5IAOA

Structure and mapping of spontaneous mutational sites of pyrr from mycobacterium tuberculosis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
171
Chain Sequence
ESRELMSAADVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDSTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mapping of spontaneous mutational sites of PyrR from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25177 / h37ra)
molecule tags Transferase
molecule keywords Bifunctional protein PyrR
total genus 50
structure length 171
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iaoA00
4M0KA 1VDMA 5ESXA 1JLSA 4RADA 1DQNA 1QB7A 1UPUA 5BQPA 2IGBA 3ACBA 1L1QA 1TC1A 4QRIA 1A4XA 3N2LA 4LYGA 4WMLA 1YFZA 3S5JA 1I0IA 3HVUA 1STOA 1G2PA 4RABA 4P81A 1OROA 1GRVA 1DQPA 3ACDA 3EFHA 1QK4A 1UFRA 4PFQA 2JKYA 4QYIB 1P4AA 1XTTA 4LZAA 1A3CA 1G9TA 5K51A 1A97A 1ZN8A 4M0UA 5HIAA 1G2QA 1I14A 1ECGA 1QK5A 1OREA 1AO0A 3ACCA 3DEZA 5IAOA 1HGXA 1Y0BA 2EHJA 4PAWA 1ECFA 2H08A 2WNSA 2GEBA 3OZGA 4RHXA 1BD4A 4Z1OA 4S2UA 3QW4B 4LZNA 3G6WA 1ECCA 1DKRA 5KAPA 1P19A 1ECBA 3H83A 4RAQA 4P3KA 1J7JA 4RQBA 3LPNA 4P83A 1V9SA 1UPFA 4KN6A 1WD5A 5IPFA 1O5OA 2FXVA 1HMPA 4IJQA 4F8EA 1I5EA 2DY0A 3DAHA 1FSGA 1BZYA 1DKUA 1A96A 2JBHA 4P80A 4RHYA 4RV4A 1XTUA 2PRYA 1P18A 2PRZA 4LYYA 5HKLA 1XZNA 3O7MA 1NULA 2H06A 5BSKA 1G9SA 1ECJA 1GPH1 4X44A 5KAMA 4RHUA 2JI4A 4JLSA 1IBSA 4QYIA 2AEEA 1U9YA 1XTVA 2H07A 1QCDA 1I0LA 3OHPA 1VCHA 1CJBA 1O57A 1LH0A 2P1ZA 1XZ8A 1D6NA 1W30A 1VSTA 5EUCA 1BD3A 1P17A 4X45A 1A98A 4P84A 4P86A 5BRNA 1TC2A 3M3HA 1ZN7A 5BQOA 3GGJA 2HCRA 1L1RA 4TWBA 1Z7GA 4RACA 4MB6A 1QK3A 4RHTA 3NAGA 5ESWA 3DMPA 4FYMA 2YZKA 1DBRA 3OZFA 3MBIA 2JKZA 1MZVA 5JSQA 4RANA 1PZMA 2C4KA 4P82A 4ZFNA 5JV5A 4JITA 3MJDA 4OHCA 4WN3A 1QCCA 3KB8A 5E38A 4LZOA 3LRTA 2VFAA 2XBUA 1JLRA 1ZN9A 1QB8A 1A95A 1U9ZA 1OPRA 4RAOA 4RQAA 2PS1A 1NONA 2E55A 3GEPA 1I13A 3GGCA 1R3UA 4M0PA
chains in the Genus database with same CATH superfamily
4I1IA 1S3FA 1E99A 4GBGA 5FWXA 4OFZA 1Z2AA 4R0MA 5C7IO 3TZHA 4EGFA 4I1YA 5J4LA 4O4JF 1UDBA 3RS8A 3HR7A 1FQJA 1ZJZA 2D4AA 3A14A 2FSIA 4WCVA 2F3UA 2IGTA 1Z0AA 2YVUA 4F97A 3JATA 3L7MA 4NECA 5KTOA 4KQ9A 3DUFA 3LX5A 1KMIY 1ZG3A 3HUTA 1MB9A 4Y0VA 3ZLUA 1D4ZA 4DY6A 3HDTA 3GFQA 4UC0A 5ESDA 1U2SA 4RF4A 3BFKA 5JASA 4XPZA 1LPNA 4F8JA 3BEDA 2DT8A 4A73A 1YOBA 2I65A 2QRVA 5DN6A 2O8DB 1NI4A 2CLIB 1YL7A 2FPIA 2V7XA 2GZ2A 3H6KA 4G3XA 5EPOA 3HFJA 5TMDA 1KH1A 3S27A 5IVHA 1JHQA 2FCAA 1RM0A 1T8WA 2F3TA 4GYWA 4MWGA 5ARDA 2BLNA 2I3DA 1HDXA 1L5WA 1MXFA 2PMWB 1W581 1VSUA 1YZKA 4URVR 4F85A 5E7JA 3OJWA 4AO6A 4CF6A 1CUCA 3EQ8A 3PV0A 1EXMA 1L7NA 2BOVA 2NAPA 1YI1A 5AW5A 1LSJA 1T0PA 3H05A 1ZNYA 2ONZA 3QJ5A 2GM3A 5I7WA 3E9EA 1TIBA 2H3EA 3GVXA 2WZCA 3HWWA 4QXOA 3N6VA 3G59A 3ZNPA 4MX8A 4TMKA 1B8OA 2VUUA 2A9KA 3DXFA 1FRFS 1O4VA 1WV1A 4CL8A 3C8DA 2R7LA 4R6XA 2YJ6A 3A36A 1CUAA 4KDRA 3VAZA 1SBTA 1HFJA 3R7BA 1BDBA 1V1MB 3I9OA 4IKOA 5F4ZA 2HXYA 1DXOA 2V55B 1MAVA 2XCLA 2VHJA 1EFDN 1I4LD 2MHCA 2B92A 3B1XA 3PRYA 4NC9A 4I1PA 1JL3A 1E6EA 2HT1A 4Q66C 3E3NA 1LWNA 4US0R 4Q3OA 3UJ8A 1OB2A 4CDMA 4IINA 1QYCA 2GQ0A 3PNQA 3W6NA 2GEDA 4FD2A 1PQYA 2GBIA 4DJEC 3IR6A 3ETEA 4AJPA 3PHGA 3SWWA 3IP5A 2WRZA 3LK7A 5I4BA 2D0OB 1G5IA 3R6WA 2V65A 4AZTA 5JCPA 5G0UA 4QPCA 4XWWA 5E4JA 1GU0A 5GP1A 3TNJA 5BSMA 2HJGA 3FCUB 4P3OA 3T7EA 3ZVNA 2FMXA 1XEWY 2X1MA 5DBEX 3HVIA 1JI3A 2QZZA 3MBIA 4FNOA 2V9PA 4FHGA 5EWLB 3E9DA 2TECE 4TWZA 5B64A 5TJHA 4DIDA 2JLVA 3NT2A 2M6LA 1G5PA 1HKUA 1DEHA 3P2OA 3L82B 4DCMA 4KR2A 1W36D 3VNAA 2DEUA 1HMYA 2C8LA 4RKFA 1M2WA 4UUAA 2QAGC 1W73A 2UYYA 2JEZA 4XVRA 3GJ6A 2IP2A 5C52B 1ZR2A 4GZ6A 4U1RA 1K3TA 3OZUA 4BASA 4N1AA 2OZLB 4FMCF 4XYGA 2ZI5A 1EBUA 1E1CA 1U8XX 3OCYA 4Q1BA 5TARA 5L3SB 1KAGA 2XEDA 3AO0B 1TMGE 1Z8FA 3DG9A 3Q3HA 5DWVA 3OF5A 3OAAA 3MPUA 2ZAGA 3VR1A 4XXHA 1JIKA 1LQ2A 3HKCA 3B5EA 1YIAA 4WZ6A 3I9FA 3ELYA 3EVNA 1DAGA 2AUNA 4L02A 4L4YA 2X4LA 5AKKA 2JGDA 2JLCA 2YC2C 2BW0A 2VYVD 1AGRA 4GX5A 3MZ0A 4BUZA 2Q41A 1C3OB 1RPAA 5A6SB 2ZUFA 2J5BA 4OHZA 3KKQA 5KSOA 5J47A 2O0LA 1UIMA 2HW8A 1P0CA 2XEXA 3P71T 3V9AA 4Y1EA 2HDOA 3NP9A 4WK2B 1RPTA 5KYVA 5GADl 2VAVA 2CBXA 3GW8A 4R1UA 4HGQA 1IN6A 1PGNA 3KTDA 5JDCA 3ABRB 3RC8A 5KX5A 1Q22A 1USUA 4BVHA 4DJDC 4MAMA 3DMHA 2RIRA 5P21A 2KE5A 2VWQA 1F17A 1OFUA 1P5FA 2Q62A 3QPAA 4X24A 4IXMA 3DL4A 1GCAA 1PYOA 3RE1A 3VAYA 4D98A 4PN3A 1S7CA 5CA0B 5F64A 1LPMA 1XWWA 3OEEA 3OPQA 4WECA 5DTEA 3M49A 2Y1FA 3HXKA 5DT2A 1YCGA 5F2KA 5C8YB 2BTEA 1LSOA 3RIYA 3RIMA 5AVVA 3BERA 3F47A 1IQRA 4PRYA 4F3NA 1XAHA 1L0BA 4PN7A 1EFRA 3I6YA 4PXAA 1OGYA 4DZZA 4IJQA 5JALA 4YRDA 3ZKWB 5BN3A 1FP4A 2IFTA 3A25A 4XQEA 4ROTA 4Q18A 3U3JA 4K6FA 1N34B 3FYUA 4HDSB 4ER5A 4O59O 2BMFA 1DAFA 4UUNA 4CXMA 2XZOA 1JEQA 1WPQA 3UAZA 2EW1A 3T5DA 3IRVA 4A0GA 3E9NA 1MC1A 4NFLA 1EWTA 1U5CA 1V8BA 1X74A 1JE0A 3AHHA 3GMSA 1VBKA 3IIJA 5FUMA 5IUJC 1YA6A 3Q7SA 1V1RA 3RABA 4M46A 1VRVA 5CDFE 4XVHA 1V11A 2GN2A 3T3NA 3NHUA 2Z3WA 3OQ1A 3KOYA 4QDTA 3C97A 3O1HB 3R77A 3OCVA 4Y6RA 4AJ1A 4AUEA 5IDXA 2VQFB 2A0UA 2Z5LA 5K3FB 1NW3A 3IGFA 3QPDA 2CMKA 2VA9A 3RRZA 1XZ8A 1RXYA 3KR2A 2CVPA 3L06A 2JVJA 2EFEB 1G20E 3I01A 4Q3AA 1EJ6A 2WKWA 3BEOA 1PEDA 1UJ5A 4QUBA 4ZA2A 3ZZTA 2PUAA 1SG0A 3HACA 4NE2A 1MABA 4PBTA 3VUFA 1QIGA 1W1UA 5D8DA 5HBGA 3X43A 2Y0BA 1NVUQ 1RLIA 2H5IA 1SPXA 1JAHA 2VP9A 2O54A 4HAVA 3J7AC 1FNNA 3BMCA 4JMLA 2YZNA 1P5HA 1ULZA 3L6EA 3V4LA 4V0SA 3RAEC 1PS0A 1MD9A 3VR3D 1H3NA 2FZLA 3L7DA 4OKSA 1EVZA 1WKBA 2HA2A 1ZD9A 2I2FA 2RK6A 1L2TA 1GPDG 1S8NA 4Z2AA 2ZUEA 3GCXA 5F4BA 4J0QA 4G86A 4U2EA 3I2GA 3ZU2A 4E70A 4WZAA 4G5SA 2VNAA 1WMFA 1NMXA 3G2LA 4KQHA 4MCIA 4TYMA 4UQOA 5AOBA 3NBMA 2DCMA 2PUHA 5K8CA 1EDZA 5AM2A 3PC2A 3QFFA 3QBTA 3GLTA 4K1LA 3VR6D 5T4HA 2F9FA 2OP1A 3CN7A 2GDZA 4YJHA 5AI0A 3OM8A 3AUFA 4Y0NA 4HDMA 1M74A 4NR0A 1G5QA 1SELA 4B76A 4GR9A 2VDQB 2GGSA 2MIIA 2VPPA 3IULA 4RF2A 1U8TA 1GTG1 1CG6A 3C6ZA 1T5OA 2C99A 3CA8A 4IV0A 2QRPA 3IB3A 4UM5A 4EA7A 4YCCA 4ZYVA 1QQBA 5HJ2A 3RJ9A 3DTVD 4MS1A 1M2KA 2JFUA 3FDFA 4CM8B 3THWB 1PZNA 4UNIA 1G0OA 3HMQA 3LY9A 4WUTA 4IMJB 4BZWA 4YRIA 2GEKA 2FJPA 1QIKA 1ZGBA 3N8KA 3RVJA 3EUAA 4X62B 3AFGA 4NCHA 2WQZA 3B12A 3R3VA 4HAXA 4MR8A 1WCXA 1UEXC 2Q3CA 2BFDB 2DWOA 3C5EA 3ROKA 2FSVA 4CG0A 3ZY4A 5BRJA 2G28A 2PS0A 2FWRA 4I5GA 3TGWA 3W8RA 2C2ZA 2JNWA 4H16A 3DDUA 4Q3EA 1TRKA 4UE2A 3D4BA 5IDYA 1QVRA 3AV0B 3WWCA 4K9DA 1NXPA 1Q0ZA 3P4UA 3VTKA 2DH6A 1ODSA 4M21A 4NU6A 5JJLA 5ADHA 4HC4A 3ZGVA 3ADOA 2ASVA 2BEJA 4KN5A 1UP7A 4H1WA 5I01A 2G9RA 2J4CA 2O2JA 3EWIA 3VGPA 3CZAA 3G9TA 3GDOA 1N7HA 9LDBA 1S02A 4E5PA 2OKGA 1S01A 2VT7A 1Y9AA 2Y92A 3MTIA 4W8HA 4YWJA 3LD9A 1EK2A 2PX4A 3HZOA 5E1BA 3EDRA 4DDUA 3PRJA 4B6JA 2J32A 3WHLA 4MR9B 4B43A 1SVIA 1YZQA 1NTOA 2FNAA 1QHIA 1BRTA 1A82A 1UDCA 4JJ7A 3NX4A 3UK0A 1J25A 2ONYA 1QIDA 5IT5A 3WP1B 4M8SA 2LP4Y 3SP1A 2JCVA 2Q29A 3DOEA 1CZNA 2HA5A 3PXGA 2EKBA 4IX1A 1N0UA 3SOZA 5KPJA 2IBMA 3N05A 1YQ9A 3HRHA 4MULA 4Z9AA 1C1DB 4EFKA 4N5IX 3AEUA 4AS2A 4Z4GA 2RG1A 5KQRA 1I7SB 4BNHA 4ZD6A 1HWYA 1XD2A 2X4DA 3G1UA 1NW6A 1V3QE 2FDXA 2PY6A 1BWPA 1ZVQA 4U2GA 4YRLA 3W7VA 3GZJA 1X80B 4DG9A 1LRLA 2VF4X 3NAGA 3HG7A 3V97A 2YZ2A 3RPEA 1KYQA 1MBZA 1EVJA 1T3LA 4JP3A 1L7OA 1ZM7A 3SR4A 4ENPA 2Q1TA 4QPJC 1Q3HA 2QD4A 2O3SA 3CZMA 1V5IA 4PAGA 1BRMA 1FCJA 5PGMA 4KYIB 1ZUIA 4BYGA 4KWIA 4R8SA 3FPFA 1J1UA 1H4VB 2A9VA 3ME5A 1A8IA 3NEAA 4XQCA 5BMVB 1AOXA 3MS7A 4R1MA 1KI3A 3C43A 2YDYA 2QRVB 4MMXB 4KXYA 1NP6A 3K9CA 2AOXA 2C9CA 2HIGA 3KOUA 4LQLA 4NBNA 5J1TB 1EQUA 4RQAA 2JFNA 2K2WA 3PC6A 3VSBA 5IX8A 2J3MA 2ZVPX 2HF8A 3NVMB 5IWCA 4G65A 1Y3FE 2ET6A 1K8QA 3DCYA 4HQFA 2B8NA 5EIEA 1SVKA 2J87A 3QKSB 3A2LA 1SC1A 3N7UA 3ADCA 2OORA 2PUDA 3PE3A 2IS6A 3RSHA 2W6CX 4QM6A 2HMUA 4ONEA 4TTVA 3SHWA 3A58B 1PX0A 3IS3A 3ONVA 2QPLA 2P2YA 2AOUA 4K26A 1WBDA 1N25A 5L45A 4JU8A 4YHBA 3ZLBA 2PA3A 3PDCA 3A8TA 3T0FA 1G6KA 2XUDA 1YS6A 4L8LA 4NBKA 4Y2PA 1P4AA 3X1YA 4JI4B 4OXQA 3FYCA 5H82A 5HIAA 2HMSA 4URWR 1R8YA 2EG5A 2GSDA 2Y6VA 4EWLA 1XL1A 6CHYA 4Z0TA 4C76A 1JQAA 2I7VA 1GZ6A 3UQZA 1BWQA 1AGYA 1EE9A 2GPSA 4TRJA 1J09A 5KOYA 1LVGA 1M1YB 2V6MA 2H65A 3QRWA 3BH7A 4RPIA 2YWJA 3PGKA 5CH3A 3S70A 1CVRA 4NK4A 4P4GA 5AVOA 2C07A 4JGBA 2ZJFA 1COZA 3OZTA 4J0JA 2QJOA 2D1SA 4EW2A 1D2NA 2PXCA 2HJVA 2OBYA 4EM6A 3U7EB 2Q0QA 3S1SA 1O6GA 2FWPA 1SXJA 4I0WB 3RS3A 3ZJ4A 4GPBA 1OIXA 1NV8A 4OHXA 3BD6A 1Z83A 3PSHA 3AOEC 4GWKA 3ORHA 4GGMX 4F5DA 5G4KA 3LTNC 4QOSA 3V8VA 3NW9A 2Q2VA 4BHTA 5AVKA 3KVYA 4KXWA 3PHBE 4FW9A 3RYFA 1DKUA 1UOEA 2YIMA 3GAMA 3LIPA 4OHWA 5FWXB 1OPXA 3Q85A 4CNBA 1N5KA 2CHVA 4DA8A 4Z4EA 4G63A 4ERNA 4C0XA 3G2PA 1HNZB 2DJ5A 2R7MA 2VXCA 3ABOB 4P58A 5BSTA 2H5LA 3FMIA 3RS5A 4ZVUA 4KLCA 1OTYA 3HCPA 5DTRA 3LUFA 1ZSNA 1TVCA 3QWAA 3IL2A 4GRAA 5DYTA 3TCNA 5BQXA 5H3LA 3B70A 4JCCA 3AX6A 2H1LA 2AN9A 1TF7A 2MR5A 1PFUA 2I6FA 1GV1A 3SEQA 4CPDA 3FF1A 1JVSA 1U8UA 2YR0A 5SY9A 1KJZA 3CLVA 2CYCA 4Z86A 5DK4A 2QEQA 4IMPA 4X45A 2Q4DA 2AHRA 5IYZF 5K0JA 3P96A 3JAWB 1NM5A 2GCNA 3LGAA 3WHPA 2GX6A 4WACA 2XD9A 3ENVA 3KHTA 4N5LA 1WV0A 5BYKA 1RYYA 4N01A 1ISIA 3KD3A 4B2YA 1V47A 2GA9A 2OFFA 5JQGF 3K8QA 1ZEJA 2FCRA 3CYFA 3EMDA 2OL4A 3NCTA 2W9XA 1LFAA 4JJIA 2NN3C 2O20A 4WPGA 3MCWA 1XTSA 3KQLA 1Z35A 1XDZA 2VC2B 3COWA 3NYIA 4KODA 3P9XA 2ZWVA 3M3PA 5TVKA 2HMTA 1CQJB 4E1BA 2JLYA 3GEIA 1QF7A 3AJ8A 2XYHA 3DVQX 2Y1KA 2B7CA 5BQ3A 3X2FA 1ORIA 1QVWA 2RI0A 4JWTA 5K20A 4HQ6A 4LGMA 2BUAA 4X85A 3K0FB 2RONA 1IVSA 1P0FA 1UINA 5FBVB 3H3JA 4UMFA 3JRWA 3H9EO 4YJ2B 4KV7A 4WAUA 3EIQA 2O50A 3MCVA 1ORTA 1VIDA 3TN7A 2ECKA 5BN3B 1KKMA 4YP0A 5KTYA 3CVJA 3EXFA 3FTPA 2AI2A 2B4TO 3ZZ1A 2D74A 1PSWA 4R9NA 1DKMA 4FGWA 3L8CA 1SQFA 2VP6A 1GUZA 4NEQA 1QMPA 2R7KA 2OHOA 2DAPA 2BTOA 1V71A 2GKSA 2ODWA 2VJQA 2Y9MB 3LUDA 3O7WA 4BBJA 4CG2A 4UFPA 5FPTA 1LDGA 3Q8KA 2JKVA 3V4ZA 2H6EA 4DF3A 2JIMA 2AG0A 2ZBGA 1DIAA 5J23A 4QDZA 4G1MB 4ESEA 2CLCX 4DNOA 4RHCA 1M2EA 1A1VA 1HPLA 3A10A 2CHQA 3GF4A 1EBBA 4U6QA 1NQUA 5IAOA 4EYSA 1GN8A 4QHSA 4RE6A 5C53B 1NATA 3FSRA 3JSXA 3H4IA 2PMCA 4Q3NA 3VH4A 2E9SA 4E22A 5DNYB 3ZV4A 2Y99A 3ZHSA 3D3NA 5T8KA 4I1UA 3V1TC 1Y1QA 3QVXA 5BVHA 5A4JA 5C1DA 1X77A 2PSHA 3CT4A 4I50F 1CUIA 3ADKA 5TEVA 4G4JA 1HR0B 3ZHUA 1TKAA 1CDDA 3ND8A 3PWSA 3EFOA 3L40A 3RASA 5EQTA 5CG1A 2DLNA 4Q7MB 3GCZA 2XMPA 2PJRA 1JKMA 1G6Q1 2W2MA 4A8HA 4GM0A 1BJKA 2E4VA 4HLCA 1J8QA 3M81A 4EG8A 4WVFA 2XMBA 4YJDA 1SHZA 3L93A 3VPHA 2ANCA 2IRWA 5I3ZA 1U3UA 3B89A 4UOQA 1WSBA 3HYRA 1TW2A 2VDJA 2HQRA 1UANA 2AQIA 3P0EA 4FYXA 4QYMA 3S2SA 5CT8A 3N6XA 2J59A 2VHVA 1ZM4A 4P4TA 3BWDD 1CB7A 4LSMA 1XZNA 3EVGA 4M1ZA 1OA1A 2GB4A 3DW3X 5DYWA 3SSMA 4AJJA 2HSJA 5I9IA 4YWHA 1KJ9A 2O9JA 4LRYA 3JAMA 3HHEA 1RI5A 3VJKA 2XIJA 2HA3A 4L4RA 5F12A 4A8JA 3EQ9A 5TVGA 3IP8A 1RLUA 3I04A 3CRQA 4R4JA 4ZVSA 2CDRA 2R8RA 1EQ2A 3WIOA 3JZIA 1H2ZA 3OKPA 1ZK4A 2FEXA 2DYKA 2IF2A 4XJSA 2VZLA 4EHAA 4ZV7A 3RJMA 1H05A 2NSHA 3EXFB 1QH1A 1Q2XA 4M0LA 4MPRA 5A4KA 5D7BA 4MTCA 5JAZA 5BYBA 2Q0HA 5KYXB 4IQ4A 5TF4A 1U0FA 3VR2A 5AK4A 3GHHA 3OVMA 4U39A 3PGXA 4RJTA 2OC4A 5B55A 4RDHA 3UG7A 3HGQA 2O5CA 4HX2A 3UMMA 3TEFA 4DCSA 2P9FA 2RGNA 1QPBA 1BS1A 4H18A 2R60A 1IOLA 1ILWA 4TYPA 1MENA 2PJZA 1RP1A 3I6BA 1CF2O 3JVEA 3T3GA 2QLJA 4ER0A 4DYDA 4NJMA 4OA5A 4AG6A 3ZW8A 3RBAA 1YVUA 2A0KA 2RI1A 1TIKA 2VCYA 2VA8A 1XBTA 3JARB 2EYUA 1WOMA 4K6KA 4R2IA 4UEQA 4ZVKA 5CT5A 5DN9A 4C2UA 1J1IA 1VL5A 5CB8A 3OBIA 1JG1A 3RIHA 4BEBA 5HVNA 4JYBA 3CJRA 1MDBA 2QJFA 4D44A 2AMJA 2VDWB 3TNDA 1E9SA 1G8PA 1XTPA 4P54A 3S1LA 4EGAA 3CG0A 2YV2A 4EJ6A 4U63A 1LK5A 3UGJA 1X7YB 3NM4A 4WBNA 1VHTA 3D4LA 1AB5A 3Q5GA 3HR8A 4EFNA 3LC7O 4TS3A 1KK2A 2HFJA 2PBLA 4RZSA 3OICA 4TYQA 1I6WA 5HOEA 4AK9A 1NKSA 2RCYA 4C3UA 4TV8B 4JELA 5TXGA 4B83A 3UMJA 2QXUA 1C3LA 4JJ4A 3R5KA 1JJAA 1P9WA 3I5XA 5ELXA 1N2IA 1EM8B 1TLFA 2OAGA 2W58A 3RYFB 2GEBA 4GX2A 4RJJA 1F8FA 2VJMB 2B4YA 1M67A 3KWLA 1A27A 4KKXB 4UBNA 4Q9DA 5EYPA 4MH0R 3TM4A 1E7RA 1OAKA 2GZSA 3ZQUA 3IKTA 3IMGA 3CCCA 3NRJA 2B94A 1VIVA 4Y6PA 1QHFA 5A3JA 2PGAA 3DS8A 4O2AF 1OOEA 3WS7A 2ZSKA 3MGKA 1GTJ1 1NLFA 3DXYA 3WV4A 3X1ZA 1BC5A 2VHCA 4CKCA 3I4CA 2QA5A 2R1TA 3U7JA 5ALZA 1Y82A 4F3RA 5TLSA 1SKMA 1I8TA 3M1LA 1N7IA 3M6LA 1JQKA 4NCXA 3ZQ6A 5EIOA 3KWMA 5F7JA 1E2QA 3F3MA 1GLNA 5FO0A 4HX9A 1PK8A 2YIVX 4LDJA 1E7QA 5G2OA 4H6PA 4M8LA 4OHOA 4NPHA 5DF1A 3TX2A 1ETUA 2Q99A 2GETA 3ELUA 4MQLA 3U17A 4LYFA 4YC7A 2CUNA 1KF0A 2RDMA 4LSWA 4E5UA 2GRUA 4ZKEA 3GEEA 3R1IA 2P5YA 4AX4A 1QTRA 5IDQA 4J0KA 1UBNA 4JSTA 5A7FA 4M87A 4MUXA 2CLEB 4I5EA 1OWPA 2G82A 3ONDA 1YRLA 2X0KA 2GWRA 1O57A 2BISA 3D1LA 1BEZA 1GPMA 4LXYA 4U2CA 2R1TB 4XOIA 3M70A 4KJZA 5FFNA 5J63A 3RNOA 3F5MA 4RA6A 4D0GA 1UCFA 3TQFA 1VQ1A 3FYDA 3LHKA 1D6MA 3OE1A 2AFHE 1W35A 2BCEA 1UQTA 3Q4GA 3DXZA 1AVTA 2PSDA 4M9RA 3G2MA 4S0XA 2CJWB 1Z28A 4Y67A 1K5PA 1Z56C 1QCZA 2GMWA 3F4LA 3JPWA 5CVJA 3ZXUB 5A4FS 1VE5A 2QM8A 1DINA 3G0OA 4Q4JA 3VVMA 4D92A 2V6IA 3FR7A 4D4KA 2WTNA 3OZFA 1IM8A 3HZRA 4ZEVA 3BFVA 4XX1A 1M7HA 3CLSC 2NO7A 4Y6QA 4I46A 1HG0A 3N70A 1IPHA 4TV8A 4N8SA 2NXWA 3L6BA 4PFKA 2C84A 2HAEA 3LJKA 4D57A 4NV1A 5LZ8A 2R66A 3X1MA 1JB9A 1SCDA 3BVPA 3TQQA 1T6YA 1UKVY 4D3YA 4BTVA 3NHFA 4TXHA 4DJJA 1G59A 3H1PA 2JJ1A 3FB4A 3OKFA 4HDRB 4OXXA 5HK8A 1KP3A 4W8OA 1CUWA 2PMBA 4EVRA 2V98A 3LYUA 1KYYA 1SBQA 1Z5UA 2NZYA 2RGUA 4KXUA 4ZAYA 3RANA 2XT9A 6AT1A 1IN1A 1DFIA 4JI6B 3UT5B 3KZ1E 2VDWA 1SN7A 4RD3A 1Y8RA 1P1KA 5LP6C 3FVWA 3ZWXA 2V7GA 5KTRA 1SULA 3CWQA 4IDGA 1UPUA 1MEJA 1IN8A 4W1PA 2JFXA 5JANA 1I2DA 2IS4A 5GONF 3VI3B 1JT9A 4GRDA 2C2OA 2PXXA 5C51B 4UMDA 4V1CI 4PYIA 2YN2A 3ETHA 5FL7D 3I34X 5J4YA 3DA8A 4UHEA 2XCTB 3BGSA 1GTL1 4CMIA 1U4SA 4D8WA 5ICGA 1TT5B 3L0BA 3X1XA 2GPTA 2EJCA 3Q9NA 4P93A 5EWJB 4ACAA 4ALJA 2IOHA 3AI7A 3V4VB 2I87A 2ZJZA 2ZJBA 4YUYA 3U5ZB 1NUSA 1T2UA 2DPMA 3CBQA 2IZ7A 1JQ5A 1NWHA 3HUEA 4ZP1A 2Y0CA 5IK2A 5K0NA 4CE6A 2EKDA 1PGPA 1NR1A 1A2QA 1T0HB 3QEAZ 1OY1A 4GOKA 3EIWA 4QG3A 1YJ8A 4PLCA 1RCFA 1SK8A 2F43B 2RG7A 4QBHA 3R7DA 3SYRA 1J06A 3TSWA 2BY4A 3VYTB 1FC0A 1XCLA 3PXCX 2G9QA 3A31A 3DEKA 3KUKA 3I04M 5FNVA 5L7WA 3HO6A 2WILA 3H6GA 1T29A 4BE9A 4J7XA 3N0WA 1BWSA 4L85A 4IBOA 5EG5A 1RAIA 3NTOA 4C0KA 3VPXA 4E13A 1GCIA 4P83A 2W90A 2YQZA 3FETA 3CMCO 1R0SA 2X0NA 4I55A 1O5OA 4M1YA 3D0OA 4QDKA 2EBUA 4A6XA 4TKUB 2ZETA 3DBVO 3IT3A 4MYRA 3UENA 4TPKA 1BZYA 4X41A 5BUZA 3WO0A 3LX6A 2BEWA 1PI3A 3C15C 1C1HA 3DNMA 4FMPA 1D0IA 1DXYA 1MHPA 2ZR8A 1JLLB 4J2OA 4MGIR 5CLIA 3W1WA 1CR2A 2PGOA 3H5RA 4JLMA 5TR9A 3T9CA 1LSSA 1KO8A 3I32A 2Q6KA 2AJTA 3I52A 3KSUA 3QXXA 4O4HF 1ADGA 1J70A 1YIOA 1G8GA 3GDFA 3MEQA 5EXTA 1AB6A 3KQYA 3P1JA 3RS9A 2J5QA 2PX0A 5DM4A 2ZBPA 5JWHA 3ZHTA 4D9NA 3MAGA 1N5LA 4BAGA 1Q3KA 2HXSA 4QA9A 3DB2A 4TT3A 1EX9A 2ABWA 4QEKA 3NBUA 3RYCB 1EGQA 1VLQA 3FNIA 2MYUA 4CT0A 1MGPA 2LUOA 1F2VA 4NBTA 5CEFA 1LJ8A 1SC4A 4Y2SA 5IKEA 4NEHB 1M76A 2C4TA 1PAUA 1DP4A 2GYWA 1N3IA 1W88A 1MT3A 1QFZA 2EP8A 3P2IA 1CT9A 1SXJD 1Y63A 3O4JA 3N2GB 5BR7A 5BNWA 1A9SA 3DOHA 4MUGA 4YT4A 2G88A 4P2BA 4OLHA 2GPJA 4NONA 2BFNA 1AQJA 3SSAA 5L3SA 1YQGA 4JVOA 3SQXA 3PEVA 2O8EA 1X7WB 2A30A 1S0UA 5CT9A 4AU1A 1SCIA 3ULKA 1WAMA 3HV0A 4FP9A 2PG3A 4BNYA 3VDXA 2F8TA 3KLOA 4W8GA 4DVGA 1S96A 3QBJA 5BOSB 4WKNA 4LYEA 5DK6A 5C18A 2IEIA 3QXJA 5KVSA 3IE2A 1XC7A 2P77A 5SZHB 3ZGZA 3OX1A 4G8DA 4NH4A 2Q3JA 4HNUA 1AS0A 3IVRA 2C4UA 1NOIA 4UXIA 2MWMA 3K1YA 1WXWA 3ZYCA 5KYUB 2RHGB 4GWGA 1GLGA 2HBRA 2Y4NA 4MQUA 3ZIUA 3LCUA 1R4NB 5K0GA 1ZU5A 2J67A 3OTGA 3EPLA 1FSPA 1TJ5A 3SMQA 1T3HA 3IILA 2JJQA 3N8IA 1DL5A 2OCXA 3TBFA 4ZVTA 2O2YA 1PL0A 3CUEF 3E5HA 4RZIA 1EDEA 2C20A 4XFDA 4HVLA 5C4IA 1BFKA 4AF7A 3B36A 1DIHA 3L6CA 1I3NA 3M9LA 2B34A 1XTTA 3RBVA 4Q00A 4D25A 1A3CA 2QXTA 3ZZ0A 4CTKA 3T3OA 1GJRA 2JJYA 2AD1A 1HDOA 5G4KB 3R7AA 2J6BA 5KWJA 1KQPA 4BGEA 1BKYA 1SZPA 2FGKA 2OT3B 4CWAA 1SXJB 2WF8A 3I1FA 2DZDA 4Q4AA 3MBOA 1SU4A 3FVRA 1FNBA 1QRAA 2CVHA 1U0NA 3RSCA 2AZXA 4DDTA 5CCEA 1AXGA 3OZSA 4JLKA 3QPUA 2R1UA 5TB5A 4BMXA 4IFBA 2WUGA 3UAYA 3WNBA 4KXNA 4RTLA 2OESA 4D0SA 4P3KA 2GERA 5JW6A 4ZO8A 1FDIA 2FXIA 1XN1A 4INZA 5HZMA 2NV0A 2CNOA 2D0DA 2RGXA 3TSCA 1ZK0A 2OBLA 2W2PA 1DQSA 4CIWA 1DOZA 2H2FA 1I9CA 2A1UA 3CPJB 4NHEA 4IQ8A 2AR7A 4IKEA 5ALIA 4Y18A 4B9EA 1NI3A 1FE8A 3GRKA 5T67A 1P1CA 4EGQA 4G5QA 3MTJA 4ENTA 1EVYA 1Q0LA 1QHGA 4HAOA 1FXSA 1S2LA 4P80A 5HE9A 3AGQA 4FS3A 3EMKA 3GFRA 3VH1A 1IY9A 5LNK1 1YJAA 4AULA 2IYAA 3GGDA 4HGYA 3EGDB 1NPYA 2JASA 3AWIA 3GNTA 2XDQB 3AJRA 4A8PA 3MW8A 5DVZA 4ZGWA 3EZYA 4O25A 4M6WA 4JLWA 4QUEA 3M6AA 4L0MA 4HWTA 3TMYA 4LF8B 4M22A 2JI6A 2WB4A 3ISJA 2IDKA 3FMOB 5JH7A 1Q6ZA 1XRNA 2BGJA 2I4OA 2PN1A 1EVIA 3GY0A 3E03A 1U7HA 3KSDO 3RK1A 3PRHA 3INTA 5A7HA 2Y1LA 1RRGA 2YWCA 4BC1A 4NZPA 3WL6A 1OX5A 4Y2XA 1Z8DA 2XB6A 4LXTA 3EDMA 4W7SA 1IHPA 4DMCA 2A5FA 4OGGA 2DBRA 3EFEA 4KIFA 4NBUA 4EAQA 5B4TA 2G4VA 1XGKA 1L5MA 2TMYA 2VF2A 2CEAA 3LCCA 1FLVA 3M0EA 4MGEA 3TKYA 1DCFA 5HW0A 4C7XA 1W47A 1CJVC 4KMOA 1BH6A 1GM5A 1NHGA 3L41A 3UMVA 3DR3A 1DARA 1SOUA 4EPTA 3NBQA 4ILKA 2W83A 2GRAA 1I4OA 3PHCA 4HI0E 1M6YA 1Y5LA 1XNHA 4D8TA 1P5RA 4JLOA 1FUKA 4JVNA 2Y1XA 1WU8A 2VSYA 4EY6A 1YONA 2XOKD 4JBLA 2SKEA 3CLTD 2C57A 1UT5A 1PJ2A 1M8PA 1SY7A 2IHVA 3RREA 1MVLA 3O1LA 2IS2A 5AOCA 5JDIA 4M88A 4DQKA 2PZKA 2WAMA 4OOEA 3T0IA 3WX0A 4D80A 2JLXA 1RRMA 3R3JA 3OOEA 5FTNA 3PL5A 1N0HA 4DEXA 1WULS 4NCIA 4DR2B 1EPUA 1ZGAA 1WUYA 2AFRA 3CINA 5A4MS 3R75A 3L1IA 4IR7A 1Y34E 5HR5A 1JAYA 2HQBA 2R65A 4JLAA 4J0CA 5DDIP 4Q4HA 4XVCA 1V16A 3EZFA 2CLKB 1VJ0A 2WIBA 4O02B 3CY6A 3F4BA 3Q40A 1GT6A 4IY1A 2DPLA 5AJTA 1GDHA 1MTOA 5ADWA 1D2MA 4EYGA 1OX4A 4CDRA 3GELA 1F51E 4NX2A 1COWA 1Q1NA 2J3HA 3G2NA 1PTJC 2OAQ1 2UVQA 4EQZA 1SKBA 4IYJA 4DUYB 1B2RA 4IUYA 1OH7A 2A33A 2YQ5A 3IEKA 1KEPA 1U3DA 4QUDA 4CTOA 1ZQ9A 4HQKA 4K6GA 4KXLA 1NLYA 4NMHA 1NMSA 4B73A 3Q2KA 5D01A 2AI3A 1V3VA 1T1RA 5FBHA 1ONOA 4C2TA 1AXRA 2X0DA 1BTOA 1MOQA 2BI4A 5IZCA 2JG3A 4M83A 3MGBA 4EPVA 4FVTA 3E1SA 4F4JA 2CWWA 3PEEA 1TM1E 2WWTA 5LQMA 3USES 3OP4A 3MOSA 1ISJA 3V80A 4BQOA 2AW5A 3SY8A 3UGQA 1E7SA 3T35A 3JQEA 3UT0A 5I9NA 3OOWA 2FP3A 4E5MA 4U9IS 2CHEA 2DETA 3RW9A 2FQXA 1CYDA 1YCDA 1YF3A 1JG4A 1LBIA 1QTIA 1HE5A 4HDOB 2O8DA 2NYUA 2C3YA 3D8UA 1LTHR 2XCOA 1EXWA 3BL5A 3BRQA 2D7DA 4S04A 2A2ZA 2YIDA 3OPYB 4LKRA 1JYSA 5ANRB 5B6PA 1G21E 3IESA 3L8DA 4DMUB 1C14A 4X1KA 2UUBB 1ZRMA 5ALTA 4X71A 2CLMB 2ACKA 4BQQA 1EP9A 3OMLA 3W90A 4PCLA 2I6GA 3AETA 3NTVA 4P4NA 4D9HA 2JIZA 2AEEA 2FE4A 4X63A 1KOGA 4OHBA 4DARA 2QN7A 2QRHA 5T3UA 4AMYA 1OCEA 3GFBA 1AQUA 1SXHA 2OYSA 4XJVA 3VC3A 4X3OA 3U4IA 1M5RA 3RVKA 1I10A 1L4LA 3DSRA 4JENA 1ZR4A 2XVXA 1NVAA 5SV2A 1L1RA 4DLXA 3DBOB 3K9LA 2RC5A 3WWEA 1C2YA 1JHUA 1M1YE 4LVUA 4MV4A 2FZGA 3SX0A 1PKEA 3PHHA 4HH1A 4LJLA 2WWRA 5CLJA 1CC1S 2YZKA 2PGNA 1PO7A 4P98A 2YYYA 2B8WA 2HF7A 2I78A 2JKZA 4NCJA 4WT7A 2GBGA 2VKQA 3HJUA 3QNMA 3R2JA 4MKGA 4TSFA 1J2TA 4BRZA 2N1BA 3UPUA 2GBLA 3L07A 1ZNQO 1NJ8A 3SLKA 3IUMA 4Z2YA 4UM7A 5CDUA 2ZT5A 4G0QA 2BAGA 4UQLA 5BT9A 5G1NA 1A5SB 3FOAA 3GZNB 5DM2A 5DU2A 5A4DA 3QOWA 1ZN9A 3MWGA 1FF9A 1H8HD 2X77A 4RMHA 4URZR 4DA7A 2REBA 3IT1A 3AIOA 4ZT4A 4DY4A 2Y1WA 1ZQ1A 3QK7A 2YS6A 1DEKA 1W4ZA 2OHIA 3P9ZA 1D2GA 1D8TA 3PDIA 4HDMB 4IG9A 5JPIA 1B0ZA 3Q9LA 3SK0A 5HZHA 3TRIA 1E3WA 1WW8A 4KO4S 2IHBA 1A8HA 3QKWA 5FUYA 1WCV1 2Q3EA 1MCZA 1TC1A 5K3CA 3E7DA 3I2FA 4AECA 1RXSA 3B1YA 2C5GA 2G25A 1G66A 5EXDA 2PR7A 4DSOA 5IWAB 4LY9A 5IKMA 1PHPA 4OV6B 4FXOA 1LVUA 4LWQA 3UAGA 2PNJA 2BMJA 2YUIA 2OV1A 3EYAA 4ZOLA 1EDDA 1ZK2A 2XOKA 2AT1A 2XJ9A 1UBFA 4QQ8A 3FWPA 3OZWA 1A8QA 1NNUA 5EKTA 2M6SA 1ORDA 1XNGA 3JQBA 5AK6A 1LDBA 1LF0A 3KLPX 3D0QA 4NDAA 2XMRA 4EEKA 4UAUA 1YU6A 2BBTA 2FFHA 3LLUA 4R8KA 4RHXA 1OGJA 2F1KA 2M9MA 2O2XA 4Y2RA 2C8KA 2GKGA 4ZO7A 5A1JA 2IOQA 3ROQA 5AI8A 1DJOA 2C3OA 1E1KA 1LVHA 3PFIA 3NOVA 4KI0A 4YEDA 3E9CA 4IXNA 1XAJA 1WEKA 4ZAVA 1HY3A 4C2AA 421PA 1H2XA 1UZMA 1XEFA 2J4FA 3WB0A 1QTQA 1NXOA 3AFHA 4JC8A 4RORA 5E7IA 1RAHA 2RGNC 3L7AA 1KYZA 1E9EA 3NS7A 4HFRA 4B31A 5LQRA 3WIEA 3L5KA 4MUYA 5EZYF 1TA4A 1XQYA 3ETJA 3HL0A 1DTWA 4O4HA 1KZHA 2OZEA 2R00C 2NZ2A 4FIDA 2WDZA 5K3FA 2J1LA 2WQ6A 1CRPA 3CRZA 3IBYA 4BKRA 2HJWA 2ZUSA 3BWEA 1E9CA 4XLTA 4EHIA 2X6TA 1YMVA 3G82C 4K9NA 1G5RA 4UTVA 3C3CA 3C24A 4HRXA 5CDYA 2JJ2A 2PXAA 2VYQA 5GIPE 5EJMA 5IM4A 1FFBA 1KDRA 3DZGA 3AQ4A 3W04A 4FFNA 4R3NA 3L7LA 5JS2A 3H2HA 4CMBA 3SJBA 1GA4A 2UXCB 1H8EA 3PVZA 4ZGGA 2ZRMA 3ITDA 2M32A 3L4EA 3RC7A 3HH8A 4TVSA 1APBA 4E6EA 1RBYA 4G0PA 4ZTZB 5F7XA 2BKEA 1N2CA 2OXCA 5BN4B 1V2GA 3UWSA 3V8BA 3W6PA 4UZSA 1W5TA 1D03A 4U0JA 4QLOA 4ZKDA 1KAOA 5EMLA 2H4YA 3GUVA 1F0PA 3ZU6A 1EUCB 3WNCA 4B0PA 4YJ3F 4KRFA 1BE8A 1ONPA 4Y6SA 1Z63A 4A5SA 3JWEA 3NHLA 4NAUA 4NARA 4R98A 3WQRA 3GGJA 4O2BF 2BELA 3H2BA 3RHZA 4GI3A 4DR1B 3N8HA 1WVIA 4Q0MA 2ZIVB 1TYZA 3BOSA 1X9IA 3GDWA 3OQIA 4D0RA 2ACVA 3CS3A 4IHJF 5CA0A 2NQTA 2QENA 2QLNA 2ICAA 3EIFA 2BJWA 3GMIA 3SYLA 1N32B 2HR1A 1P4HA 2P4UA 3JD4A 5IZ4A 1JEOA 2BFBA 5B6JA 1VLJA 3EARA 1K3UB 4JITA 2O8BA 5T8KC 5E6SB 3TZQA 3IKJA 1RLTA 1P29A 4PONA 4OB6A 1E2PA 2YMMA 4H6WA 4DCPA 1SVSA 3STVA 2CJWA 2Z9CA 3JXEA 5I9LA 1QB8A 3CUKA 5FNZA 5CAEB 2WWFA 1SGWA 4LAFA 1KJNA 3NGXA 4AKIA 2LWIA 3QUAA 1Z22A 3E5MA 4I4LA 5IEJA 2L82A 1GWNA 1IJFA 2XDYA 4L8WB 1EXDA 2NWQA 3H1GA 3C3KA 1I01A 1VGQA 3FWYA 1JLSA 3GJRA 4X94A 2ZZMA 1VJGA 4OO3A 3T0GA 4QEZA 4YMWA 1XVIA 1IG3A 4PSVA 1R8QA 3RF6A 4DILA 4ECEA 2QTTA 1UAYA 4YRAA 1UK7A 3KETA 1P7CA 3C3YA 1N5DA 3MELA 4QOEA 5K4HA 2CLDX 8MHTA 2HLNA 1UJ2A 4RABA 2E4YA 1OROA 4AG3A 1IEXA 1UR5A 3HCOA 5BVGB 5JSFA 2BFWA 4KBFA 2FEWB 3OU7A 4MYUA 2I3ZA 2GWHA 5LM3A 3P45A 5TC4A 4LPSA 3D6NB 4FUQA 4XGQA 1X80A 2YWRA 1SQ5A 3EAGA 2KS6A 2JLBA 3LHDA 4UHCA 2Z2YA 4B7UA 1MEOA 3WMFA 2XLCA 1EA5A 4JNKA 5EGSA 3TD6A 3K20A 4ZANA 5C81A 2RGYA 4FJ2A 3KALA 4GKVA 5HZGA 2OHJA 5DM60 3LVQE 4H1TA 4ZN6A 3FBGA 1ZK1A 4NJMB 4HGNA 5KWSA 3SG0A 5KTPA 1S8FA 1P5JA 1ULAA 4RIIA 4RZXA 4FX5A 3H75A 4GLOA 1X39A 1PZGA 4DWOA 5LZ4A 1X1TA 1SG9A 1ZWKA 3GDHA 1D1TA 5I4IA 2DWQA 1FDUA 1UPXA 3I9V6 2C61A 3WHKA 4Q01A 3FOFC 3KG2A 2YASA 3LKBA 3R9IA 1XFAA 2IVFA 2PRJA 1Y3CE 4NHOA 4BX0A 1NBMA 1TQ4A 4YUZA 3CNNA 4MQBA 4MVXA 1NRJB 3RIGA 1R4NA 4FQ8A 5A9SA 4U7HA 2OYRA 1GQOA 3O7MA 4NOJA 5F5NA 4C3OB 4OMFG 1VKRA 2GHQA 4BO1A 2W6ID 4UCFA 1U63A 2XNKA 3SEFA 2JH9A 3U26A 1ZVVA 3VKHA 2KMLA 4PZDA 4R84A 4X90A 3OURA 1V7QA 3KQMA 4XAQA 5FPYA 4CL0A 2GM5A 4Q4CA 2PZMA 5JSYA 5JYDA 1BVYF 5AM1A 1O4WA 2ORED 3GLIA 3Q3IA 5F3DA 2A7XA 1YKSA 4GS5A 2YYSA 1QG4A 4NABA 4OUKX 3AL2A 4OMCA 4W6QA 4Y2VA 1E3LA 1LPBB 4IZHA 4ZZ2A 3UOGA 2C5LA 5WRFA 3T7KA 1FUEA 4FSDA 2FE1A 3BGIA 1WMAA 8GPBA 1R6AA 2VWGA 4M9CA 4M1KA 3OTIA 5IH3A 2NAFA 2WY2D 4D97A 3F71A 3BF7A 3I4LA 1VTKA 2QD5A 1RRKA 1JKXA 3PXEA 1QSGA 4GLLA 4LZJA 4PHTA 5TPWA 1JAIA 3WXBA 4Q9AA 3PTAA 5FL7A 2C4HA 2I29A 4J3JA 2RSLA 1W88B 2P8JA 4HB4A 1EHYA 1P9LA 2VYCA 4ZDJA 2IKSA 5JXHA 1CDZA 2E4ZA 1G6HA 4HH4A 3QLUC 5BVHB 4RK6A 4E5NA 5ILOA 1K8XB 3UMRA 3PYXA 2PEZA 1YACA 4E32A 1F0YA 5TMPA 3BFPA 4B44A 2WF7A 3LBAA 1QH1B 2AW3A 5BW5A 1I13A 1Y9JA 1TM2A 3R9XB 2C95A 2IS1A 4NJEA 3FPKA 2QDXA 4RH1A 5AM3A 1IATA 4N8DA 4BRWA 1KVTA 3DFUA 2ZE6A 2G77B 2VBFA 3KAJA 4P5EA 2MINA 1OXXK 2G09A 3MCTA 2QVCA 1JLLA 5CFZA 4H4EA 2WVHA 1FMLA 4TV9A 2H0RA 4JJFA 4OM7A 1FSFA 4AJ4A 3QSGA 4Y2TA 3VJMA 4URHA 5JSKA 1JA1A 4MW5A 1KFJB 4N5NA 2XT0A 5ED4A 2X42A 3ZVKA 4RTSA 1CE8B 1SCUB 2I3GA 4WN9B 1CUXA 4UHDA 3SC3A 3NZEA 5LBUA 2XWPA 1FB5A 4IUCS 3SU8A 2MMCA 1QK5A 4GZMA 1VPEA 2XUFA 2ZBRA 3IMCA 3W2IA 4CF5A 1OJLA 3DFZA 1XLTA 5T5QA 1CUUA 3HYCA 3BQMB 4K6MA 3SZUA 5JMOA 4XDGA 3IE0A 4F4HA 3GI1A 2YCBA 3AVTA 4KO2S 3LQ2A 4RA9A 3D7LA 3G9ZA 3LW7A 2JD2A 1HLPA 3RT7A 2JFOA 5GMOA 4XGKA 3T9AA 4AF8A 2V5AA 4WXHA 4KCGA 3SQLA 2XYRA 1QBGA 3K09C 3WKBA 3IOEA 1D7OA 1RQ7A 3O92A 2HWYA 2B6HA 5FIUA 5I7HA 1NP7A 4QJ3A 4PLWA 1NNEA 4C04A 3V8MA 4PGMA 4OHPA 4JQOA 3C3PA 3IAXA 1NNI1 1FIUA 2GF2A 1H6CA 3WWDA 1U4OA 4EZEA 3FVTA 1DKQA 3VO2A 1E3IA 3FMFA 5E8JA 2JLUA 3C6BA 1XAGA 4N0PA 3I8OA 2ETVA 1FMJA 2YV3A 4X00A 1DTWB 3LOPA 2YNMC 4WX2B 2QKYA 4LHVA 5K3SA 1AKWA 2OQVA 1BQEA 3JYNA 4OJQA 2ZSDA 3RG8A 3RTCA 2Q9UA 4KI7A 3ZKWA 3L18A 3HNRA 5C32A 2V6FA 1Q0PA 4RGBA 1SZCA 2VAPA 3B20A 1JMKC 2G40A 5HBRA 2WD9A 3GU3A 4J7UA 2RKWA 5IHXA 2XTJA 1AZLA 2F59A 1QYRA 4RTKA 1IXZA 4BBAA 1L9XA 2X19A 3EXG1 4TKZA 1BE0A 3K8YA 4D41A 1F14A 4ZV4A 3TPCA 4JSYA 5G0WA 4U0KA 2N46A 3D8TA 4WZBB 1OT5A 4YJ2A 1SHLA 3ZDBA 3LA6A 3TE6A 2ZRNA 4XWTA 4DMMA 1C4WA 1KPIA 3K0FA 3I72A 1V11B 3QFHA 4QM7A 4IH1A 3U0VA 4LGCA 5B1EA 2WJAA 1Z0IA 2NVUB 4ZAFA 4C5AA 3ANXA 1A8SA 1KVUA 2ID7A 1GPUA 4C5BA 1A9YA 4CL2A 4DSAA 5B1SA 4P7GA 5BORA 3UMSA 3AG5A 2BFPA 4I50B 3F7OA 4FMDF 4HWRA 4QSHA 4A0FA 4BMZA 3K1ZA 3LFHA 1RYEA 2J9FA 2OWEA 2XBLA 3WB2A 4Z6KA 2ISSD 1Q50A 2IXGA 4JASB 2P7HA 3BDVA 3WZ2A 4F4CA 2P11A 3FVVA 3L05A 1DBIA 2XCUA 3HE3A 3LL7A 5EIHA 2DSTA 5BUCA 3IDAA 4YRZA 1E6WA 5LJLA 4FFSA 2R97A 3AM4A 1KDZA 1M6WA 3ANTA 2IIPA 4L28A 2F8SA 2NXCA 3KT3A 5CJJA 3IDSA 3R3XA 2I0FA 4GVXA 3RUIA 2JC3A 4QODA 1IXYA 4BQFA 5FPQA 4DAOA 1XNQB 3FBWA 1M1NB 5BV1A 1Z29A 4WBXC 4CIBA 1TYAE 1XQ6A 3W3ZB 4HO1X 2IGBA 1U8ZA 4OQMA 3GA0A 3KQTA 3W5JA 3RRBA 3C70A 4G25A 4ZZIA 2IPOA 3CH5A 3OF2A 3ZTTA 4B7ZA 2UKDA 4WMLA 2ZVJA 1R0LA 5AIAA 3HSKA 3W3AA 3OEYA 5HQJA 5IC6A 1WLYA 3V6MA 3O4FA 2KQUA 1VPWA 3JD1A 1D1SA 1U1EA 2P6RA 1B6GA 5DBHX 4HADA 2ZIXB 2VYVA 2ZU6A 1XPOA 2EX0A 3BTUA 4IOKA 3S3TA 3ZCSA 1QO9A 3I0NA 1Y5MA 4FOTA 1OXMA 2Z95A 3U61B 3TLAA 1FFXA 1H9AA 5COBA 4M60A 3CLKA 2JGMA 3SIXA 2QZSA 1RXCA 1F8UA 4Q7JB 2Y77A 3E23A 5GOTA 1CRWG 4YP6A 1TD1A 1FNMA 1DBSA 1ESNA 2R11A 2I80A 1DSSG 2VJMA 5FKJA 1YI0A 2WI8A 4URYR 4LHYA 2HA7A 2XYPA 2YJ4A 3ABQB 1SB8A 4IZOA 1NG9A 4EGJA 5J2UA 3LF1A 1WZUA 2PYDA 3GZ4A 4YRKA 5KSPA 1U94A 4UDXX 1GQQA 4B75A 3LLMA 3T3EA 3LYAA 4IGFA 1ZH6A 4RY2A 4KYTA 1G6OA 4CR6A 2F4NA 4B6SA 2BGKA 3LCMA 4X1IB 3DTNA 1R5JA 3R5JA 1JZQA 1XZAA 1X7YA 2Y8EA 4P4SB 2IEBA 4Q7LA 4BZQA 1I0ZA 3HYTA 4ZC1A 2Q7OE 4QGSA 3SYTA 1N5OX 3K6SA 3VU0A 1UBJS 4O6VA 1UWCA 1H93A 1ZC3A 5FXMA 2MTBA 4KSYA 1KBZA 2ZIFA 1IHYA 2BRUA 3BUSA 1R5NA 4RQUA 2IY9A 2Z3ZA 1JHZA 1XK7A 1I9GA 2AOUB 3WSVA 1EUQA 4WZZA 4A36A 3ONWA 1R64A 5ALPA 4CT5A 1X1BA 2CL7X 5KSWB 2YWBA 4TTSA 4DDHA 4GBED 4AQYB 3WLNA 2YINC 4NP6A 4ZT5A 2H29A 3FCCA 3RK0A 2V0CA 4OFWA 5CTAA 4AFNA 4BUJA 1RWXA 4ABTA 1E0DA 2JEOA 2ODAA 4GQIA 1OX4B 1V48A 1Y3BE 1O1YA 2C3MA 4NYJR 1NUHA 5GM2A 1Z07A 1UQRA 2AMLA 4K9QA 5KU7A 3NI2A 5AI4A 4GPZA 4OFXA 4R2MA 1AZTA 1QANA 3B8EA 3RVQA 3T95A 2O1WA 4BJHB 2WHEA 1BJRE 1AGNA 2LR0A 3D6HA 4ZARA 2DLCX 4FT4A 4UNPA 1TJ4A 1PR2A 3GYGA 1T34A 3KQPA 1D6SA 2NO5A 4ILEA 4QULA 3KDAA 1P2SA 4DMGA 3ZE0B 4XJTA 2ZTSA 3EIUA 4MEJA 2BMDA 3PR3A 5L3QB 3BE4A 3TSAA 4CTJA 1HT1E 1ZVJA 3C5HA 3BHIA 4BIMA 3GRVA 4RQTA 1AUVA 1VSBA 4MARA 4NOLA 1WUHS 5AKJA 3WGHA 1WJGA 2DPYA 1U2GC 3GJ0A 3RJ5A 1FSZA 5KKCA 1OYWA 4MHTA 2YOFA 3HFGA 3WYGA 4KO1S 3WYEA 4PICA 1DTSA 4IKPA 4YH1A 3I83A 1M0WA 4NF2A 2IU4A 4IV8A 4MW1A 1HE8B 3H0CA 1T0UA 1KA9H 3N1UA 4MR7B 4PIPA 2C1EA 3N9IA 5ESXA 5EP4A 5JZOA 4NYJQ 1OUMA 4D9GA 1IBCA 3B5JA 2RBGA 4JXJA 2BFOA 1T5SA 4O8ZA 1G8SA 1OXVA 4OAOA 3CH4B 1RI1A 1OZGA 4PVDA 4RH3A 2OD9A 1XCMA 1UUFA 2ZB7A 4EKNB 4HOYA 4KAAA 1STOA 3IOMA 1GUDA 4IFTA 3ZJUA 5JNWA 2JZOA 4Y2YA 3QMPA 2D2EA 2LPMA 2JI9A 2ZAIA 3PPWA 4YI5A 3EZNA 3GJZA 5FOVA 7MDHA 2ZRCA 3BD7A 3DONA 3LGXA 4D4LA 4YYZA 4S2EA 1IMJA 2BPOA 4X92A 4MW2A 4OU4A 3K9HA 2Y68A 2P4SA 4FI3C 1S7GA 1YDWA 4PSKA 4UEOA 5BYJA 4F4FA 1WDWB 1GEEA 4W99A 4MQ5A 2FEOA 4QXRA 3MJSA 1IY8A 2FH5B 1P2TA 2QAGA 2R9VA 4LTNA 1P1IA 5AHOA 1PQPA 1QQ5A 2F00A 4OOFA 4TS4A 4E5SA 1XDUA 4MZXA 1Z2EA 4BNXA 3L6RA 1ZGZA 4DZRA 3AH8A 3OSZA 1QFXA 1UXOA 3PHJA 3DMYA 4PE5B 4XWGA 4DHEA 4OLAA 1Q57A 4Y7CA 2V03A 4GI2A 4UHKA 2A86A 4FE4A 2ZPUA 4WXEA 1CHNA 5K7SA 1F9AA 1PQWA 5BR8B 1P1BA 4BKOA 3KL4A 3SIWA 3W2GA 4DPLA 3KU4A 1A9XB 5EJFA 1PS9A 4M0MA 3TJMA 3ERCA 4YMSA 2H1CA 3K72B 1EAMA 3S2FA 1P7VA 2XUGA 3KT6A 1U9CA 4BNLA 1JFSA 4LXXA 4YUWA 3GPCA 2PUGA 2B4QA 1PJLA 2ISQA 4K7JA 4B8WA 2ZWMA 4JVMA 1WY7A 1WQ3A 1C8VB 1E4EA 1OJ7A 2PAFA 3FHLA 3IA2A 1DVRA 3R3HA 5KAMA 1FZQA 1VCMA 4RY8A 5EPUA 3SXPA 3V2GA 2J45A 3R24A 4IIXA 5I51A 4PO3X 2XTNA 4H3SA 4II3A 1DXQA 4KFCA 5L8VA 4OATA 4EYEA 4MRNA 2N0SA 2QQ0A 1R4AA 4NZMA 3UXYA 3NB0A 4HAWA 2ZOSA 3G0DA 4OGLA 3HC7A 1N3LA 3TR6A 3UMCA 4QEDA 5JSUA 3PUHA 4HVTA 4J0EA 3VR3A 4BN4A 3FYHA 4E08A 4BFTA 2CZGA 3H13A 1Q1EA 1UC8A 1JEQB 2AIRA 4OY3A 4RL4A 4TWBA 4V02A 5IAGA 1EFUA 1P77A 1JU3A 2QSZA 4XYMA 1R4MA 4L9SA 4GOLD 3WDKA 3H5TA 1ATIA 2CNWD 5HKBA 3OTQA 1W0JD 2FZCA 2QRLA 5HQ3B 2QG4A 4ZV9A 3R7WA 3SNKA 1PLJA 4CU2A 2DQZA 5JD6A 2HK7A 2RH9B 3K73O 3S81A 2XCQA 3BC1A 3WKDA 4LBWA 1SU7A 1A4UA 3H5WA 1ZD5A 2VH5R 4LHEA 4IJKA 1W5SA 5FI1B 3VHQA 1U1DA 1ZBDA 2LD4A 3JAWA 4B6FA 2Q46A 4O4LB 4RENA 5GM1A 1QKIA 4Z3OA 4JJGA 2QRMA 5E6UA 4DT1B 2FPKA 4ND3A 2H2HA 4UD6A 1RVDA 1ZU4A 4NH0A 4I6EA 4U3JA 5HPYB 4J3NA 2I9PA 3T3DA 4KPYA 2IUSA 4LX0A 3QVVA 2I2DA 3EZGA 4RD6A 3D8BA 3UA3A 4EUHA 3U16A 1JYEA 1GAQA 1K7YA 1PR1A 1R88A 3NLLA 3B1FA 1ZIYA 2EERA 2ZEJA 1N2CE 1YKGA 2P6OA 4KDFA 4QGAA 2MSCB 3HWRA 5ILQA 4B09A 3EIHA 3PA6A 3PGMA 3ZCQA 4PX5A 5L4NA 2QZ9A 3DAYA 2CXXA 3N07A 5KHOC 1G64A 3LVFO 1ORWA 4EB8A 2VZEA 3MGCA 1Q7EA 3QUBA 4Q9IA 2FQWA 4OGKA 2VYNA 4U7WA 2WJ3A 1YB1A 2IU3A 3E7FA 2IWRA 2BGMA 3GIWA 2H8GA 2O19A 3A2NA 3GPIA 3IYLW 5BN1A 1YS2X 2EFJA 2R4UA 2WR8A 4KP7A 1HEYA 2VHXA 4TTTS 1JG2A 1F1JA 3IEIA 4OUDB 4CNQA 2CB9A 2AA3A 2A6PA 2O0KA 1KI7A 1T9BA 4JDPA 1KEEA 4KQMA 4NMXB 2OCGA 2FWMX 1I3KA 2WIKA 5BR4A 3SBOA 4KVAA 2ZYTX 1W4RA 3QW4B 5JYCA 3FUCA 4YB8A 3PUYA 2H1IA 1N2EA 3JRNA 4BV8A 5JYBA 4JXZA 4UVIA 3ANLA 1CIVA 2FPWA 4EJSC 4FEYA 1E7WA 2I3BA 3TBKA 1LWOA 1QGAA 1AUXA 2G07A 1EDOA 1JA0A 3PC4A 4HDQB 4UTNA 1PWHA 1PNVA 3VUEA 3W5CA 2UZ3A 2D5LA 3TLCA 3SVTA 4CLXA 2WNIA 3O6VA 4XB2A 3H9QA 3F73A 3FTFA 1VLMA 3G17A 3QG1A 1LBSA 4RX1A 3X2EA 1T0JB 2ZIZA 3IR5A 3PGA1 5LMCA 4A0SA 1E62A 1G63A 3QXHA 4E88A 4G4GA 5FNVB 4HSEA 3TVTA 4FFLA 1AKNA 5BPFA 2RHLA 9ATCA 1AQNA 3F1KA 1KSGA 2DTEA 2OQRA 1LZKA 1VMDA 2EATA 1JFFA 1TZCA 4QRDA 3R0JA 4UNNA 4ERXA 13PKA 1RPNA 1GOTA 4D4GA 1FTNA 3SX2A 5EIBC 1ZUHA 2VF8A 3HBFA 3HNOA 3MWDB 2XNSA 2J9XB 2QXYA 2BEVA 2C7GA 2FJ0A 1IBMB 4PGFA 1TYDE 1VSTA 1W30A 2K2QB 3TSZA 5BNTA 2GA8A 1PIWA 1S2NA 3D8HA 4DLLA 1LRJA 5JY1A 4KQCA 4FCTA 4Q19A 2V1UA 4L7VA 1OI4A 1TT5A 2ID4A 4BYMA 3ICOA 4KPGA 1IOZA 2COUA 4IEFB 4B9AA 3BM5A 1NSFA 1PT5A 2E4XA 4CKEB 4DWVA 4C4PA 3GT4A 4BWYA 4EEZA 1E96A 2H2AA 3W5UA 1O2DA 4RVNA 3RC3A 4LCJA 3ZV6A 2PWPA 3H8JA 4F5WA 1C1XA 3LKVA 4CM1A 1CJMA 2H4ZA 1IWPB 3EZ7A 3ST7A 4JFAA 5ES4B 1XNRB 1CKEA 2GUWA 3TOZA 4RVDA 2QG9A 4ND4A 4P5DA 4LIPD 4XM1A 1BN7A 3ICPA 3VX4A 1FDSA 3VISA 1LDYA 2CL6X 3BQNB 1EX1A 3V48A 2VDRB 3NAZA 3OE4A 1OIVA 2KLBA 2W6QA 1DO8A 1SQ6A 2WP8J 3BJIC 4XIIA 5EN4A 5IF9A 2C7RA 3NBKA 2XADA 5HWSA 1VDMA 5KJCA 3DP9A 4DV4B 1V9CA 4JLPA 4EIWA 3WLKX 1EFHA 3QFTA 3NG1A 4P31A 3OCZA 3WP0A 2WJ6A 4ARBA 2M6RA 1T35A 1DPGA 1Q14A 1JBEA 1VE7A 3O38A 1O0BA 3GP5A 3KPVA 3DZJA 3OJFA 1M8FA 4IP0A 5DNVA 5LC1A 3FDZB 2KM1A 2GCGA 1DLIA 3ETLA 3I2JA 1IEWA 5AK0A 2G0AA 1N3YA 1E1QD 2Q8QA 1I7PA 2G70A 2XSZA 3KDSE 2WWIA 1Z2PX 4HATA 1PJ4A 3QI7A 3MCUA 4KVZA 1I14A 3I2HA 4I4TB 1EFAA 3P0HA 4NU0A 1GU7A 2AF3C 1FVOA 4RKQA 3TI9A 2C5SA 1G17A 3BREA 4WBSA 3MOGA 4UTRA 4M0DA 4KB5A 2Q5OA 2X9QA 3K0AA 1KEWA 5JS6A 2JGIA 1B2LA 2HIAA 2RAUA 1ZSVA 1RRPA 2PZBA 2VNJA 3IFSA 3DCIA 4Z1OA 5BV7A 4G23A 5M2QA 2BFDA 4PPGA 4KPUA 4R54A 4DXHA 1KJJA 1A2KC 1Y1RA 2XE8A 1JJ7A 1E0AA 2ZAMA 3H86A 2PX2A 2HBZA 2UZ1B 1VYTA 3LBNA 3R4CA 4ZQGA 1TUGA 1Y5RA 1A2BA 3H8WA 3PPXA 4L4ZA 1ZRSA 4S1WA 5FA5A 3RHFA 4O1IA 5IT9A 3EA0A 1K5DA 4PPFA 2CXNA 4UVHA 1HMPA 3TDMA 2OY0A 3TINA 3KSBC 1FSGA 2UZIR 3MRTA 5KYGA 3JTMA 1E3SA 2R5WA 1NF3A 2GJ8A 5AFSA 2ZYWX 3U4QB 4Y1GA 3TW4A 1R0XA 2XA9A 2ZUUA 5H4HA 3PQ5A 1U99A 3KYDA 4FT2A 4KE7A 4KK4A 2JGLA 3G7UA 4LWZA 4Z99A 3VZPA 1L8QA 4LN1A 1QIFA 4BZZA 4CEJB 2TMDA 1NE7A 1XKQA 4WFJA 5J4HA 2GHIA 4PBRA 1W34A 2FZEA 4FR2A 4ZU6X 1HL7A 1GZDA 2AE2A 4KITB 1WEHA 1NYRA 4DL9A 5JECA 1P81A 4PQFA 4U5XA 4C01A 4C6RA 1VECA 2HEIA 5E9JA 3KC2A 4LMPA 4O1MA 1I2MA 2PJDA 5IAEA 1DXHA 3P2JA 3G7SA 4O4JA 3PUVA 5FTLA 1UK8A 3KVNA 5L6LB 1U28C 4A15A 1O0CA 1MDFA 3PDUA 4G01B 3PQ2A 5HMLA 1CS0B 4RFVA 1W9HA 3DDSA 1DX9A 1OLUA 3IT2A 1MH9A 1U8FO 2D1RA 1P0IA 1VL1A 3DDCA 4WESA 1VP3A 3K9FC 3WNZA 4DJ5X 1UL1X 3Q10A 4H7FA 4J0HA 4O2BA 2FOXA 5C7YA 1P75A 2HHCA 1UJCA 4PPYA 1P0PA 2ZBUA 1VFNA 2RHTA 1CR1A 2RHJA 3ZE1B 4ASUA 1QQTA 1RQLA 2HMWA 2J30A 2XV1A 3CR3C 2P40A 3SM9A 4XX0A 1PNTA 1MF7A 2FN3A 3SS8A 1IMOA 3N3AC 2QVYX 3E9ZA 3OX4A 3ILYA 2KX7A 3BSSA 4QGGA 1NZJA 2WG2A 5AMXA 1KDYA 3RD5A 5BW8A 3FZGA 4J1QA 1YDEA 1ZK3A 4JBHA 3EX7C 5JAIA 5YASA 3D3WB 1E20A 3LLCA 3Q12A 5BV8A 4XWAA 1WDKA 3I2YX 5EKSA 3TSYA 4F7WA 1KRHA 4OX9Y 4EHJA 4AMZA 4UUOA 2J9GA 1W8DA 3SIPA 4Y7DA 2EC5A 1XCPA 5IN4A 4Q1AA 1F1BA 2JK0A 3MWJA 5CIYA 2J9FB 4U7TB 3U7GA 1MIOB 3N2KB 4UVDA 2HHJA 4MQEA 4OMDA 2LKDA 3VVLA 5JPDA 2W22A 3X44A 3LZ6A 1OWNA 1XT6A 3MJRA 4QO8A 1YBFA 2BP7B 3FTDA 3S5JA 1A2OA 1KORA 3B2EA 3V7YA 4UTPA 3FTEA 4BNUA 2MSWA 4E5KA 4EOGA 3TNLA 4LSZA 2NADA 4B7XA 4NS1A 2XB8A 1SXIA 4BB9A 2E1RA 1CLEA 2QTFA 1V0JA 5C5CA 4X7MA 2ZJ8A 5AM4A 3SC2A 4YUXA 3PDJA 1QF6A 4LF9B 4ND8B 4YGXB 6YASA 4E2WA 4GMKA 2OBNA 3Q11A 4JH0A 3IC5A 2IZ5A 4BKUA 2G04A 2WUVA 4C3VA 3BMXA 1BFUA 2X7JA 1F60A 2XZDA 3K9NA 3QPCA 3THYA 1JJVA 3WGMA 3D9QX 4FB4A 3D5EA 1NXWA 3CU5A 1VGVA 1NQAO 2BP7A 3MD9A 2HH9A 2OZVA 4IDBA 2G6TA 3DZKA 4LOKA 4YP1A 4F6RA 2E4UA 4H15A 4TMTA 3RS0A 4O63O 1EB8A 2BDUA 2VI5A 3NFRA 5DO9A 3RUAA 4YYEA 3BWXA 3VZRA 1XEXA 4INPA 1JIIA 4Y2HA 4XRGA 2RK3A 2V7VA 2CNLA 3TS1A 1IBLB 4BNWA 5KWEA 3D4NA 5J9FA 4J0FA 2UVDA 2PRZA 3PJFA 3D7RA 3W77A 4IJMA 2ZM6B 3U60B 3FD8A 1GR1A 3NHWA 4CMKA 1NULA 1JILA 2AKEA 2P3SA 1ECJA 2EGUA 1WUKS 4X44A 5CPBA 4IUBS 4CFYA 3BICA 3WGIA 2ZAOA 4L3VA 4QELA 2HJHA 2AZDA 4AY3A 1A8PA 1GPAA 3K2IA 1CCWA 1WSDA 3NKLA 3QVOA 3GUZA 3DVAB 4GECA 1FU4A 2ZJ3A 2QY9A 4XD7D 4K2AA 3B7GA 3AHGA 4Q1FA 4UREA 4KXQA 5I7RA 1PJZA 1YFKA 2Y3IA 2RD2A 1CUHA 1D2CA 1LH0A 4EY8A 2GARA 2VO1A 4IVQA 1XOIA 4TWIA 4WY5A 3ECSA 1Z6GA 5KDLA 2BR5A 3OC6A 4QYXA 4F6LA 1EUYA 3VDMA 2X8LA 2ZYAA 3WL5A 2I2CA 3R3SA 1R0RE 3W8FA 5IAKA 1UBTS 1T3TA 2D54A 1IN7A 1Z4PX 5LMNB 4BE7B 3HCBA 1CS0A 4P3YA 4NPCA 4K0KB 3U7QB 2Y6UA 2LZ0A 3ZPXA 3EIEA 2Q9CA 4EG7A 5AXAA 4FGZA 2VVTA 1IFXA 2I5PO 4UD2A 1PKXA 2EJTA 1ONBA 3E3LA 5JWOA 1FYWA 1O97D 2QD3A 2Y1OA 3STHA 1RU3A 1Z6AA 2YFQA 3TG2A 2ZS7A 2FPPA 3KLNA 4R2KA 5DGXA 1U2RA 2VXBA 1SXPA 3P9PA 5C35A 1T8UA 1YQTA 3BMNA 1U0SY 4ZAWA 2F1OA 1T6BY 5F33A 3T4EA 3JQGB 1W5AA 2RBKA 4I8DA 4X54A 9MHTA 3ODGA 1XXLA 2ACEA 1KMHA 4G09A 4LCBA 1FP7A 3RVRA 3A32A 4TTAA 3ZYZA 1N36B 2NZJA 1QIEA 1U1CA 1J8VA 4B87A 1V5WA 4N7BA 1X8LA 1DEXA 1T10A 1OXKB 2IHKA 3DT8A 3EVAA 3ZIAD 1KZ9A 1YDHA 1Z6QA 3RAPR 3SJAA 3DZBA 1Q7TA 4BO9A 2B83A 4NG4A 4V3CA 1G9XA 1ZIXA 4WK0B 2CCJA 1T26A 3KOZA 2E87A 2FPOA 3TNYA 3YASA 4K81B 3ZBPA 1A4XA 1G3IA 1B6SA 3DBLA 2O2DA 1OQAA 2I6UA 3F4KA 4IZIA 4OH1A 5BOVA 3UB3A 4GUDA 3ADPA 4MV5A 4B5LA 5AUNB 5AVRA 4HNAA 2Q5HA 3JYLA 4J75A 4YDSA 1UOOA 5L6MB 2DRIA 3S55A 4C3ZA 2AR9A 4DG8A 1O8BA 1KH3A 3MD0A 3V8EA 3ZHBA 2YNMA 3E9RA 3GL9A 3SX4A 1QUFA 4BMYA 2PL5A 2BFCA 4K9OA 1PEAA 1SBIA 1DG1G 1T9GS 3VNRA 3ODPA 5AVTA 5LXTB 4M9SA 3JWJA 4IS2A 621PA 3U56A 3FCEA 4O2AB 4BVJA 5KYWA 2EHJA 2I03A 1BG6A 1ECFA 2FVYA 2VQ6A 3IP7A 3PQDA 5T4BA 4E11A 5F9FA 1I2BA 2G0NA 1ISHA 3P27A 1IIRA 3AVPA 2XGSA 1AV7A 4LQCA 4D6XA 4LX8A 5F5XA 2ZROA 1AN0A 1K6MA 2HCFA 2JAQA 1G8AA 1XG5A 2IPXA 4GPTA 4HNGA 2QRNA 2FMHA 3K09A 2JGNA 2P69A 1QR2A 3PPIA 2IEGA 2PAAA 1C9MA 2E48A 3LI2A 1KQOA 4H3VA 2A5GA 3E61A 5CH5A 5DHFA 3SC6A 3QLJA 4E94A 1WETA 3FOCA 3HEAA 2B1JA 3HCCA 3HKBB 1KU0A 5JOQA 4B40A 3AUAA 1PZEA 3MCAA 5CVVA 3I5YA 4GKKB 2I3AA 4EI8A 1JTEA 1R6BX 3WTBA 5AW0A 5F2OA 4BJ3A 3RADC 3MOIA 3IHTA 1DRWA 1Z45A 4FYPA 3C5VA 3NV7A 4W5HA 1Z6ZA 5DYNA 5HF6A 3K9WA 4I14A 4YDQA 3GUHA 4H1UA 5AK3A 3ONFA 2VHWA 2C2MA 4KNWA 3VMMA 4A0HA 4PLVA 2BF4A 3GUUA 3M4NA 2JA1A 4MJLA 4CQLB 3U0BA 3TLMA 1PQ4A 2H7VA 3LQQA 4ZTUB 3ZZMA 4TTRA 3DZ8A 3EG5A 4TOIA 3F9IA 3STTA 3UGKA 4V1CB 1D1PA 2QT0A 1EGHA 3GVHA 1OMOA 5A06A 3KTAB 5E9WA 4EARA 1QF9A 2QVZX 1I0LA 4WGGA 2AX3A 4RJKA 1XRQA 2OC9A 4TL7A 3H0EA 3GA5A 3CB4A 5KCMA 4AN0A 2NXJA 3DQZA 2BGRA 3N75A 5DBOA 4BE4A 1W44A 2HU8A 2BEKA 3K8ZA 3KIPA 3ZVMA 3MUFA 1TUBA 4UMVA 1OV4A 3QEBZ 4CMHA 4ZEOA 1W2WB 1GTVA 1QRTA 3HNPA 3PB3A 5I6DA 2AL7A 4KYUA 5TQ0A 1E2EA 1XQ1A 1SOWA 2B36A 4WK4B 2YWGA 1AURA 4Z7NB 3RFXA 4RHTA 1Y4AE 3ISTA 2DX7A 3B48A 4QD3A 3EXIB 2GXQA 1HYEA 1ABEA 5HS4A 1KQNA 3TRHA 5IJAA 4AP6A 4D99A 5GV7A 2BE7A 1JHMA 5KB3A 1BCRB 4I9FA 4GLFA 4IJ6A 1AQ6A 3IEPA 2ZRBA 3L1HA 1SJ9A 4ZPJA 4EK9A 3QU4A 4F5EA 3LY5A 4B0OA 3LLSA 1W0KD 2B8JA 2PZLA 2Z57A 3KHKA 1EP3B 4R2HA 5DGHA 5HRAA 5IMSA 3MT0A 2XNDD 2CL5A 3CNHA 4YIHA 2HJSA 2R7AA 4FYWA 2VCHA 2Q3DA 4YMVA 4C7OB 3MTDA 4UPVA 3DLCA 4X0EA 4EG0A 4RCYA 1C4XA 1T5BA 1D5WA 2Z5FA 3DZIA 2GCPA 2VSXA 3OQBA 5DYIA 4CCAA 3W4JA 5DI3A 5H8WA 3EXIA 1TCUA 3A4YA 2FW8A 1AE1A 1EAYA 2HDWA 2QIPA 2WD7A 2XW6A 3AR8A 2O8BB 4LJ6A 1EDBA 1KERA 4BKPA 3E22B 4Z51A 5JJKA 5LDHA 4RFSA 4Q24A 5K8LA 1HM5A 4G0WA 4JL6A 2A1TR 4H1HA 1TZMA 1NN1A 2H1VA 4R1NA 1LJLA 5EXPA 2P62A 1XZQA 4JEUA 1FFEA 1EFTA 3NUQA 5ALMA 2GRJA 5AXDA 4D9FA 3SYKA 1JGTA 2XXJA 5KSZA 2FMIA 1RI3A 2QN1A 2VG8A 4NE9A 3S8MA 5K51A 4RDIA 4KR7A 3BT7A 2BHSA 4OYLA 4S1TA 1Q7RA 2O23A 5HKAA 2XAUA 3EYWA 3QLVC 5JQWA 3FUUA 2GKOA 2ODPA 4E4YA 1EUCA 3WLJA 4Z54A 5ALNA 1R50A 1YRYE 2RB5A 3TLEA 1OI2A 4AWXA 1TKBA 3K2BA 1MC5A 3NHYA 1PJTA 4JYMA 2WIAA 3D6JA 1RXIA 3CIOA 1AH2A 1V25A 4C6SA 1TM7E 5K05A 3ZU5A 5EP2A 1ODLA 2VHYA 2XQKA 2OO3A 3T9EA 3RQSA 2P8SA 4Y0AA 1LNZA 3P20A 3FKSA 2SICE 1Y1KE 3H1FA 3L8GA 4QBKA 2YXNA 5B37A 3OF3A 3ZTWA 5BWLA 4L08A 1POWA 2WTEA 1LA2A 1UKAA 4G5YA 3QXSA 2R1VB 3KLBA 3TRJA 4GQBA 2BGWA 3AY7A 4GOOD 4YRCA 3PXAA 2HSDA 1UP6A 2A0YA 4ND1A 5A3QA 4RNCA 3OQOA 2XA1A 1E6KA 4KVFA 2EFCB 4LRWA 3Q72A 2M1ZA 3NTUA 5JHHB 2RKBA 4PV7A 2JI8A 4YLGA 4C30A 4K46A 4QHYA 1FW8A 1FS6A 1WMDA 4YP9A 4F56A 3TW6A 3D7SA 2UUCB 2HYIC 2A9OA 2PO5A 1IH8A 5ECGC 3IXLA 1KAQA 1CVIA 1KMNA 1TOAA 5D00A 3VR2D 4QU9A 1P31A 2EDAA 1JIQA 4ZI7A 1GPJA 5BW6B 3T94A 1JLHA 2SNIE 1ODTC 3PE6A 4NFYA 3PIRA 5AJWA 1Y6FA 4MS1B 4M1MA 2O2EA 4V0RA 2IYYA 1HFWA 2P3LA 3B52X 5KQLA 2ATCA 2QDKA 3O4IA 1AUPA 3PPVA 1UFQA 2D13A 2GVDC 4INAA 3K0CC 1SUIA 1M33A 2HIHA 3NKVA 4M1SA 4Q02A 5ISMA 3HU1A 3JWIA 5KOHB 4ZO4A 3CLUC 5FLYA 4EGSA 4DV2B 1BROA 2VSFA 4M1WA 3TQSA 5HXAA 2A9JA 4UCWA 5JVDB 3D8NA 3ZOKA 2YOHA 4Z4FA 4G67A 4LZZA 1EUDA 3KFXA 3FUTA 5AKEA 5HGJA 1K3FA 4HRVA 4NOMA 2QN2A 3VNSA 1EK5A 1E2BA 2JJMA 1BEEA 2XBUA 4JP1A 3LDUA 1NAHA 3DTYA 3MQ2A 4GZ3A 3UNXA 5FAXA 4ZAZA 3E15A 2DSNA 1WB4A 2JCYA 2J9YB 2N47A 3JX9A 3HJCA 2YL2A 4WY2A 1SCAA 5AW1A 1JEYA 2I6QA 2IYEA 3T54A 4D9CA 2P3OA 1KMQA 4R51A 2D5BA 2Q2WA 1GITA 1ZDMA 3A04A 2J3JA 1GR0A 3ZDQA 3WGUA 1QB7A 5HIKA 2CB0A 5HQTA 2XCIA 4R81A 2WSSA 1LW6E 1UJ4A 3EZXA 2QE7A 4ML3A 3OJLA 1ZJ6A 5T6MA 3V7UA 1JFRA 5CLQA 4QOGA 2VRBA 5U1PA 1E64A 1YA4A 2E4AA 1N9KA 3DMRA 1PR0A 3FTQA 4R7ZA 3T1NA 3TNFA 3E2IA 1H2EA 4F2PA 2WT9A 4POAA 3TCXB 5LU8A 1EINA 1XZGA 4DEYA 3IAEA 3DVAA 4K3VA 2D5IA 4GVPA 1WABA 4OKNA 3ABIA 3DTVA 4BECA 3FOZA 5FORA 4MV9A 3AZQA 2Q2OA 4QFDA 1LKZA 1M2VB 2R4TA 5KUTA 4QE3A 1GXSB 3AQIA 4LUCA 4HRAA 3CH6A 1VP9A 3X1DA 4G81A 4WNCA 4Z1MA 3D4OA 1JKJA 3ZHVA 2PL9A 3D1VA 4AAYA 2DP4E 2I67A 2QX8A 4ZZ3A 4LJRA 2H11A 3BIOA 1HTWA 1IHDA 5JVDF 3VZBA 1Z5WA 3AF6A 1SKYB 1R3DA 1Z73A 4QNNA 2Z58A 4BFZA 2I4IA 4N3AA 5JD3A 3DHYA 1E63A 4LDAA 2NU6A 2OB2A 4W82A 2O5RA 1XRLA 2NT3A 4Q3KA 4MYTA 1X8XA 1NQXA 1VCOA 1Z5ZA 2FX5A 2SCUA 2YUTA 1C1YA 4ZIRA 1M6NA 1LQUA 2CXPA 5KSYA 1I5RA 2OM2A 1K2VN 4YAKA 1FNSA 1CX9B 3JQBC 1ONNA 2XQGA 1K27A 1JTVA 1THTA 1YDMA 4EVSA 2AK3A 3B1WA 3J81A 1X94A 4HZUA 1FMFA 2YTZA 2DULA 1KMCA 4OBXA 2B20A 3WTCA 2PRIA 1MJNA 2HM7A 1AY0A 5A3SA 3VC2A 4CTNA 1NMQA 1ZW1A 2JARA 2NNWB 3F9RA 1SKUA 2DUJA 4DRXA 3U3DA 1CXZA 3D2AA 3OH8A 3LRXA 1NVVR 6REQB 2OG2A 3WLTA 3LL4A 1NW4A 1PF7E 3EEIA 4FN4A 3UXEA 2X15A 2HWUA 3BDIA 4IVRA 4PZAA 4MUKA 4RELA 4K2HA 4V38A 4XIGS 1X2BA 2LIPA 5GGYA 3BB4A 1FNDA 4OJKA 4PC3A 5BSHA 3LQ4A 2ZI9A 2YY6A 4PQGA 3O1IC 1H2FA 3GX1A 1X0VA 2YWFA 2YXDA 2ZRLA 1FS4A 4L8VA 4NU8X 4P1ZA 4D3ZA 1BX0A 4Q7QA 1YQQA 2QVXX 5TF0A 4GI5A 4BP8A 1CY4A 1RYNA 1TFRA 2VSQA 3RRXA 2DR0A 5JAUA 4B74A 3IMFA 5FT9A 4KE8A 4JBWA 4TYYA 1BJTA 1O03A 2R85A 4Q16A 3WYAA 1GGJA 1RWNA 4K9RA 4E0BA 5LXTF 2EWWA 3GCGA 2H59A 3O8OB 3SXUB 4D9BA 1T2CA 2DQKA 3DOCA 5C4GB 3U37A 3COPA 3BCUA 1G5HA 3LWNA 1K6XA 4CCYA 3LY8A 1ITZA 1ZH2A 4IFEA 4ARVA 4YPOA 4UUQA 1A50B 1VKHA 5GZ1A 2WM2A 3EBPA 4ITVA 3HKDA 2FVXA 4MIEA 4DIMA 3H11A 3G23A 4FFPA 2P79A 1RM3A 2OZLA 2PIDA 5LLTA 3OU6A 5CVUA 3NH9A 3OZXA 4LJ5A 3CNEA 3UFXB 3WK7A 1OFIA 1YZYA 3I64A 3TE7A 4DIBA 2FRVA 2W7TA 2ZJ2A 3IEVA 1VIMA 5F1PA 3K7EA 3SHOA 4A6PA 3CRRA 4DLWA 4LVNA 3IERA 4F4UA 3HDVA 3K32A 1K68A 1RPJA 2BMVA 1ZITA 4C0LA 3CVUA 4Z0NA 6LDHA 1K6JA 1IPFA 1DO2A 5CK4A 1DC3A 1QKKA 2EZTA 3C87A 3EVEA 3FCOA 3OI7A 2WD7B 4ZU1X 3M3DA 3AK4A 3ZHQA 5HKKD 2SBTA 1WRBA 3VC1A 4CUJA 4YT8A 3NOQA 4UUBA 2UYHA 2C77A 4W5RA 1MP0A 1P7PA 4MV6A 4W9NC 5JTTA 3E4DA 5L7TA 2UYOA 4MQFA 1T5DX 2FF5A 3PF8A 4IDEA 1XAIA 5DTQA 1USKA 5MFZA 2BYTA 4DWJA 2G1KA 1GZVA 1GL3A 1XF1A 2BKXA 1Q7GA 3BDAA 3PGVA 4HMOA 3MA0A 3VR4D 3E81A 1L7PA 3A3PA 4DS3A 2QGZA 3QUQA 3KPJA 5DHPA 3A9WA