4OK6A

Crystal structure of hepatitis c virus ns3 helicase inhibitor co-complex with compound 13 [[1-(2-methoxy-5-nitrobenzyl)-1h-indol-3-yl]acetic acid]
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
445
structure length
430
Chain Sequence
TDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLINAVAYYRGLDVSVDVVVVSTDALMFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated strategies for identifying leads that target the NS3 helicase of the hepatitis C virus.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease NS3
total genus 141
structure length 430
sequence length 445
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4ok6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok6A01
4NYJQ 1G7CA 3FHTA 2H8KA 2XZLA 1P2UA 4EFNA 3U5ZB 5KDDA 1OHHD 4PO1A 3EX7C 4ZO4A 4URYR 4QRHA 4ZDKA 4A0RA 3X1WA 1Z8FA 3I1FA 4TYPA 2FG5A 3BFXA 1ZM2A 3HYTA 3TNFA 3VAAA 1DO2A 2EW1A 2OO7A 2OBMA 2KI5A 1ZC3A 4AG5A 4JKYA 1AKYA 2A5GA 2VEDA 1FTSA 1GOTA 2ASEA 3RRZA 1XJ0A 1PLJA 2JLSA 4FXPA 1DE0A 4OQXA 2XJ4A 1VMAA 2DB3A 5EE3A 5GJVC 4U00A 3B60A 3QE0A 1XWIA 1VPLA 4GFDA 4RD2A 4Q1DA 3VKGA 1OLOA 3W3AA 1US8B 1UJ2A 3Q7QA 3SC3A 1Z28A 2W6IA 2FMXA 1U8ZA 2X19A 2EYQA 3UMSA 1D9ZA 3ONWA 2GTPA 1SGWA 3CUEF 1EFTA 4A9AA 4L4UA 3PUYA 1ZUHA 4JIMA 5K8TA 5CIWA 2F6RA 4YXWD 4OHWA 1R5BA 2D2EA 3TIFA 4W7SA 4BZPA 3RVBA 1S2MA 4IEEA 1CR4A 1CIPA 4DLRA 2GVDC 3IEUA 5BN4A 1KYIA 2AX4A 5IK2A 1GRQA 5JWHA 2GK6A 4HLUC 4ZDJA 2IYLD 5IDVA 1RKBA 2GK7A 4UQOA 3KQKA 5H8WA 1ETUA 1KMHB 1R0WA 4KCGA 4CGZA 2WIAA 4AKGA 1ZM9A 4P4UA 5B2ZA 1LFDB 3BD9A 4BFYA 1W0KA 1E94E 1NVVQ 4Q5IA 1NL3A 4I1UA 2BIFA 3TKLA 3DHWC 1A7JA 3QVVA 2WSMA 1AN0A 1I4TD 3TUIC 5BN5A 2P5TB 5KDLA 3GMTA 3DVLA 5FOVA 3W34A 3BS4A 1NSTA 2CMKA 2ZRMA 2QMUA 4Q7MB 3CF0A 5AK0A 2WHXA 1RRCA 2PX0A 5AUPB 1Z47A 2VRWA 1XXHE 1NY6A 5JHHB 2FFQA 4LRWA 4BEBA 1MRSA 4C4PA 1A2KC 3AB3A 1P75A 2DHRA 3LFUA 2XEXA 4M9ZA 3OIVA 3OESA 4I1VA 4D81A 2QMOA 4BFZA 3X1XA 4LX0A 1D5CA 4DT1B 4B71A 1ZMXA 4JVLA 1W0JD 4M9XA 3ZDQA 5JHGB 4KV9A 2VHCA 4JYCA 4XVRA 1E9BA 3ZZ0A 1RIFA 1TAGA 4EAQA 2A7QA 3N5CA 3ZLJA 1EGAA 2AKAB 1TUIA 1TQDA 1DBSA 1A82A 1EFRA 1TTTA 1OXUA 3OFNA 3A4LA 1CR1A 4C30A 1BMFD 2J87A 1T91A 3SJCA 1KI1A 4TZ0A 3EW9A 4MYUA 4PC6A 2ZI5A 4G3XA 1VYTA 4O0MA 4JKIA 5J4KA 4PZYA 2GAAA 1DOAA 2I1QA 2JASA 3AKCA 4ON9A 3GLIE 4WAUA 1BYIA 4BLOA 4MRVA 1NI3A 4I1SA 5EQTA 2NZJA 2QMEA 3L0SA 3IKJA 3OEHD 1XRJA 1GDDA 4M4SA 1NF3A 5BW8A 4CEIB 1DAMA 3SR0A 3THXA 3DEFA 4M2LA 2O8CB 3H2YA 3T06B 4HZIA 4S35A 1AGRA 1Z6YA 2AWOA 3BH7A 4RCYA 3T1VA 1X8JA 1IN6A 4D0LB 1QG4A 3T12A 3CX7A 2EWWA 3RNLA 4TL6A 4A2PA 4Q7LA 4DDTA 5G41A 2PT7A 1S96A 2NGRA 1LV7A 1E9SA 2QTFA 1MO4A 3LW8A 3HR8A 3SEAA 4Q4JA 1US8A 1E1RD 1KKMA 2RGBA 3SQWA 3U7GA 3ADBA 1MRNA 2BJVA 4IVQA 5J4LA 3GLGB 2ZJBA 2HYDA 4Q18A 3A58B 1QVRA 1YE8A 1SHZA 4DJTA 2EFHB 2DWOA 2ZRIA 3WBJA 3MGCA 1OKKA 4YONB 5HTKA 1E9DA 1XBTA 2P6UA 4C0BA 1XXHA 3UATA 5TARA 1M74A 5FUXA 2VP2A 2G0NA 2VHQA 4H9GA 1HE1C 2FFHA 3QG5A 3TE6A 3QG1A 3WXMA 2QEQA 3LLMA 1E3MA 1OFUX 4RFSB 3QJYA 4Q47A 4B6EA 1Z6AA 4G5OA 3WYFA 5KO2A 4H1VA 4B74A 1EWRA 2EWVA 4DSUA 4Z8YA 1VG8A 4QHTA 1J2JA 3CF2A 1P62B 1ONBA 3GJ7A 1P9NA 3E5HA 2AK2A 3K0FA 4HB4A 4R2IA 5EUMA 4YXWA 1GTVA 4JBWA 5F9FA 2W58A 3TSOA 2O8EB 3KKMA 1VTKA 5ELXA 1ZD8A 5E7JA 3EZ7A 1TU3A 2IC5A 3UANA 2QP4A 4Q4HB 1U81A 3VR6A 1G8HA 4GOJA 3BFVA 3RS7A 2NO9A 4WW0A 4PPNA 2ZVPX 1KTVA 4BUJA 4G0NA 1X6VA 2ZRNA 1WXQA 1XMJA 3MFYA 2FFBA 3LW7A 1OB2A 4RSGA 1GRNA 1N5KA 2OFXA 1XTQA 3FE2A 4AC9A 1J8YF 4Q9KA 5DNYB 1JJVA 2J3EA 2DY1A 4Q00A 4IDOA 2CJWA 2XAUA 2EQBA 3IQWA 1TU4A 1QHYA 2CL6X 4Q4AA 1QDEA 4ERNA 3U6KA 3K8YA 2IYUA 3NEJA 3H84A 4PAMA 3HU1A 5M04A 1XB2A 3OE7D 4JVMA 3RRMA 5K8IA 821PA 1KMHA 3GFOA 5LDDC 1T0HB 3VTKA 2BCGY 4HDQB 1LNZA 3QKSB 3V9PA 2A78A 1U98A 1G3QA 1RYHA 2VHJA 4AKEA 1GILA 4GP6A 1XMSA 3Q5EA 4QJ5A 2UKDA 2ZAMA 1CS4C 2PEZA 3HJNA 4TL9A 5D3MA 2RHMA 1SKYE 4TLEA 3GQBA 5H68A 1N6OA 4BZXA 1FW6A 5DI3B 3KFVA 2FWRA 2GAOA 1HE8B 3TGPA 2OE2A 1G7SA 5EZ6B 3IPXA 1EESA 2DFTA 3EIEA 1S3SA 3NIBA 4KBFA 4GDFA 4DC9A 3LXXA 1OYYA 4BFXA 3H1TA 1XEXA 3AVTA 2GILA 3LAWA 5L3QB 3JVUA 1N5IA 3EIQA 3JVVA 4KFRA 4DWJA 2C5LA 3REFA 4YDSA 3WMGA 4V0ME 1KSHA 1UF9A 2QT1A 4KYIB 3GLGA 3P26A 3AGQA 1WCV1 2WWHA 1Z6GA 1QHIA 6Q21A 4MGZR 1PZNA 1W2HA 2D06A 3SJBA 3VR3A 3CRVA 3E70C 1ZNYA 2XTMA 4RD1A 2WSSD 2FN4A 1MR3F 4LK2A 3EZ2A 1W1WA 3KTAB 4ZCLA 2RGAA 2E9SA 3GJ8A 3QEOA 2IW3A 3PCRB 5DO9A 1YU9A 3NTUA 3NC0C 3NVAA 1FL9A 2QROA 3SOPA 3SHFA 3VNUA 1SQ5A 4IDQA 2OCBA 3BERA 4WXPA 3D7MA 1QG2A 1ZW6A 4Y0AA 4Q1BA 4WOPA 1KIMA 2PL3A 2ZYUX 4CEIA 2JLVA 2YV5A 4LV8B 2C96A 3KXKA 3Q3JB 4IVPA 4KVGA 4LJAA 4PPGA 2G83A 4A15A 5DLQC 2WZQA 2H16A 2XTNA 3GLGE 1KAGA 2OCYC 2BM1A 2Q3HA 2MSCB 3T35A 3V00A 1W44A 1GRRA 2V1UA 1WE2A 3BK7A 3PITA 4PTLA 1N5JA 1G3UA 4Y0VA 1YVDA 4PHTA 1DARA 4DVGA 5DE3A 1J7KA 2JLRA 121PA 4LI0A 2AFIE 2P6NA 5BN3A 2IS1A 1ESMA 5KHOC 2VP6A 4DB2A 3MSXA 4HB0A 3JZMA 2BEJA 2C99A 3OEEA 4Q21A 2GCPA 3DMNA 2OCPA 4QJ3A 2CEAA 3PFIA 1FFHA 2QQEA 4RFSA 3QKTA 3I8XA 4IFEA 3GJ3A 2W0MA 3NBZC 4G5RA 4B3GA 1RC8A 1COWD 2ZPTX 1P72A 2AXPA 3SYNA 1E79D 4P32A 1U0JA 4Q9HA 3I5XA 1JR3D 1PUJA 2ZR9A 2QRZA 2ZQ5A 4OQFA 1N6HA 1XMVA 2JJ2D 3MG9A 3K70C 1YZQA 1A2BA 1FPMA 1AS3A 1TF5A 4JT2A 5JLJA 4DB4A 2WM9B 4D6PA 1OFHA 1K6MA 5EZ5A 2P0EA 1N6NA 4HLDA 3VR4A 4IOJA 4B48A 4POAA 2CHVA 2CL0X 1ZJ6A 1RVDA 3IIKA 3TAHA 4DKXA 3RAPR 2H5EA 1Q20A 3FYHA 2R6GA 4AI6A 1XJQA 4M0LA 2V7QA 1JXOA 721PA 4IXMA 5AJZA 3AF1A 1Q3TA 4CEJB 1XU4A 4UNRA 3T34A 2CJWB 2YWGA 4NCHA 2XXAB 1Q21A 3MD0A 2DR3A 1XNJA 3UG6A 4YMVA 1EFHA 1AM4D 2ZE5A 2PZFA 3PJRA 3RWOA 1KK3A 2WSSA 3Q7PA 1G291 1M8PA 2GXSA 4AWXA 4X8OA 4PPFA 4EQ6B 3R9IA 2P3SA 3CF6R 5CM8B 3AKEA 2GZHA 2ZYTX 2IYYA 4A6PA 3UIEA 4BRUA 2HCBA 3U7HB 4Q66C 2PMDA 2YWHA 3IEVA 3LDAA 2G3YA 3MWYW 1GKYA 1FQKA 4WZBE 3Q8XB 4GP7A 5FBLB 1AZSC 3U6BA 3AVQA 1KI3A 3IQXA 2C77A 3BC1A 4RZ2A 3GJ0A 3SS8A 5FTNA 5ANRB 1ZU4A 5EP4A 1T3HA 3KJHA 2GKSA 5JWOA 4XWOA 1KI6A 1VIYA 3BRWD 1PV4A 1JALA 4ARZB 2QL6A 4Q01A 5H1YA 2OT3B 4M53A 2ZIAA 4LYFA 1F2TB 1L4YA 2MSDB 3ND9A 4LZZA 3ZVNA 2G1JA 2CCGA 1KK0A 4MKHA 4ZIRA 3KUCA 4ZCMA 5HR5A 5FOWA 1SXJA 5C2JB 1TMKA 2IYVA 1E1QD 2IA5A 4A6XA 2R6FA 2CL7X 1CU1A 1E9CA 3AVPA 4QHSA 2ORVA 4TYYA 3OHMA 4DSTA 1U9IC 1YZNA 2C9OA 1E2DA 5IT5A 3KJIA 1KI8A 3EZ6A 1W2GA 1JJ7A 3QIAA 2BMEA 4KODA 2WKQA 3ZH9B 4C0JA 1Y63A 5GJCA 3GEEA 2O52A 2MSEB 3ETLA 3IPYA 1ZUNB 4HI0E 4QC2A 4WZAE 4R7ZA 1Z0KA 3ADKA 4AKIA 4PC7A 4OJKA 4DCVA 5KNDA 5KPDA 1YHNA 3CPEA 5KSPA 1B0UA 1G8YA 4EPVA 3UMFA 2R62A 4KSBA 2QORA 1EK0A 2O8FA 3M6AA 1G7TA 2AHOA 5BYJA 1SVOA 3PUZA 3GCGA 1MO6A 4EJSB 5L3VA 1YR8A 621PA 1PJRA 4G5GA 4JLDA 2P65A 4A82A 3KTAA 4D0GA 1FX0B 1KI7A 2VH5R 3A4MA 2IHBA 4DLSA 2J7PA 3KQHA 2BOVA 3Q72A 1M7GA 4JS0A 4EPXA 5JJKA 3KX2A 2F7SA 2ORWA 4B2PA 5CJPA 4A1FA 2B7BA 3DM9B 4JLJA 4LWZA 4S2EA 3W5JA 4NPHA 2RGDA 4TYQA 1YZLA 3NBXX 4HDCA 4KXFB 4YMUA 5LD2B 2OM2A 3R8FA 2RGXA 3RSOA 2RGEA 2OXRA 1E2PA 4MRRA 4LHVA 1W48A 3L82B 1G18A 3E1SA 3VKWA 3P1JA 1CTQA 3DM5A 5CLLA 5HE8A 3R8CA 1SKYB 4JLKA 2CXXA 3LH5A 2R6DA 2V54A 2J0UB 1E9FA 1A4RA 1G7RA 2GZDA 5FUWA 4A8JC 5CB8A 4F91B 1KMQA 4AK9A 4PR0A 1T5LA 2DYKA 2KBFA 4Z54A 3LV8A 4BQSA 1M6NA 4B3FX 4NU0A 5B30A 2P67A 1ZNZA 1Z08A 4HDOB 4LJ8A 4QGHA 2YVUA 4M1WA 2ECKA 2ZUDA 3IIJA 4IKEA 1S8FA 2GHIA 1TQ4A 1GL6A 4NCJA 2IEZA 3MAAC 3FPAA 4YQFA 3KJEA 2AXNA 2IF0A 1G5TA 1H8HD 2QAGC 5HCNA 3FFBA 3L0IB 4DIDA 1W4AA 4PC1A 2C9CA 1Z06A 3SI7A 1JAIA 1NBME 1GG2A 1TX4B 3CIOA 1Z0FA 5KPJA 5B58C 4JLMA 4TSFA 4LJ7A 3R9XA 1FNNA 1AQYA 1ZRHA 2FGJA 4LHWA 2O8BB 4LJYA 2ORIA 4G1UC 2X77A 4G5SA 2BKEA 3AVUA 3CNOA 2XGJA 3CONA 2VYFA 2ZI6A 1Z29A 4ZIRB 2DFKB 4IEIA 2CLDX 2C78A 2GDJA 5EP2A 1DPFA 3A1VA 4PAQA 4NKRA 4NBSA 5JEEA 4C2TA 1QZXA 4R71A 2JIZD 4V0NA 2G1KA 3P27A 2QG6A 4EKDA 1BKDR 4EQ6A 1W5SA 3LWNA 4CT4B 2F55A 3CX6A 3KDSE 1GWNA 1O87A 2JJ2A 1X8LA 3AP3A 1K5GA 2QZ4A 5FPSA 4HUQB 4RZUA 5J47A 1BOFA 4LUCA 4FMCB 2I4IA 3FKQA 2XOKD 2QTHA 4PHGA 2JLWA 1W4BA 1ZIOA 1D8TA 1T5IA 2B92A 3HP1A 2RCNA 1CRQA 4QBHA 2QGZA 1KO4A 5FPKA 1ZCAA 2ZUBA 3O47A 4KFTA 2FH5B 4B76A 2BM0A 5FBRB 5C4GB 4ARZA 5DIFA 4KSCA 5LB4A 3KFXA 1KI2A 3WNBA 2O8FB 4JT4A 3NBYC 1HURA 1OV4A 2OXCA 4NL4H 1JPJA 5P21A 4DCNA 1IXRC 1IOZA 1JQJC 2AD5A 2XB2A 2N1BA 3AUYA 3QUSA 4CDGA 3W8RA 3PEWA 2EU8A 4B2IA 2XB4A 4WVFA 2XTZA 4WXRA 4JL8A 1IY1A 4O2LA 1MKYA 3RABA 4FN5A 5C1BA 3HU3A 4F92B 4B6FA 3I3SR 1PVOA 1E32A 2ZSBA 1XTSA 4ZPXA 5FL7A 2ZSDA 1QF9A 1XCPA 2FZ4A 4K81B 1CR2A 1KGDA 4JMPA 4URVR 4C9BA 5TDHA 1ZAKA 3T1QA 2ANCA 2VF8A 1RRGA 2CNWD 4RFVA 3GPLA 3FOZA 1IAQA 1NJFA 2IT1A 4TMKA 2O0KA 4JYBA 3I73A 1G5RA 3GFPA 4DLXA 4FCVA 4ESHA 1VCOA 2GJSA 4UXJA 1R7RA 2WWWA 3HPQA 1HQCA 4NDZA 3SYLA 3LVRE 4CF7A 4N0EA 1KI4A 1P7CA 3QF7A 1NVUQ 4NTZA 3THOA 1E0KA 2CVHA 3HYRA 2ANBA 2PEYA 2IYRA 4RKFA 2WMOB 3CH5A 1C4OA 5AJYA 4DHEA 3A1TA 2O8DA 1XTRA 4XTCS 1OXTA 4LV6A 1AS2A 1TQ6A 2GXUA 4FCTA 1WBDA 2BWJA 4Q02A 1P2TA 2V6IA 2LCFA 1KSJA 2REOA 1NN0A 3B85A 4URWR 4YC7A 3ZIAA 3REGA 1DO0A 3KJGA 1NKSA 2AWNA 5DHAA 2F1HA 3X1YA 4DSNA 2CBZA 2VSXA 5DISB 3SE0A 3BB3A 4LJ5A 2Q9CA 1Z0IA 3K0FB 4QNRA 4YLGA 1GITA 5HCIA 3RSLA 4B44A 1PLLA 3T5DA 2O8EA 1UEIA 5L3RA 4QM6A 1CJVC 3RS2A 4NYMQ 3SNHA 4OHVA 4D2IA 3P4XA 4GNKA 1NP6A 1II8B 4XH9B 1W0KD 1JQLB 3A8TA 1W36D 5J40A 3EZ9A 2BBWA 3EPLA 2ODBA 2EYUA 4LYAA 4CEHA 2NMVA 5EXPA 3AVVA 1KHTA 1E9EA 1FQJA 1KSFX 2YC4C 3AKYA 4FCWA 4B32A 3ZJYA 1Z0DA 3LBIA 2Q3MA 1E0JA 1R2QA 1JAHA 4GBMA 1NNEA 3SQXA 2JEOA 1OW3B 1CLUA 4BASA 4V0KA 4JLVA 4L8GA 4IDNA 2B8WA 2CHQA 5SZKB 1SVWA 4UKDA 3A36A 3I61A 4EPYA 1JXMA 1JBKA 1XD9A 4MUBA 2ZR0A 3LVQE 5TY0A 3MJHA 4WBSA 4M1SA 3AF2A 2HJVA 2N46A 4TWZA 1ZNWA 3F5FA 2CLSA 3PUXA 4PXAA 3RANA 2ODWA 4PQRA 2HLDD 3KQLA 4BLPA 4QGAA 1TEVA 3IBYA 3A4NA 3A1UA 1IJFA 1JR3E 2W6ID 2WOOA 1XX6A 1AA9A 2C2HA 4OHXA 4BGDA 1Z3IX 3C4JA 5DI3A 1E9AA 3WMFA 3LNCA 3BB1A 3BOSA 3K0AB 4I81A 3UWKA 4DDWA 5EJEA 4HUQA 5AWFC 4C0KA 1Z63A 2W2TA 5FPTA 3KZ1E 4R9UC 2QENA 3C16C 1DTSA 4W5HA 4RD4A 1XEXB 1FP6A 3QXXA 3GEIA 3G82C 1G8FA 2IYWA 3RC3A 1U8AA 1NSFA 5AJXA 1Q1QA 1W5TA 2J0VA 1ZC4A 2JLYA 3DDCA 1T0JB 1ZD9A 3CM0A 1D2EA 2WJJA 3ZQJA 3VQTA 2JDID 3T15A 5GJWC 3VR2A 4LPSA 4E07A 2AFHE 3I92A 4UNQA 1AS0A 2F3RA 2QP9X 2ZM5A 1X1SA 4QBIA 1NIJA 3OAAA 2FEMA 5C18A 4B3DA 4UXHA 2XXAA 4F4IA 2V8OA 1XPRA 4OK5A 2XZPA 2N42A 4LHZA 4EJSC 2ZJ2A 1NVXQ 2Y8EA 3E2IA 4NYIR 4PQFA 3IUYA 4R2HA 1JPNA 3K9GA 2O8DB 3ICQB 1N0WA 1U94A 3EWSA 4TLDA 5J4VA 3BJIC 3MLEA 4KLZA 1IQPA 1G5PA 2RGNC 4IJMA 2J41A 2BVNA 2JJ1D 4L9SA 2HF9A 2ZS9A 1P73A 4DBLC 4U7DA 4U5XA 1W0JA 4M22A 4KYUA 2JLQA 4NZYA 1L8QA 2IYXA 1NG1A 3QKRA 4D80A 1SZPA 5BQ5A 4BLTA 1KO1A 2GF9A 5JFGA 4LJ4A 2C98A 2WAYA 1OXSC 3W9YA 1FUUA 2X2EA 2K5UA 2ZYVX 4IHQA 1Z6TA 2H7VA 4PO8A 2IXFA 3NDPA 4JBXA 1CJTC 3ZQ6A 4CEHB 5FBVB 1LTQA 3NWJA 2D4HA 3RS5A 4JJZA 4AYTA 5F9HA 1G4AE 4Q1FA 3U44B 3KXLA 3MCAA 2QP3A 1G64A 2NPIA 3VNVA 4TLCA 2A5JA 4IOLA 2VL7A 4JLBA 2FEOA 2PCJA 3SU8A 4B35A 3DMDA 3QNUA 3IO3A 3VHXA 3UKDA 4O2RA 5IRCD 1NJGA 3F0TA 4PZZA 4DDVA 4UNSA 2DBYA 2FE4A 1U2RA 1ZBDA 4DUGD 2GEDA 5JSZA 3U3JA 2QI9C 4YMTA 2UZ3A 1Q1BA 3BBPA 3PVSA 4KO8A 4XJXA 1KI9A 1KZGB 3BXZA 3KL4A 5GJBA 2EFEB 4Z1MA 5GADl 1R6BX 3SYKA 1KDOA 1F2UB 5FUVA 4BFTA 5C46F 3T1TA 3U4QA 3AVYA 4LSGA 1P6XA 3ZYCA 3QI2A 3CZQA 2W83A 4MKFA 1YRBA 4XSGA 3FHOA 1FOEB 1ZVQA 1N6IA 1N6PA 1J70A 2CHGA 4JL6A 3VMFA 2GBLA 1T6NA 1S0UA 1RRFA 2VP5A 2OLKA 2WWYA 5JMTA 2VO1A 1II8A 1YR9A 2VTKA 1J8MF 3CLVA 1KNQA 5TV2A 2ODEA 1JEEA 1ESNA 4GOXA 3AV0B 1OIWA 2BBSA 2IUSA 4KFSA 2IL1A 4DXAA 2WBLC 4P4SA 3NHBA 5DI9A 3ZIAD 4JLNA 2JCSA 4Q4LA 4OK6A 3AKDA 1NBMD 3FB4A 2X1VA 3EC2A 3HWSA 4MKIA 4OQNA 4A92A 2ZJ8A 4LC1A 4MITA 4DLYA 1T4GA 3F8TA 2Q9BA 1BIFA 4B3XA 4KI0A 4MKGA 2J9RA 2RH5A 4RJLA 5CLQA 4DCTA 2F9MA 2OUKA 3BWDD 2WAXA 1E2QA 4LHXA 3M0EA 5CIQA 2F3TA 4DLUA 2WWFA 2ZITA 1M2OB 4TQ9A 2QQ0A 2MMGA 2ZI4A 1XZPA 3FMOB 1E2GA 2BBOA 5F3WB 1F5NA 2NG1A 3CRW1 1EXMA 2ONKA 1R5OA 4LGMA 4HLCA 1R0ZA 4LY6A 1G8GA 5JS7A 2H17A 4LBZA 4AIIA 1HTWA 4ZI2A 5JCZA 3KKNA 2F1JA 1SXJC 2P5SA 4CZ2A 1T3LA 4BE7B 1NMZA 1DG3A 4FMCF 3ZVRA 2G6BA 2OESA 4B43A 2AD1A 3O8CA 3V4RA 2O8BA 2JGNA 3BH6A 4LCBA 2NPFA 1G19A 4C0AC 1Z0AA 5GVSA 3ZS9A 1W36C 1RJ9B 4KLNA 4L5BA 2JLXA 4H1UA 2QPTA 2V7QD 4RD6A 3QOFA 1SXJE 2O0HA 1XCGB 3LBNA 3J81k 1Z83A 1PUIA 4RVCA 1R0YA 1ZCBA 2FPKA 3RS0A 1XEWY 2VBCA 5FBQB 1N0UA 3PR1A 2GNOA 3Q5DA 3NH6A 1E1QA 4HB3A 5FUYA 4YDHB 1S9HA 1XCMA 3SDZA 1UKVY 4LDJA 2VPPA 5JI2E 4PSKA 2HV8A 3WP0A 5K8LA 1E2IA 4Q4AB 1JR3A 2VF7A 4I99A 1VYVA 2GCNA 2H92A 2VSOA 2GCOB 1COWA 1J99A 2ZTSA 1Z5ZA 3OEHA 4FIDA 4ZKEA 3P4YA 4LC0A 3R9WA 2IXGA 1H65A 3AVXA 4O25A 4RZ3A 4UJ3A 1AQUA 4TN1A 1DAEA 4GT1A 3TSZA 1T9HA 4LOAA 1F2UA 3CKLA 3VU9A 2EFDB 4KU4A 2YYZA 3BH0A 5JJIA 3OE7A 2X2FA 5JJLA 4NE2A 3CX8A 3LD9A 3TH5A 5EE0A 3QEJA 3TAUA 2BV3A 1W7AA 4M1TA 3U44A 3DO6A 5KDOA 3U3RA 4D4KA 1KDPA 3GJ4A 3VR1A 2VIIA 5KTYA 3PENA 1L7VC 3K0CC 3QXCA 2ZS7A 4CW7A 3CWQA 1ZIPA 4PSAA 1GVNB 1DELA 4XWKA 4NYJR 1H8ED 3IDQA 1LW7A 1VHLA 2O0JA 2ZANA 3ASZA 4ITRC 1EWQA 2CK3D 4MGKR 1OYWA 4M1KA 2FPMA 4HAXA 3ZZTA 4KHZA 4RD3A 2L0XA 3B9QA 3B5JA 4M1OA 3DKPA 4GI7A 3ICEA 2A5FA 4W5JA 4D4LA 1FNMA 4JLOA 1QHNA 2WICA 1F48A 4Q1AA 1CEEA 3NEYA 3KKOA 4MQBA 4OKSA 4A36A 3O8RA 2FJUA 3W5IA 4PFSA 1NN3A 2V9PA 1XP8A 4TQAA 4ZI3A 2IS6A 4MYTA 1EX7A 4DDUA 2FNAA 2BC9A 2NOAA 3NHAA 3AF4A 2ZEJA 2XZOA 2DPXA 4URXR 1ZM3A 3GJXC 3L43A 3C14C 2V4ZA 2QTVB 2ERXA 2ZU6A 1UEJA 4MGIR 3BAFA 3IGFA 3RDPA 1WDTA 2F9LA 3C41J 3G0HA 5F2EA 2VP9A 4TMWA 1CJUC 1II0A 1HUQA 1G8PA 1G20E 2D7DA 5KSOA 1GNPA 2JAQA 2QE7A 4IRUB 1G6HA 5FBWB 1CXZA 4XD7A 4A0FA 1VG9B 4N1AA 4A0GA 2IEYA 3RRYA 3WRXC 2ZRJA 4JLPA 1OH8A 1N6LA 1F60A 3EARA 4C0SA 2JJ8A 4CIDA 1SHKA 2ATXA 4EIWA 2XNSA 4OL0A 3IO5A 1E6CA 2WWIA 1L2TA 3QPUA 1XPUA 5G40A 1TPZA 2NO6A 2R2AA 4V0OA 3WY9A 4AY2A 2C04A 4HLUA 3AVOA 4C3ZA 2IYTA 4FWIB 2QBYA 1M7BA 5E7IA 3TVTA 3FDIA 3FMFA 1UFQA 2VHUA 3D31A 2KSQA 3M4YA 3FVQA 3THYB 5CDFE 1NIPA 3AP1A 1KY3A 1KNXA 4BFVA 4PQYA 4IDHA 4HEJA 4EPTA 2GCOA 2FSIA 1TF2A 1W46A 4B33A 4QNMA 2F43A 1UBCA 2ZREA 4BLRA 1AIPA 3I62A 4HLQB 2J5XA 2CCJA 4Z51A 3QSYA 4MDEA 2CE7A 2WV9A 1IN7A 2QUZA 2BMDA 3G5UA 3P20A 2WWGA 2GVZC 5EE9A 3FMPB 4DCSA 3EPKA 3W8NA 1HT2E 2KE5A 1OB5A 2PZGA 3GLFB 2H1LA 3PXGA 4DLVA 3GLIB 4NYIQ 1U8YA 2O5VA 1W4CA 2UVQA 4GOKA 4IW3B 4ABYA 1KY2A 1M34E 3AP2A 1TQ2A 1G41A 1I4DD 3CRRA 3N2EA 2ZS8A 2NO1A 3D3QA 3ND8A 1UAAA 3SFZA 4CYMA 4GMDA 4M9SA 1HH4A 1FMLA 2XSZD 3AGPA 5EXXA 3H86A 2Z4SA 3ZVMA 3A1WA 1KJZA 3Q85A 2KBEA 5DGXA 4QM7A 3WRYC 2ZRHA 2J59A 1DAIA 3LBHA 4GPTA 5FTKA 2PX3A 4WIAA 2QE7D 2GJ9A 2HEIA 3QXHA 3NC1C 2XX3A 3SBDA 3KB1A 4QJ4A 2REXB 5J4HA 1PLKA 521PA 4TYNA 4FMBB 1NVWQ 5TXGA 5JCPA 1WQ1R 1LY1A 5HZHA 2ZR7A 3ADDA 2OLJA 2PZEA 3CZPA 4F38A 4EJSA 3I8SA 221PA 1QHGA 3LO5A 1ZD1A 5K8UA 5CK5A 3DZDA 2GJAA 4QL3A 3Q9LA 421PA 4V03A 2R8RA 1VCIA 2CVFA 2VP0A 1TL7C 4KBGA 4XWAA 2BKUA 5EP3A 4QBFA 4AKHA 4V02A 4MRPA 3ADCA 1BMFA 5FTJA 3FTQA 2W6JA 5CM9C 4PZLA 2OFWA 1UKYA 4FMDF 3IHWA 5A0FA 2CDNA 1UBGA 5BXQC 4LYJA 4B2LA 5BWMA 4LBVA 3B1YA 5EP1A 3F3YA 2Z5FA 3WYGA 2OCAA 4PHFA 2VP4A 3GFTA 4OQLA 2IF2A 3O8BA 3MWJA 1A5TA 3N70A 4C0LA 3CR8A 1QVAA 2FSGA 5EUQB 4ASUD 2G0TA 2QAGA 5EE1A 3UG7A 5FOSA 4TTPA 1RFLA 1UKZA 3PEUA 2OAQ1 2BBTA 2C9YA 1P61B 3CW2A 4TTQA 3U3MA 4ACAA 2GJ8A 3L8YA 3GJ6A 1IONA 1V43A 4LBYA 1IY2A 4HATA 3GLHE 2OBNA 2GXQA 4RD0A 5AJVB 3CPJB 1HYQA 4NYMR 4BFUA 3THYA 1DAGA 2RAPA 3B8HA 4KITB 3UWOA 3WYAA 4P33A 4BZQA 1A1VA 4IOKA 3BFKA 3C15C 2JIZA 2YJTD 4OQMA 4UNPA 5AR1A 4ESVA 1E2MA 1KK2A 1Q12A 3B9PA 4L15A 4Q19A 1YQTA 3T5GA 5CYPA 3U7FB 5HE9A 5L3SB 4LPKA 4LV5B 3PG5A 4HAUA 3U7EB 4M1MA 1VHTA 1ODFA 2ZJZA 3X2SA 4A2QA 1BO6A 5IHPA 1YRAA 2IK8A 3K9NA 3VKHA 2WJHA 5L8VA 4OI0A 1EX6A 1EG7A 1VG1A 2R9VA 3C7KA 1BH2A 3BE4A 2PLFA 1CR0A 4X8LA 5IF9A 2FSFA 3GLIA 1G17A 2W2XA 1E9RA 5KNCA 1W36B 1RZ3A 1G21E 3NBFA 1X86B 4EUNA 1IN8A 3ZS8A 1P9RA 2GEUA 4OHZA 1IJEA 1KO8A 4TLBA 1OH6A 4YMWA 4IOMA 4DLTA 3IBGA 3CWZA 3GP8A 2IWRA 4QOSA 3PEYA 2ZJOA 3AH8A 2EFGA 1RW4A 3FMIA 2QN6A 2BMFA 2GXAA 1G1MA 2AL7A 2RMKA 2ZRCA 4JSTA 3HPRA 4OI2A 4TT3D 3SN6A 4GL2A 1E2EA 2Z0MA 3CO5A 4P4SB 1YR6A 4F4CA 1E2FA 1VYUA 2WKRA 4NH0A 2QNRA 2C03A 1R5NA 2WVJA 4L9WA 2KWIA 4TL7A 3AUXA 1HQYE 3MRSA 3NH9A 3QKSA 4P0TA 1N2CE 3THWB 1IN5A 3SHWA 3EIHA 2ZJYA 2D7CA 4OYHA 2DWQA 1GL9B 4Q7KA 1SKQA 5EXTA 1GKUB 5D3MB 4FMDB 1Q44A 1FZQA 2QM7A 3TR0A 5LD2C 1KDRA 5JWRA 1P9WA 1AKEA 1SXJD 4HUTA 3EA0A 1WRBA 3B1VA 3EG5A 1CJKC 1E69A 2IUTA 2ZXUA 3A37A 3B1ZA 1MO3A 5J5CA 4MUAA 3NXSA 4BLQA 5HPYB 4DRZA 3KUDA 1SVLA 2YINC 2ZVQX 4URZR 4C7OA 4PC3A 3I4LA 1YZUA 2CLCX 1SVSA 1IM2A 1F2TA 3WNDA 1SULA 4TYWA 1D2MA 4M8NE 2ZI9A 1YZGA 3K09C 3SJZA 2QAJA 3VHLB 2ZI3A 4ACBA 1LS1A 3OZXA 1E0SA 1N6KA 1QBKC 3EWAA 2QSYA 1Z07A 1N0VC 3WBKA 1K8RA 3DPUA 3L0PA 3S1AB 5KOYA 1R8SA 4TMXA 5HKKA 5B64A 1OXVA 4PO9A 3AEZA 5JSZB 2ONJA 2EVWX 3JZAA 3EXAA 2W2VA 4TMTA 3KQNA 4UXIA 5DYIA 4ZDIA 1G3IA 5JRZA 1XTKA 1XEFA 3WMEA 4LHYA 1KO5A 2AKYA 3U61B 3LXRA 4UNNA 2GRJA 3PUWA 1NG9A 3I72A 1HY3A 4TT3A 3H0KA 3IILA 1B23P 3B7GA 2CCKA 4CRWB 5L3SA 1F6BA 3HU2A 3R20A 3HDTA 3OF5A 4TTRA 1KSGA 3NDBB 2J0QA 5JECA 3DOFA 3K09A 5AUNB 1FX0A 1DADA 1GL7A 3BB4A 1XD2A 1FP7A 3V4FA 3PV0A 2A3RA 3TUZC 2I3BA 2QMHA 2WPDA 1DS6A 2Z43A 3MMPA 3OIUA 4XOIA 3I32A 5EXSA 3U3OA 2HYIC 3UMRA 3NG1A 4Q03A 4A2WA 4KAXA 3FKSA 2LKCA 2ZE8A 1KJWA 3C5CA 1OH7A 4FI3C 1OJLA 1GSIA 2G9NA 5JEDA 2ERYA 3L2OB 2Q0HA 3GEHA 4DLZA 5SZHB 4IFBA 3K53A 4NCIA 4C2UA 2B8TA 4URUR 1JI0A 2ZRAA 1W47A 1MH1A 3ASYA 2QA5A 2R44A 2AN9A 5TB5A 2OZEA 1NRJB 5DN6D 4EDHA 3W6PA 2YOFA 1CRPA 1YZKA 4D0NA 1Q57A 3PEVA 3R7WB 2BMJA 4KVAA 2BJWA 4XVQA 4ZCIA 1QHHA 2YKGA 1E1RA 1OXXK 5SZJA 2ZRGA 4UJ5A 3X1ZA 4RKEA 3OFND 4PX9A 4A8JA 4MRNA 4M1YA 1G3MA 2WMNB 4OI1A 1Q0UA 2OFOA 2W0SA 3L8ZA 4Q48A 4FW9A 1SVKA 3OIWA 1Q3HA 3B1XA 3TQCA 4BRWA 1P3JA 2QT0A 2BEKA 2JLZA 2HCJB 4B75A 1CJMA 1I2DA 4HYYA 4A4DA 4NCKA 2GEVA 1CBUA 3DZ8A 1CP2A 4RZXA 5CDFA 4DLWA 2OG2A 1CF4A 2HXYA 4JLAA 3P32A 3PQCA 3T1OA 3U2QA 2DFNA 2WTUA 3DL0A 4NCNA 3TMKA 3RHFA 3IIMA 4G01B 1VCMA 4OHYA 1OT3A 4AG6A 1NVVR 1P2VA 3CNLA 1NLFA 4GZMA 2ZE7A 3TW4A 1XD8A 4F7WA 1E2KA 5A4JA 1G16A 1GIAA 1H8HA 1IN4A 2HDNB 2JDIA 2W6JD 1S1MA 3B13B 1UKEA 3KXIA 4WA7A 5FH9A 1UDXA 5A5GA 1OFTA 4D25A 3UK6A 2KJQA 4DCUA 1NN1A 3WNCA 5FTLA 2CNWA 1GM5A 4AURA 3CH4B 5FI0B 5JS8A 2WOJA 1VDZA 4HAVA 4PANA 1OFIA 3L0OA 1SVIA 3B82A 4B3BA 1Z2AA 3KQUA 3LA6A 4FD2A 2WJGA 1MABB 1S9DA 4ASUA 3K70D 1XTJA 3LX8A 4XIGS 1WF3A 3VU9B 2WPDD 5UKDA 4E5UA 1ZM4A 1HEIA 2OHFA 2Z6VA 4DUGA 3TVDA 5KYKA 1SXJB 4W9MC 2HJGA 2ZYWX 1QHSA 2VLIA 3QKRB 3X1DA 4GRAA 1VECA 2Q3FA 1WMSA 3LY5A 2ZRKA 4N3NA 4PC2A 4Q9IA 4Z8XA 4EPRA 1ZNXA 1KDTA 2F43B 3B6EA 2IUUA 2ATVA 1KAOA 2XNDD 1XFAA 3C5HA 3ZD6A 2CE2X 2OSBA 3B78A 3WHLA 2WJIA 3S1AA 1Y3AA 3A6PC 2GBLC 3LLUA 2D2FA 2SHKA 5FPHA 5LPNA 5CITA 5LB2A 1Q1EA 2PH1A 1JB1A 3QF4A 3H4MA 1T3SA 1V5WA 3RS3A 1FTNA 3LQRA 4GSYA 1G3RA 3K0EA 2ZRBA 2ZETA 2IS2A 4ZDWA 1NY5A 1XEWX 2QY9A 3DOEA 1RE0A 5FL3A 1GKIA 2I1VB 3QQ5A 3ZVLA 4EPWA 1FUKA 4QFMA 2P6RA 2XNDA 3FGNA 1TF7A 1O3YA 4Q1CA 3PUVA 2LWIA 3W90A 3QPVA 4MDFA 3GJ5A 4N0DA 4ZV4A 1U0LA 4G5QA 4F93B 2FPLA 2W00A 3TK1A 5B57C 3W6NA 2IBMA 1NLYA 3EZFA 3U60B 1IBRA 1UM8A 2D62A 4QXAA 4NMMA 1ZYUA 2ZRDA 5FTMA 3K0CA 3SBEA 2BDTA 2G88A 5CYOA 2A5YB 2R65A 2RKOA 2Q21A 5DHFA 1YR7A 4K46A 2PBRA 4IXNA 2HUPA 3THXB 2YOHA 4MH0R 2PJRA 5E3HA 1ZM7A 3AF0A 4P31A 4HZUA 4I4LA 4KJZA 1E2LA 2FF7A 1UBEA 2JATA 4R98A 1JNYA 2R6AA 4JZKA 4K8OA 3TUJC 2NO7A 2QRNA 2Q6TA 4US2R 3VX4A 1DVRA 2AR7A 2YZ2A 3R7WA 3RWMB 4MA4A 1E96A 4DIEA 5HKKD 1QHHB 5FL7D 1AZTA 2IWHA 2YWEA 1S4QA 2X8AA 2RGNA 4DSOA 3TSWA 2XJ9A 5AUQA 1R4AA 4QHYA 2CK3A 2QU8A 4OK3A 3T61A 1OKKD 1XPOA 3OIYA 3B1WA 3PIRA 1KKLA 2A5DA 1IHUA 3AQ4A 1OF1A 2PJZA 3DKVA 4PAOA 1GFIA 1U9IA 1GNRA 1KI6B 3SZRA 4TMZA 5E95A 3RRNA 1E2NA 1VIAA 1BS1A 4HAYA 3GLFA 1CULC 1TUEA 4LBWA 1TADA 1HT1E 4EFMA 1Z6XA 3QY0A 1OH5A 1YZTA 1P5ZB 5D3QA 3RS4A 2DFLA 2PMKA 1OE0A 2J7KA 2VA8A 4TQUS 2ZE6A 5H70A 2ZU0C 1OIVA 4D26A 1Q22A 3TQFA 1ZU5A 1JR6A 1Q1ZA 2FFAA 5DN6A 1HV8A 3SJAA 1X8KA 5BYKA 2YHSA 5FOTA 1RJ9A 3K0AA 1UBFA 2A9KA 2ZRFA 1IXSB 2GETA 3AF3A 4D82A 4C0HA 3UXMA 4CEJA 3D6TB 1DEKA 2V55B 3AM1A 5CB6A 4Q4HA 3EAQA 3TJZA 4QKQA 2GF0A 2YOGA 2TMKA 2J45A 3EPJA 4HAWA 2NO0A 3ECCA 2OV2A 3N2IA 3NKVA 4U02A 2D74A 2IYZA 4L16A 1GUAA 3TRFA 2QSZA 2UZIR 2FGKA 3GLFE 4Q1EA 4GZLA 4NONA 3MJRA 4MGYR 4E09A 3OAAD 2FX3A 1AJEA 4E03A 2FOLA 4DZZA 2WKPA 3QVUA 2AK3A 1U99A 2ZRPA 4ZKDA 2OAP1 5KSZA 2O8CA 1MABA 1KJYA 1VKJA 2J46A 2H18A 2A2ZA 2EFCB 2C95A 2H57A 1XMIA 4CT5A 1MT0A 1LS6A 2WWXA 1R8QA 2WJYA 4P3YA 2HXSA 1UPTA 3RLFA 3ZD7A 5E7MA 1ZINA 2IYQA 2PLRA 4FWTA 2XSZA 1G9XA 4TMVA 3QF4B 2QPOA 5E4FA 4IVRA 2F1RA 5JRJA 4B3CA 1EFUA 1E0AA 2G77B 2C8VA 4US0R 2VQSA 1C1YA 2IXEA 2QAGB 2FSHA 3ZZUA 4AYWA 4ILEA 2IYSA 4PSVA 3KKPA 1P60A 3WHKA 1C9KA 4D4JA 1DG1G 1XJCA 2B21A 1NLZA 2IHYA 4WZ6A 3CBQA 1FMJA 4X8HA 3BGWA 4HB2A 4MYHA 4BEJA 1EFRD 1R0XA 2NZ8A 1E2HA 4JSYA 5CK4A 4OI4A 4XVUA 2OEPA 4LJ9A 4MYCA 4B73A 2J0UA 2KB0A 1E98A 5G3YA 4D4MA 3QPWA 5FOXA 5JBQA 1N3BA 5L3QA 2REBA 3CRMA 1R10A 4BFWA 2RB4A 2NIPA 3VFDA 1WB9A 1Z22A 2XITA 3B2EA 1IY0A 2F1IA 1KZ7B 1IXZA 2OBLA 5IK2D 2GA8A 3FHCB 4QBGB 4XTRA 2Z4RA 4KFUA 5DYGA 1SVMA 4PPQA 1Z2CA 2QPAA 4TSFD 1N6RA 1P4SA 1RYFA 3HR7A 3LX5A 4US1R 5FR1A 1WA5A 3D8BA 3VR5A 2PT5A 2QM8A 1X3SA 2FZLA 1N5LA 4HZUB 3QXSA 1L4UA 2WJVA 3VX3A 2VHTA 3BORA 2YWFA 3EA5A 4JVNA 4HSEA 3CPHA 2RHDA 2ZUCA 2J1LA 2ZSAA 1ZUIA 5AJWA 5SZIA 5AUOB 3GLHB 4BWYA 1II9A 1XTIA 4CVNA 1QRAA 5FR2A 5TMPA 2A30A 3KB2A 1XDBA 4E22A 2IS4A 2NTYC 1T8UA 2Q9AA 3OEED 3ZGXA 5KSYA 2JA1A 4II7A 4BECA 5LBIA 1XD2B 5JZVA 5FPYA 1HA3A 1OSNA 1UDWA 1XF9A 3KKQA 3QBVA 4HAZA 3I5YA 2J0SA 1YKSA 1P2SA 1Z0JA 2E1RA 2RGGA 1I4LD 1T8TA 2BHRA 5F98A 1G6OA 2QBYB 1MO5A 1GNQA 4GMXA 5G53C 3MUFA 5KNBA 4FINA 3THWA 2OILA 3W6OA 4O3MA 1CKEA 1NBMA 1ANKA 2Z83A 3A1SA 4EFLA 2ZSEA 5TVKA 4TL8A 3RYTC 4F4JA 1M7HA 1ZP6A 2ZI7A 1U0HC 5C4MA 1VG0B 2WIBA 1QHXA 5KU1A 3C8UA 3QXJA 2ZAOA 5FFMA 1E79A 2LKDA 1OPXA 1MOZA 1DAKA 1MV5A 4Q7JB 4TLAA 2FU5C 2R6CA 4JBYA 4V0MA 1H8EA 4C7OB 2FDCA 3CNNA 2IX3A 1S1CA 2PCLA 4QGFA 3MWLA 4QG7A 3FWYA 5FOUA 2GWHA 3UPUA 1BYUA 1AGPA 4XD7D 2ZRLA 4XSHA 1TNDA 4AYXA 4NHOA 1OIXA 1JEDA 4Z1MD 1N25A 1G4UR 2B7CA 5GVRA 4NP6A 1D2NA 3QENA 2V6JA 1NN5A 2GZAA 1E4VA 2ZJAA 3CR7A 2YNMA 4DT1A 5DH9A 4JVSB 1WP9A 3EPHA 1TEXA 2YC2C 4W5WA 3FKSD 5DSZA 3U3KA 1GP2A 2B6HA 3LRPA 4DEYA 2ZSFA 5G3ZA 1OHHA 4M9QA 1EFCA 1KK1A 1D9XA 2GESA 8OHMA 4TZ6A 1WBBA 4LJ6A 4LYHA 2DWPA 1XZQA 4RY2A 2JJ1A 1J90A 3O8DA 4B34A 4C0QC 3RC8A 1DAHA 5JI3E 1W4RA 3QBTA 1NKTA 2HT6A 4QGGA 1LB1B 3GD7A 3K1JA 5KUTA 2JLUA 3K0SA 3EASA 4B47A 2XOKA 3FFAA 2GJKA 3EC1A 1U90A 3LQQA 3AVWA 1UADA 4I1OA 2HF8A 4X8MA 1LF5A 1M1YE 1GAJA 4V0LA 2E87A 1NMYA 4P4TA 2VSFA 5J4YA 5FI1B 1LF0A 1W49A 4J0QA 2ZROA 3GLHA 4JJKA 2HT1A 4MRSA 2ODNA 3M1IA 5CJ2A 5EE5B 2BCJQ 2ZJ5A 1KOFA 2V3CC 1E99A 1AK2A 2FA9A 4BLSA 1K5DA 1LVGA 1YJ5A 4DEXA 4AD8A 3K70B 3TW8B 1S3GA 2HLDA 3W3ZB 4OJQA 1F3OA 3CB4A 1RPZA 3K9HA 1X1RA 1DAFA 4JL5A 1I2MA 1KO7A 2P2LA 1E4YA 2V1XA 4M21A 1VCNA 4BFSA 4PHHA 2NQ2C 4Q9JA 1NMXA 3QKUA 1JECA 2MMCA 2QGNA 3TLXA 3SFVA 3MWKA 3CRQA 4Q9LA 4A0HA 2J7PD 4OBEA 4RCZA 2D3WA 2DCUA 1D6JA 1RRPA 1ELOA 3WP1B 1XXHB 4Q4JB 3TBKA 4A8JB 3K9LA 3TR5A 1GZSA 3IHLA 4BPBA 4IDPA 5HZKA 2FV8A 1E2JA 3U4QB 3BIFA 2RGCA 4YMSA
chains in the Genus database with same CATH superfamily
1CT9A 5BV2P 1P2UA 2JZOA 3PGA1 4PIMA 4B4DA 5HJEA 4YJ2F 5A9TA 5FPPA 1NUSA 2G1PA 3NGXA 3LOQA 4NAVA 4CKWA 4BNMA 3X1WA 4TXHA 3I1FA 4TYPA 2FG5A 2WB2A 1LRKA 1VE1A 4GMGA 2XH8A 2EW1A 1Z16A 5IVHA 2OBMA 2ZW9A 2YV4A 1ZC3A 3CNQS 1RQGA 3D1LA 3QU7A 3H8SA 2BM8A 5A4KA 5IBRA 3AY7A 2ASEA 4LCEA 1ZVJA 1XJ0A 5I4KA 1LX6A 4BN5A 3GI1A 5U1PA 1O95C 2D54A 3BHJA 1SC9A 2NYAA 1O5TA 3G5LA 3KJXA 1TZBA 3LCVB 4LJLA 4U00A 5GJVC 3ZWPA 2X86A 8MHTA 3HO6A 5IJ9A 3LUFA 2I7DA 1XWIA 1VPLA 4P3KA 3VKGA 1XQ6A 4DV7B 1UP6A 5LZ7A 2HSJA 2QYSA 4BBJA 2EYQA 1D9ZA 3MWEB 1S2OA 5KINB 5LXTA 4ZEVA 1DGQA 4L4UA 4FYPA 3AY0A 4OHWA 3X1KA 2D2EA 4W7SA 3PUKA 4I5FA 3MIZA 1NFFA 1S2MA 1FFYA 3VMMA 1HL3A 1Q83A 1QQ5A 2Z2YA 2GVDC 3AEKB 2W2KB 4H77A 1LWOA 2AX4A 2PX6A 5AO9A 5IK2A 3UHFA 1TJ4A 5J58A 5BQ3A 1ECPA 1RKBA 1CUHA 2GK7A 2VJAA 1IN1A 1ETUA 1BHSA 4CGZA 4OX9Y 1YBFA 3FOAA 3KALA 1REQA 1E94E 1OX4B 2AW3A 1T1IA 4MMYB 5SYNA 2NT4A 4JP1A 1QH0A 2BIFA 4HDNB 1U80A 3EXEB 1RJEA 3NHWA 2IU0A 4FVTA 2DWUA 1I4TD 2R8PA 2EJVA 3KT0A 2H1SA 3L8CA 1TKRA 1KP9A 1XELA 3OF3A 4X93A 4EECA 3I9V1 4I4TA 4CMGA 1BU5A 3BS4A 2A0UA 1K6JA 1UBRS 4DMCA 1ZIDA 3HB9A 3U4IA 5AK0A 4LXIA 4PZDA 5ALVA 1FDTA 1L9KA 1NY6A 4YCDA 4Z7OB 5B6IA 4JH0A 3WQRA 3OCZA 1MRSA 3O1JC 5AQ1A 3V2GA 4GYJA 2OMKA 2VA9A 1YB2A 2VCHA 2XEXA 1YFZA 4G1BA 2I03A 4FYYA 3DTTA 4W5RA 5BVGB 4BEWA 1QS0A 5HVNA 1EE1A 5DYNA 4A1OA 4K26A 1IWOA 4LX0A 1T6XA 3HDJA 1I7NA 1ZK4A 4L78A 4U7HA 1MRZA 4WNIA 1Z5OA 1M8FA 4M9XA 3KDAA 3A3YA 4U6SA 5JHGB 3QA3E 4TYMA 3G8YA 1H6BA 1WNFA 4UEOA 5AW9A 1P4HA 4D0SA 3D4NA 2A6PA 2QKYA 1EGAA 4IWXA 2AKAB 1TUIA 3ZU3A 4C06A 1P5JA 1WUHS 1KXZA 3EVZA 3EZYA 1A82A 1U2GC 3MTIA 5EC8A 3D0QA 3IXMA 3OFNA 1F6DA 1L8LA 1QRDA 4INAA 3D7NA 3PD1A 3IQFA 4JR1A 1VYTA 4N5LA 3ZV6A 3ZXYA 5EZYB 4PZYA 1BNCA 4RQAA 5K0TA 2HBRA 3T54A 2DLCX 2DUJA 1YMQA 4YUYA 1R50A 3OPQA 1WOMA 1NI3A 4HNAA 3BIWA 5IYZF 4AJLA 4B5KA 1LPOA 4CR6A 1OLXB 2C1EA 5DHRA 2VT3A 5H16A 5KSWB 1WBBA 1TFUA 1GDDA 1J00A 1XNHA 5BW8A 2ZB2A 1A8PA 3FLEA 4JQZA 4G1EB 3CVWA 3K6SA 1VDMA 3SK0A 3SLGA 2O8CB 2ZAYA 1Q14A 2C3MA 1PFUA 4S35A 5EG5A 4GR5A 3BH7A 1V1MA 3T1VA 3VNSA 4ALNA 2ZZMA 2QMQA 4QUGA 4D0LB 3T12A 1DIGA 3RNLA 4F0JA 4A2PA 4DDTA 3PHJA 3VGJA 4Y2SA 2PT7A 1ZSNA 2PANA 3Q40A 3WWYA 4BQNA 1L7EA 1UZNA 1E9SA 4OVKA 3WDMA 4DTIA 4EK9A 4DIBA 3GFSA 1KJIA 1W94A 4MAFA 4YACA 3U7GA 4G23A 2PTHA 1MRNA 2OHOA 4RH1A 3EBOA 1AKUA 3O2NA 1T2UA 5J4LA 2VHXA 5LDGA 1KZ6A 4K03A 4FFDA 4F96A 4KZPA 5L6MB 3RYHA 3G6KA 1YE8A 1EK1A 1HTBA 1DXYA 2ZZKA 3E58A 4DJTA 1FC0A 3E8SA 2X0FA 4YUWA 1C7JA 1GU0A 2ODPA 5F64A 2BFMA 5EWMA 5C3MA 1K2VN 5ITZA 1N7HA 1TUGA 1Y7IA 2V7EA 1I0LA 2CZQA 2VAPA 3F1LA 2FY8A 4LKOA 2ESRA 3QRWA 1KC1A 3FUTA 1N2IA 3KYCA 2QNBA 3I6MA 1ZHFA 4FKZA 1M74A 3EE6A 5FUXA 1ZR4A 1YR2A 2G0NA 2NACA 4GD3Q 4IWNA 4NH4A 3V42A 3OTOB 3QG1A 4L08A 3OCVA 2V6MA 1D4AA 2QQ5A 3TIGA 1XN4A 2QZPA 4QPCA 1Y1RA 3QJYA 2RH8A 4B6EA 2EAUA 3EIOA 2I2WA 3SCZA 4B74A 4CF6A 1AHNA 1PWEA 4RA6A 4X95A 3PFNA 5THXA 4E51A 5H81A 1ONBA 2NV2B 3L5KA 4HB4A 2VR1A 4R2IA 4UM9B 3AESA 1GTVA 4JBWA 2W58A 5ALGA 3ZWWA 2O8EB 1JBQA 3GIDA 4U2DA 5F5NA 4UM5A 4YJ2B 4A5SA 5MN6A 3EZ7A 3ABIA 1IDOA 2VJLA 3EJWA 2FDCA 3ROFA 2E4VA 1M2NA 4B6SA 1NU8A 2NO9A 2YJZA 4UVGA 4GKVA 3RU9A 2GSDA 1RAFA 1KTVA 3CEAA 4X1KA 3W79A 4C20A 1NQAO 4D74A 1R66A 4EVSA 3C8DA 4ITVA 4RSGA 3VO2A 2YHIA 3N0TA 2FWMX 1BG6A 1MOPA 1ZGHA 3DKRA 1FYVA 3FE2A 1FFCA 4JFRA 3U09A 2UXCB 4OBXA 4F5EA 2J3EA 2NUAA 3UT6A 2DY1A 4K6OA 1E18A 2QW1A 4KQMA 4LJSA 2CJWA 3DE2X 1C14A 2EQBA 1YWGO 2QV0A 1JG4A 3EQZA 1M2KA 4M76B 5CVEA 3FGPA 4Q4AA 5MDHA 1JQBA 1QDEA 4UM9D 3KZCA 3VOSA 1GPKA 2V59A 1UJ6A 1YQEA 3NXKA 5ERXA 4PAMA 2H07A 2C1XA 2Z95A 3H84A 1NVGA 1KOLA 4CMIA 1Z5NA 4HNVA 1YVEI 2PZJA 1LVHA 3BZBA 4IKOA 3OE7D 1B16A 1E66A 2GM9A 2WA2A 5BW5A 1JE0A 2F2TA 5CT8A 3GJZA 4JOCA 1R0KA 1YOVB 821PA 2P90A 3GFOA 1LI7A 3FTPA 1UJNA 3WK4A 2DUMA 1H9CA 1H1TA 2BCGY 2IUFA 4NOJA 4R2JA 3V9PA 4B4UA 4B6JA 2A78A 1A9TA 4JOSA 5C37A 3IR5A 2Z2KA 1GILA 3GWZA 4GP6A 4KQXA 4N12A 1WEHA 2FUCA 2ZAMA 5LUAA 2D1TA 3ZX5A 1CS4C 2PEZA 3HJNA 1JA0A 2C7BA 4TTTS 4DR7B 1SKYE 4TLEA 1TVKA 3BK1A 5EIOA 5IUKC 1NZDA 1YCGA 4WK4B 1N6OA 5H68A 3NKLA 4HTAA 4BZXA 2JFBA 2IOQA 2LE0A 4Z6KA 5CLJA 5EL0A 2CNNA 4J3FA 2H4YA 1B76A 3NIBA 5HKBA 1H4SA 3LXXA 2YXEA 4IJ5A 1OYYA 1P5RA 2QTCA 3D4LA 2PA0A 5E2BA 2K87A 1XEXA 4B82A 3LAWA 4RHUA 1U0GA 3WGYA 1EP9A 4WKPA 1N5IA 3EIQA 1QZTA 4QYIB 3REFA 5C4IA 3HC7A 4BJ1A 3G2LA 4EKIA 4MKXA 1KSHA 1UF9A 2L69A 2QT1A 3ON5A 4D92A 1DBIA 3AGQA 3QEMA 1TLLA 3QVXA 2UUAB 1GGVA 4WJLA 4DNQA 4EA9A 1O4WA 3N75A 4MGZR 1W2HA 4OQDA 5DM2A 1TEHA 1DO8A 2C54A 3EOZA 3CH7A 3ESBA 3FVWA 4B6OA 4JFAA 3FSGD 4RD1A 4BKMA 3DDUA 1MR3F 4BGUA 1P1JA 2E9SA 3ENWA 4FT4A 3CLRD 4JODA 5DO9A 5MF6A 3ML1A 1YU9A 5DNAA 4CG2A 4KFCA 1GQFA 3MGBA 1KDVA 1YNSA 3RAGA 1WLSA 1JLHA 4R84A 1ZW6A 2VYQA 3FYUB 3O4RA 3PNLA 1UMBA 1I6KA 1WL8A 3UA3A 4N9WA 3EIFA 3ZBQA 4O2AF 2JLVA 4ICIA 1Y5LA 3N07A 2O0LA 4ONEA 2BGUA 4LJAA 1J5PA 1EDBA 3SC4A 2OK8A 1OR8A 1OAOC 2H1WA 4A15A 3SX2A 4FM9A 4NPAA 2FZVA 8LDHA 2H16A 2H4HA 1V8ZA 2XTNA 1RZUA 2AG8A 4QEZA 4QQRA 5M3BA 3RVLA 2BM1A 2I71A 3FCEA 3QE3A 4IMJB 1YJXA 1WZIA 2MSCB 4NNJA 3T35A 1W44A 1GRRA 2PDAA 3ZV3A 1X77A 2CW5A 2NTNA 3PITA 3DCIA 1TLFA 2VDMB 6LDHA 3ZEAA 4QU0A 3RPEA 4D45A 3VJRA 1XCJA 1JJBA 2UDPA 2JLRA 5JQGF 3OZIA 4BNVA 4CIBA 4WKOA 4Y9TA 4OHBA 2IS1A 1LLFA 4CI0B 2O20A 2VP6A 2X6QA 3N0WA 3MSXA 4QOIA 3TF5A 3WK5A 2BEJA 5ADHA 2JGKA 2JLBA 4Q21A 5CX1A 5CNKA 2VJQA 3IBCA 2OCPA 2C4WA 2CEAA 3RFUA 4TZTA 3O8QB 2LRHA 1C7RA 2OWEA 4KXXA 2PUBA 3QKTA 5G0UA 1FJHA 1U3WA 4H4CA 2D5IA 1JHVA 4GUDA 1RC8A 4J0EA 2ZPTX 3K1ZA 2P3QA 4P32A 4OUDA 2NXEA 3PXBA 1JR3D 3U9LA 4B7UA 1EEXB 3NHUA 2PL9A 3CLUD 4G5YA 4M1EA 4FK8A 1XMVA 3K70C 3DG9A 4NAUA 4UTVA 1DCTA 4JXZA 1A2BA 1FPMA 3LK7A 1TF5A 1H9BA 1ISIA 3MTQA 3EZNA 3FF4A 2WM9B 4U3JB 3RHSA 5MGBA 4GOLD 1I2AA 1YXMA 3W6UA 2C4UA 1SM4A 3CT6A 4O4HF 4ZAFA 4POAA 3FVRA 2CHVA 1Y3CE 3NHPA 3TB6A 1HXHA 4Q3AA 1U7WA 1F06A 2DBQA 4KMRA 4B45A 2H5EA 1TVCA 3JYOA 3ELYA 3F3SA 1I33A 4NDAA 2WAAA 5LQNA 4U7PB 1GQYA 1J2TA 1JXOA 1FSGA 5A6SB 3Q8WA 1CRLA 4L28A 4QVGA 5AI8A 1Q3TA 2OQIA 3T34A 5JY1A 3AXTA 4FZVA 4W5NA 1E8DA 2BDEA 2XXAB 1M72A 2OVFA 4J4HA 5HRAA 3PIDA 3HNOA 2I3AA 5KYUB 4I50A 1G291 2NVWA 1Z25A 2P3SA 3S2YA 3CF6R 1NUHA 5ER6A 2VDJA 2ZYTX 1GLNA 3U7HB 2HCBA 3HV2A 3MB8A 3FB1A 2YWHA 3LDAA 1FQKA 3D59A 1KJQA 4RC9A 3RBVA 3I6QA 1QYVA 3NHYA 4J2HA 1H5UA 4JSRA 1GYPA 3VSAA 4JU9A 1HOTA 2BHSA 4HY3A 3CE6A 4PZUA 4H7PA 4PYMA 2EBFX 3VVMA 5KJ1A 2C77A 2GKOA 3A26A 3SY8A 3U4HA 3GJ0A 3TVYA 1ZU4A 3AJEA 1PEKE 1ATZA 5IJZA 3NM6B 3K2IA 3KETA 1KI6A 4YRKA 4IHJB 1IHOA 2AOTB 1TZCA 2I4OA 1F2TB 1L4YA 1ODJA 3ND9A 3ZWNA 3N8KA 2P2SA 1UANA 4LDZA 3CYFA 2G1JA 2X7HA 3CB2A 3Q9UA 1Z8NA 1KZ1A 1GPH1 1Z5GA 2XCIA 3AR2A 3ILXA 4X6XA 4AZSA 5DM70 3IXQA 3K5WA 3KUCA 5LBTA 5HR5A 1OAAA 3L05A 4CIAA 1DC7A 1GNVA 1GGKA 2NUPB 3ETNA 5T8KA 5C2JB 1SCIA 2IA5A 1EINA 1S7GA 3H5TA 3GH1A 1T3TA 3AVPA 3GAMA 1E9CA 3M6WA 1OVMA 4DABA 1V6AA 4TYYA 1UK8A 3OTWA 5FFFA 4BRZA 1XA4A 4W1QA 3EWNA 3EZ6A 1W2GA 2GN2A 2VZLA 4KODA 2WKQA 1JLSA 2PFSA 3N8GA 4MINA 5HDQA 1ZHOA 2YFHA 5I5GA 4JQOA 5F1PA 1Z6ZA 2IHTA 2MSEB 4HI0E 2VBFA 3UW1A 3ADKA 5SYAA 3PYXA 4HWSA 1JPVA 3ZK9A 3LP6A 1ADFA 4IDBA 1VXRA 4Y2GA 1KETA 2XADA 1B0UA 1GUFA 1UC8A 1OFUA 2K4MA 2JI8A 5TPZA 3UMFA 3WSVA 4KSBA 5HWSA 1AE1A 3JRXA 2QORA 4OB8A 1FP4A 3KAPA 1ICEA 1C2TA 3FPGA 4UHDA 4P5DA 3SBXA 4YT8A 5AIBA 1T34A 3PUZA 4MQLA 1YR8A 4RJIA 4DMKA 3LY9A 1PJRA 1NAIA 2ZP1A 2VTVA 1THZA 1M67A 3DDOA 5AXCA 4GHWA 4JLUA 2P65A 2W5UA 1BEZA 4Q3KA 1RWKA 1ZISA 3QVGA 4X45A 4C1NA 4XB2A 4YV7A 4BP9A 3K6RA 1O58A 2IHBA 3C7TA 3UKOA 4DLSA 2O3QA 3FJYA 3JR3A 4OHCA 1YI8A 4Y2JA 1PYDA 4D6XA 2BOVA 1M7GA 1SC1A 1DWPA 1FFXA 5DLYA 1WZEA 5LMNB 1R00A 4X00A 3OM8A 5BW6B 1PV1A 2B7BA 4C6RA 4JLJA 4GEGA 1ZICA 4Y0NA 3W5JA 3LECA 2RGDA 4TYQA 4KE8A 1YZLA 1JWBB 1B3BA 1UQUA 4LXQA 3UYKA 4LF9B 4KXFB 3FHJA 5A5EA 3W5SA 2P2ZA 3FAZA 4NQZA 3IESA 2QX7A 3AR9A 1PJ2A 2RGXA 2RGEA 4GKAA 3SBOA 3KKZA 3W78A 1T36A 4MRRA 2FAXA 1G18A 2DBZA 5KWIA 5MHTA 3IP9A 2QN1A 4IV8A 4EITA 4DQKA 3P1JA 5JXGA 3R8CA 5HE8A 1CV2A 1R16A 2ID7A 2VDOB 3LH5A 1EUQA 2BD0A 1CUUA 1NVFA 4LECA 2V54A 4KH1A 1E9FA 1A4RA 3CRNA 4BO0A 4ZO9A 3JQGB 3KTOA 2W9XA 4RORA 4HNTA 2CWDA 5LMZA 4HVCA 3L01A 3LV8A 3G9XA 1M6NA 4G07A 1LZKA 2R7LA 2WHYA 3AW8A 2WF7A 1ZNZA 3DV0B 3OLWA 1K0FA 2R47A 4K9KA 5D5HA 5AVYA 3RFTA 3T3OA 1IAVA 3FROA 3HJAA 4FLEA 4KPFC 3VNBA 3HFRA 2GHIA 1WZUA 2A58A 1JHAA 2QLLA 2PUJA 3JQ7B 4Q6WA 5H02A 2A0XA 1LV8A 2IEZA 5LYJA 3MAAC 4OHOA 3T9AA 1X1AA 4JJEA 3HVRA 1MVNA 1M54A 4O4IA 5FA8A 4NEQA 2AXNA 1JVSA 2IF0A 4UUNA 5JYEA 2E7ZA 1H8HD 1PWHA 5HCNA 1H94A 3L0IB 4DIDA 2V7WA 5DJ5A 4J0JA 4O0LA 4YRZA 3N6VA 1NBME 4MIYA 5SY4A 1LZLA 3UJ8A 5B58C 4NK5A 3R9XA 3V1UA 4LJYA 4GI5A 1YHYA 4BVEA 2G0AA 2BKEA 3VYTB 5AM4A 2PWAA 3EEFA 4RQBA 1FTWA 1H2WA 4W9NC 2CLDX 5EP2A 3I5MA 4ISCA 3GEMA 4RF4A 3BA6A 3HSSA 3BD7A 2ZSIA 1T9GR 2RHWA 5A7HA 2R68A 4EQ6A 4XQGA 1J8FA 4EG6A 2WVAA 1UWKA 2G70A 2I6SA 2EKZA 1GWNA 3O0TA 3ZZ1A 1O87A 4ABTA 2Q2OA 1RMQA 2QZ4A 1PQUA 3LUHA 3TTVA 1GSAA 4PGAA 3VYWA 1BOFA 4LUCA 3AEYA 4FMCB 4QPJC 2I4IA 4J0CA 2XOKD 4Y2VA 5FEUA 2QTHA 5K2MA 3WLAA 2JLWA 4F1KA 1ZIOA 1HBJA 1D8TA 1DKRA 2PVCA 5JDCA 2WQ6A 1NU6A 2B92A 4DLNA 4RZHA 5HOQA 1CRQA 1PFVA 5CPFA 1KO4A 5CT4A 3LLVA 4NZMA 3O47A 2FH5B 1BRMA 1E58A 4H6PA 4ARZA 3DFKA 4KSCA 4WKCA 1KI2A 4ZEXA 3WNBA 4JT4A 5JYBA 1KRWA 2PRKA 1YRYE 5H3CA 3UXHA 4I1PA 1DIAA 5P21A 3DH0A 1VLVA 4DCNA 3PPVA 1HK7A 3ZI7A 1DEHA 1JQJC 2AD5A 2CBGA 2UVPB 5F77A 3DMYA 3WB1A 3JAWB 3TOCA 5F7ZA 3DS8A 1XZFA 2XB4A 3DMGA 3H5RA 3HJUA 3HV0A 2XDWA 3QYFA 2JBAA 4X44A 3RO7A 4IIEA 3UN1A 1RXEA 1XQ9A 2GCIA 3MTDA 1TVEA 1IY1A 3SFTA 1J8QA 2OWDA 4O2LA 1J1IA 1YHZA 4FDLA 3SIRA 2I33A 2LD4A 1SK9A 3BL5A 1OXBB 4DPMA 2ZDHA 3OC6A 3FCCA 2Z6AA 1P1IA 5C1BA 3I3SR 5DXJA 2ROQA 3KPWA 3H1EA 5FL7A 3NCTA 4CQNA 3U3ZA 2ZSDA 1FB5A 1U65A 4WZAB 5K3OA 2ZPAA 2WJPA 1E8MA 3LIIA 3MTJA 4MCHA 4URVR 2GBIA 2Z9DA 1RHRA 4N39A 4EM6A 4B80A 1DFHA 3HFJA 2CNWD 4L07A 1HRDA 4RFVA 5LOVA 4C4RA 1GQRA 2H63A 2JIPA 4NU5A 2ECQA 3CINA 4Y9SA 2Q5QA 3A6FA 1EZ1A 4WY2A 1CNEA 4FCVA 4AO8A 4DLXA 3M49A 4HS4A 3ZHTA 4R83A 4WD3A 3ZBTA 2CDRA 3IAHA 4E6PA 2AXEA 4AY5A 1ITZA 2OB1A 4C78A 4M7WA 5FAKA 4KREA 3R6LA 3BJRA 2D1FA 3WQHA 4NTZA 5CEFA 5LSAA 4A6DA 2P7IA 5BYAA 1M0WA 2BMAA 1QKIA 1HE3A 1FMTA 1PTKA 4DCOA 4TKVB 4RKFA 3OWXA 1YB4A 3CH5A 4X5OA 3R6TA 4DJFC 1C4OA 3G3EA 3KQVA 2P2DA 2HWKA 5AJYA 4IIHA 4D4IA 4XTCS 5AFSA 3EGWA 4LV6A 1EWVA 1I13A 4EBBA 4CR7A 2GXUA 2PXXA 3RQSA 1E5XA 1T25A 2E4AA 2PSFA 5JS1A 4FB5A 3G5AA 3P9NA 5DF1A 2REOA 3G2PA 1E3QA 4ZRNA 1PX2A 2AWNA 4I6EA 2F1HA 3CG0A 1EDEA 2PKXA 5AVWA 3ESYA 4OTZA 1XZ8A 4WINA 3SE0A 3U7IA 1Y8ZA 1RACA 3GVIA 4QNRA 4YRFA 3K0FB 1L8AA 2JFHA 3OCXA 6NULA 1PLLA 1QH8A 4AICA 2PYIA 1XVUA 2W98A 3DLBA 4YCCA 4P7KA 4OHVA 4EGSA 4J03A 3EIWA 3QVKA 5G1OA 4DOMA 3JQ8B 5LKRA 1ZNQO 5F4ZA 1XKTA 2X76A 5KWVA 3NUQA 5CMLA 1C1HA 1AGXA 2QX8A 3I9MA 3PGJA 3EZ9A 2BBWA 4HTFA 4IPTA 5E6UA 1EGMB 2DKFA 2X9QA 1RP1A 1PU2A 2EYUA 3GZNB 3HP7A 3D8NA 4CEHA 1P19A 4INJA 4PW0A 5IEBA 4EARA 2OGWA 2OCIA 1KHTA 3O4JA 1FQJA 1VPEA 4Y6QA 1CJCA 3ZJYA 4RX1A 3A31A 4KPUB 3QQPA 5ELMA 3KDPA 4TWRA 2YZKA 3EEBA 3SQXA 2JEOA 1OT5A 1OW3B 3D7SA 1PJQA 3TGWA 2C4MA 4BASA 1CVLA 4V0KA 3RVPA 4MI3A 1VE9A 1WMEA 4ZO7A 1BHJA 2B8WA 4DQVA 2FUNB 4MIEA 1TM5E 4UMEA 4UKDA 1C9DB 3A36A 6ADHA 1G98A 2DJIA 3IP8A 5FF9A 2UZAA 4LAFA 2F3PA 5COQA 3UHPA 3BREA 4MUBA 1H2XA 5AW0A 5TY0A 4M1SA 3L7IA 4LMRA 2V7TA 1UFKA 3F5FA 1GG8A 4PXAA 1LJUA 3BMCB 4YAEA 7REQB 4X90A 2HLDD 4BLPA 4HNHA 3IBYA 1H6CA 1T5BA 3A4NA 1WU7A 1RJDA 3SD7A 3VR0A 3I05A 1SFRA 4UDNA 1K4MA 1VC2A 2UYCA 5LC1A 1JR3E 3Q12A 3IOYA 1AA9A 1EU1A 3OURA 4WADA 4WT7A 2YASA 5DI3A 3DHVA 4UHCA 3BB1A 2WUWE 4FC7A 4P5PA 2DHDA 3QUAA 4J7CA 1JEJA 1E4EA 1KXJA 5D1NA 5AWFC 5G4KA 3RROA 5A4IS 5FPTA 2YYSA 4LRSB 4AJOA 3H75A 4RY8A 2P9FA 3C16C 5CD1A 1XEXB 1FP6A 3QXXA 3GEIA 3D4BA 2IYWA 2P4UA 3EFEA 2ACEA 5AJXA 4CCSA 2BFEB 2J0VA 3KD2A 4O4HB 3BGOS 4S2UA 4TS4A 3WXBA 2I76A 3CM0A 4CG3A 3R5TA 3BZWA 3VQTA 4FHDA 2JDID 2UAGA 5D3ZA 1FVOA 1JQEA 2XUIA 4LPSA 2JHAA 4OXKA 3ZV7A 3DE7X 4E07A 4UNQA 1B2RA 2F3RA 3KUKA 2BE9A 2QP9X 5EKUA 3IUEA 1B26A 4I14A 5CD9A 4GXQA 4UXHA 2DQ4A 2NV0A 4F4IA 2PWBA 2H6EA 1U1CA 5DV9A 4OK5A 3IPLA 2BRUC 2JEYA 2XZPA 3S6JA 2ZYAA 3K31A 5DU2A 4EJSC 2Y8EA 1OBOA 2O8DB 4OFZA 1JPNA 4E33A 5BN4B 4M46A 4ZD6A 3DV2A 1OAKA 2ZIFA 4TLDA 4KLZA 5FORA 4BB5A 1XPJA 2BDUA 1C8KA 2RGNC 1CC1S 4IQGA 1JLKA 1G0OA 4PV7A 2Z08A 4N0QA 4L9SA 1HORA 2XVXA 3FSEA 1N7GA 4QXPA 2R97A 1W0JA 2VT7A 3GXOA 2QMZA 1AXEA 2JLQA 3JD0A 1L8QA 5KHAA 2YW2A 1SZPA 5BQ5A 2ATCA 2D2XA 2X0JA 1BXGA 4F85A 4OIMA 1OC4A 2YXBA 4L8WB 3ZNOA 2C98A 2I6TA 2WAYA 2FPGA 4WEQA 4Q93A 3VDNB 2X23A 5IJWA 1I7DA 4BCCA 1MMFB 3PFHA 1JQAA 1Z6TA 2IXFA 3S8EA 3VC3A 1ECLA 4JBXA 1UT5A 4PZ9A 5IT9A 1W8IA 2HJ9A 1CUSA 5FBVB 1LTQA 4J0HA 5BSKA 3NWJA 4I5EA 1RD4A 2O4CA 1JDVA 3COPA 4DUZB 1PJCA 5ECYA 4IF4A 5BWNA 1T2VA 2G71A 1G4AE 3T3MB 5M5BA 3CXRA 3U44B 3D43A 1X7XA 1KPGA 3N76A 4QYWA 4KIJA 3RSSA 4DQXA 2CLHB 4JT9A 4Z3DA 4TLCA 3VPGA 2AE1A 4JVOA 3NJ8A 2VL7A 4A03A 3SU8A 3KSRA 5FLEX 2GLUA 4G0PA 3QNUA 1HWYA 3VI4B 3VHXA 1BX3A 3GZTB 1NM5C 4YMGA 2XPCA 5I6DA 1L5QA 3F0TA 4DDVA 4MQMA 3GL9A 1VA5A 4RKRA 1U2RA 4R16A 3G2QA 5C5CA 4QA9A 3U3JA 2QI9C 4D9CA 2UZ3A 1Q1BA 4EYOA 4YMTA 5FLYA 4TWJA 4E31A 4XJXA 1TTHA 4XGQA 3SKXA 4Y2UA 4Q4CA 1KZGB 1E1LA 1L7PA 1OZFA 2GPTA 2ZJ3A 1B14A 3AJAA 3BXZA 4FGJA 4V0RA 2RD2A 2EFEB 4HNAB 1ISPA 2EF1A 1BWSA 3SYKA 2AFIA 2IQ5A 4BFTA 3TLEA 4B1FA 5FXMA 2GUWA 1PJSA 1QQAA 1RHQA 1YRBA 3FTDA 3WK9A 4XSGA 3FHOA 4IH9A 3PQ3A 4EO9A 2CHGA 1J70A 4ARUA 4G24A 1QGED 2ACWA 2Y0PA 3AY6A 3OFKA 2X1LA 3TAXA 1H3FA 3ESCA 4EB0A 1YTLA 1J8DA 1DIOB 2GBLA 1T6NA 2A7XA 2VP5A 5AVZA 5IWAB 2OLKA 3IAUA 5CYFA 1J1ZA 5JMTA 4FNOA 1PR3A 1Y7TA 4WKBA 4CT0A 4L6IA 3AIIA 3A4IA 3OCCA 3IVGA 4QSMA 4AU1A 2ODEA 4ESHA 3ELWA 2BBSA 1Q7RA 4LFBB 4KFSA 3D4PA 5FUQA 1E3WA 1HLFA 1H4VB 1RHUA 4DXAA 2I2FA 3FOCA 2Q4DA 3NHBA 5HF5A 3ROKA 4P86A 2I0FA 3KC2A 4JLNA 3WKCA 1DHRA 2JCSA 4H3SA 3T9CA 4OK6A 3HO1A 1VL0A 1GR0A 1M5TA 1T2AA 1NBMD 3Q7TA 4KX5A 5ERYA 4R7GA 4MKIA 1O5IA 4W4TA 4A92A 1PL7A 3EUEA 2ZJ8A 4FX5A 4KIFA 5JBNA 4TT8A 1DKMA 5A05A 1NBWB 3F8TA 2Q9BA 3GRVA 1YASA 2WSBA 4HNRA 5C8DA 3Q4GA 1G6KA 4O1MA 3LC7O 1WMFA 2J9RA 2VDQB 4WV3A 4CLDA 2I8LA 1PQ4A 5KTSA 3BWDD 4KXQA 5T4HA 4LHXA 3WLNA 2F3TA 4OXNA 2AGVA 3KYCB 1L5RA 2WWFA 2WINI 3K94A 1JKMA 1OTXA 3ZE9A 2MMGA 2ZI4A 3OCUA 4TSRA 3CJRA 3WOHA 5TQ0B 4I9HA 2IEIA 3V7FA 1T1RA 2X2OA 4GS5A 2KLHA 4IGEA 1VI5A 1F5NA 3CRW1 1EXMA 5GV8A 1JFTA 4N3GA 4LGMA 5CLFA 3INTA 3T4XA 1ZR2A 4DVJA 4EY8A 3G8BA 3MUEA 3SQLA 1FNSA 4EHIA 4LXHA 5M7EA 2Y93A 5J1SB 4HZGA 2B83A 4F6RB 1RQ7A 1GNSA 4U5QA 2Q41A 4HH1A 4NS1A 1NMZA 2FP4A 3I6YA 1HSOA 3IEMA 4EFDA 3NTOA 4B43A 1MOSA 1RWWA 3O8CA 2AD1A 2PSJA 2CNLA 2WVGA 3M5PA 4OQZA 4RMIA 2O8BA 2DSTA 3AZQA 3L7LA 1G19A 4C0AC 3R1IA 4FILA 2Q45A 4M37A 5JAHA 2IYNA 4L5BA 4H1UA 2D0PB 2TYSB 3I34X 5CLQA 1U9JA 2HK8A 1EFLA 4S12A 2O0HA 4OV6B 3MT9A 1NUUA 3CGGA 3IVXA 2FPKA 2Z1NA 1V9LA 4A10A 1XEWY 3MJTA 2VBCA 5FBQB 5GOTA 2X5NA 2VDPB 5FUMA 5HKAA 5IH7A 3Q5DA 3NH6A 3MQ4A 1WCWA 2VHWA 3R2JA 4OP1A 3C98A 2Z8YA 3WZMA 4AT1A 2QD3A 2PS3A 1EVYA 2VPPA 3F67A 5JI2E 2HV8A 5B1SA 1B6GA 1E2IA 5T4BA 4I99A 4YT2A 1R0LA 2ZXEA 1IB6A 1VYVA 2GCNA 2H92A 5TMBA 3WRVA 5C1PA 2G40A 2G80A 4RK4A 2RB5A 3EGXB 3HCCA 1Z5ZA 3OG9A 4F3KA 5IVKA 3M3PA 3L7OA 2ZWOA 1Z7EA 4KVZA 4LC0A 1SBQA 4I3FA 3URKA 6GPBA 3R9WA 1QX4A 3AVXA 2XNJA 4O25A 9ATCA 4C3OB 2QJTA 3HN7A 1AQUA 3GU3A 5DOVA 3CFYA 5K20A 1SAYA 3LUGA 3TSZA 1T9HA 2H3EA 2AEJA 3CKLA 3VU9A 3OZRA 4CM6A 3CNEA 1MDBA 5F1YA 2OBXA 2IUEA 2XZDA 1L3CA 3DDWA 3EUFA 4N7RA 2VWGA 2GM4A 5JJLA 4NE2A 1JXQA 1UK9A 1TIPA 2WF5A 2MYPA 2XUKA 3KLOA 2QNIA 5HIIA 4TKLA 5KQSA 1T29A 2WILA 4PO3X 1QFMA 3DMFA 4YWHA 1QIDA 5CDSA 1SCNE 3CG4A 1ZGGA 1D09A 4JI0B 3L7KA 1KDPA 5EIWA 5K99A 5DFAA 5EIBC 3PENA 2ZS7A 5GTDA 1QFSA 4UCQA 4BGEA 2JH3A 3CWQA 1N5OX 4L73A 2BGJA 1ZIPA 1DU4A 1Z4PX 4WGFA 5J43A 3RVNA 1N75A 1ZH0A 2DPGA 1H8ED 2F90A 4L02A 1GXSA 4J9UE 1IUNA 1JMVA 3ITNA 4P7JA 3T1HB 3QITA 2WC1A 5SY6A 1B74A 3OT4A 2JJYA 1OYWA 5IYZB 2CHUA 5AKHA 2IOHA 1YK0A 1L7NA 3UQYS 4NXMB 1LPSA 3A6HA 3PFWO 3TLKA 3ZWXA 2NP7A 1B6RA 1EDDA 3H2HA 3GJQA 5AESA 1O96A 3E15A 3NT2A 4BYGA 4F3CA 1K7XB 4GI7A 4NOMA 3UGKA 1GUZA 1BWRA 4D46A 4D4LA 1FNMA 4AJPA 1F48A 1T5DX 2QUAA 2V6FA 3R7FA 3VHXB 4QARA 1I36A 2WD8A 1CEEA 4DBVO 1DXHA 1RP7A 4OKSA 1CZLA 4HD8A 1ST2A 3O8RA 1JFFA 1IEWA 1FU4A 2MSNA 2TRSB 2V9PA 3DZGA 3I12A 4A27A 4F5WA 4ZI3A 1KMMA 2PR2A 3QVMA 3AI7A 4R68A 4CIWA 5CAEB 3EEIA 2BEVB 4IRXA 2XZOA 3ETEA 2PKYX 3JATA 3TXYA 3W2HA 2MCFA 4JI5B 1P1HA 3JQDA 3L43A 3C14C 1AMNA 2QTVB 1AOXA 1I30A 4NNPA 1MFPA 3IERA 1JKJB 1KEEB 3ICOA 3L4BC 4G8BA 3C41J 1N2EA 5IFLA 1O94C 3W9SA 1II0A 4X66B 1XXLA 1N3IA 4O59O 2D7DA 1BXRA 3RUEA 5KSOA 2OD7A 3FX2A 5HJ5A 4D9EA 2QXTA 2IPMA 3WVNA 1OI4A 3ZCPA 1YJ8A 1N9GA 3NEAA 1GPMA 5JD3A 3WK8A 2FEXA 4GE0A 4RVUA 1AT1A 5K0ZA 1MXHA 3PA6A 3HM9A 3OP1A 4KLRA 1ZJ4A 4NABA 4UAJA 1OH8A 4JWTA 2JJ8A 5DKFA 1ESZA 3H6HA 1MB0A 1SHKA 3OZDA 3PSAA 2XNSA 2Z1MA 2OCDA 3IO5A 1QPZA 1IWPB 4P98A 2YWXA 1E6CA 2WWIA 1K8ZB 1L2TA 3QPUA 4ENUA 1D2CA 2FE1A 2O3TA 4V0OA 2HR1A 3WY9A 4AY2A 5ARBA 1FRZA 2ECPA 3NYQA 4LGCA 2C57A 4X65B 1WG8A 1QIHA 1G5IA 4AULA 1M7BA 5E7IA 4C6TB 1YONA 2A9OA 2W8BA 3FDIA 3MW8A 3TVTA 3NALA 3MINB 3T0GA 1KPHA 3PDHA 5IN4A 4OQPA 5LWQA 2WFZA 1REQB 1NIPA 2EKBA 2Z57A 3KJFA 2Y92A 4HNSA 5KOHA 4C22A 1V11A 1KNXA 1R9NA 4P2BA 3OZGA 2Y1DA 4W9RA 3U56A 4EPTA 2B2NA 1VP3A 2D1SA 2HFJA 1DV2A 3AFOA 3K32A 1PIWA 2FSIA 4OU4A 1TF2A 3VAZA 4OM7A 3SSNA 1TT5A 5CFPA 4HLQB 1FA9A 2O48X 2CCJA 3BCSA 3AZPA 3G0IA 3U9TA 3DAPA 5IM4A 4MDEA 4R1PA 1LC3A 4BKRA 2QUZA 4BIIA 5IP5A 3E5NA 1ODKA 2EEPA 2GVZC 3QUQA 5EE9A 1P33A 3SSAA 1OB5A 1Y3HA 4JI3B 1XVLA 3VSEA 2H1LA 2H2AA 3CPSA 1E3IA 3H5AA 1I3OA 3QW2A 4HBZA 4DLKA 3RE1A 5DM4A 4QQ8A 5TIIA 3HYSA 4RNCA 4OBWA 4W7HA 3FH0A