4OK6A

Crystal structure of hepatitis c virus ns3 helicase inhibitor co-complex with compound 13 [[1-(2-methoxy-5-nitrobenzyl)-1h-indol-3-yl]acetic acid]
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
445
structure length
430
Chain Sequence
b'TDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLINAVAYYRGLDVSVDVVVVSTDALMFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease NS3
publication title Integrated strategies for identifying leads that target the NS3 helicase of the hepatitis C virus.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
total genus 141
structure length 430
sequence length 445
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4ok6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok6A01
5AJYA 3CLVA 1FFHA 5TB5A 3KXKA 1XZPA 1KO1A 1QZXA 1ZW6A 4Q7MB 2ZJOA 1ZC3A 3TVDA 3R20A 2H1LA 1HE1C 1G7RA 3U3MA 1FL9A 1XD8A 5JWHA 4DLSA 5JCZA 1DAGA 2ZRKA 2GTPA 1IN5A 1DG1G 2CE7A 3EC1A 3NH9A 1GG2A 2FSIA 4H1UA 2AD5A 4XJXA 4PHGA 1GTVA 1Z29A 3U44B 2BCJQ 1JR6A 3ZIAA 1W36C 2G6BA 4K46A 4OI2A 4MKFA 4N0EA 2ODWA 2QL6A 4TYWA 1C1YA 3LV8A 3TK1A 4XOIA 2ZR9A 4D2IA 1TPZA 2QENA 5FL7A 1CR2A 3B1VA 1OIXA 1RYFA 4Q1BA 5FBRB 5DISB 5EUMA 2FGJA 5TV2A 4TMWA 1LNZA 1CEEA 4ACBA 1ZP6A 1H65A 4PTLA 1R5NA 1QHNA 3NHAA 2XEXA 4FWTA 1R8QA 3U4QA 1N6PA 2YC2C 3SBEA 2C95A 1XZQA 3GQBA 1E2PA 4PXAA 2IX3A 3GLGA 3AH8A 3AQ4A 4EUNA 3NTUA 1Z0IA 1G4UR 2HCBA 2ZAMA 3I32A 1OB2A 3W90A 1TADA 4MQBA 5BWMA 3FHOA 1AQYA 1WBDA 1M7HA 3LX5A 1NMZA 1HV8A 5JZVA 1XEFA 2NOAA 4HLUC 1UEIA 3NBZC 1P4SA 2VQSA 4P4UA 4M1SA 4Q9KA 5EP1A 2NZ8A 3OF5A 5DNYB 2HYIC 1E9DA 1Z28A 1CR4A 2OO7A 1OIWA 4C0LA 4BFTA 4IDHA 3B78A 2C96A 4RCYA 3BWDD 4HATA 4M2LA 1T91A 2NO0A 1FW6A 4OBEA 4LYAA 1PLLA 2WKRA 2KSQA 1DARA 3KFVA 721PA 2FZLA 3EZ7A 3LNCA 4H1VA 2GK6A 4US1R 4BFZA 1HT1E 3THOA 4NYJQ 2FFAA 4E03A 2X8AA 1PLKA 4BLPA 1Z3IX 4RD2A 1B23P 4ARZB 2XZPA 1G3MA 1GRQA 2QQ0A 2VF8A 4IRUB 2QE7D 1S9DA 2A5JA 1X1SA 4Q47A 4PQRA 2QPAA 1J8MF 3K0CC 4NCNA 1NVWQ 1SKYB 2JJ1A 2OBLA 4YONB 2B8WA 2GESA 3U44A 1C9KA 1K5GA 3A1WA 3DMDA 4GOKA 2B8TA 4MUBA 5DGXA 5AWFC 4GT1A 3PEWA 3GLIE 3WYGA 1TF5A 1NLZA 1VG1A 4M1KA 3X1ZA 2WOJA 3P32A 4I1UA 2C78A 3P26A 4I4LA 2FSHA 1W0JD 4G3XA 2Q9AA 3NWJA 4PC6A 2QPTA 2H5EA 4DT1B 3KJHA 4ACAA 3QUSA 2HJVA 1CS4C 3OEEA 1E2NA 3CNNA 4BLOA 5JCPA 2GZDA 5KHOC 4G5OA 4MGYR 3T1OA 2OZEA 4OQFA 4D80A 2JLSA 4HUQA 1SVIA 2GCPA 2OCAA 1US8A 3B9PA 2GBLC 3EWAA 2WSSD 5CK5A 1XTRA 2O8FB 3U6KA 4TTQA 5KO2A 1L8QA 2ZVPX 3M1IA 4DLZA 1KI9A 1E9CA 1OPXA 4JLAA 3BK7A 4QJ3A 3QKRA 2R6FA 1KK0A 4JVSB 4FMDF 3OE7A 3NEJA 4G01B 4L9SA 1KDTA 3U3KA 2OFWA 3M4YA 2YNMA 1P6XA 5CB8A 3K70D 4NYIR 1XCGB 4NP6A 4BFXA 2QT1A 3BH0A 2DFNA 3WNBA 5HPYB 1Z0KA 2A5YB 2W6IA 1AM4D 1PVOA 1SXJD 3U3OA 1XRJA 2EFDB 2QAGC 4IOMA 1COWA 3B60A 4HSEA 4V03A 3QBVA 1T4GA 1I4LD 2EYUA 3CH4B 4C3ZA 2XB4A 4M9QA 3RSLA 2CJWA 3GFOA 1WCV1 2CCGA 1OSNA 2ZU6A 2G0NA 3BH7A 2P6RA 4F38A 1T3HA 4HDCA 2R9VA 2C99A 2ZITA 1CJUC 1Z6AA 2XZLA 2W0MA 4DSNA 1DVRA 4ILEA 4UJ3A 4B3DA 1FPMA 3ZD6A 4PANA 1NVUQ 4GRAA 1RJ9B 5AJXA 5EE9A 4DSUA 3I5YA 4BLSA 5KDLA 3LY5A 2IYTA 2QSYA 3NHBA 1OF1A 3QPWA 2PT7A 4A2PA 1DAKA 1S9HA 1ZYUA 2ZJBA 3ZDQA 4Q4HB 1TU3A 4QNMA 2OCYC 2FU5C 2NMVA 3ZJYA 4DIDA 1F5NA 1KDRA 1YJ5A 3TQFA 5AUPB 2ANBA 2ZRNA 5DN6D 2QNRA 5B58C 2EW1A 2FZ4A 1G5PA 4DT1A 4XVRA 1LFDB 3PXGA 1N5LA 4DEXA 3BBPA 3FKSD 3EX7C 3B9QA 1KOFA 1ZM7A 3BFKA 4MRVA 3FPAA 4MUAA 3WP1B 3BFXA 4ZKDA 1KGDA 1AN0A 3TAHA 1E0SA 4FWIB 1DO0A 1CLUA 1CXZA 4KV9A 1QVRA 1E69A 5G41A 4MDFA 1KY2A 2QU8A 4XWOA 4C4PA 3EPKA 1NLYA 4IVQA 3W8NA 4BPBA 3AKYA 3K09C 2MSEB 2ZR0A 2W83A 1TEVA 2O0HA 3P20A 3LA6A 3LVRE 2ATVA 3TSWA 2BMDA 5GADl 1NJGA 1XTSA 1NY5A 1E9BA 2OFOA 3HWSA 3KZ1E 4Q7KA 4UKDA 3X1YA 4B75A 4ZDIA 4CT4B 4B6EA 2YC4C 2QTHA 2JJ2A 2QMUA 2PT5A 1YR6A 1QHIA 3CX6A 3R9XA 3LO5A 4S35A 2YVUA 1OHHD 6Q21A 1EK0A 3BB3A 4DCSA 1S0UA 3NBXX 3KKPA 5KNCA 1M7GA 2FA9A 2VP5A 3FWYA 3MJHA 5FOXA 4D0GA 1XEXA 2QY9A 3QNUA 4AI6A 3RANA 1NIJA 1NIPA 4RZ2A 4DCTA 3QG5A 1W36B 4AKEA 2G3YA 3DOFA 2B92A 4NONA 2D06A 3AM1A 3B1ZA 2PX3A 1J70A 2J41A 1F2UB 4EKDA 1A2KC 4JLKA 3BIFA 4MH0R 1P73A 2QROA 3MCAA 3B2EA 2CL6X 1XD9A 2ZSFA 4I1VA 1E79D 3CWQA 1RJ9A 4E22A 4DCNA 1KMQA 4NCKA 1W44A 1JAIA 2XJ4A 3MWLA 2IBMA 1W4AA 4L4UA 3LLMA 3FFAA 4Q4HA 4AURA 2XJ9A 2XOKA 1VCIA 2RMKA 1NY6A 2HDNB 3AEZA 1DAMA 4URYR 421PA 2L0XA 5H70A 4BECA 4DUGD 1ZD9A 2IYUA 4CEHB 3GJ7A 621PA 1EFCA 2FGKA 4W9MC 3TKLA 3GJ6A 1Z0AA 2A5GA 2CLCX 5CM8B 3AP1A 1Q0UA 2VEDA 4NDZA 4IHQA 4P31A 4OI4A 1JR3E 4PO9A 4GMDA 3ZD7A 3CX8A 4KHZA 4EQ6B 3GJ3A 3DZDA 4GPTA 5DLQC 4I81A 3R9IA 2KI5A 4B2IA 4EJSC 5JJLA 3O8DA 2C04A 4PZZA 3AVYA 2QQEA 4V0ME 2DFKB 4JT2A 4E5UA 1GNRA 1GP2A 2BVNA 1WRBA 1XTIA 2OV2A 3GEIA 2QM8A 3I8XA 4Q66C 3B82A 4RSGA 1LVGA 1N0VC 4ZCLA 5J4LA 5FUVA 3DVLA 2G1KA 4KFTA 4JKIA 1A7JA 1NSFA 1NVXQ 5CIWA 5HCIA 3CX7A 4YMUA 4EPYA 1G3QA 5M04A 5JSZA 4IDPA 4M1YA 1CBUA 2F9LA 1BIFA 4M9SA 4V0LA 4PHTA 1NG9A 4LZZA 5KNDA 5C4GB 4HZIA 1G5TA 3KJEA 3SYLA 4RFSB 1XXHA 3CBQA 4RZUA 4F4JA 1II9A 1N2CE 3L43A 3HPQA 1FUKA 3LXXA 5EE3A 2B7CA 4KLNA 1N0UA 2GDJA 3CONA 4F92B 3VMFA 3DM9B 2ZJ2A 4A1FA 4EIWA 1GSIA 2RGBA 3BE4A 3L0OA 2BV3A 2NPIA 1JEDA 1RRPA 2OFXA 4JL6A 3BORA 1DBSA 1E9SA 1TF7A 3AB3A 3GJ0A 5D3MB 1F2UA 2V55B 4YC7A 3VX3A 2HF9A 3VR6A 2GJKA 3IQXA 2WIBA 3PJRA 1P2SA 1P9NA 1XCPA 2FPKA 4B48A 1IY2A 1E2DA 2HF8A 2ZSBA 2QTVB 4TT3D 3IHWA 5DYIA 4MKGA 3VTKA 4EAQA 2ZIAA 1W46A 4C0QC 4DC9A 3KXLA 5DI3A 3OAAD 3MWYW 2J0SA 2QRNA 3AKCA 4L16A 3R8CA 1DG3A 1P62B 3MRSA 4A2QA 2OAP1 4B73A 3H0KA 2IUSA 3QSYA 4OHXA 1H8ED 1IN7A 2VHUA 1X8KA 3LBNA 3BGWA 4FIDA 1ODFA 4RJLA 1P7CA 5SZJA 2VYFA 5FOUA 1OH5A 4Q02A 3LVQE 5E95A 4LBZA 3FGNA 2AXPA 4MYHA 2ZE8A 2WOOA 3HJNA 3IO5A 3ZS9A 3DKVA 2QN6A 2GVDC 2W2TA 4DSTA 3THYB 4GZMA 1T0JB 2C2HA 3ZVLA 5FTLA 5JWRA 4NCIA 1N3BA 3RHFA 1S3SA 4Q7JB 1ZVQA 2WMNB 4NH0A 1A5TA 3K1JA 1GM5A 1VECA 3T12A 3T61A 3QXSA 4QGFA 2P2LA 1G9XA 3RVBA 1KHTA 2OAQ1 1G4AE 1OFTA 1YHNA 2AHOA 4JYCA 1M34E 2EYQA 2ZJ8A 2W58A 2MSCB 3RS2A 4M1OA 4M4SA 3AUXA 3K70B 1IN8A 2ZR7A 4J0QA 4TTPA 1II8A 1JR3D 1L4YA 1MKYA 2WAXA 3QKSA 4MITA 1WDTA 5JWOA 5FPYA 1VPLA 1XPUA 1YKSA 2J0UB 3ZQ6A 1HURA 5CB6A 2QSZA 2WJJA 1JAHA 4AG5A 3KKQA 3U7FB 3SN6A 1I4DD 4HAXA 5EXSA 4BFWA 3K0SA 2VH5R 2FEOA 2IW3A 3JVVA 2C9YA 4XVUA 1HYQA 2A9KA 2GZHA 2ZE7A 3L0SA 2O8DA 1G19A 5FI1B 1VCMA 2CE2X 2OLKA 2IYZA 2DHRA 3A1UA 2QE7A 1Q44A 3Q72A 3BERA 2GA8A 1KI4A 2OE2A 1E4YA 1KI3A 3E2IA 4F7WA 2PLRA 5AUOB 1RC8A 4NU0A 2HJGA 1RRFA 3CR7A 4HAZA 4S2EA 1OFUX 3MSXA 1J90A 3QQ5A 1GKUB 3NG1A 4C9BA 1GVNB 1AS3A 3AP2A 1FMLA 4EDHA 2GJSA 4P33A 2V9PA 3KL4A 1S3GA 3A8TA 3TJZA 2N46A 1W0JA 1QHHB 3K9HA 1YR9A 1ZU5A 3THYA 5F9HA 2ZSAA 4PAOA 3EWSA 1G7SA 2JLRA 1UAAA 4Q9LA 2GJ9A 2JASA 2VO1A 4ZKEA 1KDOA 1OIVA 2E87A 2ZRGA 4TSFD 1XU4A 5E7IA 4JYBA 2QGNA 4HB4A 5FR1A 3RS7A 5HKKD 3TGPA 1BYUA 2WSSA 1LF5A 2ZRDA 4GMXA 3IO3A 3HYRA 4L9WA 4ABYA 4C2UA 1KI2A 3KQKA 2BBWA 2LWIA 4HDOB 2VP2A 4PAQA 2IYVA 3MG9A 1G7CA 1J7KA 1UBEA 3ND8A 1T3LA 1MRNA 2WM9B 4BLQA 2QPOA 2KB0A 4TYQA 1Z07A 1EX7A 1D9ZA 1RW4A 1ANKA 2WJVA 4JBYA 5H1YA 4CEIA 4PSAA 4PZLA 3QJYA 5JEDA 1NVVQ 3QF7A 5EUQB 1UPTA 2QEQA 3IIJA 1E2MA 3U5ZB 1A82A 2A3RA 3ECCA 4GSYA 4KFUA 1SXJA 2C8VA 2NIPA 5G3ZA 3SZRA 2QTFA 1N6HA 1Z63A 2ZM5A 5A0FA 2J0UA 1S96A 2DFTA 2DPXA 4W5WA 3QEOA 4ASUA 4G5SA 4B33A 5K8IA 3GLIB 4XWAA 5KPDA 2C5LA 1YZTA 5AUNB 2IYRA 4HAYA 2YHSA 3NDBB 3BS4A 2B21A 4QGAA 1T0HB 3LRPA 2FF7A 4BEBA 3WBKA 3ASZA 4XIGS 4Q01A 2KJQA 1XTJA 2V3CC 2Z4RA 4JKYA 5FH9A 1KI8A 1GRNA 1CKEA 3F5FA 3GCGA 1CRQA 5G40A 4LK2A 3AVWA 4DLXA 2PZGA 3W6NA 4PPGA 2V4ZA 3ADDA 1VHLA 2ASEA 1SVLA 3ADKA 5TDHA 4QXAA 2IXFA 1XTQA 4NBSA 1FNMA 1WMSA 1M8PA 1P60A 1ZM3A 3T1QA 3EC2A 2ZJZA 4LI0A 3WP0A 1K6MA 4M21A 1QHXA 1FNNA 1AA9A 1T5IA 3SYKA 1CULC 1LV7A 1ZNXA 2BEKA 5DN6A 1QHHA 3PV0A 1ZAKA 1UBFA 1P3JA 1E94E 3AUYA 3PUWA 2X77A 3WXMA 2WIAA 3FKSA 2OCPA 4TL9A 3TLXA 3DMNA 1T3SA 4A4DA 3WYFA 3W3AA 3BJIC 4GDFA 3ZVRA 4WOPA 5A5GA 5IK2D 3C4JA 3QOFA 1Q1QA 2VRWA 2Q21A 3WRYC 1Q1ZA 1P72A 1FOEB 4B3XA 2AKAB 2J7PD 2QI9C 3REFA 2C77A 4IEIA 2BKEA 3CIOA 3M6AA 1E96A 1VKJA 1XPOA 1TNDA 1WXQA 4IOLA 1E2EA 1RZ3A 3ZS8A 2BIFA 4C30A 2HXYA 4RFVA 5TARA 4AYTA 1GZSA 4K81B 4EFLA 2ONKA 2H18A 2YWHA 4I1SA 1OHHA 2WJGA 2QGZA 4M53A 2BMFA 2WPDA 3B8HA 3GLIA 3UPUA 4RZXA 4TQ9A 2XSZD 1W36D 4RD3A 4QJ5A 3EARA 4JLVA 4KU4A 2O8FA 4ZO4A 5L3SA 1DELA 5F3WB 4AYWA 1KSJA 3EPLA 1R5OA 1NMYA 1GFIA 2Q6TA 4UNNA 3V00A 1FZQA 2R65A 1Q20A 1SVOA 4F4CA 1Q1EA 4N1AA 1E79A 4AD8A 4A92A 5KDOA 2PCJA 3TW8B 5GJWC 3N70A 3SNHA 3RRMA 1HQYE 4MGZR 2HV8A 3A1VA 3CNOA 4PSVA 4ON9A 5CITA 3PEVA 4DB4A 5FTJA 2R2AA 3I92A 4DUGA 1AS0A 1WF3A 2JLWA 4OQLA 1E1RD 5FPSA 2YZ2A 5JFGA 3T5GA 1G7TA 2VP4A 3LX8A 3NXSA 1DS6A 1DADA 3IHLA 5BYKA 3NH6A 1E2HA 1DTSA 3LD9A 3DKPA 3DHWC 1RFLA 3NC0C 4G5RA 3QXHA 4A8JA 5TVKA 2GCNA 1X8LA 4V02A 4R71A 3H4MA 1G3RA 2G1JA 1R0YA 5B2ZA 3K0AB 2AX4A 3PUZA 3REGA 5CJPA 4CEJB 4A36A 3C5CA 3AVVA 1OFHA 4CYMA 1DO2A 4JS0A 4BRUA 5FPKA 4NYMR 1N6OA 4O2LA 4KBFA 1TUIA 1YR8A 1NP6A 1AKYA 5FTMA 1UF9A 3TSZA 2AFIE 2VHQA 3O47A 5J4KA 3SFVA 4MRSA 1XMVA 1CR1A 2OILA 4TLDA 2WTUA 1OLOA 1Z6YA 1D9XA 2PL3A 4XSHA 1OE0A 3C15C 3AF0A 3BB4A 1NRJB 2HUPA 2F1IA 4ZI2A 1UKEA 2UKDA 1XMSA 1D2NA 2RGNC 3PFIA 2ZRJA 4ZPXA 1ZUHA 5C4MA 4JVLA 2ZETA 4EPXA 2Q3FA 2WWWA 3GJ5A 1G8HA 4RZ3A 1MABA 3VNUA 3TR0A 1LF0A 2CK3D 2EFEB 4HDQB 3U2QA 3CWZA 4FW9A 1IM2A 2W00A 2ZRHA 3Q3JB 1P2UA 5SZKB 2AWNA 2KBFA 2ODEA 4NHOA 4BZXA 1RRGA 3PCRB 4AG6A 1U98A 4TT3A 2VF7A 4DIEA 4DLRA 1N5JA 3EAQA 1FQJA 1CTQA 4QRHA 2V7QD 4JL8A 3OAAA 2VBCA 4IDOA 1G16A 4A0RA 3O8RA 1IONA 3PUYA 4KJZA 1ZU4A 4KSBA 3FHCB 4TLEA 4TMXA 4YMSA 2JLXA 2GVZC 2JAQA 1RE0A 3Q8XB 4E09A 2VTKA 1VIAA 4WZ6A 2X2EA 1H8EA 5CM9C 4KLZA 1P9WA 4TL7A 4TYPA 5JI3E 2MMGA 2IS1A 1A2BA 2C9OA 4N0DA 3AGPA 5KYKA 2CCKA 2A30A 1NNEA 2VA8A 2NO6A 4TTRA 4P4SB 2A5DA 3K0AA 2H8KA 3SHFA 4CEJA 1GDDA 4DRZA 1X3SA 2ZS9A 2RCNA 5BYJA 4LJ4A 2CHGA 3K0FB 5J4YA 4CRWB 1F6BA 4Z8YA 4NZYA 2H57A 2J7KA 3RS3A 2J1LA 5IDVA 3SS8A 2IYQA 5JMTA 2XB2A 4BFSA 1KSGA 2D7CA 2OT3B 2QMOA 3TUZC 4IOJA 3WHKA 3ND9A 1OH7A 4FN5A 4C0HA 4XD7D 2GF9A 1MO3A 2ZPTX 3CKLA 4DZZA 1R5BA 4KFRA 3WMFA 4OJKA 3IDQA 3AVTA 1JB1A 1JJVA 1QHYA 5CLLA 3G0HA 4QBIA 4M1WA 3A58B 2XTMA 4UNPA 4WXPA 1WA5A 5TMPA 4D4KA 4GBMA 3V9PA 1G3UA 5HCNA 3CZPA 1FQKA 1VIYA 1ZNWA 1E3MA 3NEYA 3HU3A 3U60B 2FNAA 3UKDA 2ZYVX 4B71A 1W2HA 4MYUA 3TQCA 3SEAA 4EFMA 2GKSA 4ERNA 3OFND 4Q21A 1Z6XA 4HZUB 1GWNA 2G88A 2EQBA 5HZHA 2HT1A 4FI3C 2RGXA 3HR7A 1ETUA 4PC2A 1H8HD 3GJ4A 4B3FX 3L82B 4LV5B 3I1FA 3T06B 3WBJA 1E9AA 4YXWD 4OHZA 4HLQB 1MOZA 4JSTA 1HT2E 5HE9A 1OH6A 4M8NE 4V0MA 1NSTA 2XTZA 3Q85A 4BLRA 5DHFA 4URXR 3TUJC 1HH4A 2NO1A 4C0AC 2IXEA 2IXGA 521PA 2OUKA 3SYNA 2REBA 4RVCA 4ARZA 4UNRA 1WE2A 4PQYA 2XXAB 2RGCA 4B32A 4RKFA 2GZAA 2GCOB 3E70C 3HR8A 3MUFA 2QP9X 3B1XA 2BBOA 3KKNA 3B7GA 3L2OB 4DDTA 1J8YF 1E1QD 2ZJYA 3AVOA 2J5XA 3LW8A 2RHDA 5J4HA 2WWYA 1XFAA 2Q9CA 4MRNA 3VR3A 3RABA 5FUXA 1GITA 3SJBA 1TMKA 1ZRHA 3BD9A 4C7OB 1Z0JA 3L8YA 2R6DA 4OI1A 1P61B 1MV5A 1WBBA 1IOZA 3CPJB 4Q9HA 4TZ6A 1SVWA 2CLDX 2XTNA 1G5RA 1BMFD 2I4IA 4EPVA 2HYDA 3FB4A 4UXHA 3GLGE 2H17A 3BFVA 4OQMA 4LJ7A 4Q19A 3PUVA 1AK2A 1N5IA 4TSFA 3UWOA 2CL7X 3IILA 1E4VA 1CJMA 3RRYA 4HAVA 3UMSA 1KTVA 2IS4A 5HKKA 5LD2B 1AS2A 4U00A 2I1QA 4DXAA 3U6BA 1YZKA 3MJRA 1G17A 1SXJC 1W4BA 4BEJA 1VTKA 4URVR 3MD0A 1ZIOA 1YZNA 5FOWA 3QIAA 2VP0A 4PHFA 1IBRA 1HTWA 2Z5FA 2ZSEA 3QKUA 3WHLA 1OYWA 1KJZA 2FSFA 4QBHA 4HZUA 4L15A 2YYZA 2IHBA 2RGDA 1UEJA 2X19A 4URZR 4YLGA 3I4LA 5L3RA 4MGIR 1NN1A 3JZMA 2ZANA 1W4CA 2J9RA 5AJWA 5EP3A 1KO8A 4LJ9A 5E7MA 1U2RA 4DDVA 2DY1A 3CRW1 4D0NA 4QBFA 2CMKA 3QBTA 1R0XA 4QFMA 3ZGXA 2FWRA 2ZSDA 2H7VA 3FTQA 5ANRB 4F4IA 1UKZA 1Z2CA 1XMIA 2ZAOA 4OK6A 3T34A 1DE0A 2FFQA 3VU9B 2P65A 4M9ZA 4P32A 2DR3A 2GCOA 2FMXA 2IA5A 1Z6TA 3MFYA 3THWB 4Q9IA 3GJXC 2FE4A 1E2FA 2FX3A 4DWJA 3VNVA 5JJIA 4JVNA 1JQLB 4CDGA 3UK6A 2DCUA 4A2WA 2ZE6A 3B5JA 1CF4A 2G9NA 3QVUA 4B6FA 4TLBA 4IXMA 1J2JA 5DIFA 1OH8A 4C7OA 1CR0A 2IYLD 2ZQ5A 3HP1A 3C7KA 4KCGA 3U3JA 2BJWA 4EPRA 2IYSA 5CDFA 3CZQA 3CF2A 1XEWY 1Z8FA 3QG1A 3NDPA 3EIHA 5H8WA 2N42A 1GRRA 1MT0A 2HLDD 4B2PA 1NI3A 2F9MA 4R9UC 4PZYA 2IUUA 1EFHA 3TAUA 1TTTA 4GNKA 3VKGA 4PPNA 5K8UA 3C16C 2WJIA 3GLHB 4DLYA 1UADA 1GL9B 4WBSA 1P75A 2WWGA 3VHLB 3NIBA 3N2EA 3TSOA 4B44A 2NTYC 1IY0A 2X1VA 1XJCA 5GJCA 3H86A 2YINC 4V0KA 1BH2A 4X8HA 5CYOA 1YQTA 3DO6A 2J7PA 4D4JA 2JCSA 1Y3AA 2O8BB 3RRNA 2AWOA 1GAJA 2PJZA 2IK8A 2PX0A 5JRZA 4JBXA 2EU8A 3LH5A 4BGDA 2GJ8A 4OHWA 2NGRA 3NC1C 5CLQA 3NVAA 3N5CA 4FMCB 3W3ZB 4DLWA 2GF0A 2PLFA 3Q9LA 5EXPA 2RKOA 4GI7A 2RGGA 5DSZA 1U9IC 4BZPA 3CPHA 2DWOA 3X1XA 2JIZD 1S2MA 4D25A 5L3VA 2XSZA 2GEDA 2ZRPA 3PIRA 4JLOA 1ZC4A 5C46F 4MGKR 3Q5EA 4G5QA 2IL1A 4RD0A 3NKVA 3RS4A 3K9NA 2ZUBA 4DCVA 1O87A 4LUCA 1VHTA 3VU9A 1P2TA 2FJUA 1XX6A 2BWJA 2PZFA 3TUIC 1W0KD 4C2TA 1IN6A 2O5VA 2NPFA 2FSGA 1N6KA 4JLMA 1PZNA 4X8OA 5E3HA 1XMJA 1NG1A 4JSYA 1Q3TA 5B57C 1YZLA 1EGAA 3E5HA 3LXRA 1GOTA 2CDNA 2ATXA 2PZEA 4PAMA 3RS0A 3QY0A 2R6GA 4A8JC 4CEHA 2CBZA 3ADBA 1G8PA 1ZCAA 4AYXA 2J45A 4Q4JB 2GXSA 2MMCA 3CH5A 3JVUA 5FOSA 1UFQA 4MYTA 4YDSA 4D82A 3I61A 5JBQA 4TYYA 1E1RA 5IF9A 4OK3A 4EQ6A 2JGNA 3B85A 4Q9JA 2ZYUX 2WWXA 3EW9A 2ORIA 1OXSC 2BKUA 3KX2A 4DKXA 5B64A 1NKSA 5DHAA 3TMKA 1ZMXA 4HLUA 3U7GA 2D62A 4EFNA 3OIUA 1G6HA 4CT5A 3SJCA 2QAGB 1KI1A 3KUCA 1HEIA 4NE2A 4QHTA 3RS5A 4TZ0A 1W1WA 4LPKA 3BB1A 3WRXC 1LY1A 3ICQB 1GKYA 3IGFA 2ODNA 3QXXA 1LS1A 1P9RA 4I1OA 3UG7A 4UNSA 4A9AA 3K53A 2FDCA 1CRPA 3I3SR 1EXMA 3GEEA 2QBYB 2WMOB 3LAWA 4XTCS 4RFSA 2G0TA 4DHEA 5KSZA 4Q1AA 3UXMA 5K8LA 3W6PA 3K0CA 3IPXA 4PO1A 4JLPA 3CB4A 1RYHA 1F48A 1KI7A 2WVJA 4LV8B 4DJTA 4JZKA 1E6CA 3IIKA 3KDSE 1LW7A 2DWPA 1CP2A 3CM0A 2WJHA 3CF0A 4Q03A 4JLNA 4Y0AA 1MO4A 1M1YE 2V54A 1XJQA 4ZCMA 1CIPA 3A4MA 2CEAA 5D3MA 3IEUA 3O8BA 2B7BA 4BFUA 1Z83A 5JECA 2QRZA 4LHYA 4CVNA 1ZCBA 4QC2A 2WICA 3CPEA 1G1MA 3L0IB 4XH9B 2IEZA 4Z1MD 3OE7D 1E32A 3AF1A 2GBLA 4A0HA 4HUTA 1G18A 2BBSA 2V7QA 4HB3A 1W49A 3T35A 1J99A 2R8RA 3T1VA 4LC1A 4OI0A 1IJEA 2GXQA 2IWRA 1DAEA 4AKHA 5GJVC 2WAYA 1SGWA 2VSOA 2REXB 1V5WA 3DZ8A 5CYPA 2A7QA 4PHHA 2VP6A 3ETLA 5SZHB 4Z8XA 2QAGA 1MO5A 2ZEJA 4DBLC 3HPRA 4LBWA 4OHYA 1SZPA 1VG8A 1KNXA 1S1CA 1U0JA 2D4HA 2DWQA 4HB2A 1N6NA 2EFGA 3PQCA 3IUYA 2J0QA 2ZTSA 3BH6A 4GOXA 4OK5A 1XXHE 2OBNA 3EPJA 1U94A 1OT3A 1TU4A 2J87A 4LBVA 2IUTA 1R7RA 2RGAA 4GOJA 2VPPA 5FL3A 8OHMA 2QBYA 1SQ5A 2UZIR 221PA 4ITRC 1W47A 4RD6A 3UIEA 4XD7A 1KY3A 3ZZTA 1G41A 1KO5A 1KAGA 2LCFA 4XWKA 4POAA 5G3YA 4KI0A 2DB3A 1NN5A 3FMIA 3RC3A 2QT0A 2FN4A 4U5XA 2VL7A 1GKIA 2QG6A 2HT6A 1TQ2A 4LHWA 4LYJA 4N3NA 2C9CA 5B30A 3KJIA 2FH5B 1CU1A 4A6PA 5BQ5A 1IXSB 4HYYA 4L5BA 3SI7A 4W7SA 3OFNA 3OEHD 2F3TA 1KKLA 1OJLA 1X1RA 5D3QA 3GLHE 4ESHA 3UANA 4HAWA 1H8HA 1YZQA 4US2R 3GEHA 5KDDA 2O0KA 5KTYA 2OBMA 121PA 4YXWA 3W34A 3IIMA 4EJSB 4QGHA 2AXNA 1VCNA 1JXOA 3T5DA 2X2FA 2CCJA 4FMBB 1FUUA 2QP3A 4HAUA 4IFEA 1JBKA 5FPTA 2PMKA 2F55A 1GNPA 1EFRD 5JS8A 3A4NA 3M0EA 1Z06A 1KSFX 2VLIA 1G64A 2VSXA 3GJ8A 2JATA 2DFLA 2YWGA 3LWNA 2AK2A 1ZD1A 5EP2A 3IBYA 4LSGA 2ZS8A 1NJFA 3NBYC 4OJQA 1E1QA 2BC9A 4IW3B 1JALA 3J81k 3RC8A 4KSCA 2AK3A 2JEOA 1SKQA 3I72A 4IVPA 1S4QA 4LV6A 4PC1A 4V0OA 1G3IA 2Z4SA 3C41J 3WNCA 3PVSA 5C2JB 4XVQA 3QI2A 1FX0B 3Q7QA 3EA0A 2WJYA 1AZSC 4LYFA 2J59A 1PV4A 1BMFA 2QMHA 2RAPA 3FHTA 5A4JA 3I8SA 3PENA 2JA1A 1XCMA 2O8CB 3UWKA 3VR2A 1X86B 5FOVA 4O0MA 2P5TB 5KPJA 4V0NA 1L2TA 5AUQA 4Z54A 4KAXA 3EIEA 1V43A 2JDID 1CJTC 1GL6A 5JHGB 3ZQJA 1EESA 4DDWA 4BASA 1HQCA 1E0JA 2IS2A 1MRSA 3TW4A 3PG5A 1RIFA 3DOEA 1OW3B 1CJVC 2EVWX 2YWFA 4QG7A 1W7AA 3VFDA 2CHQA 3AVQA 4C0KA 1QHGA 1G21E 4F93B 1KK1A 2BOVA 5P21A 3SE0A 2GNOA 1SHZA 4Q4LA 1JJ7A 5BN4A 1T6NA 4NYIQ 4R7ZA 3C5HA 3L8ZA 4WAUA 1NBME 2O8EB 3MMPA 1PUJA 2W6JD 1TQDA 3B1WA 2NZJA 1Q57A 1I2DA 5FFMA 1HUQA 3HYTA 2JJ8A 1ZUNB 4LC0A 1Q3HA 2ZYWX 1Z0DA 3EZ9A 2ZI6A 3S1AB 2GEUA 3SC3A 4D26A 4LYHA 1ZD8A 3GLGB 1W5TA 3X1WA 3GMTA 2BDTA 1K8RA 1UDWA 3C8UA 1EWRA 2B6HA 3D7MA 2P6NA 5EE5B 3SJAA 3SOPA 4JLJA 4US0R 1ONBA 2JLUA 3KUDA 2HXSA 4LWZA 2CXXA 4GP7A 4LHXA 5JHHB 4NTZA 3SBDA 3ZZ0A 4XSGA 5FTNA 2F6RA 2QMEA 5DH9A 1DAIA 2OG2A 1KNQA 3LLUA 4XTRA 3W5JA 1E9EA 4WXRA 4L8GA 3LFUA 3VKHA 3BAFA 3WYAA 2R6CA 3MWJA 2HLDA 4DCUA 4ZDKA 3D8BA 2O8CA 1M7BA 2Q3HA 1WP9A 4WW0A 4A0GA 3H2YA 4JJKA 3RWOA 4IEEA 2W2XA 4B76A 2AR7A 1CJKC 1A1VA 4JT4A 4AKGA 1XP8A 1GIAA 5SZIA 2YKGA 1SXJE 2XNDD 1GILA 2ZE5A 1T8TA 4B3CA 2PJRA 3ICEA 4RD4A 2CNWD 2LKCA 2PMDA 4MKIA 4II7A 4AK9A 4M1MA 4CF7A 3SU8A 3GLFE 1DAHA 1UM8A 2GWHA 2KWIA 3SQXA 4LOAA 2FPMA 5TXGA 4QHSA 1XB2A 2XX3A 3WNDA 1Z6GA 2HCJB 2EWVA 3OIWA 3A1TA 4Q18A 1XWIA 4G0NA 5KSPA 4IOKA 1YVDA 1KO4A 2O8EA 4HUQB 2JIZA 5HR5A 1E2LA 1US8B 1QBKC 1XEWX 2IYXA 4TMTA 3OESA 5JEEA 2VSFA 3CRMA 1S1MA 3FYHA 3AP3A 1NVVR 2ORVA 3LDAA 3S1AA 5GJBA 1W0KA 2MSDB 4CW7A 4WZAE 3V4RA 4Q00A 3QKRB 4D4LA 2FV8A 5J5CA 4KBGA 4NPHA 2H92A 1FP7A 4ZV4A 5FR2A 4P4TA 3AKDA 4ZCIA 4O25A 3U61B 1ZJ6A 1KK2A 2NQ2C 4U7DA 2R6AA 1ZBDA 4IFBA 1N5KA 3WY9A 2GETA 2OESA 5FPHA 2QP4A 4IXNA 2GEVA 4MA4A 2CVFA 1U81A 1S8FA 4JMPA 4LDJA 5C1BA 3EASA 1XD2B 3IEVA 1IN4A 1L4UA 1EWQA 2ZU0C 3DEFA 2CJWB 2TMKA 1TAGA 4OKSA 4LX0A 5E7JA 5JS7A 2WWFA 4R2IA 1W2GA 1X8JA 2CL0X 1KI6B 2G83A 2QORA 3FMFA 3K0EA 4LCBA 1N6IA 3U3RA 1N0WA 3VQTA 4A6XA 1NBMD 4M0LA 2V8OA 1MH1A 5E4FA 1FTSA 4FXPA 4O3MA 2WSMA 5HZKA 1KZ7B 1E2JA 5CK4A 4D0LB 3CR8A 4O2RA 5DE3A 3A1SA 3PEYA 4NMMA 4IJMA 1R0ZA 1E2GA 3KFXA 1SHKA 4FCWA 2I3BA 4PR0A 4QM6A 5EXTA 1YZUA 5IRCD 3O8CA 3F3YA 2ZRFA 2ZI3A 4FCTA 4QJ4A 4B3GA 4URUR 1HE8B 2Y8EA 5KU1A 1JPNA 1U8YA 1OFIA 1T5LA 4TWZA 5IT5A 3KQHA 2ONJA 5UKDA 5LB4A 1W5SA 1NF3A 4OYHA 3AVXA 3LW7A 3GD7A 4I99A 4QM7A 1JR3A 1Z08A 2OXRA 2OM2A 1R2QA 1ZM4A 1EX6A 2R62A 1E0KA 1UBGA 1ZNZA 2BMEA 2YOFA 4M9XA 2P3SA 2D2FA 1UBCA 2NO7A 2ZI5A 5J4VA 3I5XA 3I62A 1KSHA 4BZQA 4Z1MA 2JLVA 4DSOA 2P5SA 2OLJA 4ZDJA 3RRZA 4JVMA 2A78A 3D31A 1TQ6A 1G8YA 1ZM9A 4G5GA 3CNLA 5G53C 4RY2A 1VYVA 1Z5ZA 3PEUA 2YOHA 1KO7A 4KODA 1AZTA 4YMWA 4ASUD 1XD2A 4BWYA 5IHPA 1U0HC 1XEXB 4TQUS 3U7EB 1XPRA 1IY1A 4DVGA 1NLFA 2FG5A 2BJVA 4ZIRB 5KNBA 2WHXA 4YDHB 1D5CA 4P4SA 2Z6VA 4WIAA 1KI6A 1W48A 4JLDA 3B6EA 3A37A 4FMDB 3K0FA 2Z43A 4PC7A 3SHWA 1R8SA 1FMJA 1TX4B 3SJZA 2ZRAA 4LY6A 4UQOA 4AC9A 1ZIPA 1KMHB 2F3RA 4KVAA 1YRAA 2ZJ5A 1T9HA 2R44A 2AL7A 4FINA 3K70C 3H84A 3RWMB 1VYUA 4B35A 5J47A 3LQRA 2ANCA 2BCGY 3QPUA 3AVPA 5AR1A 3VR5A 2ERXA 2LKDA 5H68A 3KKMA 3VX4A 3P4YA 4U02A 5L8VA 2OCBA 1L7VC 1SVSA 2Z0MA 1ZM2A 2HEIA 2IS6A 2ZRBA 2C03A 5EJEA 4NL4H 3W5IA 4URWR 4QGGA 4DLUA 2WZQA 1QHSA 3KB2A 4OQXA 2JLYA 4Q4AB 3OEHA 3IKJA 4LJ6A 1II0A 1AKEA 3VHXA 4B34A 1ESNA 2IC5A 1QG2A 4KO8A 4BFVA 2ZROA 2WV9A 4AWXA 3FFBA 1NN0A 3BC1A 5CIQA 3WMGA 5LB2A 2XZOA 2XGJA 5JSZB 2YV5A 3R8FA 1OKKD 2O0JA 2EFHB 2D2EA 2OSBA 3AV0B 1D2EA 3TRFA 2FOLA 2WKQA 2XXAA 2ZI9A 1XXHB 3RLFA 1KJYA 1TQ4A 4A0FA 1XBTA 4ZI3A 1EFRA 2WPDD 2YOGA 4QL3A 1EG7A 1XF9A 2KBEA 2YWEA 3K9GA 3P27A 3GP8A 4RD1A 3AF2A 2ECKA 2IWHA 2E1RA 2GRJA 3ZH9B 2Q3MA 4B3BA 1FTNA 4UJ5A 1U8AA 4ZIRA 1UKYA 1HY3A 2NG1A 1GL7A 2QZ4A 1EFTA 4OHVA 3T15A 2F43B 3HU1A 2BHRA 3OIYA 4LGMA 4Q1CA 1UDXA 3B13B 4QHYA 4NYJR 5DYGA 3KXIA 4Q5IA 4DDUA 1N6LA 3G5UA 3EA5A 1FP6A 2BBTA 3W8RA 4Q1FA 2PBRA 1XJ0A 4MRPA 4WA7A 1TF2A 3ZYCA 2GILA 1U8ZA 1AQUA 3MAAC 2V6JA 3FE2A 3L0PA 4FMCF 1KMHA 4TLAA 4GP6A 3EXAA 4TQAA 4KITB 1ELOA 5DI3B 4EPWA 2A5FA 1OYYA 2PEYA 2UZ3A 3ONWA 5IK2A 1IJFA 1E99A 1BS1A 3CRVA 2ZUDA 5K8TA 4W5HA 4OQNA 2WWHA 2Q0HA 5JLJA 2RB4A 2JDIA 3R9WA 2KE5A 3U7HB 1E9RA 3EPHA 3ZIAD 4CGZA 3MLEA 1U99A 4HB0A 4TL6A 1VCOA 4JIMA 5JI2E 5ELXA 4EPTA 2ORWA 4PPQA 3FOZA 4Q4AA 1NMXA 4Q7LA 3SFZA 4LHVA 1R10A 4H9GA 4MYCA 3ZVMA 1MO6A 5FL7D 3ASYA 2ZRLA 1U90A 4Z51A 4MDEA 1KIMA 2BEJA 1F60A 4DLVA 5F2EA 2QM7A 4NKRA 1OXXK 1SKYE 4KVGA 5AJVB 2W6JA 4R2HA 1N25A 1E9FA 3R7WB 3AGQA 1NKTA 3GFTA 3DL0A 1B0UA 1F2TB 2ZS7A 2RH5A 3RSOA 3GPLA 2JLZA 1G8FA 2WBLC 3THWA 5EE0A 5C18A 2E9SA 1OV4A 2WKPA 1UKVY 2ZUCA 3I73A 3KB1A 3TE6A 3ZZUA 1KDPA 3VR1A 4C0JA 5LPNA 5KSYA 2VHCA 3OZXA 3QVVA 2OEPA 3EG5A 3P1JA 3PITA 4KYIB 3Q5DA 2F43A 1VMAA 4TMZA 5FOTA 1TEXA 2RGNA 4BRWA 1II8B 4TMVA 3PR1A 3QKSB 3TBKA 4LJYA 1VG0B 1P5ZB 3VKWA 1OXVA 5BN3A 3TVTA 4P3YA 4FCVA 2ZRMA 1N6RA 1U0LA 2BM1A 1T8UA 1YRBA 4GZLA 4IKEA 5EE1A 3THXB 4ESVA 3X2SA 2IYWA 3CRQA 2CVHA 1OB5A 1KJWA 2AFHE 4WZBE 1D6JA 3K8YA 2K5UA 3GLHA 3VR4A 4F91B 5JJKA 4OL0A 2FFHA 5AK0A 3EZFA 4UXJA 2O8DB 2RGEA 4A82A 2A2ZA 4D6PA 2J0VA 1ZUIA 2ZI4A 1R4AA 2H16A 3T1TA 4HI0E 3CW2A 2JJ1D 5EQTA 1BYIA 2O8BA 4YQFA 1G291 3A4LA 4QKQA 1WQ1R 1K5DA 3QXCA 2XNDA 1GNQA 1XDBA 2V1UA 3EZ2A 3DPUA 1Q21A 2P6UA 2CNWA 1C4OA 2F1RA 2VP9A 1R0WA 3UMFA 5JRJA 1BO6A 1VYTA 5J40A 1UJ2A 3BXZA 3OEED 1G20E 4WVFA 4KFSA 1Z47A 4B43A 4LPSA 3KQNA 1IQPA 4LJ8A 4IVRA 1Z2AA 1M6NA 3UG6A 1VDZA 1XTKA 4KYUA 3WMEA 5L3QB 2ZREA 2G77B 3PUXA 2O52A 4TYNA 4MRRA 1YZGA 2FEMA 2CK3A 3R7WA 3AF4A 4HLCA 1F2TA 3FMOB 1Z22A 3ADCA 4LRWA 3IQWA 1A4RA 1I4TD 1NL3A 4B47A 3EZ6A 3SR0A 4TN1A 1DOAA 1PUIA 3RAPR 1IAQA 1OXUA 1RVDA 3KTAB 2D3WA 4PPFA 5CDFE 3CF6R 3LQQA 2UVQA 4M1TA 2W6ID 4DEYA 2W0SA 2XNSA 4PQFA 4CEIB 2GXUA 4PC3A 3QXJA 5FBWB 3X1DA 2IHYA 1COWD 2PEZA 4Q4JA 4AIIA 4IDNA 1SXJB 2FPLA 2AKYA 4RCZA 1DAFA 1VG9B 2GXAA 2F7SA 4HEJA 3MWKA 1JPJA 5F98A 3THXA 2VIIA 2BMJA 5BXQC 3D6TB 1P2VA 3JZAA 3DDCA 5EXXA 1KZGB 1O3YA 3QPVA 1D2MA 3GLFB 4A15A 5BW8A 3FMPB 2ZI7A 4TMKA 3HU2A 4NCJA 3F0TA 3A36A 4PFSA 4RKEA 1BOFA 4DB2A 1NBMA 2N1BA 4B74A 5FTKA 2DYKA 3QE0A 2IT1A 5EZ5A 2J3EA 1KYIA 4AY2A 3MGCA 3W6OA 1EFUA 1E98A 4LBYA 1JXMA 4D81A 1E0AA 3BOSA 3CRRA 2D74A 4NYMQ 1ZNYA 3IBGA 2I1VB 4HLDA 2W2VA 1M2OB 1F3OA 3QF4B 3ZLJA 4LJ5A 5L3QA 3AKEA 1Z0FA 1SVMA 1Y63A 2CHVA 2NO9A 5GVSA 3GFPA 1I2MA 4GL2A 1IHUA 4PO8A 2OXCA 2OHFA 3LBIA 4KXFB 2QA5A 4W5JA 4Y0VA 4QBGB 821PA 3ZVNA 1NN3A 1MR3F 4R98A 1D8TA 1KK3A 4E07A 4LHZA 1Q1BA 3FVQA 1AGPA 1G6OA 2GAOA 1SVKA 1X6VA 4PSKA 2ZYTX 3KTAA 2VHTA 1JI0A 3QEJA 1Q22A 2JJ2D 1QG4A 3OIVA 5FUYA 2J46A 2QAJA 4C0BA 1JEEA 3LBHA 5KUTA 1E2QA 3KQUA 3TH5A 1QVAA 4MKHA 3TR5A 2D7DA 2AD1A 2BM0A 3EIQA 1OXTA 3K09A 4BUJA 2RHMA 3KKOA 3DM5A 4CIDA 4BLTA 2IF2A 3BRWD 4BE7B 1M74A 5HTKA 3V4FA 1KAOA 4B2LA 3SDZA 2GK7A 5KSOA 3GLFA 4Q1DA 5L3SB 1ESMA 3Q7PA 2F1JA 5BN5A 2ZXUA 1LB1B 2GHIA 2DBYA 1BKDR 4X8MA 4BFYA 4YMVA 5FBVB 1RRCA 5FBLB 3TNFA 2XITA 1JECA 4G1UC 1WB9A 2GJAA 3QKTA 2VHJA 3IPYA 2IYYA 1TUEA 3RDPA 5LBIA 2QUZA 3CUEF 3G82C 2ZJAA 2XOKD 1AIPA 4K8OA 5DI9A 2P67A 4DLTA 4GFDA 3P4XA 4M22A 4YMTA 1W4RA 1LTQA 2WWIA 3A6PC 5AJZA 2P0EA 2Q9BA 4TL8A 4IDQA 3E1SA 3W9YA 2SHKA 1DEKA 1LS6A 1GUAA 4Q48A 2C98A 4C0SA 4JBWA 1RKBA 3OHMA 3K9LA 3SQWA 3D3QA 4Q1EA 3QF4A 3AF3A 1AGRA 2JLQA 1KKMA 4A8JB 3B1YA 2EFCB 5TY0A 1YR7A 3RYTC 5KOYA 5CJ2A 4CZ2A 4JL5A 4LJAA 5EP4A 4ZDWA 1QDEA 2ZRCA 3F8TA 4UXIA 1JNYA 3AVUA 1PJRA 4QNRA 5GVRA 1E2IA 2REOA 2AN9A 3CO5A 1SULA 4EJSA 3TIFA 1QRAA 4NCHA 1HA3A 3KQLA 1PLJA 4QOSA 2V1XA 1RPZA 1JQJC 5FUWA 3HDTA 3H1TA 2ODBA 2IF0A 4P0TA 3UATA 3KJGA 1Q12A 2V6IA 3UMRA 1OKKA 3U4QB 3C14C 2ERYA 2F1HA 4BQSA 2ZVQX 1G8GA 2PH1A 4FD2A 3QENA 1E2KA 3N2IA 1XNJA 5FBQB 2EWWA 1YE8A 5HE8A 4UNQA 4JJZA 1IXRC 4D4MA 2FFBA 1ZINA 4X8LA 1MABB 3VAAA 3RNLA 2Z83A 4PX9A 2ZRIA 1IXZA 2IEYA 2PCLA 5FI0B 1R6BX 4AKIA 1AJEA 2CLSA 3FDIA 3FKQA 1TL7C 2GAAA 1FX0A 2XAUA 3NBFA 1U9IA 5LD2C 5EZ6B 1DPFA 5F9FA 4TLCA 2YJTD 4JLBA 5LDDC 1QF9A 5DO9A 1YU9A
chains in the Genus database with same CATH superfamily
5AJYA 3ZTWA 3KXKA 3ZPXA 1QNFA 1J0AA 4MYDA 4UUQA 1ZC3A 5HBGA 3TVDA 3QFRA 4EH1A 1HFWA 1HE1C 1X38A 2H1LA 3D7KA 1JMKC 1EGMB 1U02A 1SOVA 2XGMA 4B4OA 1DAGA 3K71B 2WHEA 5LLDA 4KO2S 4U2BA 4WFIA 4AQYB 1E6EA 1XVUA 2W2MA 1IN5A 2IYNA 3EGIA 2ZYDA 1NOJA 3BSWA 5E1DA 3SCZA 1JYEA 2Y92A 3WL7A 1G6Q1 1O95A 1CE8A 3NH9A 4J0GA 2YJ5A 1B6TA 1DKNA 2FSIA 1WO8A 3Q3IA 3F6YA 3QE9Y 4YIHA 5LYJB 2OKGA 1JR6A 1RHRA 3MQFA 1Z5WA 1SB8A 2DZDA 2WB2A 4OI2A 4M60A 4TRRA 2Y1FA 4RH3A 1ATIA 4PCAA 3H5LA 4NSNA 3LV8A 1WHSB 2W6PA 4DMRA 4AJHA 1UEXC 2QQFA 4YUAA 4R16A 1RCUA 4JDPA 3Q8MA 4DYVA 2P9JA 5JZMA 4OHPA 4XDYA 1UOQA 1RQPA 1RYFA 3F71A 1X87A 4PGGA 2OFPA 5DISB 4KJXA 2FGJA 4Z2AA 1OVGA 5D5PA 1EDBA 4Y2JA 1NUHA 3K8OE 4L8LA 4N5IX 2R4QA 3VUFA 1PT9A 1A8QA 1Z5NA 9ATCA 1EWVA 1R8QA 1GLNA 3EZXA 2E4AA 2VT6A 4XVHA 2YC2C 1UZNA 1Z7YA 3K1YA 5JSHA 5BNIA 4MUJA 3GQBA 1E2PA 3AFGA 4GE3A 2BMWA 5IJXA 3GLGA 3AH8A 1TZ2A 2G7ZA 4V1CI 4EY6A 1OB2A 2A1TS 1V8PA 4Z1MD 1TADA 1YNSA 3L7YA 4NY1A 5AI6A 4CKBA 1USIA 1AQYA 1M7HA 1GN9A 2AX3A 3LX5A 4KKVA 3WB9A 5CXXA 4RTNA 3GLQA 4TMFA 4ENVA 3NBZC 1P4SA 4PBSA 4R40A 3RHSA 3V4SA 4EO9A 1JTEA 4UTPA 2BHSA 4L5YA 2J30A 1DEHA 4JOBA 1IUPA 3ESXA 1IDOA 3SX2A 4PLFA 5BQOA 2CYCA 3A9UA 1P39A 2JEYA 4IDHA 2JCGA 4OUDB 3K92A 3U31A 4BFTA 4JV5B 1ZKMA 3C8DA 3OU7A 2ZPUA 4HATA 1T91A 1FLDA 1MEJA 4F12A 5K2OA 3MRVA 4YYEA 5TGTA 1TDJA 5LZ4A 4GLLA 3LZCA 3KFVA 2QRLA 721PA 1DV2A 2YVLA 3EZ7A 3LNCA 2VRCD 4UTZA 2GK6A 5BNTA 5CCEA 1WQ3A 3GDWA 2QR5A 4RY9A 5HOQA 1DLJA 4E03A 2X8AA 1P1KA 2W5UA 3NOXA 4BLPA 5JDIC 4MHTA 5EUBA 2XZPA 1GRQA 2OMEA 2WUFA 3M6FA 3PTLA 4KRGA 3TKYA 1HQKA 3C5WP 1SC4A 1WVMA 5K7SA 1ZK3A 2FWIA 1J8MF 3K0CC 1NVWQ 1Q7TA 1EVQA 2C20A 1SHUX 2IIQA 2OBLA 3PSAA 3ONEA 1YTLA 4YONB 1C9KA 3HEBA 5DLDA 5AWFC 5FLXA 2B8TA 3IV7A 3PEWA 3IFSA 2QRGA 5HDBB 3RFXA 3MQ2A 5FI3A 6PFKA 3SMVA 3SQLA 2C78A 4I4LA 1SIOA 3EZLA 5DM0A 1CQPA 2FSHA 3L7JA 4HZGA 5IKMA 2JCYA 4DS3A 4F9TA 2QPTA 1J23A 2MR5A 1JQEA 1K06A 3C3CA 3D6MA 1P1FA 2BHLA 3H8SA 3HCPA 4R69A 4BLOA 3ELDA 2AH5A 1PJAA 3CWCA 3RVNA 3SXPA 5LQUA 2WF9A 3T1OA 1MZPA 1YDWA 2IOQA 4HN9A 2JLSA 3EY9A 4YUVA 1DJPA 2ODPA 2P9HA 4MLPA 3R4VA 3F8SA 3SEFA 1US8A 3B9PA 1BWSA 3KYJB 1ZX1A 2WSSD 3I5UA 3RT1A 1F8YA 1QC5A 5CK5A 4OHBA 3A6KA 3I6ZA 5EIHA 1Q7BA 4BCDA 3ETDA 2H4HA 1L8QA 1QHFA 2R8EA 1CDZA 1K6EA 3FIUA 3L1UA 3OUUA 3KWJA 4L57A 4ZTUB 3HA3A 4QJ3A 1KYQA 1Y4SA 1KK0A 1O2DA 1PBTA 5CB4F 4JVSB 4U7GA 3OE7A 2VBGA 4POOA 3VGJA 2OFWA 5CH3A 1MENA 2ZSKA 3ORFA 4NYIR 4BFXA 4F5EA 1NE2A 3VPBA 1AHIA 2C5HA 2HEGA 3BH0A 1PWZA 2W6IA 5HPYB 4IGFA 2H1SA 1R9NA 4I55B 5GPBA 1WPRA 3E7XA 2C0QA 5ESWA 1COWA 3RU7A 1IHXA 4YCDA 1Y6GA 2I3DA 3A2MA 3QBVA 1T4GA 3V8PA 4F8YA 1X7WB 1PEYA 3UFXB 2XB4A 3RSLA 1IY9A 1GRCA 1YDFA 1FDIA 1WCV1 2G5PA 1H2HA 2EIHA 1Z5OA 1DDOA 5IARA 1PG0A 1YDMA 2DP4E 4YI5A 1TM1E 4UM9D 1VMKA 1OJ7A 1OT5A 4MROA 3BH7A 4OXNA 3MC1A 2JI7A 2V59A 3INNA 5BRJA 3TGWA 2HIGA 3CISA 2JGRA 1YMVA 3K8QA 3ECAA 3ZHSA 1OAOA 2IY7A 2VP3A 2XYRA 2W0MA 3HKBA 4DSNA 3GH1A 2IE0A 4UJ3A 5GGXA 3ZD6A 3PC4A 3DKRA 1MZVA 4GRAA 3DW3X 5AJXA 5HG0A 4DSUA 1Q95A 1P0IA 5ED4A 3NHBA 2Q2WA 1UBTS 5DNVA 3MOSA 4A2PA 1DAKA 1S9HA 1ZYUA 2ZJBA 3EFBA 3E3MA 4JJ8A 4JLSA 4Q4HB 4YFYA 1HR0B 5CCXA 3QMWA 1QKIA 1A3CA 3I52A 3ER6A 4ZZ0A 1Q1AA 4WLUA 3TQFA 5ALRA 4DABA 3PF9A 1MCZA 3DVAA 3URKA 1R66A 1AA6A 4Z2YA 1IUOA 3P2EA 4LXIA 4X1IA 1JQAA 3KUKA 3FKSD 2G04A 3OTQA 4ZZIA 3EX7C 1EWYA 4ECAA 4JUDX 2EW2A 5A4DA 2NUBA 4M6WA 1NFQA 4QICA 3WP1B 2CLEB 2H7YA 3BFXA 1DBVO 1YZFA 3T5BA 4F3KA 1KEEA 3EW7A 4Y2XA 2NPOA 2V4MA 4BNXA 2JK1A 3E15A 3UT0A 1UAGA 2F67A 3F73A 1HWYA 1QVRA 2WJZB 3MYRA 2UXBB 4YUXA 1NI4A 1GNTA 4KEAA 4XWOA 2QU8A 5JTTA 2VUIB 4C4PA 4BPBA 4I5EA 1D0IA 1C4WA 1O54A 3RVQA 4KV7A 1TEVA 2AFHA 2NWQA 3LA6A 4WZBA 3MRTA 3RFVA 3L6UA 4ZICA 4OXKA 2OFOA 4Q7KA 2AMLA 1PVDA 3RNOA 3UMJA 4EA8A 3X1YA 4B75A 2WWRA 1YI1A 1KMMA 4B6EA 2C58A 3A05A 4J7XA 3DMTC 2QMUA 2CMFA 2V03A 3ENZA 3CTPA 1NXVA 4U6SA 1CUYA 3LO5A 3HRKA 4RM3A 1ZGHA 3ZDYB 5B55A 5ALMA 4ZCQA 4J76A 4DMMA 4OY3A 4L8YA 1SD5A 3KKPA 3MT7A 1BTOA 2VTVA 2QXTA 1NBAA 4V2IA 1UBKS 3ZWXA 4ER7A 3MJHA 4NBRA 5M7EA 1CJCA 3MJEA 5FOXA 4BMPB 1XEXA 2UYGA 1L5MA 3GGSA 4KOEC 2G71A 4NE9A 5HF9A 3RANA 1G2PA 1C5KA 4Q9DA 4YRNA 4RORA 4N18A 1NUSA 2IRWA 1G20A 1CS0A 1N1EA 3CVOA 5GM1A 4CF3A 1X9HA 1NVTA 1U9YA 4MQFA 4CM7A 5CFLA 5KJ6A 3L7LA 4EKDA 2PUCA 2UYHA 3L5KA 3BIFA 3QKWA 4FWBA 2XWQA 3B2EA 2C0PA 1XD9A 2FW9A 2ZSFA 3FSGA 4HX9A 1Y4AE 4I1VA 4BJHB 1RJ9A 2CUNA 3O8QA 4GKBA 1FYDA 1XK6A 5DHSA 5A05A 4D9FA 3QYFA 1SRQA 1UKBA 4CMHA 5FORA 2NSLA 3M9XA 3H2SA 3QTLA 3LLMA 3FFAA 1DIOB 4IDAA 3TLEA 4E1BA 2XJ9A 1V1RA 4LSMA 1ENOA 2HDNB 1LDBA 2L0XA 4CEHB 4ZK6A 1Q0RA 1CUUA 2FGKA 3DNMA 1O0BA 1GTJ1 2VNAA 1R0SA 1Q0UA 4QDUA 2J4FA 1S8OA 2VEDA 2QLLA 3QKIA 5AW8A 3W78A 3TTVA 4WN9A 4HNUA 4KHZA 3FFWA 5JJLA 4TTSA 2GI4A 4P22A 3F5MA 1HNNA 1T1RA 2VS1A 3R3JA 3L8HA 4QE3A 4V0ME 5EI5A 3LXMA 5A04A 3NP9A 3H05A 5IUNC 1IUKA 4HGPA 1BFKA 1WSWA 5CW2A 1E60A 5DTIA 1N0VC 1FXUA 5AKEA 3GGJA 4OAQA 1LPMA 4BV8A 2BPOA 3EVFA 5C81A 1A7JA 1EA5A 1IOVA 4RGBA 1R9MA 3CX7A 1QH8A 4HH0A 3C3WA 3RWBA 3ZXSA 3JQGB 4ESEA 2CNBA 2VDWA 2F9LA 3IERA 4M9SA 4DCCA 2W6NA 4G8CA 1NG9A 5AK3A 4GPEA 3KV1A 3DYBA 3E05A 1J97A 4DJ5X 3RR2A 3B52X 3KJEA 4YCCA 4XIFA 1GN8A 4BKUA 4RZUA 3HA7A 1V1MB 1B6RA 1II9A 3AYXB 3HL4A 5LDGA 2IPAB 3C3JA 3TQQA 4HLNA 3HPQA 4E12A 1SCQA 3CONA 2AQIA 2POCA 2SBTA 2WF7A 3IAAA 4AJEA 1RWBA 3DM9B 5LLTA 1EVJA 3DHYA 4FJ1A 2X23A 4K1LA 2BV3A 1QJCA 3DKIA 2NPIA 3S27A 2LCQA 1C2TA 3EWNA 1RRPA 1GA6A 2OFXA 2Q3CA 3C3EA 3C1OA 3L7AA 1WTCA 3MZ0A 4QNNA 5JAQA 3RVKA 1ML4A 1DBSA 1E9SA 2JZOA 3HLKA 5D3MB 1WTAA 3I04A 4HHEA 2HF9A 4BKOA 2JK0A 3IQXA 3M9WA 3G9QA 3ZQ4A 1QK4A 2HGSA 5KJCA 4FFPA 4P82A 5CU7A 3IRVA 4PO3X 5TMBA 3RBVA 1QANA 4TRMA 1YS6A 4QVKA 4XFDA 4DC9A 3KXLA 5DI3A 3OAAD 5IBPA 3Q0IA 4MR8A 3RIYA 1GUFA 2H5IA 2IP4A 1MW9X 3F5DA 5IABA 4L16A 3R8CA 1H23A 3D4OA 1DG3A 1X13A 3PTZA 3MRSA 2I9PA 5TQVA 1DZIA 3TD2A 4TROA 1C1XB 1O94C 3H0KA 4L1KA 2VDUE 3QSYA 1E3JA 1JDSA 1C3OB 1N57A 4OHXA 5ESDA 4DQ0A 1T0IA 3ORQA 3PKIA 1IEVA 2H07A 1YBVA 4LFAB 3M6VA 2WNSA 2OK7A 2WJPA 1NJ8A 4FIDA 1LTKA 1XRSB 3N2KB 3PFFA 3HK2A 4XZ3A 5T8KA 5A9SB 3LBAA 1IZ8A 3IV6A 4CN8A 5IKEA 2VYFA 3NX4A 4RLQA 5FOUA 4GI5A 1OH5A 1D4AA 2OGWA 2LBPA 3PRJA 2ZE8A 1XQYA 2AEEA 1WR8A 2WOOA 3UGKA 1M5TA 3HJNA 1F2DA 2QN6A 1I6WA 4LF6B 1Z88A 2WC1A 3DOJA 1PFYA 1KBZA 4UUBA 2YFKA 4GZMA 2C2HA 4G4JA 1ZAYA 1AN9A 1PR2A 1VJDA 3G5LA 4NCIA 4RACA 3IUQA 1XT6A 3H7AA 3TZBA 1RMQA 1S3SA 1ZVQA 4NH0A 3K1JA 1LFAA 1GM5A 3T3OA 2OXEA 2YHIA 3ZHXA 4M1EA 3QXSA 2AOUA 2ZBDA 3B1FA 3DWEX 2DXIA 1G9XA 3RVBA 2I8LA 3ANMA 4OAPA 4CKXA 4DV1B 2HU7A 3O4FA 4DTIA 4RTSA 1H6BA 2AHOA 1C50A 1L9KA 1AB6A 1KU0A 3V6LA 1L7PA 2EYQA 1U3UA 1J0BA 2QRUA 4LK3A 5AXBA 3WQRA 5M34A 2W58A 4FB5A 2XQKA 4FSXA 3RS2A 3WGIA 4M1OA 4EEXA 1TTPB 1HDGO 2GB4A 4NJEB 3A3OA 4JKOA 4B79A 5IAAA 4NWIA 2OY0A 3K70B 4E6PA 3WWCA 4EB6A 5IT0A 4J0QA 5KQRA 1Z75A 3UJ8A 5FBKA 1UPAA 3K9CA 4Z86A 2BT4A 3TBFA 5FPYA 1C14A 4I4CA 3WWOA 1YKSA 4MPRA 3ZQ6A 5JYBA 1OFVA 1RM5A 2VDKB 1WY5A 4EUKA 2WSBA 1U8UA 3KKQA 1ESCA 4AZ0B 1NXQA 3NWEA 4PYJA 1GPMA 5B6PA 1K89A 1LX6A 4TUYA 2ONCA 2VH5R 1CEQA 1GA4A 3TDKA 5H83A 2C9YA 2H4WA 2ZDHA 3D2LA 3MK31 1G21A 1ATZA 1PJLA 3P0FA 2QS9A 2PXCA 2WSLA 5LYYA 4BO1A 3K05A 3UWSA 2GZHA 5BORA 5KTTA 5CURA 1PCXA 4J0DA 1GG8A 1VCMA 4KL8S 1QMGA 2OLKA 1FY2A 2EXXA 2OLEA 3FPCA 3PHBE 5KCMA 2UDPA 3DYIA 4KFCA 4FNGA 2NW6A 3RUHA 1N2BA 1K8XB 2ZSHA 1R37A 2IOHA 4ZC8A 3EVNA 4K9SA 1E4YA 1KI3A 3E2IA 4B7UA 4DVJA 3CVJA 2YVAA 3LOUA 4RBNA 3ZWYA 5IDWA 2DMRA 2CV0A 2M6SA 2EFYA 1J90A 2JHAA 4C9BA 2J3DA 3ICCA 5EIFA 5EKUA 1ISMA 4J1NA 5JROA 1AS3A 1FFBA 1W4ZA 4J2OA 5DFAA 5JNSA 4ES6A 4KXVA 1JFLA 3A8TA 4ODIA 2N46A 3ZWPA 2NYVA 4EZIA 3GVXA 3B3QA 3I23A 1QHHB 4HQRA 2C4NA 4L0DA 1C80A 3E9NA 2G1PA 3R4CA 4U2DA 3THYA 3P0JA 2HOQA 1QCDA 1RKVA 2RSLA 1G7SA 4FHFA 4IKPA 2HRBA 4Q9LA 2B6NA 1KWGA 2BTOA 2LDXA 4Y2VA 4ZKEA 5HQ3B 3L8EA 4FE7A 1OIVA 1D4FA 3EDOA 3FX2A 1XU4A 3JQ8A 5FR1A 5KHLB 2ACWA 3K4QA 1GKKA 2C9ZA 1T2DA 1KPHA 2HQRA 2Q5FA 4RDHA 2JIDA 3AJ8A 3JRWA 4DADA 4L9WA 3WIDA 4ABYA 1E8NA 1Z4OA 3PHCA 1UANA 1MTOA 1QE5A 2BBWA 2LWIA 2R1VA 3H5NA 2VP2A 4HDOB 4UBOA 3RJTA 4BWVA 1SIUA 3EQ6A 2OL4A 2I4MA 1MRNA 3UJ3X 5FWDA 1GARA 3H8JA 1EX7A 2TMYA 3N8NA 2HK6A 3DOCA 3PWKA 3RS8A 2DFPA 1M0SA 2XI4A 3KYBA 2EJTA 4G0ZA 2Y6VA 3AJAA 3K5HA 4HH3C 4PZLA 4TKLA 3DDWA 3RUCA 1ZK0A 5EUQB 4UE2A 1UPTA 2PUHA 2QEQA 3L7OA 1UOOA 1PFQA 4FKMA 3LX4A 1A82A 1MT3A 1PHPA 3ECCA 3G5TA 1SXJA 1ZK1A 3JATB 4GSYA 1N6HA 5A0FA 2J0UA 1S96A 3WLOA 3GR6A 4UHBA 2DPXA 3P96A 1MQ9A 3QEOA 1ZGBA 4UEOA 3DDHA 4B33A 5ICSA 3HC7A 3GLIB 1F0KA 3DD1A 3ZD8A 3ZWMA 5AUNB 3EK2A 5FNVA 4UBIA 1JVNA 1A5AB 2IYRA 1EVZA 2C7OA 2B8JA 3I2FA 4BBJA 5LU8A 3OJXA 5CH5A 1A27A 2BFBA 3LRPA 4PFJA 1JHAA 3IT3A 1JXQA 1ZEJA 2GZRA 1ULZA 1XTJA 2C7GA 2KJQA 4X64B 1T5SA 3BMCB 5FH9A 1IVNA 3EN0A 4LK2A 1WUYA 4DLXA 4JC4A 2PZGA 3WTCA 3AEKB 5SYMA 1M2EA 4DIOA 1R8YA 1N9KA 1VHLA 5TDHA 4XM0A 1MO2A 1JLLA 4NENA 1XTQA 3WNQA 3S2EA 4ZPJA 4YREA 1FNMA 2OENG 1SWWA 3DONA 1M8PA 2J9YB 1ZM3A 1X1BA 2HDOA 2ZBEA 2F9FA 3C48A 4ZRDA 2VEOA 2W4MA 3T1QA 1P8AA 1J6UA 1QHXA 1T5IA 4KG7A 1CY2A 3LGAA 1CULC 3GCXA 4OJMX 5DN6A 2HBYA 1EI9A 5TS2A 1P4JA 5LOVF 1I5EA 1JLSA 2VK2A 4H7DA 4AS1A 4R3WA 4NJOA 2V0CA 3M1YA 2OCPA 4TL9A 5EEGA 3DMNA 4K03A 1JDZA 2JKZA 4OF4A 4OU5A 3VPDA 3WYFA 4EGQA 3MLAA 5KQLA 2XWPA 4EHNA 4EVSA 1DX4A 1BA2A 1L7EA 3BJIC 4GMKA 4S0XA 1LPBB 3PUHA 2DH6A 3KLNA 1EUCA 4NBWA 5ALHA 1VLQA 1Q1QA 1PDOA 4BVEA 2C94A 1ZL2A 2Q21A 4OOEA 2QVYX 4CUJA 2OORC 3SC2B 4JITA 1IHDA 1MPTA 5I8WA 5I9LA 1THZA 2C77A 4CW7A 2XRYA 2BKEA 3DMPA 3GCZA 4L76A 1SCBA 1VKJA 5E4YA 4KPFC 4P35A 3WI7A 5JBIA 1SG6A 1MDFA 2GEKA 2X9QA 1V5FA 4FB4A 5IYZA 1Z8DA 2BGMA 1E2EA 1H0SA 4K3VA 5TPWB 4Y2PA 5ETJA 4JQZA 2HJSA 4UREA 4C30A 3NVDA 4RFVA 4RJ2A 5TARA 5EJMA 3O31A 5K09A 3TE7A 3R6LA 2GCIA 2ACVA 4V1CB 4JC0A 1X0VA 3CLRC 1CZLA 1JTVA 1A1SA 1NE7A 1OWPA 1PT8A 2WJGA 4H1HA 4HGNA 1F0YA 2WPDA 3B8HA 1LX7A 2Q1TA 1PO7A 4BP8A 3MS2A 5AVUA 3BWMA 4RD3A 1L5GB 3BX1A 4KU4A 2HL6A 1HNWB 4ZO4A 4IJWA 3EXFA 3D8UA 2HK8A 1KSJA 4LZOA 5GZ1A 1NMYA 1I1QB 3MJSA 1FU4A 4TSRA 4H35A 2Q6TA 3TW6A 5JCXA 2RH9B 2ZUVA 3ETEA 1JFTA 1FVOA 1YNOA 4FGJA 1FVXA 3V00A 5CA0F 3FR8A 5CA1F 4YCLA 1SR8A 4XRRA 3T5AA 2IUEA 3RG8A 3O5AA 4WRRA 4AD8A 5A6SB 2I99A 4A92A 1QCYA 3ETCA 3Q3GE 3QVJA 1HDOA 2H5JA 2ZSJA 4X6LA 2PLNA 1LW6E 3LZDA 2BGRA 4I4TF 2OCIA 2ZOSA 3DBHB 3U37A 3A1VA 4CM4A 1VSVA 3VU8A 4BBAA 3N2YA 1O4WA 2JAWA 4HWRA 1FMTA 3I92A 1DKMA 4QYIB 5IU6A 5K99A 3K0HA 5IZCA 1M67A 5JFGA 3U39A 3T5GA 2MINB 3LX8A 2HWKA 1BH6A 1DADA 4O2BF 1X1EA 1X92A 1Y8QB 1E2HA 2J48A 3B2NA 3DKPA 3DHWC 1LXCA 1IG0A 1RFLA 3NC0C 3L8DA 3T9EA 2CFSA 3QXHA 1R8XA 5FV4A 3W1WA 5I9NA 4H0FA 4K6OA 4EO7A 4MMYB 1G3RA 1R0YA 1T9GR 1RI3A 4JDUA 4YJ3A 3PUZA 2EWMA 4C0XA 2DJIA 2V7EA 4HVTA 3C5CA 3W2EA 5CVTA 1A97A 5K6AC 2C3OA 4GKVA 4NH4A 2DBZA 4BATA 5FPKA 1MX3A 4BFLA 1PX2A 3FTDA 1N6OA 3JWPA 3KR0A 4NK4A 4O2LA 4DAOA 3FJOA 3TSZA 5KTSA 2VTDA 2AFIE 4OM7A 1KEVA 4JI2B 3SFVA 2OILA 1U7WA 3K3PA 3GMSA 4CWAA 2WTUA 3QVLA 4Y2UA 1OLOA 3IR5A 1Z6YA 3V8QA 2EKBA 2PANA 2FUEA 3WRXA 2O9JA 5KB3A 2HUPA 4E7OA 3JWJA 2ZXEA 1V5GA 3VUEA 1XMSA 2JFYA 1P9LA 2Q8PA 3LT2A 5J3JA 4B80A 3GO4A 1ETHA 3O91A 1SPBS 3PFIA 4K9QA 2KS6A 4PFKA 4ZEVA 4EY3A 4WGFA 1FLVA 2OP0A 1AQLA 4WUTA 3G6WA 3U4IA 2Q3FA 4V0SA 3GJ5A 1WMEA 5KNBH 5H80A 3ZTYA 2YFQA 1DINA 2X2OA 1MABA 3IVXA 4XRGA 1B2LA 1YQWA 3LUPA 2GEJA 3OD5A 2GZ1A 1P1BA 5MDHA 1R0KA 4P58A 1E3SA 1IM2A 2HPZA 3A1CA 4RTLA 2EP7A 8ADHA 1HSOA 3Q3JB 1CUIA 1F8UA 4N01A 4RJKA 3WYDA 5CEFA 1JN0A 1R15A 2QLBA 3NDIA 3QU9A 1IMJA 2VJQA 4BZXA 2HRRA 2ODEA 1GEGA 2WJAA 5DGHA 1WB5A 1CUGA 1V7PC 2OHXA 5FYQA 3DO8A 3EAQA 1MJNA 2EBUA 3EFOB 3NHFA 2KLBA 1FFEA 2Q0XA 3A31A 3IDSA 3H6GA 4QBKA 1G6KA 1GGFA 3EQ2A 5I9TA 2ZYIA 4UCXA 3H5AA 4EI7A 1ZU4A 4KSBA 1YQDA 3COVA 2N3ZA 4E11A 4WCFB 2HC9A 1P1HA 2O5EA 2HZBA 2XUKA 3ESYA 1FFAA 5LP1A 2GHTA 4K6CA 5ALWA 1DAOA 1H8EA 2X2EA 4KLZA 4TYPA 2MMGA 2XMDA 2XMCA 5LYJA 3X43A 2C9OA 4N0DA 3C45A 2A30A 5IM4A 2DTEA 4P4SB 4TTRA 3T7RA 2OPHA 4BP1A 3GUYA 3SHFA 1HOXA 5J2UB 1SXIA 2KMLA 1A0OA 3JS5A 1UODA 1XZMA 4CKZA 4REMA 2XMPA 1JV2B 2HNKA 2CZGA 4P7BA 5BYJA 4LISA 1ML3A 4CRWB 4NS1A 2PKQP 2Y2UA 3FWHA 2W6ZA 3DZCA 5JMTA 3UMMA 3ROEA 3KDAA 3MSCA 4TGLA 1KSGA 4C14A 2QMOA 1RXVA 3IDAA 4FLMA 3ND9A 5AFSA 2W70A 4C0HA 4H7KA 4XD7D 2GF9A 4E4RA 3O92A 5LZ9A 1LI7A 4WJLA 1HMPA 5FKJA 1K1EA 3IDQA 3G0HA 2LIPA 4LTMA 2VK4A 4UNPA 1L7BA 2PV7A 2QWXA 4WXPA 1A76A 1WA5A 2FLWA 3E3OA 4ZHQF 1KJ9A 4KZPA 2XUIA 3BBLA 1CRLA 2Q1WA 4TXNA 5G0SA 1VIYA 3VC2A 1E3MA 3HU3A 4O08A 1L3IA 2CLLB 2H65A 4X0EA 4YRPA 3UKDA 1QZUA 1BN6A 5IDYA 1UC9A 3SEAA 3ZBQA 3RT7A 3MRXA 4KWCA 4DCJA 2PVCA 4QUIA 3OFND 2AFVA 3FZEA 1SC6A 3FBWA 2EQBA 3KOOA 3P2IA 2XH8A 2Y93A 1IZYA 2AF4C 3V42A 3RBXA 1Z73A 3GJ4A 1DFIA 2V58A 1SCAA 2R85A 3I53A 3D1VA 1E9AA 3FOBA 3KJZA 4OHZA 4TS9A 3IUEA 4OUDA 2RHOA 5CYGA 4K9KA 1N2JA 4XCQA 4PZDA 1ISRA 3QHPA 1UMCB 1EK2A 4CTKA 2G7MC 4QD3A 3R5KA 3W8FA 4URXR 2AJTA 1CQXA 1E92A 1OLXA 1VOTA 3NHMA 5IZ4A 4J0CA 1QYRA 1UWCA 1VLLA 5D6NA 4C0AC 2IXEA 1FS4A 2REBA 2C29D 3MT8A 4RVCA 1WE2A 4X7MA 1ZOIA 2QTWB 4J2TA 4PS1A 1TO6A 1DIGA 1PNQA 1R5JA 2GCOB 1RI5A 1ZD3A 2XWSA 3E70C 3HR8A 4UVHA 2BEVA 4WI1A 1Y42X 3KYIB 1TT7A 3KKNA 3B7GA 4E1AA 4DDTA 2O14A 5FLKA 1KOGA 3WGHA 4OLAA 2ZJYA 2W8BB 2XCTB 2Q9CA 1T5OA 3OJOA 2R8ZA 1N1MA 2B4TO 2FFRA 4G1VA 4UCQA 2CKDA 4FC6A 1O6CA 4FLFA 3SJBA 3WMXA 1TMKA 3BD9A 3R3HA 5JAPA 2VQEB 1MC8A 1WCWA 2WUEA 3KYDB 4HJRA 4C43A 2MSNA 1Z0JA 3L8YA 4P53A 1M34B 1P61B 1RLTA 4GUDA 3LI2A 1WBBA 1OTYA 3CLTC 3DOUA 4NZZA 1SVWA 4W8OA 1M1YB 1BRMA 4QLBA 2IHTA 4RTJA 4O2AF 4EPVA 2HMWA 4L7QA 3UWDA 1L7NA 2H17A 1WABA 4OQMA 2PIAA 5AICA 4XJVA 2YJGA 3WLHA 2P3QA 1ZIXA 2YCBA 3UBTA 1AK2A 1N5IA 3UWOA 1CJMA 4HAVA 4OU4A 1GSHA 3ON5A 5HKKA 3FWZA 1AS2A 2WNIA 4U8GA 3DZHA 4FYPA 4HDKA 4M99A 1JA0A 1IIBA 4IGAA 3AUFA 3H1AA 3MD0A 4AXXA 1DT5A 5FOWA 2JIBA 2VBIA 2Y27A 1CQIB 1VM6A 2WDZA 3QIAA 4PHFA 1DOHA 1RACA 3T9DA 1T6XA 3GEPA 1R12A 1VE9A 1A2QA 3NQ41 1DEAA 1OYWA 4UVGA 1NJ2A 2FSFA 2VJBA 4HZUA 1O6BA 5KX5F 4W1SA 1V8OA 5BT9A 2D54A 1Q2XA 2GEBA 3MTBA 1Y1LA 4L15A 2X19A 4EY7A 3IBSA 3LUJA 1U6KA 4KXNA 3I4LA 2W48A 3RSHA 1NN1A 5B12A 1X7WA 1XYYA 4FYHA 4RYLA 2AOVA 5AJWA 3HBMA 5FX2A 1FRFS 3N2GB 1KO8A 4B6GA 1SB9A 1SXPA 2Z9CA 4LJ9A 5AK5A 5E7MA 5REQA 1OI2A 2DY1A 4HPXB 4DDVA 4XGKA 2B9VA 2CMKA 4B4KA 1U2EA 5BMVB 1GL3A 2JHFA 3VZQA 3NPMA 4FGWA 5I3CA 2I6SA 3HKCB 4ONEA 3OM0A 1D4ZA 1SZJG 5ANRB 3V7FA 1P6QA 3FBTA 1Z2CA 3HI6A 2IU0A 3R7LA 4YCJA 4Y1GA 1DE0A 1S7CA 2A9JA 4JGBA 4GD3Q 2PIDA 4Q7QA 2ICAA 1BROA 3CZ5A 4A6XA 4DW8A 3LE8A 4ZVTA 4EW2A 3SC4A 1D04A 1Z6TA 2OO5A 3MFYA 4IX1A 4UBNA 3O2SB 4EO4A 1KOLA 2WVAA 2QTTA 3H9BA 4DWJA 1I6KA 3KK0A 4EA6A 5E8RA 1CX9B 4WXYB 3BIOA 2DCUA 3UKJA 4LF4B 3DCJA 5B2FA 5T5QA 4QREA 4Z4EA 3WDSA 4TLBA 4B6FA 4WNYA 1ZWKA 4IXMA 4C7OA 1N4DA 1QYXA 4B0OA 2YV2A 5ECWA 4KNWA 4LZLA 3HNRA 3U09A 3C7KA 4KCGA 3LQ2A 5AKGA 1VIVA 1MFPA 1XEWY 1VBFA 4PPYA 3EIHA 1E5VA 3IUBA 5H8WA 2J6HA 1J8FA 1MT0A 1ZLXA 1IYZA 3BCSA 1ABFA 2FZKA 5C5DA 2JH9A 4R9UC 4PZYA 1EFHA 3TAUA 3FCXA 1UJ5A 3KZVA 3MT9A 4TZTA 4HXGA 4J29A 3BSFA 4X85A 1GL9B 1KYTA 2QRKA 3AR6A 1QGED 3DR3A 1P75A 5KYXB 2W37A 2X15A 3TLBA 3VHLB 3N2EA 1QO9A 1IY0A 2X1VA 1XJCA 3NWBA 3UEOA 4EB0A 4EG3A 3DL7A 4V0KA 3T6KA 3TIIA 1KVQA 2ZWMA 3DO6A 3NCHA 4TV8F 4BNDB 2J7PA 4DQLA 2O8BB 2JCSA 1Y3AA 1YS4A 4RDXA 3AESB 2L2QA 2B94A 4MQUA 3RRNA 4I46A 3Q8LA 1C3EA 2PX0A 1RWOA 2A1UB 2IIVA 4HQ0A 4JD5A 1XJ5A 4LHSA 3SKYA 2EU8A 3GNLA 1I4OA 1YRHA 2X6QA 3E7WA 3AR8A 4P3OA 4JX8A 1X15A 2NGRA 3GN2A 2EZ8A 3NC1C 1UMDB 5CLQA 4YXFA 4W5QA 3N5CA 3JSXA 4OO3A 1G42A 4XJTA 3FBGA 4DLWA 1DHTA 4D92A 1V2GA 1FUIA 4PZAA 2RKOA 4BBPA 3DMHA 4DG5A 5B4VA 3IXMA 3X1XA 1T2CA 3R24A 2BDEA 2XSZA 4BC1A 3TRJA 5L3VA 4HNVA 4JLOA 5EIAA 4EWLA 1ZC4A 3MCZA 1TLFA 3ZZNA 1A9YA 5C46F 2MTBA 2GX6A 3KRTA 2JJMA 4MQEB 3TF5A 3M34A 2IL1A 3RS4A 3K9NA 3L6BA 4Z0HO 1O87A 1XX6A 1DBIA 4ZO9A 4C2TA 2FN8A 3RTAA 1J5EB 2XYVA 4X8OA 3OTWA 5B57C 3K6RA 1OGIA 1EGAA 3LXRA 2AI1A 1RXUA 2Z9DA 3E2PA 5LZ5A 4UBMA 1VGRA 3MBOA 3R77A 3PDUA 3TNYA 4MR9A 3B53X 3QHQA 4A8JC 4CEHA 3B38A 1E2UA 1H2EA 1VL0A 3HJHA 3I5AA 1WDWB 3JVUA 5FOSA 3I61A 1AH2A 4YDSA 4JBLA 4XYMA 3TCNA 5LLSA 2C4MA 1E1RA 3G9ZA 3MTIA 3T94A 4OK3A 4MWTA 2WSYB 3B85A 4Q9JA 2ZYUX 3D54D 3I64A 3EHDA 4DKXA 6GPBA 5DHAA 4MV6A 4XJSA 3V1YA 4CMCA 1ZMXA 2EJCA 5BNZA 3NIWA 3U7GA 1M1NB 3H3JA 4FU0A 3OIUA 5LQDA 4CT5A 3SJCA 2O3JA 1U3DA 3CRNA 3D4BA 4QHTA 4F45A 5CFZA 1MNQA 4Y1FA 3B70A 1NVMB 3CF4G 1THMA 3NIGB 4JI3B 3S29A 3ZHZA 2HSEA 4FYJA 4EK9A 1JKJB 1MW8X 3JQGA 2R5FA 2VYVA 2XLCA 1ITZA 4X65B 4UNSA 4LOLA 5HIJA 3ANXA 2GNAA 3BHNA 1YQQA 1EXMA 4RVHA 3E8SA 3ZI0A 3MHPA 3WB1A 1ZIYA 3OOHA 2O06A 3V7YA 5ADWA 3MVEA 9ABPA 5KSZA 3SDSA 3KE8A 1ZH2A 3W6PA 4YH1A 1A8UA 3GAAA 5JFOA 1F48A 1KI7A 4INAA 5AHRA 5IUJC 2Q50A 3DWGA 1D1QA 2HSWA 1DDIA 5HM8A 3KDSE 1LW7A 1RJWA 2NXEA 1UJ4A 2DWPA 1CP2A 2XUAA 2PUFA 3BXEA 3EH2A 3I39X 4PRZA 5I9BA 2WT9A 4EL0A 4LNHA 3OFJA 2PGXA 1UBJS 1XJQA 2O8NA 1F12A 3IAFA 3P9NA 4G25A 5A71A 3L6CA 2CEAA 5C8DA 5D3MA 1T1SA 3LC0A 4BFUA 4GPBA 2Z2JA 3GEDA 4RENA 3N0WA 4CVNA 5IKXA 3BWXA 1T5HX 3MWFA 4IUDS 3DLHA 4Z9FA 3WIOA 3A14A 1G1MA 4DKJA 1Z7GA 4XH9B 2GPNA 2IEZA 1M6VB 3EA4A 4Y2YA 4I8IA 1ADBA 2YNMD 4R1UA 3OQ1A 1E6KA 2D13A 3JCZA 2V7QA 3AL2A 1FNSA 3T35A 2NU7B 5HK8A 1GU0A 3ABQB 1DQRA 1WZNA 4Z4CA 1C3OA 2QVGA 3P52A 4LQCA 1KIFA 4N40A 2RHTA 1BA3A 1T3TA 4D8VA 2JFHA 4UM7A 5ITZA 2I4OA 2JH3A 3N2KA 3CVXA 4G5HA 4LRSB 2PG3A 3PHIA 4YJ2B 4AS2A 5A9SA 3ETHA 3DS8A 5HGXA 5CYPA 1AX9A 2HFJA 5SZHB 3RFUA 3RYIB 4Z8XA 1MQAA 3ESDA 3HPRA 4G63A 1SZPA 3G7UA 1YWGO 3R6GA 1UXJA 4NF2A 5ECYA 4WFQA 4MV0A 3M3DA 1TVKA 2J0QA 2ZTSA 1ND6A 2B61A 4G56A 3UTCA 4Z0NA 3SVTA 1VHJA 2YMQA 3FOWA 4F71A 1PIWA 2J87A 3FUXA 4MUIA 4NEGA 1VBMA 3IC5A 2F3PA 4R1OA 4GOJA 3VOAA 2A84A 2VPPA 4J75A 4AL4A 1OXKB 1TUGA 2FPGB 5FL3A 1E89A 4YP0A 221PA 1A8IA 4RD6A