4OK6A

Crystal structure of hepatitis c virus ns3 helicase inhibitor co-complex with compound 13 [[1-(2-methoxy-5-nitrobenzyl)-1h-indol-3-yl]acetic acid]
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
445
structure length
430
Chain Sequence
TDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGVDPNIRTGVRTITTGSPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAGARLVVLATATPPGSVTVSHPNIEEVALSTTGEIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLINAVAYYRGLDVSVDVVVVSTDALMFDSVIDCNTCVTQTVDFSLDPTFTIETTTLPQDAVSRTQRRGRTGRGKPGIYRFVAPGERPSGMFDSSVLCECYDAGCAWYELMPAETTVRLRAYMNTPGLPVCQDHLEFWEGVFTGLTHIDAHFLSQTKQSGENFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMTCMSADLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Serine protease NS3
publication title Integrated strategies for identifying leads that target the NS3 helicase of the hepatitis C virus.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 141
structure length 430
sequence length 445
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4ok6A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok6A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ok6A01
1U98A 5P21A 5FTJA 3KTAA 3RYTC 4MQBA 3QOFA 1UF9A 1EG7A 3RS4A 1JI0A 1BS1A 4MKHA 2IWRA 4JLAA 4F4JA 4LI0A 4TLBA 4JLJA 5KSZA 3IEUA 3NH9A 1KSFX 1DO0A 4LV6A 3K9HA 4A9AA 3EIHA 3VKHA 2C96A 5H1YA 5KPJA 2ZVQX 2ZJZA 4JIMA 1G18A 1TUEA 5LD2C 5SZKB 1Z6TA 4OQXA 2PZEA 2Z4SA 5CITA 1KKMA 3K9GA 3VR3A 1EX7A 1XD9A 3MWYW 5FL7A 1Z6GA 1OYWA 1UPTA 4W7SA 3LFUA 2KBFA 4I1VA 1QVAA 1S3SA 2CLDX 3V4FA 1E1RD 3N2EA 2BC9A 1T4GA 4C0AC 3BB3A 2IUTA 2IYWA 4AY2A 4B3DA 3UIEA 3AUYA 1IXRC 3X1DA 2B8TA 1OXVA 3FHCB 1DAKA 2ZXUA 5GJBA 5FUXA 2J59A 3P27A 4GFDA 4W5WA 2O0KA 3OAAA 3OEED 3CM0A 4DIEA 2GK6A 5DSZA 1Y63A 2R65A 1XJ0A 2VP9A 3K0SA 2FSHA 2CJWA 4KBFA 5AJXA 3VR5A 4W9MC 2P6UA 2QQEA 4DSUA 4X8MA 4NBSA 3OFNA 2ATVA 2FA9A 4CF7A 2Z83A 4F93B 4G5GA 4AI6A 3MAAC 2DY1A 1RRGA 1CJKC 1D2MA 1RC8A 1II8A 2J0UA 5BWMA 1UDXA 5EE0A 3HYRA 5G40A 2ZQ5A 2QI9C 4MRRA 1W46A 3BH7A 3GJ5A 2GEDA 4BFXA 3JVVA 4LYFA 4M22A 4GRAA 4BE7B 1G41A 2DWOA 3NC1C 3R9XA 2J5XA 2YWFA 4V0OA 4DVGA 2XNDA 3B78A 3CKLA 3AF1A 3Q3JB 1KZGB 1G4AE 5FH9A 3JVUA 3IEVA 1AQUA 2FSIA 1JEEA 4Q9KA 4R2HA 4G5RA 4DT1A 3GJ8A 4XJXA 2NZ8A 1XPUA 4QM7A 4P4SA 1IN7A 2ZITA 2NG1A 4DXAA 1NVVR 3PR1A 3EPJA 1KJWA 2IEYA 4PHHA 1EK0A 4LSGA 2VHJA 3THYB 2JJ8A 1JPNA 3MGCA 2IXGA 4CZ2A 4TZ6A 4GT1A 1MV5A 2PT5A 2BCGY 4Q9LA 1TEVA 1ZM4A 3L0SA 2VQSA 4TL7A 5B58C 2RGCA 4B3BA 3GLFA 3X1YA 3QF7A 4FINA 2WJIA 1SVKA 2A5JA 2JGNA 1NN0A 2D06A 1XD2A 3WNCA 3KB1A 2FSFA 1K8RA 2WWIA 5FBVB 2WM9B 2AFIE 1FX0B 5KSOA 4F4CA 4M9XA 2VP0A 1U81A 1QHIA 1VCIA 4I99A 4WZBE 2G1KA 3MWJA 5CB8A 1YRAA 2BJVA 4HYYA 4US1R 1UBCA 2IK8A 2OEPA 3C5HA 2V1XA 5K8IA 3KJGA 3FDIA 4NYIQ 4F7WA 4CW7A 3V9PA 2MSEB 3RABA 2QAGB 4JVMA 3O8BA 4DCVA 2JJ2A 4WXRA 1NVWQ 3LBIA 3LRPA 4I4LA 2C03A 3EC2A 1E9AA 5KOYA 4AIIA 1B23P 2C9YA 5IRCD 1OXXK 4Q4LA 3FFBA 4GL2A 1KI1A 4N1AA 3QF4A 2DB3A 1VYVA 2QP3A 2OBLA 4EJSA 4TYYA 2QP9X 1GL6A 3AKCA 4US0R 1AM4D 4M9QA 2Q0HA 2FDCA 2V1UA 1CS4C 1HT2E 2V6JA 621PA 1TQDA 4JYCA 4KYIB 1PVOA 2DPXA 4IXNA 2B21A 4O0MA 2ZRKA 5TV2A 4NE2A 1CF4A 4NCKA 1ZD1A 2C98A 4QG7A 4HLDA 2JLZA 1KMHA 2QNRA 1MKYA 3EASA 4KFTA 5FR2A 4CEIA 4P4TA 3AF2A 4EKDA 1U9IC 4PSKA 2EFCB 4AD8A 4U02A 4TMKA 4M1MA 2CCGA 4M1YA 4QC2A 3LBHA 4L9WA 5JEEA 1YR7A 3WBKA 3DZ8A 1W4BA 2ZE8A 5EUMA 3AVVA 1LS1A 2FG5A 4V03A 4ITRC 3NHAA 2OSBA 1T5IA 3B7GA 1G9XA 5F9FA 1H65A 4JVSB 4NYMQ 4NYIR 1S9HA 2OLKA 1I2MA 1Q21A 3ONWA 5KUTA 1QF9A 1XJCA 3O8CA 4HLCA 4NONA 4EFLA 2CHQA 4CYMA 1CIPA 1UKZA 4BRUA 4AK9A 2OILA 3UMFA 3V00A 5G3ZA 3GLGB 3HWSA 4ZDWA 1ZD8A 3BH0A 4CIDA 2QU8A 3FPAA 2G0TA 3J81k 1TL7C 2YWGA 3SQXA 1KI4A 1TF7A 2BMJA 2ZSFA 4OHXA 4C9BA 5CM9C 5EJEA 2A5YB 2ZE6A 3MWKA 2O8BA 2JJ2D 2KSQA 1XX6A 4TMVA 2O8CA 2FU5C 1G6HA 2XTZA 5JHGB 2UZIR 3D3QA 5JFGA 1H8HA 1OIWA 4XSHA 4M1TA 5LBIA 1NN5A 2C5LA 4B47A 2WVJA 4JLMA 4DLYA 1ZIPA 1RIFA 3T15A 2EFDB 2HLDA 3WRYC 1Z29A 3FYHA 2ATXA 3QNUA 2GTPA 3EW9A 5ELXA 2ZR7A 1J2JA 4PC3A 1HY3A 1KJYA 1KDRA 5LB4A 3W6OA 1LF5A 1PUJA 3K0AA 1OH8A 2LCFA 3AV0B 3TR0A 3DVLA 3KFVA 2G0NA 1XRJA 3ZLJA 2YJTD 4P3YA 4Q1AA 4FCWA 4JLNA 2QMEA 4NMMA 5E7IA 1Q1ZA 5J47A 1P9WA 1KYIA 1SQ5A 4LJ8A 3HU2A 3E2IA 1P61B 3UANA 3HYTA 1ZC3A 2FEMA 2O8EA 3QEOA 1XEFA 3FVQA 4ZCLA 2GJ9A 3FE2A 1N6RA 4IRUB 4DEXA 3PIRA 3AVPA 2BV3A 3L8ZA 3ZIAD 4UNRA 3EX7C 2PJRA 1CLUA 2HJVA 521PA 2P0EA 1JXMA 4EFMA 1KO8A 1YU9A 2VPPA 2YOFA 3VX3A 3LBNA 2X2EA 4A0FA 5GVSA 2IYYA 2EYQA 1M1YE 1ZNWA 3HR7A 2ODBA 5E4FA 2VP2A 3NBYC 3PUWA 5HZKA 1JR3E 3K9LA 3ZVNA 1EXMA 5FPTA 3QIAA 1TEXA 3G5UA 4OHYA 3Q7QA 1L4UA 3VTKA 2E9SA 1JPJA 4OHVA 1WBBA 2LWIA 3Q5DA 4V0KA 2GXQA 3EZ9A 4DLVA 2WJYA 1CBUA 4NYJR 1H8HD 3GLHB 2NO0A 2WAYA 2JDID 3SZRA 4DLWA 1G4UR 1DARA 3IBYA 1Z0FA 4D81A 3IIJA 4RJLA 5J4KA 2NIPA 3IGFA 3MUFA 5DLQC 3IO5A 2O0JA 2H1LA 1VHLA 2EYUA 1TAGA 5DI3B 3GLHE 1YZLA 3QPVA 4RY2A 2QAGC 1XD8A 3VAAA 3H84A 3WHLA 3A1TA 2W2TA 2XZPA 1NP6A 2BBSA 5JI2E 1CP2A 2RGGA 1XEXB 2VA8A 2OE2A 3VX4A 2XX3A 3GLFB 5BYJA 2Q21A 5EXPA 3U3OA 1W36D 3QKTA 5AJWA 2RB4A 1EWQA 4URWR 1LF0A 1FOEB 1P2SA 3UG7A 2OCPA 1Q3TA 2GBLA 4WBSA 1GILA 3RHFA 3GJ3A 3WNBA 3CRVA 3RSLA 1I4TD 4RCZA 4TYQA 3ICQB 4V0NA 2CE7A 4FW9A 4LOAA 1R10A 3TW4A 4K81B 3QVUA 2XJ9A 2G3YA 5L3SA 1AGPA 3AVOA 5FI1B 4IEEA 3U5ZB 2AX4A 1P2UA 3SE0A 3QKRB 4C30A 5JJIA 1HQCA 1ZU5A 2VHCA 2JLYA 5J5CA 3FTQA 4L15A 3RLFA 3SHWA 5DN6D 2ZEJA 3I92A 4JZKA 4LGMA 2B7BA 2GZAA 3A4MA 4KSBA 2V3CC 2B92A 4LRWA 2IYTA 3OHMA 4JYBA 4TL8A 4YQFA 1VYUA 2REBA 1W7AA 3CPJB 1XDBA 2N46A 4BFTA 1G7RA 4D2IA 1EFUA 1WB9A 1TPZA 4KYUA 1XPOA 2XB2A 2HXYA 4D82A 3R20A 1N5IA 2H7VA 4LK2A 2R44A 3T1QA 4F4IA 3SR0A 2CE2X 1AQYA 1N2CE 3MJRA 2ASEA 3SC3A 4BEJA 1A1VA 4CGZA 3FB4A 3CRQA 4HB4A 2X77A 1HUQA 4OQMA 1P2TA 3EWAA 3ZVMA 1VIAA 3X1ZA 3ADCA 4CEIB 1GKUB 1W2HA 3UG6A 1Z63A 1KI2A 3K0CC 4R7ZA 1OT3A 2V7QA 2WKRA 3QVVA 4MGKR 2R62A 4KLNA 1OKKD 1VG1A 1XEWX 1QBKC 3L0PA 2C9CA 2Z6VA 3AP1A 3GJ4A 4HUQA 3K1JA 3AVTA 5B57C 4QXAA 2AXNA 3FMFA 3VFDA 3KKQA 4BECA 1RRPA 2P5TB 2Q9CA 1GZSA 1TMKA 5E95A 1KI7A 3VU9A 1A4RA 4TLAA 3GEEA 4Q01A 3NHBA 2P6NA 4JLDA 1PJRA 4POAA 4OI2A 821PA 5JRZA 4QBGB 2IS1A 1NBMD 3QXSA 4OQNA 5CIWA 4IDPA 4ON9A 1GDDA 1CRQA 1OFUX 5A5GA 1SXJD 1OIVA 4TL9A 1T3SA 3W5JA 3WMEA 5JCPA 1DAHA 1RRFA 4KO8A 2A5FA 3R7WA 2CL6X 1XJQA 4PANA 1HV8A 2BEJA 3LVQE 4ASUA 3IQXA 1WXQA 1DTSA 3AKEA 1OHHD 2G9NA 5JEDA 3PEYA 3B9PA 2GESA 2O8BB 2HEIA 3TLXA 3KFXA 2O8CB 2IYXA 4PFSA 1SVSA 2FN4A 1CJTC 1E6CA 1R0YA 1GM5A 2RH5A 3F5FA 2WOOA 2IHYA 5EQTA 3D31A 1K5GA 2PT7A 3IIMA 4MH0R 2JLWA 2GF9A 5D3QA 4PSVA 2HT1A 5DHFA 4LHWA 1G8HA 5D3MA 2RGDA 2DCUA 3NBXX 5DYGA 3C7KA 3GEIA 2DWPA 2C78A 4A2QA 4PQYA 3K0AB 2V6IA 2WKQA 2QTVB 2QORA 1JEDA 1TQ4A 4AYWA 5AUPB 3ZDQA 4TMTA 1QVRA 2V7QD 4EPXA 1JAHA 3REGA 1ODFA 4DCUA 3M1IA 4KVAA 2KBEA 1AKYA 3ZYCA 3V4RA 2VRWA 1IY0A 5KPDA 1F60A 1P2VA 4KLZA 4LJ7A 4XD7D 4DCNA 1ESMA 3I5YA 2QMHA 4B3GA 2ZI7A 5IT5A 1VIYA 2V8OA 5CLLA 4JVNA 3T5DA 5DNYB 4D4KA 4E07A 4XWOA 2H18A 4MUAA 1UKVY 1XFAA 4C0HA 4B2IA 1VDZA 2WZQA 2WOJA 3NIBA 3SS8A 2YVUA 2ZRPA 4B44A 2ZVPX 4QBHA 4ARZB 3VNVA 4OK6A 1X8KA 4GP6A 2XAUA 4Q19A 4TSFA 3R9IA 3U44B 4FMDB 4BWYA 3EXAA 1TQ2A 1TF5A 3PUZA 1Z8FA 3DOEA 4PC7A 4DIDA 3CW2A 5AK0A 4ASUD 3I72A 2BKUA 4ILEA 2P6RA 3RS0A 3LW8A 2NPIA 4PZYA 2KJQA 5JBQA 1E0KA 5C1BA 4OJQA 4DLUA 4BGDA 4OI4A 2Z5FA 3B82A 1QDEA 4PAOA 4JBYA 5IK2A 1B0UA 2GHIA 2GJKA 3FKSA 4BFZA 1XZQA 4P33A 3ECCA 3NG1A 2GJSA 5HCIA 3VNUA 4JT2A 1U8AA 4ACBA 3C4JA 4BUJA 4TYNA 1X6VA 3N70A 3P4XA 3QKSA 2GJAA 1GNRA 2VP4A 2F43A 1M8PA 4IDHA 1XMJA 2QM7A 4GI7A 3P4YA 5L3QB 4DKXA 5A4JA 4PQFA 4ESHA 1TX4B 1P75A 5FPSA 1HT1E 2ODWA 3SBDA 2W6JD 4WW0A 1UDWA 3MLEA 1D2EA 4R98A 3NC0C 5HCNA 4DBLC 3U4QB 3EPKA 5TY0A 1N6NA 4C7OA 3QG5A 3G0HA 2ZRFA 2NPFA 2G88A 4M1WA 2OBNA 4O3MA 2AKAB 2V4ZA 3PQCA 4PSAA 4QJ5A 3T61A 3PXGA 1JB1A 4M21A 1P60A 2OFXA 3OESA 4ZDJA 1NMZA 1QHXA 1D8TA 3A36A 3FGNA 3QEJA 4Q4AA 2A7QA 1KDTA 4Q7LA 4TSFD 3W8NA 4LV8B 5EXTA 4URXR 3OIVA 4YXWA 3CUEF 3IPXA 2OT3B 4LJYA 4N3NA 2IEZA 2QPOA 2WMNB 2IWHA 2WHXA 1E1RA 1W4AA 3PEWA 2ZANA 5FTKA 4JSYA 2QBYB 4ZDIA 1U94A 4LBYA 3NWJA 1MRSA 1GG2A 3KUCA 4B71A 2CHGA 4Z8YA 1OIXA 2PH1A 3SI7A 4CEJA 3TSOA 2ZAMA 3H4MA 2IHBA 3I8XA 4D4JA 2DFNA 5IK2D 5EZ5A 3OEEA 2P3SA 3ZS8A 4B73A 4JL8A 4LHXA 2JCSA 5JLJA 4O25A 2I4IA 2WJJA 3LX5A 2HJGA 2UVQA 1WMSA 1L2TA 2F1JA 4IKEA 3ADBA 1GOTA 1FMLA 2X2FA 3GJXC 4IVPA 3TSWA 2CVFA 5C18A 1QHHA 4HDOB 1RJ9B 1E2JA 4D4LA 1K6MA 1U0LA 3BK7A 2HUPA 3W90A 4RFSB 4TQ9A 2NTYC 1KAOA 2Q9BA 3QXJA 4IDQA 3K70B 2Z0MA 1EX6A 4QHSA 4Z1MD 2RGNA 3VU9B 4Q9HA 2AN9A 4Q1CA 3AUXA 5GVRA 1UKEA 3P20A 1D9XA 4PPNA 4MDFA 5DI9A 1XB2A 1FZQA 4LC0A 1KO4A 4PC2A 1DEKA 1F2UB 3C14C 3T1VA 3U6KA 3BGWA 1XXHE 3CH5A 4RZUA 4BASA 1O87A 2QPTA 3Q9LA 4LJAA 4UJ5A 3K0FB 3RRZA 2J7PA 2QTFA 3TRFA 2WWFA 1J70A 1Z22A 4OI1A 1JNYA 1Q1BA 1EGAA 4HLQB 4II7A 4NP6A 2BOVA 1IBRA 4QHYA 1AA9A 1VECA 4JKYA 2IF2A 2MSCB 3CRW1 3HR8A 4QGHA 4HI0E 1P62B 3WRXC 2QTHA 1XBTA 4EPWA 4YXWD 4GSYA 1EFCA 4EIWA 3I1FA 1TUIA 1QHNA 1PLLA 1VYTA 2CLCX 3LLMA 3RWOA 4IVRA 2QM8A 1KIMA 4EPYA 4RCYA 4F91B 1MABB 3QPUA 4Q03A 1N25A 4B43A 4OHWA 2GZDA 1IY1A 4G5OA 1L4YA 1T0JB 3REFA 1WBDA 3SHFA 1AS2A 3ND9A 3CBQA 1I4DD 4EPRA 1MO5A 2ZJYA 3RSOA 1YZGA 4HDQB 1OH5A 3IIKA 1LB1B 5DH9A 1RPZA 3S1AB 2ZJAA 1NG1A 4JL5A 1E9EA 1Z3IX 2GNOA 2WV9A 3Q85A 3QXXA 4BFWA 1XPRA 4DEYA 2OG2A 3CF2A 3TH5A 2FJUA 1WDTA 5HR5A 1HQYE 1W1WA 1E2QA 3AH8A 3CONA 4HSEA 5A0FA 1UKYA 2RCNA 2ERYA 2WWWA 2ZI4A 4HEJA 4B3XA 4WZAE 4L16A 4BZXA 2QMUA 3K8YA 1MR3F 5CK5A 4ZCMA 1W0KA 4L4UA 3DMNA 5EE1A 4DDUA 2HXSA 1NY5A 1P73A 3AVQA 2R6FA 3QQ5A 4IDOA 4YMWA 5FUYA 1AGRA 1QHGA 2HDNB 4P32A 4YMSA 4TTPA 2J7PD 3EAQA 2GBLC 4PC6A 4RSGA 3VHLB 3SEAA 1YKSA 3CZQA 2XXAA 2ZJ8A 1QG4A 2BVNA 3E1SA 3SQWA 1Z06A 4HAYA 1HYQA 4PPGA 2GXAA 1P4SA 4D25A 1XTSA 2CXXA 2FWRA 1ZNXA 1JR3A 4Q21A 2I3BA 4D26A 3X2SA 1LVGA 3KKOA 1NVXQ 3ASYA 1X1SA 2F6RA 3CNNA 2IS6A 3BFVA 1ONBA 1P3JA 4A6XA 5GJVC 1G8YA 3N5CA 1AZSC 3M0EA 5CLQA 4D0GA 1P9NA 3DL0A 3LD9A 4V02A 3IHLA 1OYYA 4TQAA 5GJWC 1KK0A 1FTNA 4MRNA 3HPQA 1D9ZA 4B32A 4H9GA 4XVRA 3RS7A 1O3YA 2WBLC 1E2HA 4FCTA 3LX8A 1TU4A 4JLKA 4M53A 3L0OA 2EQBA 2OCYC 1XZPA 4QNMA 1M6NA 1F6BA 3KZ1E 4RD3A 1JJ7A 4P0TA 5FPYA 2Q9AA 3AP3A 1CRPA 2FPKA 1OB5A 2IA5A 1R5OA 4JJKA 1US8A 1NN3A 3A1UA 4UQOA 4EFNA 4US2R 4BFUA 3TW8B 4B76A 1COWA 1DAIA 2VP5A 3R9WA 4HLUA 3RRYA 1VCNA 3AF0A 3BXZA 4WOPA 4D80A 3VR1A 2X8AA 2ZYVX 4IVQA 1W5TA 1N5LA 4UXHA 1ZJ6A 1ZVQA 1BYUA 721PA 1W0KD 2CVHA 2VF8A 5JSZB 5B2ZA 1NLZA 4MA4A 5L3VA 1X8LA 5AUNB 3K70C 1E0JA 2C95A 3TSZA 2GAOA 3TNFA 4GPTA 1AS0A 4MYHA 1S96A 3HU1A 4X8OA 1C9KA 4URUR 3PUVA 4B74A 2VEDA 2VHQA 2IYRA 4I1UA 2YYZA 3WMGA 2PX0A 3EG5A 3SN6A 2CNWD 5JS8A 4XH9B 4Q1FA 1QG2A 2ZRMA 5J40A 4A92A 4D6PA 3FHTA 1IN5A 4DC9A 2QSZA 1YZQA 4CEJB 1JR3D 3K53A 4Q00A 5JHHB 2FGJA 2O8FB 2IS2A 2W6ID 3BAFA 3K0EA 2CL7X 3WHKA 4KVGA 2KI5A 4JS0A 5JI3E 5FUVA 1Z07A 3PENA 4IFEA 4NZYA 1XCMA 3HJNA 2ZS8A 3A1SA 2GVZC 2ZRHA 4G0NA 2WAXA 1Z0DA 2ZRNA 5BXQC 3PUXA 4Q1BA 1ZCBA 3ZZUA 4A8JA 3UKDA 1W0JD 4AKGA 1NLFA 3B6EA 1G3QA 3ZIAA 4CT5A 4KAXA 1E9BA 2VLIA 3VQTA 2JASA 2ZSEA 4EDHA 5AUOB 1F2TA 1RKBA 2BBTA 3GJ7A 3EZ6A 4I1SA 1KMQA 1II9A 1YR9A 1BOFA 3EARA 4HZUA 3BD9A 4YDHB 1ANKA 3GFTA 3KTAB 5CDFE 3UPUA 1COWD 1HE1C 2BIFA 3T1TA 3GLIA 1R0XA 2KB0A 3GLGE 4CDGA 1E2KA 2ZRIA 1J7KA 3AVUA 1NLYA 3PJRA 5JMTA 1M2OB 5EP4A 2NOAA 3DMDA 4JMPA 1EFRD 2JDIA 3EZ7A 1XMVA 4OQLA 2QRNA 3DPUA 1TNDA 1LS6A 1N0UA 2QL6A 1KK3A 3HP1A 3LLUA 4HB2A 2WWYA 3AVXA 1W4RA 2AK3A 2NO7A 2ZTSA 1EWRA 4OHZA 1KY3A 3KQLA 2WIBA 5C4MA 3TKLA 1KHTA 1N6IA 2IUUA 1YHNA 2QG6A 3VR6A 3IUYA 4HAWA 4HAVA 2ZRDA 5CK4A 5HPYB 5C46F 3VMFA 3E5HA 3MFYA 1WA5A 4NYMR 3KUDA 2IYZA 2Q6TA 1XMIA 4W5JA 4A4DA 5JJKA 1M34E 1TTTA 2D2FA 2O0HA 2BBOA 2JLSA 4LDJA 3TQFA 2ZETA 4NH0A 2CJWB 1G8GA 4CRWB 3NXSA 1F3OA 1X8JA 3QXHA 4URVR 1E3MA 3EIEA 1ZCAA 4UNQA 4A2PA 1G291 1RZ3A 1L7VC 2PCJA 5EZ6B 3ZZTA 1BIFA 1T9HA 4EQ6A 4LJ5A 2IBMA 2BDTA 2R6DA 2YNMA 1XTIA 4IOLA 1II8B 2J0UB 1P72A 4GNKA 2IXEA 5CIQA 1RYFA 2OUKA 4DLZA 5FUWA 1NI3A 1U90A 2PCLA 2CHVA 2WKPA 2XTNA 3KB2A 5DN6A 2BJWA 3HPRA 4LCBA 4OL0A 5K8LA 4C3ZA 3B1WA 5KNBA 4XSGA 4YMTA 2YV5A 3D6TB 1PZNA 1DAFA 4MKIA 4PO1A 3RS3A 4B2PA 1OFHA 1T91A 2W0SA 2CCKA 2WMOB 4ZO4A 2J1LA 2X1VA 3QI2A 2RHMA 3KQNA 1GTVA 2UKDA 1E9CA 1E2NA 221PA 1OFTA 3MD0A 3ZS9A 1WQ1R 2ZRLA 3QG1A 1JECA 4XWKA 3O8DA 1E4YA 4NU0A 1WE2A 1ZUNB 3ADDA 4M0LA 1T8TA 3KL4A 4KFUA 4DT1B 5KSYA 4E03A 2XXAB 3PV0A 4K46A 4XVUA 4P4SB 4WVFA 2PEZA 2ZM5A 2JLXA 1E2EA 1TQ6A 4LJ4A 3A8TA 4WXPA 4TL6A 1E2LA 3I5XA 5J4YA 2AK2A 3QBVA 1RW4A 4C0BA 5BN4A 3LDAA 4JLBA 1DO2A 2QA5A 4BZQA 1GVNB 1OKKA 3CIOA 4IOMA 1GSIA 4C0JA 4DLXA 4BLQA 3HDTA 3N2IA 1R5BA 1GUAA 2ANCA 1P6XA 5FBLB 4RD0A 2ZUBA 4FMDF 3NEYA 2IC5A 3VKWA 2D7DA 4B33A 1XD2B 2DBYA 4C0LA 2FGKA 2MMCA 3GLFE 4GDFA 4MGIR 1GL7A 3W3ZB 5KNDA 4OI0A 3KXIA 5BN3A 1NBMA 2BEKA 1M7HA 4NCJA 1US8B 1CJMA 1GKIA 3LQQA 4Q7JB 4A2WA 2FOLA 3EWSA 1CR4A 2VHTA 1II0A 4U7DA 1SXJA 4TWZA 1Z28A 1Z0KA 1XTQA 4QM6A 3W5IA 2ORIA 4RD4A 3UWKA 5CM8B 1OHHA 1ZUIA 2XITA 3RRNA 2IYUA 3GD7A 2B7CA 4ZIRA 2ZRCA 1KNQA 1S3GA 1H8ED 3KJEA 1DG1G 1F5NA 2NO6A 2EWVA 1GNPA 1ZYUA 2ZPTX 3Q72A 1SKYB 3THWA 3OIUA 3BB4A 3QF4B 1CU1A 3EA5A 3T12A 5H68A 4EJSB 2HYIC 5HTKA 2RAPA 1NRJB 4FCVA 2A78A 2RGNC 3AP2A 4E5UA 3RWMB 4CEHA 3H0KA 4TLCA 2FNAA 2ZIAA 3GQBA 2OBMA 3ASZA 1E9FA 4B6EA 2YWHA 4QBFA 1VCMA 2CL0X 2P67A 4IEIA 4TMXA 1ELOA 2YC4C 3BS4A 3LA6A 1KMHB 1X3SA 1KKLA 4XIGS 1S1CA 5CJ2A 2BMDA 4RD2A 1ZUHA 4XOIA 1BMFA 2R6AA 5JWHA 1IM2A 4U00A 2LKCA 2CDNA 3GFOA 5DE3A 3WYGA 4FD2A 4XD7A 3L8YA 2J7KA 4PPQA 2ONKA 4ZI2A 1XNJA 2W00A 3TGPA 1CXZA 3B1ZA 1DBSA 1NIPA 4TLDA 1FL9A 2VTKA 2LKDA 1F2TB 3I73A 4GMXA 1LNZA 1G8FA 3U3KA 4KITB 4KV9A 4IXMA 3P32A 2IF0A 2JIZA 2WWXA 4KI0A 1G7TA 2AD1A 2O8DA 5AJYA 3GLIB 1OSNA 4ZKEA 4H1UA 5CYPA 4R71A 5KSPA 1D2NA 4PR0A 2P2LA 5E7JA 2OFOA 4Z8XA 3U3MA 1VCOA 2RGXA 1IN8A 3SYLA 1OXTA 4TMZA 3ZH9B 1M74A 3R8FA 4KHZA 3AF3A 4QL3A 3F3YA 3C41J 5AWFC 5M04A 2J87A 3PVSA 3WP0A 3L2OB 4M9SA 3EA0A 1A7JA 5JCZA 4NKRA 2JEOA 3UMSA 4W5HA 1NJFA 1Q57A 2B6HA 3LVRE 2AL7A 2VO1A 4QFMA 2FE4A 1M7GA 4AG5A 3CR7A 1IY2A 3I32A 1M7BA 2HF9A 2XEXA 1SVOA 4RKFA 1W36B 5FFMA 1NF3A 3RVBA 1KJZA 1N3BA 2GK7A 2GDJA 2F7SA 3MSXA 2Y8EA 4Q9IA 2BMEA 4MDEA 3Q5EA 4G5QA 4LBWA 4QRHA 1BMFD 2W6JA 3TVTA 4BLSA 1KK2A 3RRMA 1MH1A 4IOKA 3FHOA 2BKEA 4EUNA 1R2QA 1SVLA 2EU8A 1QHYA 2QE7D 2R9VA 4G3XA 5DHAA 3B1YA 4KBGA 1JR6A 1ESNA 3UK6A 2O8EB 3IKJA 1A2KC 4HAUA 4BFVA 1K5DA 1PLJA 2ODNA 2VYFA 2CBZA 2PZFA 4Z54A 2BHRA 2DHRA 4HAXA 4DLRA 4MGZR 5F2EA 1UADA 1YRBA 4M1KA 2GILA 4DCSA 1GNQA 2NO9A 1Q0UA 2GCOA 3SJAA 2FF7A 2IYVA 3GCGA 4KODA 4DHEA 5IDVA 2JIZD 3ZQJA 1G5TA 2O5VA 2QEQA 2OCAA 2NQ2C 1LW7A 4C0SA 4V0ME 5CB6A 2C8VA 2ZU6A 3IPYA 4M8NE 2XB4A 4MKGA 1T3HA 2F55A 5AR1A 2AWNA 4LHVA 3PEVA 4FN5A 4NPHA 1DVRA 3ZD7A 1E9RA 5G3YA 5FBRB 1FQKA 3RANA 4HLUC 1XEWY 2F9MA 2J46A 4TN1A 3W3AA 1GL9B 5JS7A 3K09A 2OO7A 1N5KA 2IXFA 5FOSA 1UM8A 2IX3A 5FTNA 5H70A 2W83A 4OQFA 2GETA 2ZE5A 2PMDA 2PL3A 1QZXA 5JECA 2SHKA 3FMPB 3SBEA 4LPKA 3JZAA 2ZREA 4EJSC 1SVIA 1W48A 2AKYA 2C2HA 4Z1MA 1KI6A 4LX0A 3THYA 3A37A 2XSZD 1DADA 1OE0A 3OEHD 3BB1A 2JJ1D 1DELA 4HB0A 3U3JA 5F9HA 3U60B 4A0HA 1E0AA 3L0IB 5L3SB 3KDSE 2F1RA 1QRAA 3C5CA 3I3SR 5KDOA 1SXJB 2YHSA 3BIFA 4QOSA 2O52A 1DOAA 2VH5R 3QKUA 4P4UA 5CJPA 3TUIC 1PUIA 3CX8A 4GP7A 2E1RA 2HCBA 1N0WA 1E99A 3B85A 3Q7PA 3RAPR 2IYSA 5L8VA 3VKGA 1TU3A 5HE8A 4A6PA 1UBGA 4ZIRB 4HAZA 2A5GA 1VG9B 1EFHA 2VP6A 4IW3B 3DM5A 2JAQA 1ETUA 1QHSA 3IQWA 1E79A 1SHZA 4YDSA 2EFEB 2AHOA 2OAP1 2ZS9A 4JVLA 3ZVLA 1W4CA 4F38A 2G77B 1A2BA 1KSHA 2W2VA 2KE5A 2ZJ5A 2RKOA 2WTUA 1E94E 3ETLA 3QY0A 1Q3HA 2YINC 3DM9B 2ZJ2A 5F98A 2QAGA 1E9DA 1XCPA 3F8TA 4JLOA 1KDOA 4UKDA 3VHXA 4I81A 1WRBA 2VIIA 5EE5B 2I1VB 3CNLA 2R2AA 1NL3A 3W9YA 4G1UC 1PV4A 2FSGA 3KKPA 2BM0A 3WYFA 1GP2A 1Z6AA 3MWLA 3CWZA 4IJMA 2D2EA 1W44A 4HUQB 3OF5A 4QJ3A 5HZHA 2GXUA 3AEZA 3U7FB 1G7SA 1GFIA 2WICA 2YOHA 3I8SA 4C4PA 4PZZA 3W34A 4XVQA 1R0WA 1OH7A 1R8SA 2EWWA 3GPLA 4HATA 3BFKA 4KFSA 1WCV1 2WSSD 4DB4A 2Q3HA 3KJHA 5EXXA 1W36C 3B60A 4FWTA 1BYIA 2CK3D 2PEYA 4RZ2A 4GZMA 4L9SA 4DWJA 2ZS7A 4G01B 4BQSA 1DAGA 1KI9A 4QHTA 3OIWA 1UJ2A 3CZPA 1Z2AA 3R7WB 1IJFA 3H1TA 1LTQA 2DR3A 2DWQA 1ZNYA 2OLJA 2ZSDA 3QXCA 3C15C 3DO6A 2ZR9A 2WWGA 1FW6A 4PQRA 1E79D 4M1SA 3GLGA 4LV5B 1FUUA 2QPAA 1NKTA 4M9ZA 1FP7A 4KJZA 1CR2A 1G5PA 1GRQA 5E7MA 4RKEA 1E2FA 1FQJA 3K0CA 2A2ZA 2QT0A 4C2TA 1S8FA 5D3MB 4PX9A 4CVNA 4KFRA 1SGWA 2VF7A 1JJVA 3IHWA 3I61A 1IQPA 5TMPA 3QSYA 4FI3C 2ODEA 5H8WA 1Z83A 1L8QA 3AGPA 3LQRA 5EP1A 3VR4A 3CRMA 5BW8A 1N6LA 3AGQA 2NO1A 2AR7A 2ONJA 4MYTA 2IW3A 4ZKDA 4LC1A 3SFVA 1XTKA 4EPTA 4LBVA 1AZTA 2VHUA 4M2LA 5FTLA 1Q1EA 1X86B 3LAWA 3IO3A 3FOZA 1AS3A 2ZYUX 3CX6A 3SU8A 4MRSA 1NVVQ 2A5DA 1V5WA 2AFHE 1N6OA 2GEVA 3PCRB 4URZR 5KDDA 1XP8A 3DHWC 2XJ4A 4AC9A 2ZJBA 1R8QA 5J4VA 3FWYA 3K9NA 4S35A 2GCOB 2ZYTX 3E70C 4A0GA 2VSFA 4Q4JA 3GFPA 2BCJQ 2D62A 5EE9A 5G41A 1ZRHA 5C4GB 2OHFA 3LO5A 4BLOA 2I1QA 3BBPA 4JLPA 4L5BA 4FXPA 1SULA 2H8KA 2QUZA 3DEFA 5AUQA 5FR1A 1ZM2A 1XTRA 2JLRA 3SOPA 4Z51A 4JL6A 2CNWA 4N0EA 5G53C 3BRWD 2J45A 2XZLA 1J8YF 1E2IA 1MOZA 2W0MA 1SXJC 4QBIA 4TZ0A 5DIFA 2NGRA 5HE9A 2V55B 2W6IA 1TADA 1UEIA 2JLQA 1IXSB 3OIYA 3ZZ0A 4DJTA 2CEAA 2FV8A 2ZI3A 3ZVRA 1HH4A 2D4HA 3EC1A 1HURA 3LH5A 3QKSB 3TK1A 5CYOA 2F43B 2BMFA 2WJHA 4BPBA 1W0JA 2HF8A 3CLVA 2REXB 3GLHA 2RGEA 1CULC 1Z47A 2RGBA 2J41A 2YWEA 3PEUA 1HEIA 2FMXA 5FL7D 4B2LA 1KI6B 2HV8A 5DI3A 2YKGA 1XU4A 3I4LA 3KQHA 2D74A 4J0QA 4KU4A 3P1JA 1XEXA 3LY5A 4DSNA 4C7OB 3U7HB 4QGFA 4Q7KA 2JA1A 2R6CA 4IDNA 1RRCA 1ZNZA 1E32A 3U61B 3TAUA 3I62A 4B3CA 1W5SA 3SJZA 1Z08A 2F9LA 5F3WB 3KX2A 3OAAD 2FFQA 1W47A 2OM2A 2QSYA 2WWHA 1U8YA 3WNDA 3EPLA 3C16C 4YLGA 1MT0A 2CMKA 3NVAA 1KO5A 1NSFA 2J9RA 4KCGA 3D7MA 1RYHA 1RVDA 1NG9A 1YJ5A 3KQUA 1EFRA 4Q4AB 3U6BA 3OFND 3QUSA 2GRJA 1IOZA 4B34A 3X1WA 1W2GA 1G5RA 4DCTA 4LJ9A 3X1XA 1UAAA 2J3EA 2PJZA 1HA3A 1KO7A 3QKRA 1Q44A 3PG5A 3CWQA 1CTQA 4N0DA 4PHGA 2WPDA 3GJ6A 4RD1A 1NN1A 2ANBA 3B8HA 5DYIA 2QAJA 1AKEA 1EFTA 1G3UA 4Q48A 2ZI5A 3ZGXA 5SZJA 1KZ7B 1T8UA 5L3RA 2QN6A 2XNDD 4Q4HA 1R4AA 4P31A 1WP9A 2QGNA 5BQ5A 2ZRJA 5SZIA 1CJUC 4OKSA 2ZUCA 3EPHA 4LYJA 3KJIA 4Q7MB 2J0SA 2FPMA 2IYQA 2OAQ1 4IOJA 3SNHA 1RE0A 4Q1EA 1N6PA 2Z43A 4TLEA 4LHYA 4YONB 3A6PC 1F48A 4UNSA 4OK3A 1ZMXA 4WA7A 3B9QA 2FPLA 1QHHB 1AN0A 3A58B 2IUSA 2IT1A 1DG3A 4Q18A 1MO6A 4LWZA 3KXKA 2VSOA 4DSTA 1Q20A 3AF4A 1GAJA 2OESA 3CPEA 4ABYA 2RGAA 4QKQA 2ORVA 2NMVA 4E09A 4Q1DA 1OFIA 1T6NA 2AXPA 3U7GA 4O2RA 1MO3A 2BWJA 2FEOA 2GCPA 4O2LA 2JATA 1JXOA 2N42A 2P65A 3QE0A 5JWOA 1VMAA 1ZM3A 1FNMA 4AWXA 4GOJA 1DS6A 3SJBA 4LYHA 2FZLA 1E98A 3NTUA 4Q5IA 4PXAA 5GJCA 3H2YA 2OZEA 3KQKA 2PLRA 4LZZA 1OB2A 3BH6A 3TIFA 1OW3B 1SZPA 1ZAKA 1DPFA 1ZIOA 2J0VA 2QQ0A 5FBWB 5KO2A 1FMJA 2ZYWX 3BE4A 1IXZA 1V43A 3OZXA 3SJCA 3TR5A 4HB3A 4LBZA 2WPDD 5JZVA 1CEEA 3BOSA 1N5JA 5B30A 1BO6A 2RMKA 2AWOA 4LUCA 1G1MA 1VTKA 1U2RA 4XWAA 1CR1A 1R7RA 4D0NA 3THXA 3LV8A 1NKSA 1FFHA 3EZFA 3WBJA 1S4QA 1IN4A 4Q66C 4URYR 4A82A 2OV2A 3KKMA 2N1BA 2HCJB 1J8MF 1VG8A 2F3TA 5EE3A 1E0SA 4B48A 1A5TA 3AB3A 1KI8A 1Y3AA 4R2IA 3QJYA 3WY9A 3WYAA 3RC3A 2BBWA 4MRPA 1GKYA 4TTRA 2IS4A 1G17A 2R8RA 1S9DA 5AJZA 1R6BX 1Z2CA 2DFKB 3K09C 8OHMA 1S1MA 2PLFA 3O8RA 1BH2A 2C77A 4NYJQ 3TUJC 1OV4A 1AIPA 1MRNA 4TTQA 4OYHA 1S2MA 3RS2A 1SVMA 1CJVC 1E69A 2CCJA 1H8EA 1NVUQ 2GAAA 3CF0A 1G64A 1YZUA 1A82A 4X8LA 1E4VA 1ZC4A 4A0RA 4JBWA 4Q4JB 4BLTA 2V54A 1NMYA 2KWIA 4C0KA 1KGDA 2L0XA 2QZ4A 2JLVA 4MGYR 3TBKA 2Q3FA 3U7EB 4ZV4A 4TYWA 2G83A 2G6BA 5FBQB 2WIAA 2HT6A 2ZSBA 1C1YA 2ERXA 2FH5B 2QENA 3U2QA 4HDCA 1Z5ZA 3LNCA 1N6KA 4IFBA 1KAGA 2ECKA 2XTMA 1LFDB 1G3IA 4RVCA 4V0MA 4ARZA 2R6GA 4DB2A 3LW7A 1CKEA 1Z0AA 1JBKA 4A1FA 1AJEA 3U44A 4QGGA 4PPFA 1G8PA 3DDCA 2DYKA 2FFAA 4B3FX 4C0QC 1G19A 2GZHA 2QP4A 1KOFA 1AK2A 4K8OA 1OJLA 1U0JA 4BFYA 2ZSAA 4D4MA 1G16A 3NH6A 4PZLA 3QPWA 1YVDA 1J99A 4UXJA 2C99A 3AKYA 1N0VC 3RC8A 4RD6A 5EUQB 2WSMA 4DZZA 5EP2A 5TARA 4ZCIA 2ZR0A 4JBXA 4DSOA 1E96A 4OBEA 4DUGA 1DAEA 1E2GA 2HLDD 1P7CA 5FOTA 2UZ3A 5HKKA 2OFWA 2IL1A 1C4OA 3GMTA 3IILA 5FPKA 1LV7A 1OXSC 1E1QA 3THOA 3UWOA 5L3QA 4NTZA 4Q02A 1KSJA 3WMFA 2ZU0C 3TQCA 2VSXA 3DKPA 3CH4B 2PBRA 2ORWA 4TMWA 2ZRGA 4Q9JA 1E2DA 1Q22A 2A3RA 1OF1A 3U4QA 2XGJA 4CT4B 1FNNA 1Z0IA 3B1XA 3D8BA 2YOGA 2ZUDA 2VBCA 1SKYE 2Z4RA 4PHTA 3T06B 4RZXA 4MUBA 1E2PA 1ZM7A 4MYUA 4A36A 1UFQA 1WF3A 2JLUA 1JAIA 1SVWA 4BRWA 3MCAA 4GBMA 2YC2C 5IF9A 4JSTA 5FOXA 3MJHA 1KO1A 2G1JA 2OXRA 4AG6A 4EPVA 4LJ6A 3T34A 2RHDA 4Q4HB 2H17A 1CR0A 4DDWA 1YQTA 1IAQA 1IN6A 1E9SA 3FMOB 5EXSA 4LY6A 5TXGA 3T1OA 1ZBDA 1E2MA 2QE7A 3O47A 1OLOA 1VG0B 3EIQA 4UNNA 5BYKA 2QBYA 3ADKA 1JALA 2A30A 4A8JB 4YC7A 2QRZA 4UXIA 1NJGA 4ESVA 4JT4A 4AYTA 4AURA 2GCNA 3CF6R 1Q12A 3CO5A 4NDZA 1KNXA 3B5JA 4PTLA 3NDBB 1ZW6A 3T35A 3SYKA 1Z6YA 2B8WA 4GOXA 3WXMA 1W49A 1NMXA 4HUTA 2GF0A 4QNRA 3SDZA 3L43A 4JLVA 4DUGD 5KU1A 4H1VA 3ND8A 1Z6XA 5LPNA 4LPSA 4UJ3A 4HZUB 5TDHA 4MRVA 5HKKD 1XMSA 4MYCA 3CB4A 5TVKA 4QGAA 3TAHA 2QMOA 3SFZA 2MSDB 1RJ9A 4BEBA 4R9UC 1E1QD 3A1WA 3CX7A 4U5XA 4B6FA 1T5LA 3LXXA 4RFSA 1ZD9A 1VKJA 1GIAA 3IBGA 3B13B 4QJ4A 2DFLA 4I1OA 1IHUA 3R8CA 4DDTA 3GLIE 3PFIA 4ZDKA 1XXHA 4PAMA 5GADl 3H86A 1NNEA 2ZI6A 5FOUA 3SYNA 3G82C 1F2UA 3ICEA 1S0UA 1G6OA 2A9KA 4LYAA 4NHOA 1G21E 5FTMA 5KTYA 3K0FA 1G20E 2EW1A 4FWIB 2GXSA 2XOKA 3NEJA 2C04A 1KDPA 2C9OA 1U9IA 3LWNA 4UNPA 5LDDC 1GWNA 3AKDA 3THXB 3AVWA 1YR6A 1ZM9A 1G7CA 4BZPA 2ZI9A 3JZMA 3NKVA 5KDLA 2EVWX 4TYPA 4AYXA 2D3WA 4FMCF 4OK5A 1VHTA 4YMVA 2FX3A 4S2EA 2QT1A 2XSZA 4YMUA 1I2DA 421PA 3OEHA 2QROA 3LXRA 2JJ1A 3MRSA 3UATA 2PZGA 1MABA 2IYLD 4EQ6B 4X8HA 4BLRA 1JQJC 2ZROA 1NSTA 4Y0AA 3T5GA 2J0QA 1LY1A 1OH6A 5JJLA 4ERNA 5K8TA 3C8UA 4WZ6A 5FOWA 4B75A 4MITA 4Y0VA 4WIAA 1ZP6A 4EAQA 1ZINA 1GITA 2WJGA 1G3MA 5JWRA 5SZHB 4BFSA 1KY2A 4ZPXA 4DLSA 3OE7A 3S1AA 1T3LA 3AQ4A 2REOA 5KHOC 4JKIA 5FI0B 1SKQA 3BC1A 4RZ3A 1OPXA 3W8RA 3DZDA 5K8UA 4OJKA 1U8ZA 3W6PA 5LD2B 3QBTA 5UKDA 4M4SA 5E3HA 5AJVB 1Z0JA 4GZLA 1SHKA 3HU3A 2XNSA 2E87A 3M6AA 2X19A 3B1VA 3BORA 3K70D 1D5CA 1TF2A 5FL3A 3NBFA 1R5NA 121PA 3A4LA 5FPHA 3ZJYA 3TE6A 2DFTA 2HYDA 4DLTA 3WP1B 1VPLA 3CRRA 4TQUS 5FOVA 1XCGB 4AKEA 1OXUA 5JRJA 4E22A 2XOKD 2ZE7A 1Q1QA 2WJVA 3VR2A 3BWDD 3FKQA 4A15A 2F1IA 4PO8A 4TT3A 4V0LA 2XZOA 3UXMA 4NL4H 2GEUA 2EFHB 1YZNA 3A4NA 5DGXA 2TMKA 4PC1A 1X1RA 3FMIA 1FPMA 2V9PA 2K5UA 1KK1A 5ANRB 4B35A 1UBFA 1XTJA 3NDPA 2F3RA 3TJZA 2WSSA 4NCNA 1MO4A 2H16A 2H57A 1YZKA 2GJ8A 1RFLA 1UBEA 4BLPA 2CK3A 4KXFB 1NIJA 2QGZA 4DRZA 1YE8A 2FFHA 3TMKA 4LHZA 5DO9A 5J4LA 1NBME 4L8GA 4M1OA 2YZ2A 3GEHA 4WAUA 2GVDC 5EP3A 1P5ZB 4XTRA 1IJEA 4RFVA 2OXCA 1DE0A 1SXJE 1DAMA 3RDPA 3CNOA 3IDQA 3OE7D 1UEJA 3U3RA 1FX0A 2NZJA 4A8JC 3PUYA 2ZRAA 3THWB 2H92A 1XF9A 2PX3A 6Q21A 3MG9A 3RS5A 4XTCS 4JJZA 2D7CA 4GMDA 3MMPA 3DKVA 3KKNA 3BFXA 4AKHA 5J4HA 1ZU4A 1HTWA 4HZIA 1N6HA 2MMGA 1KSGA 4CEHB 4AKIA 4ACAA 1R0ZA 2P5SA 2ZAOA 3QENA 3BERA 5C2JB 1HE8B 5DISB 2ZJOA 4D0LB 1U0HC 3ZQ6A 3AVYA 1GRNA 3Q8XB 4G5SA 5JSZA 1YZTA 1EESA 2Q3MA 4FMBB 1G3RA 2GWHA 3A1VA 4C2UA 1T0HB 2CLSA 4TT3D 5B64A 5KNCA 3RNLA 3F0TA 3AM1A 1PLKA 3CPHA 3GJ0A 2EFGA 2F1HA 1IONA 1KI3A 1I4LD 5LB2A 3P26A 2W2XA 4GOKA 2ZRBA 1FUKA 4NCHA 2GA8A 4PAQA 4KSCA 2O8FA 3FKSD 5BN5A 4Q47A 4IHQA 3ZD6A 5IHPA 1P9RA 1J90A 1GRRA 3B2EA 3CR8A 2FFBA 2QY9A 3FFAA 3UMRA 4PHFA 1JQLB 3BJIC 5TB5A 3TVDA 3M4YA 2OCBA 1FP6A 1XWIA 2W58A 3TUZC 3GP8A 2GKSA 2O8DB 3PITA 4DDVA 2BM1A 3NBZC 1KTVA 4FIDA 4FMCB 5KYKA 1D6JA 4F92B 1YR8A 3DOFA 1NY6A 2H5EA 3L82B 1FTSA 4ZI3A 3W6NA 5CDFA 4NCIA 2VL7A 1BKDR 4MKFA 1XXHB 2AD5A 2PMKA 2FZ4A 3EZ2A 1U99A 4PO9A 3KXLA
chains in the Genus database with same CATH superfamily
3AIMA 5P21A 3KTAA 2ZBVA 5K6AC 3QOFA 1LBHA 2Y0BA 4FNMA 2PWYA 3G9ZA 4HX2A 1JI0A 4FHZA 4PY2A 4RENA 5C7OO 4HDMA 4D3ZA 2BGUA 2G5TA 2WF9A 2H2AA 1CQJB 2AH5A 2H5JA 1QAOA 3OD5A 1CC1S 3AM3A 4LYGA 2OHVA 3P0JA 5AKZA 4EJMA 1EG2A 2AXEA 2I6FA 1DO0A 2KYRA 3K9HA 4GR4A 4K05A 1L5GB 4A9AA 2O4CA 3TCKA 3VKHA 2OAEA 2C9DA 3QVJA 4ZT2A 3ZHYA 4BO0A 5KWSA 1WPGA 4R8KA 1R3UA 2NU9A 1KKMA 3K9GA 3OOEA 2FCRA 2EERA 5EERA 3MWYW 1Z6GA 2JFNA 1OYWA 3BWMA 3CH7A 3DFUA 4J4HA 3LFUA 4QREA 4DCPA 2IOFA 3LIPA 4Z4FA 2ZWVA 4FOOA 5CH8A 3IP9A 4AUMA 2HW8A 3N2GA 4PLYA 2HM7A 2PBZA 3H1GA 3LBYA 1R6DA 1JDTA 2IUTA 3O3NB 2JKVA 1EP2B 2X9NA 5A1JA 3AUYA 4FHFA 3CF4G 3H9QA 3NYWA 1Z5WA 3FHCB 1W1IA 5GJBA 1IY9A 2J59A 1L4NA 4GLLA 1DIOB 2J8ZA 4FDLA 4W5WA 4BBZA 3J7AC 3VH4A 2B94A 3OEED 2Z9BA 4MWTA 1LDGA 3OTHA 2FQWA 2V03A 1XJ0A 3ILVA 2CJWA 1UXOA 1WXGA 4L95C 1HTTA 3WC4A 1C4WA 3OOWA 5JRDS 1XKQA 3OLWA 2DLNA 3PNVA 4GXRA 4NBSA 4UBLA 5D3KA 2UZ4A 3VZRA 2WIKA 3PQ8A 4CKEB 1OLUA 2DY1A 1CJKC 2BONA 3PCXA 4URHA 2DPHA 5JH7B 5FWXB 1J9ZA 5BWMA 5ICMA 1JEYB 1KIAA 1MOPA 4JJFA 4OSPA 3S0JA 5CFMA 3D1LA 1VJRA 5REQB 2IYOA 4HCJA 4PGGA 3GJ5A 2GEDA 4ENWA 4BFXA 3JVVA 4D9EA 1S2DA 1G41A 3R3SA 4BE7B 4ZC1A 4QLBA 3GY0A 1EE9A 1NTOA 4QARA 4Z4QA 3F71A 1JWBB 2XNDA 2P2ZA 5EHZA 3CTPA 3TBHA 1KZGB 5BSRA 3GT7A 1MB9A 4HG2A 3U7IA 1NLUA 4JB0A 1RLJA 3GN2A 1AQUA 2FY8A 2YRWA 2WAOA 1H4VB 2FSIA 4LCEA 4CQMB 4D3DA 1X0XA 1E18A 1FMTA 3N2KA 3R2JA 4ZA2A 3SVZA 4X1KB 3SYTA 4R1SA 4XJXA 2ZYGA 5JSUA 2NZ8A 1TO6A 1OCEA 4AX4A 1XLWA 3FNHA 2ZITA 1ZLYA 1CQWA 3PJDA 4HH0A 5H83A 4C1BA 1SBYA 2EF1A 3MM4A 3ORFA 3UUEA 2FEPA 1VE9A 1ZUWA 3CUYA 2QRLA 2G7MC 4EJ0A 1ZVJA 2HN9A 3ESYA 4ZOLF 4CZ2A 2PKQP 3NIWA 3IURA 1YS2X 2BCGY 1UZAA 2Z2ZA 3A6HA 3R5JA 4UVEA 4Q9LA 5JE8A 4ER5A 5BWLA 5E2IA 3OC0A 2C0QA 4N9QA 3LY7A 2VAVA 4TL7A 3W2IA 1XDSA 4Q3OA 1JZSA 4YROA 4YN3A 4B3BA 1EXDA 1GZVA 1BGWA 2C2OA 3X1YA 2I4TA 2WUDA 1TVKA 2WJIA 1SVKA 3HCOA 1OROA 2D06A 1WXFA 3NHKA 4JI2B 4Q82A 5I7OA 2BD0A 2QD5A 1T13A 3WNCA 3M6LA 3RVLA 2FSFA 2YBDA 5KEIA 1K8RA 2GR9A 2HJWA 4LYYA 4B6JA 2WM9B 4PLPA 2XNKA 1SY7A 3PDWA 5KSOA 1U0TA 3GA0A 3RAGA 4KQMA 5AJTA 3N59A 4F2PA 4F4CA 4KIGA 4F97A 3NUGA 2LCQA 3LK6A 1RAHA 4YY3B 1UQUA 1K5PA 1UH5A 2G1KA 5CB8A 2HUNA 4Y2UA 1BXRB 4DA9A 4US1R 2VAWA 1UBCA 4BN5A 3K7EA 2IK8A 2OEPA 5EIOA 2WW8A 1ZNQO 2W90A 3KJGA 3DS8A 3RK4A 1G5QA 3OOYA 2PV0A 3I6BA 2QAGB 4I19A 2X4IA 1PZXA 5BP7A 3A9VA 5DW3A 2Y1FA 3GUCA 3BN3A 5JW6A 2ET6A 4RJKA 3X43A 4YMHA 2C9YA 1H69A 4CR6A 5J2UB 1KI1A 1U1FA 2DB3A 1CDOA 2OBLA 4EJSA 1H1DA 5CEJA 4TYYA 1GUZA 4US0R 1OBHA 4UHBA 4RTMA 5ERXA 2VXBA 4M86A 5LYYA 1GPKA 3Q88A 2DPMA 1O94D 2IOFK 2ZG6A 1WF6A 2ACKA 4O0MA 2WT4A 4MW1A 1UXIA 3LCVB 1ADBA 1J06A 4NCKA 4RTSA 3HFJA 3DZGA 4M1QA 4QG7A 1A4IA 3NHJA 5KYWA 2VJLA 2DQSA 4IDBA 5LOVB 1DIRA 5AI4A 1Z17A 5HOEA 4NS1A 1M54A 1Z25A 2BT4A 3NPMA 4AUNA 4EKDA 3FTFA 1JKMA 1TJ4A 3NT2A 3JAKA 2EFCB 2PFSA 4TMKA 3UBTA 2JCBA 3LBHA 2I99A 4G63A 5CX1A 3TRIA 5JEEA 3BULA 4IJUA 1C3VA 1I80A 2AUTA 1QG0A 2ZE8A 5EUMA 4WXMA 1LS1A 3BPSA 4AP6A 2O5CA 4V03A 2P0YA 4XASA 2YX1A 1WS6A 3TEFA 3EMDA 4M76B 3P0FA 2QQFA 4PHCA 2FP4A 1S9HA 1WD7A 1Z4LA 1Q21A 3A04A 3NS7A 1QF9A 1SA0B 3O8CA 1OXMA 2R79A 2JBAA 1TFRA 2ODTX 3AEQA 3DWFA 4U7FA 2CHQA 4LX8A 5FHRA 5A5EA 2XB8A 5CD1A 4BRSA 4C7BA 4GLBA 4AK9A 1KH2A 1OI3A 2JK1A 3C6XA 2LR0A 5G3ZA 3GLGB 3HWSA 2IFTA 1XZMA 3RTBA 1X92A 3LK7A 4XVHA 3BH0A 3PUHA 1QIMA 4C89A 1Z2OX 4O4JF 2YJ5A 3KDPA 1GTG1 2G0TA 5BSEA 4AVYA 4E2YA 3OPYI 4ZOQI 1KI4A 2ZSFA 4OHXA 3SR3A 1TZBA 3KVOA 3F98A 5CM9C 3N07A 5IZCC 3QPCA 1UFKA 4OXKA 3X1MA 4TMVA 3CSSA 3I2JA 2EP5A 4DPLA 5LIRA 1H0RA 1H8HA 1OIWA 3QYFA 3THRA 5D5QA 5I8WA 3KETA 4KPYA 1QIEA 2C4WA 2XB9A 2YXBA 3AY7A 1NN5A 1O6GA 1QIJA 2VZLA 4RK7A 1WXWA 2FZ5A 5KYUA 5AVXA 4K9PA 3ZV3A 4JUFA 3ZNOA 3HL4A 2J85A 4MKZA 1C81A 3TLMA 2GKGA 2Q1SA 2JB9A 2GTPA 1P81A 3ODPA 5JYBA 5ELXA 5LDGA 3UK7A 3W6OA 4KN6A 2ZVDA 5EAIA 5TNXA 4JFAA 1F7VA 4RVSA 1Y1TA 1QVZA 3VZBA 1J33A 4ZOEA 4HTFB 4E5KA 2I91A 4OHFA 4IMPA 1T3ZA 3NWOA 4H27A 1W85B 1XRJA 4KQWA 4JA0A 1EUDB 1SU7A 2J5KA 3GUZA 1U3FA 2JIMA 2YJTD 4P3YA 4ZGGA 4CKCA 3U3ZA 1F8GA 1P9WA 4QIHA 1SQ5A 1OWOA 1EGHA 4BNDA 2PMCA 2BKVA 4QDTA 2FEMA 1L8OA 2HNAA 1WWKA 4ZCLA 8GPBA 3E7WA 1YTLA 4UASA 2VS1A 2C2ZA 4WBNB 1N6RA 5C34B 4FBLA 4KGVA 5EFZA 3BTOA 3ZIAD 2BFEB 5K09A 1VSQA 2NP7A 4LWPA 3OU2A 4LNAA 5DXFA 1HKHA 1L8LA 5U9CA 4ZJPA 3HXQA 1HMPA 3AI1A 2P0EA 1YU9A 3D3NA 3W6ZA 4N12A 2VPPA 4MW2A 3LBNA 4NSNA 3BF8A 3LC0A 4ZVQA 2IYYA 2EKBA 4OQDA 1M1YE 3IEPA 1SIOA 3C0KA 4O4HB 4Q24A 3WZLA 3O8LA 5E4FA 3AEUA 3NBYC 4X1YA 5HZKA 1JR3E 3FDJA 4H1TA 4DJFC 4HXGA 5FPTA 5GGYA 2UU9B 3Q7QA 3RVQA 1XU9A 4FEYA 3VTKA 1JPJA 4S12A 3AKZA 1WBBA 3S68A 3ZLTA 4V0KA 4WASA 2BMVA 3HSKA 2PSJA 1SG6A 4NYJR 1H8HD 1QCZA 2NO0A 2YQ5A 3AY0A 4QELA 3SZRA 4DLWA 1G4UR 4GLJA 2XE4A 3IBYA 2NXJA 1QFSA 3IIJA 1IUPA 4I4TB 4RJLA 3BZBA 4ZAVA 2NIPA 3IGFA 1ITZA 4I50A 1YI8A 2FF5A 1DT3A 1VHLA 2CUKA 1IDOA 3EEOA 3MHPA 1EK5A 4LTNA 3U16A 1JRLA 2PA3A 1XD8A 5L9AA 3H84A 3WHLA 4FJ1A 2W2TA 2XZPA 1FDUA 2BBSA 1XEXB 5T3YA 3MNFA 4O2AB 5FA8A 2HQSA 5BYJA 1T9BA 4MUGA 3RQSA 3S3TA 5AJWA 2GOYA 3PSAA 2GHQA 4DMFA 4EO9A 2OCPA 1NA5A 1NVKA 3KYDB 3TEMA 3ZGZA 1DJPA 1GILA 1K88A 1GQFA 1NQ5A 2JLBA 2PGJA 3CEMA 1M1ZA 3JAWB 2RI0A 3ESQA 3OM8A 2CLHB 3CRVA 2B1IA 4RCZA 3RSLA 2IBTA 4V0NA 2CE7A 3R6TA 2JGDA 4FMPA 3BZWA 3NCHA 4D99A 4URVR 1U0GA 5C3MA 5DNCA 5JAPA 4IEEA 1LPBB 4GBED 3UN1A 4KZPA 1U6KA 3QKRB 1E5LA 3IQFA 1GAXA 5IT4A 1SIWA 1Y7TA 2G9QA 3R75A 3RLFA 5AW3A 4D5GA 1AB5A 4XIJA 4UCFA 2ZEJA 3I92A 4MLPA 2B7BA 2I1WA 4JI1B 3H6GA 1C3EA 2V3CC 3L7CA 3V7FA 4LRWA 4WZZA 3MA0A 1NXWA 2IYTA 5TEWA 5LA6F 1VYUA 1W7AA 1C9NA 3DPIA 1ZEMA 3I9MA 1YAHA 4RV4A 3G1WA 4L4RA 1K9SA 5B30A 4R0VA 4HVLA 4RYLA 1G7RA 5F51A 4BOYA 1X39A 2XQKA 3FPBA 1TPZA 2D1YA 2HXYA 4OGWA 1FRFS 1E3DA 2NTEA 4AJPA 3R20A 1N5IA 1U1EA 4D82A 2R44A 3CKYA 1QJCA 4FFOA 3SR0A 3L7YA 3PNQA 1EDOA 3RADC 1NW3A 2ASEA 5CA1F 2QRUA 1M1NB 3NTRA 2XXBA 1RWKA 3FB4A 5EHIA 1WTAA 2CXRA 5MFPA 2GI4A 1VIAA 2DT8A 4BGEA 4WRRA 1H1LB 5AHKA 4CEIB 4RJ2A 4O59O 2AXQA 3G9QA 3K0CC 2XMQA 4CGYA 1GZ4A 1P1HA 3PFCA 4I9FA 4FYVA 4I6JA 5DBFA 1U3CA 5E7QA 2PKEA 4KLNA 1XTUA 2ONYA 4HWOA 4Q9DA 4KB5A 3GJ4A 3U7RA 4F9TA 4FPXA 1E3EA 7YASA 2A4KA 5ER6A 4DMGA 2P9FA 1RACA 4F5EA 2POQX 1IOWA 4E2WA 2YYYA 4WXEA 4BECA 2P5TB 4WCDA 2ST1A 4W5NA 4EHNA 3WQRA 1TMKA 2HZ7A 1BVUA 3JD4A 3LKVA 3IB3A 3LY8A 1A4RA 3PDJA 4BKOA 2YH2A 4Q01A 2CVQA 2IHJA 3EOAI 4HY3A 4JLDA 4QDXA 4QBGB 4KXNA 4BYMA 4C7XA 3QXSA 4OQNA 4O2BB 5CIWA 3PLNA 1JG3A 4RV9A 3ETEA 4QSHA 4UEOA 3ZWBA 3GYGA 4NV0A 3H3XA 3NBQA 4JBGA 3WMEA 4KO8A 3MPOA 4ZRDA 3G79A 3HUFA 3R7WA 1Q3KA 2XDAA 3LVQE 4ASUA 1NYTA 5JY6A 3AFGA 3VVCA 3MWDA 4KPEC 4X1IB 2VZEA 2GESA 4AJ4A 1EVKA 1KC3A 1Z5OA 4QFBA 5T41A 4DMUB 4DUPA 2O8BB 2O8CB 2IYXA 1PNRA 4PFSA 5HEKA 2JARA 1ETHA 5IU6A 1EFDN 1GN8A 1GGJA 3C39A 3KCQA 4CMAA 4PNEA 1Y1PA 2MR5A 3DONA 1TM1E 3Q9UA 2WOOA 1AMOA 1WJGA 1Q5PA 3GIWA 3ZWDA 3JSAA 1H3EA 4DR7B 1R00A 1JLMA 2E5WA 2GAJA 3IIMA 4F2GA 1HNZB 2EKQA 5J2TA 2FMIA 1YQGA 2E4UA 4KO1S 2GF9A 2W4MA 4CMIA 4OSOA 2HT1A 2DUJA 4X65B 2ZIGA 2FRDC 4LHWA 2R48A 2RGDA 5H80A 4IZOA 1HG1A 3QUQA 1X9GA 3GAZA 4LXYA 2QTVB 4REQA 4AN1A 4UBNA 1FVOA 3DNPA 4JD5A 1IJKA 2PT9A 1USKA 2NWQA 2YRXA 3FVWA 3FWKA 1NW9B 4I8DA 3D5EA 3OSZA 4MPTA 4TQGA 4DIKA 4DCUA 1HE5A 2W98A 3QEKA 4LYEA 3AETA 3QX9A 3ZYCA 4IDEA 1J9GA 1ULSA 3B9BA 1HE4A 3MMZA 4RX1A 4Z4CA 2COKA 3HR4A 3PC8A 4NU6A 1LBEA 4X62B 5DOZA 4E12A 2O3SA 2BEUB 4EI2A 3I5YA 2II6A 4FHEA 5K3OA 3QW4B 5AIBA 1UZLA 2MYTA 4KQ6A 4U2FA 4JR0A 1VIYA 3NRBA 2I3DA 3T5DA 4PE5B 3FNQA 4YRTA 1PVDA 1V39A 4MUAA 1SCUA 1UAGA 1OGYA 1GYQA 2MR6A 2WZQA 3NIBA 1UXGA 2M6LA 5CDTA 4OU4A 4QBHA 1RBQA 4YIKA 3TB6A 1X8KA 1JFVA 4TSFA 3GT3A 4IDGA 1VPDA 4OREX 4RMGA 3RFTA 1QLWA 2GLTA 1OVGA 5IEJA 1O0BA 3PUZA 1Z8FA 4A26A 4F12A 4MJ3A 4H3VA 2CLEB 3DFFA 4ASUD 2BKUA 4ILEA 3V32A 3QUTA 5DRYA 5JVDB 4PZYA 4I7EA 4JJAA 4RL4A 3KRTA 5EMNA 3K6SA 2OPBA 4PNZA 4BGDA 2I34A 4GOLD 5B4VA 3B82A 3H83A 4NDNE 3M49A 3RRXA 3E3OA 5JROA 1F14A 4HEQA 4JBYA 4YBZA 3CFYA 3IP6A 3CVYA 3CB2A 4F85A 5CCBA 2GJKA 4BFZA 3LUFA 1XZQA 2GJSA 2WVHA 4OP3A 4ALIA 4P92A 1MG5A 3MB5A 2B1GA 3PJFA 1LSSA 4BL5A 2GD0A 5LBTA 3A0UA 1EWKA 3C4JA 1FDRA 5THXA 3Q2OA 5AVOA 5JMOA 2C8KA 3P4XA 3GPBA 1GXSB 1Z56C 1SUDA 1VZ2A 2GEKA 3CXUA 2IDKA 2ZB3A 1PG5A 5K0GA 1KBOA 1X77A 1PK9A 2NYAA 2QR3A 4HR7A 3V1MA 1DMRA 4CM4A 2GJ4A 1E63A 4GVPA 2XWBF 4RMIA 2DQKA 4G2NA 4RQAA 4XX0B 4MWBA 1P75A 2ODWA 5TRTA 1KEPA 3ZH2A 2ZIUB 1G5HA 3QFRA 3B6IA 1P2GA 1JDBC 4L7VA 1KQ3A 1FBNA 1UDWA 2H2FA 3MLEA 3OIGA 1WB5A 4R98A 3SVTA 3NC0C 4DBLC 1EXVA 1RBYA 1LPNA 1PNVA 3PWKA 4GR9A 3JYOA 3ICPA 3ZWYA 2ZRFA 3LGXA 3R6WA 1XTBA 3VISA 3ACBA 3WWEA 5IKPA 1NC1A 4BO2A 2HAEA 4FE4A 2AKAB 4R31A 1USVA 1V45E 3G7UA 3KELA 2V4ZA 1UXHA 4PSAA 3V4SA 2AEEA 3T61A 1T15A 2QX7A 5A3SA 4AS3A 4LXGA 1U8CB 1CUAA 3KPWA 2JIQA 4BVEA 1N9KA 5ALXA 1B7GO 3C43A 4G8BA 2WUGA 4Q3BA 5EMHA 4RVGA 2RHBA 4Q4AA 2YXNA 4TSFD 1K8ZB 1AK9A 3SZOA 3WE7A 5C5CA 5DTRA 3OIVA 5DHRA 2H4WA 3R5FA 4MR9A 4YXWA 4EF4A 5J3JA 2PFKA 1XIVA 4ZRNA 3SOZA 2Q6OA 2QPOA 2DFPA 4OQEA 1E1RA 2VNAA 5FWYA 4Y1RA 3PEWA 5FTKA 1XRQA 4JSYA 2O2SA 5H9WA 4CDRA 2X7HA 1ZL0A 1U94A 3PWSA 5D6OA 5LZ7A 1XI2A 3NWJA 3OJOA 4I1PA 2X40A 5A3QA 1JQBA 2JFGA 1BEEA 1GG2A 4M0EA 4MCHA 2VLBA 3QLUA 3OT5A 2ZSHA 1BDMA 3D6UA 2AEFA 2P62A 2LD4A 4LMBA 1Y6FA 3H4MA 3I8XA 4NCBA 1LLFA 3JW8A 1UM9A 1V4BA 2JCSA 3UAGA 5AVUA 1FMFA 2XT9A 3QMMA 2H3EA 1SK9A 3ZE9A 1JS1X 1WCIB 2CXHA 1FMLA 3L1KA 1P1KA 1V11B 3GJXC 3Q0TA 4G5HA 3BMXA 3TSWA 4YR9A 3O91A 1TE2A 3WV5A 1Z8NA 1LTKA 1JHAA 3EIOA 3KPUA 1KDZA 1QVWA 1HORA 2Y1KA 1FDSA 4XUCA 5EZYA 1JEQB 5DULA 3QXJA 4BNGA 4Z1MD 2BZ1A 4II2A 2XUDA 2M9MA 1ZN9A 2RGNA 4Q9HA 1S3IA 3ETHA 3AUXA 1NUAA 1ST3A 1UKEA 4DDMA 4RPIA 1P0IA 1T1GA 1QO0A 3C3AA 4HKTA 5DI9A 2A4MA 2C8JA 4DLKA 4LC0A 4MDFA 5L95A 1DEXA 3OPMA 1KOJA 2ZFUA 2CSUA 1YFJA 2QPTA 2XWQA 4LJAA 4UJ5A 2GEFA 5LVAA 2GFHA 1FTWA 4F8YA 5JATA 2UUCB 4P34A 4Q05A 1JNYA 3W4KA 2ZAIA 4HLQB 1WHSA 4HQLA 2JFHA 1IBRA 5L7YA 5EJFA 3OKPA 1J1ZA 1VECA 2QJRA 2WZCA 1BW9B 3DBRB 2HRCA 3KSAC 2G0AA 3HR8A 3EQZA 1P62B 1X1BA 4YXWD 1BCRB 1EFCA 4MXDA 3DHYA 3ESBA 2H2IA 4K6OA 2CLCX 2OGUA 3RSCA 4DQLA 4IVRA 4LDNA 2WU8A 1ZH2A 3GRFA 2K4MA 4OYRA 3IUEA 4D56A 1R0KA 4CIBA 1Q1AA 5K8CA 4ALNA 4WCFC 5EMLA 4CQNA 1FK8A 3EVFA 3MZ0A 1CUCA 4E88A 3N1UA 3U39A 1T0JB 2A88A 5GGXA 4I3HA 3ZHSA 4LAFA 1M2EA 1OWMA 1AS2A 1XHEA 5FAXA 1BFUA 4MI6A 5HS4A 5HGXA 1MX9A 2RE8A 1Y5MA 2IU6A 4M7RA 4EPRA 4NJEA 3LZCA 4NFSA 3RSOA 4HDQB 2AG5A 4KUHA 4DEVA 1OH5A 5DH9A 3G2IA 1DRJA 1DWPA 2RJNA 2ZJAA 1DSSG 4IUYA 5ILGA 3S1AB 2O48X 4PWYA 3L7DA 3Q85A 1Z3IX 4RAQA 4ARAA 4X3CA 2G36A 3VOBA 2BGKA 5FNVA 2HHLA 4XJTA 3F7MA 1SG9A 2J30A 4O4LA 5L40A 2OG2A 4HBZA 4WKCA 3TH5A 3F5MA 1E2QA 4HSEA 4LFAB 1GR1A 1ZQ9A 1UKYA 3AFIA 2OTCA 3DDWA 4AL4A 3DHEA 2FR0A 3M6IA 4ZI7A 1RMQA 4HEJA 4WZAE 4L16A 4BZXA 5HRAA 4ARCA 3G8AA 5EVCA 3ACDA 4Y9SA 3DMNA 3GRYA 4B40A 2ZCUA 4D02A 2GX6A 3TDNA 3HI6A 1NXOA 1NY5A 1P73A 2J3LA 2R6FA 3AVQA 3EISA 1P45A 2P3QA 2R7AA 3GLRA 3PYLA 4JT9A 4OXIA 3TLYA 4X92A 3SVLA 3KQVA 2W2LA 4BQPA 1TVEA 2Q0QA 4PC6A 1K3UB 4EG4A 2HGSA 1RLUA 2XUJA 3C45A 4P9NA 4PO3X 2V65A 3SQWA 4UTRA 1Z06A 4EEXA 4EW3A 4HAYA 4PPGA 4YRPA 3D02A 1M1YA 1AMNA 2FWRA 1Z0ZA 4RHTA 5DM1A 3TLEA 1JR3A 4Q21A 4D26A 3JZFA 2I8CA 1JHPA 2ZWMA 3UAWA 1N33B 1NVXQ 3WGKA 1MJNA 4EZEA 4EHKA 3SWWA 2F6RA 4P5DA 4CM8B 1J39A 3CNNA 2E5FA 1JT2A 3BFVA 4U3JB 2P1DA 4C7VA 1ONBA 5JTTA 1P3JA 3CX3A 4QRIA 3ZU2A 3V8QA 4A6XA 2H1HA 3IAM6 3Q7EA 1AZSC 3BJZA 4TV8A 4YH1A 2XRFA 4UULA 4RTQA 2RGYA 3IHLA 1M2NA 1OYYA 4MRNA 3HPQA 1T2DA 1SOWA 3KJXA 2VDKB 1CUEA 3I58A 3RS7A 1E2HA 2E0IA 1L4EA 3GUHA 4FCTA 1L6IA 4JLKA 5CD9A 3F73A 4K9MA 4WTOA 2QLNA 2WJ6A 2JZNA 3DEAA 4KYTA 4R1MA 3QUCA 2EQBA 4C2BA 3VXKA 3HO6A 4QNMA 4ZXPA 2NVWA 2ZCVA 2QAIA 3KS9A 2PMWB 2WF6A 3KZ1E 4P0TA 3UFBA 1CRPA 5KX5F 4TRJA 3ZUGA 1ZKMA 1NMSA 3HB1A 3JD2A 3A1UA 3NYQA 4JJKA 4UEQA 3SMVA 1UL1X 1ZAYA 2YWCA 3LYLA 4UE2A 5F77A 3EEQA 3VHRA 4D6YA 4B76A 1TKBA 2VP5A 3GT0A 1PJZA 3BXZA 4RUKA 3OQMA 1N77A 5IABA 3WO1A 2X8AA 1WW8A 1D6SA 4IVQA 4UXHA 3GGCA 2W2OA 1U80A 3VC7A 4PIMA 1SJ9A 3OU6A 3PXXA 3LF1A 4D8YA 721PA 1TZKA 1Y3CE 2VQEB 3NP7A 4QAQA 1CW2B 1XP5A 2BISA 2CVHA 3EOBI 5AXCA 4TM7A 1N57A 2A0FA 1NVMB 4WH0A 4RK4A 1E6LA 1NYLA 4GPD1 3FJ1A 2GS9A 3AERB 4GPTA 4OHOA 4PTYA 5IZ4A 1YTUA 3JQRA 1SWWA 3KL2A 4X8OA 3PUVA 3SG0A 3SHQA 3LTNC 2UAGA 5F9MA 1X3LA 3N5KA 3N86A 3WMGA 3KBOA 3SN6A 5JS8A 4K9RA 4XH9B 2DECA 2LDBA 3NOVA 1D4FA 3PIIA 1JR3D 1L3IA 3R6GA 5JADA 3K53A 4CIYA 2IY7A 1E1NA 5BR4A 5JMWA 5KKNB 4QYWA 2VSQA 2IS2A 1XVIA 1JAXA 3Q40A 1VRCA 5AI0A 1M0WA 2QJWA 2NSDA 4NULA 3OJLA 4ZT7A 3WHKA 2ZJ3A 5E1MA 4HN4B 2KI5A 4RM3A 3MQ4A 2XCSB 1Z07A 3OZAA 4C4TA 4NZYA 1XCMA 5LQJA 1OYVA 2GVZC 3A1SA 1VIVA 2OCXA 1FW8A 3PUXA 3LT0A 1YA4A 1YHYA 1ZCBA 4QQFA 1FJXA 3LOQA 2CLOB 3U4IA 3FW1A 3L7KA 4P0QB 1BU5A 4JR2A 4TSRA 3KP1A 3VU8A 3OPYA 2OD2A 2NT4A 4CKBB 4PN7A 4KAXA 4TN5A 2JASA 3RVKA 3T3GA 2J31A 1F2TA 3F4KA 2ISQA 3UCXA 3WDSA 2BBTA 3NJ8A 2O3RA 3GPCA 1R6VA 3HFSA 5TGZA 2NXEA 2AVDA 3JAMA 2DH6A 4PLVA 3RV4A 3TNLA 3D7SA 3KTAB 3WWZA 3T1TA 3U3XA 2ODPA 1VLVA 1ZEJA 6REQA 8ABPA 2I7TA 4I9HA 5DPMA 1U3WA 4A2CA 4W1PA 1HL3A 1L4BA 5DKFA 4B7AA 3PFKA 4WACA 5GZ3A 2YW9A 3NHZA 1KORA 2GTIA 4TKLA 4F4HA 5JMTA 1TA9A 3KUUA 4BFLA 3MRXA 2YJ4A 3DKKA 1Y0BA 5AI5A 1AGNA 4JMPA 2JDIA 4ZT3A 4DG5A 1Y3BE 2C42A 1TNDA 2E4ZA 2QL6A 3QVXA 2NU9B 5CFNA 4JOSA 4RADA 4RTJA 2NO7A 1RM0A 1EWRA 5CFRA 3ULKA 2V58A 3AJDA 5CLHA 5C4MA 2JAWA 1YHNA 4KUGA 2R66A 2P9CA 1KAHA 3TCNA 3IUYA 3N2GB 1C3XA 4RPGA 2O8VA 4HAVA 4NBTA 2ZSKA 4RVUA 5CK4A 1QCYA 2LVBA 2VJDA 4ZAFA 1A3CA 4F4FA 2Q3EA 3KNZA 1OX6A 3UNXA 3KUDA 1H3FA 1CQPA 3MW8A 1S8AA 1XMIA 1DHTA 4NJOA 4A4DA 3WISA 3Q8MA 5JJKA 2EEZA 5FYDA 2O0HA 4BC0A 5C31A 2JLSA 2VJQA 3TQFA 2CJWB 1UPUA 2ZIWB 3B36A 4S1NA 5EMJA 1F3OA 3II6X 2YV3A 3JARA 4UPEA 2VBGA 1ZCAA 2BM9A 3RASA 4A2PA 5CEFA 1G291 2PCJA 3I8OA 5EZ6B 1KJ8A 1U7DA 3SEFA 2XMZA 5I9TA 2IU3A 1OLUB 1AU9A 2FW8A 4I5DA 3ROPA 4YJ2F 1NW5A 4X94A 4CWAA 3ZWOA 1RHRA 5CIQA 3ET5A 4KMOA 1RYFA 3KAKA 2PUWA 3OQBA 1NI3A 4YRNA 1Q0TA 5LQNA 1ISSA 2BJWA 3HPRA 4LCBA 4OL0A 4E30A 2BLNA 2YV5A 1DAFA 2N3ZA 2V3WA 4MKIA 3RS3A 1OTXA 4BJHB 3GA7A 1EJ0A 3GRRA 4UUMA 2J1LA 3QI2A 4OO3A 2JGEA 4X71A 2UKDA 4O6VA 4YT5A 1E2NA 2PD4A 3ANSA 4EHFA 5C81A 1CNEA 1ODSA 3TLAA 4TWJA 3MD0A 3ZS9A 1WQ1R 2ZRLA 1OZFA 1I5OA 3N2KB 5BSTA 4O1IA 3NTQA 4QTXA 2EJBA 4YRIA 3EMVA 3KL4A 2FWNA 4KFUA 4ZICA 5KSYA 3RYHA 4K46A 3BTVA 3EDYA 4WVFA 4RV5A 5EPOA 4R4JA 5L4LA 4KXVA 4RH1A 3NB0A 1P74A 3RIHA 4DV6B 5ILOA 4KWHA 1E2LA 1P1FA 1A1SA 1TGVA 2AV6A 1UJ4A 5CGZA 3F8SA 5E9AA 1TT7A 1XNHA 2LE0A 4XGNA 2D5LA 3N87A 2DJIA 3HCFA 1PNOA 3ZI0A 4EMSA 5BN4A 3E05A 1VE7A 4RTRA 1GVNB 1OKKA 3FZYA 3DYBA 2BL4A 4IOMA 4PZ9A 1EB8A 3AR8A 4D8WA 4C0JA 3EXHA 3N2IA 1PQPA 2FFRA 5DTIA 1N5DA 3ZHZA 5LMCA 3DFKA 3E15A 2QIPA 3IRVA 4Z4HA 2AA3A 2G5CA 4Y67A 4ZCSA 1WCYA 2VDRB 4RLQA 4C4RA 3SPXA 2IYAA 4GDFA 2DBYA 4NMXB 1IQ0A 3AR2A 3FRHA 5AI6A 1Q0RA 2G8NA 3FVTA 4FILA 3HG7A 4PQGA 1QUFA 3ILHA 4MTLA 4QYXA 4C4ZA 2JCVA 4HDKA 2AI2A 2BEWA 1MAAA 4IQFA 2QUKA 3QVWA 4RTPA 1N2XA 1LPAB 1TIBA 2BEKA 1M7HA 2O3QA 2OSVA 3M4JA 4CM9A 5HUJA 4HJRA 4KPGA 1US8B 2EW2A 2Y1EA 3H3JA 3LHIA 3OO0A 4Q7JB 3ORHA 1IZ7A 3REQA 2G28A 2VHTA 3SQLA 1N4AA 4TWZA 4JB3A 1XTQA 4QM6A 3KYCA 4JGIA 2D54A 1V8DA 1P44A 1OHHA 2XITA 4FX5A 5CM8B 2QWXA 1HSZA 4BKQA 2IYUA 2DAPA 2Q46A 4ZIRA 4RANA 2HSEA 2P9YA 5H3LA 2ZRCA 4UNIA 2FJ0A 3QKWA 2H07A 2Y6UA 1DG1G 1F5NA 3Q72A 1ZYUA 2ZPTX 3D3EA 1BJRE 4FZJA 3VKUA 3BB4A 4MCAA 3GVHA 3KK0A 3TLKA 3EAGA 4WGFA 1I8TA 4EJSB 5H68A 1Y5IA 4I0WB 2HYIC 5HTKA 4ARIA 2EEPA 2ZVJA 1GSOA 2RAPA 5CFZA 4KE6A 1NW6A 2WYVA 3WIEA 4E5UA 4CEHA 4QODA 2G7ZA 3AW9A 4TLCA 2FNAA 3JQBA 2A9JA 3ASZA 1STOA 1MUUA 3K4HA 3GGOA 4ZHQA 2YL2A 2YWHA 1XZ8A 1FFAA 2EDCA 4IEIA 4K1LA 4PICA 4R5MA 5KYWB 1GLGA 4EKEA 4BV8A 1X3SA 1KKLA 3WB9A 1NM5C 5AH0A 2IRWA 4CU2A 4G56A 3WYCA 3L0DA 1VSVA 3OQJA 4CG1A 1ONNA 4X95A 4TTVA 2ATCA 1ZUHA 1BMFA 3JAKB 5AK4A 5JWHA 4Y9RA 4YQZA 1Z16A 2HDHA 3Q41A 3STTA 3DMTC 4YAGA 4Z4EA 1A97A 2QT9A 4U00A 2CDNA 3K1AA 5HXAA 1M66A 2OK7A 1P7WA 4XD7A 2Q4BA 2W00A 5K0BA 3BSWA 1NRIA 5FCDA 3ZVKA 3HB0A 3BM5A 2FP4B 3GUVA 3NBAA 4GNRA 4XEHA 3H5RA 2WT8A 2HU7A 3AEQB 2JBAB 3OLZA 1ZXLA 1WY5A 2R85A 2VA9A 2X5OA 2GPJA 4MPPA 1J8DA 5L3ZA 1EEXB 2XMSA 3AG6A 3A3NA 3PPYA 1XOIA 4H77A 2XUAA 3RUDA 3U3KA 3G5LA 4YJ3A 4ETNA 4IXMA 3NORA 3ROQA 2JIZA 4F9EA 3VSCA 4CTKA 4PG8A 2HMWA 1PJ2A 2CMHA 4H1UA 1DTWA 4PR0A 1QIFA 3HCDA 4X91A 1TQHA 3DVAB 4BWFB 2OFOA 3DO5A 3GI1A 4I9NA 3UGKA 3R41A 3ZH9B 1M74A 2C59A 4NC9A 4JJGA 1BGXT 1R74A 3PVSA 3WP0A 3ZI7A 3I2KA 3L2OB 3ECSA 4HXFB 1XHLA 5TMEA 1A7JA 4R8SA 4RYDA 5JCZA 1X7HA 1NX6A 4LY3A 1SD2A 3QNWA 1NJFA 1LCIA 3ZHUA 4ZTZB 3ZU5A 3K4PA 1KRWA 3A0RB 1NBHA 5BY2A 2HO4A 3ZY2A 3CR7A 3LO8A 1YDEA 3CLUC 1Z39A 1KZHA 2NADA 3VZSA 1P33A 3T5MA 2BRUC 5DHTA 1ENOA 3QITA 1UP7A 2H1VA 5FKJA 3MMSA 1XVAA 1CEQA 3R7DA 3SLKA 5JMPA 1YS1X 2WB4A 4Z5XA 1E7SA 3M6FA 1R0LA 2F7SA 1JSCA 2Y8EA 4GX1A 2BMEA 5K99A 5LSAA 4MDEA 1CYDA 1XZIA 3MTBA 4HFNA 4LBWA 3RBVA 1BMFD 2G9RA 4BLSA 2XA9A 1MH1A 4PBTA 5AKIA 4F71A 4CKCB 5FV4A 5JANA 2BKEA 3WX0A 1R2QA 1SVLA 3Q3GE 3B1YA 3K9WA 4KBGA 4GLFA 4OHCA 5ARBA 3FPCA 2D13A 3TZLA 3TTVA 3ZY4A 2VNHA 3INRA 1K6EA 1BMDA 3D7NA 2R8BA 1K5DA 2ODNA 1N4DA 3AF5A 3OFJA 4QICA 3FLMA 3GEDA 4KC0A 1OC2A 4YWHA 2WZDA 2COEA 4KX5A 1H2ZA 4NHEA 2Z5GA 3SJ7A 1AV6A 3OUZA 4M1KA 1Z6PA 2GILA 2PXCA 3OT1B 4YP5A 1KA9H 2IYVA 1V3UA 3O1JC 1KEEA 2I4NA 1XTZA 2JIZD 5IDVA 4CI9A 1G5TA 2O5VA 2C2BA 2QEQA 3TWOA 2NQ2C 4C0SA 3AEUB 1S2NA 4X1YB 3OZIA 2Q50A 4N48A 2C8VA 4WZAA 2FZWA 1T6XA 3TKAA 2KLHA 3PNOA 4GMFA 3AHFA 3WK6A 2PGAA 3IJPA 2CJFA 4FN5A 4ND7A 1B16A 4NPHA 4OUDA 5GIPE 3UJAA 4B46A 5HIJA 4BNMA 4DJ5X 2DLDA 1I7QB 5BV0A 1BC5A 3KWFA 2IZOA 3KZNA 1CD5A 1ES9A 1KFJB 1QFZA 1XAGA 2VCHA 3HL0A 3WLTA 5IXYA 3E48A 4R6WA 3RANA 3KU4A 1JB9A 1RC0A 2J46A 1L5WA 3UAZA 1OREA 1KH1A 3K09A