4OK6A

Crystal structure of hepatitis c virus ns3 helicase inhibitor co-complex with compound 13 [[1-(2-methoxy-5-nitrobenzyl)-1h-indol-3-yl]acetic acid]
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
445
structure length
430
Chain Sequence
b'TDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLINAVAYYRGLDVSVDVVVVSTDALMFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease NS3
molecule tags Hydrolase/hydrolase inhibitor
source organism Hepatitis c virus
publication title Integrated strategies for identifying leads that target the NS3 helicase of the hepatitis C virus.
pubmed doi rcsb
total genus 141
structure length 430
sequence length 445
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4ok6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok6A01
2YOHA 4ZDKA 4NCNA 4XTRA 1UPTA 1OFUX 3A4NA 3KTAB 1ZYUA 2BMDA 1BYIA 4QJ5A 1KI7A 3Q9LA 1ONBA 4MRVA 2GCOA 1OB2A 3IQWA 1J90A 1S8FA 2IYWA 3Q8XB 4TL7A 2OT3B 4LJ5A 4Z1MA 2QQ0A 2A7QA 2NGRA 2XNSA 2GXSA 1OXTA 2IUTA 1P62B 2OLJA 3EZFA 2JCSA 2WMOB 4NMMA 2RGBA 2BMJA 3ZQ6A 3LH5A 1QG4A 3C5CA 3PUYA 4NCHA 5KSPA 1A4RA 5SZIA 1OH6A 2ZVQX 3G82C 3PENA 2F9MA 1ZM4A 4RD1A 4DUGD 1YE8A 2HXYA 1E2HA 3OIWA 4TT3A 2W6JA 1N5IA 4HAUA 4M1OA 1Z6XA 2E9SA 3DOFA 2F3RA 2JATA 2VSXA 4UXIA 2YC2C 4E09A 5KSYA 1T5LA 2DWOA 4PHFA 1YZLA 1G3RA 1GL7A 2YWFA 4FXPA 3IILA 1PUJA 1FW6A 1N6RA 5F3WB 1DE0A 3A58B 1KI1A 3N5CA 1PLLA 2JGNA 2GXAA 1NLFA 5AJYA 2MMCA 1WBBA 1DARA 4PTLA 4F38A 1KDPA 3GJ0A 4B74A 1UADA 1XMSA 2BCJQ 4IOJA 2C9YA 5HR5A 1HTWA 5EJEA 1KY2A 4LBZA 2IEZA 5AJVB 2I1QA 3R9WA 1U9IC 3C5HA 4PC7A 4PSKA 2OLKA 1S0UA 4O2LA 1KOFA 1NLZA 2XAUA 4FCWA 5L3SA 2KJQA 2JJ8A 1L8QA 4BRWA 5B30A 2O8EA 3PFIA 2A5DA 3TUIC 2RGDA 4R2HA 3O47A 4HLUC 3QKRB 3SFVA 2IBMA 2REOA 3DMDA 4B47A 5BN5A 3L0PA 4ZCMA 3HDTA 5CYOA 2OESA 2QY9A 5EP2A 1G1MA 1KYIA 2H8KA 2XSZD 4KAXA 1T91A 4PAOA 2QU8A 1FP6A 1CJKC 1SVSA 3B1YA 5AUQA 2H16A 4HLDA 4TWZA 2ZS9A 3TR0A 2P6UA 2PEZA 2FSIA 1HURA 1R8SA 1W7AA 2WAYA 621PA 3RRYA 2O8BB 3AF4A 4BLTA 3QKRA 2ZRMA 3QXJA 2JLQA 3Q3JB 2C9CA 1KZ7B 4I1VA 4PC1A 4UNPA 4URZR 2B8TA 5HE9A 4URXR 1DBSA 5HTKA 5KOYA 3CF0A 1IXRC 2ZRPA 4HDOB 5KNCA 3NIBA 3RRNA 2VP9A 2R6FA 3F8TA 1ZAKA 1R0WA 3D3QA 1K6MA 4QBGB 1GNPA 5F9FA 1WA5A 3H86A 4Q4AA 2BEKA 2V55B 3TQFA 4GRAA 6Q21A 1N6LA 1XEXA 5JMTA 1GRNA 3PUVA 4RCYA 2GJ9A 3T35A 4C4PA 2FPLA 1XPUA 1Z07A 4Z51A 4Q5IA 1DOAA 1L4UA 2H57A 3P4YA 1CRQA 5FOTA 2F1HA 4ASUD 4OK5A 1IAQA 4NPHA 2WPDD 4HDQB 4RFVA 1CJMA 1VECA 3GLHE 5BYJA 5BXQC 1S3SA 3BORA 3EA5A 3MAAC 3QQ5A 3QPVA 4B43A 4YXWD 1NG9A 2J46A 1NVVQ 3TBKA 1BMFA 3TSZA 2JJ1D 2FPKA 5HCIA 1E2KA 2VLIA 4FCVA 3GLIA 2WWWA 2YKGA 3L8ZA 4UKDA 4CIDA 1WXQA 2CJWA 3NBZC 1AKEA 3HPQA 5C1BA 3D8BA 4NH0A 1N5KA 4OHZA 1OYWA 1TADA 2WBLC 1NIPA 4FWIB 2O0JA 2P6RA 4TTRA 3TKLA 4OJQA 1FOEB 3FVQA 4OYHA 1N5LA 4QHYA 4M21A 4LOAA 1LTQA 3CM0A 3CWZA 3PV0A 2O8FA 1ZRHA 4LJ7A 4KU4A 2FEMA 1V43A 3W34A 4PAQA 1YR6A 3AEZA 1SVOA 2C96A 3K9HA 1EX6A 4WW0A 3IEVA 5C46F 1QHHA 4M1TA 3THWB 4HLCA 3KQHA 5KDOA 1MO3A 1NMXA 2EYQA 4TSFD 1CIPA 3Q85A 1VCNA 4CRWB 2NO6A 3GCGA 2OG2A 2A3RA 1KHTA 4RFSB 1N5JA 2ZE8A 2X8AA 3OFND 1D9XA 2RGNA 4N0DA 3UMFA 1XJ0A 4TQ9A 4AK9A 5JECA 1VKJA 2OCBA 1JXOA 1OH8A 1CR0A 4WBSA 3R7WA 4CF7A 2BOVA 5B58C 4EPXA 4DB2A 2GCPA 5HZKA 2O52A 1EWQA 1XF9A 1X8KA 4TYPA 3TW8B 1YHNA 2H92A 4TYQA 2RGAA 1XXHB 4TLDA 2BKUA 2E87A 3BIFA 4D0NA 4D4JA 3VR1A 1FX0B 4D6PA 2FX3A 3QKSB 3SBDA 1FNNA 3GLIB 1KSFX 1OFTA 1WB9A 1X8JA 1Z08A 2YHSA 3HU2A 1W4RA 2CLDX 1XX6A 4DCTA 3WXMA 5FBRB 2MSCB 2CMKA 4LSGA 3EIEA 1ZD8A 1HT2E 5LDDC 5EUQB 2GXUA 1RYHA 3LWNA 2QGZA 4B73A 4BECA 1NSTA 2QP3A 5FTKA 1MRSA 2O5VA 1QHGA 4EQ6B 4IFEA 2FF7A 4F7WA 1E2DA 4IVPA 4HLQB 3AKDA 1JR3D 4DWJA 4A2QA 2QBYB 1G8PA 2BJVA 4V0OA 4NCJA 4Q19A 1LY1A 1H8ED 2GESA 1Z3IX 2BCGY 3LVRE 2NPFA 4LRWA 1RZ3A 1N25A 3DOEA 1N6HA 2FH5B 2ERYA 3AVQA 2WSSA 4LX0A 3L0IB 2OXRA 3OZXA 1XXHE 3CLVA 2JIZA 5FUXA 4CEJA 2QT0A 4F93B 4HI0E 3U5ZB 2QAGB 3ZVMA 1E9FA 5GJVC 4AKGA 2PH1A 4YDSA 3THYA 2GETA 2IS1A 5FOSA 2ZYUX 3BAFA 3OIYA 3W3ZB 5KUTA 2WWXA 5GVRA 4JBXA 3U44A 1KO5A 3RLFA 2IX3A 1E0AA 1IN5A 4POAA 1DELA 1A2KC 1KDOA 2RKOA 1RPZA 1EFUA 2QL6A 2EFHB 2J87A 3WP1B 1YU9A 1M1YE 3MG9A 3UATA 4DXAA 2G1JA 4JYCA 2ZUCA 1VYVA 2AD5A 2ZJYA 1N3BA 5FPSA 2QE7D 1NMYA 2R6AA 3Q7PA 3ZVRA 3ZQJA 1E2NA 1ZM9A 4MRRA 4M4SA 1TL7C 2RGNC 3R8FA 4C0KA 4A92A 5HPYB 1VG1A 3GFPA 3SYNA 2VHQA 3MJRA 5G40A 2PEYA 2ZM5A 1JJ7A 2VA8A 3E1SA 3OE7D 3FHOA 1TQ6A 1H8EA 4GOXA 1W0KA 2GJKA 3OE7A 4LPKA 4UXHA 3SJBA 3GJ3A 3VHLB 2KBEA 1E2PA 5GJBA 4XH9B 1OE0A 2F43A 1PLJA 4QL3A 1CBUA 4PO8A 3WMEA 4HEJA 4LYFA 1IBRA 4C7OB 1DO0A 3RVBA 1G8FA 2GEUA 4HSEA 1G7CA 3SU8A 3GLGE 2JLUA 3KB1A 4A15A 1GKUB 4W5JA 1E0JA 1BS1A 2HDNB 1HQCA 4NCIA 4DLTA 1IN7A 3QIAA 3RWMB 1MT0A 4JLMA 3RC3A 3REFA 2WJIA 1WE2A 3TLXA 3AP2A 3B78A 3WRXC 4OJKA 4RKFA 4CEHA 2DB3A 3BFVA 8OHMA 3RS0A 2AK3A 4LDJA 1A1VA 1P2UA 1FUUA 2C03A 4Q1AA 1U98A 3LXRA 3EPHA 2QROA 2XZPA 5JBQA 4R7ZA 4F91B 2FFHA 3A1WA 2FFBA 1GZSA 2P2LA 1OIVA 4JLOA 3HPRA 4WXPA 4V0LA 1SVLA 4JL8A 3SI7A 5KPJA 3R9XA 1XTQA 1F2UA 2Z4RA 3ADBA 2WSSD 1YRBA 3UPUA 1XDBA 3RRMA 1VG8A 3MWYW 1UAAA 3EC2A 3EG5A 2ZRCA 2B7BA 3GEHA 3AVOA 3VMFA 4TN1A 2QM7A 1D2EA 1G4UR 1PZNA 3RAPR 4U7DA 2NG1A 2AWNA 2XJ4A 1YR8A 1GL9B 2V4ZA 4PHTA 5FR2A 4AYXA 2G3YA 5J4LA 2JEOA 4JYBA 1WP9A 3PUZA 3GLFE 2OCYC 2WZQA 2D2FA 3K9LA 1DTSA 2FE4A 2WAXA 3NH6A 3ICEA 2Z5FA 2NPIA 3KUDA 4F4CA 3BBPA 1EX7A 1XEXB 1SVKA 4E03A 2QRZA 5DLQC 2Z83A 4EPTA 3A4MA 1ETUA 5JFGA 4V0MA 1PVOA 1HEIA 4DLUA 3OHMA 1G7SA 2GJAA 2DWQA 2AX4A 4LZZA 1T9HA 3BK7A 4RZ2A 3TMKA 4BLRA 4ESVA 2LCFA 4I1SA 1BOFA 1FTSA 4Q01A 3I32A 1OH7A 3GEIA 4YQFA 4MH0R 5FL7A 3L8YA 5CJPA 1XD2B 1E1QD 2QEQA 2ZQ5A 1ZM3A 3MCAA 1US8A 4LHWA 2J3EA 2ZJOA 3FWYA 5B57C 5JRJA 3IGFA 2OZEA 3EX7C 1X86B 1G5RA 1DVRA 2ONKA 4ZCLA 3SOPA 4HAZA 4A6PA 5A4JA 5JJKA 1DAFA 3LFUA 2YVUA 721PA 1LS1A 5TARA 3JVVA 1T3LA 4DLYA 1UBEA 1L7VC 3B85A 4JLDA 1NI3A 1NKSA 4OQMA 5CLLA 1TPZA 3AGPA 4PO9A 4ASUA 2CDNA 1KK0A 2J45A 3B9QA 1AKYA 4OI0A 1SXJD 1US8B 1K5DA 3NDPA 3GFOA 4IRUB 1LF0A 4NCKA 2ZITA 3AUXA 4R9UC 2XEXA 4DLXA 3QXHA 3LDAA 3K70C 4OQFA 1KI9A 5CJ2A 2MSEB 1NVVR 1GTVA 1KI8A 5LB4A 4BFWA 4TZ6A 4B75A 2YJTD 4TYYA 3QXSA 3NC1C 4YC7A 4GI7A 4ACBA 2IWRA 1OFIA 4BFYA 1W36C 3CF2A 4ZPXA 2N1BA 4JVLA 4G0NA 4HAYA 5IF9A 4M1SA 3TJZA 2FNAA 4YXWA 1NJGA 1L2TA 4IDOA 4RJLA 4BFZA 4DUGA 1GNRA 1GM5A 1KAGA 1P2TA 3SR0A 1W46A 4XD7D 3RNLA 1NBMD 1WRBA 4AYTA 2HT1A 1AIPA 5FTNA 1HY3A 1AS2A 3E5HA 4LBYA 3VR2A 4B6EA 1TF7A 1UF9A 4XTCS 1BKDR 3U4QB 4BQSA 5JWOA 2BBTA 4YMUA 3X1ZA 2OAP1 4HLUA 4YDHB 3R9IA 2O8FB 1VPLA 3UANA 2CK3A 1W4AA 1S3GA 5P21A 4D80A 4PQRA 1TMKA 2WV9A 4C2UA 2RHMA 1AK2A 3DMNA 3OESA 1AQYA 3ETLA 5C2JB 1R5OA 3EXAA 2Q3MA 1ZW6A 3OFNA 2FSGA 1G8GA 1X3SA 3SHFA 2WWIA 1T3SA 1KI6A 1MV5A 3GLFA 5FBQB 4BE7B 2XTNA 5G3YA 1PV4A 4DJTA 2G6BA 2WKQA 3D6TB 2J0QA 2PJZA 1YZNA 3FKQA 3SBEA 3EPKA 4KJZA 1UM8A 2FN4A 4NYIQ 2UVQA 2O8DB 3PQCA 2CHGA 2WM9B 3KZ1E 2IC5A 3PCRB 1U8ZA 4AI6A 2D4HA 4EJSA 5IHPA 1AA9A 2VP5A 3KDSE 3VNUA 1TX4B 3VAAA 4C9BA 1E99A 3BWDD 3NWJA 1JNYA 2HT6A 2L0XA 2R6DA 4ACAA 5J4HA 2IYZA 1J8MF 2VHJA 2IYSA 1SXJB 4M22A 5CB6A 4LGMA 1HV8A 1NN1A 3T61A 4U00A 2H1LA 1NL3A 4F4IA 3AVWA 1GITA 1T0HB 2IYLD 4WOPA 3VKHA 5JWRA 1XMJA 3MSXA 3B2EA 3NBXX 3HYRA 1D6JA 3OEEA 3SFZA 4P4UA 1VHLA 3LVQE 2ZXUA 5J4KA 1S1CA 1ZIPA 2JLZA 4DDWA 3LO5A 1U8AA 2ZI4A 4HAWA 821PA 2A5GA 5DHAA 3THOA 1JALA 4CZ2A 4US0R 4EIWA 4XWOA 4I4LA 4S35A 3CONA 3V00A 4QXAA 4RSGA 4E22A 4HAXA 1G3MA 4DEYA 2F3TA 1M6NA 1U81A 2I1VB 4BPBA 4PANA 1KKMA 1GOTA 1XFAA 1N0WA 3X1XA 3BJIC 2FMXA 4KYIB 4C3ZA 1TF2A 3JVUA 3C8UA 3DDCA 2G9NA 3BB4A 4A0FA 1TAGA 2PZGA 4GL2A 3DL0A 1BIFA 1MRNA 3TR5A 5H8WA 1W36B 3I8XA 2F6RA 1VG0B 4MDEA 2X77A 4GZMA 4RVCA 4JLAA 1SXJC 2VHTA 2NIPA 2NOAA 1J7KA 2IEYA 2W2VA 1NJFA 3IEUA 4WIAA 2REXB 3WHKA 1XMIA 1RJ9B 3BB1A 3QXCA 4M9XA 3LW7A 5JHHB 1Z0JA 4LHVA 1GNQA 3I61A 2CVFA 3FE2A 3P1JA 4KSBA 5DISB 5FPKA 4A0RA 1ESNA 1OXXK 5JEDA 5F9HA 3DM9B 2HJGA 2YWGA 3B1ZA 4QNRA 2CK3D 2ZJZA 1S1MA 2PZEA 5B64A 1N0VC 1P7CA 2VIIA 3I8SA 3LW8A 3LQQA 4GMDA 1YR9A 2ODNA 4Q4JA 1S96A 2QBYA 3ASYA 4D81A 3UG6A 3QSYA 3THYB 1CJUC 2DPXA 3P26A 3VNVA 1Q57A 2EFCB 2F43B 3X1YA 3ZD7A 4Z8XA 1IONA 1QHIA 4YMTA 3L43A 3K9NA 1QVAA 1KKLA 1E9SA 3X1WA 1DAMA 4L16A 1ZUNB 2H5EA 2N46A 2ZI5A 2O8DA 2CVHA 4HUTA 2VRWA 2N42A 3K8YA 3I4LA 1ESMA 1K8RA 3LY5A 4FIDA 4IDHA 5JLJA 4ZCIA 2IYVA 3A4LA 5KNBA 4J0QA 1KI2A 1KAOA 3VR4A 2GF0A 5DE3A 3MWJA 1RW4A 2ZU0C 4WAUA 4NYJR 1GVNB 4TL9A 4DZZA 5EP1A 1IN4A 1KSHA 3DEFA 2D62A 2ZRDA 4DBLC 1XU4A 4XVQA 3FDIA 1Q1QA 1ZD9A 2CNWD 1GFIA 4PHHA 2J9RA 3SNHA 4GSYA 5KTYA 1LFDB 3U3OA 3CX6A 1NRJB 5DN6D 5KSZA 1G6HA 2KI5A 4G5RA 4LJAA 1O3YA 2IYXA 2GEVA 1Z6AA 2GDJA 1E6CA 4LYJA 4AC9A 2WWHA 2IS4A 1RRFA 1SQ5A 1XTIA 4MYCA 5AUOB 2YZ2A 4WZ6A 2IS2A 4ITRC 5DI3B 1N6OA 5D3MA 1EXMA 4HYYA 4FI3C 4MYUA 3WBKA 3QKUA 3NBYC 5FOXA 3GLHB 3K0AB 3K53A 4MUBA 1E4VA 3KXKA 2AFHE 4FMCB 1XMVA 1YR7A 4OHYA 2YINC 2IUUA 2WPDA 4V03A 4BFUA 3B6EA 5JHGB 2C77A 1GP2A 1KI3A 4S2EA 1RYFA 4MKIA 4D26A 2ERXA 1WQ1R 2HJVA 3LBNA 1SKYE 2QTVB 5GJWC 2DFKB 3VU9A 1HUQA 2SHKA 1LB1B 4DDUA 4EPWA 1JEDA 1RJ9A 4GP7A 3FHTA 1J8YF 2AFIE 1E9DA 2XZOA 2W2TA 1TQDA 2ZSBA 4B32A 3P4XA 3F3YA 2GAOA 4OHWA 4PO1A 3NEYA 2CL0X 1P3JA 3W6OA 4DVGA 4PC6A 1QF9A 1S9DA 2F9LA 4GMXA 1XEWX 1G7RA 2GWHA 5EXPA 4PC3A 4H1UA 3BFXA 4B3XA 3S1AB 2WOOA 3K70D 2YWEA 3BE4A 3MGCA 3THXB 4PHGA 1AM4D 2RHDA 2BBWA 3K0CA 4Y0VA 2XJ9A 4JBWA 1H8HA 1WDTA 4QBFA 4V02A 4HB4A 4X8MA 4KSCA 1JI0A 5D3MB 5DHFA 4C0LA 3K0SA 1W36D 4KBFA 3VTKA 1B23P 1CF4A 2ZSDA 2EWVA 1E1RA 2R6GA 4WVFA 3ADDA 4Q4HA 2RMKA 4TMXA 1CKEA 4G5OA 3K1JA 4G5SA 2ZEJA 3TUJC 1O87A 3QBVA 1E96A 1S2MA 4LV6A 1ZJ6A 1TEXA 2ASEA 1OKKA 2J0VA 1I4TD 4OI2A 2EQBA 2LWIA 2IA5A 1Z0FA 3DO6A 2GZHA 3WY9A 4GDFA 2ZAMA 3WRYC 5C4GB 4Z54A 4QBIA 1JB1A 2G0TA 4W9MC 2W6IA 1E2QA 3LLMA 2WWGA 1GRQA 4M9QA 4Q9KA 2ATXA 5M04A 4BZXA 1NVWQ 3L0OA 4Q9HA 1G20E 2JLSA 2JLXA 2V54A 2JIZD 4M9SA 3ZS9A 1XJCA 5F98A 4M1YA 3AVTA 1KMHB 1G5TA 5FL7D 3W5IA 4U02A 1D5CA 2EVWX 1DPFA 1ZC4A 2GVDC 4QM6A 4GPTA 5DI9A 1EESA 1W5TA 3AKCA 5LB2A 2HYIC 5J5CA 2YV5A 1OH5A 2OFXA 5CITA 3EZ9A 4BFTA 1M7BA 2VPPA 3SYLA 1D9ZA 2WKRA 2V6JA 4PPFA 2QP4A 1HQYE 3FB4A 3BS4A 4P33A 1UDWA 3PUXA 4PSAA 4C0AC 5EE9A 3W9YA 2GHIA 2VYFA 4RD3A 2ZIAA 1B0UA 1JR6A 4KCGA 5E4FA 1G5PA 1RIFA 2KB0A 2QZ4A 4P32A 4QGAA 2JJ1A 3TSOA 4I1UA 1SULA 1TF5A 2QMOA 1TU3A 3KB2A 4ZI3A 4YMSA 2E1RA 4XOIA 2CBZA 1LW7A 5TB5A 3MUFA 3DM5A 3GEEA 2P0EA 4GNKA 4Q1BA 4LJ8A 1E2EA 2AD1A 2JJ2D 1GILA 1NVXQ 3WP0A 4KLZA 4AKHA 5CLQA 1EK0A 3BFKA 2C8VA 1T5IA 3I72A 4O2RA 2GK7A 4IW3B 2W00A 5IK2A 3PG5A 1R2QA 3BH6A 3N2IA 2WOJA 5DSZA 3PEWA 4EFLA 4EKDA 1UBFA 4F4JA 3QENA 1NNEA 1OXSC 2JASA 3VQTA 2HLDA 4OL0A 3IUYA 1EFCA 1W47A 4O0MA 1J70A 4JBYA 3ONWA 5JWHA 2QRNA 1XPRA 1U9IA 2ZPTX 1GRRA 2PBRA 1XRJA 2XB4A 4FMDF 3WHLA 3BD9A 4JLVA 2GTPA 2OV2A 1OFHA 1DEKA 4QG7A 4Q21A 4B33A 4JKYA 2D3WA 4XJXA 1OYYA 3GJ4A 1KNQA 3FYHA 2O8CB 4IFBA 3PUWA 4LV8B 4D4MA 2VL7A 2QPTA 2QI9C 2BC9A 4KFTA 3F5FA 1Q3HA 1XEFA 3B1VA 3O8RA 2XSZA 4JKIA 1SZPA 2WIBA 3MJHA 5FBWB 5FOWA 4B2IA 3C4JA 3AVXA 5CM9C 4G1UC 1FL9A 1A7JA 4KV9A 2DFLA 5BN4A 1R0ZA 1F2TA 4P31A 2QA5A 2ZUBA 1E0SA 4C30A 3TK1A 4UNNA 4QGGA 4EAQA 4BLOA 3UWOA 3AGQA 2VHCA 1QRAA 3EIQA 1NSFA 1N2CE 4BEJA 2ZUDA 1NN5A 2CNWA 2ZRKA 3EZ6A 3QG1A 2QMEA 1ZUIA 3VR5A 4IXNA 1JPJA 1LVGA 1GG2A 1Q12A 4DDVA 2EW1A 2X2FA 3ZLJA 2F7SA 2DY1A 3TE6A 4DHEA 4OQXA 2ZJ2A 5HKKD 4R98A 2ZR7A 3RS5A 1MABB 4LHXA 4D82A 4TLCA 3L82B 3OIVA 5FTLA 2XXAB 4ESHA 1Z0KA 2P65A 4ZDIA 2FG5A 1SVIA 1DAHA 1KIMA 1CR1A 5L3RA 1E2GA 5DNYB 4JS0A 1MR3F 5E95A 4EJSB 4DIEA 4N0EA 1YZUA 1Z2CA 4F92B 3KKPA 5LD2B 1C9KA 2CE7A 2ZYVX 2PJRA 2ORWA 4TQUS 5EE3A 2FOLA 4G5GA 3LA6A 1JECA 3P32A 2ZI9A 3TH5A 4D0GA 2XX3A 3FTQA 3DZ8A 5EZ6B 1OW3B 1XP8A 2O8CA 3C14C 4PZLA 4PC2A 4BUJA 4DC9A 1U0HC 2ZRNA 2B6HA 1ZNWA 2XGJA 4NHOA 3R7WB 1ZNXA 1G3IA 2ZJBA 3GLHA 2RH5A 4IOMA 3Q5DA 4URYR 1W5SA 4MRSA 1E0KA 2P5SA 4LJYA 3W8NA 4NTZA 4DIDA 3QF4B 1I4LD 2DHRA 5GVSA 5TV2A 1QG2A 5J4YA 3ZD6A 2D7DA 2QG6A 4LHZA 3W3AA 3CPJB 2FWRA 3GJ5A 1OLOA 4C0HA 3CF6R 3BC1A 4NKRA 1E69A 1UEJA 1W0JA 4GOKA 3L0SA 4JMPA 3IHWA 5K8UA 4RZXA 3IDQA 1ANKA 1VCOA 1JXMA 3ADKA 5AJZA 1KO8A 2X2EA 3IPYA 2TMKA 1LNZA 3KJGA 4H9GA 1U94A 2PT5A 4MA4A 4DKXA 2YYZA 2V7QD 4JLPA 1H8HD 3EASA 1K5GA 3EARA 2Y8EA 2DYKA 3CBQA 5SZJA 1Z8FA 1G16A 1JAHA 2FEOA 1E9RA 1D2MA 4C0JA 1PLKA 4BWYA 3KKOA 3ZH9B 5IT5A 5GJCA 2EYUA 5HE8A 1KTVA 2IXGA 4XIGS 4UNQA 3WNDA 4G5QA 1XBTA 1Z83A 2QENA 4DT1B 2UKDA 2W58A 2QAGA 4D4KA 4JSTA 5ELXA 2BM1A 3B7GA 1TQ4A 1NKTA 2ZREA 3QKSA 5KPDA 3SDZA 2EU8A 4Q7LA 3QXXA 4Q9IA 4DSNA 1CRPA 2NO0A 5JSZA 2W6ID 4HB3A 3PIRA 4MGKR 1II9A 2XNDA 4Q00A 4Q7MB 1G8YA 2AXNA 4GP6A 4QKQA 1XB2A 5K8TA 3RDPA 4XSGA 3CH5A 4DSOA 4LJ6A 1F60A 3M0EA 3QI2A 4K46A 3P27A 4I99A 1XZPA 5JZVA 5DH9A 2OBLA 5JS7A 3KQLA 3U7GA 4B2PA 4QNMA 1IN8A 3PEYA 2ZJAA 2FGKA 3T1TA 1E2LA 3B1XA 3KJEA 1UKVY 2V7QA 2ZRIA 3HR7A 1FTNA 4LJ9A 4QFMA 3AM1A 3M1IA 1KY3A 1T6NA 1NBME 5DIFA 4PX9A 1P72A 2XXAA 4QHSA 5KDLA 1ZNZA 1KGDA 1IY0A 2W0MA 4KITB 1U90A 4TLAA 2I4IA 3M6AA 3LBHA 3ZZUA 3PITA 4L5BA 3IQXA 4AYWA 2PMDA 1ZP6A 5EZ5A 4TYNA 2FSFA 4B6FA 2K5UA 1WMSA 3DZDA 4Z8YA 3RS3A 4C7OA 1XCMA 4O25A 3MWKA 3O8CA 5L3QA 3CPEA 5E7JA 3I1FA 4Q48A 3ZYCA 1ZVQA 3T34A 4XVRA 3IIKA 4OK6A 3SZRA 5IDVA 2OFWA 4LCBA 4P4SB 2XTZA 4ZDJA 2FU5C 3T15A 1MH1A 1QHXA 4NYIR 4A8JB 3K09A 1YVDA 3AV0B 2FV8A 2J7KA 3OAAA 1DO2A 5EUMA 3QPUA 1Q21A 4DCSA 2OCPA 5F2EA 4DEXA 3GD7A 4QRHA 4BFSA 2ZETA 4H1VA 2ODEA 3LRPA 3ZJYA 1I2DA 2ZSFA 3U7EB 1DAEA 2VP4A 4UJ5A 3TGPA 4EPRA 1F2UB 5UKDA 2OM2A 1A82A 1XCPA 5FI0B 4Q9LA 5FUVA 3RABA 3RANA 4WZBE 5CB8A 2HF9A 3AQ4A 1YQTA 2OCAA 3EW9A 4PZZA 4EPVA 1J2JA 1VDZA 1CJTC 1W1WA 1R4AA 3NHBA 1Q0UA 4MQBA 2A5YB 2GEDA 1Z6YA 3T12A 1II0A 3KUCA 3B60A 5EXXA 3LNCA 2PMKA 1BYUA 1P6XA 4WZAE 3K70B 1AQUA 3FKSD 3W6PA 1JQJC 1VCIA 1Q1BA 3ECCA 3HR8A 3CKLA 4QOSA 4G01B 4TMVA 2ZE7A 2IYRA 5E7MA 5JCZA 4CVNA 4W5WA 1N0UA 2Q21A 4MUAA 3N70A 2DCUA 1E3MA 4RFSA 3L2OB 4CEIB 2GZAA 2IL1A 3WBJA 2CJWB 1G19A 1G64A 2HF8A 2V6IA 1N6PA 1LV7A 1G7TA 2XOKA 1KMHA 5J47A 3HU1A 1W0KD 4CYMA 1EFRD 3AF0A 3B9PA 1NF3A 3PVSA 4TLBA 1JJVA 1LF5A 3CZPA 5FTJA 2PX3A 1JBKA 2IF0A 2C9OA 4MGYR 5K8LA 3UMRA 4G3XA 3REGA 1CS4C 1E1RD 5FBVB 3NDBB 3OIUA 4M1MA 3RWOA 1UJ2A 2WWFA 2AR7A 1IJEA 1X1RA 2ZE5A 3EIHA 4ZIRA 1J99A 4FD2A 1HE1C 3T06B 1FUKA 3NHAA 1X6VA 2FZLA 5CM8B 3CRVA 4PPQA 2ODBA 4ZV4A 3QPWA 3IHLA 3LV8A 5FPHA 3EAQA 1Z29A 3WMFA 5FL3A 3UIEA 1AJEA 4HUQA 1SHZA 2PL3A 3LXXA 3NKVA 4FWTA 2R9VA 4D2IA 3LX8A 4URWR 1M74A 1VYUA 4M8NE 4B35A 4W7SA 2WJJA 1R0XA 1YZKA 1YZQA 2VF8A 3GQBA 2AL7A 3SJCA 1Z6TA 2WJVA 1ZU4A 2GF9A 1YKSA 4TQAA 3WNCA 2WWYA 1Q20A 4PFSA 4B44A 5L3QB 1XXHA 5LBIA 2DR3A 4PR0A 3R8CA 4ZI2A 2GJ8A 1MO4A 2CE2X 2R6CA 1M34E 5ANRB 5TY0A 2A9KA 2ZS8A 3PEUA 1F3OA 2YC4C 4AIIA 4FINA 3SJZA 3T1OA 1CTQA 3C41J 5CDFE 2D74A 4TSFA 4A8JA 2VTKA 1ZCBA 1YJ5A 2A30A 3VU9B 5JEEA 4JVSB 1VIYA 2HYDA 5FR1A 3T5GA 2F1RA 3TVTA 2BEJA 1ELOA 2NZJA 5EE5B 2W0SA 1TEVA 2CLSA 2OEPA 3IBGA 5CIWA 1SXJA 5DGXA 2JAQA 2B21A 3MD0A 1BH2A 3NTUA 4Q1FA 2OILA 5HKKA 3NC0C 4LC0A 5LPNA 1W49A 4KVGA 2IUSA 2HXSA 2BWJA 3T1VA 1SXJE 2FJUA 4FMBB 1E2FA 1I2MA 3V4FA 5KNDA 3A6PC 5CIQA 3IIMA 4OBEA 3K0CC 1DAKA 3BXZA 3DPUA 2ZRLA 4JLNA 4AKEA 1R10A 2G0NA 3W90A 4WA7A 3FKSA 3QE0A 3IPXA 1II8A 3KX2A 4JLKA 1SKQA 3OF5A 5H70A 2QN6A 4MKHA 3U3JA 1T8UA 521PA 2Q0HA 2H18A 5DO9A 1C4OA 1ZINA 3SEAA 2RGGA 1ZCAA 2IT1A 2O0HA 5L3SB 4CGZA 2J0SA 4JJKA 3X1DA 2AHOA 4KYUA 3THWA 5L8VA 2V3CC 2VSFA 1XD8A 1T3HA 1XTRA 2ZTSA 4DDTA 4MGIR 2IXEA 3SHWA 5TDHA 5EE0A 4KXFB 1HH4A 1EFTA 1Q22A 4KHZA 4CT4B 4JL6A 3IIJA 4MKGA 4B2LA 1GIAA 5DN6A 2C98A 1DAGA 1OJLA 1NY6A 5FOUA 5KU1A 3CX8A 3QNUA 3Q72A 1G41A 3DKVA 4RD2A 1OPXA 1G17A 4JT4A 2J0UA 1KNXA 2BMFA 4OHVA 3QBTA 1CP2A 3JZMA 3WMGA 2OFOA 4EJSC 3AF2A 4Q47A 4YMVA 3RRZA 2ZYTX 1OIWA 1E9CA 2DWPA 3TSWA 2ZE6A 3TAUA 5TMPA 4Q9JA 2EFEB 3R20A 4LY6A 3CUEF 4MYTA 4BZPA 4RD6A 2IF2A 2CCKA 3B5JA 4Q4JB 1Q1EA 2BKEA 2QPAA 4B48A 2OE2A 3K0FB 4BGDA 4OI1A 4HAVA 3U2QA 3I3SR 3GFTA 1GAJA 1G9XA 5FUYA 3WNBA 4P4TA 1P75A 3F0TA 5C4MA 3VHXA 1AGRA 1W48A 4BLSA 1SKYB 2R65A 1P9RA 3RS4A 1W2GA 4HB2A 3RYTC 1FMJA 1G3UA 1TU4A 2NMVA 4NONA 5E7IA 1N6IA 1JQLB 1UDXA 1WF3A 1KJYA 2KBFA 2EFGA 4DLZA 2ZJ8A 2JDIA 1RKBA 1WCV1 1COWA 4FMCF 3AKEA 2J1LA 2WICA 3ZS8A 5BW8A 1EWRA 4M1WA 1TQ2A 1EFHA 3K09C 3CWQA 4ARZB 1XEWY 1GKYA 1R7RA 4FW9A 2RCNA 4X8LA 4B3BA 1NY5A 1IY1A 4OHXA 2ZSEA 3EZ2A 4BFXA 2OAQ1 3E2IA 1IXZA 4PZYA 1E79A 2RGXA 1QHNA 2ZR9A 2CCJA 4LUCA 4HB0A 4I81A 3SS8A 2BV3A 3BB3A 4RZUA 2BVNA 1JPNA 2BDTA 3I73A 5CYPA 2R62A 4BRUA 1WBDA 3ZGXA 2C5LA 4ZKEA 1ZM7A 4DCUA 2QT1A 5JCPA 1QHHB 4ARZA 1KJZA 1G6OA 2Z0MA 3AP3A 3CIOA 5IRCD 1JR3E 4CT5A 4LK2A 1KO1A 4E5UA 2ORVA 4TLEA 2LKDA 1SVWA 1M2OB 2Z6VA 1CXZA 1E9AA 3HP1A 5CDFA 1OKKD 1XTSA 5LD2C 2UZIR 1JR3A 5KYKA 3WYAA 3TIFA 1OSNA 2BMEA 2XB2A 1T0JB 3CO5A 4D0LB 3M4YA 1UKYA 3EA0A 3TW4A 5AK0A 5FUWA 3GPLA 2QGNA 4BLQA 2ZRHA 3B82A 4DLWA 4X8OA 3KFVA 4ZKDA 4MGZR 2NO7A 121PA 4DLRA 1XD2A 1E4YA 2PLFA 3CX7A 1KSJA 5TVKA 3P20A 1G3QA 2ONJA 4E07A 1AZTA 3EPLA 3KXIA 4AKIA 1MKYA 4JIMA 3U44B 4X8HA 4C0SA 2QTFA 1E2MA 4IDNA 1VHTA 1UKEA 3QVUA 1ZBDA 4BEBA 3FOZA 4QM7A 3CNNA 4KFRA 2ZRAA 4IDQA 2BIFA 4DT1A 4URUR 1HA3A 2WJGA 1IOZA 2QAGC 4LBVA 2JJ2A 4MRPA 4NYJQ 3ZVNA 3PJRA 4Q7KA 5JI3E 3ZZTA 3SYKA 5JS8A 3I62A 1KZGB 4ZIRB 4HDCA 2NQ2C 3H4MA 3RC8A 4DLVA 3GLIE 3UK6A 1MOZA 2YWHA 3CZQA 4P0TA 1F6BA 4KFSA 1IXSB 2AN9A 2GCOB 5CK5A 1NVUQ 221PA 4LPSA 4Q7JB 5AJXA 4LV5B 1QDEA 5G3ZA 1FX0A 3VKGA 3GLGA 3W8RA 2GBLC 4XWKA 4AY2A 4C0QC 4GOJA 2P5TB 1NMZA 1XPOA 1KO4A 3V9PA 1Z0AA 1XTJA 3B1WA 1DAIA 1PUIA 2A5FA 2JLVA 5JJIA 2ZRFA 1YZGA 2FSHA 2GKSA 4Q4LA 3RSLA 5EXTA 1KJWA 2VEDA 2CCGA 3PXGA 4KLNA 3IKJA 4QJ4A 4A2WA 1N6NA 2AK2A 1VYTA 1QHSA 3A36A 4Q1EA 2ZU6A 3AF1A 4HATA 2ZJ5A 2G83A 4WXRA 3K9GA 1IHUA 2ZYWX 4LHYA 3MWLA 2CHVA 4B3GA 1RRPA 4ZO4A 4TL6A 2ZRGA 1VMAA 3V4RA 3S1AA 4RCZA 3U3MA 2PCLA 1FNMA 5DYIA 2BJWA 2PCJA 1AN0A 4IXMA 4HUQB 3THXA 4MYHA 1GUAA 1QBKC 2C78A 4ZDWA 2C95A 4JT2A 4BZQA 2KE5A 4US2R 1P2VA 1U2RA 3VR3A 1GWNA 1OHHA 2IYUA 4BASA 3EZ7A 1D8TA 3SN6A 1A5TA 2ZI7A 3SJAA 3CRRA 3VFDA 4UNRA 3TQCA 2HUPA 2CLCX 2O0KA 1ZM2A 2IS6A 2OBMA 1ODFA 4QC2A 4AG6A 3OEED 1KO7A 2KSQA 4FN5A 2ZANA 4D4LA 3SQXA 1UBGA 3FMOB 2B7CA 2DFTA 4A2PA 3GJ7A 5EE1A 1C1YA 2JDID 4N1AA 2RGCA 3U7HB 1VIAA 2FZ4A 3D7MA 4Q03A 3GLGB 2C99A 3GMTA 5JRZA 1I4DD 1Y3AA 2F1IA 1KSGA 2VH5R 1HE8B 3O8DA 3KQKA 4NBSA 3I92A 2GRJA 2R8RA 3Q5EA 3QEJA 3MFYA 1ZIOA 3HYTA 4KFUA 2VQSA 3H84A 1DG1G 5HZHA 1GKIA 4US1R 1U99A 1QHYA 2EWWA 3CH4B 1P73A 3K0AA 1CR2A 3BH7A 3QOFA 3RHFA 2QQEA 2ZVPX 3QY0A 2NO9A 2YOFA 2RAPA 1E94E 1NBMA 4PSVA 3KQUA 3NH9A 2X19A 1HT1E 1P9NA 1S4QA 4M53A 2WMNB 4AG5A 4CW7A 1CEEA 1E2JA 2HCBA 4Q1CA 4OI4A 1NN3A 5AJWA 1U0JA 1AZSC 1NIJA 1ZNYA 2B8WA 1IY2A 3U4QA 3ZZ0A 3AB3A 3BERA 5BYKA 1P4SA 1KDRA 3ASZA 3EC1A 1MO6A 3TAHA 4CDGA 1LS6A 4U5XA 1RC8A 1G4AE 3KL4A 4NE2A 3A1TA 2IYQA 1IM2A 4ILEA 4EPYA 2O8BA 1KMQA 3MRSA 1F5NA 1UEIA 4XD7A 3K0FA 4OKSA 3UKDA 1Z63A 1OXUA 3TVDA 3GLFB 2F1JA 4KBGA 3G5UA 5FH9A 1JAIA 1Q1ZA 1EFRA 2XTMA 2AKYA 2GK6A 1Q3TA 1XNJA 4DSUA 4W5HA 1AS0A 2GJSA 3PR1A 1M8PA 1DG3A 4RD0A 4KI0A 4HZUA 1Q44A 2WIAA 3HWSA 2CL6X 4QBHA 1FFHA 4KODA 1E9BA 1KK3A 1CLUA 2VP0A 3VX3A 2XZLA 3CRMA 1P2SA 4AURA 3MMPA 2BBSA 3CB4A 1Z5ZA 1GL6A 2QE7A 3FFAA 4JJZA 5G53C 3CW2A 3DKPA 2CEAA 3FMFA 4FCTA 5H68A 1UKZA 2ZROA 4LYHA 4NYMR 2FDCA 4B76A 1U0LA 1E1QA 5FPYA 2IK8A 5A5GA 3WYFA 4QGFA 1FQJA 4BFVA 4RZ3A 1VTKA 2IWHA 2JLWA 3RS2A 3HU3A 5KO2A 3G0HA 1HYQA 5DI3A 5JI2E 1COWD 2VBCA 2Z43A 2GZDA 5FFMA 4IVQA 4TZ0A 1CR4A 1XZQA 4A1FA 4A6XA 3O8BA 3A1UA 1OHHD 2WJYA 5CK4A 1Y63A 3AVVA 3JZAA 3FPAA 4JL5A 2AXPA 4YMWA 2Z4SA 1OXVA 3OEHD 2HEIA 3CR8A 1G291 4GZLA 1P61B 1W44A 2BBOA 4PQFA 4V0NA 1G21E 4QGHA 5BWMA 1RRGA 1Z0IA 2QUZA 5EP4A 2PZFA 3BOSA 2HLDD 4CEIA 2ZS7A 1CJVC 4MKFA 2W6JD 1QVRA 4IEEA 3U3KA 4L9SA 4B3FX 5B2ZA 4TMZA 4HZIA 4L8GA 1FMLA 5J40A 4DCNA 1OF1A 3ADCA 4PQYA 3ZIAD 5A0FA 4BLPA 2CXXA 4Z1MD 4EQ6A 5KHOC 3IBYA 4XWAA 1TTTA 1ZMXA 2NZ8A 3HJNA 4IOLA 1W4CA 1V5WA 2GILA 4Q1DA 4Y0AA 5TXGA 4DB4A 3KJIA 4LC1A 2D7CA 4UJ3A 4UXJA 3KKNA 5FBLB 3FGNA 4LYAA 1Z2AA 1E79D 4TTPA 4NZYA 4Q66C 3QF7A 4TL8A 4QJ3A 2PT7A 1X1SA 1KDTA 3VX4A 1KI4A 2ZRJA 2EFDB 1SHKA 4CEJB 1AS3A 5EQTA 2QORA 3PEVA 1ZD1A 3NG1A 4ON9A 3LD9A 1FQKA 1S9HA 2GXQA 5AUNB 1OT3A 2QM8A 4TYWA 4Q4AB 4R71A 2W2XA 4ABYA 3C15C 1XCGB 2CHQA 2YNMA 3BH0A 1EG7A 3UMSA 1FPMA 4C0BA 5AUPB 2VP2A 2QMUA 5IK2D 5JJLA 4NYMQ 4TMTA 2WHXA 5KDDA 2OUKA 3A1VA 4C2TA 4IVRA 2WTUA 2VHUA 5EP3A 2QPOA 4KO8A 3UG7A 5J4VA 3KKMA 3TUZC 1P60A 3Q7QA 4A4DA 2PX0A 4B3DA 3CRQA 5L3VA 3W5JA 3NEJA 1TNDA 3CNLA 2AWOA 1GSIA 2FFAA 3QF4A 1RE0A 1SGWA 4MRNA 4UNSA 2P3SA 1CU1A 4TMWA 2GVZC 3QJYA 1ZUHA 3NXSA 2DBYA 4HZUB 1T8TA 4DSTA 2H17A 1TUEA 3A1SA 1KK1A 3U60B 2IHYA 1R0YA 2VSOA 1IN6A 4LBWA 1F48A 2J7PD 3LLUA 4JZKA 3FFBA 2HV8A 2Q9CA 2CL7X 4TT3D 2J5XA 2J7PA 3DVLA 1Z22A 2G88A 1YRAA 2ZI6A 4IOKA 3GJ6A 3K0EA 3EPJA 2NTYC 3GJ8A 1A2BA 4P3YA 4GFDA 3ZDQA 1W4BA 2P67A 4A36A 1DS6A 3ZVLA 2O8EB 2GA8A 2IW3A 1BO6A 4B34A 1DADA 3OEHA 2MSDB 1E32A 1R5BA 2R2AA 2GNOA 3QKTA 4M2LA 3A8TA 4NU0A 3CR7A 4II7A 5AR1A 1FP7A 1NP6A 3KFXA 1ZU5A 2J0UB 4PPGA 1OV4A 2H7VA 2ECKA 1IJFA 1II8B 4GT1A 2QSYA 3U7FB 4JVNA 4QHTA 2ZAOA 421PA 5JSZB 4MDFA 4K8OA 4M0LA 4AD8A 3VR6A 2AKAB 4A8JC 2V1UA 3T5DA 2IYYA 3FMPB 2HCJB 2J41A 2A2ZA 2GBLA 4LJ4A 1NG1A 3QUSA 1XD9A 1E2IA 4N3NA 2C04A 1XJQA 2QNRA 2ZI3A 2FFQA 3LAWA 5SZHB 4DLSA 2I3BA 3A37A 2FGJA 3U6BA 5AWFC 3ZIAA 2Q6TA 4L15A 4LI0A 3SE0A 1G8HA 3LX5A 1G18A 2WSMA 1SVMA 2Q9AA 2B92A 4A82A 2D06A 2IHBA 2RB4A 2J59A 3AUYA 2Q3FA 4ERNA 4JSYA 2OXCA 4B3CA 4A0GA 2QMHA 3BGWA 4V0KA 2VF7A 2F55A 2W83A 3UXMA 2ORIA 4OQLA 4D25A 2A78A 3U3RA 4I1OA 1OIXA 2NO1A 1XWIA 4NDZA 3DHWC 2R44A 3I5YA 3SQWA 3TNFA 1N6KA 3WYGA 4PAMA 2GAAA 1KK2A 3H0KA 1ZC3A 2V9PA 3H1TA 3AF3A 3ND9A 4IDPA 2IXFA 3CNOA 5H1YA 2OO7A 3CRW1 4JLJA 4EFMA 4MITA 2G77B 2V8OA 3AVPA 4IJMA 4UQOA 1E98A 1RVDA 2QSZA 3LBIA 5BN3A 2C2HA 4FMDB 2XOKD 2VO1A 4Q02A 5K8IA 2QAJA 5FTMA 1VCMA 3ND8A 1EGAA 3H2YA 3E70C 4OQNA 2PLRA 3RSOA 2MMGA 3MLEA 4DCVA 1QZXA 4A0HA 1F2TB 1Z0DA 2QP9X 3X2SA 2G1KA 2BM0A 4XSHA 2OHFA 4RKEA 5KSOA 4Q4HB 1AGPA 2QTHA 3FMIA 5SZKB 3BRWD 3UWKA 1Z47A 3I5XA 3B13B 2Q9BA 4R2IA 2OBNA 4PXAA 2A5JA 2IYTA 4IKEA 2XNDD 1D2NA 1P9WA 3QG5A 2VP6A 1XTKA 3N2EA 2ZRBA 3NVAA 3C16C 4TMKA 2BHRA 3B8HA 3IO5A 1GDDA 1MO5A 2WVJA 3GP8A 4LWZA 4OK3A 4L4UA 4EUNA 3U61B 2FPMA 3AP1A 3AH8A 2JLYA 4DRZA 3KXLA 3D31A 2Q3HA 2REBA 4YLGA 2OSBA 1R5NA 1M7HA 3AVYA 1OB5A 5D3QA 2JA1A 1UBCA 4O3MA 5FI1B 4M9ZA 4M1KA 1Z06A 4JLBA 3EWAA 5GADl 3C7KA 4RD4A 5E3HA 3KQNA 3J81k 4YONB 3OAAD 2ANBA 3FHCB 1RRCA 1W0JD 2JLRA 4TTQA 2KWIA 4V0ME 4NL4H 4EDHA 1E9EA 2FA9A 1NN0A 3CPHA 5EXSA 3KJHA 1Z28A 3QEOA 4IHQA 2LKCA 3IO3A 3TRFA 3KKQA 1W2HA 3AKYA 3EWSA 1H65A 2RGEA 5G41A 4L9WA 5FPTA 4URVR 4CEHB 1M7GA 1IQPA 1NLYA 1U8YA 2ODWA 1BMFD 4PPNA 1JEEA 2D2EA 1VG9B 5HCNA 1T4GA 1YZTA 3W6NA 2ZSAA 1MABA 1Z6GA 1RFLA 1CULC 2X1VA 3GJXC 3VKWA 1X8LA 4RY2A 3T1QA 2UZ3A 2ZR0A 4K81B 2WKPA 4JVMA 4Q18A 1FZQA 4EFNA 4B71A 3U6KA 3QVVA 3KTAA 2ATVA 2GCNA 3NBFA 1L4YA 2ANCA 1TUIA 1P5ZB 4IEIA 5BQ5A 4GBMA 4NP6A 3ICQB 3RS7A 3SC3A 1PJRA 2XITA 1KI6B 1R8QA 2YOGA 2WJHA 5C18A 3LQRA 1R6BX 4KVAA 3AVUA 2DFNA 5DYGA 4AWXA 4XVUA 2V1XA 4P4SA 2P6NA 1UFQA 4A9AA 5FOVA
chains in the Genus database with same CATH superfamily
4NK5A 2ID9A 1UZNA 3HABA 3H2ZA 4NCNA 4XTRA 4KR0A 1KEZA 2HGZA 1J33A 3M2TA 4Z99A 1MG0A 3A4NA 5K0NA 2DEUA 1PYOA 4OGFA 3AR3A 4QJ5A 3UN1A 3T1HB 2R2GA 1OT5A 3Q9LA 3GB9A 4CG1A 4DILA 1YNOA 2VDQB 2GCOA 2C3PA 4A6DA 1VLQA 2ECOA 1S8FA 2Z1DA 4E08A 3VC2A 3PA8A 4LJ5A 3ECAA 3F6BX 3PE4A 5EQFA 4D56A 2XNSA 3OT5A 1F8FA 2B8EA 1EE9A 2G9VA 3UICA 4MUJA 3WB2A 3UJAA 3UM9A 3W4KA 1EMDA 5CT9A 1QG4A 2TMDA 4NCHA 1XRSB 2BTOA 1HLPA 1VJDA 2A4KA 2CN1A 2IU3A 2QRVB 3G82C 4HMQA 4IXWA 1W9MA 4UU8A 1VZ3A 3WL5A 7ABPA 4DUGD 1VMEA 1BQ4A 2BKLA 2G1PA 4K6MA 4Q3BA 2BL4A 5E7QA 1QORA 1RM0A 2GZSA 1HGXA 2W6JA 3EPRA 3Q40A 1Z6XA 4ENTA 3IXLA 2A94A 4CIYA 3UF0A 3BRSA 4UEJA 3UO8B 5BNZA 1DIBA 3ZKAA 5KSYA 1XA4A 3PFCA 1T5LA 1V5EA 5ESRA 4N48A 2YW2A 3GHHA 3HXTA 3ONDA 1I5OA 1MX5A 1PUJA 5ICSA 2OORC 4BGVA 3A58B 4INPA 2M1XA 2A35A 5IDXA 1U4OA 4ZHSA 5AJYA 2V9ZA 3CJQA 1C1DA 4L75A 1J5XA 4PTLA 4Q3DA 4EGJA 1X15A 4O0LA 1RD4A 4F86A 1UADA 4IOJA 4W5TA 4F56A 5I48A 1HZZC 3G0CA 3I2KA 1QNLA 3FNFA 3PICA 4IHJB 4MV0A 1N2IA 4RHFA 4AUEA 1T5OA 4JD5A 2HHHB 3JASA 3R9WA 1PW7A 2I1QA 4RF5A 2VZEA 4PC7A 1KYQA 4H7JA 2JZOA 5D7BA 1S0UA 3NJ8A 4IUBS 1NLZA 4GPEA 1Y48E 2DUUA 2YQZA 5MGNA 4GC5A 2B4YA 3IOYA 1M6WA 3ZHOA 3CEMA 4MQFA 2A5DA 4W1PA 1Y6GA 2RGDA 3L3BA 4LGYA 5J3JA 3O47A 1IHYA 4INZA 3SFVA 5GY7A 4PNHA 4B47A 4FCCA 1G2IA 1NX6A 2UYQA 3MVEA 3O90A 3K4QA 3MUNA 2UDPA 1LH0A 3HDTA 1MVNA 1N2EA 1KYWA 5FTWA 2LXNA 1AVTA 1U2ZA 2G4CA 3KLBA 5AKGA 5D5PA 1DFGA 2NV6A 3COVA 1HRDA 4KAXA 4QAJA 4EL0A 4PAOA 3DDHA 3GLUA 4ND5A 4XI9A 1AC5A 1CJKC 4KTVE 2H16A 3SHOA 2ZS9A 1AX9A 4EO4A 2P6UA 1CIJA 4FGLA 2BTQB 1R8SA 2GGSA 2VJPA 3RRJA 3JS5A 4LXYA 621PA 4TSKA 2XH8A 3RRYA 5A5DA 3AF4A 3QKRA 3DV0B 1QR6A 2ZRMA 5JAZA 3QXJA 3I01A 1P17A 1RZUA 2JLQA 2QR5A 5J2UF 2B8TA 1HC7A 3OLYA 1DBSA 4O08A 4INJA 5IXSA 5KOYA 3LCJA 3RJ5A 3NIBA 1EVJA 1WVMA 4ZYWA 2OC9A 3L06A 2R6FA 5A1JA 3BT7A 4UPDA 1PGPA 4ZCPA 1V3TA 1ZAKA 1R0WA 3ONVA 4UZFA 3O91A 4OQZA 4BUCA 4YIKA 3EAGA 1GNPA 4L5IA 5F9FA 3QKWA 2JIRA 2BEKA 5AT1A 2FZ5A 4GRAA 4UU7A 4XJTA 1JE0A 1VHDA 4GVPA 1RKVA 3TSAA 3GRVA 5E9QA 2DCMA 3SLRA 3COPA 3IMCA 3PUVA 4EKEA 2FPPA 4C4PA 3IAEA 3DDUA 1LJUA 1RBZA 2QW0X 3OP4A 3P4YA 4FQ7A 5G0VA 2PSSA 5K8JB 4NBKA 4OK5A 5CFOA 1RHMA 2WPDD 4ZAXA 4TN5A 4HDQB 1L5GB 4D3YA 1XLVA 1MC8A 3D4PA 4FDMA 1DUIA 1ZD3A 3GP3A 1S3SA 2FQYA 3FVWA 1U6JA 3BORA 3EA5A 3M49A 3P45A 5CW1A 3RJTA 2GQ0A 2A1TS 1P9OA 4QPJC 5CLFA 1V5IA 4J3FA 1E2KA 1QO9A 1Y7TA 2AF3C 2B8NA 2RHBA 2VLIA 4FCVA 4JITA 1DBIA 2JEYA 3L8ZA 4M0FA 4UKDA 1Y8QB 2VWPA 4BO0A 1AKEA 1X3LA 1QYRA 2IXAA 2Q0XA 3LS2A 4E3ZA 1BW9A 5C1BA 4R2JA 2WU8A 1PQYA 1GADO 4OHZA 4FMPA 2R79A 3OJOA 5ICMA 5HM8A 1VLHA 1NIPA 3AI3A 4MW2A 4R01A 5EJMA 4DQUA 2HA3A 1U7WA 1TK2A 3EDYA 3MINB 1IUNA 1A9XA 4PVCA 3C3BA 4N39A 2FRDC 1JA1A 3RAGA 4EG7A 2PQ0A 4F6CA 4G1FA 4M21A 1FYFA 1E6UA 1XZEA 5EXDA 2LNDA 1JWLA 5EQJB 1LQ2A 4OB6A 4DUZB 1QKKA 1QG0A 5DTQA 3T0GA 2XCTB 1ODSA 1ZRHA 3W3AD 4K40A 1YR6A 3AEZA 5IS2A 5EWJB 3THWB 3ICPA 3T5BA 1Z16A 2CD7A 3ZDYB 5BN4B 2K2WA 1F20A 4BNDB 1UWKA 2G07A 1MO3A 2EYQA 3IAM1 3E22B 1NOIA 4UMVA 1CIPA 5D01A 2H63A 4X44A 1VCNA 4Z3KA 2WKSA 1T0UA 1LDEA 3GCGA 2ZGVA 3GFQA 4UU0A 5FO0A 2JAUA 5DJ5A 1FSPA 5FIUA 3OFND 1Z5PA 1UANA 2I2XB 1ZD5A 2XZDA 5IW8A 1XJ0A 2AC7A 4TQ9A 2F4VB 1VKJA 3L4JA 3OECA 4AZVA 4FOSA 3BF8A 1V26A 1UMCA 4BO8A 1HI9A 1U5CA 3D6HA 5HZKA 4F9FA 3FSRA 1PDWA 1OYVA 2BGJA 3OZWA 4L4ZA 3PXAA 2IY7A 5CDSA 1PSZA 4K3UA 4TYQA 3FDZA 1O4VA 1C0IA 2K7ZA 2F2TA 3OM0A 3BGIA 4D0NA 4D4JA 4OLAA 1AF4A 4DMKA 4IWYA 5KINB 2H48A 2XYVA 3SBDA 3GLIB 2OP0A 3GG2A 3GRPA 3WDMA 3DQZA 1XN4A 1NNLA 1MF7A 1PFYA 1I3OA 4LOHA 3WLNA 1W4RA 5COQA 1NMQA 3WXMA 3ZN2A 2MSCB 1JHPA 1HT2E 2BFMA 1BCRA 3VRHA 5LDDC 4ZQFA 3Q0IA 1ECCA 1H4TA 3F49S 4OVKA 1NSTA 1X77A 2VTBB 1THGA 1Y8RB 3HYLA 1NUQA 3CPSA 4EQ6B 3LTEA 3LPMA 4ARUA 4B8ZA 5LXTA 4Q3KA 5DBHX 1QQAA 2BJVA 4GYWA 4V0OA 1MQSA 2SCUB 1XKLA 4OYRA 1CFJA 3KVRA 4H7HA 2XQJA 4Q19A 2GESA 2BCGY 2I6SA 3ZW9A 4C2AA 1N6HA 4KXVA 1XWFA 1N2OA 2EF0A 2V59A 2X0IA 4M98A 1SOUA 4CM9A 1YMUA 2N47A 3KKKA 3AHDA 5FUXA 3K6RA 4F93B 1RQPA 1CZHA 1Z2PX 4HI0E 5ERGB 5F5LA 4ZU3A 5C34B 1X38A 3KUKA 5GJVC 5CDTA 1L5HA 4Q93A 2FXIA 4V38A 3N28A 2IS1A 2W43A 5FOSA 3R0XA 5CA0B 4NH4A 3CEJA 3FMGA 4I8IA 4L57A 4MYRA 1E8NA 1VKNA 1RBQA 2C42A 3OQ6A 4TZKA 2JGDA 2IX3A 2QJRA 1E0AA 1IN5A 4POAA 1DELA 4YVFA 3OSUA 1KDOA 2C7OA 3CXUA 2XMDA 4BJ1A 2IYNA 1XNHA 3A6GA 1RCUA 5JS2A 4JKOA 3UATA 4P7BA 2OCGA 1V96A 1FE8A 4B6RA 3MEQA 2D5CA 4JYCA 4IGIA 2ZUCA 1TT5A 3RYIB 3VO2A 4DBVO 2IQ5A 4F2DA 5IN4A 4PQGA 2DERA 1N3BA 5FPSA 3DBRB 1NMYA 4PY2A 3SMQA 3ZQJA 4L3OA 4Z4QA 2H1RA 3IAUA 3M6WA 3TW0A 3QELB 4BE4A 3RAFC 2H0AA 3K6SB 4M4SA 4RZIA 4XDYA 4A92A 5HBGA 3WGQA 5HPYB 1OOEA 3VO1A 5M7EA 2E85A 3GFPA 3LM8A 4HGRA 4O1IA 1OWOA 1U2GC 2OGWA 4K9RA 2ZM5A 2AZXA 1JJ7A 1XK6A 3FSGA 3OZTA 2HU5A 2KQUA 1H8EA 3KZNA 1W0KA 2Q0QA 3WKEA 3OE7A 1F0KA 4LPKA 4C7VA 3EVFA 1MDFA 4L5YA 3P52A 2KBEA 5GJBA 3RV4A 5EJ9A 2F43A 1N0HA 3R5TA 2G7MC 5IT4A 1UPFA 4MWDA 1DO0A 4MIOA 5LOVB 2FN3A 4FJ0A 3P2KA 1FX1A 4FNOA 3GCZA 5FWYB 2R8XA 4LFAB 3MOGA 4HSEA 4MW9A 1Y4SA 5AI6A 1TECE 3B1JA 2O3SA 5EJGA 3GLGE 3WQBA 4MV6A 1ISPA 4W5JA 1BS1A 1FLAA 5CG2A 4RPJA 3RWMB 4M86A 3QJ5A 5K1ZA 4GE0A 3REFA 3RC3A 4BX9A 4F2GA 2WB4A 2WJIA 3D1VA 3TLXA 2QVBA 3IRVA 4RTSA 2A67A 1XRLA 4EZBA 1K6XA 2DUJA 4RKFA 4EVIA 2WW8A 3BFVA 1GCGA 3N8DA 1C4WA 1PR6A 4LDJA 3TAXA 1R4MA 4RADA 3LYUA 2EFJA 4Q1AA 5T6BA 3U0VA 1U98A 2WPNA 2QROA 4IUYA 4FI3F 3HB5X 3THRA 1QO7A 4E4TA 4R7ZA 4ALMA 1IG0A 4Q82A 2UV8A 4JLOA 1I3NA 4ZJPA 3N8KA 1QB8A 4V0LA 1TW2A 3QNMA 1T5BA 3QI7A 2B0CA 4O59O 4WOJA 5LDHA 1F2UA 4ZTBA 4DQDA 3EOZA 3UVEA 4Q24A 4ENWA 3JD4A 1XDBA 2BZGA 2NO4A 1X9IA 4Y18A 3EC2A 2ZRCA 1K7YA 2B7BA 3CZCA 4OJTA 4JT8A 4TN1A 1FUIA 5G1PA 3ZNQA 4J0FA 3DG9A 2D5IA 4H60A 1KMNA 3T9CA 4F96A 5BYBA 1QTQA 1ATIA 1YR8A 2HM7A 4CTKA 2JA2A 2A9QA 3EGWA 2R7LA 4GYJA 4J07A 4OHUA 4ZO9A 4ZTZB 5JSYA 2X5OA 3QLEA 1ATZA 1B15A 1U3DA 2XODA 2G3YA 4AYXA 5IDWA 1G8AA 6LDHA 4LWPA 1JG2A 3GLFE 2OCYC 2Z04A 2D2FA 4K9SA 1WW8A 4RDIA 1DTSA 1NZJA 4NF2A 3ICEA 5F12A 4TYMA 2P2SA 2Z5FA 2NPIA 4FXOA 4P4LA 1PR1A 3KUDA 4P7GA 2HDHA 2O2JA 3ANNA 4QUHA 4E51A 4F2HA 4E03A 1DCMA 1XEXB 1SVKA 3AYXB 1Q7GA 5DLQC 3TNYA 3A4MA 5KX5B 1Q6ZA 3GAAA 5DHTA 1K7SN 3VBEA 1U7PA 5JDCA 1PVOA 2BGRA 3ILHA 3TL3A 5TVGA 1Z8NA 3BIJA 1T9HA 2OKCA 4LZZA 4CKYA 3ZWOA 3TMKA 1GTMA 3BKWA 4BLRA 5ICGA 2B3DA 4I1SA 1BOFA 2Z5VA 1IZ9A 3A0UA 3M5WA 4QDXA 3U37A 4OFBA 2J5KA 4ZVPA 3TZEA 3U80A 1NHGA 1JQAA 3SCZA 4IQ0A 4WY8A 4ZK6A 4GAEA 3VJKA 1E1QD 2ZQ5A 5AI5A 4DNQA 3MC1A 4KWHA 1Z4JA 2J3EA 4HEA6 5L9AA 2ODQA 2ZJOA 3WK7A 1Y6ZA 1TGVA 2WF7A 3V2IA 3IGFA 5J58A 3MB8A 3SOPA 2ONKA 3OPMA 4HAZA 1QH1A 1VDMA 1C0KA 3Q10A 4Q9AA 5A4JA 3OFVA 1LS1A 3FTFA 3KNZA 3MILA 4BVFA 3L6UA 4YJ2F 4MIEA 1JZTA 4PU0A 1JJBA 1JKJA 3I9V6 4ZALA 2RAFA 5KOHA 2IPNA 1NKSA 4KPGA 2CF5A 4S1PA 1YB2A 1H0SA 3CG4A 1E7SA 1GQRA 1C30B 1IE3A 2P3LA 4JUDX 4ASUA 2FPWA 3JALA 4YCJA 1AKYA 4OI0A 2VWGA 4FBMA 3RRBA 3I2IA 4CQMA 4GD3Q 4M54A 4RGVA 4ZYVA 3AUXA 4R9UC 5CXXA 3QXHA 5ALMA 1KI9A 1NVVR 2HSGA 4TZ6A 1GQFA 2WU1A 2YJTD 3BMCB 1K86A 3B8EA 4HQ6A 3TD9A 1XZNA 1D6MA 4UOZA 5TPWB 4X0EA 2IWRA 2IZ1A 1EVZA 3DCIA 3CF2A 4KYVA 3D2AA 3CMCO 4RGBA 4YRPA 2XYGA 2Z9DA 1PAUA 3FCOA 5IF9A 2Q27A 2XY4A 4EUKA 4MUFA 3TJZA 1RAFA 2ZJ4A 2P3QA 7MHTA 1JN0A 1U3FA 4IDOA 3TTWA 5DK4A 4BB5A 1K9SA 4P7KA 3GDFA 3TLBA 1P2TA 3SR0A 1NBMD 1S2OA 3RU2A 3BMCA 1WHSA 1AIPA 1EH5A 3EXIB 3H4TA 3PZRA 2XIJA 3E5HA 4LZOA 4Q15A 3OQNA 1TF7A 4GUDA 1UF9A 5K2MA 4P3OA 3U4QB 3TOCA 1WMDA 1DKLA 1PWHA 2I0FA 3CZMA 3GEMA 2HPVA 5AI9A 5EWLB 3UANA 3DZIA 5LP6B 4PQRA 2WV9A 4F3RA 5B4UA 3DMNA 1CT9A 3KZXA 4RVFA 5FV7A 3UV6A 4BQOA 5LSAA 5F35A 4MPDA 2O7VA 3NWEA 4D8VA 3OFNA 4BNLA 4OLJA 4YJ3F 4L7QA 2VDKB 3E9NA 4DV1B 1Y8CA 3CUTA 1A2QA 1CUGA 2FPIA 2OHGA 4TMYA 5B2EA 4U2GA 2G6BA 3FZQA 3D6TB 5DTIA 3G5LA 2AQKA 5U4XA 5JYCA 5GINE 1GARA 3RUIA 2YX1A 3AM5A 5B7PA 2OO5A 4BGUA 2RGUA 5BQXA 1UM8A 2FN4A 2UVQA 1ADYA 3L1VA 2CHGA 4N76A 4RJKA 2RC6A 4AI6A 2B4AA 4EZEA 2D4HA 3S6JA 2ZIGA 2W7TA 1FMTA 1AA9A 1ZY2A 2AFRA 2VP5A 3G9QA 2CUNA 3KDSE 4QFDA 1GSOA 3AIIA 3LBAA 3QVJA 3LYLA 5C81A 3NWJA 1F17A 5J4HA 3DFKA 2IYZA 3RV3A 2XQKA 3GI1A 4DYHA 1AK1A 2EX0A 4M22A 5CB6A 1QOQB 4DJ5X 5JZOA 3Q4GA 1HV8A 3F6YA 1J24A 4XYMA 4N9WA 4Q3OA 1U2PA 1ULUA 2LDXA 1YZHA 3B2EA 3CVOA 3NBXX 4JFAA 4LKRA 1NA5A 2AMYA 2H3EA 1VHLA 1UBTS 1WTAA 5JXGA 5ADUS 1S1CA 1FXWF 3DEKA 2VCYA 1YULA 2JLZA 1HO3A 3LO5A 4QDOA 4HAWA 3RJMA 3GEGA 3VAZA 1MVOA 2OM6A 3P9PA 4NIMA 3ZOKA 1LEHA 2JFZA 3T7CA 1OR8A 4CM9D 2UUPA 1PHRA 3HBLA 4US0R 5DV9A 5LZ5A 4CZ2A 3F6CA 4I4LA 3BWYA 1XZGA 4FR0A 1QVWA 3EEBA 4U6QA 1I6LA 3V00A 3CONA 4GQIA 3TEJA 2DWCA 4QXAA 2QY6A 4H3VA 4NATA 3TTUA 2NT3A 5FJJA 3BICA 3PTZA 4HAXA 1G3MA 1N3LA 1M6YA 2W22A 3E3OA 2EJUA 4J0CA 1QIMA 5H02A 4PANA 4CDRA 4UASA 5HX7A 1XZJA 2DUNA 2O2EA 4BPBA 3T38A 5JVDA 1PFVA 4IFIA 4KYIB 3IAFA 4MS1B 1VKZA 3DDCA 3C70A 2G9NA 1KZHA 4Z3OA 2I91A 2PZGA 4PX3A 4D0SA 3VZSA 3N58A 4MV4A 3ORSA 5JTTA 2CBXA 1BAPA 2O1SA 2CZGA 5LA6B 4ZGGA 1D5WA 2H7XA 3G9ZA 4MDEA 2I8CA 2X77A 5EMHA 4ITUA 1KDZA 1XQXA 4RVCA 1RMTA 3K2IA 4TXNA 3RBXA 3IEPA 2P9ZA 3SNKA 2HADA 3PC8A 4LEIA 2W2VA 3TQSA 3DZHA 4UD2A 3T9AA 4O4HB 1BOOA 5BN5B 5CDHA 3H3JA 4MEBA 2LRHA 4OP1A 4MS4A 1V8BA 2FX5A 4I4NA 4D9FA 1UWCA 2P9JA 2CDCA 1OU0A 2KYRA 4HP8A 1TT5B 3G0OA 4GI3A 1SUCA 3LDGA 4KSBA 5DISB 4BNHA 4D9CA 3T1YB 5FPKA 4A0RA 3V6MA 9LDBA 3DE1X 1C1XA 5F9HA 1GPAA 1JDJA 2HJGA 2HV9A 4UBIA 4YI3A 3HS3A 3NI2A 1T8WA 1TCVA 1EGMB 1N0VC 3FPFA 3I52A 3I8SA 2VIIA 2XTAA 3LQQA 2ODNA 1S96A 1JLSA 4IF4A 3ASYA 4RO0A 4DQ0A 1J8QA 3OX2A 2OGSA 4D81A 3RFUA 1D2HA 3VZBA 4LJLA 3QSYA 3RE1A 1P0QA 2BF4A 2NUPA 3GPDG 3SXJA 1PK9A 4J9VA 2F43B 4LF6B 1NJ5A 1SQ0A 1VOTA 3ZD7A 3MTJA 5F33A 2AG8A 1IONA 1NVEA 4YMTA 5B3KA 3I0ZA 4ZYYA 4HX2A 5H3HA 5A4IS 1QVAA 4MIKA 4D92A 2FSVC 3NB0A 5ALVA 1M1XB 1DCTA 1L4FA 1PUXA 2AE2A 4EBFA 2IHUA 5KVCA 3O8QB 5L6LB 1DAMA 1Z25A 5JBIA 3LG2A 1ZUNB 4DW8A 1WULS 2YV2A 3BCRA 4HOYA 2CVHA 1LLFA 4PPYA 4JR0A 3BKXA 3JQRA 1PZHA 2HREA 2QD1A 3K8YA 3WLRA 1ZRNA 1JPVA 1NP7A 2F48A 1A9TA 2YQ5A 4FIDA 2GR9A 3RSGA 3U16A 4CN8A 1W5EA 3QUBA 5KNBA 4TWAA 3Q3VA 4J0QA 2VDUE 2QYOA 5AHKA 5K3EA 1PQUA 1DWQA 4GO1A 5DE3A 2ZU0C 2PZMA 2ST1A 3EFHA 1I14A 1BFKA 1FNBA 1MA0A 3KAPA 4GHWA 4MR9B 2BT4A 4GMFA 4C08A 2BDEA 1E1YA 1K4MA 3DEFA 1M1NA 4HBGA 5DBOA 3D6UA 5DMHA 2QL9A 2ZRDA 1Z0UA 3I5MA 1EX1A 4LHEA 4BIIA 5CCXA 2Z6QA 3R5FA 2QVZX 4ENSA 3OQHA 3MJEA 3SNHA 4D42A 1BEZA 9GPBA 1A7AA 1GCOA 4TXMA 3EGDB 1ZMOA 2KI5A 4Q1VA 1V2GA 2IYXA 3CURA 3R4VA 4O2AF 2GDJA 2EX1A 3DMYA 2GNAA 2WWHA 4W9RA 1C7JA 3H13A 5DK6A 4KPFC 1SQ5A 1XTIA 4K9MA 4X6LA 1Z73A 3IESA 3EFBA 3EQ7A 2IS2A 1MAUA 5F73A 3LCUA 1N6OA 3BK2A 5JXWA 3NTVA 4FI3C 2Q4RA 4QDZA 3AV3A 3WBKA 3QKUA 2BRUC 3K3PA 2VBFA 2J9YB 1LLDA 2VJNA 3AUAA 3GLHB 3KAQA 3K53A 1W85B 4L50A 2V7UA 5DBGA 1J5PA 2AFHE 4FMCB 4TRMA 1XMVA 1YR7A 3AHHA 3L7MA 4BO4A 4FX2A 2ZCJA 4BFUA 5CM2Z 3B6EA 1T1SA 1KI3A 4S2EA 4XASA 3UV7A 2QLFA 3D3WA 2CJPA 1YDHA 4MKIA 3LBNA 4LF7B 4J3JA 1SKYE 4NS4A 4CTJA 2WF9A 4RMNA 4F45A 2PT9A 4BO6A 1B2RA 4DDUA 3U13A 4EPWA 4R8KA 4KAAA 3WLPA 1RJ9A 2I67A 3IT0A 1PS8A 4RPKA 3O1IC 3O3NB 2X3YA 3CS3A 4DARA 2WF8A 2XZOA 4AM8A 4XM2A 3TF5A 2ZSBA 1TQDA 2P7IA 5HSGA 4UHDA 1O6GA 1TUGA 3C7DB 1KJNA 1K08A 4IO1A 1GZHB 2CL0X 1P3JA 4ZJUA 1WTCA 2VWQA 4LF4B 1TC2A 3DJYA 1JMKC 2B0JA 5KREA 2WNSA 5AJHA 4UTPA 1G7RA 2GWHA 4JCOA 3ND6A 4HK4A 3S1AB 2D5LA 2WOOA 1W93A 4RVHA 4EJ2A 1BXRA 1E59A 1QPGA 4JI2B 2C20A 1KRWA 1ENYA 3BE4A 3MGCA 3THXB 2P7HA 1FNCA 1WPXA 3K0CA 1ZHOA 3GN2A 3VH3A 3KEMA 4O2AB 1GT6A 4LZWA 3IUSA 4KSCA 4MVJP 1CF4A 4C0LA 1B23P 2VK1A 1PX2A 2ZSDA 2VZLA 4HXGA 1V6AA 2EWVA 2C1ZA 2R6GA 5D3KA 5ALHA 5K6AA 2QTWB 3CZ9A 5K6RA 3ADDA 4U7PB 2GYYA 4G5OA 4G5SA 1HSZA 2CUKA 2P1ZA 4HMPA 1O87A 3TUJC 3VISA 1E96A 4DWWA 4K1XA 4ZCRA 1R0RE 3R7DA 2B3TA 2BPOA 3DAYA 2J0VA 3F1LA 4OI2A 2FUG1 3HZHA 4WKPA 4EKYA 4TV9F 1P7YA 3KPUA 4HBZA 3NS7A 4JBLA 1NV8A 2FUCA 1USIA 1A1SA 2NSDA 4ARSA 1FA9A 2G0TA 4MQLA 5LZ2A 1E2QA 4LMRA 2WWGA 4M9QA 5GAJA 1QH9A 1TIPA 3KWMA 2BFNA 5G4KA 5M04A 4CT0A 1PZXA 1ZK4A 3GFSA 2CHFA 2P75A 1DDIA 1G20E 1U31A 3S8YA 3E7FA 4WFKA 2G7ZA 5H59A 4EM6A 2PBZA 2I2WA 2JIZD 5IXYA 1YOVB 3H8WA 4EA6A 1CZLA 3V4ZA 1H93A 4MLDA 5C32A 5F98A 1QP8A 3R7LA 3AVTA 1GLVA 1S7GA 4GQBA 1DAPA 4J16C 3HV0A 4U02A 5GMOA 3MT0A 5ITWA 1ZC4A 5KOJA 4J7CA 3WGZA 1QYXA 5G02A 3F2IA 3HDGA 1GQQA 1JTEA 3AONB 3CT6A 4PRYA 5LB2A 3DLHA 4QT0A 3AHGA 2YV5A 3DD1A 3EULA 2Z2YA 1ZEMA 2IEBA 4M7RA 1ZN8A 3SYLA 1SOMA 2V6JA 4OBWA 2Q4EA 4PPFA 3MLBA 4N82A 3LZ6A 3FB4A 4HQFA 3PFHA 1GLNA 2QTLA 2P0AA 1L5OA 3L05A 1XAJA 3QEKA 2ZAIA 4O33A 4PSAA 3AESB 1J0CA 3QQPA 4DM3A 5HBRA 1S3FA 4UC0A 2W8BA 4PTZA 3BM5A 4P82A 2P9QA 1W73A 3WYNA 2ZIAA 5HUQA 1JR6A 4KCGA 1NVAA 1RIFA 4C21A 3WC4A 4KWEA 4RFLA 4P32A 1OTXA 4ONEA 3TSOA 3NRCA 2W6ZA 5J5VA 1TU3A 3KB2A 2Z2XA 3WMXA 1K9VF 4C5CA 2QV7A 4JP5A 4MOWA 3VPAA 1RACA 2HPAA 1LW7A 2Q4OA 3DM5A 2XYHA 4DREA 1IEQA 3RVPA 3K35A 4EW3A 3PT9A 3RUHA 2AD1A 1RZVA 5CT4A 1NVXQ 3WP0A 3KB8A 4MHOA 3N05A 1ADBA 1XZCA 5EIHA 3QTBA 1BROA 3JYHA 3N0XA 3HBFA 4IIHA 3KE8A 4TVKA 5IX8A 3KK0A 3T5AA 2X0NA 4KREA 2GK7A 4FX5A 1QP4A 4EWLA 1DKOA 2KPOA 4G8JA 5FOQA 3AEQB 2PFSA 3PYLA 4BVLA 3FZYA 5DSZA 4EFLA 3AJDA 4EKDA 3H2HA 3BQMB 4QE3A 5AHOA 3NFRA 1JJAA 3DO8A 5GONF 5LOVF 4WY2A 1C3JA 5BV2P 4K2AA 4WZBB 3IUYA 2PRKA 5ALKA 5JMWA 1W47A 2OL4A 2WZBA 4AS2A 5DNVA 4UVHA 1J70A 4KLAA 2RGRA 5JWHA 2VNKA 1IY8A 2GVNA 4TWRA 3E03A 2QZPA 2J07A 2XB4A 4AMUA 2GTPA 1M8KA 1I2CA 2I7XA 3BTVA 3CISA 4QG7A 4Q21A 5GGYA 3A9WA 2DQYA 4EB6A 4FOTA 1OYYA 3O31A 3NP9A 4ES6A 5F2KA 5B12A 3PUWA 2O8CB 1QHFA 2VL7A 2QI9C 1WP4A 1PZMA 1XEFA 2YXPX 4DJFC 3IUEA 4JKIA 1SZPA 5FOWA 2IPXA 1TO1E 4CMIA 4N3AA 1IWPB 2Q3JA 1PJZA 3AVXA 3R3WA 1MAAA 3A28A 1FMFA 1FL9A 1I33A 3LQKA 2PX5A 3PKIA 4KV9A 3UK0A 5BN4A 3HLKA 5M2QA 1E0SA 3PI6A 4EAQA 4CNBA 4X7RA 2GN2A 5SY4A 4AQ7A 3PXXA 5T67A 1L7NA 1UWVA 5CDYA 1ZUIA 2J9ZB 2JCXA 2O7NA 4I3FA 4Y9UA 3BHIA 2VTDA 1ZKDA 4PG5A 1KE2A 3X43A 1MW9X 1W76A 1ZWLA 2IOFK 3OVMA 4B7AA 5FD8A 5BSGA 4DDVA 1GA4A 3FZGA 4MKXA 3F73A 1U3GA 1P81A 2F7SA 2I3ZA 3A9CA 5CA0F 3RWBA 1RWQA 5DN9A 4WACA 1SUBA 1YRYE 2UYOA 4N6NA 1TMYA 1FEZA 1SUAA 2PV7A 3FNQA 2N9UA 3QW2A 4JMLA 4B8WA 4C1NA 4D82A 5K3OA 4WCDA 5TS2A 3PGKA 4F3YA 4IF6A 5DCWA 2Y1CA 5FTLA 2HK6A 2Y27A 2XXAB 1AK9A 2P65A 3QV2A 2FG5A 2NW6A 1UP4A 1KC1A 3OOWA 1KIMA 1CR1A 1C7RA 2FWJA 5L3RA 3TSCA 4PXYA 5AVYA 2WYWA 3BMOA 4NI5A 3U56A 1XGKA 1BCRB 1E5TA 4MW4A 1B0PA 1M2HA 3OQVA 5KTOA 1C9KA 1PU2A 2CE7A 2M6RA 2ZYVX 3NJRA 4L22A 3WLAA 2PJRA 4G5GA 3AMVA 3LA6A 1BEUB 3RIGA 3VKFA 4IH1A 1NVDA 4BNGA 3OIGA 1J8VA 2G80A 1UBKS 3HDYA 4AJ1A 4GBJA 1SXPA 4MUIA 2QN7A 3C14C 4KAFA 4F85A 1SCUA 4DC9A 3EZGA 2B6HA 1EVLA 1LDGA 4WESB 4NNPA 3VSBA 1ZNXA 1YDMA 3ZR4B 2ZJBA 2GPSA 2POCA 1JEYA 1EXVA 1MAHA 1A4XA 3L7NA 1YQQA 2RK6A 1QM5A 3D8HA 3ZDDA 1E0KA 1ABBA 3LC7O 2FLVA 4ZQEA 4RGYA 3KR1A 3MUOA 5T64A 3FYUC 3PJDA 1O9GA 3C8DA 5C7OO 3MAGA 1EE2A 4YCAA 4LHZA 4CCSA 1Y1KE 2FWRA 4MWSA 4OXNA 3K31A 1OLOA 4PG4A 3JQEA 3S2EA 4C0HA 5JSHA 1YF3A 3L8DA 3BC1A 2VLBA 1AB6A 4O4IB 1XK7A 1JYFA 2IIQA 3E3AA 3LDUA 3P0IA 4GOKA 4JMPA 4K5QA 3JWPA 1UK8A 4X95A 1KJQA 5IKEA 1D1PA 1RAGA 3ADKA 1KO8A 2X2EA 4J6FA 1EINA 2NPOA 2TMKA 1LNZA 4H9GA 3L6DA 1U94A 4KMMA 4KX3A 4KUGA 3ICVA 2P3OA 2X58A 3DT6A 3HB7A 3NHFA 4MS1A 4FD3A 3QX8A 1JZSA 3OT1B 4JLPA 4B87A 4E46A 4HGQA 3AU9A 4R1TA 4M89A 1R0LA 3H83A 3KDAA 4XIIA 3KRTA 3PS9A 1YWGO 1JAHA 2FEOA 1OFVA 1QIFA 1ZOIA 1PLKA 4ALIA 3PWTA 3WHPA 5IT5A 1MV8A 2ZXFA 1PJTA 3WB1A 4UNQA 3WNDA 3HVHA 3ZBPA 1DTEA 4XR4A 2VRBA 5E1MA 2Q2NA 2QENA 3IA7A 3LQYA 4R2KA 4MWEA 3CEAA 3ZU3A 4R5HA 4D4KA 1SC9A 4P80A 1ZAYA 3SZOA 1FYDA 1QONA 3BYZA 1NLUA 3I64A 3IJPA 2C83A 3VXKA 4ZRDA 1KORA 1VCHA 2H00A 3UK7A 3W79A 1KAQA 3UOGA 1MOQA 3NBUA 1XDGA 4FFPA 1LRJA 2XVMA 4DSNA 4ZN6A 2X5JO 4Z5XA 5I7EA 2Q2WA 5JSZA 5L40A 4J0HA 3PIRA 2FN9A 1Y7HA 3LX4A 4BGEA 1DFHA 1BVHA 4YI5A 4GP6A 4G85A 1H4VB 5CFMA 4XSGA 1U7OA 5L7WA 1A9ZA 5GP1A 3ZDFA 1KYVA 4LJ6A 4CFZA 2PZLA 3M0EA 5LP6F 4CF3A 3QI2A 3ABQB 1W5BA 5L6MB 5CAEB 1SBCA 2PGXA 3D43A 1J56A 2I7DA 1UC4B 5DH9A 3SF8B 2FZWA 3BEOA 3D2CA 2EP5A 4MX8A 5EJIA 1R8YA 2I8LA 1ZK2A 4FFVA 4LRYA 3U7GA 1UBLS 3K6SA 2Q29A 4HNAA 1SPXA 3FDJA 5C52B 4RPGA 2C07A 5SICE 3IDAA 1D2AA 3TS1A 3J7AC 1FTNA 4ZT4A 1NM5C 3OPXA 1F8UA 1U02A 3UTCA 1IM5A 1FYVA 3HUTA 1P72A 2ECFA 4PX9A 3PX7A 4JNCA 3VNAA 5KDLA 1ZNZA 3ZGLA 4Z4CA 5CX1B 2FKNA 1SCAA 3S70A 2X6QA 5BMVA 4ZK2A 3LBHA 1NT4A 3ZZUA 3VU1A 2Z6UA 4WNAB 4XW2A 4HWPA 5HMMA 4IV0A 3G3EA 3OP1A 4GPAA 5LLDA 5JH7B 1BJRE 2ADMA 2HMAA 2JS7A 3CVWA 1EWTA 3RB8A 1WMSA 3DZDA 1DFIA 1X7XA 3O03A 4URHA 1Z35A 4KNWA 5JNLA 1B26A 3Q0EA 1O95D 1N1DA 2PUHA 1WSAA 2QUHA 4QD3A 3OO0A 3IHTA 1HQKA 1Z4QA 5E7JA 3I1FA 2JI8A 4YAWA 5JVDB 4BQIA 4ISCA 5C5IA 1JHZA 3SZRA 5IDVA 1P33A 3BMNA 3OY7A 2OYSA 4NEGA 4UE3S 1QGDA 1WXGA 1FZTA 5G2OA 1EXWA 2XUIA 3FBGA 4LCBA 5TMBA 1L5FA 3TIIA 4DV4B 3T15A 1MH1A 1VBKA 3MJDA 2PGOA 4LKOA 4P4NA 3DAPA 4Q16A 2BE9A 4A8JB 2BFCB 1DTWA 1T6ZA 2FV8A 1CW2B 4K0KB 3BGOS 4PRKA 4YRLA 5TEVA 4MV3A 1JSZA 1LLCA 1O97D 2OCPA 1T4BA 4JIGA 4L4RA 4P38A 4QRHA 4DEXA 2QX6A 4WCVA 1RVV1 1Q7EA 4BMPB 5A2GA 5DM70 3ZJYA 1IULA 2V7TA 1DAEA 1RRMA 4RESA 4Z4GA 2R5FA 2PGDA 3T4EA 3A6HA 4DR4B 3C6ZA 5FI0B 4D5GA 3N2NA 1DX9A 1OWMA 1ONPA 1QB7A 3PJGA 5HIJA 3V46A 2B82A 5DLDA 2GHQA 4CG2A 5C3UA 5ITSA 1X7YA 3AY7A 1VDZA 3JQQA 4WBNB 2W37A 4MQBA 1EKXA 1RTTA 1Y4ZA 4TROA 1C8KA 3TRIA 1BX1A 2GEDA 1XMQB 2YFQA 1TAUA 1Z6YA 4MP6A 4X9XA 4B46A 3B60A 5EXXA 5LDGA 1GRVA 3T3PB 1UBHS 4CIBA 2PMKA 1BYUA 1P6XA 2CF6A 3K6KA 3GT4A 4K7JA 3HE3A 5HJEA 3K70B 1INLA 3HGMA 3FKSD 1JUDA 3S2SA 1R74A 5LZ9A 2LPMA 3ECCA 3MTQA 3LBFA 5JXJA 4IPTA 4TMVA 4G01B 3RFVA 3SIWA 2HU8A 5KQRA 1Y89A 1WU8A 5L7TA 1W5FA 4FEAA 3WGLA 1E1KA 2OXEA 2GBCA 4HYEA 2OENG 5D8DA 4C06A 1XFDA 2CNNA 2EARA 3I5AA 5C4IA 3GFRA 1G5HA 2IL1A 2J6CA 2CD9A 2XT6A 3KYCB 4C1BA 2CJWB 3S2YA 4WVLA 2Y4NA 3KM0A 1G7TA 3J80A 1RDFA 3C6QA 2DUWA 5G0TA