDTA 2Z6VA 3ZD7A 1TPZA 3B1ZA 3DZDA 4QHYA 2C77A 1TAGA 2BBTA 3X1ZA 1BOFA 1W4CA 2WSSD 3C15C 5DHFA 1XJCA 3SHWA 4A4DA 2ZYVX 3ZGXA 5L3QA 5IHPA 2RKOA 4BZPA 4NKRA 4B3FX 3REGA 5E95A 1XD8A 2RB4A 2Z4RA 1EGAA 5BYKA 4A82A 3B2EA 2UZIR 2ZI4A 2YC2C 2OFOA 2P6NA 1DAFA 2LKDA 2ZI7A 5K8UA 3KKQA 4CEJA 1KSHA 2FJUA 2YJTD 2YV5A 1NRJB 1N0VC 2H1LA 4LJ5A 4MRNA 1A1VA 3EZ6A 4WXPA 3GLFB 2AXNA 4C0KA 3HPQA 3AVTA 1YR9A 5E3HA 1MO3A 3B6EA 4BZXA 1FZQA 1CJKC 1ONBA 4LYHA 3GJXC 1RJ9B 4DUGA 3GFTA 4QBHA 1YR8A 5FL7A 1NN0A 2YWFA 1GIAA 3CRRA 2XNDA 1AN0A 3C7KA 2GWHA 2J7PA 5DNYB 1AKYA 1OIVA 4H1UA 4II7A 4NZYA 3GLHE 3GLHB 1FP7A 3QQ5A 2V8OA 1UKYA 2GJKA 3SFVA 4QKQA 1YRBA 5H70A 1HQCA 1RRCA 1XP8A 3DM5A 1I4DD 3WMFA 1F60A 4GRAA 4RFSA 3I5XA 2BKEA 2R62A 2OO7A 3T5GA 1FTSA 1AKEA 1OFHA 2YHSA 3UWOA 2HYDA 2J5XA 4GI7A 3TR5A 3K0SA 5D3MB 2XXAB 1NMZA 3G5UA 3GJ7A 4JLJA 2R44A 4JVLA 4A8JB 4JBXA 1T3HA 3QVUA 3OEEA 5JS8A 3PQCA 3AKDA 2ZRIA 4D26A 2KJQA 2V9PA 3OZXA 1XRJA 1ZU5A 4EFMA 4NYIR 2QPTA 3LNCA 1R0YA 2WWIA 4ACBA 4B71A 3EIHA 3AKCA 1J8MF 2G83A 2VQSA 3UATA 2AKAB 1DAKA 3DL0A 3U7HB 3A1UA 3W9YA 3AVPA 1WBBA 2ZRPA 4LJ4A 4B32A 1RRPA 1WCV1 2ZRAA 3X1YA 4LSGA 5F98A 3LW7A 1LTQA 3GJ3A 3U44B 1IN4A 3Q85A 1IQPA 3K1JA 2RMKA 4F91B 2OXCA 2P0EA 4NCJA 1U0JA 3U44A 5KUTA 3F0TA 1E2KA 2XITA 1NVXQ 1DS6A 4M9ZA 2J45A 4NYJQ 5GVSA 3U6KA 3O8RA 3CR7A 2O52A 1RIFA 2O5VA 2Z43A 4C2TA 3R7WB 1NL3A 2ASEA 5SZJA 4E09A 5IT5A 1E69A 5BYJA 5KNDA 3I1FA 4LOAA 1KY2A 3GJ5A 3QKRB 3K09C 1LVGA 1KMHB 4ACAA 4DC9A 3AVWA 2BEJA 3K0AB 4MKFA 1EFUA 1M8PA 1XD2B 1II8B 2FGJA 2XZPA 3B7GA 3AM1A 4BASA 1N6LA 1OYYA 2BWJA 4HDOB 4ZPXA 1JBKA 4HZUB 4B48A 2ECKA 1W2GA 2H17A 1G41A 1EXMA 1Q1ZA 2CCGA 1U8AA 1Q57A 1E2EA 4B6EA 4PR0A 3EZ7A 3A1VA 2ZYTX 1EWQA 1E99A 1CJVC 1W0JD 3LXXA 4IOMA 4AI6A 4H9GA 1RE0A 4RZ3A 3B1VA 2GKSA 1IJEA 1Q3TA 3ZZTA 5JZVA 1Z22A 4F4JA 2VP2A 1JJVA 1MV5A 2F9LA 1CS4C 1E0SA 3EAQA 1FW6A 1NJGA 5GJVC 1LFDB 2JCSA 4GOKA 5BN4A 3AGQA 5EXPA 3SQWA 5K8LA 1E2PA 1IBRA 2IWRA 1ZBDA 1S4QA 3DKPA 2ZJAA 3U3MA 1WRBA 3VFDA 4MKIA 2GAAA 2C9CA 2GEUA 5KU1A 1YJ5A 3LVRE 2WV9A 1OYWA 2HJGA 4TT3A 4L5BA 4TZ6A 3U7FB 2PT5A 3RS5A 2WIBA 3ONWA 3TAHA 3K0FA 2QTFA 2EW1A 5IRCD 4YMVA 5TDHA 1W46A 4NL4H 2OFWA 4XSGA 2JJ1A 3QXJA 1Z5ZA 5JMTA 1TF7A 3KKNA 1Z6GA 1G21E 4PAQA 2IS6A 2KBEA 4R2IA 1HY3A 4A6PA 1CRQA 4TMTA 3K0FB 1TQ2A 4A2PA 1P72A 3JZMA 5LD2C 2QM7A 2FH5B 1IOZA 1XB2A 2VO1A 3OHMA 4E03A 3AF4A 4OJKA 4M1KA 4LBYA 2JATA 5HE8A 4DLTA 2A78A 1UDXA 1P3JA 4V0OA 1Z8FA 4V0KA 1R0XA 3ZIAD 4DCTA 5AUQA 2D2EA 4MYHA 1QHGA 5L3QB 4C4PA 4JSYA 1WDTA 3AKYA 2J46A 5JCZA 3GLIB 4I1OA 2BOVA 4IW3B 3NVAA 3VX4A 4B76A 2IX3A 5ELXA 3K70C 1MO6A 3WNCA 2NO0A 3X1WA 1E1QD 1YZKA 1RYFA 2I4IA 4C7OB 5EXXA 2QA5A 2AXPA 4G5SA 4JVNA 3RWOA 2BHRA 2ZSEA 2N46A 4CRWB 1EFRA 1XPUA 3QJYA 3WBKA 1KMQA 4M9XA 1R8QA 2G1JA 1G3MA 3U2QA 4Y0AA 1XTIA 2GJ9A 3FMFA 1M34E 2FGKA 2ZRFA 1EESA 1R5OA 3S1AB 1YZTA 4ZDJA 2A2ZA 2ONKA 2C98A 2GESA 2P3SA 1FNMA 3B9PA 4TYPA 4XTRA 1KY3A 1DELA 1Q22A 2WJYA 4HEJA 3Q5EA 4D4JA 1Q12A 2C8VA 2QRZA 3T61A 3PEWA 2O8BA 2ZE7A 4G5QA 1DAGA 4TSFA 4LK2A 4ZDIA 1UPTA 4XWKA 3MSXA 2O8CA 2HT1A 2VP6A 5L3VA 5EE3A 1ZIPA 3DVLA 4JT2A 5CITA 1QHHA 2X2FA 4TLCA 1SULA 2ERYA 2JDIA 1BS1A 4QL3A 1KO1A 2CBZA 3KJGA 1ODFA 2GDJA 2Q9CA 1M1YE 2DWPA 3CWQA 4Q9JA 5AJZA 1OB2A 2AX4A 3EPKA 3IIJA 1NN3A 1TQ6A 3CX8A 4TL7A 4DZZA 3BFVA 4QFMA 2BKUA 4H1VA 4IEIA 3OFND 1SQ5A 4EUNA 4UKDA 4GOXA 3CNNA 1M74A 3CRQA 2OAP1 5JWOA 4HUTA 2V54A 1P62B 2V6JA 3PUWA 4O0MA 1XU4A 2OHFA 3QPVA 4BFXA 1LV7A 2WJHA 3RS7A 1WBDA 4A15A 3I72A 4OHYA 4Q4HA 4HYYA 3KKPA 1CJMA 4M0LA 3V00A 3VMFA 2HUPA 2ZSAA 3K0CA 3I32A 5J4LA 2V7QD 1HUQA 4RZUA 3UG7A 1F6BA 4LZZA 3UG6A 4HDCA 2F1HA 1HYQA 2FOLA 2CLCX 3TW4A 5JCPA 3T5DA 4JVMA 4LBZA 4P31A 4URUR 2W00A 4KFUA 1OFTA 4NCIA 1OIWA 121PA 4OK5A 1E79D 3ZQJA 4RD1A 5AR1A 3QF4A 2L0XA 3HWSA 1XWIA 1E6CA 3KB1A 4TLEA 5FOSA 2O0HA 1DADA 4B2LA 3FTQA 5UKDA 2JDID 4EDHA 1TNDA 4US2R 5G53C 2HCJB 2QT0A 2TMKA 1UEJA 4D4MA 5C18A 1LY1A 3VU9B 2VH5R 3WMEA 4WZBE 5IDVA 2F1IA 3K0CC 3N70A 2E9SA 2DFLA 4M9SA 2QUZA 1GL7A 4LYJA 1UKEA 4LHVA 4OHXA 1IJFA 1U2RA 2Q3HA 3KJIA 2AHOA 2QEQA 4B6FA 5JRJA 1DE0A 5TY0A 1XJ0A 2CJWB 5CYPA 1XXHB 3A1TA 1NI3A 1UADA 2C03A 2D3WA 1NKTA 4XD7A 3WRXC 4NYMR 3AVYA 1H8ED 3LRPA 2GVDC 4HB3A 4EPTA 4TYYA 2NQ2C 3REFA 1Q1BA 1T6NA 2NIPA 1L2TA 1Q21A 4PC3A 1GNPA 1S1CA 4A0RA 4D0GA 4XJXA 2J87A 1VCNA 4ASUD 4N0EA 2PZEA 1CF4A 4PXAA 4Q4LA 2ZAMA 3EC1A 4Q1DA 5LB2A 4NONA 1W4BA 4ZO4A 1GZSA 3NC1C 1AZTA 1OT3A 3FMOB 4KFSA 4RD3A 3CPEA 4Q47A 3QXCA 1P6XA 5A4JA 4B47A 3ZZ0A 2K5UA 3GJ6A 2CLSA 2QP9X 4QBFA 2ZYUX 3EZFA 1SKYB 5KSYA 4JLVA 3B13B 4OK6A 1RYHA 5FFMA 2JJ2A 4DWJA 1IY2A 3TIFA 2ZVQX 4PANA 1EK0A 1EFCA 2IYXA 2F55A 2P6RA 3PEYA 2AK3A 4KI0A 4W5HA 3ZD6A 4C7OA 3Q72A 2ORIA 4EAQA 4GBMA 3VTKA 4OI1A 2FWRA 2FEMA 3QPWA 5BXQC 4BE7B 2QAGB 1G18A 2JLYA 3TSWA 3K9GA 5FI0B 4JVSB 4QOSA 4Y0VA 2GK6A 1G5RA 2BJWA 4KLZA 2AKYA 4TWZA 1KO5A 4GZLA 4ABYA 1Q20A 2H5EA 3ZVRA 2HF9A 3KQLA 2AD1A 1XMIA 1G3RA 4TL8A 3V4RA 2YVUA 4M1MA 3DMDA 4QHTA 3AVUA 1JR3D 1KK3A 2OILA 4ZV4A 1J99A 3RDPA 4PPQA 1KNXA 3ICQB 2ZRJA 4C9BA 2IYYA 2P67A 4NE2A 4JLAA 1GFIA 2CMKA 1DAMA 2B8TA 3BB1A 3NKVA 2GVZC 1FOEB 3EWAA 4Q1CA 1Z0IA 2CK3D 4DIEA 1P75A 3KXLA 1YZUA 3BGWA 4NPHA 2F9MA 5HKKA 2WJJA 1OH5A 3AF0A 1OV4A 4HLDA 2IEZA 3PV0A 1F2UA 1TX4B 4Q19A 3BD9A 2EWWA 3B78A 5HE9A 2YC4C 3KKOA 2JAQA 4JKYA 4OI4A 1T9HA 1KTVA 1S8FA 2CLDX 1BKDR 1SXJE 1KI8A 2AFHE 2Q9BA 4A0FA 2DY1A 3KKMA 3CF2A 1IY0A 4DJTA 1M7HA 4ON9A 1PV4A 2J0VA 3IO3A 4NTZA 5D3QA 3ASYA 1KYIA 5FR1A 3EG5A 1W7AA 4LJYA 4KBGA 4MUAA 1RRFA 2QBYA 1N6KA 2AK2A 1L7VC 2XSZA 4QRHA 2MSEB 1QHIA 2X19A 4RCYA 2Q6TA 4FMDF 3HYRA 1GG2A 1E9EA 3QF4B 3W3AA 4UNSA 3RWMB 4JIMA 1Z6AA 2QQEA 1F2TB 4FMDB 3B5JA 4HZUA 1Z6XA 1GKUB 2VSFA 4DB2A 1IAQA 2ZJ2A 1UAAA 4MKHA 4TLDA 4AKIA 5FOTA 4GP7A 3EW9A 1E9SA 2O0JA 4IDQA 3E5HA 5TARA 4MGZR 4DIDA 2HJVA 3QKRA 1E94E 1E4YA 2OLJA 2Q9AA 1ZMXA 4CEHA 2H57A 1KJYA 2DR3A 2VHCA 4B74A 3K70D 1SKQA 4BEJA 2ZXUA 1XEWY 1SKYE 2B8WA 1VECA 3KTAB 3LX8A 4ITRC 4KVGA 1P9NA 1TADA 4MQBA 2Y8EA 1XPOA 4KSCA 1YKSA 4PAMA 1X6VA 2W0SA 4FWTA 3NG1A 1Z2CA 2KWIA 4YMTA 4JYBA 2NO1A 2ZJYA 2SHKA 1DARA 2FX3A 2ZRBA 1U9IA 3K9NA 1IN7A 4XWAA 2IW3A 3FYHA 4LUCA 4NCNA 2ZJ5A 4GP6A 2FPLA 4PQRA 4Z1MD 5FPHA 2ANBA 5E4FA 621PA 2KSQA 4LGMA 3U60B 1Y63A 3LFUA 3H2YA 3PUZA 3MWYW 3U3KA 2ZS7A 3F3YA 4PPFA 4US0R 4YQFA 2RGBA 4KFRA 2V55B 5JFGA 2FMXA 2PMKA 3LDAA 1NJFA 3EX7C 2J0QA 1KO8A 5LB4A 1TEVA 2NO9A 3D8BA 4RD6A 3VKGA 3RLFA 1G9XA 1ZRHA 1KI2A 5FBLB 4HLUC 1Y3AA 1XX6A 4RFSB 1KI4A 1PLJA 3AP3A 1G7SA 2PX3A 3BXZA 3TNFA 4C0JA 4FD2A 1A2KC 1NVUQ 1L8QA 4PQYA 4I81A 2OAQ1 4HAYA 4PTLA 2YZ2A 4DCVA 1XEXB 1T0JB 3L2OB 4Q48A 2WTUA 3RRMA 3CH5A 4QGFA 4KJZA 5DI3B 2RGAA 4OQNA 1F48A 4ARZB 4QBGB 1K8RA 5KOYA 4DSNA 2EFHB 3E1SA 1US8A 1E98A 2C04A 1ZCAA 2XOKD 4PC6A 1Q44A 4DLUA 2ZI5A 4IOJA 4L9WA 1OXVA 3TGPA 1KJZA 3QG1A 4IRUB 1P5ZB 3AUYA 1B0UA 3WBJA 2WVJA 3DM9B 1KI3A 3HJNA 2NMVA 1DOAA 2FN4A 1FX0A 3T06B 4Q9KA 3VAAA 1XBTA 3IPXA 2AN9A 3LW8A 1T5IA 3ZVLA 3H1TA 1QG4A 3SI7A 2CHQA 3O8DA 1ZINA 4Z51A 2ZREA 4TQ9A 3B1XA 1VIYA 4HAUA 1P2SA 2A30A 4U5XA 1NLYA 2WICA 1T4GA 3CKLA 4KHZA 3UXMA 3WNDA 4DLXA 2WKRA 2JIZA 1T8UA 1W0KA 4RKFA 2AD5A 1RFLA 3QI2A 1HV8A 2D06A 2XJ9A 1NG1A 3U4QA 4DBLC 3U7GA 3BB3A 4G5OA 1N6IA 3TMKA 1R8SA 2FA9A 2Q0HA 2W2VA 2R6FA 5EXTA 4AC9A 1SVKA 1Z6YA 4RJLA 2ZJBA 3FMPB 1MT0A 3BB4A 3MAAC 1VYUA 3FFAA 3THYA 2WSSA 4G5RA 1XMJA 3OIUA 4S35A 5FPYA 4BECA 4E22A 3SEAA 4C0BA 1NMXA 2CDNA 3CUEF 4EIWA 4BLQA 4HAVA 3ZS9A 1GDDA 4MH0R 3TVTA 1WMSA 2FU5C 2QMEA 1BIFA 3I73A 2D7CA 3OIYA 1OW3B 1NN5A 4EPYA 1QVAA 2CNWD 1E79A 2C95A 4XH9B 3QXSA 4LHZA 3QVVA 4RD2A 2W83A 2BCJQ 4OHZA 2B7CA 2HXSA 3U7EB 2GA8A 1CTQA 3NIBA 5FUVA 3T12A 4AWXA 2AWOA 3K9HA 3SC3A 3WYAA 4ZKEA 3D31A 3ZQ6A 4F7WA 4DDUA 1EFHA 5B64A 3NDBB 2ZVPX 3SS8A 1IN5A 2RGDA 2YWEA 4M8NE 1JXMA 1ZIOA 2ZR9A 1OB5A 3A37A 1VG1A 3BWDD 3OIVA 2VSOA 4OHVA 1ZU4A 3AVOA 1RW4A 4LHYA 1TU3A 3IEUA 4LJAA 3I61A 5DHAA 5EUQB 4JJKA 1GAJA 3O8CA 1COWA 2BBWA 1NBMA 2IF0A 1OHHD 1QZXA 1ZW6A 3D3QA 1KMHA 4PSVA 4EQ6B 3ADKA 2NPFA 5AK0A 2J7PD 1XTSA 4ZI2A 3EARA 2VP0A 2C2HA 3RSLA 2CE7A 3R7WA 2F3TA 1ZNZA 4Q21A 2WWXA 4Q02A 3CONA 5E7JA 1QVRA 5F3WB 2KI5A 8OHMA 1J70A 4HB2A 5JECA 2QMOA 3UKDA 1VDZA 1MO5A 3VNVA 3HYTA 3TLXA 1Z07A 1GRRA 2VP9A 3L0PA 4HZIA 2IA5A 2R65A 1KI6A 3WMGA 2J1LA 3DDCA 5E7MA 4POAA 1KDOA 5BWMA 3PG5A 1E32A 1BO6A 1OXTA 2FSHA 2IS4A 3KQKA 3TE6A 2C78A 5J40A 2IXEA 1TQ4A 3PENA 2J0SA 4OKSA 3QIAA 1YQTA 1KI6B 4OQXA 2ZRLA 3SU8A 2MMGA 3TUJC 1A82A 4ESVA 1O3YA 1VKJA
chains in the Genus database with same CATH superfamily
4ZAWA 4ZHQA 3ZJVA 1BH6A 3QRWA 4ZQGA 4FOOA 4OUDB 2IH4A 2ZROA 3WYEA 3WGZA 3F73A 4LJRA 2X13A 3B6JA 3RRJA 2HIHA 1Y48E 4Z86A 3EZ9A 1UBOS 3D6TB 1DAHA 4HD8A 3QWHA 5EYPB 2FPPB 3MJDA 2DULA 4L95C 5K2OA 3UQYS 3AOEA 2V6IA 3HJBA 4D6YA 4RDIA 2UU9B 1RRGA 3ENQA 1L7XA 1DJQA 3QNWA 3TK1A 4P58A 4TQGA 4NIMA 3FA2A 4NYIQ 1M34A 2WE7A 3FR8A 4KTTE 1LRLA 4EF6A 3P9CA 1M1NA 4KN5A 5CT5A 5EUCA 2ZS9A 1YE8A 1CUCA 1VBMA 4E7PA 1JQDA 2IV2X 1R37A 2PZGA 1N2IA 3FCUB 4ER0A 1YB6A 2C96A 1L7DA 1ENZA 3B20A 4PNPA 4D9NA 3VSAA 5KTNA 4EZIA 4CWAA 4I1RA 3ZWMA 4PS1A 4JKIA 4HNTA 4TSFD 1NKVA 1UXIA 2VQ3A 2Y1LA 5DHRA 2W2XA 4YWJA 4JI6B 4YT4A 4GUDA 1CJCA 3RKUA 4MS4A 3E7FA 4XKJA 3OHPA 5TMDA 1RCUA 3H0KA 2C7VA 1JQAA 3HXPA 4GOOD 4KVAA 1MW9X 5LBUA 3TQIA 5JATA 2P7IA 2R11A 4KE6A 5K0EA 4XVRA 2YWHA 1CP3A 3QEMA 3WQBA 1G0NA 2GARA 2GMWA 4W7SA 3TD2A 3VO2A 1ZJ6A 3LIPA 1KQOA 4IJVA 4PFQA 2BSQA 4YRBA 1IONA 1YZLA 1ZD3A 5B1DA 4DEVA 3DXYA 5FR2A 3JQGB 1U2EA 3HCEA 4FWBA 2BM1A 4EGCB 3ZEIA 1SOAA 1UJ6A 5TQ0B 4D25A 4L85A 1MA3A 2QPAA 3FVRA 4BDTA 4CEIA 4HUJA 2DTDA 2LW7A 3C4JA 4P9NA 5CX4A 4GMDA 4R1NA 4OHOA 1ZQ1A 3IOMA 3VAZA 5CDSA 3G3EA 1WVMA 1NVBA 1RXSA 2LUOA 4J0GA 4TTQA 3NWPA 3ZBPA 4XVUA 5AHRA 4POOA 1RQGA 2EEPA 1BDMA 1FP2A 3EQ7A 3J81A 2Q1WA 3KWLA 3O7WA 1O95D 3E2PA 2W6JA 3H9CA 1EE1A 4BWFB 1JHXA 4KR3A 5C2JB 4IINA 5TPZD 1J5PA 4D5EA 1H66A 1UDCA 3QU7A 4AJJA 1FJGB 3VNBA 1QK3A 3JRWA 3EXIA 1TF5A 4JELA 4AM8A 3U1BA 2DCMA 4HB0A 1ZL2A 1N6RA 4HPWA 2WJ4A 1P2TA 1T8TA 4LGYA 1QPBA 5B55A 5CU7A 2IP4A 1Z2AA 3K16A 4OH1A 2GH1A 1G5QA 2Q5OA 2K4MA 1QIKA 3CH4B 2O2IA 2QRVA 2OBFA 3TTYA 4CIXA 3P0HA 4E5YA 3VC3A 4F9FA 1U4OA 3WHKA 5T67A 4H7FA 1ZAYA 3G9TA 1YVDA 3SEQA 4HSEA 4N49A 4LPSA 4UUBA 2PZLA 4BAGA 2E48A 4JK3A 5J2UB 1JQLB 2YZNA 4IYRA 3DNMA 5TGDA 4P0QB 2JF0A 3I76A 1JVSA 3WK7A 3FNGA 1KVUA 3DZIA 1N2SA 4PE5B 5DM60 5J2TA 5FA5A 2R4QA 4CCSA 3JRNA 4CTOA 4KWEA 4Y2GA 1EUCA 4L0QA 1G5FA 4RHXA 4BGEA 1EHCA 1BX3A 5LQAA 3A4IA 4LVOA 1MB2A 1H23A 3BH6A 3KOZA 4QOHA 3VR5D 4FXPA 3W5UA 4YRCA 3L4KA 1A8IA 3I5AA 4MNTA 2VHXA 3AV0B 2PDAA 2CV2A 1UJBA 1D8AA 2UUAB 3G5LA 4DV2B 4X65B 1NX6A 3HM9A 1I6LA 5DYGA 1JDZA 4PCAA 3U3XA 4DVJA 1Z63A 1WA5A 3NHAA 4IIYA 1MB9A 3I9OA 4OBWA 2Q5QA 3QEOA 1WUIS 3RYFA 4JT9A 1RCFA 2AL7A 3MTJA 1DPGA 2XA9A 3DFFA 1M2EA 4M2LA 2XB6A 3PEUA 2G1AA 2XE4A 5KYWA 3SF0A 4BTEA 2IGTA 4L0DA 2GHIA 4NZZA 3VSDA 3SJZA 5P8WA 4RMGA 3E03A 5SY4A 5CVTA 3AW9A 3HP1A 3V80A 4DYDA 4A10A 3RYIB 1JEYA 4LC9A 1G5PA 4CIAA 2WKWA 5TF0A 2ZRCA 4Y2QA 1BU8A 3QBDA 3DSRA 1ODJA 1B6GA 3R09A 4QNNA 4B3HA 1FDWA 4IDPA 2AR0A 5EQJB 4F7DA 3S8YA 4GOJA 1D6MA 5GVRA 2HWUA 2PFGA 2H7YA 5E0KB 3F3MA 3UT5B 2ODEA 5ESDA 2GEDA 3CF0A 1OAAA 4UZEA 5HZHA 4U2GA 3A4NA 3KTAA 1HA3A 3DPUA 4L50A 1F4VA 2G71A 5CNMA 3SHQA 4DUPA 1PJRA 4YJHA 1QCCA 4P4LA 2BYTA 4YT2A 2OZVA 3DPSA 1JYEA 3WQHA 3OZDA 3GLGB 4FYYA 1K8YB 4K6HA 3SQNA 1DEOA 2C3YA 1FA9A 1TVEA 4MZDA 1BX0A 3N07A 3KR1A 2E21A 5AFSA 1SUFA 3HR4A 3EVBA 4GVXA 3HKCB 4M1YA 4JLNA 2POCA 1JQKA 4AW9A 1ESNA 2K7FA 4RLHA 2WF8A 2A9OA 2AZTA 1OWMA 2CUTA 4NENA 3OJLA 3A05A 3JTMA 4Y2HA 5F2EA 4AF8A 4CCWA 3EXG2 2VTKA 3SE0A 3VPGA 4I0WB 2X7JA 1YA8A 2WT8A 2JCGA 2X6QA 3L02A 3P0IA 2FXIA 1O96A 4HDSB 5K0FA 4UMVA 1PJAA 3OPMA 1A8QA 2Y1GA 3F67A 1L4MA 4PRLA 4XOUA 5DHSA 1ODKA 1HLPA 2OCBA 1IN6A 4I9UA 2AJTA 2VYND 4D8VA 1PR6A 5JRZA 3VO9A 1EJ0A 4YJGB 2VJLA 5JJCA 1KZ1A 1EFPA 1PW5A 1XWWA 4F1KA 4GG1A 5FV7A 4N0QA 2K2QB 2IY7A 5E6UA 3GDHA 1NYQA 5AKEA 3IHTA 4J1TC 2GPAA 5DLDA 1PS0A 2FEXA 5ALHA 4Q01A 2PLFA 3QYPA 1QX4A 2CVFA 2PUHA 5CLJA 1PUJA 1JP7A 3FOZA 2FZGA 4B31A 3ZW7A 4Q6BA 3S2SA 4MDEA 5A05A 2A7QA 1DWPA 2C0PA 3DBLA 4G1UC 2XGGA 3E9MA 3AJ9A 3T7EA 3GMTA 2VF4X 4C3ZA 4Y2SA 1XPJA 3LDFA 4X7BA 3QKTA 4NBSA 4Q03A 2FP4A 3WADA 1EBBA 1UC5B 3IL2A 1I2AA 4MRRA 1P1JA 4X7RA 1VRCA 1RLOA 3PB3A 3O9MA 1Z6QA 3W5VA 3B6ZA 2FP4B 1TEXA 3I39X 2G0TA 2ZAOA 5FWYA 1EEXB 1YTUA 2X4IA 2HDWA 2J32A 4C89A 4QPDA 2JIZD 1J2TA 2FZLA 1ZP6A 2UAGA 1UBCA 5D3KA 1CY4A 3IPCA 4JJAA 4RTKA 1X1QA 3EXFA 1ZUHA 1M7GA 2EGHA 2ZSFA 5I9SA 4EFNA 3BK2A 1U4SA 3TVYA 2RHBA 5F3RA 4YMGA 4ZC8A 5A9TA 3VNAA 3HV0A 3NIDB 4QO7A 1RHMA 1KZ4A 1SIBE 2YJ5A 4MAAA 1DX6A 3P9RA 4MVJI 1JBQA 3FPCA 3NRCA 2B1IA 1Q1NA 3C3AA 4DZTA 3VR3D 3RVNA 2GJSA 4M7RA 1NM5C 4KYIB 3SIXA 4ANFA 2RHJA 3DEIA 3IESA 1QE0A 1YOBA 4U02A 4YLGA 4XWTA 1ABBA 4XW2A 2HNAA 2ZJFA 2E5WA 1KAGA 4H27A 2H92A 3KEQA 3VU8A 1OXBB 4C3UA 3MJFA 1J07A 1VPEA 2VZ0A 2HHAA 1Q15A 4JUBA 5B1EA 2ZJZA 4EQ6A 1N32B 2QV7A 2AFVA 1ZM4A 1GGFA 3M6VA 2D0DA 3FKSD 3ROMA 3FLMA 3AU8A 5KINB 3AOGA 2BFDA 2QQGA 3KT0A 3MUNA 5AHOA 3N5CA 1RFGE 1MQ8B 1T5OA 1E1QA 1QH8B 2IXDA 5CTAA 5ICSA 1JLKA 3DE0X 2QR5A 1HQYE 4E51A 2H08A 1SU4A 5EHNA 1P6UA 2V98A 3ESBA 2XT0A 4ZVNA 3BHJA 1M8FA 3TG8A 3JS5A 4UXHA 4L9AA 2JFOA 4GMKA 3NC0C 4LJLA 4BO0A 3VC7A 1PEDA 3NHBA 3HCFA 1WCIB 3CLTC 3DG9A 3PPIA 4BN4A 4EA8A 4MP3A 5E0OA 5HF6A 3UQZA 1ML4A 4B5KA 4FN4A 4M76B 2Q0SA 3OWHA 4BQNA 1I7PA 1SG6A 2NXNA 1C1XB 3FOCA 1U6KA 3I2KA 3RRYA 1DAEA 3UH0A 5AESA 4OGLA 5FA8A 1P81A 4HGQA 1NTRA 3MS4A 1W4AA 1TYDE 2HRQA 5EP1A 4E13A 4GZ6A 4ROSA 2DT8A 3GUZA 1DIHA 1DRVA 2R6AA 2G6BA 2X0NA 3HFRA 2PUEA 3K2EA 2DKFA 2EVWX 3IEMA 2PFKA 1QQ6A 3H0CA 1I6MA 3IKLA 4HMPA 1XEWX 2WILA 3UMFA 3ZUPA 2RAUA 2B7BA 3N9IA 3RU2A 2LPMA 4BMCA 5BQ3A 2OFPA 4BMVA 5L40A 1YZNA 4X61A 2IP2A 2IDJA 3U3JA 3HB1A 3NTOA 4MPJA 4Q15A 2XLBA 2J5QA 4KXXA 1I80A 2OXFA 2NSYA 4WJKB 2E37A 3KV3O 5JFOA 4UE3S 1KQ3A 4TVOA 4MUGA 1Q11A 5DXAA 3WNQA 1DL5A 4G9GA 4HRYA 2I4RA 4UULA 4EUHA 2IHKA 4OGKA 1F1JA 1YONA 1Z2EA 3FDIA 5TRTA 1L5HA 1E6LA 4O8CA 4INOA 1FNBA 1W76A 4LC1A 4YAKA 3LQ4A 6REQA 2G9ZA 3I9V1 2ACVA 1WPRA 4GX2A 5I51A 3P5BA 1CJSA 1V8DA 3UWDA 4F4CA 1XHFA 3HUDA 3RT9A 5C1OA 4HB4A 3WSTA 3FWPA 4LYYA 1ZM9A 3DW1X 3KQSA 1PSDA 1RWWA 3KWFA 1AK2A 1WUJS 1UEXC 1XZCA 3T3DA 3D8SA 3TQCA 5BUZA 4IDBA 1XF1A 2HV9A 1FQKA 5DVZA 1L3CA 3ADDA 3I6BA 1E77A 2RHMA 2ZWVA 2P4QA 3FVWA 4HY3A 4MWZA 1W73A 4Q4AA 1RZ3A 2J0EA 3A28A 3O3MB 3WFIA 1NY5A 5F1YA 4DNQA 5KMGA 4DLYA 2IS1A 4H3SA 4QT0A 5IFKA 2NU6B 2ZI6A 1JIXA 2BW0A 1NSYA 2P5SA 2XODA 3T0GA 1WY7A 4BOYA 2AC4A 1QIMA 4AG3A 5CB4A 4W1RA 2N47A 3D4BA 3ZXIA 4ESOA 1W2HA 3L6DA 1SRRA 4RHEA 3CG0A 3QTBA 5FI3A 2ZZMA 3R0JA 4TTTS 5F78A 1H2ZA 3DH0A 5LYJF 4KGVA 4YA6A 3ICEA 3NV9A 3ODPA 2O8CB 4MHSA 3MBKA 5CT6A 5L3SB 5TJ9A 2FPGA 3AUKA 1SPBS 4DHEA 4LHEA 3C14C 1RBZA 1S7CA 1B3BA 4FEYA 4JP2A 1HFKA 4LTNA 3KZMA 2HDOA 2ZRMA 4QQNA 1L5SA 1PK7A 3QVXA 2FHPA 2VDWB 4HEHA 2I7VA 2QJTA 3M4JA 1PK9A 1Y1TA 4N3AA 4IHJF 3RVSA 4FINA 4UEOA 1JKJA 2Y4OA 5HKAA 1OBHA 5A1TA 2X3FA 1QGDA 2LP4Y 2Y05A 2H29A 2V7WA 2B21A 3ZUGA 5KPDA 4DR3B 1QHSA 3TSAA 2WINI 4PU0A 1R8YA 2W2MA 4QAQA 2N1MA 2WM2A 3OPYI 4RPLA 3OCJA 1Q19A 2YVQA 1QZZA 2A0XA 4A16A 3MLEA 4J9UE 4ZYYA 4G65A 1N5KA 2KHZA 5IJ9B 3H9GA 2G7MC 1WZIA 2J3MA 1ORWA 3CX7A 3EWIA 4HH0A 4IVNA 5EZ5A 4AJPA 5B2EA 4EGQA 3ZQJA 2ZSDA 4DLVA 3ZLJA 2WTXA 3SS9X 4U39A 1FRNA 4QU9A 3TLGB 4E94A 1KYVA 1DRKA 4N5HX 3W2GA 3EBOA 4J3NA 4ZMBA 2JARA 3EGXA 1NQTA 2CYBA 3TKLA 3GNSA 1P2VA 2H1IA 1D9ZA 3GHHA 4ND8B 2ZR0A 5DGXA 5EWJB 2FPMA 3A9WA 3Q9SA 2ZIVB 5K51A 3SYTA 4XX0A 3KOOA 5EFZA 4LKRA 5EGNA 2JLBA 2R47A 1NIPA 2MINA 2HMAA 3ZCXA 1WM1A 2G17A 1Q0UA 1CJTC 2QN3A 3PI7A 4G97A 1T3GA 1KC1A 1USIA 4W8OA 5DM70 4D46A 1EFDN 2H1CA 4L3WA 3A32A 4BNFA 4B43A 4PYJA 4JL6A 3TJZA 3DUWA 4D9GA 4HNVA 2XW6A 3KQTA 4RZQA 4TMVA 3EASA 4HN4B 4YK7A 4EM6A 1EXVA 4I5EA 2IKSA 4ENTA 1AX9A 1RSZA 1IM2A 2J6CA 3BEOA 4DAOA 1AV6A 1D2NA 1OGJA 2VJKA 2EXXA 1MOZA 3K5PA 4P98A 4OU4A 2CL6X 1XYYA 2RD2A 3GUHA 3PRYA 4Q12A 1YQEA 4HFRA 1AN9A 1TC1A 4Z4HA 3PGMA 1EA7A 4BQRA 3B52X 3MBIA 1DCMA 3O8BA 1Y8RB 3U26A 1FPMA 3VZSA 5HIMA 4U6QA 1PCXA 1VGRA 2ILVA 4G0WA 4KRYA 5THKA 3RAFC 3EMDA 2C2XA 4RA6B 3SBDA 3OZTA 5BUCA 4HGPA 1EDZA 4PTZA 1TQ8A 1MRZA 1DAIA 2VPPA 4TWJA 3VISA 2PMFA 1UC9A 3BERA 2R60A 4EB6B 2O3RA 3F8WA 4WBNF 1BQ3A 2ODWA 1FFYA 4BZQA 4ER5A 4MLCA 2WUEA 2ZOSA 1PQWA 3K8QA 1RAFA 3WMRA 1N3IA 2Z8ZA 3FSJX 2EU8A 3EH2A 1SHTX 5G3YA 4YPVA 2B34A 3OWOA 5EZYA 3KKLA 1C81A 4UMEA 2LTAA 2NAFA 1XTPA 3ZWVA 4EA6A 1QRUA 4ZIRB 5IW8A 2SKEA 2BFBB 4KO4S 1E2NA 1P1KA 1ZD1A 3MAJA 2IL1A 4MGKR 3SN6A 1JPVA 2R2GA 2DBVO 1L4HA 1YR6A 4IR7A 4FFRA 5BN4B 3RV3A 1O57A 1B42A 1W0JA 4UQPA 2D7DA 3UC9A 1SU6A 3AB3A 3TINA 1UOOA 2OVBA 2AX3A 3IDAA 1M0TA 3JD3A 4HJXA 1RLJA 1Y9DA 1F3OA 1KOJA 3T41A 1XXHE 4A8TA 2SNIE 4S04A 2ZM5A 4BNGA 1XAJA 3MMXA 1H22A 2POQX 5K3SA 4FEAA 1ZNQO 1AV7A 4KVZA 2PA3A 4NJEA 1P1FA 5EYPA 1Z08A 3ROXA 5AVUA 2BF4A 5FWXA 5JD4A 1UPBA 3CRNA 3E3AA 4DL9A 3LPAA 2OLEA 4IJUA 4CCAA 3X1DA 2XD4A 2XZDA 5IASA 1F6DA 3ONNA 4I4NA 4B80A 2PT6A 3HBJA 5FKJA 5FQOA 2D4HA 2UYYA 4DCUA 3S1AA 4ESHA 3TAHA 4F3RA 3VDQA 2C20A 5AM1A 4CM6A 5THXA 2QLFA 4JQZA 4MP8A 4P80A 2DR2A 5HJ2A 4BNMA 3W77A 1Y5LA 2QZ9A 4JBYA 3U7JA 2I5PO 3WOVA 1NW3A 1XRMA 5FBRB 4CTKA 4HVLA 1QAMA 3L7BA 4NLLA 4BUJA 3LKVA 1A5SB 3TIVA 1KYQA 3NDPA 2R751 3VI4B 3OY7A 3KEOA 2OHJA 3DLHA 3Q0EA 1GL6A 4AB1A 4RJ2A 4ZCQA 5E1OA 5JISA 1ENPA 4RHTA 3HLTA 1BXRB 4RCZA 3GLGE 3QSYA 2DLCX 3T3OA 3UCEA 2DPLA 1II0A 1MH9A 5KNCA 4II3A 1CQIB 2JH8A 1T9ZA 2C4UA 1SVSA 4D9FA 3PICA 4MV1A 1A5AB 4O4IA 1H05A 4M49A 1JQJC 2QG4A 3K4QA 3LT4A 3RSCA 5JAUA 1UBSB 5JAZA 3I28A 1JU4A 1ZK0A 3KYDB 4BP9A 3W7AA 2UVQA 2BHSA 2GJAA 3QIVA 2XGMA 1QG2A 2PX0A 2IX9A 2LKCA 3WYFA 4JR0A 2NWQA 4ZV7A 3T34A 5I7HA 2NU8A 4C21A 3CLSD 3HRIA 5EJ6A 1DJPA 1ICEA 2PRIA 4LX8A 4N5NA 4DLNA 3M0EA 4QBTA 1E1KA 4ZMSA 3S4YA 4RNDB 3FFXA 1V25A 3E7XA 4GGMX 1CULC 2Q6VA 1SBQA 3SJCA 3FNHA 1XU9A 1XE3A 3PXXA 3SVTA 2QTGA 4HDKB 3PCRB 3LCCA 5BQXA 1KI1A 2H2IA 2CMFA 3N7AA 3OOSA 5TLSA 4OSEA 3E5NA 3I0MA 4DCMA 4YI3A 1FFDA 4C6SA 1YV9A 4CTJA 5AM0A 3O1HB 4GICA 4DDVA 4HWKA 5KSOA 2YL2A 4JLWA 5GZ6A 1NMQA 4XUGB 3SLKA 2ZTVA 1E96A 4EGFA 3A9RA 3FHJA 2JFHA 3OQNA 5BV2P 1XZQA 4MVJP 4P7GA 1L7NA 2QUBA 4KI7A 5GTDA 4IIEA 4Q3BA 3A0UA 3JQ7B 1Q0LA 5K0ZA 1NJSA 1HTBA 3O4VA 3ANLA 4GFDA 1RYZA 2WM9B 5JNRA 3T7DA 3UW3A 5KIAA 4UXJA 4O2AB 3E0XA 2YYYA 4EB0A 2VR1A 4PQEA 4PXYA 2OCGA 4FTWA 1JB1A 3F49S 2IZ0A 3T52A 5EL0A 4MV8A 1X77A 5EEHA 3SEZA 4QVKA 2FKNA 3N2ZB 1YASA 3PTZA 3MTDA 3HDGA 3OECA 1DUSA 1HH4A 2G76A 3DO6A 1BE0A 3MERA 3PVZA 4H4DA 4JJEA 2WTBA 3PFCA 4MV5A 4RE5A 2QWXA 3BIOA 3SR4A 3WHLA 5JI2E 1CEYA 3UJ9A 5J5CA 1YFJA 1J49A 1HE2A 1ZH0A 2C57A 4ZVMA 5EUMA 1IXZA 3UV6A 1KYTA 1ORIA 3IQZA 5SYNA 2O23A 1JDUA 1DQZA 1OLSB 5AICA 4RMJA 5KWVA 3X44A 1E6WA 1R66A 5KU7A 1O0CA 3WLLA 1AKWA 2O5RA 3NEPX 3EOAI 1MU0A 4RD4A 1I32A 4BLTA 1Q0PA 3FMVA 3O38A 4CF4A 4LF4B 4CFZA 4MULA 1F20A 2H0AA 4H6VA 2W6ZA 4TN1A 2V1UA 1CHDA 4YRNA 2Z0MA 3LYAA 1R64A 1LFAA 1Y5MA 3NM4A 2C54A 1VC2A 4YJ3B 2J59A 4RJTA 1CUUA 2QZ4A 3OQVA 4XDYA 1Y4AE 3GJ4A 3W5DA 3F9IA 1YIOA 2OQRA 3FYUC 1ZNYA 4G01B 4OQPA 4EPVA 5CA0A 3WDSA 2QJOA 3AO0B 3K2IA 3NCTA 2PL1A 4IILA 4UQLA 5JROA 1W36C 3H2SA 2BGIA 3K1TA 3L82B 4NBUA 1W0CA 3UF0A 5BN3A 2PVCA 4BO4A 3DMYA 5I7VA 1RXIA 2CFTA 2A9VA 1ZVKA 4BAZA 3C3JA 4N82A 2IYEA 4IVQA 1LI4A 4ARZA 2ZUCA 1AUXA 3QITA 5KHAA 1QHEA 3U56A 2Z6UA 3MWEA 1XTUA 2BLNA 4CV1A 1XCMA 3Q2IA 1LF5A 1N6PA 1JNXX 3D7KA 5DBEX 2A1UB 4P93A 3U61B 3WGLA 1KFKB 1TK3A 2XMDA 5INTA 1RP1A 1YZ3A 4FMCF 4MQUA 1J1UA 1SGWA 2EX0A 5EPOA 2AFHB 3K31A 2J41A 1O7JA 3AF5A 5HF9A 5KOJA 5IYZA 1T35A 1CDEA 1KDPA 3ASUA 4XCVA 5IMSA 4WBXC 2BV3A 2IWHA 1LZKA 1VL8A 1UP7A 3CVUA 5JJKA 4PRYA 2IEYA 2XH8A 3EQZA 4JBLA 3VR1A 5LQCA 1RJEA 4CI0B 1I2DA 2E85A 3JQEA 4E07A 3C45A 5HZMA 1WQ1R 3NT2A 5GM1A 4YIHA 2Y0PA 1K86A 1VM6A 2ATVA 1T34A 2EHDA 1MIOA 1CR1A 2PKEA 3LXRA 4M36A 5CPBA 3ZIUA 4MW4A 2A35A 5F5LA 5JNVA 3CUUA 4URYR 4O33A 2FUG6 1PBTA 3H19A 3MWEB 4RKEA 1OBVA 4R71A 1WB5A 3DC2A 3ADBA 3ZGZA 1I36A 2FQYA 1QE3A 3N7TA 5LUBA 2OCYC 1JKXA 3WGTA 3I62A 5AI6A 1KQFA 3AL0C 1IUKA 4HATA 3KPUA 1NHGA 2EWVA 3GJ8A 2GAOA 4AKGA 3ETCA 1N25A 1HX7A 3HKDA 3OD5A 3OOHA 5CA1F 4L4ZA 4QDKA 3UAVA 3GWZA 1A4RA 3WICA 1IOLA 3ETHA 4D02A 3UPTA 2G4VA 3G0OA 1P6QA 4HNUA 2AV6A 4B73A 1JFLA 3MINB 1M54A 1N2CB 3W8DA 2YCBA 1CUFA 4ARBA 1ZJ4A 1ZK4A 3OZSA 2W6MA 2NVUA 2FWAA 2OCXA 5B3JA 3REOA 4AG5A 1I3LA 1CUWA 2G9RA 3JTEA 2ZKLA 5ALEA 4CODB 1TCBA 1B74A 3GPIA 3OICA 3QWAA 5JV5A 2VQFB 1R0ZA 4YRPA 2WA1A 2XRFA 2VYQA 4CW7A 1H5UA 2E4UA 2P5TB 3FNFA 2OPBA 3F6SA 3MTIA 3TZEA 1F51E 2WTAA 4W82A 4INJA 3SBEA 3CE6A 3TL3A 1RC1A 2YKGA 1H1TA 2O8EB 5DBGA 4NBKA 3PNQA 2O1WA 1SIUA 1X14A 2RHCA 2QSUA 1TRHA 2YNMA 3Q11A 5TGZA 4KNYA 2O3JA 1P4AA 3QE0A 4NU8X 2O7VA 1SRQA 4OREX 1UANA 1C3EA 3M49A 2GF9A 3QM1A 4JZYA 4WX2B 1YRLA 4YO8A 4AWAA 4E88A 1LBHA 1MVLA 3AVXA 3TZLA 1I5RA 1ZI6A 3E81A 4MAMA 4MPPA 3WNZA 1TIKA 3GEPA 1E3JA 3LTEA 2VJYA 3EPJA 3WKDA 4BFUA 2ZJ4A 4R0MA 4ZARA 1YQXA 4AZWA 4DJEC 2C9MA 3L18A 5KVAA 3F6BX 3IUBA 3TNDA 2W6IA 1JI0A 4LFAB 5DBHX 4RK1A 1IZ9A 1ZUNB 4FC6A 4XWOA 1E6MA 1SXJD 2OCLA 3EWSA 5E4TA 1R10A 3PJGA 4GSYA 4KWIA 3GQVA 4CKYA 1OLUA 3NPMA 2R8PA 4CEJB 2EGGA 1AA9A 4NULA 2J0UB 4CE6A 2XKKA 5A4AA 3W5BA 3VR5A 3DHVA 5IKMA 3M5PA 3V7FA 1ESMA 1YZGA 1MD9A 1GOTA 1M9NA 4C4YA 2Q6OA 2G77B 4IIBA 5AVWA 1RPTA 1E6EA 2BC9A 3I2HA 5FNZA 2IHYA 1COWD 4EYQA 4UBMA 1XVVA 2HREA 2O0LA 1OXXK 4HQFA 4O29A 1IQRA 4ZVQA 4G5XA 3BJMA 1SVOA 1L4NA 2N75A 3I04A 3V4VB 3E70C 4BUZA 1KYWA 2VYVA 1XQVA 2IK8A 3WGVA 2YOFA 1QFMA 3BL8A 4R51A 1O4WA 2C4MA 2JZOA 2H9YA 3AUAA 2F9FA 3COVA 3LWZA 1UDWA 3C4QA 4NBNA 5F4ZA 1HDZA 2Q1XA 3ZGVA 2WKQA 5FYDA 1GYPA 3I37X 5TXGA 1HE1C 5IF9A 4W9MC 3HR7A 4CHGA 4P4SA 1GDTA 4EJSB 2VDJA 1E9FA 2XGJA 2ZU0C 2W98A 5KTMA 1U04A 3V6MA 3WY9A 2F1JA 3FFBA 1GQRA 2GSDA 3ID6C 1CSEE 5BQPA 5DYWA 3HSSA 2MSDB 1J8VA 1DDGA 3PSAA 4BIMA 4DJJA 2EFJA 2XNDD 2XD9A 3KXKA 1HFWA 1HORA 3PA6A 2PJZA 4AMYA 2IP1A 2HRBA 3ABOB 4EB3A 1MNAA 4G2NA 3LBFA 5G40A 3UFBA 1P2GA 3BYZA 5HFJA 4B7CA 2PR7A 3UMRA 2VWPA 1WDKA 1GNQA 4NAHA 3UMMA 2O7QA 3EPLA 2CE2X 3RB8A 1U8TA 1Z6TA 3QOXA 2UXBB 5EMNA 2PX5A 2JLXA 3EPHA 4E6EA 2FB9A 1OVMA 1AVTA 3M9LA 2IITA 4HWGA 1D8TA 1PR9A 4BVLA 1Y6QA 1CJUC 1IG3A 2F3RA 3C4VA 3B6MA 1JDTA 4ZVKA 1WHSA 2AQIA 3C3MA 3I8OA 1UKBA 4F6RA 5JUWA 4YAOA 2GR9A 1IHPA 4XA8A 3CEPB 2O7NA 1B8PA 4P3YA 2DB3A 4M6WA 4ZHSA 2Y1CA 2IU6A 1RPAA 2NVWA 1MDBA 3IELA 1O6FA 4WXEA 1H93A 4HDNB 1GN8A 5CHEA 4BMXA 3U6BA 4BV2A 4YJ2A 3QVWA 4Q1FA 3U48A 5ER9A 3MD0A 4TYQA 1ZZEA 3CQ9A 4JB8A 3HH8A 3VH3A 1NXPA 1A8HA 2CB9A 2G88A 1P7ZA 2ZIGA 5EKSA 2FQQA 1YJQA 3PGVA 3QEBZ 5G3ZA 2Z08A 3PLRA 2BTOA 2Z4TA 3EBPA 4NFSA 4KQ6A 2IHZA 2Q3FA 4MGHA 4JHLA 3K70B 4EW2A 3S68A 2FPRA 2PUJA 2MSKA 3MQ2A 1JR3A 1L4KA 1SN7A 2JW5A 2Q50A 4KSYA 1ZMOA 1AHPA 2JCYA 4E5PA 2VDQB 1MC1A 4URXR 1KE2A 1ACLA 1MJGA 3DAYA 4U5QA 4D4LA 1Q1EA 3CLRC 1I3OA 3U4IA 4BO1A 1J2UA 4O3MA 1HE5A 4OQDA 4URZR 4Z7NB 1M6YA 3P8ZA 1H8HD 3OQBA 4Q24A 2UZ1A 3V8EA 2PSFA 4WQMA 5CT8A 1X8XA 4BE4A 1KY4A 3UT0A 3R8FA 4LIPD 4ETNA 1PJCA 1SCIA 2X1HA 1QV7A 4J76A 4LYGA 2VA8A 3QEJA 4FFOA 3RYFB 5CEFA 4AKHA 4HUQA 4XD2A 4Q82A 4C7KA 1ZEMA 5B7GA 1O6CA 2EKDA 1Q1AA 1JPJA 4M0EA 1LVHA 1NRXA 3FCXA 3U1VA 4PLTA 1CEEA 1FXWF 1WUHS 1WW2A 2GD1O 2VG8A 4ID9A 5DLEA 1J5XA 1UBKS 2JAPA 3CUWA 3SDBA 3U9TA 3URKA 5IAAA 3TFOA 3VA7A 2JGDB 3OJEA 4YS6A 1E3EA 1DO8A 2R8BA 1YFZA 1J0BA 3RK4A 1RJGA 3MIZA 1N2BA 2JZCA 4F5WA 1YBVA 3EN0A 4LYEA 4L9RA 4TZ6A 1QHHB 2A14A 3B82A 4M9CA 3LUGA 1U7ZA 2I03A 1VBKA 3LQFA 1W85A 4I66A 4UHBA 1VPDA 3SGLA 4GLFA 3V8MA 2QAGA 4BNUA 1QTIA 1C30B 4HAIA 3BIFA 4JJGA 3AIOA 3D9QX 4P84A 5JEDA 5F9HA 1JIUA 4L4YA 4MYUA 1FUUA 1WVIA 1QYRA 3DW3X 4TMWA 5AT1A 4H17A 2DBRA 1MFPA 3LHDA 4UCFA 3CPSA 3EZGA 1I2BA 4EH1A 3DEFA 3OFJA 4H18A 2G4CA 4G0PA 4EG6A 3M4ZA 4NC9A 3GRAA 3Q6IA 4X24A 4UQOA 2F67A 3OOWA 5CUQA 5EY5B 5FLYA 2G80A 3AP2A 5MN5A 2JLUA 3ZVNA 4Q7JB 3QBTA 1N7GA 5ALJA 3TOCA 2GASA 2XA2A 2J3KA 1V0JA 3NOQA 1U0OC 3TMYA 1GSIA 1OWOA 2LGJA 4L8GA 2GUGA 1A9SA 1RPZA 5E1BA 1X1SA 2CK3A 3NJ8A 3TG2A 2AJDA 3H86A 1LS6A 2FZKA 3TQHA 5IKXA 1QANA 3U4DA 2WAOA 2V74B 3MC1A 2RH5A 4YRJA 2VP4A 1YK1A 1M8JA 3CPHA 4G56A 2P9QA 1KL7A 4DMLA 3OESA 5JSKA 2AMJA 4JBNA 1JECA 4RHUA 1OVGA 2FTKE 5EE5B 3SAJA 4CQLB 2PZ8A 1TEZA 4EEKA 4B0OA 1L9XA 5E7IA 2BGTA 4I55B 4A1FA 3RU7A 2HPZA 3WRVA 4KAFA 4OMUA 4I6EA 4RKRA 4WZBA 3ZI4A 2YYAA 5IK2A 1MJFA 2W8BB 1E2QA 1C5KA 4EKNB 5K8TA 4C20A 3R3JA 3OZIA 5LDHA 1Y9EA 1T4DA 2WOJA 5BUSA 5K3OA 4MWGA 4HEA1 1UBJS 5KTKA 2J08A 4LMPA 4GI5A 3BRWD 5FFFA 1DZ3A 4WPGA 3BVPA 1S3GA 2LCIA 2I8AA 1NF2A 2WBLC 1NSFA 2A67A 2HAEA 4JODA 3L84A 4DPLA 1TT5B 4LHWA 3U13A 4PYMA 4V1CB 3T9EA 3MJVA 3F8TA 1DIAA 2ARKA 2GEVA 2VF5X 3HU5A 3EBLA 3I30X 3PSHA 4FYMA 4O5AA 5E6SB 3VU9A 4ARVA 5HW0A 3V8PA 5L7TA 2ZUFA 4DGSA 5BR8B 1NUQA 5DRTA 4WFKA 3QYFA 3PWKA 1DQNA 4RXMA 1VG0B 5BURA 1ISJA 4JS0A 1FJ2A 4MRPA 2WJGA 4KSBA 3TLMA 3DV9A 4G2TA 2QN1A 1JI3A 3LPCA 2GXQA 3E3NA 1IQ0A 4IHAA 4P0TA 3E9RA 2AG0A 4M1ZA 3QXXA 3RVLA 3ZY5A 1G8HA 1HOTA 3R9WA 1N5OX 5IFLA 1P1IA 4I8IA 2DBQA 3LZDA 2QRKA 1IBSA 2XTNA 4Y2RA 4AF7A 3I6MA 3UOAB 4J6EA 2WVHA 3WQQA 3GELA 1AQUA 3A1DA 3ZWYA 4IIJA 4ETIA 4MTLA 1N2HA 3TI7A 4FSXA 3RVMA 1J8YF 3LC7O 4R1PA 4DUGD 4PO9A 1QB8A 3DKVA 3V4FA 2XMPA 3T1HB 3KKEA 3BXGA 3MQ4A 1D7AA 4Q9LA 2XMZA 4K26A 2BH9A 2QTHA 5JH7B 2OBNA 3ZWAA 1UBTS 1W5AA 1W5EA 2EV9A 3QELB 4TXJA 2GX6A 1KI7A 3NT5A 4MVXA 2QAJA 3CLHA 1UWKA 3DUFB 3ZJ4A 1XHLA 3HRHA 3M5DA 4XQGA 3BXXA 4BDSA 5JANA 3LG2A 4NXMB 4JOSA 3OX3A 1KS9A 1TUGA 3AZQA 1UFQA 2QD3A 3PNVA 4ZAFA 5JAQA 3UBTA 2EZ4A 3GH3A 5AK3A 4HLNA 1HEUA 4HNSA 4PZCA 3WWOA 5C46F 4N8SA 1IWBB 3G6WA 3BKXA 3VAYA 4BO6A 5KOHB 3Q8MA 2NZVG 4QELA 4JEMA 3I2JA 3FTNA 3IIKA 1OA1A 3BJIC 2A8YA 3LDUA 1C2YA 4ZJYA 1EFVB 2W6PA 2ZSBA 3C8HA 3JYPA 3GLFE 1JIVA 2VHTA 1F2UB 4OM8A 1QIFA 4M1OA 4BVFA 2O6LA 4XFJA 4BNJA 1MXHA 4TYNA 4RA9A 1SZPA 3NXSA 3M3DA 1Z83A 4RU1A 1XZFA 2ZS8A 2NZ2A 2HEIA 2IT1A 3KFLA 3R20A 2PTHA 4IUCS 4M0UA 3TNLA 5ICGA 4IZIA 1FNNA 2OENG 4L2IB 1UKVY 1WCIA 3V1YA 1Q0QA 2QLMA 4U7WA 2DR0A 3BUSA 2QGNA 3L0ZA 1RVV1 5KQMA 4FMCB 4AROA 1EAYA 1WEHA 4UNPA 1Z06A 3W90A 2QGZA 3KXDA 3RAGA 4ALJA 4C1NA 3E8MA 5B7QA 4JLKA 4TLAA 1CYDA 3WK6A 1PWHA 6Q21A 2NO7A 4CFYA 1ZD9A 1NVDA 4K6GA 1AXRA 4L74A 3U7RA 2BFMA 3C7TA 1H2WA 2BGNA 3ML1A 4MPRA 3R6LA 4R68A 1W59A 3OMWA 1II8A 3D0OA 2O5EA 3H2KA 4LAFA 3AVVA 1RKXA 1EUCB 2CWWA 1H3EA 3L7CA 1I10A 3N6XA 4G5YA 3AJRA 4YGXB