4OK6A

Crystal structure of hepatitis c virus ns3 helicase inhibitor co-complex with compound 13 [[1-(2-methoxy-5-nitrobenzyl)-1h-indol-3-yl]acetic acid]
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
445
structure length
430
Chain Sequence
TDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLINAVAYYRGLDVSVDVVVVSTDALMFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease NS3
publication title Integrated strategies for identifying leads that target the NS3 helicase of the hepatitis C virus.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 141
structure length 430
sequence length 445
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4ok6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok6A01
4D6PA 1E3MA 2BM1A 3DZDA 2B8TA 3CO5A 2R6FA 1T91A 2VSOA 3G82C 4UXHA 1UM8A 1UKEA 2W2VA 2G3YA 3EZ7A 3GJ8A 4GMDA 4Q1AA 3KKMA 3PIRA 4ZCMA 2ORWA 1N6KA 3TNFA 1E2QA 2P6UA 3FB4A 4DHEA 1Q1BA 1IXZA 2BVNA 1TU4A 3TRFA 1E6CA 1II8A 1LFDB 1FP7A 8OHMA 1ESNA 2VQSA 3ASYA 2IF2A 3B1WA 1KI1A 2ANBA 3GLHE 4HAYA 2O5VA 3LWNA 3OIYA 4QHTA 1DS6A 3KTAB 1NBMA 2A7QA 4CDGA 1Q44A 1QG2A 3CPHA 1N6OA 3QKRB 5KUTA 3IEUA 1LS6A 2GAOA 3R9IA 1Y3AA 4MGYR 3KJEA 4BLRA 5BWMA 1HT1E 2WM9B 5LBIA 3I5XA 3AEZA 1GAJA 5H68A 2VL7A 3W6NA 5FR1A 2PZEA 1DAEA 4U02A 4F4IA 1JR6A 1PLKA 3RYTC 2JLRA 3RWMB 2ZRCA 1KJZA 4XVQA 1KY3A 4Z8XA 4IOLA 4NCIA 1RZ3A 1E2PA 3TGPA 1NVWQ 4O2RA 4B44A 3BIFA 2VIIA 3W8RA 5F9FA 4OHXA 2QMUA 3UMFA 4DUGD 5FBLB 2EWWA 3QG1A 3AF3A 5IT5A 1XZQA 3CLVA 1SZPA 2GXAA 4OK5A 1BMFA 1XEXB 3ZZTA 3P4YA 4O2LA 2YINC 3SR0A 3N2EA 1GFIA 3B2EA 5FBVB 3B85A 2D62A 2ORVA 3BERA 3BB4A 2AD1A 2B92A 3A4LA 3CB4A 2FZ4A 3KB1A 1OYWA 4GBMA 2WZQA 4WA7A 2FH5B 1P2TA 1A4RA 5DHFA 4QNRA 4G5QA 2KJQA 3QKTA 3FFBA 3LVQE 3RS4A 1X6VA 3QXHA 4YMTA 3F5FA 3ZVNA 2OCBA 4BGDA 1ANKA 4K81B 1VG1A 3IPYA 2BV3A 1SVWA 3A4NA 1OXVA 4PPFA 2B21A 1MR3F 4WZ6A 5GJCA 2BIFA 3AQ4A 3GFTA 3I72A 4AG5A 1PUIA 1RRFA 4HB4A 4MGZR 4JBYA 5B57C 3WRXC 4FXPA 3AM1A 4Q1EA 1DAMA 1G18A 2YKGA 3QKSA 4GFDA 4JLMA 4EDHA 4EKDA 2QT1A 2ZS8A 1M74A 3G5UA 4HB2A 4IOMA 4OQFA 3SDZA 1FUUA 4F38A 2WWFA 3GD7A 1IBRA 4M2LA 5EXPA 1FX0A 3NH6A 5FOSA 1XJCA 1H65A 2ERYA 4TLCA 2HT6A 1P9WA 1TQ4A 2OFXA 5HKKA 4Q47A 3U6KA 5SZKB 1DO0A 3QPVA 3ZZ0A 1ZMXA 4B71A 1VCIA 1ZD1A 2QM7A 2R6GA 4TL7A 3CRW1 4I81A 2W6JD 4Q18A 3OZXA 1GVNB 4DT1B 2WAXA 3K1JA 4ZIRA 2WMOB 1E9EA 3FVQA 1KSJA 4NH0A 3U7GA 4MKHA 3SHFA 3IIJA 2XOKD 1Q3HA 4DLZA 2WVJA 3A58B 3U3OA 2AK3A 4JSYA 3ZIAA 3C4JA 1E32A 1R5OA 1ZNWA 4HAVA 1JPNA 4RZ3A 4M21A 3VNVA 4IFBA 1J70A 2A5YB 1KDTA 1FMJA 3WXMA 1R6BX 4QGAA 2ONJA 3CIOA 1J2JA 4IOJA 4JIMA 2JIZA 2WSSD 4IVPA 2ZM5A 2RB4A 4KFSA 2VHJA 5BW8A 2WKQA 1X86B 5JI3E 2JLWA 3RRMA 2CDNA 5JS8A 3AVVA 2ZJ5A 1GIAA 2J41A 3R7WB 2GZHA 2EYUA 2G6BA 4B35A 5C2JB 1GUAA 2QN6A 2C77A 4ON9A 1ZVQA 1G8YA 1X3SA 3CZPA 1M7HA 3BGWA 4LPSA 1XEWX 1RW4A 2ZVPX 5JECA 5KDOA 2XTMA 3BC1A 2ZYVX 1TU3A 5TARA 1E4VA 1NG1A 1P3JA 1Z28A 1IY0A 4NPHA 1S3GA 4ZCIA 1Z0DA 1VECA 2PT5A 3Q8XB 4O3MA 1NN0A 2QNRA 4BFSA 1N6RA 1KTVA 1MKYA 2O8BB 4PC6A 5EE9A 2HEIA 1H8HA 3VFDA 4L9WA 4URXR 1P60A 1VCMA 2DWQA 2OCPA 4BFTA 5GJVC 3PEUA 5LDDC 2VA8A 3BH0A 4NKRA 3ZH9B 4BRUA 3AP3A 2DFTA 5JSZA 2V7QA 2C8VA 3UKDA 1C4OA 2ZVQX 5CITA 4UNQA 1KMHA 3W9YA 4A0RA 3OIVA 4W7SA 5DO9A 1X1RA 2C98A 2HYDA 4OHWA 3C14C 5LB2A 2D4HA 4QJ4A 4DXAA 3JZAA 1XDBA 3I61A 1VTKA 2Z4RA 1YU9A 5AJWA 1S0UA 1SXJD 2I4IA 3LBNA 4BZPA 2FV8A 4B75A 1SGWA 1T5IA 2WHXA 4ERNA 4ESVA 1F2TA 2CHGA 2VEDA 2OE2A 3VQTA 3UG6A 2IA5A 3LY5A 3V9PA 1HA3A 4GMXA 3MJHA 4DDWA 5JHGB 5DE3A 4A9AA 2OBLA 3B9PA 3D8BA 2HDNB 3O8RA 5J4HA 3RRNA 4NCJA 2CE7A 2QAJA 2ZYWX 3DOEA 5FL7D 2JJ1D 4Q4JA 3THXA 3PV0A 2QP3A 4LHXA 4HB0A 4EFLA 2QSYA 3SJAA 1NSTA 2QTFA 5FOVA 4JJKA 3WNDA 1AJEA 2FEOA 1ZRHA 3H84A 5G3ZA 2V4ZA 1GRRA 2GEUA 4HUQB 3KXLA 1IOZA 1HH4A 3MD0A 4HEJA 4F93B 1CF4A 2WTUA 4OQNA 1XPUA 1N6NA 1Q12A 4MYTA 3ICEA 4Q9KA 2W2TA 4KYIB 3OF5A 4DDTA 2DR3A 4LHZA 3KX2A 2F6RA 3CR7A 1ZM2A 1E69A 1SKYB 3X1YA 3HWSA 5IK2D 3ADKA 2XITA 2B7CA 1HE1C 5EXSA 1F2UA 4R2IA 5EP3A 2KI5A 1XEFA 3RDPA 1E94E 5DIFA 1KNXA 2G0TA 2O8EA 3PG5A 3GJ6A 1T3HA 1IJFA 4B76A 4XSHA 1ZUNB 2J7KA 4OBEA 4LGMA 4DKXA 4DVGA 2ZR7A 1Z6AA 2VF7A 3RS0A 3EZ6A 3QF4A 1W48A 221PA 2EVWX 2EFDB 3R20A 4QGFA 1RIFA 3UWKA 1VIYA 3AKCA 4RY2A 3WYAA 3ZGXA 2E9SA 1ZM4A 1E99A 3ADDA 1BYIA 1G21E 1N6LA 3D7MA 3VU9A 1W0KD 4DLYA 1XD9A 2Y8EA 4LDJA 3U7EB 5J40A 1T9HA 4B32A 1Z83A 4OK3A 2IEYA 4LJ6A 4E07A 2VHQA 5CB6A 3IHLA 4IDPA 3C8UA 5J47A 2XOKA 4PO9A 4RD2A 3KQKA 2FN4A 2UVQA 3QXSA 3VR1A 3AVOA 2CMKA 1E2DA 4JLJA 3HPQA 4NONA 3E2IA 1RPZA 2AN9A 1Z47A 2XB4A 4RKFA 4DSUA 4WXPA 4FMCB 4B2IA 3SEAA 2FFBA 3GJ0A 2W0SA 4Q1FA 3QNUA 2ZE7A 2WSSA 3RHFA 1RE0A 5JWHA 1XJ0A 5J4LA 4Q9IA 2MMCA 2GHIA 2OILA 2AWOA 5K8TA 1AQYA 1K5GA 1Q22A 1XX6A 5GJWC 4DEXA 2ZI7A 3QF7A 5BN3A 3GLHA 3UPUA 4LUCA 3O47A 1G4UR 5FBWB 2REOA 3TKLA 3X2SA 5BN4A 1EWRA 4LWZA 3R8CA 4FI3C 2OUKA 4TLBA 2J45A 4US2R 2AD5A 2GK6A 4MH0R 3A1WA 1K5DA 2C03A 2X1VA 2FG5A 2IC5A 2REXB 4NHOA 4G5SA 4QHYA 1A1VA 3PUYA 3K0SA 4DLUA 1QHHA 2NO7A 4UNSA 3BJIC 2ZI3A 1UKYA 2A5DA 3WNBA 3F3YA 1G7TA 2GZAA 2BEKA 1MO3A 2P6RA 1XD8A 1E2LA 1A7JA 4LBWA 3FMIA 3K8YA 3WYFA 4II7A 4US0R 2GETA 2VYFA 2ZAOA 1JAIA 2OBNA 4BFUA 4LY6A 3DM5A 1N0VC 5TB5A 5AJVB 3LNCA 5EP4A 4GP7A 2MMGA 2QG6A 5F2EA 4WBSA 4PFSA 1U2RA 1QHGA 2EFGA 5AJYA 1OXTA 1SHZA 4R71A 5GVSA 1OFHA 1G5TA 2C9YA 3THOA 2D74A 3MRSA 2RGNA 3CF6R 3CWQA 1D2NA 3KKOA 3X1WA 4C3ZA 1CXZA 1Z07A 3VR3A 3SJCA 2BBSA 2FE4A 3I1FA 1P2SA 5M04A 2QRNA 1CR2A 3KUCA 1JAHA 4QXAA 3W5JA 2Q9AA 3GJXC 3W6OA 4A2QA 1ESMA 5JJIA 1K8RA 1G5PA 1DAKA 5FL7A 5J4KA 3IO3A 2JJ1A 5DI3A 5DN6A 3QXXA 4L4UA 1NN3A 2R65A 5CIWA 4CZ2A 1RVDA 2GJAA 5C46F 1E9RA 3P4XA 1MH1A 3I3SR 2G1KA 1DTSA 4MUBA 4PXAA 2GKSA 2WJGA 3SNHA 4RVCA 1J8MF 3ICQB 4DLRA 5JJLA 1W46A 2O8CA 2VO1A 4GOKA 1LTQA 1X8LA 4P33A 2EQBA 2FPMA 2VRWA 1P61B 2MSCB 1KO5A 2BMDA 2H16A 2QROA 4TL9A 4W5HA 2UZIR 3THYB 2IYYA 3WBKA 1JR3E 2F43A 1D2EA 1ZCAA 5FUYA 1DARA 3NC0C 2BKEA 2QBYA 1OYYA 1CJMA 4OI2A 1UDXA 3U7HB 2F3RA 3L0IB 4DB4A 1OPXA 3I4LA 4DCTA 2BDTA 1KO4A 1NL3A 4DCSA 4CEIB 4YDSA 3LLUA 4QL3A 2O0KA 2AFHE 1RYFA 2N1BA 5FTJA 1YZNA 3U3JA 1S8FA 4PAMA 1HURA 3B13B 5FPHA 2F55A 1CKEA 2H57A 2GJSA 5L3VA 4Z1MD 2IS6A 5KPDA 3KJHA 5JJKA 1KZ7B 2O8DA 1MABB 2I1QA 3IIKA 4UNNA 3B1ZA 2OXRA 2BHRA 4AI6A 5H70A 1V43A 4LHWA 3WMGA 5EP2A 2NIPA 4GZMA 2YNMA 3NKVA 2OESA 3SN6A 4P31A 2J0SA 2PZGA 1O87A 2GWHA 4HZUA 3THWB 3T15A 2JAQA 4D4KA 4AYXA 5A0FA 4NYIQ 5E7JA 1GDDA 2GCOB 1VHLA 3KQNA 3LDAA 1U9IC 2UZ3A 4CGZA 2FWRA 1N0WA 2OO7A 3NHBA 2CE2X 1RJ9B 4B6FA 2W6IA 1ZU5A 2XSZD 1E2JA 1PZNA 3DVLA 1ZNZA 5FUVA 2WWGA 3L82B 4XWOA 3W5IA 3EWAA 3AKEA 1LW7A 4JLPA 3EA5A 1NLFA 3SFVA 4GDFA 1CRPA 1Z63A 4N1AA 4KSCA 1COWD 4TYWA 2FNAA 1ZUIA 1E4YA 1F5NA 4TLEA 3AGPA 5IHPA 4AKHA 1WQ1R 4PHGA 5DHAA 5JRZA 1Z6YA 3FHOA 3AP2A 1QHIA 4PQYA 1NMZA 1DAFA 2QORA 1OSNA 1ZAKA 2WBLC 4BEBA 1KI3A 4TMWA 5EQTA 5EE5B 5HE9A 1RKBA 1E79D 1NN5A 1LS1A 4TYQA 2VBCA 4KSBA 2GJ9A 2QENA 4NYMQ 4IKEA 5TY0A 4UJ5A 1IN8A 1KAOA 1E2MA 1UADA 1GKUB 2R62A 2FA9A 3V00A 3WRYC 4AIIA 5LD2B 2PJZA 4WVFA 2GXUA 3TH5A 3M0EA 4EFMA 3TUIC 4XVRA 4FCWA 5SZJA 2OHFA 2ZRNA 1OKKD 2RGNC 3NH9A 1SHKA 3QE0A 1P72A 4M1MA 4E22A 1SXJC 4A92A 1JR3D 4X8MA 2HYIC 1EFHA 5EZ6B 3NTUA 4WIAA 3NWJA 3QPUA 1CJVC 1XXHB 4G5OA 4EFNA 3TUJC 5F9HA 1P9RA 2QAGB 3S1AA 2V55B 3WHLA 4BLOA 5BN5A 1W4BA 4KVGA 4TQAA 1NVUQ 2RGAA 3WP1B 4EPXA 4DSTA 4QRHA 5G3YA 2QT0A 1I4TD 2ZE6A 4KCGA 4Z54A 4MKGA 3HR8A 4I1VA 4A2PA 3CX8A 4ZI2A 1LB1B 2IYUA 3FKSD 3W6PA 4NCNA 2PT7A 2N42A 2GXSA 2JDID 1X8JA 4UKDA 2V54A 4JLNA 3TR5A 2ZR9A 3LW7A 3SHWA 2GCNA 4KXFB 1DG3A 2P5SA 3NC1C 4B3XA 2O52A 2SHKA 1CEEA 2IYRA 2CXXA 4XJXA 2D7DA 3MLEA 3FPAA 2ZE5A 3L0SA 3QBVA 1XZPA 5FL3A 5B58C 4KBGA 3KTAA 4A1FA 3Q5EA 3QKRA 1NLYA 1WRBA 2WJHA 2QPTA 4MGKR 4JT2A 2IWHA 5CK5A 1XTQA 3TVDA 2QEQA 3PEVA 4AKIA 1FL9A 3I5YA 3RS3A 4RFSB 5HE8A 5L3SB 1AK2A 4YQFA 1TQ6A 4Q19A 3B78A 4R9UC 5CM9C 4BASA 4LC1A 2F9LA 2GF9A 2YVUA 5EZ5A 2PCJA 1XEXA 4M1YA 2J3EA 3AVXA 1KDOA 5JMTA 3OIUA 3CKLA 3ZZUA 4M1SA 1V5WA 1J99A 1NY6A 5ELXA 2VHUA 5AK0A 5TDHA 5JRJA 3RSLA 4EQ6A 4DLWA 2C5LA 421PA 4JVLA 5KSPA 3RS2A 3MJRA 1IY2A 1I4LD 3U6BA 2WIAA 2I3BA 5C4MA 4Z1MA 1W0JD 3LBIA 3TAUA 3TQCA 3DZ8A 1PJRA 3VMFA 2DFNA 3VR2A 3OFNA 2QUZA 4CYMA 3AH8A 3LAWA 1I2DA 4FCTA 4HAXA 4TTPA 3ZVMA 3L43A 1TF5A 2J1LA 1KO7A 1W5TA 2Q9BA 3GP8A 4V02A 4BQSA 2ORIA 3E5HA 4IDQA 2EWVA 1YZKA 1LY1A 5JCPA 2XX3A 3U3MA 4OQMA 1IAQA 3QQ5A 2W2XA 3PUWA 3NIBA 3OESA 3EAQA 4TL8A 1NMXA 2ZROA 4CW7A 2MSDB 5E95A 3FWYA 3ECCA 1N25A 4OKSA 1UKZA 5FPTA 1U0LA 2GRJA 3HU3A 3EIHA 4ZDIA 1KI2A 3REGA 4G5RA 4V0MA 2J87A 1HV8A 1CJUC 1VPLA 4NL4H 1FFHA 4N3NA 3B82A 2IXGA 3F0TA 4KFTA 1KK2A 4A6PA 5FPYA 4B43A 2IUSA 3U61B 4DJTA 3PVSA 3QENA 1YRBA 3AUXA 5JLJA 2FFAA 1L7VC 4ZV4A 1RC8A 2O0HA 2ZIAA 3A1TA 1TAGA 4IEEA 3X1ZA 1COWA 1SXJE 1QRAA 1NMYA 5ANRB 5HCNA 1MOZA 3B1VA 5K8LA 1EFTA 4LJ9A 4Q4HB 3T12A 1OJLA 1P6XA 1G19A 3C41J 3EC2A 1G8HA 2XTNA 1A5TA 3W8NA 3R7WA 2JASA 4H1VA 1P2UA 1R5NA 2FPKA 5BYJA 1E79A 1US8B 3CPJB 4IEIA 1XTIA 2ODWA 1R0WA 1DADA 2WAYA 2ZJZA 1QG4A 4DZZA 1XNJA 1AKYA 3WBJA 2RGBA 3PFIA 3SQXA 4TSFD 3P1JA 1D2MA 1N5JA 2K5UA 4V0LA 5CYPA 1DAIA 1OW3B 5EE1A 2RH5A 4P3YA 5K8IA 3LX8A 4IVQA 1LVGA 1XMVA 3DPUA 4HDOB 4O0MA 1E0KA 4QJ3A 1WF3A 4IOKA 2VP4A 4PPNA 3GFPA 1OKKA 4JZKA 4DLTA 2GCPA 2HCBA 3VNUA 2O8BA 1J90A 1JR3A 4WW0A 1QHSA 4MUAA 4TT3D 2R6DA 3CRRA 2OLJA 1D5CA 2ZRBA 1G7CA 2R6CA 4LJAA 5CB8A 1E0SA 3I32A 4B48A 1GZSA 1RYHA 1JALA 2VHTA 4M9QA 4AKEA 4LK2A 3EZ9A 1MO5A 1A2BA 1G16A 1VCOA 4DRZA 1W36D 3IBGA 1Z06A 3H4MA 1N6IA 2JDIA 4RCYA 4PQFA 1E9SA 3TMKA 4F92B 2OEPA 4CEHB 2IYWA 4BLSA 1EK0A 1Z08A 4KV9A 4TMKA 1UEIA 3LO5A 2ZITA 4LJ4A 1D6JA 2CCKA 3U44B 2HF8A 3K0EA 2EFEB 2ZRAA 4M53A 4JJZA 2O8FB 2IW3A 1GRQA 1KSHA 1ONBA 3WY9A 4U00A 2C99A 3R9WA 2EFHB 5B64A 4I4LA 5G41A 2KWIA 4NBSA 4U5XA 4C9BA 1Z6TA 4CRWB 1G8FA 2FSHA 2RGXA 4Q02A 1EGAA 4R7ZA 3EA0A 4HUQA 3VR5A 4DSOA 4TYNA 4A8JB 1ZNYA 4G0NA 4QBFA 5FOWA 3RC8A 4NDZA 3BORA 1IN7A 1E1RD 2XJ9A 4EPWA 2X8AA 2JA1A 4I1SA 1TEXA 2WSMA 4P0TA 4RD0A 5FTKA 3U7FB 1XXHE 2HF9A 3GEEA 5EXXA 3WNCA 2ZUBA 3QSYA 1Z6XA 4LJ5A 4QFMA 2G77B 4TQUS 2FDCA 1AA9A 5KO2A 1ELOA 4LBZA 1G6OA 4B3GA 3K0CA 2GF0A 3MWKA 3ZYCA 3CZQA 4PPGA 4CEJB 1KHTA 2V9PA 1E2HA 1FPMA 2OT3B 4KODA 4PZZA 5AUNB 5EUMA 4DIDA 1OIVA 4Q66C 2QRZA 5KDLA 5DISB 3B9QA 3K53A 4XH9B 2VLIA 4JBXA 4BEJA 2ZS7A 2OZEA 4FD2A 4QG7A 2GZDA 1L4UA 3X1XA 1TF7A 1KYIA 5AR1A 1Q57A 3DMDA 3UK6A 2DCUA 4DCUA 2OAQ1 3IO5A 2Q21A 1NVXQ 3IGFA 1AQUA 3TW4A 3GLFB 4C7OB 2VTKA 2X2EA 3P32A 3DMNA 4TWZA 5GADl 5EUQB 4BZXA 2ZJOA 5GVRA 2DHRA 3VAAA 5KYKA 4IXNA 1UEJA 1M8PA 2F1HA 3KL4A 3LQRA 2FPLA 4QOSA 1E9CA 1KKLA 5EE3A 4RKEA 2XZLA 4DUGA 3GLGB 1MO4A 1YZUA 1IM2A 3BH7A 4Q9HA 1UBCA 3IUYA 1YQTA 3BD9A 4P4SB 3QXCA 4XVUA 1UFQA 2HCJB 1R8SA 2WJJA 1OT3A 3BWDD 4GOJA 4Q7MB 3T1VA 3MWLA 3U4QB 4YMSA 2QPOA 4RD6A 1Q0UA 2XNDD 2JJ2D 2VH5R 4ZKEA 3AVPA 4GL2A 4M4SA 1KDPA 1P73A 1TMKA 2P67A 5KSZA 5DYIA 1BS1A 4NCKA 2HJVA 1QHYA 4URVR 3VX4A 1KMHB 1KK3A 3D3QA 2XGJA 3VX3A 3E70C 4V0NA 3WYGA 1GOTA 1KK1A 1NIJA 1ZCBA 3LV8A 3CONA 2J7PD 3GLIB 2IK8A 4ARZB 3SFZA 4PAQA 2YHSA 1QHXA 4B3DA 1AS0A 1CTQA 1IONA 4YLGA 1VG9B 1JPJA 1XRJA 4TTRA 5D3MB 4A8JC 4KVAA 4TSFA 2Z6VA 3T1TA 1EG7A 1SQ5A 2AXPA 3HPRA 1M6NA 1XTRA 1C9KA 4DWJA 4H1UA 4A82A 4GRAA 2W6JA 4OK6A 1T8TA 2ZU6A 3AF2A 4RJLA 1G3RA 1WP9A 1CBUA 4PC3A 4FINA 4F4JA 4JLAA 2QQEA 3LH5A 1OE0A 4LBVA 1YKSA 3GPLA 3UMRA 3RRZA 2IWRA 3HU2A 1FNMA 4TT3A 1GWNA 5TVKA 2JJ8A 5B30A 2QE7D 4LJ7A 1E9BA 1UBEA 3MAAC 2XEXA 3KUDA 4PC2A 2ECKA 4IJMA 2CL7X 1YE8A 1XEWY 1OIXA 4EUNA 2WPDD 2E1RA 2NZJA 4JLBA 4POAA 3SYNA 1G3QA 4XWAA 1XMSA 1U9IA 2CHVA 3RS5A 1F6BA 2P0EA 2NG1A 4EPRA 3QEOA 2ANCA 2OAP1 4IDHA 5JFGA 1E2FA 4BZQA 3VR4A 1FOEB 4B47A 4Q9JA 2XJ4A 3PUVA 1SVSA 3QI2A 4M1OA 3CRVA 4ACAA 1J7KA 3NDPA 3ASZA 1G9XA 3H0KA 3MG9A 1W2HA 1XCGB 1GTVA 1P4SA 3B1XA 1TUEA 4DEYA 4PSAA 5G40A 4B34A 3QF4B 4RD4A 5L8VA 1XTKA 3KFVA 2IF0A 4IDOA 4Q4AB 2V6JA 1BH2A 2PMDA 2WV9A 3AF4A 3I8XA 1G3IA 2CK3D 2DFKB 3K0CC 5AUOB 4ZPXA 2A78A 2OFOA 2PLFA 2QMHA 2QA5A 4JL8A 2WJYA 4V0ME 2KE5A 2C78A 1O3YA 1I4DD 1JECA 1E1RA 4JLOA 4XTCS 1DE0A 3THYA 1Z8FA 4K8OA 3ZVRA 5HPYB 2ZETA 4Q7KA 1W36B 1II0A 3OEHD 3K70D 2J0QA 4QNMA 2CJWB 2HLDD 5DLQC 2ZRDA 4DLSA 4QBIA 1OH8A 1ZW6A 4CEIA 2Q9CA 4MITA 4JBWA 1SXJA 4JLVA 2RCNA 3ND9A 4G5GA 3A4MA 1L2TA 1FQJA 5C18A 3BS4A 3SS8A 2ZREA 4QBGB 1EFRD 1GNRA 2YV5A 3KJGA 5FR2A 1HUQA 1T4GA 4V03A 2CNWD 4JVSB 4LJ8A 3PITA 4NZYA 5DH9A 5KTYA 2AR7A 1XP8A 1KZGB 1SULA 2QTVB 2RHMA 2GVDC 4LV5B 5SZIA 1S1CA 2VP0A 4EJSB 4BFYA 1FZQA 1NKSA 2OBMA 4MRPA 4QKQA 3LQQA 1MABA 1JB1A 1UKVY 2BBWA 3C7KA 2ODBA 3T1QA 5C4GB 1XCPA 4BFXA 1FMLA 2QTHA 4TZ6A 2OLKA 3QY0A 1W5SA 1DVRA 3TJZA 1M1YE 4L15A 3IEVA 3TIFA 1G17A 3FTQA 1ZD8A 1OHHD 1E2GA 3C5CA 4QGGA 4DIEA 4QHSA 3K9NA 4NTZA 3O8BA 2IYSA 2ZSAA 4YONB 3WHKA 2X77A 4HLQB 3THWA 1G3MA 4HZIA 2GDJA 3KKPA 2FSIA 1XD2B 4L9SA 1NNEA 5FTLA 1HYQA 4BE7B 1L4YA 2GCOA 3QUSA 1U8YA 2D2EA 4AC9A 4Q5IA 4LYHA 2ZRKA 2WJIA 3HDTA 4CVNA 3OAAD 1RJ9A 1W4AA 2H1LA 2XNDA 5KHOC 1NG9A 5F3WB 2A5JA 5IK2A 4C4PA 1G291 4JKYA 1QBKC 4OI0A 1KY2A 2FMXA 2WWWA 4XD7D 1N5IA 3W3ZB 4EPYA 4PO1A 2OCYC 3PUXA 5TMPA 1KMQA 2ZYTX 1BOFA 1NSFA 1M2OB 4URYR 4RZXA 2LCFA 3NBZC 4BECA 821PA 2PL3A 2OG2A 4ZDWA 4A2WA 3FMFA 1JXMA 4ABYA 4AD8A 2IUTA 4URZR 2IHBA 2ZJ8A 1XPOA 4D81A 4DLXA 4ASUD 3REFA 1NP6A 2J7PA 4ILEA 3ND8A 2EFCB 5CJPA 2GK7A 4BLPA 5HZKA 3B5JA 3K0FB 4D26A 1IJEA 4MKFA 1P62B 4IXMA 1W0KA 3UWOA 4E09A 4B3CA 3G0HA 3AVTA 4AYTA 4AG6A 4C0BA 1AGRA 5CK4A 2IS1A 1Q1ZA 3QVUA 2ZJBA 5E7MA 2NQ2C 3I92A 1W47A 3GLFE 2KBFA 1OFUX 3BFXA 1W36C 2QQ0A 1NN1A 2LKDA 3KKNA 3CX7A 4S35A 4KLNA 5KSYA 1DAGA 3WMFA 1RFLA 2NOAA 1FNNA 2W00A 3A1SA 2QU8A 4Q9LA 2QE7A 3SBEA 3SQWA 1R10A 1XXHA 5LB4A 3KQLA 4A6XA 4XWKA 2FSFA 3CR8A 4YMVA 4A0FA 5DSZA 1D9ZA 1VYUA 2QAGA 2G83A 1PUJA 1FP6A 1DAHA 2XZPA 4P4UA 4ZO4A 1Z5ZA 2Z83A 3OE7D 1PV4A 1R0ZA 2W0MA 3RAPR 2WPDA 3M4YA 4ITRC 1SKYE 4PQRA 1SKQA 4Q4LA 4TLAA 4UXIA 2XXAB 4TLDA 2H5EA 1ZIPA 5BXQC 4UNPA 4D4JA 1HEIA 2BC9A 4PANA 1Z0JA 4Y0AA 4W9MC 2VP5A 2ASEA 1U98A 3GJ7A 3T5GA 4HLUA 2DWPA 3ZS9A 3T5DA 2B7BA 3IBYA 2FEMA 4NU0A 2QMOA 1UDWA 1OXSC 2C9CA 3AB3A 3T61A 2PMKA 2WICA 2F9MA 3K9LA 2MSEB 1DOAA 2HJGA 2ZYUX 1KO8A 3SC3A 3GLIE 3Q85A 4YXWD 1T8UA 1YJ5A 2J0UB 4DCNA 2AK2A 1YHNA 2WJVA 5JHHB 1QVRA 3Q5DA 1YRAA 2BJVA 1G5RA 1ZIOA 3LX5A 5BYKA 3EIEA 3D31A 4I1UA 4I99A 1CS4C 4AK9A 4TYPA 2AKYA 4PX9A 3NVAA 1T5LA 4C0HA 1E9FA 3EASA 4GI7A 3PQCA 4FCVA 5HKKD 4RFSA 1UF9A 5L3SA 1R5BA 1ZM9A 3IKJA 1UJ2A 1XU4A 2RMKA 3TK1A 1E2IA 5KU1A 2CVFA 5CYOA 4KO8A 5L3QB 4LSGA 4RZ2A 4IFEA 1W2GA 1JEDA 2C04A 4Q01A 2FSGA 4TMZA 2WWXA 2QM8A 5K8UA 3QG5A 1R0YA 5JEDA 4XIGS 3OEHA 4ZDJA 2HLDA 2VF8A 5FTNA 2NMVA 2NO9A 1HY3A 2ZEJA 3KKQA 5FFMA 2A30A 1Q3TA 3KQHA 1G8PA 3I73A 3GQBA 2IS4A 3L8YA 1DBSA 4OL0A 2CLDX 1EFRA 4WZBE 4D0LB 3A6PC 1JQLB 3IPXA 1WXQA 3B8HA 2CNWA 3SJZA 1SVKA 1NVVQ 2IBMA 3NG1A 3B6EA 4G01B 2BKUA 2YC2C 4GP6A 4W5WA 3W34A 4AWXA 2JATA 1Y63A 2CL0X 1F60A 5FH9A 4RSGA 4OQXA 3FGNA 2XB2A 2GJ8A 4CF7A 2ZI9A 2BJWA 4D82A 1KI6B 4YMUA 1G4AE 3BFKA 2FGKA 3CNNA 4CT4B 4JL6A 1OHHA 3J81k 2ZRGA 1MV5A 4FMCF 4MA4A 2AXNA 1VYVA 3DHWC 3SYLA 3P27A 1R4AA 3LVRE 1DELA 3K09C 4TTQA 1OXXK 2ZRMA 1B23P 2J59A 2REBA 2UKDA 3Q9LA 4C0AC 1S4QA 2DWOA 3CRMA 4TN1A 5FOUA 1XJQA 1Q1QA 2X19A 4YDHB 3K70B 1KI4A 4I1OA 1IXSB 1KK0A 4FMDF 4MYUA 3R8FA 3X1DA 5IF9A 1Z29A 4FWIB 1KSGA 2R6AA 3OAAA 3RNLA 4MRSA 4RFVA 4A15A 3R9XA 1H8HD 3FHTA 1U94A 4HSEA 5CLQA 4B3BA 2XNSA 4C0SA 1YR7A 1KI8A 1T3LA 1IN4A 2IEZA 1H8ED 2ZI6A 2ZR0A 1FUKA 3A1VA 3CUEF 3B1YA 4NYIR 2XAUA 3N2IA 4WZAE 4CIDA 3TSWA 3NBXX 4PTLA 5KDDA 1BIFA 3BE4A 4FN5A 1M7GA 1AS2A 2JLYA 5LD2C 1T6NA 3U60B 4JT4A 5IRCD 2D3WA 3IIMA 3VKWA 5AWFC 3RVBA 4Q4HA 3CPEA 4RCZA 3FE2A 5CLLA 4ASUA 4BFZA 4GPTA 2V8OA 1OXUA 1DO2A 2JLSA 4URWR 1US8A 3P20A 1E9DA 2PEZA 2A3RA 3Q3JB 2ZRFA 1N6HA 3F8TA 2QAGC 4FWTA 4U7DA 5JWRA 5DI9A 3N5CA 1ZNXA 2BBTA 3VKGA 2P3SA 3CF2A 4LX0A 2Z43A 1ZBDA 1Z0IA 2B6HA 1Z2CA 3NDBB 3FKQA 2HXYA 3SYKA 4Z8YA 4DT1A 2V1XA 4AY2A 2YC4C 3AVYA 2IYLD 4Q21A 1KJWA 2IYXA 3KZ1E 5UKDA 4ZKDA 3ETLA 4RZUA 1TF2A 3AGQA 4D4LA 3MGCA 2D7CA 3AVQA 1P75A 2XSZA 1BO6A 4HLUC 4NYMR 5TV2A 3BFVA 121PA 1GITA 4PHHA 1HTWA 4TYYA 3K0AB 3TUZC 2JCSA 2W83A 3BH6A 3OE7A 4LV6A 3EIQA 4Q00A 2PCLA 1R7RA 3MWJA 3ZVLA 2C2HA 4B2LA 1MO6A 3PCRB 4JLKA 3TR0A 2RGEA 2Q3MA 3EARA 3VR6A 4A0HA 4OQLA 2E87A 5EXTA 1OH6A 5EP1A 1MRNA 2TMKA 2JLUA 2ZAMA 4ZI3A 3DKPA 2ATVA 1P2VA 1YZTA 5FBRB 2P2LA 3SI7A 1AGPA 4EQ6B 4Q7LA 4OI1A 4QJ5A 1JJ7A 4CEHA 1II8B 3T34A 4KJZA 5IDVA 4NCHA 2F3TA 1VG0B 2KB0A 5CM8B 3U44A 3AF1A 4OI4A 1RRCA 4YXWA 5FUWA 3CNLA 2AL7A 1YZQA 2O8FA 1PLLA 4WXRA 3K70C 2EW1A 3MSXA 3IHWA 4O25A 5J5CA 2CBZA 5HR5A 4JVNA 2ZRJA 1ZM7A 3BOSA 4B6EA 1QDEA 1F3OA 3GJ4A 4M9ZA 1IN5A 1F48A 2D06A 1OV4A 2F1IA 3GJ3A 3KB2A 1NVVR 4Q48A 4A4DA 4DDVA 3VKHA 2C96A 3EZ2A 2AKAB 2ZSEA 5B2ZA 2DYKA 2RHDA 1R8QA 4A8JA 1ZM3A 3PENA 4EPVA 2V3CC 2CLCX 2NPIA 1Z0AA 1EFUA 2NO0A 1GG2A 2RKOA 3FDIA 4M0LA 5KNCA 1JEEA 4QBHA 3NHAA 2YWEA 1Q1EA 1N5LA 1N3BA 3FKSA 2CVHA 5DGXA 4IRUB 2YZ2A 2ZUDA 3QJYA 4L5BA 3E1SA 4KFUA 1KGDA 4Q1BA 3TVTA 3KXKA 2QP9X 4MQBA 2IS2A 2IYTA 2IXFA 2QP4A 2YOGA 4EPTA 4BFWA 1S1MA 2KSQA 1E0AA 1GL6A 3L8ZA 4JYBA 1VCNA 2IX3A 1KI7A 1VHTA 4CEJA 3FMPB 5E4FA 3AV0B 1JNYA 4D25A 1NKTA 2AFIE 1OH5A 3Q7PA 2BOVA 2HUPA 1G3UA 1HQYE 4LOAA 3CX6A 4RD3A 3TW8B 3V4FA 2ZSBA 1ZYUA 4A36A 3DDCA 1W44A 3MFYA 3QKSB 1U8ZA 1XPRA 4TMXA 1JI0A 1PVOA 1VKJA 1YR9A 1S9HA 1SVMA 2H92A 3SU8A 4MRRA 3GLFA 4FW9A 3VHLB 4C2TA 1FX0B 4C7OA 3KQUA 2DFLA 1EX6A 5KSOA 2D2FA 3V4RA 4N0EA 1TQ2A 4PHFA 2OSBA 3EC1A 2G1JA 3IQXA 4C0JA 4UNRA 2WKPA 2J9RA 4MKIA 4PHTA 2N46A 3L0PA 1M7BA 1TNDA 5EE0A 2GJKA 3GLGA 5G53C 4ZIRB 3CH5A 4GZLA 3HU1A 2P6NA 4UQOA 1P7CA 4P4SA 1G7RA 2NTYC 1FQKA 1FTNA 3DOFA 2PJRA 4E03A 3U2QA 521PA 1X8KA 3H2YA 3KFXA 4F91B 3U4QA 1WBBA 3DL0A 3GJ5A 3MUFA 2GEDA 2ZPTX 1N0UA 5JCZA 2NPFA 1ETUA 3RS7A 2WWYA 4XSGA 1OIWA 4KYUA 2A2ZA 1H8EA 4LYJA 5FUXA 3FOZA 1W0JA 2ZRIA 4M22A 1TUIA 2XTZA 5L3RA 3JVUA 2RGCA 2ZRLA 2RGGA 1GNPA 2AHOA 3ZDQA 1G6HA 5FI0B 2FZLA 5HCIA 4B2PA 5CDFA 4LJYA 2OM2A 2YWGA 2H17A 3OEED 5HTKA 1WDTA 1QZXA 3GLIA 1LV7A 1GL7A 3BB1A 4ARZA 2WIBA 4LI0A 1XMIA 3H1TA 2RGDA 2GILA 1A2KC 1EESA 2P65A 3GFOA 3TQFA 3IQWA 2C9OA 1TX4B 2PLRA 4V0KA 5D3MA 3C5HA 2BCGY 4PZYA 1YZLA 1R0XA 1AZTA 4OYHA 3Q7QA 5KPJA 5AUPB 1CP2A 1ODFA 3NXSA 5J4VA 3PJRA 5DN6D 1SVLA 4RD1A 3U3RA 1FTSA 1GRNA 2IYQA 1AM4D 1KNQA 2CHQA 3QXJA 4LCBA 1TQDA 1P5ZB 5FOXA 2IXEA 4K46A 3IDQA 4OHVA 1Q21A 3QEJA 1Z0FA 4GSYA 1FW6A 2BCJQ 4BPBA 1XB2A 2QY9A 2BWJA 4B73A 3KDSE 3AKDA 4YMWA 2J0VA 1EX7A 3FMOB 4Z51A 5JSZB 4FIDA 4B33A 1CIPA 3ADBA 4DB2A 1CJKC 3L0OA 2OFWA 1KI9A 4HDCA 2FGJA 1E96A 2PH1A 3SOPA 3LRPA 1UPTA 1CU1A 4TMVA 1W1WA 1JBKA 1AZSC 1TL7C 1BYUA 4GOXA 2H8KA 4JMPA 4H9GA 1OLOA 1F2TB 4LZZA 3T06B 3UXMA 5GJBA 1RRGA 4R98A 1NJGA 5LPNA 1RRPA 2IT1A 2OCAA 3UMSA 4BLQA 3LW8A 4HLCA 4KFRA 4E5UA 2ZTSA 2HT1A 1LF0A 2ATXA 4Q4JB 4Q03A 4D4MA 3DKVA 3THXB 3EW9A 1OH7A 4LYFA 1IXRC 4Y0VA 1D9XA 4DBLC 2R2AA 1KIMA 1CLUA 2F1RA 2G9NA 4Q4AA 1E2EA 2PBRA 1GM5A 4IHQA 3GMTA 4YC7A 5HZHA 3PR1A 1KDRA 2BBOA 2ZJAA 4Q7JB 2JLVA 2QMEA 2IUUA 4X8LA 1B0UA 1JXOA 3GEHA 5KNBA 5DYGA 3U5ZB 4NP6A 1HQCA 2BMEA 3ZD7A 4FMBB 4LC0A 2GVZC 5FPKA 2ZUCA 2GNOA 4HAUA 4X8HA 4AKGA 3RABA 4HAZA 3TSOA 1KKMA 1GP2A 3KXIA 4UJ3A 4HDQB 3EPJA 5JZVA 1SVIA 1GILA 2CJWA 1R2QA 3SE0A 3RSOA 2Q6TA 4OJQA 1U8AA 1N2CE 4B74A 1VMAA 2PEYA 2W6ID 3LFUA 3RLFA 4NE2A 3NEJA 2ZSDA 2YWHA 3NBFA 2IHYA 4LBYA 4R2HA 3RWOA 1F2UB 1OF1A 2NGRA 3EZFA 4LV8B 3H86A 2DBYA 1G20E 2O8EB 4HLDA 3FFAA 2VPPA 2EU8A 3OIWA 1LF5A 2B8WA 3LXRA 4EJSA 1EXMA 3FYHA 3LD9A 3ZLJA 1S9DA 4M1TA 2ZS9A 3LXXA 3A1UA 4V0OA 1UBFA 1IY1A 2I1VB 2RAPA 1X1SA 3A36A 4FMDB 1E1QD 2YOHA 2G88A 3SBDA 1CR1A 2ZQ5A 1XCMA 2J5XA 3M6AA 3SJBA 4DLVA 2HXSA 2FX3A 2WWIA 3EWSA 1NBME 2PX3A 3IILA 1VDZA 4S2EA 3VU9B 1WBDA 2AX4A 2HV8A 4W5JA 2CL6X 2VP6A 1Q20A 2DB3A 1UAAA 3D6TB 4AYWA 1VG8A 2GBLA 1OFIA 2YOFA 1EWQA 2F7SA 4PPQA 2ZJ2A 1XD2A 4XTRA 3RC3A 1S96A 4DCVA 2JLQA 2ODEA 1WB9A 1MRSA 2AWNA 4DSNA 3BB3A 1GSIA 3FHCB 5E7IA 1DPFA 1KSFX 4BUJA 4MGIR 5C1BA 1QF9A 5A4JA 3O8DA 3I8SA 3AVUA 1ZUHA 3PEYA 2Q0HA 1KJYA 2ZXUA 2LWIA 4M9XA 2DPXA 4LPKA 1ZC3A 4LRWA 4KLZA 1N6PA 4PR0A 3QKUA 5H8WA 3AF0A 2IYZA 4F4CA 1GNQA 1VIAA 1YZGA 3QPWA 1T3SA 3DEFA 1CULC 4JKIA 4C30A 4BWYA 4QM6A 721PA 1S2MA 2WMNB 3GLHB 4HI0E 3OEEA 3HYTA 3WMEA 4ESHA 2GTPA 1VYTA 2IYVA 3BAFA 1ZJ6A 3JZMA 4QC2A 2JLZA 5CJ2A 1E98A 4JYCA 1A82A 1NLZA 3QIAA 1OB2A 1E2KA 3K0FA 3OHMA 4MYHA 1YR8A 3B7GA 3K9GA 1S3SA 1YR6A 2DY1A 1Z3IX 4DDUA 2O0JA 4CT5A 2KBEA 4JLDA 3EPLA 2X2FA 1AS3A 5A5GA 3CH4B 1EFCA 2BEJA 2ZSFA 1ZC4A 3AUYA 4M8NE 4TQ9A 4D0GA 1QHHB 2VHCA 1HT2E 4ACBA 1OFTA 4J0QA 3AKYA 2ZJYA 3ZD6A 2W58A 2LKCA 1T0JB 3W90A 1ZD9A 2GEVA 4WOPA 3EX7C 2F1JA 1XMJA 2GXQA 2JJ2A 4QGHA 5CIQA 3PUZA 3LBHA 2Q3HA 4GNKA 4JVMA 1XBTA 3BXZA 3BK7A 3M1IA 1GL9B 3EXAA 3MCAA 4WAUA 5EJEA 4OJKA 2EYQA 2WOOA 1QHNA 1W49A 3CF0A 3O8CA 5D3QA 5TXGA 3ZQ6A 1NRJB 3K09A 3NBYC 4G1UC 4NYJQ 2JLXA 3QBTA 4QM7A 2XXAA 1WE2A 3JVVA 2R44A 2H18A 4LHYA 1D8TA 5AUQA 2NO1A 2XZOA 1TPZA 1AKEA 2QSZA 4F7WA 1SXJB 3DO6A 2ZE8A 2YJTD 1WMSA 4A0GA 1Z22A 1G64A 2VSXA 4KITB 5SZHB 4N0DA 3RRYA 2YYZA 1E2NA 1U81A 4KAXA 4P4TA 4EAQA 3UATA 3W3AA 2CLSA 1G1MA 1KOFA 4TMTA 3PXGA 1CR0A 1NBMD 5DI3B 3OFND 4IDNA 2J0UA 3CM0A 4GT1A 4P32A 3UG7A 2PZFA 4KU4A 2Z0MA 3A8TA 2QI9C 3BBPA 3UIEA 4D0NA 1I2MA 2VSFA 3SZRA 2ERXA 5FPSA 3WP0A 4AURA 2OV2A 4XOIA 3HP1A 2WKRA 3VTKA 4HATA 2ZU0C 2O8CB 5JI2E 3GLGE 2A9KA 5JEEA 4URUR 4MRNA 4PAOA 3UANA 1Z2AA 2ZI4A 4ZDKA 1KAGA 5FOTA 5FTMA 1U0JA 5L3QA 4MYCA 3KJIA 1LNZA 1DG1G 3CW2A 4PO8A 4D2IA 4EJSC 2NO6A 2F43B 1M34E 2QGNA 3ZJYA 2GAAA 4KI0A 5DNYB 2QBYB 1BMFD 2ZI5A 1YVDA 2JEOA 3TE6A 1XTJA 2PX0A 2NZ8A 2BMJA 3ZQJA 3I62A 3TLXA 3VHXA 2VP9A 1SVOA 1NF3A 3P26A 4PZLA 1IHUA 1XF9A 5JS7A 3CRQA 4US1R 2ONKA 2C95A 5AJXA 5P21A 2ZANA 4LHVA 5F98A 5CDFE 3MMPA 4PSKA 4BRWA 1XTSA 2Z5FA 3B60A 3C15C 2GBLC 4C2UA 4C0KA 4UXJA 3HR7A 4NMMA 2O8DB 4L8GA 4TZ0A 1NI3A 3AP1A 3QOFA 2ODNA 1E1QA 3QVVA 4LYAA 1W7AA 2CEAA 3MWYW 1Z6GA 1KI6A 3TSZA 1MT0A 1ZU4A 1AIPA 2JGNA 2QGZA 2CK3A 4Q1CA 2IL1A 1L8QA 5E3HA 4JL5A 5BQ5A 1PLJA 2WOJA 4HZUB 4B3FX 3C16C 1K6MA 2GESA 1QVAA 1WA5A 5FI1B 4Q1DA 5J4YA 4MDFA 2QZ4A 4TL6A 2FOLA 3LLMA 2OXCA 1CRQA 1NJFA 1IQPA 2WWHA 3ZS8A 5JWOA 4OHYA 1W4CA 4MRVA 4M1KA 2ZRPA 5AJZA 4KBFA 2G0NA 4C0LA 1TEVA 1ZP6A 3EPHA 3AVWA 3CBQA 3HYRA 3ZIAD 4C0QC 3L2OB 5JBQA 1TTTA 4OHZA 4DC9A 4BLTA 3GCGA 1AN0A 1II9A 4M1WA 3EPKA 4HAWA 2GA8A 2R9VA 2V6IA 3U3KA 1ZINA 4PSVA 4IW3B 2Q3FA 1U0HC 4PC1A 4HB3A 2YWFA 1WCV1 1W4RA 1E9AA 1GKYA 2H7VA 2JIZD 3TAHA 2A5FA 1IN6A 2VP2A 4PC7A 1U90A 3EG5A 3N70A 1JQJC 2ZRHA 4ZCLA 3Q72A 1CJTC 3BRWD 4HUTA 2R8RA 2QL6A 3GEIA 3TBKA 2FFHA 1NY5A 1N5KA 4D80A 2BMFA 1KO1A 1T0HB 2QPAA 2V1UA 5H1YA 4BFVA 4JSTA 2BM0A 1TADA 1DEKA 621PA 4NYJR 1Z0KA 4G3XA 2P5TB 4HYYA 3PEWA 1E0JA 1UBGA 4M9SA 1JJVA 1C1YA 3DM9B 3LA6A 3NEYA 3T35A 3K9HA 1CR4A 2FF7A 4JS0A 3CNOA 2FJUA 5FBQB 3A37A 6Q21A 3ADCA 1G41A 3RANA 2FFQA 3ONWA 3CWZA 4EIWA 1P9NA 2CCJA 1GKIA 1J8YF 1BKDR 2L0XA 4L16A 1G7SA 1NIPA 3HJNA 2J46A 1XFAA 4XD7A 5KNDA 3S1AB 1XWIA 1HE8B 5KOYA 1U99A 1G8GA 2CCGA 3K0AA 2A5GA 4X8OA 1OB5A 2FU5C 2V7QD 2Z4SA 3T1OA 4MDEA 4IVRA 4KHZA
chains in the Genus database with same CATH superfamily
3J7AC 4D92A 4I4IA 1T91A 3D2LA 4UXHA 3SYRA 5M2QA 1QANA 1UKEA 4Y2SA 4CLDA 3CWCA 3EZ7A 4IO0A 4GMDA 3EDRA 2CNDA 3PIRA 3QVKA 5FHRA 2MJLA 4F9EA 3L1IA 4JJ4A 3LYLA 4DMMA 5KJFA 4I0WB 4DHEA 1IXZA 2BVNA 2HCRA 4JB2A 1QWSA 1PWZA 1JDVA 4NBVA 4BO7A 4PRZA 1CRZA 2Y05A 3NTXA 4DZTA 1LFDB 1FP7A 8OHMA 1ESNA 1J1UA 3NHJA 4MW0A 3CVYA 3GLHE 3H1BA 5KYXA 4LECA 3HI4A 4HXGA 5LQUA 1DS6A 1C5KA 2EKZA 3GU3A 2A7QA 1YMQA 4XUEA 3SDSA 3QKRB 4X7RA 2CD7A 1Y3AA 4MPJA 2VDNB 2XGSA 2NXCA 5LBIA 4M6WA 3Q3GE 2HF2A 1GAJA 3WQHA 3W6NA 1MEOA 4B7XA 3I2JA 5FR1A 2B0JA 4PRLA 2EQ5A 2J3IA 3EY9A 4QUAA 1PLKA 3SMQA 1TVMA 2PE5A 3DHVA 1QOZA 2RGUA 3GX1A 4J43A 4Y2JA 4IIJF 3ZJUA 4XW2A 2YRWA 1RD4A 2F3SA 4U2FA 4XVQA 5EYPA 4MVCA 2CNKA 2MINA 1BE6A 1RZ3A 3TGPA 1JHQA 1NVWQ 3VVMA 2XVXA 3OZVA 1E7SA 2VIIA 1O96A 3GJRA 2ACWA 4CQLB 5LP6B 3UMFA 4DUGD 3JQBC 1RTKA 5GZ1A 4KMOA 4XEHA 2XUFA 1SZPA 3CLVA 2F3UA 4IKOA 3ZZTA 2PR2A 3DXZA 4XCVA 1SOVA 4U9HS 5HDQA 5EJIA 4O2LA 4BV9A 2WP8J 1GT6A 1YB4A 1V7ZA 1GFIA 3N2EA 3O4HA 4XM2A 3SR0A 4CKZA 1CUWA 1YZVA 1E3LA 2B92A 4GBMA 1AXRA 4OGFA 1T15A 2JK1A 4A8TA 1WNTA 2DT8A 3EFBA 5DDIP 5DHFA 4ZYVA 2UYCA 4QNRA 1OAOA 1ESZA 1M6VB 2GZ3A 2ZJ7A 2KJQA 4LTMA 2OHHA 1ULHA 1YB2A 3QKTA 4DV4B 4MWDA 3M6LA 4BGDA 4DQLA 1LDMA 1O5OA 2BV3A 2I91A 1OXVA 2D59A 1B14A 1MR3F 3TZBA 3PJGA 2RH4A 4AG5A 5AI5A 3AUJB 3ZE0B 3WRXC 5JZBA 4HNVA 3CZ4A 3AM1A 2P62A 1DAMA 1U2TA 1YI8A 4RDHA 4RJJA 1C3OB 2YY7A 2QT1A 4MW1A 5AW6A 1EUYA 3JQ8B 4B82A 1ACMA 2CXTA 4F38A 2WWFA 2BFFA 2EP7A 3TLBA 5BSRA 1XJCA 1H65A 4TLCA 2HT6A 1TQ4A 4JSRA 3E4DA 4Q47A 3U6KA 3N2KB 1YB1A 3RF6A 4DQXA 1P29A 5CBPB 2QD5A 4GNRA 1SUAA 4RQUA 3HLKA 2NV6A 3FX2A 1M5TA 2W6JD 3LC1O 3AF5A 2QQ5A 1PTKA 3OZXA 1GVNB 4YI5A 4PG6A 4ICIA 2WIFA 4WNAA 4HEA6 1E9EA 4M37A 1IULA 2AOWA 4NH0A 1KSJA 1HSOA 4RETA 1UC9A 1V4VA 2Q9UA 4MKHA 3Q8MA 4FUTA 4IGIA 4DLZA 1FMTA 1LSSA 4JB0A 3SQLA 1R8XA 2BDEA 3H8SA 3C4JA 3HZOA 4D46A 4F4UA 2ES4A 1JPNA 5LIRA 4RZ3A 4M21A 3VO1A 1R0CA 3OM0A 3K72B 3SJUA 4DNFA 1HE4A 4JP3A 1V95A 1Z8HA 2AS0A 1KDTA 2JFNA 4NOKA 1L8OA 1D4ZA 4KX3A 4QGAA 2DUMA 1AMOA 5KC8A 4F5EA 5CYGA 5CG1A 4IOJA 1TMGE 1ZD4A 5DTEA 2JLAA 3HFRA 2PT6A 2XUOA 1ENYA 2O19A 4IILA 1QB7A 3M9XA 3E2MA 3A04A 3GFBA 1VGVA 2O4UX 1NBOA 1OX6A 4KYTA 4RA9B 3JQ6A 1GIAA 1JFSA 4E1VA 2EYUA 2YS6A 4CCWA 2BI7A 3IQZA 4E03A 5ULLA 2V9CA 3ORFA 4KE8A 1XDUA 4TV9F 2XD4A 4AS3A 1YBMA 4Z7OB 2C77A 4ON9A 4GMKA 4A8HA 4X65B 1X3SA 5CGQB 3HCPA 1PUXA 1B15A 1VJCA 2XTMA 3BC1A 3C48A 3O4FA 2ZWVA 3LZCA 3S81A 5TARA 1E4VA 3F46A 9ATCA 1IY0A 4I1PA 1L5OA 1PJSA 4UOEA 2CJXA 1CCWA 4DIBA 2QRVA 5AQ1A 4O3MA 1L4NA 2O05A 3R4CA 4B3JA 1EGQA 3CNHA 3I30X 2O8BB 1U28C 2PJUA 4PC6A 5EE9A 3RRJA 4M9UA 5K3AA 4IWNA 3VFDA 1LQ2A 2XB8A 4J8PA 4ZVUA 1LW6E 1P60A 2B7LA 1MEEA 2JD2A 2OCPA 3GYGA 4FBLA 2JL1A 3PFWO 2VC2B 4EVSA 4NZNA 3EQ6A 1C8LA 1H2FA 3FCEA 4NENB 1ZBQA 3FYUB 2C8VA 1QIDA 1WLSA 1GCAA 2LNDA 3MRVA 2O2ZA 3UKDA 3H2BA 2C4HA 4F85A 4H08A 1VFPA 2VOEA 2YICA 3DKKA 3W9YA 4MW9A 5CTJA 3OIVA 2XE6A 1H23A 4R8RA 5F35A 5H82A 1X1RA 1EPUA 2C98A 5HK8A 3WLEA 3WQSB 4D6XA 2CLOB 3IYLW 1MC5A 1VPDA 1KYZA 3COYA 1DRUA 1W76A 3EMVA 1OYVA 3HRKA 1AVTA 2I4IA 3LBNA 2G6TA 1MOPA 3FUUA 3QRWA 1SGWA 2ID4A 4O0LA 2OHVA 4X5OA 4QECA 1F2TA 1E0DA 3IQHX 2C2BA 3F6RA 3G9QA 3MELA 4HDNB 2H2AA 1PDWA 3IQDB 1JIVA 2YZ7A 1WG8A 2WWTA 1IVSA 1PFGA 3KYCA 4A9AA 2HDNB 3AG5A 3O8RA 1LPMA 3REQB 2QAJA 1MG5A 1XQYA 4O2AF 4HGPA 4WNYA 5ALJA 4Q4JA 2FZKA 4YV0A 2Q4RA 4MA0A 4V38A 4C43A 4ZVPA 4EF5A 3PV0A 2QP3A 3RB8A 3MJVA 4LHXA 2B8NA 2QSYA 2C94A 3SJAA 1HT3A 1NSTA 5FOVA 4GM0A 4Y2QA 1BDJA 4D9NA 1MH9A 1YULA 1V8DA 2JIQA 2GEUA 1XPJA 3EEFA 3L46A 5F64A 1IOZA 4ZO9A 3E9ZA 4QPCA 4BHTA 3E4CA 3GD5A 4NBNA 5LVAA 1XPUA 1Q12A 2EZTA 1RKUA 1AHHA 2ZYDA 4PFJA 3EK2A 4R1NA 3GBSA 1ZAYA 3OCUA 3N07A 3RUIA 1RT9A 2DR3A 1Q11A 2GPAA 2RK3A 2XE8A 3VOBA 3KX2A 4DG9A 3UY4A 4MLDA 3IP1A 4DV6B 3LGAA 4DLLA 3AEXA 4MA5A 3AILA 5KTNA 3WGGA 3NHYA 1F7UA 2Q0SA 5JU6A 2B7CA 1O9GA 3LPCA 1HE1C 3FPLA 4HYEA 1NLMA 5IJWA 3BIOA 1CVLA 1UT5A 2KI5A 3OEWA 1EB9A 5EMJA 5JCXA 1J8FA 4LXYA 2G0TA 1JHYA 3STWA 3I5UA 3DVSX 4HJXA 3EVCA 3GJ6A 3K92A 3H8VA 5EHGA 4B76A 1ULBA 2C54A 5DK6A 1CQXA 4OBEA 3K8ZA 4WE3A 4DVGA 1V6CA 3B5IA 1XC7A 5CA1F 4BL5A 4R2WA 1P77A 3EZ6A 3CG0A 1I7LA 1H6BA 3QF4A 3T94A 3BSSA 4GM1A 3WOVA 5KVQA 3KSBC 4PG4A 4C4YA 221PA 3R20A 1Z8DA 2EFDB 3V8MA 4EHIA 3GEBA 4CN9A 3K35A 1ZM4A 1E99A 3DCIA 5JT1A 2YNMD 4NFSA 1UMDA 2QX6A 4KH0A 4UDOA 2WYIA 1N6LA 4KPUA 5ARBA 3D7MA 5BOVA 1XD9A 4EMTA 3UMBA 3SQNA 1EWKA 5IT9A 3MN1A 4AMGA 4JKOA 2BGJA 3OUZA 4DHWA 3Q10A 4OB8A 2IEYA 3TYXA 3PC8A 1JFTA 1H2YA 1S2GA 3AESA 4P38A 2PWPA 3IHLA 4ZARA 3V1MA 4BV3A 1XNQB 2D0PB 2VDJA 3ZGVA 3X43A 1X7YA 2P9YA 4B6JA 5FWXA 4EJ2A 4PO9A 2NZWA 2ATIA 4EHBA 3KSDO 2G1UA 1RFGE 3UMMA 3AI7A 3HM2A 3GFRA 3KVOA 1WB5A 2FTKE 3AM5A 4KG7A 1K89A 4FE3A 2O1EA 1QAMA 3E2IA 5THQA 1O5IA 4BC0A 1NUQA 5JATA 3PPWA 5DNAA 2A0UA 3GZNB 5HS4A 1EGHA 3UJ9A 3SEAA 3L04A 3ANTA 3RTAA 3RYIB 1SWWA 1HM5A 1T2FA 3IVMA 1BVUA 3PFHA 4ALJA 5JNWA 1EM6A 1O8CA 1WCIB 3RHFA 2EGGA 1TJ4A 1RWNA 3DE4X 1YWGO 3ESZA 3NQ41 4RNCA 4Q9IA 2J5RA 4ZEXA 4XM1A 1SBZA 3ZQ4A 1Q22A 1E7MA 3MERA 5K8TA 5U4XA 4EYGA 3GLHA 4X63A 3B3FA 3O47A 3X2FA 4QEKA 1NI4B 2H1RA 3ZDZB 3V2IA 1GZ7A 4QYXA 3JY6A 2VLBA 3QFTA 1EWRA 4NFYA 2W2KA 5IAJA 3ZR4B 3KZMA 4B4KA 2I7XA 3K9QO 2JFPA 2OUKA 4DJ5X 4I9GA 3Q0EA 2F17A 5A4AA 4BOYA 2AD5A 2WHQA 1N7JA 4IQGA 5FLYA 4W5TA 2PG3A 2G0AA 3ZD8A 4HDSB 4PYJA 2WWVD 4BGEA 3DMYA 5JASA 1KFEB 1L1FA 3SSOA 4NATA 1G0NA 4DV3B 4G5SA 4EARA 2Y1XA 1A1VA 1QU3A 5BXYA 5CFRA 4DLUA 1QHHA 2NO7A 4HNTA 4EUEA 2JRLA 4FEGA 1KC1A 4MARA 3F3YA 5AK5A 4ZVNA 5G2OA 1X7ZB 4GE0A 2VJMB 4DYHA 4ZHSA 2CUKA 2SKCA 1ST3A 3OQIB 1GXSA 3I2FA 4X6UA 1T29A 1E2LA 3GHYA 2X8WA 4LBWA 5BRNA 2BEVB 4BMNA 4RHEA 3RYHA 4BNJA 1ZZEA 3KOXA 2EHJA 1C9EA 2GETA 5BV2P 3E7PA 5IAKA 5HUQA 3GELA 1JAIA 3OPYB 4BFUA 4FGSA 3F5MA 1GD1O 5C8YB 5F2EA 1E5LA 1E92A 4PFSA 1U2RA 4QTTB 5ELLA 2J85A 1QHGA 3EQ8A 1Q15A 2LV8A 4OD0A 1MB4A 2M2IA 4WFJA 1OFHA 4N76A 4O63O 2ZSJA 4OQ4A 2TSYB 1XTZA 2X9LA 3D7NA 4WZAB 3THOA 3LGXA 2RGNA 2ZR8A 3M6WA 1D2NA 3CHYA 4I19A 4MMXB 3U1BA 1E2UA 3I5MA 4OLJA 4PGHA 5GOZA 3R23A 5JISA 3J81A 1F0PA 1JF8A 1N57A 1P5HA 4YR9A 2CN1A 3LF2A 3UWSA 3ZHZA 1P2SA 1FFCA 3DGFC 1CR2A 1Z2NX 2C8JA 3W5JA 3I9JA 5IFKA 2Q9AA 1SHJA 2YCLA 3GJXC 1T9KA 3HA5A 3KQQA 4A2QA 4AXBA 1AKVA 1K9VF 2ZQZA 1ESMA 5GOTA 2C1XA 3U7EB 3MD9A 1DAKA 2WYHA 4KB5A 5J4KA 3HLYA 2DBZA 3NTLA 4JOCA 1L5MA 1Z4MA 4C6HA 4YP1A 1OT5A 4YPFA 4A3SA 1SC4A 2GJAA 3PICA 3SIPA 4CR6A 3RYCA 1E9RA 4FFMA 2B78A 1MAHA 4L74A 2IP4A 2G1KA 5DEIA 1DTSA 4G1EB 4PXAA 1SQFA 3RNOA 3QLVC 2BR4A 4JUFA 5EKDA 3BMOA 3SNHA 2D13A 3DNFA 4PZ9A 3PFKA 3WKAA 4BNXA 4HXEB 4PWZA 1J22A 4GOKA 1Z25A 1LTQA 4P33A 5KQMA 2F8TA 2PU5A 2CMFA 2E49A 4OHFA 2C5FA 2G06A 4WK2B 1F8UA 1KO5A 2BMDA 2QW0X 2CFIA 2UZIR 3THYB 5L40A 1R12A 2DAPA 4ZC1A 2F43A 4DMCA 1E1DA 1U6IA 1XTTA 1DARA 2X3UA 1V48A 1JA1A 1OI7A 1Q2XA 2BKEA 3EJWA 2A1UA 4MIEA 4XLTA 1YUMA 3FNBA 3KQMA 1CJMA 2F3RA 4DB4A 4FN4A 4DCSA 1EX9A 5A03A 4HP8A 1TM1E 4NICA 3H42B 4MUKA 2PKYX 3LUCA 5FF9A 4W5QA 2GRAA 3CS3A 3QVGB 1XJ5A 1RU3A 4QJBA 4UM5A 3OUTA 3LUHA 4W1PA 2Q46A 1YZNA 4NMWA 4IZOA 1T1IA 3O3OB 4YRCA 2F55A 5FPHA 1CKEA 1LZKA 2LIPA 1EAYA 2GJSA 3FPSA 3M4NA 4C14A 1DBPA 5ICFA 1A1SA 3CNBA 2FFRA 4HG2A 5KPDA 4ARIA 3QITA 3KJHA 2IS6A 1Y8QB 4XFDA 5JJKA 5B3JA 2PS1A 1U3TA 3WAKA 5AESA 3VR2D 2BGNA 4K8RB 1R4NA 2DFVA 3WO0A 3K5HA 4WN9A 1E60A 1VL6A 4RM3A 1T8YA 4UNNA 3W7AA 1KGSA 4IUCS 2I6FA 2PWZA 3CW8X 4GPEA 4MIOA 4X6YA 1W85A 4MKXA 2IDKA 5EUBA 5H70A 3H11B 2G8NA 3DG9A 2D54A 5KTPA 2YNMA 3LK7A 1YRYE 2VYVD 2XV1A 1G8KA 1J7JA 3QH4A 2GWRA 2OESA 5MN5A 2OG1A 3V80A 1I7DA 1ZCFA 3EHEA 2LPMA 1SIUA 2OC4A 4E4TA 5AO9A 1Y6RA 4IDDA 3QVWA 5H4GA 3T4UA 4K05A 4L6IA 1R4MA 2YUTA 4AYXA 2Q2OA 4NYIQ 1L7PA 1NASA 1PNQA 1R15A 2FUKA 3PNLA 4KNVA 3DL4A 4ITUA 2JGDA 3D0KA 4RY9A 2GCOB 1E5DA 1VHLA 2FRXA 3GJYA 4CGZA 1QH9A 5K03A 4HTAA 1RJGA 2FWRA 1KVQA 1XOIA 2OO7A 4F5WA 5IHXA 1RADA 2Q4TA 1HDGO 2GPWA 1E3JA 1HDEA 1ZU5A 2YIVX 3TNJA 1PZNA 4N49A 2HQ1A 1ODTC 4EMBA 5J43A 5A4DA 5C0OE 3LI2A 5LQRA 3AB7A 3FZNA 1LW7A 1T34A 3CEMA 2RAUA 3PT9A 4ZQBA 1LDNA 3AONB 1QG0A 4NSNA 4OB7A 4NCAA 2OZLA 4U5QA 3GUVA 2FNAA 4TYWA 1P3Y1 3WWYA 4TLEA 3W5CA 4DR1B 1NR5A 2PNFA 2JGMA 1WQ1R 4AKHA 5HFJA 4WK0B 1DAFA 5G02A 2QORA 1TLLA 1ZAKA 4BEBA 1KI3A 2WW8A 3ZU4A 4XUCA 3D3WA 2JAHA 4CNQA 2WUVA 3BE5A 4K6CA 1YOVA 4HY3A 4ND4A 5E9WA 5AVWA 3BT7A 5ESXA 2QENA 3ICCA 4J7AA 4TRMA 2G4VA 4NBLA 2Z5GA 4BJHB 1E2MA 3NIDB 2ZB8A 1Y8RB 2GH1A 2FA9A 4AIIA 1HQDA 5A5FA 1GG9A 3OMWA 1TKBA 4HH3C 3JRXA 3KEFA 5HF9A 2MYPA 1XZIA 2Q4DA 5E1MA 2EW2A 5BUQA 4YCCA 4QASA 2JFXA 4EFMA 1EE2A 3A31A 4G86A 4XVRA 2J5KA 4DBVO 4DE5A 2O2YA 2ODPA 2VXBA 3GDOA 4YAKA 5JSFA 2NUPB 2PUVA 4UVEA 3O75A 2ZDHA 3OU6A 4IJWA 4GXNA 1SXJC 3ZV7A 3OZEA 1CDOA 3T7CA 2HYIC 4DREA 3I9V1 1TZCA 2L17A 3UK7A 4F5DA 1VE3A 1P9RA 3T4XA 2YWBA 2HJ9A 4Z5XA 2G70A 3WHLA 4TQAA 4IR7A 2JCXA 4LYYA 4QRHA 2XUQA 1A8QA 4E31A 2YX1A 1T4CB 1CUAA 2WVGA 3NRCA 4KCGA 1QLWA 3HR8A 1UWKA 2UYQA 3LT0A 1LB1B 1IC6A 2V0GA 3W6PA 1N9GB 2HLHA 3NALA 2P1ZA 4J0EA 1UWVA 2N42A 2PT7A 2JDID 4V1CA 4UKDA 3CE9A 4YT5A 2V54A 1YMUA 5IYZA 1P0QA 4P9NA 1AOXA 2ZR9A 3SHWA 1DCTA 4F46A 1NR1A 5JFTA 2GCNA 1XUOA 2GO7A 3QEMB 5KYWB 1G60A 4CLRA 5F33A 3KQYA 1CEEA 3I2YX 2X5KO 2OV6A 5LA6A 3HK2A 2B9VA 4GIBA 3MLEA 4JI1B 4XVCA 5B58C 1VLVA 3TX2A 4ARCA 3KHUA 2I3DA 5LJIA 1PTJA 1P18A 1Y9ZA 4BQFA 4YT4A 3Q5EA 3ERCA 2QPTA 3HNRA 1SOUA 1TA0A 2IWHA 5CK5A 3TVDA 1K3FA 5AKZA 4M76B 3C3YA 3LSTA 4CM4A 3ZJVA 1B74A 4MRMB 5EGNA 3TL2A 5JC8A 4RFSB 3UAXA 1T36A 5HE8A 5L3SB 3ZDBA 2GCEA 4QTZA 2AUTA 1M2VA 2BTOA 4U2KA 2AI2A 3H9CA 1SHTX 1XL0A 3B78A 3OD1A 3ZY4A 3KETA 5LLSA 1CUFA 4Q3BA 4UBLA 5CM9C 1OJ7A 1NXOA 3LXUX 3DZJA 3U26A 4LGVA 1J1IA 2CEKA 1C1DB 2FJ0A 5JSZA 4HUJA 2V7XA 4M1YA 5K8VA 3AVXA 3OIUA 1U0EA 1J24A 3CKLA 3NM5A 4G1MB 3ZZUA 1OA0A 2FCRA 2OB1A 3N8GA 4OEHA 2AOXA 4MQ6A 1KE2A 4RHYA 3DE7X 4NV0A 3SX2A 4AJHA 5JYCA 3GDWA 4DLWA 2DLCX 3DBIA 4XLZA 3O4JA 1JG6A 3LQYA 4JVLA 3PNMA 5JNRA 1YDMA 4F5ZA 1IY2A 1I4LD 1TYZA 1W9MA 3GNTA 3U6BA 5BR8B 1JQAA 2GD1O 1X7XB 4BEWA 3TAUA 4YHBA 2GN6A 1KJJA 2DFNA 3VR2A 1JT9A 4CYMA 3ZVKA 1KIAA 4AZ0A 3LAWA 1C81A 4HAXA 4V24A 2G04A 3P7MA 3RKRA 4OXXA 3ZBPA 1N34B 1W5TA 4BX0A 1HWYA 5CGZA 4BQSA 4IDQA 1X74A 3SE7A 1YZKA 1YU6A 5DXJA 2HXGA 3RKUA 3O4VA 2W8ZA 3U3MA 2PIAA 3QHAA 2W2XA 4CNBA 1PQWA 2BHTA 2OD2A 2DWCA 2VYVA 3PFFA 5EIEA 1UMKA 1JIQA 4I5GA 3V2HA 5LQKA 3IBFA 2VPZA 1SCIA 1YQUA 3FWYA 3ESDA 3PNSA 4JV5B 4KO1S 5FJIA 2GF2A 3ECCA 2BGGA 1HNWB 5LMZA 4OKSA 1UKZA 1RAHA 5FPTA 3ROGA 3LT1A 4DG8A 3EIHA 4ZDIA 3WZLA 1KQPA 1KU6A 3G9TA 4G5RA 4UCXA 2XUHA 4TLMB 1O6CA 2J87A 1HV8A 1WZIA 2FR8C 3JQPA 1L7OA 1VXRA 4WGFA 2OFFA 3IUQA 2QTZA 1VPLA 1W1UA 1KDYA 2H1SA 4EVQA 1NVKA 3JQ7A 4NBUA 3B9RA 1E1MA 4K6MA 4EHHA 1V3QE 5BNIA 2VPWA 3C7DB 4B43A 2JVJA 1AX9A 4KYVA 1KYTA 4XB2A 4EB8A 3E3LA 4ZT7A 5HNKA 2QTMA 1L7VC 3EW7A 3VO8A 1L7DA 3D0OA 5EINA 2FW1A 2YVLA 4C08A 3CLSD 4R4JA 1C7FA 3MJ4A 3GMSA 2WE7A 2CLKB 1NMYA 2RKWA 5FULA 1L5KA 4ZYUA 2I4LA 4LJ9A 1Y7IA 4Q4HB 5HX7A 3MCWA 2PT9A 2FPPA 4EMUA 4PN3A 4JASB 2IHNA 3EIFA 1RI5A 2XMGA 5KAMA 1E58A 1AUOA 2DPYA 3BAZA 1V1RA 2M6RA 2RG1A 3BWCA 5TE9A 3AR7A 3H5LA 5BYJA 4V1CI 1ORTA 2NSJA 2PLAA 1R0WA 1UODA 2WAYA 2O7SA 4EO7A 4O02B 4DZZA 5AYVA 1XNJA 3HJBA 3WBJA 5T67A 2RGBA 2D1RA 3PFIA 4JT8A 4M99A 1GQOA 5GV7A 1AKQA 4RH1A 4TSFD 5A06A 3P1JA 2K5UA 2PM8A 4KN5A 4MI9A 4V0LA 4D8XA 5I01A 2HQSA 1OW3B 1QK5A 3AR6A 3IBTA 1ISJA 1TJYA 3ADPA 4O0MA 4BVHA 1WF3A 3JX9A 1QCDA 4MI3A 2VP4A 1H69A 3GFPA 1R0BA 3UCEA 4OFBA 1IPEA 4JZKA 4RADA 4ZPJA 2XXBA 1Z2DA 2X0KA 5F76A 3VNUA 1OU0A 5ED0A 3IVXA 3JR7A 2JGFA 3EPPA 4ZT5A 1G5FA 3OLZA 1PEKE 5T6BA 1QHSA 4MUAA 4TT3D 3V9AA 9GPBA 1JJBA 2R6DA 2JHAA 4ER3A 2OLJA 3HB4X 4O4LA 5PGMA 1VP3A 4HTFB 1OBFO 5JMPA 1MC4A 3RE1A 1GZSA 3KCQA 1RYHA 3HBMA 3SSMA 1NM5C 2J4DA 5JAZA 2CB9A 3IRUA 2FR1A 3RSZA 3O0DA 1KVRA 3A6EA 1A2BA 4KRXA 1N2SA 3U9SA 3UUWA 5CFOA 5HXAA 5LMCA 4ZYLA 3E9DA 2Y77A 4DRZA 4PZEA 1ZG3A 3UHOA 5JDCA 1W36D 3IBGA 4QVKA 1I36A 2V7BA 4R6XA 1DJNA 3KV1A 4QQNA 3WMXA 3WBFA 1Z06A 3H4MA 5I7VA 2C0QA 1Q0HA 2JDIA 4ZTZB 4L57A 4F92B 4PGMA 3FNGA 2A1TR 1FS5A 4ZU1X 4YMLA 4PV7A 3RADC 1XCBA 3IQIX 2AOTB 2RAFA 1L5ZA 3I6IA 1I1HA 2VNKA 1K8YB 2IYAA 1G8AA 1UEIA 5C1IA 2CVZA 2ZITA 4HWSA 4OP2A 4P34A 4Q39A 3SY8A 2HF8A 4NV1A 1PYDA 5I7WA 4WBNB 4AN4A 2EFEB 2ZRAA 4XIYA 2E4XA 1K68A 2P6PA 2Q8PA 2D5CA 3NWBA 1H66A 4CKBA 1ZLYA 1XAJA 1GAEO 2IPXA 2DERA 2AEFA 2JH9A 5B53A 2H2GA 3WQBA 4ZVVA 4MJXA 2C99A 3R9WA 3EXHB 3L0YA 3NU1A 2EFHB 5B64A 1LC0A 5C7IO 5G41A 3WISA 4WECA 2W71A 4C9BA 1Z6TA 4CRWB 1EGAA 4GLOA 4KPGA 4RDXA 4HUQA 2B98A 1N2ZA 2HK6A 4E2WA 4TYNA 1E61A 1ZICA 2C58A 4QBFA 3RC8A 5K6RA 4Q34A 2RB5A 4EPWA 1DXYA 3DQZA 3CZRA 1YJCA 2FI1A 1GPBA 3H5NA 2E82A 2YHUA 4RD0A 1TEXA 2WSMA 2VJCA 5FTKA 3U7FB 2AG1A 2XDAA 4C0XA 4RY8A 1XKQA 1XXHE 5CMLA 2CF5A 3T9BA 3NKFA 3UWMA 2HF9A 1KF0A 3GEEA 3K8OE 4O08A 3KG2A 4XPIA 5L6MB 2GYVA 4JJ7A 4BMSA 2W22A 4B8WA 2FDCA 3L6BA 1VSBA 3NIGB 4NI5A 2O6HA 4TV8B 2P11A 5EWMA 3SKVA 3BTOA 3V34A 3A6ZA 3PF8A 1KY5A 3R5KA 3F2IA 3Q88A 4IV8A 5IUNC 1DQPA 5DYYA 4B79A 3CZQA 4PPGA 4CEJB 2V9PA 1E2HA 1EP1B 1ZGCA 2OT3B 2QDKA 2D1YA 4J0GA 4KODA 5FIUA 3T7JA 3D7KA 4M7PA 1OIVA 2PQ0A 5JDIC 1MB0A 3RM3A 3JWJA 1B7GO 4J1TC 5LNK6 1E8MA 3O1HB 1Z7YA 4JELA 4WSOA 1FXWA 2VLIA 4XH9B 5DISB 3WSVA 4QG7A 1TCCA 1YGPA 1J33A 3VZPA 1F8FA 3GNQA 5AR1A 3KOOA 1N3LA 2GRUA 2AUNA 3L5KA 3DAOA 3IO5A 3VTFA 3TW4A 2V03A 2VTKA 3PJDA 3SICE 4UBKA 4CV0A 1JLRA 3P32A 3O83A 4IQ0A 5GADl 3L6EA 4ARSA 1L7EA 3VAAA 4BZXA 5KOJB 4IXNA 5DLPA 1UEJA 4GXTA 3TLCA 1M8PA 3NUQA 4XD2A 2EJWA 1T8WA 1L8XA 2FPLA 4QOSA 2J3MA 1E9CA 1VKHA 4OFWA 3BCUA 2QU7A 2XZLA 1VHWA 4KDFA 1Q83A 1MO4A 1YZUA 2L42A 1UBCA 2YJZA 1IVYA 3ILHA 1VL0A 3EF1A 3QXCA 2GCIA 1R8SA 3HKBA 4KDEA 1OT3A 1GAWA 1YR3A 2AXEA 4P98A 3T1VA 3AR9A 4YMSA 1IZ9A 2QPOA 4F3NA 2P9TA 2XNDD 1X7WB 1RWKA 5E6RA 1E3WA 2WSYB 1J0XO 3MIZA 2ZJFA 4PSCA 5H16A 4KNWA 5G4LA 4KP7A 2CZGA 1OY1A 1KDPA 2W8BA 4PS0A 5B7PA 4GL2A 2P67A 2X6QA 2XLBA 2ST1A 1R6AA 1QFYA 5KSZA 4EW1A 1P1BA 1ZHFA 2XCQA 3DWEX 2DPLA 2E89A 2H06A 2PPVA 1OXMA 3KHTA 2VYNA 2XGJA 3D3QA 1LK7A 5K3OA 3WYGA 3FJOA 3KVRA 3HBAA 3MCTA 4G6ZA 4DJDC 3LV8A 2N0SA 2J7PD 2BISA 1D03A 3LZ6A 4WI1A 4BO3A 3QKWA 2JHGA 4JDUA 3SFZA 1DWQA 4MROA 3ZDRA 2XYHA 2LR0A 4B3DA 4GUAA 1CTQA 4D02A 3OWOA 5KVCA 2WTAA 5SYMA 1AGXA 1Q0PA 2PU7A 3KPJA 3DS8A 1XZAA 2Z6VA 4L4XA 1EG7A 3DFIA 4TSFA 2X9VA 5CYFA 1XTRA 4YDRA 4H7FA 4X64B 4RS3A 1WZ2A 3DL7A 3AF2A 5AJUA 5A05A 3ZW7A 4GOOD 5G1NA 4PC3A 2PA0A 1UT6A 4HWGA 3TO5A 2ZVDA 4TXHA 1YQGA 4CIAA 3EGWA 4G5XA 2BR5A 5DM4A 5I9TA 3LH5A 1NULA 2H6EA 1K3TA 4UZFA 3GPLA 1AMUA 1NQTA 2A8YA 4BO1A 1G6KA 4TT3A 4G4SO 4EBFA 4XGKA 1O4WA 2YL2A 4IGFA 2XW6A 3IURA 1PT8A 2FUG1 5EC8A 2RK4A 3AYXB 4LQLA 4L5IA 1MN6A 3JCZA 2CL7X 5LBUA 7ABPA 3BIJA 1RXYA 2I6TA 4W9NA 1JS1X 1OIXA 3ON5A 5K0TA 1H9AA 1UEXC 1M6EX 1O97D 3RVMA 2MHCA 1NVBA 3NTRA 1KHHA 1Z5PA 1OC2A 2OA0A 1PJBA 5BSTA 4KR6A 1F6BA 5KIAA 3D6HA 3QEOA 2ANCA 5A2QA 3QELB 4FILA 5DBIA 1RQPA 5JFGA 4CMHA 3DMPA 4I55A 4O4JB 10MHA 3NR2A 1RHRA 4MVWA 2XJ4A 4JGBA 3CE6A 4MAMA 1S2LA 1IWPB 5JQGA 1J7KA 3I2GA 4JGGA 1ODKA 1KARA 4IHJB 1YVEI 1G9XA 1X1TA 4R1MA 4DY6A 4ZYYA 5LP6F 1IK6A 1I13A 3MG9A 4PIMA 3TZCA 1MJGA 1VKNA 1MLDA 3L40A 1GTVA 2ODQA 4NJOA 4U7WA 4F1KA 1TUEA 2HM7A 4EW2A 4PSAA 2OKGA 5AKGA 1SNYA 3KFVA 2XMRA 2PFSA 2G5PA 3MT8A 4N0QA 2JA2A 4Q4AB 2JAUA 5KQSA 4K9PA 4I5DA 5BSUA 1BH2A 4BNZA 3I8XA 1G3IA 3PPXA 1CV2A 1N7IA 3K0CC 3L1JA 2PRZA 5AUOB 4P3XA 5BMVB 3AJAA 2QAIA 3ZG6A 3PQ6A 4ZPXA 2PTHA 2OFOA 4G5FA 1GPKA 5IBCA 2I2DA 3L8EA 5TGDA 1QDUA 1GKLA 1M2GA 3H05A 1O3YA 4GXRA 1I4DD 2WZBA 4GR5A 4H17A 4UTRA 4K03A 1GGVA 1FLNA 1WWKA 3CF4A 3OX3A 3PQ8A 3UJBA 3S27A 3AXSA 2ZETA 3TR6A 1DJPA 1B43A 3FDFA 1II0A 2B5VA 3QBJA 4Q7KA 2IQIA 2CYBA 4FS3A 2J0QA 1JQDA 3DYIA 2CJWB 4FOOA 4H6PA 1A97A 2DCMA 5KAPA 1NPDA 2BI8A 2DPGA 3JS5A 3RH0A 1SY7A 4L9AA 2GEJA 1BWPA 4KL8S 1ZW6A 2R7LA 3STXA 3OJCA 1EWTA 4MITA 1KU0A 5DM70 1VLLA 1RCFA 2V6MA 5T5QA 3I2KA 1E77A 3ZHCA 1IBSA 1SD5A 3BS4A 5LQMA 3ZW9A 3I6ZA 4QBGB 4MV6A 4E70A 5TQJA 5HKOA 1WQ4A 3KJGA 5FR2A 4ALLA 2ORYA 4JVSB 1I3LA 1Y8ZA 2P6OA 4EJSB 5ERYA 3DB1A 4MWBA 4BFYA 4JYAB 4H3VA 1AA6A 3VH2A 5AVUA 1YB6A 3F6BX 4N6GA 2AX3A 3UAYA 1LVHA 4YTEA 5DTMA 2QTAA 4QKQA 3C7KA 4E5MA 2ODBA 3P71T 3T1QA 3NONA 3NYWA 1R4ZA 4JYZA 3WDLA 4DKJA 2XVZA 4C21A 3PHCA 4TZ6A 4OQPA 2FLKA 3R0XA 2DXIA 3WGQA 3IDAA 1KYXA 1M1YE 4O1HA 3VISA 1G17A 3FTQA 3OQBA 4L3OA 1OHHD 4B85A 4QOJA 5G0SA 1J8DA 3DL2A 4JBGA 4O6VA 5CVJA 4NTZA 4G0UA 2ZSAA 3KOWA 4KR0A 5LLDA 3N9IA 1RAGA 3W78A 4ZYZA 5T64A 1ZEMA 4RF3A 1B42A 1WMAA 4HLQB 1TOAA 3G2LA 5AVYA 2FSIA 4ZVKA 3SNKA 2GQ0A 3IOMA 1U9ZA 1VL2A 3P8ZA 2G4CA 4BE7B 2D2EA 4EG5A 1JEAA 1V3TA 3EVBA 2FEPA 2C7RA 4GMHA 2X14A 3HO8A 1RJ9A 2H1LA 2IE8A 2XNDA 2Z6UA 3S2SA 2Y6VA 3BXOA 1JYFA 2B20A 3DLAA 3R5JA 1RWBA 2JI8A 1AF4A 1I2CA 2NXWA 4HNAB 1J42A 2WWWA 5ES4B 3W3ZB 5LOVB 1N5IA 3DCNA 4M7RA 3UBMA 1TMOA 3RW9A 4Z7NB 4PO1A 4RPKA 1YCDA 5HJ7A 1SKMA 3PUXA 4QOGA 1NSFA 3P0EA 4LRYA 3OKAA 4URYR 4CM3A 3H87A 4NEQA 2OG2A 4J94A 3C98A 1D4AA 1JXMA 4JHLA 4KQEA 4ABYA 4BRSA 2VXYA 4URZR 1GEGA 4YJ2A 1SOMA 5FORA 2ZJ8A 1E7RA 1GN9A 1XPOA 3HKDA 1PQPA 2C5AA 3AJDA 3PYLA 1NP6A 2J7PA 4ILEA 5H80A 3OFSA 3JATB 3REFA 4XX0A 1G42A 5AT1A 4LJRA 5HZKA 3B5JA 4O4HF 3ORRA 1ESCA 2AGVA 3QMVA 1ESDA 1UBUS 2BHSA 3QA9A 4MKFA 4NQRA 4QFBA 4A26A 3EG9B 2VDPB 4G2NA 3Q2KA 4XFJA 1OX5A 5C8XA 1KZYC 4Q6BA 4IAOA 3RTBA 5E7MA 5FFFA 1ZJJA 2RFLA 1GZVA 1Q5PA 3I92A 4DLBA 5LZ8A 2F67A 1XZLA 3K1TA 2ZULA 4KWEA 4RSHA 1UC8A 4ZRMA 3DAFA 5KYYB 4RIFA 2LKDA 3TLGB 2DUUA 1R37A 2E6UX 3GMIA 1I6LA 3CINA 2H4WA 3V8PA 1RLIA 1DAGA 1AQLA 1YDEA 3H9EO 3LUFA 2NP7A 3BEDA 1RFLA 1VLZA 1FNNA 2BZ0A 2NOAA 2PAAA 2F64A 2QU8A 2NZVG 4Z7QB 3ZXYA 3DEZA 2VCEA 4MUFA 1R10A 1XXHA 3IMEA 3CX4A 3FR8A 3SCZA 3T7AA 2FSFA 4YMVA 3DWFA 4XWKA 1VYUA 3AEUA 4QSHA 1SHUX 2G83A 4YJKA 2PUEA 1TVKB