5IAOA

Structure and mapping of spontaneous mutational sites of pyrr from mycobacterium tuberculosis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
171
Chain Sequence
ESRELMSAADVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDSTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Bifunctional protein PyrR
publication title Structure and mapping of spontaneous mutational sites of PyrR from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25177 / h37ra)
total genus 50
structure length 171
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iaoA00
4FYMA 4RABA 4QRIA 1JLRA 1P19A 3GGCA 1A95A 2AEEA 1DKUA 2WNSA 2PS1A 4RAOA 2E55A 3NAGA 1XZNA 4P81A 4RHUA 2VFAA 3H83A 1R3UA 4P84A 1MZVA 1LH0A 1QCCA 2FXVA 3OZGA 4RQAA 1V9SA 3QW4B 1IBSA 5KAMA 4IJQA 1L1RA 4LZAA 4WN3A 1Z7GA 1U9ZA 4RHTA 3EFHA 1ECFA 3OZFA 1P18A 4RADA 5BQPA 5BQOA 1A98A 1HMPA 1YFZA 1J7JA 2YZKA 5JSQA 2C4KA 1DQNA 5HIAA 2H06A 4RAQA 1ECBA 4Z1OA 2JI4A 4PAWA 4RHXA 1G9TA 1QCDA 3G6WA 1A97A 5KAPA 3KB8A 2P1ZA 1U9YA 2EHJA 1I0LA 4KN6A 4X44A 1OPRA 1O5OA 2PRZA 1STOA 4F8EA 4M0PA 4MB6A 4RV4A 1ECGA 3ACCA 3DEZA 1P17A 3DMPA 3HVUA 1I13A 1D6NA 5EUCA 1A3CA 1JLSA 4RHYA 1TC1A 5BSKA 1DQPA 1O57A 4LZNA 4RACA 1G2QA 2H07A 4RANA 1L1QA 4OHCA 2PRYA 3M3HA 1P4AA 1G2PA 1WD5A 1BZYA 1UFRA 1XTUA 1ECJA 4LZOA 4P83A 4S2UA 5BRNA 1CJBA 1UPUA 3DAHA 1PZMA 3S5JA 1QK5A 3LPNA 3LRTA 3ACBA 1OREA 2HCRA 3OHPA 1ECCA 2H08A 1I14A 2DY0A 4LYGA 1GPH1 1G9SA 1QB7A 1XTVA 5ESXA 1W30A 4RQBA 3MJDA 1I0IA 5JV5A 1I5EA 3ACDA 5IAOA 4WMLA 2GEBA 1Y0BA 1HGXA 1DBRA 1ZN7A 1AO0A 1QK3A 4JITA 1A96A 1QK4A 1VCHA 1GRVA 4LYYA 5K51A 1XTTA 1ZN9A 2JBHA 2JKZA 1NULA 1OROA 2IGBA 3GGJA 4P86A 4TWBA 4QYIA 1NONA 3MBIA 1FSGA 1TC2A 1A4XA 3O7MA 1DKRA 2XBUA 5HKLA 1QB8A 4P82A 4JLSA 4M0UA 1ZN8A 4QYIB 5ESWA 1VDMA 2JKYA 4P3KA 4PFQA 5E38A 4X45A 4ZFNA 3GEPA 5IPFA 1BD3A 1UPFA 3N2LA 4M0KA 1XZ8A 1BD4A 4P80A 1VSTA
chains in the Genus database with same CATH superfamily
4OOEA 3G79A 2X3FA 1MV8A 1LPOA 5CR9A 4JC8A 4QJBA 3WOHA 5EY5B 1RKBA 3H18A 2OCLA 2NU8B 2NV6A 4EG1A 5AVQA 1U6JA 3S81A 3V4RA 4B2PA 4V2UA 1PHRA 2JEOA 2FETA 1M1YE 3ZHTA 5AW7A 2I6XA 3ONFA 2OGTA 4PQGA 1KC1A 3FTQA 2GGSA 4BE7B 4C6TA 3UJHA 1FRZA 2I6GA 1C1XA 4JODA 1UK8A 4XGNA 3ZWXA 3F9RA 1UR5A 2D1YA 1HL7A 1QGAA 2WHEA 2Z2KA 3A1DA 4CF5A 2CK3D 2W90A 1M76A 1TTTA 4BNMA 1YJAA 4HMQA 4PFKA 2PXXA 3KSBC 1W85B 5D3MB 1TADA 1T24A 2YXBA 4BVEA 2CVOA 2QP3A 1KAGA 2AK2A 2J9XB 3CVJA 1W93A 2Y1WA 3MC1A 4R69A 2CD7A 2RGCA 3WIEA 1ORVA 2LDXA 2FFBA 1E2LA 1JHMA 3L1VA 1T8UA 4G56A 1M2HA 1ONNA 5DM70 4H3KB 4JI8B 4MYCA 1SBYA 1BQ4A 5FOWA 1QKKA 2PRZA 1IYZA 4DHEA 1RRCA 3L5KA 4NS1A 1HBJA 3EMVA 4HVCA 3SG0A 5HW0A 2BRUC 1N75A 3EW9A 4HS4A 3ZW8A 1V8BA 3KVRA 4YP6A 4CMBA 2QRNA 1NVFA 3GUZA 4ZDWA 3ZK9A 5J47A 5G1OA 2FUEA 1TL7C 2Q3MA 2HV9A 3SF0A 1ZNXA 4OQZA 4K2AA 1OWLA 4X8HA 1VMIA 1CUBA 1S2GA 5EIWA 1E6CA 2C4WA 4WHMA 4I9UA 2EKDA 4AWBA 2ZYDA 4FE4A 4GBED 3FOEC 5KX5B 4J8PA 1FB5A 3KYCB 5J2UF 1KMNA 1S8AA 2Z57A 1GQ2A 1XWWA 5DGTA 4ADSG 3BICA 4ZCMA 2UYCA 4BEBA 2G8LA 5FO0A 1E4OA 2WAMA 1U0RA 3RANA 2ST1A 2YYZA 1P2VA 1XL1A 2VIIA 4REQA 2AZMA 4TRRA 5LCXA 1YBHA 3AM3A 4CDMA 1GLGA 2TRSB 1SZDA 4FUQA 1YMVA 1H2WA 1ZH8A 5LBIA 1BW9B 1C3JA 1DUSA 4TXMA 5LFAA 3UGQA 5A5FA 2HSZA 2C9BA 1JIXA 3CRRA 4EG8A 3E5RA 4IQ4A 4EHLA 1RRPA 2H4FA 2JIOA 1R88A 3IVXA 4PYMA 3ZZTA 4KO3S 1ESEA 1PBNA 1QG6A 4PRLA 5LLTA 2IHKA 4GMFA 4P5PA 2ON6A 2IGBA 2DC1A 3MILA 4P86A 1ZXBA 4YB8A 3TNFA 2JIPA 4FZ3A 3QE4A 2W2QA 4Q7JB 5HKLA 2G1KA 1XA3A 3IPRA 1S3IA 3A3PA 2PJZA 3LWZA 4FZ5A 4KU4A 4TRJA 2QVXX 2WUVA 3RFUA 1JVBA 4MR8B 4RLFA 3U31A 5C3MA 4IW3B 2OCYC 1S0UA 5FWXB 3G6KA 3DO8A 3OZEA 4TLLB 3P5BA 4Y2TA 4J0DA 4MHTA 1QRTA 4F71A 4BMVA 4DIBA 1QTIA 2X6TA 3KEFA 2IS2A 1ECLA 4HRAA 4LXXA 4N48A 4RIIA 2PWBA 2IXFA 4W82A 5ER9A 2ZS8A 1BH6A 1XMPA 2AFIE 2CZQA 3GYBA 3N1UA 5F76A 1KQNA 1E0SA 5AT1A 5KOJA 4X65B 4RF3A 2I4IA 4MKXA 5AW2A 4Y2VA 2GNAA 4UUMA 4YDQA 1E3SA 4Y9UA 3HYLA 5EZYB 2HJSA 3RJMA 2IHZA 1TK2A 5CK5A 3D0QA 2VOJA 1QRUA 1EB8A 3P26A 1I10A 3AUTA 2OPHA 4JLUA 4U9UA 2RG1A 7MHTA 4MJXA 4XA8A 1QU2A 3MTGA 4HBZA 3GCZA 4IXMA 1UFVA 3GRYA 1SMKA 1Z5ZA 1FSPA 1A9XB 2IIVA 4FCWA 3HH8A 2FDXA 1T2EA 2Q1TA 3CZPA 4JUDX 3PTLA 2VPZA 3CF0A 3K6JA 4X1OA 5EZYF 4LYFA 1KZ7B 4R0MA 1CQPA 4PF1A 2C1ZA 2C4MA 4KL8S 4NBWA 2VDKB 2JIZD 3C7CB 4KLAA 3CH6A 2VZEA 1MORA 4EZIA 2I9KA 1ZX1A 4BU1A 2DUJA 2WF5A 1HK7A 1JSXA 4KDFA 3RWBA 1C7RA 3QA9A 4E7PA 2HMSA 3EZGA 3ANSA 5CVUA 4YWHA 4FC7A 5T4HA 3BL8A 3ZDEA 3L7KA 3CKLA 4XCXA 3QIAA 2HF9A 5JASA 4BO5A 2XXAA 4DWOA 5TF4A 4QD3A 2ZRLA 4KQCA 5AJXA 4RTKA 1G42A 2QX8A 1IN7A 4HNAA 5EJ2A 1UADA 3QOWA 2FZLA 3NOVA 4R8KA 3STUA 1O08A 2AG0A 4KE9A 1ZA1A 1GAJA 5C8YB 4NZYA 1JIQA 5FTLA 2ZAYA 2G9VA 3ZK8A 1UBNA 3ERCA 2EJCA 2FW6A 1X1TA 3K5IA 2R6FA 1I2CA 1IEXA 2NQTA 2ZREA 2XEXA 3B78A 3ECSA 2E3JA 5A71A 4EBFA 4ETNA 3K6SB 2DR0A 3IV9A 4TXHA 5CDTA 2DUUA 3U7FB 1B23P 4Z51A 3LCJA 3VYUB 1IEVA 2E7ZA 2FFJA 2VC2B 2NSLA 2XB2A 1KDVA 4OJKA 1XRQA 2PH3A 1T1SA 1OA1A 4E03A 1K88A 4C7MA 1IN8A 2ES4A 2XQKA 3K0BA 3MJSA 2XUAA 4Q82A 1M66A 2W93A 4Y7CA 1ONPA 1TM5E 2OB2A 2OHJA 3E35A 3U2QA 3E5NA 1UZAA 1DKMA 2PVPA 2RGGA 1WQ1R 3WLKX 2PD6A 5JHHB 4IMJB 3WHIA 2BGKA 3MMZA 4YRTA 3C85A 1A2KC 1XJWA 1C1DB 1L4EA 3LOUA 5FBLB 1J0AA 1IN4A 4AP5A 3K2QA 2IEAA 2A88A 5BYBA 3GGPA 4DLPA 3QJYA 4LMBA 1BCRA 1EJ2A 1RW4A 3GAZA 3JSXA 3KWMA 1IVSA 1GADO 2YMQA 1T3HA 1MX1A 5A62A 5BN5B 1M75A 3DDNA 1NW8A 1A4XA 3NTQA 1EGVB 3AFOA 2QL6A 3T3MB 2JEYA 2DFLA 1PJCA 3HY6A 3MHTA 2XBMA 1HX7A 1F9EA 1C2TA 3DW1X 3OA2A 4M83A 1PAUA 2EL9A 3CRNA 3N2IA 4X45A 1ND6A 4RHEA 1EM8B 2FEPA 1G7TA 1SEPA 2XCQA 5EESA 2Y0EA 4OFWA 1AK1A 2Q1XA 4JGIA 4Q21A 6GPBA 5EIOA 2DUNA 3IMEA 5CB6A 2Q5FA 1KDRA 4PBSA 5JLAA 3CX8A 1E18A 3BDAA 4MUEA 3REGA 3DTVB 3V34A 4J91A 5BSVA 4FX5A 4WZBE 2BFDB 3FYDA 5KDDA 4N47A 1J21A 1US8B 4IFTA 2NO5A 3JASA 1T2NA 4XSGA 4YXFA 4BQRA 4C7XA 1AZSC 4LGCA 4JP5A 2ZJBA 4JBGA 2RAVA 4QHSA 1AHHA 4LGYA 2R2AA 2OV1A 5E6UB 2WSSA 1L6IA 4OUKX 4M9UA 4P4SA 4CLXA 1ORHA 1WP9A 4M76B 1BXZA 1JEDA 4OAQA 3WWZA 2P9YA 3TZ6A 1F4LA 4R1MA 5EMMA 4U7JA 2DTXA 3EUWA 1O96B 2WWFA 3VR4H 2VWGA 3OETA 3WLMA 4AIRA 5DWDA 4C0LA 4JIMA 4DL9A 2FMFA 2JNWA 1SCJA 4W7SA 3QU5A 3UFXA 5JCXA 2O3JA 1GCGA 1UDXA 5BQ3A 1Z33A 2J85A 4K46A 3AT1A 3BTSA 5I8WA 4QEZA 1QF6A 1PWYE 3WYAA 2PRKA 4KQ2A 2RJ3A 4R6WA 1YFLA 1KRHA 4EG5A 1XC7A 1XI2A 1XCJA 1KO8A 4DG8A 3PEYA 4RQTA 1EGHA 4DIDA 2EXXA 4ZI7A 1MW9X 1DV1A 2X0EA 1WXWA 5JSFA 3U1BA 5G02A 2AI1A 2C84A 2B1RA 2O14A 2G28A 2CEAA 3N87A 4QNNA 3R7NA 4FPXA 4M8LA 4KXLA 4CM9D 1ZO8A 3C8HA 3LT1A 1U2GA 4RACA 4MIOA 1AS3A 3W2HA 5DASA 2WM9B 2EARA 5DYTA 2Z9CA 3MMPA 4OF4A 3COZA 5DT2A 5KREA 4Z4FA 4YC7A 1E9RA 4KWTA 2XWPA 3M9XA 4M4SA 4DS3A 1IZZA 3GRCA 3Q2KA 1K3TA 2BHTA 3AHFA 3M34A 3TM5A 2W4IA 4I5GA 3I6YA 4Q7QA 3MFQA 2O8VA 5FR1A 3PEWA 3ZD6A 2Q27A 1MCZA 5HKKD 2J6BA 1AN9A 1CRWG 4QSMA 3VPXA 3CR3C 1DEOA 1HYHA 4KFSA 2NYUA 2IS6A 1MIOA 1M10A 4BXOA 4RBNA 5K09A 4PQFA 1L4HA 4EG3A 4PZAA 3GRAA 5HTOA 5ALVA 3RD5A 4CN8A 3VJKA 4JSRA 4NI5A 1KK0A 4NBNA 3G82C 3PR2B 3ZZ0A 2ZITA 1MOSA 3D3KA 2JLRA 1GGHA 2EFYA 3L2OB 4OKNA 1GRVA 4EB8A 4K05A 5ESRA 3EPRA 3CNBA 3T9DA 2IYNA 2FI1A 2NTEA 1QV7A 4OQYA 4LX0A 2EAUA 1NXXA 3I8OA 1E5LA 1RU3A 1BE6A 1X80A 3WDSA 1L5RA 1QYIA 1E20A 4TXLA 4B4KA 4LI0A 5KNDD 2NO1A 3UAWA 2ASVA 2I91A 4OIMA 4BU0A 2GN9A 1IM2A 1DKNA 2CCJA 1BFDA 2PMKA 1SXJB 3DUWA 2Z43A 2Z83A 3R74A 5EJ9A 4MPPA 3QVGA 5DLDA 1JHPA 2O2DA 2WV7A 4PPFA 3TPFA 4EY6A 2DBZA 2MYUA 2W48A 5HRAA 2JGMA 4H0FA 3W5IA 4QRIA 2IUTA 3SZUA 3D7LA 2E4YA 5HEKA 5LZ8A 3Q5GA 3EUAA 1U98A 4X90A 1VL6A 3K8ZA 3KB2A 4RH3A 1UJBA 4B31A 3FVVA 3CX3A 1YE3A 5E2IA 2BEJA 1P4JA 3PYLA 4CKBB 1R3UA 1W5BA 1WCIA 2YN2A 3MF4A 4YJHA 3UW1A 1MZVA 4D02A 3DL4A 1BMFD 3OWHA 3ND7A 1QANA 4NPAA 4U6QA 2XD4A 3T94A 1OSNA 3V4PB 5ALNA 3W90A 2B36A 1XZDA 1V48A 5T64A 2BKXA 3SJ7A 1DJLA 1RWMA 3CIFA 5DI3A 3ZV4A 5CXSA 8OHMA 5EWLB 3ZBPA 4IOJA 4UHDA 1ZI9A 1IFXA 2WMOB 2GYYA 1YQEA 3WXBA 3QELB 3AG5A 3WQRA 3N2KB 3H17A 1NYRA 5K2MA 3ZQ6A 5EJ4A 3A9TA 3EZ7A 1MQ8B 3ZBUA 2W6OA 3G5MA 2VQ6A 4WZAE 3W2IA 5D8DA 2WFMA 3WWOA 1R16A 1ICEA 3B6MA 4WESA 2XYPA 4EEXA 1ODKA 2H2WA 3G2QA 3AVWA 4M0MA 1G21A 2Q99A 4PHGA 1YAHA 5BSRA 2YN0A 2PGAA 3WP0A 2NYAA 4Q9LA 3MAJA 2BFFA 4FLEA 2C88A 2JGRA 3NXSA 1C0KA 3K6KA 4G2TA 4GLOA 4XM2A 2VDUE 3AH8A 2CVZA 4YAUA 2DAPA 1PJQA 2ONKA 1NG1A 1Q1EA 2Q3DA 1RYZA 5U9CA 3L8CA 4KMRA 1AF4A 3R5JA 4UCXA 3U13A 1N6KA 2HFJA 2JH8A 2OM2A 3ORYA 4J76A 3CW9A 4OIFA 3IMFA 1BVHA 4EO9A 2ONZA 3PUYA 4QICA 1QZUA 1Q77A 3PFCA 1CTQA 5JAPA 1JL3A 1CUUA 1OVMA 1X8XA 4DLWA 4C6SA 2HD4A 3N7TA 5AVSA 1RWXA 1ONBA 1MB3A 4Y2JA 2CXUA 2EJVA 3ZCXA 2X4DA 3N39C 3DPIA 3DQQA 2O52A 3Q40A 5AHWA 1NU8A 1OASA 3F3SA 1GKLA 2ZYHA 1BCSA 1G5IA 1MA3A 4QC2A 1GCAA 4A5OA 1D0IA 1DFHA 2NXWA 3QBJA 1XG5A 3CR8A 2W2PA 4YRAA 1O4VA 3Q3JB 3X2EA 2ZXUA 2RGXA 2G9RA 5CA1F 4GVPA 4KIWA 2CFTA 3COVA 1G8PA 1C8LA 2A0KA 2R6GA 3VSBA 2OV6A 2FW8A 4KODA 4AL4A 4C87A 1E1RD 3PF8A 3D6AA 3VVBA 3I5YA 1U11A 2R1UA 2JARA 2FWPA 4EPYA 3RUIA 2O2SA 2X8JA 4PX2A 3QEAZ 4Q4HA 2Z5FA 1M6EX 5IC5A 3BE6A 1HRDA 1XPOA 3LUGA 1N3BA 4PZPA 4YP0A 2O8EB 3HL4A 1SUSA 1A7JA 4FFPA 1CCWA 4ZICA 4TTIA 4ZCSA 1FMCA 4RL6A 2FQWA 1FVHA 5ALWA 4Q9IA 4HB0A 4IDHA 4FYPA 4JOCA 2CXHA 3QBVA 1ORRA 2WVJA 4RL4A 2P2LA 3FJOA 4AJ9A 1OTHA 4I6JA 3CG0A 4QFBA 1JJAA 4IIBA 1KYWA 1FFEA 1ZSNA 2H16A 4KOEC 1R10A 1IHPA 2PGDA 3A0UA 3DTVD 1C4XA 1YJQA 1JA0A 2QTCA 2B7BA 1IBLB 4ZGGA 3O3OB 2B8TA 3D0RA 1QH8A 2LIVA 1BHJA 1SQGA 1Z0KA 2R47A 3BS4A 5KIAA 1KDTA 3VU3A 1A4RA 1AGRA 2ACVA 2Q41A 5DBFA 4CMIB 2W5UA 4Z4CA 1BDBA 2X86A 4P31A 1FQJA 5B7NA 1O8BA 4BP1A 4MJLA 2J1LA 3SOPA 2FP4A 2ZJ1A 3CMMA 1EDZA 2A0XA 1V9CA 3FYUB 1GZDA 3CG4A 4A8JA 1LFDB 2QT1A 4AG6A 3N8GA 3RLFA 7ADHA 4O4JA 4JNCA 4L6AA 3L4JA 1XA0A 2ORVA 1R6XA 2Q0SA 3TZEA 3IAXA 3UWDA 3MBKA 1YFZA 4C76A 9LDBA 4G8CA 4KMMA 1WUYA 3LGAA 5AK6A 4CHTA 3JTEA 1NBMD 1O95A 4NP6A 3K0CC 4GYYA 4Z8YA 4AJPA 3KC2A 3LFHA 4X7BA 1CS0A 2FEKA 2IPLA 1L8AA 2WP0A 3SYTA 3JYPA 1J07A 4EPWA 2R8OA 5DFAA 3LS2A 4I9HA 4ZKDA 2XJ9A 2ACWA 3RSCA 4DLNA 5CXXA 2ZFUA 3S68A 3TZCA 5LQCA 1J25A 2QTBA 5GAJA 4G0QA 4RYDA 4F7DA 1M7BA 1WVGA 3ZNPA 5C53B 3AEUA 1YZVA 2AZXA 1R74A 2JFNA 1XEWY 4BQNA 4IMIB 1NXWA 2QMOA 3GJXC 3L93A 1NMYA 1WLYA 1UMBB 4OJNA 5TGDA 2W6ID 3W9SA 1K7XB 1CVRA 5IC6A 1WL8A 4TXNA 4YY3B 1FDRA 3MYYA 3PNYA 2R44A 5CVCA 3OIUA 3ISTA 4FFDA 1V1RB 1ZBQA 4URUR 4TROA 5K0CA 4YDRA 3BK2A 3NOQA 2ZE6A 1CJBA 4GLBA 3KKOA 1WV1A 4XXHA 2A4MA 1BO6A 4D9CA 2YIVX 1ZGAA 2L19A 2HR1A 2Z95A 1P1RA 3OZTA 5AVVA 5FWYB 6AT1A 4LRWA 3OIYA 3OHPA 3IIEA 1U9IA 1E2DA 1U3FA 3PFIA 1SVSA 4PGGA 1PCXA 3ORFA 5FD8A 1TYBE 4UTPA 4Y0AA 1QB7A 1A4IA 5JJKA 1XP8A 3GCXA 4F21A 5F51A 3ZOZA 1Y5IA 5YASA 4ALNA 1KAMA 2Q7XA 1D2AA 3SDBA 1ID8A 2PZJA 2GM9A 1NVMB 2C2WA 3ZE1B 3K0SA 2PJRA 1GUYA 5ALQA 2YHAA 1YOVA 2F1HA 5FOUA 1ZCAA 3GLHE 3VPDA 2Y1OA 3I01M 4OO3A 5KTYA 2JKZA 1VIAA 5C8VA 1TIBA 1RTTA 2EP7A 3CT6A 5DH9A 4KRYA 3URMA 2N1BA 5BV0A 1QWSA 5K8CA 1NJ5A 1E3WA 1K97A 1XD2A 3HLYA 1D6MA 4MHOA 5E4YA 4PGMA 1R6BX 3ZBQA 4C4SA 1Z29A 1DTSA 3CX6A 1JZQA 1SXJD 2AVNA 1NASA 2C5FA 3TE7A 4ALMA 1JW9B 2QVZX 1CDOA 1KEPA 3EIHA 3BXFA 1QGDA 4BPBA 1EG2A 3MT9A 3CVWA 2NMVA 1QAMA 4XZ3A 4CTNA 1KR2A 2HHAA 3HKDA 1Q22A 3AU8A 3I6BA 4GM0A 5ALDA 5IJ0B 1BD4A 4QRDA 2O2HA 4I5DA 2DPHA 5K7SA 1AKMA 1WDTA 4E7OA 4LZLA 5FI3A 1CPYA 4YAKA 1HFWA 1XTIA 2BKAA 4FDUA 3QKRA 4XIFA 1DCTA 5HSGA 2HCBA 5HUQA 2I2WA 2A84A 3C4QA 5CMLA 4JJZA 3UK6A 5JZMA 4HB4A 2NUBA 5E1BA 2YKGA 3H3XA 1M1XB 1V11B 1W59A 4H77A 3OBIA 3USZA 3ZHSA 4HQNA 1J99A 2YINC 2Z08A 1XLTA 4H4EA 1IZ0A 3UCXA 5KCZA 3BJMA 4B46A 1U2ZA 1AHIA 4LZAA 1WLSA 3KJFA 5J4HA 3PP8A 3OQNA 1IMOA 4JQCA 2YFYA 2V6BA 1XEAA 3G5LA 2YV5A 2Q5JA 3T3DA 3UK0A 2ZJZA 1LPPA 3FF4A 2HQSA 5JANA 5I3ZA 3LUPA 4ARVA 3AKYA 3KB6A 1UAYA 1IBKB 1CHNA 1FDWA 1WY5A 3W05A 2B30A 2NNWB 3K8QA 3P9NA 4ZCLA 3KKMA 3WWPA 2WWGA 5EJFA 1WNTA 5SY9A 2BFOA 3REOA 3V4SA 1GZ6A 5TEVA 4CHGA 5KYXA 5EKUA 2VTKA 4AMYA 4IIJA 1YJCA 1U9YA 4KJZA 1GA6A 1H1LB 2I6UA 1RXEA 4HV4A 1PUIA 1JHRA 3PDIB 2AFHE 4KWEA 3WMRA 5KHLB 3I5XA 3U7HB 1UJ2A 3ZDXB 1DXQA 1N3YA 3LZ6A 4FM9A 1U1FA 3PPYA 2QLMA 1RP1A 1C7QA 2JFZA 2QN2A 4Y2SA 4AJEA 1TU0A 5L3SA 5HP4A 3BZBA 4NULA 3T3NA 3DKKA 1AGYA 1NN0A 1TM2A 4RTQA 3EZ2A 3V8MA 2QP4A 1E4VA 3JPYA 3E9MA 4J0JA 2WB4A 2WUWE 3B82A 3OAAD 3N2GA 5H3CA 1NUAA 4RVOA 3VUFA 1A1VA 1FYEA 3HYNA 5LLSA 2CF5A 1I94B 3UQYS 2JBAB 1W8DA 4Q15A 3HLTA 2R7AA 4PTZA 2VHZA 5B1YA 1IJBA 3W2EA 3U6KA 3GC6A 3TL6A 4F3KA 3BCUA 3E9QA 3HY3A 3TRFA 4ZCRA 3OOYA 5FBHA 3TOVA 2FWBA 4DV2B 2HT1A 1TZ2A 2REBA 1DAIA 1TJ3A 3GJTA 1D09A 2H85A 3PLNA 2XKAA 3NAMA 4MRVA 2QUJA 5DW3A 1C30B 3UBMA 3PFHA 5FNVF 4BKRA 1C0LA 4DNOA 5CDFE 1V0JA 2CL7X 4BLOA 2EFDB 2JHCA 1OGIA 2B21A 5H3HA 1H23A 1UBHS 3OEYA 3KJXA 1AKNA 1KPIA 2ZR8A 4GPZA 3DL7A 2GDJA 4QOGA 1U2PA 4AMZA 3BD8A 1FSGA 4EVSA 4CQNA 3X0DA 3AILA 2ZSEA 5FADA 4ZIRA 1JKJA 3IUMA 5G4LA 5KSYA 4HEA6 3ZXIA 3EIWA 4KVGA 2HGSA 4HK4A 3TIIA 4MKHA 3F46A 1M2OB 4FS8A 4BO4A 3O2JA 4N8EA 3DCJA 3KJIA 2YHUA 4UHEA 1KI2A 2DX7A 1T0HB 4GU5A 4QJ3A 4ZYUA 4FWBA 1CY8A 1H4TA 3IV6A 2X0NA 4BDSA 1RKXA 4HX9A 3CF2A 3UK7A 4DSZA 2QUKA 4MMZB 3VC3A 5JWOA 1N3LA 2TMGA 4ZEOA 2HU5A 2Z30A 4J9UE 5KVCA 3FKSD 1A9TA 1P80A 3DDCA 3L7DA 2JLYA 3DDSA 1B0UA 2RSLA 2H7XA 3PHHA 4C07A 1RAGA 2XVZA 3M1AA 3C3AA 2J07A 4GOJA 4E6EA 2PUBA 3DMFA 1TMGE 3CBQA 3DULA 2AEEA 3EGWA 4L4ZA 2Q6TA 4LGVA 4YRQA 4DTIA 5BT8A 5THQA 1Y7LA 4P4GA 2EZUA 3SQMA 4WKPA 2I1QA 4U6SA 2G6TA 3BFJA 4IDEA 1IEWA 3EXEA 4UATA 4LTDA 5SV2A 1M8GA 3BMOB 4FEYA 4H7IA 4PS0A 3FSRA 3GPLA 1FTQA 1V45E 3F98A 5GJVC 4A2QA 1X0XA 1QVRA 3GVXA 2PUJA 4DCNA 1A8QA 3MNFA 2I1VB 3B3QA 1BDMA 1A9YA 3VH1A 1NC1A 5MFZA 1SURA 3KPUA 1K86A 1ORDA 2CNLA 2APJA 2X8LA 3AM4A 4YTEA 3UWOA 1OXUA 4L7QA 1CJKC 4BO3A 3ZD8A 2Y1EA 5EC8A 1B3BA 4JR2A 7AT1A 3M89A 5K3CA 1UBKS 2YHSA 3AY3A 4RHXA 3FLEA 2G67A 1AO3A 1FP1D 3H05A 3LTEA 2Q6KA 1EVJA 4XQGA 2WTEA 4FKMA 1A76A 2C61A 3PXUA 2YYSA 4S3MA 3A4IA 3NHSA 2EWMA 3ZQKA 5GVSA 1W88B 1ZGJA 3T7KA 5A3JA 1N33B 1OB5A 1DWUA 5CX1B 4G89A 5IS2A 1QXSA 4LHSA 4R0VA 5IXJA 4DEXA 2H54A 2PJUA 1DFIA 3PITA 3RRMA 3PCRB 1J09A 5AJTA 1OWNA 1V5WA 1TZKA 1UEXC 4XWYA 5BSFA 5TMEA 1W0KD 3UMBA 2EGHA 3L05A 4O3FA 4G1BA 4D4HA 2A3NA 4WTOA 2Z9DA 2FZ4A 3UPDA 1PZMA 4AZ3B 1T6ZA 2HK6A 2EERA 3AXSA 1SBCA 4BZXA 4OI0A 1I2MA 1Y8QA 4G85A 1OLSA 2M6SA 2VDQB 2OXTA 3DV0B 2O8DB 3CSUA 3KAJA 3GEHA 3SBDA 1A71A 5FKJA 5E7JA 2C5LA 1K98A 4W5QA 4JXKA 5K03A 2A9VA 4OCZA 1J9ZA 1I0IA 1VMKA 3DS8A 1JXAA 3JQAB 4O2AF 3UMFA 5JZVA 2IS4A 2BCGY 1XN1A 2VUSA 5CTAA 3IQDB 2XT6A 1DBPA 1USVA 4H1HA 1ZITA 3EEFA 4KGVA 4L16A 5EE1A 1SG0A 2HM7A 4MVJM 3S8EA 5C7YA 4Y0NA 3WRVA 4KREA 1SBNE 4P3NA 4LV5B 5HF8A 10MHA 2BHSA 3TG8A 5MGNA 3C48A 1G20E 2X9VA 2N42A 1YTUA 1V7QA 4JDUA 1VG0B 3VU1A 1XMIA 2IU0A 1O03A 2WF6A 1LBEA 4EF5A 4EQ6B 1YBMA 1T4BA 1TVMA 2J45A 2PKRA 3DZKA 1GKKA 4WZAB 3W5AA 2ZXEA 2XAAA 3IOYA 4QXAA 3CEJA 5F64A 2IUUA 5JQGB 4G25A 2Y1LA 1BX0A 1L9XA 3CWQA 4O4IB 4CMJA 1WF6A 3FGOA 3HUTA 2JGKA 2H9AA 1YIOA 4S12A 2ZTHA 4DLXA 2QJOA 5DHSA 3A9UA 3RIYA 2FPPB 2QE7A 1PWZA 1QM5A 1QE5A 4F7WA 1YCHA 3L0PA 2Z58A 4Q37A 2XV1A 1QIJA 2NTJA 5EMJA 3OLXA 1Y5RA 2AI3A 4MARA 1X74A 1UZNA 3AB3A 3K0KA 4NX2A 1T2CA 2D4HA 5AHKA 4YN3A 3HJTA 2GLUA 2QENA 2LGJA 2QF7A 4NLLA 3RUFA 3UENA 4X97A 3Q8WA 3PCXA 4CQMA 4I2NA 3IKMB 5IVDA 2UZIR 4INPA 4BV8A 5C1PA 1A69A 1OY1A 2YZ7A 4F0JA 1E7MA 1J90A 3BBPA 3V6LA 3JATA 4E21A 1WETA 5HHTA 1V43A 1R8XA 4U2FA 1EXVA 1SVNA 1Z17A 5H70A 4CEJA 4L8GA 4AY2A 1UIRA 3EDYA 3TOSA 2H1SA 3JQ8A 5A06A 2YJTD 2A33A 4K1LA 2A57A 3F5FA 4CM8B 5ITZB 5LB2A 1FPQA 2UZ0A 4L15A 4LBYA 1D2HA 2FR1A 2H06A 2VHCA 3WGHA 4DLRA 1QIEA 4B47A 1FS6A 4BJ1A 2NUTA 3NONA 1JDUA 2O2GA 1SKYE 4KO2S 3MPUA 4RSGA 3HO1A 1W5TA 5E3JA 3HBJA 5TARA 1CUFA 2B2XA 5JDCA 1PHPA 4N5NA 5H4GA 1PYGA 1D7OA 2PNFA 1U3VA 4A0SA 1L5HB 3I3SR 5KNBH 4CIWA 1I6KA 1TRKA 3NOOA 3OVMA 3DMHA 1D6NA 1HTTA 2BR5A 4MQ5A 4J3JA 1X1RA 4KVAA 4MVJP 4NAHA 5ILOA 4MV3A 4QG7A 3GMIA 2F48A 2WQ6A 1YBFA 2GSWA 2B8WA 1ARZA 3EYAA 4Q12A 1SU6A 3GAAA 4X0EA 5EE9A 3MRSA 4EMBA 4DAEA 3EW7A 3NG1A 1MQ9A 1WUJS 2CFOA 3NTLA 1P4AA 4MWEA 2CCKA 5DHPA 5BN4B 1U2TA 2ZIGA 3OFSA 1D5CA 3WJ7A 2FW7A 2CNKA 3PNSA 4A10A 4AQ7A 2Y71A 2PKQO 3F7MA 2J0QA 1UP7A 3H2SA 4FDAA 5T8KC 2JFPA 1JVSA 4GPTA 4YRKA 4Q16A 3CX4A 1YOBA 1ZK4A 2HSEA 1DINA 2QE6A 3FMFA 4HAIA 1JWAB 4KVFA 3QLJA 3UT5A 1YBAA 2FQQA 4DV7B 3JS5A 5CTJA 3PQEA 3RVRA 1BAPA 5L4LA 2GBPA 3PA8A 4IHJF 4MI6A 1RCUA 1EJ6A 4JS0A 1UC8A 1R27A 4RXUA 3NVAA 3G5AA 1XK7A 1AURA 5ENZA 2HBZA 2VBGA 2ZYUX 3KYBA 1E0JA 2N46A 4NG4A 4EUSA 3KALA 3M5WA 2VNJA 4BZQA 1Z0FA 4CT0A 1PRYA 4XB1A 3ZY2A 1B0PA 4X1KB 1Z2DA 2IT1A 3R8XA 1L0BA 1NI4A 4Q05A 1P0IA 3GRZA 4GMHA 2WE8A 1ZKMA 3QEKA 1XNHA 4QUKA 4D45A 5B4TA 2XMRA 5AM1A 2HO5A 1IK6A 1JLHA 3SS7X 2XCTB 4O8CA 3WBBA 3RADC 4LVOA 3ZD9A 4KXYA 3BN3A 4I4CA 2Y1KA 4KFRA 3KQMA 3GFGA 5D85A 1Z4OA 2R4QA 3HS3A 5DP2A 1BOOA 2ASEA 3HA3A 3LL4A 3I1IA 3O4HA 1MO6A 4F97A 3WYFA 5G1NA 1MNQA 3ZY3A 3Q8LA 3ANTA 3NTUA 2D5IA 2XADA 2JAXA 2WVHA 5DVZA 3VYTB 4E5DA 5JXIA 2RE8A 3V6MA 2QZPA 3EC2A 4UOQA 2PWZA 5ILQA 4GBGA 2J9FA 1E3JA 3L02A 3CKMA 5DP1A 3CU5A 4CKEA 2ORED 4NFLA 1G19A 2VXOA 1X8LA 1XRRA 4DRXA 3DR5A 1ZHHA 2O0LA 1DS6A 2FEXA 3AHHA 1NI5A 2HCTA 3JU3A 1NVVR 3WWYA 2R8RA 3INYA 3H6KA 1XMJA 4AECA 4BEVA 1YDWA 2QWXA 5I9NA 1K68A 4BNLA 5ABPA 2DCUA 1PZNA 1S2LA 2WIKA 1DX6A 1R37A 3K30A 1SCUB 1AQIA 3TSWA 2D7DA 4EKIA 2Z3VA 3QUTA 5CH3A 3AF5A 1IATA 2ZIVB 2PX6A 3TKYA 2OAQ1 3EFHA 4YPOA 3EQ2A 2Z6UA 1R15A 2FTKE 4LZWA 1QMGA 5IVPA 3S1LA 3KWLA 2HK9A 3RHZA 4OHMA 2OLEA 2EU8A 3RRFA 2GJSA 3NVMB 4GKJB 4Q9JA 1YC2A 1QH1A 1LWOA 3QF4B 2QG9A 4I81A 4YVFA 3H2GA 2O7SA 3ORSA 4QHYA 2AN1A 2I4TA 5C8DA 5LNK1 4I9GA 4Q1AA 4OXIA 1N2CA 5CG2A 3DMPA 1GFSA 2ECPA 4EY8A 1FP6A 1G7SA 4BCBA 1MRNA 3BWYA 1I33A 3IBSA 5JADA 4ISCA 1GV1A 2P4SA 8ADHA 4JB3A 5C1IA 2H5LA 1LF0A 4FEGA 1NXPA 3B53X 4RZUA 3W78A 5A9SB 3TSCA 4C7BA 5GQSA 4BAGA 2VDWA 1ZKDA 4QYXA 3RYTC 4JT2A 1E7YA 2GKSA 3R6TA 2XUQA 4NOLA 2PRYA 1FUYB 1BIFA 3IVGA 4RD3A 5G1PA 1ECJA 4A8TA 1SBTA 2J32A 2ZYRA 4RD0A 3G7SA 2BY4A 3QMPA 4HQOA 4G5HA 1IJEA 3C3YA 3N0RA 2BR3A 4WLOA 421PA 2BGNA 1F8GA 1V9LA 2A35A 3AR9A 3H5OA 3HU1A 3MERA 1NJ6A 4MVJG 4FYIA 4DR4B 2ID4A 2Q62A 2VF7A 1IAQA 2XVYA 3IAAA 5J4KA 1NZDA 1ZFNA 1YD7A 2BGIA 1OXSC 4IG4A 3D64A 4PX9A 2EV9A 2NZXA 3C6XA 4ZZIA 1RRMA 2C78A 1YL6A 1QHNA 2CDRA 1NLUA 2EKBA 4O63O 3CMCO 4QGAA 5A4IS 2OA0A 4GWLA 2QMEA 2NXNA 1RAEA 1SFRA 3GU3A 4L72A 2ZWOA 3H3JA 4G5QA 2WY2D 4GP6A 4ZHQF 5C8XA 3F3MA 1YIDA 1KEWA 2BP7B 1AKUA 2ZRPA 2O0MA 3WYNA 2PGIA 2DSTA 4IEEA 4YQFA 3IE2A 1H9AA 3NRBA 4TLCA 1NJ2A 1F0PA 4MCAA 2QM3A 5EPOA 3T4EA 3ZW7A 5HJ5A 1AX9A 1FSFA 4H7PA 1DQZA 2OPBA 4WN9A 1THGA 4LRYA 4UHJA 1DCFA 4X94A 2R2GA 1XKTA 2B9EA 1Y81A 1KKMA 4GSLA 5TV2A 3RR2A 4D0LB 2RD2A 1HLDA 3FKJA 3IIJA 3AIIA 3VC2A 4LTMA 2QXYA 3DE0X 5CFPA 5COQA 4DT1B 2AOTA 3BGDA 3VI4B 1A8IA 3IP3A 5C18A 1EP1B 5HVNA 1RWBA 4D3YA 1X15A 1FRNA 1GSOA 2GCGA 2GT1A 3GT3A 4IH1A 4MW6A 4OD0A 3KB1A 2ZZMA 5HQTA 2EBWA 5EWJA 3W5HA 5LBTA 3HSYA 1RJDA 2IF2A 4DMHA 1DAFA 4MYDA 4LSWA 3BKXA 4U7WA 3ZGOA 1KS2A 2DR3A 2EKLA 4FEAA 2R68A 4X61A 3KELA 4ARBA 1P0PA 4HWRA 2QX9A 1EHCA 5ELXA 2V65A 4JKYA 3BIJA 4LRSB 4CCYA 1EFPB 4FSXA 4GWKA 1IUKA 4YP7A 2O1SA 1L1RA 4FGLA 4UAGA 4X92A 1HURA 3TR6A 2ENUA 5F7OA 1QX3A 2RAFA 1GTRA 3OQJA 3U9LA 1S7CA 4E22A 5JO0A 3NYRA 1NVBA 1J7JA 1UL1X 2OC9A 1U3UA 4KQGA 4WDRA 3ZHBA 5BUZA 2PX4A 1CRPA 5GIOE 2OBYA 1DWQA 1XMXA 2MSNA 3NB0A 4OY3A 4C2TA 1SCAA 4A15A 5L3QA 2E5WA 1JR3A 1KO5A 3LQ1A 1ZIYA 2PT9A 3CPSA 3IKTA 1KH3A 3DZDA 1RXUA 1UANA 2D0PB 3K4HA 3MIIA 3RSHA 4XOUA 1P7YA 4DKJA 3S44A 3T7EA 4E5NA 4HAWA 3LL7A 2HPAA 1S3FA 3GLIB 3UXMA 3E15A 2O1XA 2VJLA 2B8JA 4ND8A 4G63A 2QD2A 2R3SA 1W87A 3KKEA 2R4UA 5AI5A 5TE9A 4U6NA 4OX9Y 3SNHA 2Q5OA 2RGNC 4HUQB 2FN8A 1UQUA 2GEUA 1XZJA 5CB0A 3TVTA 3G9ZA 5JBIA 4OHCA 5E2AA 1HH4A 4J2HA 1RYNA 5C4IA 1XFDA 5HKBA 2M32A 1FLVA 5BSHA 1VYHA 2AVDA 1URPA 2KS6A 4NBVA 4DM3A 4E3ZA 3KQPA 4E5VA 3JD2A 1ML4A 4X93A 2D1QA 1U63A 4QEDA 3EHDA 5I4CA 1T36A 2J3MA 5C7OO 5IJAA 3U9TA 1L5KA 5GOZA 3MHPA 5KQMA 1YKGA 1T35A 2NTVA 3IBYA 4OFZA 5FPTA 3NMUF 1DJMA 4MQFA 3AUYA 5DXFA 1TYDE 2V1XA 1JB9A 1IHYA 4YMIA 5IXYA 1JALA 4X9XA 1L7MA 3GBSA 1LB1B 3DDOA 3AL2A 2ZYAA 3I9MA 1ZLXA 4YV0A 4CCAA 1QHYA 1ADJA 3QTTA 1RHKA 4I46A 3R7BA 1J1IA 4GUDA 221PA 5KDLA 1PL0A 5AHOA 4R98A 1GZ3A 4TWAA 2Q4RA 2HPVA 4UZSA 5H02A 5P21A 3TL2A 3FCEA 5ALKA 2FOLA 4Z0PA 3E1KA 5I7WA 3OFND 4C9BA 4ML3A 4BFXA 3L8YA 4IO0A 2QTLA 1JSZA 3F0TA 3SLRA 4CKXA 3ZXYA 4LHXA 1TA4A 3K20A 4JP8A 2WLTA 3CRW1 1Q0UA 3NH6A 4KPUB 4OPMA 4COKA 1R6VA 5I4KA 2OVFA 3LUKA 1T29A 1TZMA 1R5NA 2QW1A 4P80A 5K6AC 5KYWA 1VSVA 2IX3A 3Q8MA 1E8DA 1NU6A 1QCZA 3A1TA 4D46A 4JU8A 4UPDA 4D9NA 4KPEC 1NVVQ 1YS1X 2ZRHA 2GTPA 4DCVA 2HXSA 3D3WB 1ESMA 3DYIA 1SXJC 1GZUA 4JQSA 4YT2A 2PCLA 5AESA 4HO1X 3OZXA 4O6VA 5AKGA 4C88A 3GD5A 1G0NA 1KIFA 3DO5A 2HEGA 5TB5A 3AF6A 1W36B 3C6QA 3N0WA 3R3UA 1S4QA 3GF4A 3TTXA 1LTHR 4EJ2A 2QR3A 3K9BA 4TT3D 4Y18A 1IBSA 2XZLA 2BISA 2SHKA 1NHWA 1VLZA 4WN3A 3U3JA 1M34E 5AM2A 1P1BA 3DF7A 3LWDA 2OBLA 3GUYA 1VM6A 5FIUA 2PWYA 2IE8A 3PX2A 5DGHA 3HV0A 3EAGA 4BWGA 4MPRA 3NETA 5IC4A 1RZ3A 1BE0A 5EEGA 1G8JA 5EPUA 3SC3A 4KEAA 1KAHA 3CH5A 2ANCA 4M1TA 1G9TA 4ILKA 2IVZA 2Q9BA 1DIHA 3T8YA 4B80A 3EA5A 4Z5XA 5CDUA 1RI1A 2VK4A 4OI2A 2X5KO 3VU9B 1B6GA 2V5AA 4F8EA 3GJ5A 3QPVA 5JSKA 2V96A 1G20B 3SK0A 2QN8A 4CPDA 1LNZA 2B4TO 4KX5A 4EG0A 4M7OA 4JJ8A 4HQKA 2FSUA 1ODJA 2Z2IA 3U0BA 4BX8A 3SP1A 1QE3A 1EGMB 1PWEA 2GF9A 3KOOA 2GTHA 2YR0A 3R6DA 1Y98A 1NV9A 1X6VA 3ETCA 1NM5C 3BWDD 4K86A 4X41A 5BNZA 5JH7A 1PF7E 3FMGA 3MT8A 4ZK6A 2FN4A 1P61B 4RWEA 2H59A 2P75A 4QPJC 4K0RA 4WNCA 3SXUB 1CZOA 3D5TA 4DADA 4WPGA 5ES4B 4Q1VA 5TQ2B 5DHQA 5JSYA 1SC9A 2G72A 1V4VA 3I72A 4UQOA 4YRLA 2R84A 2O23A 2OCBA 2QS9A 1OBHA 3FOBA 4R9VA 3AF0A 2OFFA 1WCWA 3LFTA 1DJQA 2FRDA 4WXPA 4I5IA 5A2GA 3AR6A 3OM1A 3SJZA 1EVQA 1E5QA 1C3EA 1BFUA 1G5QA 1VE6A 5C5IA 2V0NA 3VZBA 2QUZA 1YSCA 4NEGA 3RC7A 5EIHA 3FHTA 3D6MA 1OZGA 4PHTA 1E1MA 3BB3A 3V8VA 2BKUA 1XFAA 1PP4A 2W98A 1H8EA 2W7TA 3ICEA 1WTCA 3DKVA 4I3FA 3VPAA 1WO8A 3MQFA 2YVUA 4MVYA 4ZOLB 4US0R 4EYQA 4HNVA 1H6AA 1HOXA 2O48X 5JQWA 3KKKA 4A8PA 4D9BA 1MAAA 1T2FA 3D2LA 4KFCA 1R2QA 5C34B 3O8RA 3NEAA 4TV9B 3CA8A 1J8QA 4GO1A 3HVJA 3HMKA 2EG9A 4E5PA 4ZXFA 1CQJA 2ZYGA 2CVQA 2I54A 1Q0ZA 2ET6A 2EATA 5KNCA 1XD9A 4C4RA 3IC5A 2GCOB 5FTMA 3IQWA 4HJRA 4R7ZA 2FZVA 4RK7A 3BWMA 5IEBA 2B34A 4LOLA 2QNBA 3C8DA 3LT2A 3NYWA 1T9ZA 3KOZA 1KVQA 3OZAA 4AO8A 5AIBA 2BFWA 3LOQA 3ITEA 4TMTA 4CF6A 1AMNA 4MV6A 3FOAA 4NYIR 3E9ZA 1HRKA 4CL0A 1Q6ZA 1UPBA 3OQVA 2ZSIA 4Q3CA 1OV6A 2E21A 4ZTUB 3CONA 1YI1A 3SE0A 3UMCA 1QJ4A 2AIRA 2HIMA 1WHTA 2YXNA 2XMDA 4ALLA 1EXWA 3L0YA 4FFRA 1KORA 3Q11A 3ZWBA 4A91A 4ERXA 3ONWA 4KYUA 2VRCD 6CHYA 1E69A 2IOFK 1PV1A 1VJ5A 1VJDA 3GX1A 3W7AA 3W9UA 4EA8A 1QSGA 5EQFA 3DHYA 3BEDA 1SULA 2EP8A 3EEQA 1YIAA 3LA6A 1DI0A 1J6UA 1B8OA 3ENNA 1QTQA 2BEVB 1ZP6A 4JEUA 1LPMA 2FHPA 4HDSA 2Q07A 3MELA 2PMCA 4R7TA 3RQSA 2ZVJA 3V4LA 1ICIA 4JFRA 1EM6A 5IM5A 3ICOA 1KGDA 4J43A 2PZKA 1G41A 4C29A 1UBUS 1DRKA 2VJPA 1JJ7A 3LC1O 4KQKA 1KSHA 1VXOA 1XDWA 4U02A 5F52A 3R7WA 3WE7A 4ZOEA 1RHUA 4FBGA 3ZWDA 4ZAVA 4NV3A 4EYKA 1WBDA 4G24A 3NZEA 2PY6A 4GICA 3OPQA 1FZTA 1ZUD1 3NW9A 4RAQA 1N78A 1WDWB 4Z1OA 1OILA 3D6VA 2ZSUA 4HGOA 4ZVRA 2QL9A 3G23A 3FHOA 1GPUA 4WJKB 3CJTA 1JAXA 1GG8A 1BS1A 2CSUA 4DREA 5IT4A 1Q3KA 1RRKA 2BFAA 1M6VA 2V9ZA 3DBIA 3OE7A 3QW2A 1I0LA 3W3AA 4G36A 4PC1A 2CLMB 3PC8C 5DW0A 3SF8B 2GX6A 3Q98A 2QB5A 2XMPA 2DJIA 5SYAA 5EE3A 1HDOA 4KNYA 1CR6A 2AWNA 1G5PA 1U0FA 2ZAIA 1INLA 3MOGA 3QPDA 3RUAA 1A2BA 1I4DD 1GJRA 4C4OA 4B6SA 4AM8A 4E4TA 2IWHA 4GHWA 1KE1A 3I58A 5FL7A 5K4HA 2JLUA 1XTSA 1O5IA 2COKA 2AYYA 2VF4X 2SBTA 3GBVA 3NGMA 4X5OA 1UBRS 2ZYIA 3DDWA 2YY5A 3LQ2A 5JZOA 4P83A 3RK4A 4LHWA 4F12A 1P77A 3OA0A 4MUXA 3RFXA 5A7FA 3GI1A 1KAEA 3L0DA 1N0IA 2JZCA 3V3TA 3CF6R 2ZI5A 3SWWA 1ZK2A 3RBXA 2BFBA 4PAMA 1A5AB 1EINA 2FEWB 4U3JB 5AJYA 1MAUA 2NLOA 1RLIA 3H75A 3LLUA 3U4QB 2FW1A 2PQ2A 2QVGA 5J1SB 2BDEA 5T3UA 2DKNA 1NMQA 3HB5X 4AYWA 3AINA 3IP5A 4L8YA 4U2BA 5HA5A 3T7IA 3UC5A 1MF7A 2ZTMA 3BRWA 1U6KA 2JFWA 4PTYA 3WRXC 4JLVA 3SZRA 3SVLA 3VHXA 4IKOA 3E8SA 3JW8A 1V16A 3FNGA 3LFUA 3J7AC 5EMLA 5F5LA 2MSDB 2IYZA 4OQDA 4DMMA 4CETA 3KZ1E 1TK9A 2ROQA 4ITUA 1HT0A 1P29A 1C7ZA 3GFFA 3PC4A 4TMXA 4TKMA 3HFJA 4RGBA 3ZWYA 3KR9A 5LUAA 5MHTA 1HM5A 2R1TA 4HC4A 3KYJB 4LV6A 1TJYA 2HRCA 4ILEA 3ND8A 4L2IA 3ZHCA 5JHGB 5L6LB 4MDEA 2BI4A 3A6DA 3GEIA 3EGEA 4ZT5A 4J49A 4D9JA 1Z4MA 3NM6B 2EWVA 2VT3A 3Q7RA 4JZKA 4KMSA 4QL3A 1NTOA 3QXXA 1ZH4A 1VI6A 2JLSA 3LHSA 4BQPA 5SY4A 3WLNA 5LYJA 2JIDA 4OI4A 1AQUA 1XZ8A 3LBFA 1X3LA 4G9BA 3NU1A 3NUGA 2UUBB 2VUIB 4M9XA 4PANA 3R40A 4BQOA 3RJ9A 3K4QA 2XUFA 4DCOA 5A9TA 4DLLA 5GM2A 1GEGA 5BYAA 4RVSA 3EFEA 3WK9A 5TMDA 1BJKA 2C5BA 1I7LA 1CRQA 1JDBB 3PRHA 4FGKA 3C8ZA 1ZRMA 4EA7A 1II8B 3IQGX 4BATA 3QFRA 4YGYA 3ITDA 4TTAA 4YJGB 1YFJA 4GMDA 3AIOA 4MRMA 1EWQA 1UKCA 2B3TA 2QY9A 2K5UA 4RQAA 2C99A 4WBNB 3O2SB 1N6OA 1CE8B 2H4YA 4LV8B 5DHTA 3KD3A 4F2DA 1R8YA 2OZLA 5BRAA 1YKSA 4GP9A 2I55A 4FYVA 2NSHA 4HQ0A 1Y8RB 4OU4A 5DCYA 4X8OA 5LJLA 3RT9A 4PAWA 4AWAA 3PXAA 4KXXA 5JBQA 1B0AA 2Z56A 5A0VA 1PT6A 3W8RA 3V8EA 5I4BA 1M0WA 5KOIA 2YVKA 3CLHA 3GROA 5DHRA 4CFZA 4DANA 4EW1A 4EKDA 2PUGA 1SQ5A 4KC0A 1O9GA 3SHVA 5EJMA 3EPLA 5JS1A 1KEZA 2ODAA 3UCFA 2C4UA 3F6SA 2Y4NA 4YH1A 3EFOB 5CH8A 1E1YA 1VHDA 5FEUA 2FFAA 1ACJA 2CJYA 3LPDA 1GQRA 5KJEA 3TI7A 4BPRA 5LKAA 4GIBA 1LTQA 4MVXA 1OZFA 3F6BX 4RO0A 4AIIA 1C3OB 3EXFA 4QTUB 4M1EA 5I7SA 3KXPA 2QD5A 3G2LA 4RGYA 1UT8A 1JWBB 3NHMA 3QKTA 4IBOA 4PHCA 1N2GA 2ILVA 3BXEA 1AV6A 4KV9A 4D6YA 1RM3A 2FSFA 1KF0A 2HX1A 2W58A 2R6JA 3IQXA 4XIGS 1E5TA 1SU4A 3VJLA 5L40A 1YA4A 1FIUA 4QAJA 1L1EA 2LV8A 3O8NA 1MIHA 3DAPA 4MI1A 3BIWA 3OHSX 2BSXA 3S8YA 2O1EA 5L3RA 1PFKA 5H0IA 3DCNA 3ILXA 1DV2A 3LRTA 4TUYF 2QMYA 3UHOA 1NW9B 1GG2A 3KTDA 2HTFA 4OHZA 4IDDA 3TH5A 1Q20A 1T13A 1WV0A 3KQTA 4BVFA 4OHVA 5EAIA 5G4KA 2ZQ5A 2C3UA 1F5NA 5GM1A 3VRHA 5CPBA 2WWRA 1ZEMA 3ACDA 3TS1A 3WQHA 5CEJA 1PJLA 1QH9A 2IV3A 1TCVA 3KUKA 4GS5A 2A59A 2F43A 1Q1GA 3R9IA 1T4MA 2ZSHA 3PRYA 4O3MA 2CLIB 2WV9A 4YCBA 4K9PA 1ZU5A 1PGPA 1T43A 3EIXA 2JFOA 1XAJA 4QIHA 1YBVA 3A4MA 4MGZR 4CEIA 3B3JA 3DTYA 3EGVA 3U7RA 4S24A 1L7NA 3JRXA 3OZUA 3QUSA 3DBRA 4DV5B 2FEMA 3FDIA 3DBVO 3RIGA 1OUMA 1Z2NX 2A5LA 1KA9H 3EXHB 3FPLA 4WCFB 1R0XA 1LDEA 3BD7A 5CURA 4NYIQ 3RTEA 2O8FA 4PVCA 3L0BA 2HDOA 4H16A 1TKRA 3ESCA 1SOAA 1C1XB 3L1JA 1N2XA 4KQ6A 4TSFD 3QM1A 4DC0A 3AZQA 4UDXX 1JLMA 5HMLA 1YS2X 1V7CA 5BOSA 3LNCA 3DXFA 2KM1A 1H94A 1MG5A 4F46A 4AKIA 1SH7A 5AQEA 1BGXT 1C81A 1ZLYA 3V7FA 4O1MA 2XGGA 2QT0A 3DEYX 4GOLD 2H1FA 2NTNA 3C4VA 3UGKA 1CIVA 2YRFA 4NU6A 1JDVA 3O4VA 3RK1A 2P2GA 4JB0A 1ZI6A 3HUFA 4G07A 3QU7A 2Q8PA 2RHTA 3W4KA 4ERNA 1TAHA 2WILA 3EXAA 4OQNA 1E2GA 1YB7A 1EB9A 1U0LA 3ESZA 1VPWA 1KDPA 4IJQA 4KZKA 4BMYA 4JMLA 1SIOA 3RIXA 1C3LA 2HU2A 2J0VA 2VTVA 3NBAA 4IQGA 4ZZ1A 1X7XA 1XRMA 2I2AA 3WFIA 2QPOA 1EFVA 3A28A 3OX3A 2QLNA 4QOSA 1I8TA 3D1VA 4QQRA 5KJFA 3KAKA 5EHNA 5K3FB 3GFBA 2WTXA 3ODPA 4BASA 3DZBA 1TW3A 1RVV1 1G17A 5A1JA 1IXYA 4W6QA 3NVDA 3M82A 3GWGA 4ID9A 4ND7A 3KB8A 2DBVO 3FVTA 3S8MA 3U9SA 1QCYA 1VLLA 2HZ7A 3WK5A 2GCEA 3PQDA 4EDHA 4JT4A 4AKEA 3DO6A 5F7ZA 1DO8A 3EJ6A 4FOPA 4RJIA 1G8GA 2J6IA 2ZBGA 4FHEA 3ZI4A 2IY7A 3ADPA 1FFCA 1N2BA 4MB6A 3JQGB 3TMAA 2WJHA 4UU7A 3UYLA 5BVHB 1X7HA 1NSYA 4UQLA 3VPGA 3PNMA 5FLEX 2PL9A 3VZPA 2AE1A 3NHUA 4EGCB 3PE6A 4L9SA 1W581 2ZI3A 1EZ1A 2CUKA 3TWOA 2HRQA 3EG9A 1Y4SA 2NUPA 2ORIA 4D5GA 1BMTA 5SYNA 4EKEA 4CLRA 2CSXA 2DR2A 4ARAA 4C01A 2FLWA 3DOHA 1YB5A 4UOEA 5EN4A 3ZE0B 4PCUA 2AKAB 3AHJA 4Y2PA 1QRAA 5D00A 1PR2A 3BJRA 5IKOA 5JCOC 4MVJH 2VDOB 4Q4AA 5JCZA 2J59A 2ZBVA 1HF3A 1AVTA 1I5RA 5LMNB 1JE0A 3E6AA 1NQOA 2F8MA 3PE4A 1RI5A 4BZZA 4KO4S 2B78A 2BYTA 2A58A 2DHEA 2WA2A 2XBLA 5PGMA 5JEEA 3MQ4A 2AHRA 3L9WA 5HIMA 3NFRA 1RKVA 2X0RA 4HX2A 3I04A 4LYGA 5D2CA 3KCQA 4BX2A 5JPDA 4I8DA 1DPFA 3ZJTA 4CWAA 1NBIA 2R8BA 4TWZA 2I8LA 3D7RA 1NVWQ 4KOAA 4MITA 3OOEA 1M34B 1S2NA 2IEYA 1GVHA 4GMGA 1P1CA 1VL1A 1Z4QA 3AQIA 4XDZA 1ST3A 1LLDA 5CW2A 2GCIA 2CXRA 4DR3B 3EZFA 3I12A 1C7IA 1TGVA 3U3MA 2R87A 1OWPA 2FHSA 4EBBA 4IJUA 1HZZC 4JU9A 1JG3A 1DELA 1XCMA 2XGSA 5DTJA 5EIXA 3HTXA 1PFGA 2OK8A 2VAMA 3AYZB 1QB8A 1KIMA 1VJ0A 1GNRA 4IYJA 4NYMR 2DQSA 2CFRA 2X58A 4ZMSA 2XRZA 1E6UA 1NLZA 1YL7A 2XNHA 4OQLA 1O0BA 1KDOA 4E6PA 1SC6A 2EBHX 4D9MA 5AXBA 2YWGA 2PGNA 3U3XA 3KEMA 1K8XB 1O3YA 5BP7A 1SUCA 3GT4A 5LXTF 2YHIA 4ITRC 4Q9KA 4KSCA 3HZZA 2NU8A 5IBRA 3W06A 3LQFA 4HFJA 2YFHA 3I9V1 4TM8A 3RK0A 3N3AC 5JVDB 4LDPA 4EL0A 4B6FA 3UJ7A 1EFTA 4MWDA 5CYOA 1XNQB 4DJEC 1JEQB 1X70A 4ZEXA 5EXPA 1T2AA 2HMUA 1ZBDA 2NTYC 3OOJA 4RD1A 3SFVA 4BKOA 2PSJA 2Q45A 3D6JA 5I9MA 5I47A 4GE0A 3A6JA 1SIUA 4ARZB 4E5MA 1MH9A 2A9KA 3C15C 2GEFA 3EG5A 3U19A 3LU1A 1QG0A 3KQUA 1P5HA 1ZINA 2XXAB 5CM2Z 1DLJA 3VJRA 4NU8X 3VOAA 3WLRA 2GO7A 3PVZA 3QPUA 3Q0TA 1ISPA 1VSUA 5CNIA 2GILA 3E7XA 2HJVA 4RA6B 2ZT5A 3ILVA 2H57A 2ZATA 1PO7A 2ZT7A 3SX4A 3LBIA 1JWLA 1MB4A 3AM5A 1GRRA 3S99A 1Z07A 4BP9A 5CLHA 3ODGA 3PQ6A 5EZ5A 1CBUA 1REQB 2QNIA 3HBLA 2EJTA 4KK3A 1IRIA 4KNVA 1FLNA 1B3RA 5T57A 1OW3B 4CW7A 1I13A 2DP4E 2IY8A 1IHDA 1UBSB 3LUCA 4CM9A 5KX5A 1V1JA 2BHRA 3KYCA 5IYZA 3FI0A 4WL0A 4YECA 5CDGA 2JFXA 1NA5A 2EX4A 2D2FA 2O2YA 2SKEA 4I0WB 4KQ1A 4KHZA 4UBIA 3VUEA 3A3YA 3DZFA 4FOLA 2G9QA 4EQZA 2H4WA 2YRXA 5DXJA 5ERGB 3DMNA 3WV4A 2CLLB 4DC1A 4DSTA 4JI4B 4OHBA 4YV7A 5ETJA 1W35A 2AV6A 2C92A 5J4LA 1QUFA 4X85A 5JJCA 1BW9A 1BCRB 1TQ8A 1UXJA 4AMBA 2VK2A 4ZWNA 1P1KA 1N5LA 2Z2JA 4AYTA 5HKKA 3X1JA 2Y6UA 3DMTC 2CFIA 1FFGA 4G5YA 1DVRA 1QIHA 4AZ0A 3E3OA 4LWOA 1KZ1A 2M98A 3E0QA 4IGKA 3W2FA 3KPYA 3T15A 4EGFA 4AJJA 1PSWA 1U0GA 1AOXA 2O5VA 3GMTA 4N3BA 3LMKA 5C4GB 4BJHB 1YRHA 1E4EB 3EQZA 2RHJA 3HDVA 3HWX1 4G4JA 2Z8YA 3NS7A 2I2BA 2OSVA 5D5QA 3BWCA 2RARA 5CFLA 5KS2A 5ALLA 3HZRA 3WDKA 5BPHA 4K9NA 2CLKB 2A1IA 4LJLA 4MQMA 5CM8B 3FOZA 5HS6A 3B2QA 1IOLA 2Q3CA 3L41A 2C9DA 3RVSA 5IWCA 3OZSA 4QVIA 2CT8A 3BXOA 4RZHA 4Q1BA 4X54A 3UHPA 2KMLA 4WXHA 2AOWA 4X24A 5BSMA 1GZ7A 1TYAE 4WLFA 2IEIA 1B6RA 1XRSB 1YWGO 3HNRA 3L7NA 1MJFA 2HLPA 4LDRA 1ZHOA 1E58A 2XE8A 4V0KA 2RG7A 3PYMA 4M0UA 1RE1A 2QQFA 4V02A 5FWXA 4D5EA 5KNDA 1B1AA 3ZGVA 4DDWA 2MU1A 5INTA 3Q7IA 4ENQA 4RTNA 4CDGA 2N9UA 2DXIA 4OXQA 5DM2A 4ZRDA 5CCBA 3RHTA 1TLTA 3FBGA 3HRHA 3TGWA 4RV9A 2CMFA 2QT9A 2AA3A 1K8RA 2AUMA 1GPAA 5JYDA 2C2YA 1H3FA 4LJKA 1KYTA 1N5RA 1YA8A 4FR2A 1JRLA 4KAJA 1S7GA 4C4ZA 1PWXA 4UBMA 1BYIA 5BNFA 4YMHA 3GLFE 5JMOA 1O1YA 4TKUA 2OL4A 4KO1S 3TXXA 3U6BA 4E1AA 3NHPA 4PX5A 3U49A 2XAUA 4JNKA 4OHYA 1SVIA 3ICCA 4P84A 4AY6A 4JVLA 1BMFA 1GG9A 5LWQA 2PU5A 5IAEA 3Q87B 3PHIA 3RVPA 3PDHA 1A9XA 1LRLA 5IVIA 2GKGA 3RASA 4IIGA 4G0NA 3ZY6A 1QV9A 1PL6A 2PX8A 4MVJI 2O07A 4IPTA 4JP1A 5J40A 5ITWA 3M6FA 4C4YA 4MRSA 5I9TA 3GZJA 3F7NA 1Q11A 1YGPA 4MWZA 5HJ2A 5KI6A 2GPWA 5CLGA 3E1SA 2VEDA 3M6AA 2IBSA 1PZEA 1WSBA 3IEIA 1GCUA 3C2QA 4JL5A 4Q39A 4F9EA 3CUKA 4ND5A 3O93A 1W6RA 1MT3A 1NYQA 5AXAA 3HNOA 3AZOA 4B7AA 4UM8B 5TQ0B 2ZYSA 4FFBB 4GVLA 2V6IA 1RYEA 2X0IA 1TCUA 1P4RA 3FJYA 3JQQA 4IJMA 4JZYA 4ZO8A 4DLTA 4ZI7F 3ZKWB 2I78A 3JQCA 5ALHA 1Y1SA 1Z4JA 4IFBA 2LNDA 1TMKA 1YQXA 2R97A 3A1CA 4IMPA 4WNAB 3FPGA 2VZ9A 1PE0A 2ZBDA 4R1LA 5EGNA 1G291 2GEDA 5EVCA 5JC1A 2RKOA 3OEWA 3VH4A 1TJ5A 3LPCA 2B82A 5C8YA 5ALOA 4UNSA 5FPYA 4PLCA 1SG6A 1G5HA 1L7PA 4KLZA 3P8ZA 5FEMA 3RDPA 4BXOB 2OHFA 3K6SA 3EGOA 1POXA 3A1UA 3KVYA 4HH1A 2WG2A 4C4XA 4DARA 2G1PA 3WFJA 3G0IA 1KWGA 3WL6A 3PQ4A 1BZYA 1A5SB 3PGA1 1UPAA 4DDUA 2WJ4A 3G85A 1Z3CA 4I3GA 4UTOA 1QVAA 4JWKA 4OUDB 4EB6B 1W0JA 4IGEA 1OXTA 5FI1B 2WWTA 1RXCA 4AJ2A 3QEMB 3COSA 5I4IA 4OLBA 3K1ZA 2FG5A 3BB4A 3W6NA 2NXJA 5CBPB 1X80B 3CE9A 2JIMA 3QOFA 1YR3A 1QNLA 1C1DA 1KZ9A 2C3MA 2GJ4A 2PN1A 1A7KA 3E4CA 3KXDA 1SK8A 1CUDA 2HA4A 3DOIA 3PGJA 1GGVA 2OZKA 4ATNA 1LK0A 4PNPA 4LTNA 3UUFA 1G60A 2PCJA 4K9KA 4RMGA 1LW6E 2B2CA 5SZKB 1E1RA 4HGRA 3TRHA 3EPJA 1ACMA 4LSZA 1NYTA 3QLUC 3W5DA 1RKUA 3JYOA 1Y42X 3QPAA 5CCDA 3CUWA 5BUCA 4RJTA 5FPPA 1Y6FA 2XZTA 1B74A 4NYMQ 1MFPA 1ISGA 5A0TA 3MAGA 5FA6A 1I7DA 4BNHA 4M7WA 1EM8A 3TLMA 4N9QA 1THZA 1F8UA 2J3IA 3A3NA 3VNSA 3D3JA 3GEEA 2QD1A 4PWYA 3ZPXA 1WCIB 3H5TA 3PI7A 3STHA 1GGFA 1U3WA 1R9MA 3QLTA 4X3OA 3C6MA 4CQJA 1K2WA 1AXEA 1ULAA 1Y9DA 4LJ5A 4N01A 4QGFA 3F73A 1MZPA 1OXMA 3QFCA 4DA0A 3DTVA 1NMXA 1KO7A 3FY4A 3IESA 3AV0B 5K99A 2DH6A 2YW9A 2OQ2A 5DI3B 2ZLBA 2BFDA 4YAOA 3NKFA 3UPUA 4BO2A 1US8A 4F8YA 3ZVKA 3GRKA 4D0NA 1MTOA 4M1YA 3CNEA 4HB3A 2BH9A 2PQMA 1VBNA 3AB7A 4WK0B 2JD1A 1XSEA 2WT8A 5E6UA 4Y67A 4MLDA 4GSYA 3CH4B 4QU5A 4KXNA 1LBIA 2P9BA 1ZC3A 4WESB 2AT1A 4PZDA 2H5EA 13PKA 3KQVA 4GR9A 1PL7A 3QW4B 1R12A 1IBCA 2NZJA 2Y92A 3C3BA 3ZGNA 2QUIA 1KNXA 5HKOA 3ZDCA 4YO7A 5IX8A 4DG5A 1FJXA 1UFQA 1C0PA 1U7WA 1LC0A 2VLIA 4ZT7A 4IUBS 1XMQB 1ZUWA 2CHQA 3K9WA 4M0LA 3D0OA 3W6PA 1PIWA 4WBXC 3LLCA 3UB4A 5BV2P 3N5CA 3G9XA 4BLVA 1NBMA 4J75A 3RGWS 2GOYA 4P53A 1TMYA 4NFHA 2C1EA 2CHUA 1YK0A 2PXAA 4LZZA 3M0EA 2ZIAA 4G6ZA 4MS1B 4TLAA 4H6XA 2RGNA 3AMVA 3FCAA 5ECGC 2GCNA 2H3HA 1KP9A 3HWWA 3T3EA 1SCBA 2XITA 2Q4TA 4LVUA 1E77A 1VZ3A 3VDNB 4GPD1 1X7YB 4EY5A 5DIFA 3R0XA 3CEMA 4FFMA 1KQPA 4KE8A 4UD6A 1E3DA 3W5SA 3PC3A 2DM6A 2Y6VA 4KMOA 2IYSA 5JNRA 3IPCA 3I0ZA 2W6IA 4W9NA 3ZV6A 1BCSB 2WDPA 2B1IA 4W5WA 1DFGA 2XCSB 4REMA 2J5XA 3SBEA 4YR9A 2PUWA 1J97A 4YT4A 4NCXA 1ESNA 4B3JA 4LZJA 2QGZA 3PXGA 4CF3A 2R00C 5AI0A 4UMFA 2PX3A 4F4HA 4Z3KA 5IF9A 1TAUA 3E9NA 1ZONA 2O3RA 2ZUFA 5CFRA 1I2AA 1XDBA 1YV9A 2XUKA 1XT6A 2QAGC 3OWOA 4I4IA 3G1UA 3NCTA 1ISJA 1NURA 1VBFA 1RT9A 4MQUA 3ZWPA 4QTYA 5J2TB 1JTEA 2X8JB 3NANA 3ICPA 5EE5B 4GC9A 2H92A 5AJWA 3OUZA 4CV2A 1DOHA 4YV1A 3GZ4A 5E9AA 1F8FA 1GHTA 1Y9AA 3HJHA 3IMGA 4TWRA 4MA4A 3E4DA 4WXRA 1IEQA 2FX5A 5CJ2A 1DQSA 1UBMS 1BMQA 4IVNA 1X13A 2PKYX 3U4IA 3WP1B 2BGTA 3C5EA 4V0QA 2A9PA 4RS3A 4HJXA 4I1YA 3OJ0A 3PIDA 1FFWA 5IAGA 3RV3A 3ZWKA 3OJOA 3NHRA 3MN1A 4HYEA 1W73A 2CE7A 1AGXA 1LSUA 1X7WB 2GBIA 2VPWA 3AEXA 2HJ9A 2VNSA 3BFPA 2WKRA 2CHFA 2GZ2A 5K6AA 1DC5A 1OPXA 3EQ9A 1QH8B 2ENWA 2JHPA 3B8HA 3F4KA 4QREA 3AKCA 1SXJA 3GEGA 3CJQA 3ENVA 4JFAA 5FOVA 4PFQA 1GL3A 4TTVA 3W8FA 1M6HA 2R7KA 3NBKA 4G4IA 4HOYA 5FCDA 5E8JA 4CUZA 4HWPA 1K5PA 2CY0A 2FP4B 2GPAA 4C4PA 4BQIA 3A6GA 5IPFA 1T6YA 3LC7O 3TIFA 4ZAFA 1PJ3A 1V2HE 2EQAA 2P1RA 4Q7EA 3TRJA 3L6BA 1NQWA 4JDPA 4O4JB 4YJ3F 3SD7A 2EFJA 1YNSA 3L06A 2G71A 4JWTA 4PFSA 3NHJA 1Y9EA 1KH1A 3BREA 3IELA 4WUVA 4ZRNA 3WWCA 2B2NA 2HTEA 2NAFA 3KKPA 3A04A 3GVCA 4MQBA 1P19A 1T10A 2CFSA 3AF1A 3WLPA 3I2JA 4CKBA 5BV7A 3WL5A 4YJFB 3JWHA 1NYLA 3C5WP 3ZW9A 4DCCA 4QQ8A 4UHFA 4EKNB 2F1IA 3FUVA 4BRWA 2X22A 1N8KA 4ABTA 1Z0UA 3EWIA 2CLCX 1G7RA 2ZJ7A 3FLAA 4O4JF 2I3AA 3WS7A 3EVZA 4LF5B 1LDYA 3UWMA 2RHMA 5JT1A 5DBGA 4OMUA 1E1NA 1Z73A 1X0VA 1ZR4A 2YXPX 5EWLA 5H3LA 1P5JA 5DGXA 1LDGA 1SB8A 3AEUB 5F73A 4YAGA 1SOWA 3QELA 4H60A 3N2KA 4RY0A 2HY7A 3NTOA 1FU4A 1XPJA 1HLGA 1CFZA 4H0CA 1JEEA 2IHTA 2QEQA 4FD2A 4INZA 3CGGA 4XYEA 3WGUA 5HIKA 1ZGGA 3PJRA 2FWRA 4DR6B 1YDFA 3UA3A 4PYNA 4YJ2F 1NM5A 2XWBF 3VR5D 2OQVA 3TLAA 5B7PA 3TX2A 5DBEX 3L01A 3OD1A 2MSWA 5PNTA 2I7CA 4O08A 4P2BA 1W4ZA 3AWIA 2WAXA 2BE7A 5TVKA 4DMGA 2P9HA 2ECFA 4RF4A 1ZWLA 1EQ2A 3FIUA 4N82A 4NF2A 1VKNA 2OBXA 3H3FA 4W6ZA 3ZS9A 1DAEA 4FR5A 1GAQA 4QUJA 1RR6A 1CR4A 1W6UA 3MYRA 4CV0A 4D0RA 3QHQA 2UZ4A 3KR2A 2Y0PA 2JDID 4DXHA 3RREA 1ZIOA 3NR2A 1Q14A 1TM1E 2FUNB 2PYZA 2KYRA 3OAAA 1WPXA 4FYYA 3TINA 1L1QA 1ZG3A 2HFKA 5IVHA 4MGIR 5DGIA 3LI2A 4WUTA 1K3UB 1N7IA 3NNNA 3HUEA 4OBBA 2WM8A 2G82A 4UTNA 2WI8A 4IJ5A 4MGYR 1O6GA 3QWFA 1SOMA 1V4NA 4TZKA 4C4TA 2VKQA 4NBRA 4LJAA 1Q44A 3U40A 5DCUA 1BGWA 2UU9B 4IAOA 3FR7A 1XPRA 2IYUA 3MB8A 4M21A 1N6PA 3ACBA 4ZAZA 2IXBA 1VLHA 2O2ZA 3FFAA 1YQDA 1WCV1 3RVOA 4LPKA 3WO0A 2QLLA 1QTNA 1E3WB 1PV2A 1XD2B 2A1TS 2QZJA 3JWGA 3PPVA 4E13A 5ICEA 3T7SA 2DERA 2O19A 4I1VA 3EDRA 2JRLA 4GW3A 1IN5A 2YDXA 2BEKA 3QWAA 4X1IB 5KCMA 3OKCA 4HLUC 3PEVA 1ZUNA 3R20A 1N6LA 4ZVLA 5IT9A 3WLOA 3HP4A 3HKDB 4WBSA 1SUBA 2O8EA 3KU4A 3MWFA 4HR7A 3SNKA 4BMOB 1Z22A 1LLUA 4IZIA 3DAYA 3OX2A 3Q2OA 3T3OA 3UQZA 1FP7A 4AWXA 5J1TB 1HUQA 2FSSA 3L77A 4D3DA 1VE7A 2TSYB 3A6EA 3FNHA 3KWJA 4FQ8A 2X0FA 2GERA 5B3JC 3LV8A 1PZFA 4OKSA 3R75A 4HDMB 1N6NA 1UOEA 3AIKA 3AHIA 3PG5A 5IBPA 2EQBA 4F3CA 4I9NA 4XD7D 2D7CA 3RAJA 1RBZA 1TVKB 1WE2A 4M60A 2JA1A 4ALKA 3ZHUA 4EX7A 2JGDA 2YCBA 2WF9A 3LQYA 3MWEA 5FTWA 4PLFA 2GFQA 4EOGA 1T4GA 5KSZA 1TUIA 3OURA 1N32B 1SPBS 3SEFA 4CMIA 3I5AA 3JQ7A 1PR1A 1OFHA 2A1UA 3HB0A 4XCVA 3FRIA 4HZIA 2HMAA 2QSYA 3P0JA 4D7AA 2NQ8A 3V4OA 4UTVA 3R7LA 3OPYI 3X1KA 1XKQA 2NXCA 2YYYA 1DIRA 3C45A 3H2HA 4G0OA 4EVIA 5HUJA 5JY6A 5KYXB 3QH4A 1O77A 3OF2A 1MA0A 5LMUB 1ZM7A 3B13B 3U80A 4E5KA 3KVNA 3BWXA 1B26A 4PQRA 5KTMA 1KGSA 1QJCA 1Y48E 1I3NA 4Y7DA 1KY5A 1L5ZA 2VJAA 3DE5X 2FPGB 4PPGA 3P32A 1Q95A 2W4QA 1VGQA 1T2UA 4HGYA 2PA0A 2QVYX 1KOGA 2ZVPX 3ANYB 3NCHA 4IIJF 4KQ9A 4NQRA 3THOA 2P5SA 3H0KA 4MW5A 5FWDA 1NXVA 3WLQA 2DKFA 3A3OA 2PQ0A 3UAVA 3G7NA 3TKAA 3N2GB 3PJEA 3P9ZA 1AS0A 2VJMA 5JOQA 5KTSA 1XGKA 2ZIWB 1GDDA 2BC9A 1G8FA 1B6TA 5AK3A 4UU0A 4QZVA 3K9HA 3PUXA 1UMBA 3Q1LA 1EVYA 3VDMA 1HDRA 2V03A 4ZALA 4TZ0A 3D1JA 1AGPA 3B9QA 4TX1A 3UKJA 4HATA 2P9GA 2XECA 4ENPA 3C8UA 3AFNA 1U7TA 1UJMA 5JRZA 1RRVA 5TLSA 4WD3A 1SC3A 1WCYA 5IJXA 1E1QD 2JH9A 1GLVA 4V0OA 2OXFA 3Q85A 5U1PA 2ERXA 3T7TA 1U04A 1P73A 3TLEA 2RHOA 3PL1A 4GGMX 3ZV3A 5K0SA 3BSYA 2EW8A 3FLMA 4S2UA 2A67A 2VUTA 3ASVA 4U8HA 1RLTA 3Q7QA 1ZA2A 3PXEA 4GRDA 3BCHA 3AI1A 1Q0QA 1U8UA 2C0QA 4X1YB 4ETMA 3H5AA 3I9OA 1K6EA 1M1NA 3WGZA 3R3XA 4F4DA 2BUCA 1Q16A 1DJPA 3HZOA 4IDFA 3U56A 3ONNA 3DC7A 3HJFA 1S2OA 4O2BA 4HN4B 1Z0IA 2FN9A 4E0BA 2G5TA 5JLJA 3OSUA 3E23A 1GY8A 2JATA 2Z98A 2YWEA 3H9GA 4D0GA 5K8VA 3AVPA 4FZVA 1N34B 2P0AA 4A73A 2IXEA 3Q10A 5FYDA 1T5HX 3I4CA 1CQZA 1JAIA 4J0IA 5EMNA 2FUG6 1HQKA 4PO8A 1C9EA 3DZGA 4LKOA 3PDWA 3B9PA 3IAM1 2P2DA 4GP7A 4KXWA 4PNHA 3ANXA 4F60A 5A9RA 5K05A 1IXZA 4HDKB 3IOBA 4L9RA 1P2DA 2CDAA 3EOZA 2YIDA 4G2NA 4QDOA 5C32A 4ROSA 3R3ZA 4YIHA 3HJAA 1E89A 3UT0A 2R48A 3I6IA 4CKYA 2WWXA 4J07A 1MJ5A 4TV8A 2C82A 3SIXA 4YCMA 4C7OA 1IY9A 2QRKA 1I9GA 4K5QA 2JL1A 4RNDB 4NS4A 4RU1A 3PVCA 2W0SA 4EX6A 3PEEA 4G1FA 2IELA 2P6NA 4YO8A 2AX3A 2NPFA 2Z4SA 1NPDA 2UZAA 3M5PA 1SU7A 3A7EA 3R09A 4WLNA 3S2UA 4C89A 4KGXA 5K0TA 2C1XA 4FYMA 3H5WA 5KBYA 3H16A 1NNEA 2CUTA 1P2SA 1DO0A 3VDRA 4KE6A 1B93A 2RKBA 3A70A 4YHBA 5EHIA 2O05A 1TPYA 2BUAA 1KWKA 5GVRA 1V11A 3V8PA 4ZD6A 1RXVA 1DX4A 5KTNA 1V7PC 3EB9A 4CM7A 2WR8A 4BFYA 2QTTA 1JEOA 4KXMA 5DULA 2CJPA 1M1ZA 2Q4BA 1KMQA 2XW6A 3IERA 4OQQA 4BAZA 2OFWA 1CIPA 4RMNA 1LX7A 2XI4A 2L82A 4GZ3A 1JDBC 2KW5A 4B8YA 1AGNA 1XLWA 2J5QA 3BE4A 1J56A 1W19A 4EFKA 5K9ZA 2XDWA 4BTEA 1HDIA 3Q3VA 4QQFA 3PX7A 3BBLA 3DEFA 3ABOB 3VZDA 1Q83A 3UKOA 1VPLA 5IM4F 3SLKA 3FX2A 2W71A 1YJ8A 1H1LA 3ESXA 1XJ5A 1CZLA 1JP7A 3FZGA 1GNLA 4MB0A 3VXKA 1Y8ZA 1YR7A 3PDIA 3GLVA 4HADA 1NC3A 2F3SA 4TKLA 1Q91A 3QVXA 1DLIA 5DX8A 3ETNA 4RLSA 1WDMA 4AJHA 1W48A 1ZL2A 4YRDA 1XRJA 4NAUA 2X5OA 2ZSJA 3VTZA 2FPUA 5IT0A 3HM2A 1OKKD 3E5HA 3FMIA 2SNIE 4LBZA 5L3VA 4Z53A 2AR7A 1ECGA 2YQ5A 4OGLA 3X1ZA 4FIZA 1Z37A 4JR1A 3EQ6A 3KWFA 4X63A 1KIAA 1OLSB 1M2FA 4NOJA 1J5XA 2G1JA 2OQRA 1R6DA 3LDGA 4XIIA 3BGWA 3VTAA 2H5JA 4M6WA 4JOSA 4LOJA 2Y0CA 1DIGA 1ZVQA 3MOIA 1G4UR 4JAVC 2PG3A 4M8NE 2C7QA 4TTRA 1E2EA 1OFGA 3NHAA 3P0IA 2ZRNA 4PW0A 4Q4JB 4DPLA 1U81A 1EDEA 3H9JA 4UD2A 2GBFA 2QSJA 5CVTA 4MYSA 1JDJA 1MKYA 4WZBA 1TECE 5BV1A 1NFFA 2FG7C 1QK5A 5DHAA 3IGFA 1PGNA 2HF7A 2QRLA 2OECA 1HNXB 3U48A 1GDHA 1E98A 1TIPA 5AMXA 4DJJA 4CV1A 2VSXA 1ZQ9A 4K81B 1GQSA 3PFKA 4MA0A 4OA8A 3R7DA 3R9XB 3K70D 4YNBA 2GAAA 4DEYA 1G9SA 4B35A 4GLFA 4OK3A 3ZDBA 1LA2A 2DMRA 4BN0A 2GZ3A 4YAWA 5CT6A 2ICAA 3BF8A 4N5DA 3U7IA 4TYWA 1A8SA 5HM6A 4OU5A 2CDNA 5IDXA 3RT1A 1J33A 4JLAA 4JYCA 3HACA 4TS1A 4U1RA 4W4TA 5E95A 3TSZA 3LK7A 2JA2A 4IUDS 1AO0A 4I36A 4N65A 4G97A 1UZMA 2C7BA 4OATA 5CVVA 4CIAA 5ENVA 3DB1A 4UM9B 2CJWA 2RGYA 4WE3A 5JPIA 2I03A 5IG2A 5HFNA 1M6YA 4DC9A 3RYHA 5FHRA 5J58A 3PUHA 3QKWA 3VR6A 4TQGA 4DLSA 1M2OA 2DPMA 5HWSA 2AOXA 3U17A 3WB0A 3IAEA 3O3NB 3ADDA 1T9GR 5KSPA 4LIPD 4HUJA 2PUAA 1D2GA 4P5DA 3SU8A 1TF7A 3K6RA 5C0OE 5IBCA 5JSZA 3MIZA 4L9WA 2DBQA 2QOEA 1PI3A 4BGEA 5L53A 1OMOA 1RYYA 1WEKA 2I3ZA 1U7UA 2PGJA 4WCFC 4YRCA 4E4YA 2BBSA 2OZVA 3QQPA 4IS3A 3CCCA 4J29A 1FFXB 1TMOA 3FZYA 4QUGA 5C1OA 1QF9A 2BM0A 3AW9A 5I5EA 1XE3A 1ZI8A 5F3WB 1RI2A 4EP1A 5CT9A 2XUIA 3F2VA 4I1OA 4C30A 3SC6A 3KSDO 3R3SA 3IR6A 1EVEA 2G1AA 4V38A 3NWJA 1BNCA 1T0IA 3JRWA 3N75A 4PBTA 2YDYA 5DHFA 4MVJF 4WY8A 5KKCA 1ZOPA 2NUTB 3FD8A 1YONA 5KQSA 2YUIA 3JD1A 5FFNA 2WIBA 4A03A 1K4MA 3I2HA 2RGRA 3DB2A 3BTUA 3GLKA 3BMXA 1JAHA 2AMYA 3DJYA 2DF8A 3MWDA 4OTZA 1M73E 3PK0A 4YMVA 3EVEA 4LYAA 4QO7A 3EQ8A 1XQXA 2VDMB 3R0VA 4N0MA 3BE8A 4KN8A 3I2KA 4UPVA 1ULTA 5I9SA 4AMUA 1XZIA 1ISIA 1V3UA 3R9KA 3ECAA 2BOVA 1CNMA 2BSAA 4P9NA 1WVMA 3UIEA 1X94A 4FJ1A 5DNDA 4KN6A 1N0HA 3JVIA 1PK7A 1IL0A 1DP4A 1SVKA 2QTWB 2ZE7A 5HK8A 5CX1A 5JCOA 2Q0XA 3LT0A 4HWTA 4KPFC 3SX0A 1JH9A 1EG7A 4DTCA 3ROEA 3TLGB 1JDPA 1P17A 3B36A 5JRDS 5EXXA 2ZWPA 3LO5A 1ENZA 2H11A 2WWIA 4R2JA 1WWKA </