3IIJA

The structure of hcinap-adp complex at 1.76 angstroms resolution.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
175
structure length
175
Chain Sequence
PEFMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coilin-interacting nuclear ATPase protein
publication title hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, transferase
total genus 67
structure length 175
sequence length 175
ec nomenclature ec 2.7.4.3: Adenylate kinase.
pdb deposition date 2009-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13238 AAA_18 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3iijA00
4KJZA 1CJMA 3IO3A 4W5WA 4LJ7A 4RJLA 2ZSEA 5CJ2A 4DDUA 1OYWA 3E5HA 4RD2A 5CLQA 1RRPA 1DO0A 2WWWA 3QJYA 3AQ4A 4EQ6A 1ZC4A 3KL4A 1LNZA 1JXMA 4LJAA 2GWHA 3K1JA 1TPZA 1ZMXA 4XVQA 3TR5A 2HEIA 4PR0A 1SVKA 1Z6GA 2W83A 3FPAA 3FHTA 2NIPA 1EFTA 5K8LA 4NCJA 1ZCBA 3GEIA 1XD9A 3TW8B 2DB3A 1DAHA 2EVWX 1NMXA 4HLUC 4B2LA 3U4QB 4YQFA 3OFNA 5EZ5A 3THYB 2ZYWX 2RGCA 2IHYA 1TX4B 1DE0A 2J41A 1VKJA 3K0SA 2J0QA 2CEAA 2PT7A 2D7CA 1AQYA 5G3ZA 5JI2E 3W3AA 1UFQA 4A4DA 2R6FA 4QNMA 4DDVA 1E1RA 2PLFA 1G19A 4M1KA 2X8AA 4UXIA 3THWB 3ZD7A 3KKOA 2LCFA 4YMVA 2GJSA 4M9XA 5BN5A 1ZUIA 3WYFA 2AWOA 1CEEA 4AKGA 4DBLC 4RD4A 1W5TA 2RHDA 3WNCA 1NJFA 1Z6TA 3FKSA 4Q9HA 4EJSA 5DI3B 3NDBB 2OFWA 4LJ4A 4EKDA 4Y0AA 3X2SA 2JLRA 3EIHA 1DELA 3K70D 1QHGA 2BV3A 1SULA 3BC1A 4DIEA 1KK3A 4RCYA 1CR2A 2VEDA 1XP8A 2O8BA 3AKEA 4AG5A 3LX5A 2PX0A 2AKAB 2OM2A 1E2JA 1XTIA 3D8BA 4RFSA 1GKIA 3ZGXA 4BFWA 1GL6A 1PLLA 2WMOB 1A7JA 5C4GB 2V8OA 3DKPA 4EPTA 3AVTA 1GNRA 4I81A 1JB1A 4DSOA 2F43B 1IJEA 4DHEA 1SHKA 2IYVA 4P4TA 2GCNA 3RS2A 3RANA 1AKYA 1GSIA 2FZLA 4RD6A 2LWIA 1Q3TA 3IGFA 1XCGB 5D3MA 4B3XA 1XPOA 5KPJA 2AXNA 3KTAB 4JSTA 2ZS9A 1US8A 3TMKA 4BASA 3WHLA 2AWNA 3IQXA 4B2IA 3DOFA 1YKSA 2QTFA 3C14C 1OE0A 2OEPA 1T6NA 2RCNA 1GWNA 3E70C 3PR1A 2A5YB 1S1MA 3HU3A 4PO1A 4MGIR 5TB5A 1D8TA 3I32A 3JVUA 1ZNWA 4AYWA 1ANKA 1S9HA 4ASUA 2H7VA 4V02A 2QBYB 2IL1A 4LV6A 4ON9A 4P4SB 4BEBA 5CIWA 4TYQA 3GCGA 4M21A 1TUIA 4PC1A 4BZPA 2FX3A 4RZ2A 2YHSA 2QM8A 3U3RA 5EP1A 3VR4A 4QKQA 2ZR0A 2C99A 5FBRB 3VNVA 3W8NA 4DT1B 3V4RA 1F48A 1KJYA 1TQ6A 4V0LA 1Q1BA 4G5OA 1L2TA 2E9SA 3LVRE 1G5TA 1G3MA 1J7KA 4LC1A 1Q12A 2GRJA 3LBNA 4F4IA 3B2EA 1E0JA 2JJ1A 3R9WA 1QHHA 1U8YA 1W0JA 1FQKA 1L8QA 2G6BA 4C0JA 1C4OA 2WSSD 3MWJA 1QHSA 4NYMR 4PZZA 4A8JC 4Z54A 1GG2A 1NG1A 3UK6A 1L7VC 1R7RA 3HYTA 4W5HA 1SXJC 4L8GA 4MRSA 3CF6R 2ZI9A 1OLOA 5L3QB 3WP0A 4A1FA 3QVUA 4QGHA 1KMHB 2IC5A 3IPYA 3VX3A 1HE1C 4DCTA 2QPOA 4TL9A 4L16A 4TLDA 2BM0A 4JKIA 4OHZA 1N3BA 2XITA 4DEYA 4II7A 5M04A 5JBQA 1HURA 4OQXA 821PA 4DKXA 4KSBA 3IIMA 1KHTA 3QE0A 4D2IA 2QQEA 3NH9A 1IN7A 2XJ9A 4TMTA 4DLXA 3D6TB 1YRAA 3Q7QA 2ZETA 4GOKA 2QAGA 4PFSA 1XBTA 3SYKA 3UMFA 1YR9A 4HLQB 3FB4A 4XWOA 1V43A 3EXAA 2GVZC 2ZVQX 4B34A 3EC2A 4HAXA 4JT2A 3OZXA 1Q20A 1KYIA 2E87A 4PC2A 2REBA 2EFHB 1P61B 3JVVA 1VMAA 2O8FA 3W5IA 1G7TA 2JATA 3SFVA 2F7SA 3NBYC 2ZUBA 5LPNA 2ZROA 3PUXA 3A37A 1G9XA 2B8TA 5FR1A 5B30A 4V0MA 4A8JB 2FPMA 5CK4A 3K9NA 2RGXA 4QBFA 3CX7A 1G16A 1QHNA 3GJ3A 2CXXA 2ORVA 4DUGD 1W4AA 3EZ9A 3REFA 3ZVRA 2ORWA 1O3YA 1S0UA 4RCZA 5EUMA 4AG6A 3ICQB 5DLQC 3GJ7A 3SHFA 4LOAA 3TLXA 2OLKA 4HI0E 4XD7D 4FCTA 3CR7A 2CMKA 3A4MA 2QRZA 3IQWA 5K8UA 3QG5A 1XEFA 2A5GA 2HCBA 2V54A 1U8AA 3WMGA 4Q4LA 4DDWA 4UNSA 4OBEA 2ZRPA 2VP6A 2HLDD 3TVDA 4KFTA 3GLGE 4ZIRA 1J99A 5JRJA 1WP9A 3LNCA 4N0EA 2WWHA 1VTKA 5FBQB 3TK1A 3B78A 2IYLD 3GQBA 2ZI4A 1ZD9A 3ZVLA 2IYQA 2ZAOA 2Q9CA 4WXRA 2WKQA 5KDDA 2XOKD 5B57C 4JL6A 4D4MA 4HEJA 4S2EA 4L5BA 2XB4A 3GJ6A 2QQ0A 5E7MA 3FFAA 3K0CA 3KXIA 2C95A 4U5XA 1J8MF 1KAOA 3T06B 3EX7C 3SNHA 1OSNA 3BE4A 4JLMA 1T5LA 3KFVA 2H17A 3NBZC 4BWYA 5L8VA 3GJ8A 3L8YA 1FNNA 2GZAA 3BFVA 4I4LA 1VIYA 1F5NA 1T4GA 3RC3A 1B0UA 1OH7A 5GJCA 3QG1A 1W0KA 4ZKDA 5FTNA 5JWOA 1E2PA 2CVHA 3L82B 4WW0A 3PCRB 3GLHB 3QOFA 5GJWC 1G3IA 1EWQA 1VG8A 1G5PA 4AKIA 2HT6A 1SVMA 2F6RA 1SKYE 2RGEA 3QKRB 5TDHA 1FUUA 2HLDA 3B1WA 2O8DB 3LH5A 1Z8FA 2GCOA 4RVCA 4AYTA 3GMTA 1EG7A 3Q8XB 2EYQA 4YONB 3MJRA 3OEED 2OV2A 3A4NA 3GEEA 1X6VA 4Q4AA 5JI3E 1OIXA 4EUNA 1YR8A 1M6NA 1QVRA 2F55A 4KCGA 5FFMA 4C4PA 1JJVA 4QG7A 4BFYA 1P75A 1Q21A 4DDTA 2FSFA 4TMZA 2RGNC 3RHFA 3TQCA 4C0QC 1VHLA 1D9XA 1IY1A 1XMVA 2Q0HA 1AA9A 4A0HA 3SN6A 4YDSA 1ZRHA 4LBVA 4ACBA 1P7CA 1FTNA 1KI1A 2QPTA 5JZVA 3PJRA 2AK2A 4JYBA 4N1AA 1O87A 2CCKA 2HF8A 1AIPA 8OHMA 2X2FA 4KFUA 1W36C 3SI7A 1D2EA 1XJ0A 2J7PA 1UM8A 1IQPA 4B6EA 3NVAA 2WPDD 1VYTA 1XMSA 1NSFA 3ADDA 1DG3A 4LDJA 1S2MA 1I2MA 1Q3HA 2FEMA 1ZD1A 3K09C 2WSMA 1E6CA 1HA3A 3F8TA 1OFUX 1J70A 1UADA 4KLNA 2XGJA 3MUFA 1N6LA 2ATXA 4FW9A 4D0LB 1E99A 4PAOA 5CM8B 4ZCIA 3RC8A 2H1LA 2IS4A 1FX0B 4TT3D 1X8KA 2HXYA 3GFTA 5JSZA 1Z6AA 4LX0A 1G8FA 1OT3A 2JJ2A 1ZYUA 3W6OA 4C7OB 1GKUB 2PH1A 4IXNA 3QXJA 3CNNA 1LFDB 2O8FB 4WOPA 1UDXA 3PFIA 1VCNA 2ZE5A 5KNDA 3QXXA 1ZNZA 3MJHA 5AJYA 2ZJBA 4JLJA 3GLGA 5JFGA 4URWR 1VCIA 2AK3A 4LJ6A 4BPBA 2JLVA 1G6OA 4GBMA 1FOEB 4OI1A 3H2YA 5TARA 4D82A 1KNQA 2GAOA 3GJ0A 2VP4A 3HU1A 1COWD 2QM7A 3NG1A 4LSGA 1EK0A 3B85A 4D80A 4PPQA 1X8JA 2VLIA 2PZGA 1G8HA 1GKYA 1CU1A 2OT3B 3FE2A 2W0MA 2GAAA 4FIDA 2JASA 4I1VA 1RRCA 1OFTA 1Z0FA 4US2R 1M34E 4NMMA 3AP1A 4B35A 2V6JA 3DM9B 5E95A 2WBLC 1U9IA 1E4VA 1M2OB 1ZU4A 2IYUA 1OH5A 4GFDA 5CYOA 3VKHA 3PV0A 3F0TA 3IILA 1ZUNB 4B43A 1QHIA 2ZSBA 3QI2A 4WZBE 1ODFA 1LY1A 1XEXA 3BK7A 2GXQA 4DZZA 5JHGB 3G0HA 2J46A 1AZSC 1E9CA 4Q1FA 4ITRC 5G40A 3LD9A 3EPLA 4CT5A 1R5NA 5B64A 2V4ZA 4B73A 2NMVA 2IS2A 5DHFA 2ONJA 1NN3A 4PAQA 4CEHA 1JR3E 3DKVA 3FMIA 3IUYA 2IUSA 721PA 3A1WA 3EPKA 2C96A 1YZUA 2Z0MA 3IEUA 3CZQA 4LHXA 1G8PA 5BWMA 5L3SA 3RS0A 3HR7A 3HU2A 5L3VA 1KIMA 4LJ8A 4NPHA 3ADBA 2IWHA 2V7QA 4BFUA 2D2FA 3BAFA 4DCVA 1OHHA 3QIAA 3CM0A 4QHSA 4QRHA 4UNRA 2ZU6A 1XPRA 1NY6A 4GP7A 1E4YA 1H8HA 1XXHB 2W6ID 2VA8A 3AM1A 3CONA 5CK5A 1TNDA 3ASYA 4HAVA 2WWYA 3PENA 1U0LA 4MGKR 2REXB 2QL6A 4KVGA 3GJ4A 3ZQJA 5KUTA 3SBDA 2QI9C 2O8EA 2C98A 3W9YA 2IUTA 2BBOA 1X8LA 2X77A 3X1WA 3HR8A 4US1R 4Z1MA 3L8ZA 4BRWA 3QKSB 2O8EB 1TAGA 4XOIA 2W2VA 4O0MA 4TYYA 2FSHA 2WWFA 4XIGS 2ZRGA 2FV8A 3AVUA 4GZLA 1XDBA 2FSIA 4KYUA 3TGPA 5IDVA 4NYIR 3V00A 4URUR 4FI3C 3LLMA 1ZVQA 1FZQA 1G3UA 4TMXA 5FI0B 1HQCA 3QQ5A 4IJMA 3U4QA 1Z0IA 4WZ6A 3C7KA 1RRGA 2WOOA 4FMCB 3THYA 3X1ZA 1NL3A 4R9UC 4HUTA 1TF5A 2ZR7A 3QPUA 4PHGA 4TQAA 2GA8A 1FMJA 2BEJA 2GXAA 1FFHA 3KKPA 1QVAA 4B71A 4JBXA 3QKTA 1GP2A 2EFCB 2J0UB 1MO5A 4ZV4A 3CF2A 1YZTA 2XTMA 3W6NA 2ZE7A 5H70A 2DYKA 4PC6A 1R0ZA 3THWA 3C16C 1MOZA 3GEHA 2BC9A 3OE7D 1JR3D 1QDEA 4RFVA 1CR0A 1A1VA 5DO9A 4B3GA 1PZNA 3PUWA 2BVNA 2CBZA 1SVWA 2GJAA 2O52A 3RWOA 3F3YA 5CYPA 3WNBA 5CLLA 3JZAA 5DI3A 4IEIA 1Z2CA 4UJ3A 2KBFA 1SVOA 2BKUA 3O8BA 4CEIB 2RMKA 1JQLB 1DVRA 3QF4B 4FMDF 5FBLB 1W4RA 4NTZA 1L4YA 1OXTA 3C4JA 5HKKA 2IBMA 2VBCA 1KI3A 3KQLA 4MKIA 3KJEA 3FMFA 2ZAMA 4Q1AA 5HE9A 1NY5A 4JLDA 1E0KA 1Q0UA 4MITA 3TUZC 2C8VA 2ANBA 2I4IA 5FPKA 1ZINA 2GJ8A 4LC0A 1WBBA 1N6OA 4NBSA 3RVBA 2GZDA 1XMJA 1LS1A 2CNWD 4A15A 2F43A 3A8TA 4ABYA 3OESA 1QRAA 1ZCAA 4B74A 2NO1A 4TMVA 4DWJA 2Q9BA 3AVXA 3OE7A 1GRRA 3KTAA 3X1XA 3GJ5A 2WTUA 2QE7A 1E9DA 4DLSA 4NU0A 2ZANA 1F2TB 1GRQA 1Z6XA 2ERXA 3IHLA 3A58B 5DI9A 1YR6A 5IK2A 1QHXA 4MDFA 2W6JD 3Q9LA 2A9KA 3ZYCA 4EPRA 1WCV1 1XCPA 2BWJA 3RS7A 4LJ5A 2A7QA 4M9SA 3P27A 4LBWA 1VPLA 3UPUA 4QFMA 1GILA 2QBYA 4Q18A 1JPNA 4BFXA 1ZNXA 3DZDA 2BMJA 3MSXA 4P4SA 3K0FB 4TL7A 5JJLA 3ONWA 3LW7A 1P4SA 1Y3AA 1KGDA 3BS4A 2JLUA 3EA0A 4CRWB 4ERNA 1NBMA 2GILA 4TQUS 2R65A 3HP1A 3PQCA 3GPLA 2OFXA 4C30A 4DT1A 4R98A 4BLTA 4DLRA 4A9AA 2LKDA 2ZRJA 3IPXA 3AV0B 2RKOA 3BB3A 5LD2B 2QEQA 3VR5A 2EFGA 3OFND 1RC8A 2YNMA 3K9GA 3TQFA 1ZUHA 3QENA 3OAAA 1AK2A 2ANCA 2HUPA 3VAAA 3E1SA 1LB1B 5BN3A 2DHRA 1FQJA 2KSQA 4A0RA 3MMPA 2W6JA 3HJNA 1N6IA 3VQTA 3BJIC 1WBDA 4MYUA 3ZZUA 3PVSA 1JNYA 3U3MA 3C15C 5L3QA 1XZPA 4A36A 3DEFA 1FP7A 1ZNYA 3A1TA 3RYTC 1KMHA 2WKPA 4CEJB 2XXAB 1C1YA 4BEJA 1AS0A 2JLSA 3AF3A 3CNLA 4G5SA 2FH5B 3FKSD 4QJ4A 5F98A 2CLSA 1OH8A 2FU5C 3A1SA 1NJGA 3L2OB 1WF3A 1KO1A 2IS6A 4GOJA 3WNDA 1S3SA 2V1UA 4TL8A 3R7WB 1R8SA 2ZRHA 2BMDA 3GD7A 4W5JA 2UVQA 3RABA 3NHAA 4BECA 1N0WA 4WAUA 2A30A 2L0XA 4XH9B 3VHXA 4L4UA 3RS5A 3QY0A 1OW3B 1IN4A 2ZJ2A 5EP3A 5A0FA 4Q48A 1UF9A 3WYGA 4HATA 4EFMA 3VKGA 3QUSA 4HYYA 1F3OA 4FXPA 3D31A 1JAIA 5KU1A 5JECA 2ZPTX 5HTKA 3CF0A 3ZIAA 4Q7JB 2IF0A 1E2GA 4KI0A 1KO7A 4NONA 3R8CA 3B1YA 3IBYA 4PANA 1KDOA 4A8JA 1IN6A 3LRPA 2VSFA 2A5FA 3A36A 3CPHA 1UDWA 1G5RA 4M22A 5LDDC 2ZI6A 1CJKC 1E9EA 2ZJYA 4J0QA 4JJKA 3H84A 1MO4A 2GCPA 1IN8A 2YV5A 2CK3A 3CIOA 1PLKA 4O2LA 1BOFA 1RFLA 3KB2A 1F60A 2QUZA 2VP5A 2ZREA 4G5GA 4ASUD 1I4TD 4CW7A 2DFTA 5J4KA 2R6DA 4TQ9A 3I1FA 1Z6YA 5FL7A 1II0A 3NC1C 4OK5A 1NI3A 1EFHA 3Q5DA 2VSOA 2FEOA 4Q7KA 1VCMA 4DB2A 2XNDA 4I99A 4MYTA 5KHOC 2HCJB 3X1YA 3N5CA 4D26A 3KQKA 4OK3A 1LF0A 3AVYA 2BOVA 5DGXA 2D3WA 4Q4JB 1S9DA 3ETLA 1EFUA 5IHPA 4MGZR 1DTSA 4V0ME 3FDIA 1E9SA 1N6HA 1NMYA 2ZE6A 4TSFA 2H8KA 2OHFA 1CR1A 1NNEA 2IUUA 4EPWA 1G4UR 3GLIB 3GFPA 4XVRA 2JJ1D 2QU8A 4UXHA 1KSGA 4C2TA 1W0JD 3SYLA 4TYNA 5EZ6B 2ZJ8A 4BLOA 1G8GA 4BLPA 3SJZA 1E2HA 2VHJA 3ND8A 4MGYR 2QY9A 4GL2A 1XMIA 4UQOA 1E2EA 3C5HA 4JKYA 5FOTA 3EAQA 1MRSA 3BRWD 4YDHB 4GNKA 2J0VA 2Q9AA 4PPFA 2GKSA 3AUYA 4XTRA 1TQDA 1KMQA 2YWHA 4Q4HB 2AD5A 3H1TA 4GDFA 2J59A 2RHMA 3M6AA 3GLHA 5F9HA 4AYXA 1T8TA 2AN9A 3EW9A 3SJAA 1EFCA 1FL9A 3QKRA 2WJIA 5AWFC 3U6BA 5JJKA 2IYSA 2O8DA 2QSYA 1TMKA 4O25A 4TLCA 1X1RA 3A6PC 1IXSB 4P33A 4POAA 5ANRB 4DEXA 4YMUA 2O0KA 3FHCB 5JWRA 2HYIC 2WWXA 4YXWD 5DH9A 3M4YA 4V0KA 4XVUA 2NO7A 2Z4SA 1Q57A 3TVTA 4PHTA 2ZUCA 2GZHA 4WBSA 1GZSA 2YZ2A 3SQWA 2FWRA 3LWNA 1ESMA 2VHUA 4B32A 1EWRA 2DY1A 4A2QA 2GHIA 2LKCA 1IJFA 3UG6A 2GBLA 1KKLA 1CR4A 4Q9LA 1M8PA 4TMKA 1U2RA 4KHZA 2WWIA 4N0DA 2QRNA 3RS4A 2VHCA 1ZW6A 2NO9A 2AD1A 5EE0A 3WMEA 1XTQA 1TUEA 2OBNA 5FTKA 4E03A 2CHQA 4R7ZA 5KTYA 3GLFB 4F93B 4KXFB 1KY3A 3THXB 2GTPA 3G5UA 4M1OA 3LW8A 3FYHA 5KSPA 3RWMB 1S8FA 2IW3A 3LXXA 4BLQA 2G77B 1TF2A 1R10A 1U90A 3B82A 4M9ZA 2A3RA 1UAAA 1EXMA 4L9SA 4AC9A 3BH0A 4GMDA 3B7GA 1GTVA 2JAQA 3EWSA 4YXWA 2C9YA 4JBYA 4A82A 1H65A 5K8IA 2F3RA 1DAFA 2FZ4A 1FX0A 1Z22A 4JMPA 5AJWA 3RSOA 5BN4A 1Z29A 3UIEA 5KPDA 1DAIA 4G1UC 1IY2A 4C7OA 1XX6A 1GOTA 3LLUA 2WAYA 4NE2A 2BHRA 1A82A 3ZS9A 4BZQA 2IS1A 1NMZA 3U61B 2QP4A 1KI8A 4P4UA 2ZRIA 3U6KA 4K8OA 1GRNA 4IKEA 2IYWA 1RPZA 2R44A 3AVQA 1MT0A 2B7CA 3RDPA 2XSZA 4HZUB 4NCNA 3N2EA 2BJWA 2ZRDA 3AF4A 4P32A 3CPJB 2ATVA 3H0KA 4JYCA 1SXJB 3EIEA 1N0VC 1XB2A 3T34A 2G1KA 3W5JA 4URXR 1N5JA 2G3YA 1W1WA 1XD8A 1J2JA 4PHFA 2FFBA 4GI7A 3OIWA 1JXOA 4JLAA 3OIUA 1XD2B 2WOJA 5E4FA 3GP8A 4DB4A 2C5LA 2R62A 5GVRA 5H1YA 2PX3A 1W0KD 2D4HA 5KSOA 2W0SA 3K70C 1BYUA 1E1QA 4LYHA 4LZZA 5AUQA 1MO6A 4F38A 1VIAA 1KNXA 2XX3A 5HE8A 3UWOA 4AKEA 4C0LA 4Q9IA 2AL7A 3CNOA 2B92A 5EJEA 1E0AA 3NKVA 1W2HA 1G41A 2JDIA 2J5XA 2PZEA 1Q44A 2FNAA 4TYWA 1VECA 4KVAA 4LPKA 5EXPA 3OIYA 2VIIA 4PX9A 2P5SA 3TIFA 4B47A 2RGAA 2QP9X 3UMSA 5DYGA 3EPJA 3VR6A 3QNUA 1BMFA 1GFIA 3D3QA 1U81A 3ZVNA 3PEYA 1W47A 2BDTA 2CCGA 3K9LA 5KDOA 1XWIA 5TMPA 2BIFA 2WMNB 2JLZA 2ZSDA 3THOA 5HZKA 3EZFA 121PA 2CL0X 5FBVB 4D25A 2VPPA 4B44A 4ZCMA 4QM7A 5KNBA 4NYJQ 5E7JA 3LQRA 5TVKA 4NCKA 2XZPA 1OF1A 3QEJA 4RKEA 4ESHA 2A78A 2J7PD 5EP2A 2ZRAA 4ZKEA 2CHGA 3WMFA 2HJGA 2NZ8A 3LXRA 3HPQA 3IKJA 2OXRA 2W2XA 1XXHA 4B76A 1F2UB 4YMWA 3WY9A 1E2MA 2JGNA 4PPGA 2NGRA 4IHQA 3RRZA 2OBLA 1IHUA 3S1AA 4GSYA 2JJ2D 3AGPA 1I2DA 1YU9A 2IK8A 4OK6A 4BZXA 5J40A 2FF7A 5JS7A 2QAGC 1KDRA 2D7DA 3QKSA 2WAXA 1VG0B 5CIQA 3L43A 3I5XA 4BFSA 4M1YA 1MV5A 1D6JA 3K8YA 4KO8A 5FI1B 4NL4H 1NP6A 2W00A 2J9RA 2JLQA 3SEAA 3I61A 5J4VA 2CL7X 2B21A 2BKEA 3DHWC 3F5FA 3T1OA 1VYVA 4AK9A 1W2GA 3V9PA 3GFOA 1KK0A 4MRNA 3CR8A 2IHBA 2ZRMA 1C9KA 4QL3A 4L9WA 4TZ6A 2V55B 2Z5FA 3A1VA 1E98A 1FP6A 4G3XA 2MSDB 2J0UA 4JVNA 1Q1QA 2QAJA 2E1RA 4OJQA 4R2HA 3HDTA 3T12A 3BB4A 2HV8A 1AJEA 1LV7A 1E94E 3PUYA 4KLZA 5L3RA 1GITA 5LB2A 4P0TA 1X1SA 3LO5A 4YLGA 4F7WA 3CRMA 3U7EB 1S3GA 4A6XA 3LX8A 3QXHA 2ZS7A 2CLDX 4LHZA 1CXZA 4TLAA 2AR7A 3ICEA 1YVDA 3DM5A 5UKDA 4CEIA 3FFBA 4LRWA 4QJ3A 4IDPA 3U3KA 1S96A 3QF4A 4HUQB 4C0AC 3I5YA 2CLCX 4P31A 1GVNB 1KDPA 2MSCB 4B75A 1ZM7A 3KKQA 4KV9A 3TAUA 2PJRA 4BLRA 3TH5A 5DE3A 1SZPA 1NIJA 4Q1CA 2YINC 4MDEA 3TBKA 2DWQA 1CIPA 1TQ4A 2R6GA 2QMUA 1CULC 1YZGA 5HPYB 1OYYA 3CWZA 3NBXX 4QGFA 3BXZA 5SZJA 5FUYA 2YOHA 4E09A 1UBFA 1CJTC 3EZ6A 1W36B 1HYQA 2GNOA 3K0CC 5JEDA 3U5ZB 1HTWA 1XF9A 1U98A 4DLTA 1DO2A 3QXCA 1SVSA 5FOSA 2QPAA 2V7QD 4BLSA 3N2IA 1FW6A 5JJIA 1GL7A 1OHHD 4RZ3A 1FPMA 4D81A 3LBIA 2HF9A 2PEZA 4TTPA 1KI6B 1ONBA 1H8HD 2OE2A 2OSBA 2PLRA 1F2TA 2DFLA 5DYIA 2P67A 5LB4A 5SZIA 1M7BA 4QHTA 1MRNA 3WBJA 1T9HA 2F9MA 3Q7PA 5EXTA 3SS8A 1P9NA 2C77A 2XTZA 4JLVA 1KJZA 3TUIC 3VTKA 3TUJC 2J45A 3Q85A 4EDHA 1CRQA 1G3QA 3R20A 3K0FA 1NVVR 3DL0A 2ERYA 1YZNA 2X2EA 4Z1MD 2ZXUA 1OKKD 4ARZB 2REOA 4AI6A 3NTUA 1KTVA 5CM9C 4FWIB 2HJVA 1R8QA 1SHZA 4UNQA 2IYTA 3SYNA 1Z08A 2QT0A 2WM9B 4TMWA 3SJBA 3VU9B 3LQQA 4ZPXA 3KX2A 3NIBA 4IDOA 4KITB 3MLEA 2ZM5A 4C0HA 4HLCA 3CWQA 2XEXA 4QOSA 2KWIA 4HZIA 4I1UA 4X8HA 1E79A 2AX4A 2IYYA 2JA1A 2QMHA 3KUDA 4PO9A 4DVGA 1RKBA 2J0SA 1MH1A 4Q1DA 4DSUA 3DDCA 2IYZA 4KU4A 3BGWA 1CS4C 1GL9B 3P20A 5CDFE 4AWXA 2JIZA 2P3SA 1KKMA 4LBYA 1G64A 5GJBA 3QKUA 4GOXA 4OQLA 3R9IA 4MUBA 3CRQA 1MR3F 1M1YE 2VF8A 4QNRA 2Q6TA 2QGNA 4CF7A 2ZE8A 2IEZA 1WRBA 1R6BX 2D06A 4G0NA 4LHWA 4CEJA 3S1AB 3IO5A 1NBME 1SVLA 2FMXA 2H57A 3DVLA 4Q7MB 2VHTA 2XXAA 5J4HA 1Z06A 4M4SA 1Q1ZA 3QPWA 3U7HB 5KYKA 3EWAA 4MRVA 3W90A 1OKKA 2XNSA 5FTLA 3FGNA 5EXSA 2R2AA 4LI0A 4D0NA 4CVNA 3K53A 5E7IA 2GEDA 1G1MA 1JPJA 4DLYA 2VHQA 5HKKD 1EX6A 4OJKA 3R7WA 2IWRA 1NLZA 4NKRA 1KSJA 1QBKC 1Z47A 2BBSA 1N0UA 1P2VA 4AKHA 1AN0A 3QVVA 1OFIA 3ADKA 2IXGA 4C0BA 1IONA 1MABB 3UG7A 3W34A 5JS8A 1FNMA 1LF5A 2CE2X 2H18A 4RSGA 3NWJA 5FTMA 5SZKB 4E07A 4RZXA 2Q3FA 5AR1A 3SR0A 1FMLA 2NOAA 4MRPA 2O0HA 2IYRA 3AH8A 4NCIA 3BH6A 2Y8EA 2A2ZA 3T61A 3TSZA 2N1BA 3NEJA 3GLFE 3EA5A 1JAHA 2QE7D 1AZTA 1E9AA 2RGGA 1E2DA 3IHWA 5IK2D 1RZ3A 2I1QA 2IF2A 5FOUA 1ZBDA 1EFRA 4Y0VA 1W46A 1U9IC 3P4XA 3H4MA 2OLJA 3VHLB 1D2MA 5DN6A 2ZI5A 1UBEA 3SU8A 2PZFA 2P6UA 5FPSA 2YC2C 3TE6A 1IAQA 1OB5A 4JLBA 2J1LA 1RE0A 2TMKA 1ZC3A 3IEVA 1RJ9B 1QHYA 4JLOA 2F3TA 1NBMD 2OILA 2WV9A 4Q4JA 1KY2A 3L0IB 3CRW1 4HLUA 3ND9A 5EQTA 3CW2A 1E32A 3I92A 621PA 4AIIA 2EYUA 2QTVB 2P6NA 4Q66C 2EFDB 2ZRKA 4MH0R 3CX8A 3I4LA 1JEDA 3IIKA 3GLIA 1LTQA 2G83A 3BWDD 2X19A 2OESA 1NN5A 1YHNA 3OAAD 1UBGA 1WXQA 4JLNA 1M74A 1ZAKA 4N3NA 3G82C 1KJWA 4B3DA 5IF9A 2QP3A 1G291 2GF9A 4TLBA 1T3LA 4EPXA 2ZIAA 3AF2A 2BMEA 5CJPA 4LV5B 4DJTA 1Z0AA 3EZ2A 1OXXK 5CDFA 1Z0DA 3KQUA 4Q4HA 4OKSA 2FSGA 4LCBA 2EFEB 3WYAA 3KB1A 3MWKA 4ZI3A 2ZYVX 3MWLA 1OIVA 3MRSA 4EAQA 1K8RA 3KFXA 4Q9JA 4LJYA 3H86A 4DCSA 1HE8B 3KUCA 4MYCA 3QSYA 1P5ZB 1BKDR 1RRFA 2QORA 4US0R 4Q01A 4UNNA 4B2PA 2C2HA 3UMRA 2KB0A 3FVQA 5JRZA 2FE4A 5C46F 4G5RA 1SKYB 3R8FA 2G0NA 2WKRA 3VX4A 3TJZA 1UJ2A 4XWAA 1XCMA 3Q3JB 4UKDA 4Q9KA 2WWGA 3B1VA 1OIWA 2G88A 3CUEF 4HDOB 4KBFA 3FOZA 4DLZA 4BRUA 3AVWA 4WZAE 1KO5A 1AGPA 2ZRBA 4TN1A 3T5DA 4OI0A 1DAGA 4IVRA 1WA5A 1R2QA 4GT1A 4XSHA 1XRJA 2R6CA 4B48A 2VRWA 3SOPA 1W4CA 2QN6A 2OBMA 2EWWA 4HAUA 3ZIAD 1R4AA 3SDZA 2JLXA 3GLHE 3OEHA 3NDPA 2UKDA 2VF7A 1SGWA 3VFDA 3O8CA 5TXGA 3PITA 4A6PA 2I1VB 4DSNA 4O2RA 1G20E 2IEYA 3B13B 3ZZTA 1N6PA 3A1UA 5GVSA 5JHHB 1NF3A 2D2EA 3WBKA 221PA 2ZJZA 3LDAA 2VP9A 3FMPB 1N5LA 1UEIA 3SHWA 4X8LA 3GLFA 2CK3D 5KO2A 3LY5A 3THXA 4ESVA 1JJ7A 4RKFA 1W4BA 5ELXA 4Q1EA 3T1TA 3B1XA 4AY2A 1AKEA 1G6HA 1II8B 5FL7D 4U00A 3NEYA 3FHOA 5C1BA 2XZOA 3K0AB 4C2UA 3AKDA 4RY2A 4BUJA 3C5CA 4HDCA 2XNDD 3DZ8A 4PSAA 5EE3A 4OHVA 3AUXA 5J4YA 4IVPA 4ZI2A 1RYHA 2EQBA 1IBRA 3CRVA 3UATA 1ZIPA 3TNFA 1W48A 3HPRA 3KXKA 1N6RA 1ZM4A 3PEUA 2N46A 2QT1A 3EC1A 1E2NA 1XJQA 2BMFA 1EX7A 1DBSA 4GRAA 1KZGB 4TSFD 5FPHA 2FPLA 1AS2A 2OCYC 4C9BA 3VR2A 4K81B 3CB4A 3I8XA 4QHYA 4M0LA 4MA4A 1R0WA 1S4QA 2WHXA 4HZUA 4JIMA 3TRFA 5HZHA 2FDCA 4DSTA 1E3MA 4JT4A 1Z83A 3VNUA 2J87A 1H8EA 3J81k 1SXJA 2V3CC 4C3ZA 2V1XA 5AJVB 3RRYA 4HB0A 3KXLA 3ADCA 4JSYA 4RD3A 2BEKA 2ZITA 4M1WA 4Q5IA 3UKDA 1XD2A 4B3CA 4LJ9A 5H68A 4DC9A 3EIQA 4OI2A 4DXAA 3I62A 3Q5EA 2R8RA 3SFZA 3O8RA 5AUOB 1VYUA 5JCZA 3N70A 3FTQA 3LAWA 1W7AA 2YWGA 2X1VA 1Z28A 2GEVA 4M9QA 3U3OA 5C2JB 4PQFA 4UJ5A 1CJUC 5G53C 1ZIOA 5EE5B 5TY0A 3BIFA 4I1OA 3U2QA 4H1VA 2CCJA 4QJ5A 2GDJA 3IDQA 1Z3IX 1J8YF 2J3EA 3UANA 3VMFA 2O8CB 4LV8B 4IEEA 3U44B 5AJZA 2Q3HA 4LHVA 3I72A 3QBVA 5B58C 1N6NA 2G9NA 2DWOA 4CT4B 4Z8YA 3P1JA 4TWZA 3U60B 5HCIA 3W6PA 1NIPA 4WXPA 4F4JA 2ZI3A 2Z4RA 2ZJAA 4NYMQ 1WMSA 4M1TA 5CB6A 4D4JA 1CKEA 3ECCA 3LV8A 4M8NE 3RSLA 1R0YA 2CJWB 2WJHA 2RAPA 1RYFA 3AF0A 3QXSA 1OPXA 2ZYTX 1N25A 3HWSA 3T15A 5JLJA 4NHOA 5J5CA 1P73A 2QMEA 2NPFA 4EPVA 1GAJA 4IFEA 3OIVA 1LVGA 2F1HA 4IDHA 4PC7A 4AURA 2ZSAA 4HSEA 3BB1A 1KDTA 1TU3A 4GP6A 1KI9A 5EE1A 4PQYA 3WXMA 2J7KA 1F2UA 1X86B 2B8WA 3AKYA 2C9CA 4PSKA 1E2IA 5BQ5A 1BYIA 2G0TA 4IXMA 4M1MA 1P72A 4LUCA 4V0OA 3T35A 2NTYC 2VSXA 1KI4A 2WIBA 4LGMA 1TADA 1K5DA 1XZQA 3AGQA 4LYJA 1T0HB 1HQYE 1RIFA 1Z0KA 1KO8A 2Q3MA 3A4LA 3IIJA 4JLPA 3LVQE 5AJXA 4ILEA 4FWTA 3RS3A 4ZDWA 3VR3A 3RRNA 5TV2A 1E9RA 3QPVA 2C9OA 3NXSA 2RGDA 4QBHA 3ASZA 4OQNA 1JR6A 3PG5A 1NLYA 3PEVA 1WQ1R 2XSZD 4NH0A 3B9PA 2HYDA 4URYR 2BBWA 3QF7A 1XXHE 5AK0A 1E2QA 3ZZ0A 2HXSA 5F3WB 2RGBA 4RD1A 4DLWA 3IBGA 2FOLA 4OQFA 2IXEA 1BO6A 1JEEA 1W36D 4QGGA 1YRBA 4X8MA 3MG9A 3B1ZA 4OYHA 2WJVA 4MQBA 5JEEA 4EJSC 2OO7A 4B33A 1YJ5A 3C41J 5FPTA 3P4YA 5HR5A 2P6RA 3ZVMA 2OZEA 3AVVA 1E1QD 5GJVC 1GNPA 4JVMA 3ZLJA 1NSTA 5E3HA 2GJ9A 4U7DA 4EQ6B 1Z2AA 1GNQA 3PUZA 4FMDB 2JDID 1TTTA 4GZMA 3LBHA 2QA5A 2ZJ5A 2HDNB 1E0SA 4HUQA 5FOVA 2PMDA 2SHKA 1K6MA 2CHVA 4D0GA 5CITA 2FPKA 2RGNA 4FN5A 3WHKA 4BGDA 3AVOA 1Z07A 1CP2A 5FR2A 1XEWY 4BQSA 1BIFA 3U7FB 1BMFD 1HY3A 1T3HA 1HT1E 1P9WA 2H5EA 1OJLA 2GJKA 2OAQ1 2PT5A 4MYHA 2WSSA 5C4MA 1P60A 4FMCF 3VKWA 1NN1A 4B3FX 3JZMA 4E22A 2JLYA 2HT1A 1OH6A 4OI4A 3KQNA 2QROA 2G1JA 2Q21A 4EIWA 3ZD6A 3EG5A 4JLKA 2YWFA 4PC3A 2FJUA 1W5SA 2FFHA 4PHHA 1ZP6A 3MGCA 2GF0A 1KK1A 3UXMA 4LYAA 5FPYA 3K09A 5K8TA 1KI6A 2DCUA 1E69A 2ZVPX 2JJ8A 3CBQA 4PZLA 4EJSB 1PLJA 2FN4A 3SJCA 1OXVA 2WJGA 3TSWA 3MAAC 4A0FA 1NKSA 3EPHA 3BOSA 4X8OA 3AKCA 2YOFA 2P65A 4IOKA 4L15A 4DRZA 1ZU5A 2GEUA 1QG4A 4Q03A 521PA 1TQ2A 1AGRA 3TW4A 2O8BB 1P2SA 1YE8A 1OXUA 4HAYA 4URVR 2ZTSA 1P62B 3I8SA 1HEIA 4RFSB 3RNLA 3TAHA 5BXQC 4F4CA 2XZLA 1PUIA 1XTKA 1I4LD 2QNRA 3KKNA 2DPXA 3FMOB 4OHYA 4ARZA 1KSFX 2FFQA 2PCJA 4JBWA 1N2CE 2C03A 4DCNA 2ZRLA 4G01B 2AHOA 3MCAA 2FFAA 1G7RA 5SZHB 1KZ7B 2Z6VA 2FGJA 3VU9A 1SKQA 2B6HA 4PPNA 4CYMA 5DHAA 5D3MB 1EGAA 1TEVA 1ZM9A 1DG1G 2MMCA 3P26A 1US8B 2NPIA 3DMNA 4H1UA 2ODWA 4BFTA 2GBLC 2DFKB 4Q47A 4DUGA 4ZDKA 1VG9B 3B60A 3M0EA 4W9MC 1UBCA 1UEJA 4ACAA 4M1SA 1P2TA 1E2KA 2ZS8A 1ZD8A 3K70B 4OHWA 2GESA 4XD7A 5EP4A 2ZJOA 1R5BA 4Q19A 2OCAA 1P2UA 3CH5A 1A2BA 4EFNA 1Z63A 2WZQA 4R2IA 4DCUA 1NVUQ 1CBUA 4KFRA 3AB3A 3WP1B 4BFZA 2VP0A 4KAXA 1UKYA 2NO0A 4LK2A 1DARA 1PVOA 4OQMA 4K46A 2PL3A 4TLEA 5FL3A 2VP2A 1HT2E 3B9QA 3TR0A 4IOJA 1GDDA 2K5UA 2EWVA 5JWHA 4TL6A 4KYIB 2W2TA 1R5OA 4DLVA 1IXRC 2DR3A 4M53A 3TSOA 1CF4A 1IXZA 1KOFA 1W44A 4PTLA 2AFIE 5EXXA 2YVUA 1WDTA 1QHHB 3CKLA 2XOKA 2V9PA 4JVSB 1KAGA 1MABA 4NDZA 1QG2A 2FG5A 2QSZA 5G41A 1SVIA 2F1JA 3BORA 4MKFA 4XSGA 4A2PA 4NYJR 3R9XA 1E2LA 1ESNA 4Q21A 1XTJA 2GXUA 2YKGA 5A5GA 1U94A 4EPYA 5F2EA 4YMSA 1NVXQ 3AP2A 4QGAA 4JS0A 2WIAA 2DBYA 3KKMA 4KBGA 2MMGA 4HLDA 2YYZA 4WIAA 3KJHA 3V4FA 1JALA 1WB9A 3X1DA 5C18A 1NG9A 1T8UA 4D4KA 2B7BA 4DIDA 2O0JA 1GM5A 1A5TA 1Q1EA 2Z83A 1N5KA 4FINA 4IVQA 3L0SA 5G3YA 3OEEA 4MKGA 2D62A 1G8YA 3RRMA 1SQ5A 4ZDIA 1NKTA 2QAGB 1B23P 4JL5A 1MO3A 1DADA 1K5GA 4F91B 3SQXA 3FKQA 5DSZA 3ZH9B 4BFVA 5FH9A 2CE7A 3TKLA 3WRXC 4D6PA 4LY6A 1RJ9A 2ASEA 4R71A 1YZQA 4KODA 1VHTA 1EESA 1L4UA 2A5DA 2ZEJA 2WJJA 1NVVQ 4D4LA 1E2FA 2VTKA 2QENA 5DIFA 4Z51A 1AM4D 2UZIR 3AVPA 2YJTD 2RH5A 1CLUA 1Z5ZA 4PQRA 4Q02A 4URZR 1RVDA 4GPTA 1DAKA 4JL8A 1E9BA 1E79D 1T5IA 4TTRA 5A4JA 1OXSC 2F1IA 4HDQB 4S35A 3T5GA 2EW1A 3ZDQA 3BFXA 2I3BA 3I3SR 4IDQA 3W8RA 2WPDA 1DOAA 2JIZD 1U0HC 4HAZA 2NZJA 5IT5A 2JLWA 4E5UA 2ZSFA 3O8DA 4Q00A 3T1VA 3LFUA 4YMTA 1M7HA 3PIRA 3AEZA 1LW7A 2VQSA 3UWKA 2XAUA 4UNPA 3OF5A 3CZPA 1DS6A 3WRYC 1JECA 4M2LA 3B8HA 2WJYA 2IT1A 2PEYA 4O3MA 1UPTA 4PSVA 1ZM3A 2YOGA 4IDNA 5FUVA 3RAPR 2IX3A 6Q21A 4TT3A 4ZCLA 3BBPA 1G4AE 5FBWB 2EU8A 4F92B 4I1SA 4W7SA 4ZO4A 4JJZA 2CL6X 1XEWX 2C78A 3ZQ6A 4ZIRB 4RD0A 5BW8A 3GLIE 3PUVA 4XJXA 2KJQA 3OHMA 4B6FA 5FOWA 1ZJ6A 1OV4A 1U99A 2C04A 3NHBA 2GVDC 1HUQA 4QBIA 1TEXA 4WA7A 1CJVC 1IN5A 2YWEA 2AFHE 2BBTA 4C0KA 4NYIQ 1Y63A 3SC3A 2AKYA 2BJVA 1I4DD 2XJ4A 4U02A 3MFYA 2NG1A 3KJIA 4XTCS 1TL7C 3EARA 5FTJA 4TZ0A 2PJZA 3ZS8A 1HH4A 1Z0JA 1YZLA 3HYRA 3B6EA 1N6KA 4LYFA 3GJXC 4MUAA 4KSCA 5F9FA 2OFOA 1G18A 2R6AA 2ONKA 5LBIA 2ZU0C 1COWA 4V0NA 1UKVY 1LS6A 1FTSA 3KJGA 1GIAA 4TTQA 1E96A 4HB4A 4G5QA 1DAEA 4MKHA 2KI5A 4A0GA 4PAMA 3C8UA 3O47A 2FA9A 5AUPB 2OCBA 1PJRA 1PUJA 3M1IA 1IM2A 1D2NA 2GCOB 1T3SA 2NO6A 3DPUA 4QBGB 1GUAA 1F6BA 1DPFA 3QBTA 1J90A 3K9HA 2CVFA 2OAP1 1IOZA 1EFRD 1G7SA 1V5WA 2DWPA 1IY0A 3SZRA 4Q4AB 2VL7A 4IW3B 1D9ZA 3CH4B 1II8A 5DN6D 3REGA 3ZJYA 1N5IA 3K0AA 3P32A 4QC2A 2ODBA 1BS1A 2F1RA 3NH6A 2NQ2C 2YC4C 5AUNB 1OFHA 1RW4A 4DLUA 4RZUA 3CPEA 1M7GA 2O5VA 2ECKA 2H16A 2F9LA 1NLFA 2OCPA 2ZRNA 2KBEA 5KDLA 1YR7A 4LPSA 4PXAA 421PA 3DMDA 3I73A 1XNJA 3MD0A 4FCWA 4Q7LA 3VR1A 1PV4A 1CRPA 2BCJQ 1WE2A 2QTHA 5JCPA 1G21E 2JEOA 2VYFA 3CLVA 1YZKA 1X3SA 2P5TB 3BFKA 5H8WA 5IRCD 4BE7B 1D5CA 1JQJC 4A2WA 2PMKA 1Q22A 4MRRA 2ODEA 4HAWA 3PXGA 1ETUA 5HCNA 1DEKA 5EUQB 4QXAA 2WICA 3K0EA 3L0PA 3QEOA 4Q1BA 2W58A 1VCOA 2QZ4A 2WVJA 4EFLA 1VG1A 3BD9A 1ZM2A 2VH5R 5BYJA 1U8ZA 3KQHA 2W6IA 4A92A 3W3ZB 4YC7A 1A4RA 2ZRCA 4GMXA 1CTQA 4PO8A 3CRRA 2OXCA 5B2ZA 1S1CA 4IRUB 1E9FA 2VO1A 1XTSA 2A5JA 5GADl 1R0XA 2P2LA 4JVLA 1KO4A 3L0OA 5JSZB 3NC0C 2CDNA 2D74A 2GXSA 4Z8XA 1NVWQ 1QZXA 5KSYA 1JI0A 3AP3A 5JMTA 2OUKA 5J4LA 1NN0A 2GK6A 2H92A 4NZYA 2FGKA 4PZYA 4C0SA 3LA6A 2MSEB 3GLGB 1P6XA 4CGZA 1SXJE 2O8CA 4ZDJA 2IYXA 1MKYA 3U44A 2QG6A 4IFBA 1XU4A 4LWZA 4AD8A 4TYPA 2AXPA 4P3YA 5LD2C 1NRJB 1TU4A 1UKZA 5FUXA 4CIDA 2UZ3A 1G7CA 4IOLA 1KSHA 2IXFA 1ELOA 3SE0A 3OEHD 3U7GA 1A2KC 1YQTA 4QM6A 2CJWA 2GK7A 1DAMA 3BERA 3RLFA 1JR3A 2QMOA 1JBKA 3T1QA 2XTNA 1AQUA 5KSZA 1T91A 3SBEA 3DO6A 1FUKA 3KZ1E 2P0EA 3FWYA 4CDGA 2JCSA 3B5JA 5D3QA 4NP6A 2RB4A 5BYKA 5CB8A 1OB2A 4OL0A 4XWKA 1XEXB 2ZQ5A 3D7MA 4B3BA 4CZ2A 4FD2A 1BH2A 4H9GA 3MWYW 1P9RA 2ZYUX 2QGZA 4HB2A 2XB2A 2BM1A 2PBRA 2OG2A 4FCVA 1KI2A 2BCGY 1II9A 2ODNA 4KFSA 3PEWA 4JZKA 1G17A 1KI7A 3BH7A 5KOYA 1XPUA 4IOMA 5P21A 1AS3A 2R9VA 1P3JA 2N42A 1VDZA 4LHYA 2CNWA 4CEHB 2IA5A 2GETA 1XFAA 3CO5A 1G3RA 2ZRFA 4UXJA 1TF7A 3EASA 1T0JB 2ZUDA 3EZ7A 4OHXA 5L3SB 2ZI7A 5EE9A 5DNYB 3Q72A 1KK2A 5DISB 5FUWA 2DFNA 5KNCA 4FMBB 1XTRA 1H8ED 1HV8A 3AF1A 1SXJD 2PCLA 2ORIA 2V6IA 3CX6A 3NBFA 4V03A 1W49A 4HB3A 1UKEA 1U0JA 2ZR9A 3E2IA 4WVFA 1XJCA 3U3JA 2KE5A 5FOXA 4LBZA 1E1RD 2Z43A 1QF9A 5J47A 4NCHA 3KDSE 3DOEA
chains in the Genus database with same CATH superfamily
4XLZA 1KKUA 1Z73A 3DKRA 5CXXA 4JI1B 2ZSEA 5T64A 1SJ9A 4LZOA 4JCOA 4P54A 4L02A 4XFDA 5J2UF 3OM9A 3RYIB 1KU0A 1UDBA 2P9YA 4EQ6A 3UWPA 4I3HA 1SR8A 3CVUA 2QTTA 3VU8A 4LJAA 3KC2A 3TOXA 3K1JA 1NKVA 1TPZA 1B6GA 3DXFA 2O19A 5AKYA 4CG0A 1CFJA 1FFXA 4TVOA 5H4GA 4PR0A 1WMBA 3KHKA 4AQDA 1A98A 1Z6GA 4UBKA 5DM70 4U7WA 1E1CB 1EFTA 1FW8A 4NCJA 2VNKA 2DB3A 1DAHA 2QR5A 1P7YA 3QVTA 1W4LA 1EGVB 2ILVA 1L1FA 1TA0A 2P9GA 5ALGA 3THYB 2ZYWX 2YH2A 1ISMA 2IX9A 3D0OA 1UT6A 3FZQA 2OHOA 4E7OA 1R6VA 2EZ4A 4RIGA 4TMYA 5FA8A 2YIDA 4RYLA 4CDRA 1IG0A 1UC8A 5EPEA 2IHZA 5G3ZA 5JI2E 3K20A 5K0ZA 3OIDA 2R6FA 3EVTA 2IOQA 3HDYA 4HQKA 3NP9A 1G19A 5IDYA 4BVEA 1K27A 1Z5OA 1D4AA 5JPIA 4RL6A 1DXQA 4U2EA 5HCUA 4F4FA 2GJSA 5BN5A 5B3AA 1ZUIA 3VZRA 2H1FA 1ZH0A 2VAMA 1YS9A 4OEHA 3D2AA 5DBGA 5MFPA 1L4NA 1XC7A 4NBVA 4FFDA 1NJFA 1Z6TA 3FKSA 4P7BA 4RK4A 4PGHA 4FX2A 2E4UA 1AGXA 4HH4A 4IO1A 4P34A 4EJSA 1Y6GA 2FFRA 2WYIA 4XIFA 2PO5A 5BRNA 4HHEA 3RHTA 3GA7A 3W6ZA 1DELA 4B3SB 3V46A 4CFSA 2AJLI 1QHGA 4NZMA 1SULA 4DXHA 3OTOB 4NEGA 3IUPA 3G89A 3AETB 1CQJA 1UXKA 3BC1A 3C43A 3IAAA 5CX4A 5AI0A 4BVAA 2MHCA 4CUZA 4DIEA 1H6BA 1CR2A 3E7DA 3H5IA 4AG5A 5EUQB 1XQ1A 4YP5A 5ICFA 2FWNA 2PX0A 3RBXA 4Q7EA 1E2JA 1YVPA 2O1EA 3W05A 1OLSB 3ZGXA 4JBHA 1PLLA 1A7JA 1N4DA 2CB9A 2V8OA 3R6GA 3DV9A 4JWTA 4KLAA 3WK6A 1RWMA 3C6KA 3I6MA 1GNRA 4I81A 1JB1A 3H4VA 3OHPA 4DSOA 2F43B 4JEMA 1YOBA 3A2KA 3FTPA 3TBHA 1BS2A 1SHKA 1V7QA 3ZLUA 2HIAA 4FKZA 1YDMA 1QP0A 1S2IA 2IELA 3B48A 1W6UA 3HCRA 3WO1A 1EVLA 1F8XA 1Z4NA 1UJCA 3BTVA 4P92A 5D3MA 3IUMA 4FDLA 3P5SA 4PRZA 1XRRA 4I5EA 4KX3A 3QNMA 1EFKA 1MB9A 4CMBA 4L8YA 5DKFA 4EDFA 2AWNA 4B2IA 4EG0A 4UHCA 4BQQA 2QTFA 2ZCUA 3M2PA 2L82A 2CXUA 1OE0A 4WT7A 1P74A 3E70C 1GWNA 4MO2A 2IH5A 1AKWA 2AOTA 3DWFA 4QTZA 1E4EB 1GTJ1 1TC1A 2O4CA 4HS4A 3WLMA 5KZMB 4BV2A 3DAGA 4R6WA 1D8TA 3JVUA 3PHGA 5BSVA 3H3JA 1S9HA 2VZ9A 4L8WB 4WOCA 2IL1A 4KPUB 1CV2A 3CN7A 4LV6A 4ON9A 3F7MA 4P4SB 3H9QA 3II6X 1M1YB 1N3IA 4X85A 3G2KA 3VNRA 2VZEA 1P2FA 1GY8A 2C88A 2QM8A 3G8AA 4GSLA 3U3RA 4QKQA 3LUKA 3H5LA 3AEKA 2PXHA 2BSQA 4FDAA 1GVHA 1M10A 1Q11A 2Z5GA 1JDNA 3GVCA 1EE9A 3V4RA 3VISA 1TQ6A 4FFRA 5I7UA 1Q1BA 4KO4S 1B41A 5HZMA 1QE3A 4X7MA 2OYRA 3LBNA 2KLBA 1UCFA 3I5AA 3V55A 3HM9A 5FWYB 1QHHA 5BSKA 1EQAA 3DAYA 1L8QA 1GPBA 3OX1A 1EVQA 1C4OA 2QN2A 3MWJA 1QHSA 4G67A 3ZHRA 1ISHA 3U80A 1GG2A 4JH0A 4MEBA 4O4HB 4FHZA 4RUKA 3DONA 4R1NA 4WX2B 1L7VC 1RXCA 4I1RA 3QFTA 1QS0B 1SCQA 5DW3A 5I9MA 3WGJA 4YLYA 3O1HB 4L8GA 4E32A 4BATA 2XWJI 1P45A 1L5RA 3OE5A 4OJYA 1KMHB 3WQBA 2IC5A 4JP5A 3AERA 3STXA 3HXPA 1QJ4A 2Q4EA 1PVVA 2VDJA 3OCYA 1GNLA 1X7DA 4DCTA 2QPOA 5E2IA 5HDQA 4L16A 4FIZA 2AI3A 2Q5HA 1UBUS 2CUKA 3W5AA 3VZSA 3R7BA 5DBIA 2IZ6A 4EP1A 1QGOA 2B5VA 2A9QA 2XMDA 1QIDA 3ZBPA 1KJ9A 1Z0UA 5CNIA 3QVJA 4RLFA 4X20B 2I7CA 2D5IA 3EDQA 4QOJA 821PA 2ES4A 5LA6B 2Z58A 4XASA 5D87A 4FBMA 4B9EA 1YRAA 3Q7QA 3EXFA 3EVBA 4GOKA 2QAGA 4W9NC 3VHXB 3UMFA 4L85A 2C4MA 1PS0A 1A04A 2WZBA 4KGDA 4F1JA 3EXAA 4QXOA 1RJDA 3TG2A 1PNOA 1A7KA 3CBGA 1VKZA 3EC2A 3OZXA 3RRFA 1Q20A 4PC2A 2EFHB 2PMFA 3E84A 3T7CA 1UFVA 1PR1A 1VMAA 2OD2A 3N0RA 3QPCA 1KOLA 4R71A 2W2QA 1IHXA 1A2OA 4INPA 4JB0A 4QDKA 2AFRA 3NBYC 5FORA 3SFVA 4EG7A 5LPNA 1ZI6A 3JQ9A 2JG3A 3HVJA 3UXEA 3A37A 3QX7A 1G9XA 2B8TA 2CZQA 5DHUA 5FR1A 5B30A 5A3QA 2R5NA 5CK4A 3K9NA 1CUWA 2RGXA 4QBFA 4JR0A 1EM8A 1T29A 1GPH1 3WRVA 4ECEA 3EQ8A 1XDSA 2CXXA 2FOXA 3QE2A 5AXDA 4B6SA 2JGLA 3EZ9A 4DAOA 3ZVRA 1LDNA 1KEPA 3SKYA 2R48A 3DD1A 1JIJA 3HJRA 1S0UA 2Q1WA 3EVFA 2WYWA 2CXNA 2GBIA 1X7WB 1QGED 1XTZA 4K9OA 1NW9B 1KBQA 2XKBA 3FNGA 4HI0E 1PZHA 4HWPA 3OZAA 4FCTA 4MP6A 5J5VA 2X0JA 5T3YA 2UUCB 4ZI7F 2RJ3A 4AJIA 4GLJA 3RIEA 1GRVA 2BEUA 5IJAA 2P1DA 3IQWA 4WCFA 3QG5A 1XEFA 3R3VA 4A91A 2HCBA 1EJ0A 1RPNA 2V54A 4EABA 2ETXA 3PQFA 3RVRA 4DDWA 3PDIB 4UNSA 4OBEA 2VP6A 3QHAA 4JCCA 4WBNA 4HAIA 2PUEA 2P0AA 4W5NA 4R4JA 5E3JA 2ZYSA 2BKXA 2VDKB 3A3PA 5FWXA 3RUHA 3ZX5A 4ZIRA 5CEFA 2IY9A 1O89A 3GLGE 4OO3A 1H85A 2WWHA 4N0EA 1VTKA 4O2AB 3VYUB 5BWLA 4QG3A 1J09A 2C07A 3B78A 1JYSA 4P4NA 2B98A 1P33A 3GQBA 3N6XA 5C8VA 2I6XA 1ZD9A 1TZMA 5DBFA 4F5DA 1SC9A 1I3KA 1TCUA 2GEKA 1BRTA 1VKOA 2ZAOA 3OA2A 3OFJA 4KQHA 1MN6A 2YICA 4UM9D 2VJKA 3U40A 1PGNA 3MYRA 2FZKA 4QYXA 5JH7B 5KDDA 3BL6A 3THSA 2NYVA 1KAEA 5TVGA 4D8TA 1H5NA 3PB3A 4BOYA 2XB4A 5KX5A 2QJTA 3FFAA 2Y27A 3FFTA 4F3CA 4C4ZA 5EGSA 3ZH2A 1JIUA 4D7AA 1VBKA 4LE1A 3AR9A 3KEOA 3KFVA 3PGLA 1DC3A 3NBZC 1P3DA 1D0SA 1ZCZA 3JSXA 5F5NA 1JKIA 4BWYA 5C81A 4ZV9A 3W2HA 2E4AA 2Y2UA 3BIOA 4OHCA 2FPIA 1F5NA 1T4GA 1B0UA 3ET5A 3EUFA 3QG1A 5GJCA 2FR0A 2IEDA 3L4JA 3H9JA 1RBMA 3G2IA 3KLOA 3VUEA 1OAKA 5GJWC 5BYBA 4AKIA 3H6GA 1DZIA 1O58A 2VT2A 2HT6A 1SVMA 2F6RA 2RGEA 1TDJA 2XDWA 5CFZA 5TDHA 2JC3A 1WD5A 3AXTA 3EXHA 3R09A 4Z7JA 3ZNNA 1Z8FA 2GCOA 4AYTA 1KL7A 2HSZA 1MPXA 1RADA 1Y1LA 1W94A 1CDOA 3OJEA 4YONB 1YO6A 1PYOA 4LCJA 2R00A 3BDVA 4EYEA 1CT9A 3OE1A 1NNUA 2FPUA 2DH5A 3WNZA 1EWTA 3L6CA 4RJJA 1RMTA 5TEVA 1R8JA 3VNBA 4C4PA 1IWPB 1P75A 1JVBA 4YAUA 3F6YA 1N33B 4TMZA 4DL9A 4CM4A 1BMQA 3QYPA 4A3SA 4F2HA 4HTAA 4OMFG 1D9XA 1ITZA 4TM7A 1SCUA 2A0UA 2AG1A 1XMVA 2Q0HA 1ESDA 1S89A 3UAYA 1YIAA 3SSMA 3UH0A 1C4WA 1QFZA 3SN6A 3WOHA 2OV3A 3G79A 1ZRHA 4ZO8A 3V2IA 1G5QA 4LISA 4I5DA 4ACBA 3K4PA 3PCXA 2W4QA 3IKTA 2VTDA 1GSHA 3TLKA 1EEXB 3OFSA 3L7OA 1KE2A 1N3LA 1U8EA 4IJQA 1IY9A 4HXFB 1H9BA 4BP3A 1FVHA 2WWTA 3CVOA 4CG2A 5EY5B 4FOLA 1DI0A 2WPDD 4GLLA 4UAGA 5DLDA 3K94A 5AKIA 1DG3A 3PXBA 3U26A 4LDJA 1I2MA 1ZD1A 3C5EA 3FNRA 1GZVA 1T9KA 1NWCA 3EMDA 4E4YA 3S2EA 3BE8A 4IJUA 3WB2A 3F8TA 1OFUX 1J70A 1K68A 1UADA 4MRMB 4DV0B 2ACEA 1M9NA 1E99A 3GG2A 1RQNA 2PZKA 3HFJA 2H1LA 5CXSA 3K5IA 4TT3D 5BN4B 2AMVA 3WL8A 1XRLA 2HXYA 4EG3A 1JHUA 4XE5A 2JJ2A 2QVCA 3RGGA 3KAQA 3W6OA 3IAM6 1I4OA 3QVMA 1HYHA 3QXJA 2P35A 4R9VA 1UDXA 2RDMA 3M81A 3ONDA 4WOPA 4YECA 3R7SA 3PFIA 5GGXA 1VCNA 4WY8A 4HWGA 3SVLA 4MVYA 4Z4EA 5CURA 3J7AC 4JLJA 5JO9A 2JKZA 1VCIA 4LJ6A 3P9PA 5EYPB 2I3ZA 3F3MA 5DF1A 4GBMA 1D4FA 3PHLA 1BZYA 2Q2VA 4GR4A 5M3BA 5C31A 3DVAA 5TARA 2NV0A 3A06A 4FFOA 3GJYA 1ZVVA 1KNQA 2C2OA 3VPCA 2PGJA 2ZBDA 3LHIA 2DKOA 3VV2A 3SCZA 3M34A 1V2HE 5A4DA 5KSWB 3HADA 2JHAA 3GEGA 1H66A 4IILA 3KYJB 2XNJA 1ZOLA 4QPZA 1NZDA 1U8UA 3NG1A 3QE4A 1T5BA 3O3MB 4LSGA 4QATA 1DINA 2PUVA 3EFBA 4GPD1 4RZIA 1RR6A 2YUTA 1FQWA 3M89A 3ROQA 2FPPA 3PF9A 5JY1A 1E3LA 2HCFA 2X6TA 2YFYA 1PDWA 2HJWA 2Z3VA 3QA9A 1ODIA 4YO7A 1CU1A 2NSHA 2JASA 3R0IA 4A8PA 4FOSA 1Z0FA 2QV7A 3LGAA 1ICEA 1V4BA 5FBKA 1NP3A 3BGSA 3MCVA 3AHJA 3HFSA 3MCZA 2RD2A 1Y37A 1U9IA 1ZU4A 2IYUA 1OH5A 5A9TA 2V0GA 3LYUA 5CYOA 4DCGA 2XHZA 1LJUA 4YRJA 5A4IS 3QI2A 2J08A 1QAQA 1XEXA 4X41A 1AGYA 5JCJD 5JD4A 2GXQA 5IJXA 4DZZA 2VJDA 1VIDA 1ZK0A 4HQRA 1BXGA 2I03A 3MMXA 4X6XA 1B43A 4HZGA 1GNSA 3VOAA 3LECA 2WJPA 5I7OA 1HE2A 3DE3X 2ALJA 3IP7A 5DTIA 1KQOA 3I2KA 1QQ6A 3LD9A 4WOJA 4BMXA 4DOMA 3GLUA 5IMSA 5LLDA 1SVUA 2DGDA 1ECGA 1KPIA 2V4ZA 5BSEA 5I7WA 4G9BA 1B0PA 2CMHA 5DWQA 3GXBA 5AVRA 4RGYA 2HGZA 4TTSA 4BXOB 1KVQA 2BM8A 4NATA 5DHFA 1NN3A 1BQ4A 2XXBA 4CEHA 3DKVA 4YP0A 1JQAA 3SSAA 3R3ZA 2M6SA 2G06A 4EFDA 1QFXA 3EPKA 2C96A 2Z0MA 4LHXA 3ZHXA 1D2GA 1ACLA 1G8PA 5CVTA 5L3SA 1MH9A 4MS1B 4LJ8A 4A6DA 2YZNA 2PKQO 5DXAA 1G98A 1R0RE 3HTXA 4NLLA 4BFUA 4KQMA 2G25A 1AUPA 2PE5A 1N7HA 2BTQA 5A9RA 3HCBA 1NY6A 1HYBA 2PN1A 3Q12A 3U1VA 3RU3A 3V7UA 2DBQA 3WA6A 4PIVA 4HAVA 5ED0A 3LT2A 4NXMB 1EHCA 1O6ZA 1TUBA 1XCLA 1YGYA 4EQZA 1WCWA 2QL6A 4KVGA 3CLHA 5K0GA 4ZVNA 5GM1A 3ZJ4A 3ZQJA 3IEKA 1P44A 3JVIA 1X8LA 3X1WA 5K6TA 1ZVMA 1K7CA 1A4UA 3L8ZA 3PWKA 3QKSB 4X90A 1THTA 2W2VA 4TYYA 2XBMA 1FY2A 4HGOA 4AUEA 4BKUA 2FV8A 5AVKA 5DHQA 4UVHA 5G1NA 2F62A 3CG0A 4F85A 3DDNA 2FW0A 3F5DA 1MDBA 2HU7A 4FQ8A 4KYUA 5DU2A 2BEVB 5IDVA 3V00A 3ANYB 1NW6A 1ZVQA 3OQPA 3TZKA 5CHYA 2XUPA 4KACA 3TW8A 2DUMA 1EAMA 2AF4C 1J00A 2P2YA 4RIHA 3AL3A 4U7JA 4BBZA 5KBYA 1Z0IA 3U4QA 3AC0A 2ZIXB 3C7KA 4L75A 1DBQA 4BJ1A 2DT8A 3H13A 3QBEA 4PZ9A 4HUTA 3WAJA 3EH1A 1VLVA 3W79A 3NORA 4PHGA 3P2OA 4TQAA 1U7PA 1IULA 1FMJA 1FFWA 1I5RA 1WU7A 2BEJA 1NXWA 2GA8A 2JIDA 2IDKA 1QVAA 2Y3IA 3D4OA 2CMFA 3KKPA 3QKTA 2EFCB 2BZSA 2HBYA 1NQXA 4O4LA 1KYVA 4CU5A 4OXKA 4AMYA 4LTNA 1YZTA 1WX1A 3OWOA 3W6NA 2ZE7A 1Z88A 3QK7A 4KH1A 3SHQA 4ND6A 1PWXA 4RVSA 4ZU6X 5H59A 5C1PA 4RA9A 3VR4H 4ZYTA 2V58A 1EFDN 1U6KA 2EL7A 3CCBA 5DO9A 5EIOA 4L76A 4CF3A 1EXVA 2PHZA 2IZ5A 3C3YA 1ZR4A 4BV9A 1NUPA 2W2KA 2KBFA 1CUBA 4MVJD 5BQOA 3PHBE 1OZ0A 2H2AA 1RLTA 4Q4DA 2IUEA 3QZUA 4G0PA 4TS4A 1V0JA 2VP3A 4JODA 2FEAA 4XWTA 2IBMA 2J3JA 1YB1A 3A9VA 1KI3A 5GMOA 3KJEA 1QVWA 3C3PA 4N18A 2BTOA 3PUKA 4U4AA 1BE1A 2PSHA 4JT9A 4L9AA 2AI1A 1NY5A 4JLDA 1E0KA 1ZDMA 2X9NA 4MITA 4NICA 5HE9A 3ZWKA 3SXUB 4BIMA 5DCWA 1ZJ4A 4O5OA 3MTDA 1ZINA 4GICA 2H2WA 1WBBA 2C7QA 4JBIA 4KDEA 3RVBA 5JDCA 1A9XA 1PTJC 2CNWD 4D96A 1OX5A 3RVSA 3ZW7A 2X7JA 4A15A 4KV7A 3NWBA 4HP8A 1IB0A 1XQYA 1N2JA 2HK7A 2XWBF 1R3DA 3B3FA 4B74A 3BMXA 2F1KA 3PF8A 4AP5A 1WVIA 2EQ5A 4UHBA 2YRXA 4JXKA 4XIJA 5IKMA 4M6WA 4AZSA 1I1QB 3KTAA 3X1XA 1EUYA 3IKVA 3AY3A 2ZIZA 4DBZA 6GPBA 3Q2IA 2QE7A 2RSLA 4YYZA 4EI7A 1RWQA 4UU0A 1UEXC 2CKDA 2MINB 4Q3CA 3GHYA 3IHLA 2ERXA 2WU3A 1QDLB 2B2NA 1PV2A 3ED1A 3P97A 5EFOA 3GLIE 1QHXA 2OSVA 4MDFA 2EBWA 1JGTA 2P68A 3EA4A 3C8HA 1XCPA 3ZYCA 2BWJA 2ZT7A 5FAXA 3SLKA 3AONB 2YCBA 1U5CA 2XB8A 3FLMA 4GBJA 1P1HA 2JBWA 4B31A 3AY6A 1GILA 3E9CA 4KWIA 2X5KO 4ZTBA 4C03A 2PTGA 1ZNXA 4EHKA 3AR3A 1EM6A 5EWLB 3K0FB 5ALPA 5IZCA 4TL7A 1YACA 3PD7A 1KFKB 4AXXA 5JJLA 3GFFA 3LW7A 3L93A 2NTVA 2I55A 3U17A 2C4WA 4JU8A 4YP1A 3OUTA 3KTDA 3RVOA 3CMMA 2UVPB 4ERNA 2V7PA 4UHHA 1TO2E 3MQ2A 4GGPA 4HQLA 5KJ1A 2D54A 2K6GA 4C6TA 3RD5A 1ZOPA 3GLRA 1CUSA 4L4RA 4U39A 1MJHA 4LECA 2H2GA 1YULA 1Z4PX 3KB6A 4FFPA 1I33A 1QGAA 2BFBA 2QVGA 3AV0B 1I5OA 3WRWA 2RHOA 5MFZA 2SKCA 4PNPA 4AJ2A 2AW3A 4KSYA 1SOMA 1T9DA 3URMA 2YXBA 5GV8A 3WK8A 2GKGA 2O05A 3K9GA 3KSRA 1ZUHA 2CT8A 1QLJA 3M1AA 3OAAA 5KB3A 2ANCA 3WTCA 1N9ZA 3PPXA 4Q37A 1LB1B 1ZVKA 4FYIA 3CLUD 3EF3A 4MKXA 4N0QA 3HJNA 4YCBA 4F6CA 4MUIA 2PWBA 2PBLA 1DMRA 2FWMX 3ZZUA 2D8MA 3PVSA 4LI3X 3U37A 4YCMA 1XZPA 4A10A 1QHEA 4BDTA 3ZQKA 1FP7A 1ZNYA 3R6DA 2PSEA 5HTOA 4F3NA 3E3AA 5CM2Z 1IZ7A 3D0RA 3LUGA 4BFCA 1P31A 3HB4X 1Q7TA 2V7TA 3CNLA 4G5SA 1SQSA 4UBIA 1Y8QB 2AOXA 3TQRA 1X1QA 4M1QA 4DIUA 3WB0A 1PZGA 2CLSA 2Y0BA 3H2SA 2FU5C 4ND5A 1NJGA 1I80A 3NPAA 5DHPA 3L2OB 5DXFA 3F5MA 4YAOA 2IS6A 3M2TA 3WNDA 4IUDS 5BNWA 4V0SA 2OK8A 4LQLA 2XQIA 3R7WB 3SIRA 4KK3A 2YY5A 1R8SA 2AQIA 4S0ZA 4EG4A 2ZRHA 5E6UB 4JQYA 4TV9B 4QQ8A 4BECA 2PQMA 5HDBB 1A5BB 3O83A 4WAUA 3ROXA 4HTFA 3FTCA 3OC0A 4P08A 2AG0A 3FYDA 2MYPA 1BX3A 3WLAA 3ZQ4A 1I7QB 1H2FA 1CNEA 1HL7A 3HL0A 4Q12A 1IN4A 3IS3A 1K89A 4Q48A 4A16A 1TZKA 1XZCA 1ZN7A 3QUSA 1PJLA 3I2HA 2XH8A 1SA0A 2DWUA 1QKJA 3KKLA 5JECA 5DK4A 5KU1A 1S2NA 1C41A 1M2JA 4E1BA 3NTRA 1CS0A 1PT7A 16PKA 2DPMA 2OUIA 3B1YA 2Q7DA 4PANA 4G85A 1OTXA 3S2FA 1DWUA 2PK3A 4ZVVA 2YN0A 4NU8X 3HXLA 3ASVA 4QXRA 1EESA 5AW2A 1NXOA 4B6JA 1VIMA 4OMDA 1XVUA 4HNQA 1D3AA 1QO7A 3TD6A 1EFAA 1XE3A 4ZOQI 3TECE 1WWKA 2QVYX 4J0QA 5I47A 1J20A 1HDZA 2IXBA 4JJKA 2GCPA 3W5SA 2CK3A 1CW2B 1S3FA 2X22A 1VLMA 1NGSA 3KB2A 2WF6A 3K15A 2HRCA 2ZREA 3C6MA 4ASUD 3M5CA 1NYLA 5F3DA 3PD1A 5HBRA 5ALXA 5CDTA 2DFTA 3JQBA 4TQ9A 4IIBA 4MYDA 5FL7A 1V7CA 1II0A 5TRTA 1JH8A 4G0UA 1VRVA 3Q5DA 1RHJA 3KD2A 3IBFA 3WS7A 5KHOC 4MR9B 4EW2A 4H08A 1LF0A 2MWMA 4OHKA 5IJ0B 3OQMA 3HXMA 4RKRA 2BFCA 3UWMA 1W76A 2F17A 4YJHA 3SYRA 5BRAA 2XR1A 5A05A 3UK0A 4C01A 2HPVA 1R0SA 1V1JA 1BCSB 1H4TA 3GQVA 4N9WA 5IT4A 1CR1A 1L9XA 3M4ZA 3PCTA 1JDZA 3UM9A 4EPWA 1TB4A 3MIZA 4C1BA 3GFPA 2JJ1D 2QU8A 4UXHA 2VJPA 1W0JD 2Z3WA 3WKCA 4I1PA 2R8BA 4TYNA 4BLPA 3OZBA 4HX5A 5HYVA 2PRJA 2H1SA 2VHJA 4V2UA 4MGYR 3H87A 1A8PA 1QK5A 1I0IA 4QAQA 1I4EB 3KQTA 4K1XA 5ILGA 3CZ5A 1FRFS 5FOTA 4Y9UA 1L7MA 2Z2YA 2EARA 4UHJA 2NVWA 2Q9AA 2GKSA 3AUYA 4XTRA 1TQDA 1YKFA 1FJ2A 1QFMA 3EFOA 3ELDA 3VO1A 3URKA 3ZEIA 1P18A 2FYTA 4IIJF 5A62A 1DU4A 1NONA 3AEXA 1M2GA 4DLLA 3M3HA 1Y82A 2NTJA 1W5AA 2RHMA 1M67A 3HWWA 5KNDH 3HJBA 3QV1A 3TINA 2D0DA 4D8YA 3RBAA 2FN7A 3OHSX 1OC4A 3LUPA 2IYSA 1LI5A 2O8DA 3RRXA 3GO4A 1DMSA 2BHTA 1YTUA 1JIKA 1EE1A 3WO0A 3GZNB 4X3OA 4MVJG 4B83A 1ZJZA 1PD1A 2CLKB 3FHCB 1VGVA 1OWNA 2REQA 2JEYA 4YFVA 3LUHA 5DH9A 1W2WB 3M4YA 2NO7A 2DUUA 1JLRA 3EWIA 3FPEA 1P5JA 2C92A 3B6JA 4MINA 4TOIA 3TVTA 4D46A 2CF6A 4IH4A 2GZHA 3KVOA 1TRKA 3CRZA 4MV6A 1KAHA 4WHMA 2MU1A 2NLOA 2YZ2A 3ND6A 1RACA 1KBOA 1TGVA 3LWNA 5C34B 1RZRD 3A6EA 4MHTA 1BOOA 4LJLA 1TK9A 9ATCA 1VE7A 2GHIA 1XTUA 1XHLA 2BFAA 3ITDA 1IJFA 5DT9A 3STUA 2QZJA 3NM5A 1PN3A 4Q9LA 3V8RA 3V97A 2O1WA 2VXCA 1U2RA 4KHZA 4N0DA 3EQ6A 1P17A 3BULA 2VHCA 3CQ9A 3DZBA 1ZW6A 4MPPA 2AD1A 1K8ZB 2AOUB 2CSXA 3DFIA 2ORYA 3WWYA 2OO3A 1CG6A 2WG2A 3BA6A 5THXA 4GBGA 4M89A 2PMEA 1BCRA 5EVCA 4W4TA 2AZDA 3KHSA 3KUUA 1EP9A 5IKEA 3PFFA 4ZT4A 4O4JF 2Q1SA 1OQAA 1ZNQO 3ZDRA 1VPTA 2DHQA 2ZSUA 1WHSA 4LK3A 1Q0QA 1TF2A 5KYXB 2GHRA 5CYFA 2MSLA 3T7AA 3ER6A 1X1DA 1NV8A 1SXGA 3DOJA 3F9IA 3M83A 4MV1A 2JFZA 1Z56C 2JAQA 3AI2A 4BBJA 2C9YA 4ZYZA 1F8GA 3HV2A 3FYUA 4A82A 4FLMA 1VLLA 1TPYA 3DZJA 5C80A 1FX0A 2ZBUA 4OB6A 5K8IA 1FDRA 5KWIA 3IX7A 3ZJUA 3M4NA 1YRWA 3FTFA 4C7OA 3TO5A 1U4SA 1GOTA 2OV1A 4GPBA 1YS4A 4FOOA 1JIXA 5G4KB 3HJFA 5JAHA 4IHJF 1R37A 5G0TA 4MUJA 1KI8A 2GM9A 2GJ4A 3R3WA 4P4UA 3MRTA 1MX5A 3CEHA 3IUQA 4K8OA 1GRNA 1COZA 3UK7A 5CD9A 3U6KA 2YHAA 1XK6A 4EW1A 1XDDA 3KP1A 1RPZA 2QRUA 3UENA 2B7CA 4NCNA 1GQQA 3N2EA 1QBGA 3AF4A 3IERA 1BXRB 4FJ0A 4WERA 4LTMA 4URHA 1JXQA 3H0KA 1MX1A 1A4IA 5ECGC 5COAA 3NFRA 4PGMA 5I5GA 3T34A 4URXR 2I2FA 4NULA 1N5JA 2WAAA 3U7QA 1LLUA 1W1WA 2YHIA 5AVXA 3A6GA 1O77A 4QNNA 4IRXA 2VJLA 2NVOA 3EULA 3OIWA 3VAYA 1JXOA 2DUNA 3MM4A 3OIUA 1I6KA 1XD2B 1ZONA 2WOJA 3AIOA 1FP1D 4JLAA 5E4FA 5H3CA 3ZBTA 4AJLA 3GP8A 1JDSA 2R62A 4LN1A 5GVRA 2YYAA 5TS2A 1OWPA 4RF2A 2UYQA 3EUAA 4MCHA 4MJLA 1ISSA 4LYHA 1GUDA 1MO6A 3COYA 2XX3A 4H3SA 3H7AA 5KINB 2G0AA 2IKQA 2IP1A 5EJEA 2JDIA 2NUBA 3KR9A 4MLCA 2HX1A 1OBOA 2VSQA 4WK0B 3WX0A 3ZE9A 4WEOA 5HILA 4RWEA 5A4FS 1DKPA 1KJIA 1LDEA 1BQEA 3USES 2VIIA 4PX9A 3RVKA 2P5SA 3GA0A 3TIFA 4B47A 4QFDA 4R8SA 3EMKA 4WECA 3ZV4A 4HGRA 3UJ6A 4DILA 1HBJA 1GU7A 1TK3A 2QP9X 3EPJA 2FFJA 4HPXB 3A9RA 4HJRA 3NM6B 4DHWA 3E18A 2BDTA 5KTRA 2WMDA 3DMYA 3ENQA 1XWIA 3Q7EA 2Z3ZA 5KDOA 1G0NA 5TMPA 3R8XA 3AEQB 1VI5A 1K7FB 1Q0PA 3H4IA 3S2YA 1JAYA 2VPPA 2WTNA 3DGFC 4WFKA 2VDLB 5BVGA 4QWMA 1WP4A 4YB8A 7GPBA 5CFQA 2HTEA 4D9GA 4MQFB 5E7JA 1EVYA 3JQAD 4FUQA 4Q9NA 5ILQA 5TVKA 1Y6RA 1CEXA 3HCEA 3PHJA 3I2JA 4RKEA 2C4VA 1LKZA 2QWXA 3A6LA 4ESHA 4F5ZA 2F59A 5JS1A 2Z6AA 1OJ7A 4NJEA 5DLEA 3DYVA 3GDOA 2CHGA 2HJGA 1R4ZA 5FT9A 2WNIA 3FCCA 1TIPA 2DAPA 3W6UA 3WRYA 1MTOA 3IKJA 4IZOA 4PZUA 4WV3A 5PNTA 4C4XA 4ND3A 4B76A 4YMWA 3MNFA 1PNQA 1XDUA 1QO0A 3LQ4A 4OXRA 4LQCA 3EY9A 4QX6A 3DO5A 4QFCA 5JVDA 3IKLA 3WGMA 1SMKA 3IQEA 1IHUA 1PYDA 3S1AA 1J5XA 4CU2A 2I9KA 3EGXA 5J40A 4KC0A 2FF7A 5C1IA 2QAGC 1A2QA 5I8WA 2WG1A 1VG0B 4LWQA 2VZ0A 2QS9A 5LIPA 3SF8B 3D4NA 3OPMA 2JLAA 4GHWA 1ATIA 4U9HS 5EWJA 2YDYA 3RKRA 1KARA 4FNMA 5JYEA 4YJ2A 2J9RA 5HS6A 2YV2A 2JLQA 3VSBA 1BU8A 2CNLA 5J4VA 4R9RA 3I61A 4XCQA 5F2NA 5EHXA 3JQ9C 1C0LA 2B21A 2BKEA 3DHWC 4FQ5A 4WVLA 1VYVA 4OGLA 1RQPA 1L4FA 1W2GA 1JKFA 4RVHA 5HOEA 3GFOA 2E37A 3RTDA 1L8XA 2V96A 4GM1A 1E5QA 4WKCA 3RF6A 1Z2PX 3VO9A 4YEDA 2X9QA 4B2YA 2OGWA 3EF1A 2VYCA 4OP3A 4EGFA 1F5SA 3IVXA 2CZCA 2J0UA 3WDKA 1ZSNA 5J5AA 2QAJA 4Z3DA 2Z5LA 2ODPA 5K45A 4B3HA 3F49S 2Q8NA 2Y68A 4OA8A 1J8QA 3CTPA 1E94E 4YBZA 2BGTA 2IV2X 4P0TA 1X1SA 1J07A 2B9VA 4U6NA 4UPDA 4XEHA 4F7WA 3CRMA 3O4VA 1CUHA 2XMCA 3HM2A 4OYYA 2ZS7A 4EF4A 2FE1A 2ZSKA 3VI4B 4LQDA 3PYXA 3ICEA 1I10A 4CEIA 4HDSB 4CCSA 3H2ZA 2CDRA 4IS3A 3QF4A 4C0AC 3GVPA 3LPLA 1GVNB 3ZEAA 4EEXA 1ENZA 3E3OA 3SS7X 2QX8A 3SZGA 1SHJA 4M0CA 4BLRA 2CDBA 3PHCA 4DA8A 2RI0A 4BL5A 4KPYA 4KXWA 3UT5B 5DM1A 2YINC 1T36A 4LFCB 2YXLA 4YHBA 4CLEA 2B99A 4N4AA 4ZHSA 2RGWA 3L06A 2PLWA 2V7XA 2ACKA 1CULC 3W04A 3X44A 3EGCA 4MWCA 4FYKA 4DIFA 3LWBA 3O31A 3DVRX 3MCTA 3KETA 3BXZA 5SZJA 3VPBA 3IPAA 4FYPA 5J63A 4E09A 5JMOA 1BSVA 1OX6A 1JEYB 2CNNA 3K2QA 2QQ5A 1E6KA 2HD4A 1DT5A 2JPDA 4C14A 1XF9A 5IN5A 2JGDB 2Y77A 2Z8ZA 1L4MA 3E35A 4Z9BA 1ZMBA 3V8EA 1V1MA 4RNCA 1GD1O 3ESXA 4RORA 4E13A 5JJIA 2ZR8A 4RZ3A 1FPMA 1NE7A 1B15A 2H63A 4TXNA 3H0CA 4TTPA 5JZMA 1CF2O 2PBZA 1N2ZA 3GCXA 2AF3C 5EZYB 4BX2A 2ETVA 2PLRA 1MAHA 1MG5A 1NF8A 5LB4A 5SZIA 1M7BA 4QHTA 4DE5A 4M86A 4FX5A 1ZGJA 3GLKA 3L02A 1DP4A 1T9HA 3OPNA 4G1MB 2J9FB 2IP4A 3EXHC 3Q7PA 5EXTA 4E5NA 1A95A 1OREA 1O6BA 1P9NA 2VN8A 3FB1A 1DKMA 2C77A 2WZCA 2XTZA 3BTSA 3QRWA 3NUZA 1P1IA 1YQXA 2J45A 1AUQA 3R20A 4ZOEA 3U7HB 4YJKA 3IDFA 2R00C 2R84A 5ALWA 2AN1A 1FDOA 3DL0A 1O5TA 1V3QE 1HDXA 2BKAA 4PU0A 4U2KA 3SZMA 4F11A 4AI6A 1KYZA 2IEIA 3DBHB 5GOZA 4FWIB 4C76A 2Q4OA 3BXHA 4RX1A 1PX0A 1SHZA 4UNQA 5FLKA 3SYNA 1Z08A 3T3DA 5KTSA 3MWGA 1U7ZA 4JGBA 4D8WA 3LQQA 2EZ9A 1USWA 2VJCA 4AKSA 4AX8A 4F5YA 3P0HA 4RJ2A 3WK7A 4M8KA 4RY8A 3RYCA 1T4CB 5GTDA 1VJCA 2WM8A 4H2DA 1DC7A 2AEEA 3DBOB 4YI5A 4X8HA 4BNFA 2AX4A 2IYYA 4CQNA 5IKOA 3GT4A 3X0DA 2RK6A 1A8SA 1OI3A 4K9PA 5CT4A 4BQRA 4DSUA 4WXMA 1T24A 2UXDB 1I9CA 2HRBA 4AWXA 2JIZA 1YS1X 3IOYA 5LYYA 3M9LA 2G08A 1MJGA 1UDRA 4GNRA 1ACJA 1M1YE 5EC8A 3TLCA 2Q6TA 2QGNA 3V7NA 3WJ7A 4F2PA 8ABPA 2PRZA 5FWXB 3DHYA 1WABA 2D06A 2ZSHA 1QCZA 4X44A 4CEJA 2F1OA 2GPYA 3NYWA 4TUYB 5TQ0A 3HA3A 1EXNA 2ECQA 2ATIA 3WIOA 4BV8A 4DGQA 2AV6A 1NAHA 3L1IA 1K06A 2IU6A 2CMGA 2HA2A 3HI6A 4LI0A 5EXSA 4QJIA 3RC1A 3LS2A 2GN8A 3PKIA 5E38A 5G1OA 2VHQA 1R0KA 2A33A 3SG0A 4DLYA 1FXWF 5ELLA 3ICWA 1OWOA 3QEAZ 5KWEA 3HCAA 3FZGA 2WIGA 2IWRA 2RARA 4DVJA 4KN8A 3QX3A 3EUEA 1QBKC 1WMEA 1XLUA 1SOAA 3QVVA 2LIPA 3ADKA 4LJKA 2DOKA 3IXQA 2IXGA 4X1YB 3BXPA 3N75A 2B4KA 3PQ6A 5K8JB 1GSOA 1FNMA 1LF5A 1LWOA 4PIMA 1L1RA 2JJQA 4TTJA 1A9QA 1UMCA 5CU7A 4BRSA 5JATA 1TC2A 1YKGA 4Z9AA 4BNGA 1VLJA 4D74A 2W2MA 1FE8A 4I9FA 4J7CA 4RHUA 4NCIA 1P7PA 1PIWA 1MX9A 5KJCA