5IAOA

Structure and mapping of spontaneous mutational sites of pyrr from mycobacterium tuberculosis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
171
Chain Sequence
ESRELMSAADVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDSTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional protein PyrR
publication title Structure and mapping of spontaneous mutational sites of PyrR from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25177 / h37ra)
molecule tags Transferase
total genus 50
structure length 171
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iaoA00
1ZN8A 4P86A 1QK4A 2C4KA 1I13A 2H08A 2DY0A 2WNSA 4JLSA 1U9ZA 4RANA 3ACCA 3S5JA 1BD3A 1A95A 1VCHA 1WD5A 4PAWA 1NONA 2PS1A 1P4AA 3DEZA 4FYMA 4P81A 1I14A 2PRYA 4RHXA 4LZNA 1LH0A 1P19A 1ECGA 1Y0BA 1G2QA 4P83A 1D6NA 4RQBA 1DKUA 5K51A 1UPFA 4RAOA 3GGJA 3OZFA 4WN3A 1R3UA 5BQPA 1P18A 1O57A 2XBUA 1QB7A 1Z7GA 4S2UA 5ESXA 3N2LA 1O5OA 1I5EA 5HIAA 2IGBA 1UPUA 1V9SA 1P17A 2PRZA 1A97A 1TC2A 3O7MA 4RHYA 4KN6A 1VSTA 1QB8A 4RAQA 1STOA 1PZMA 4X44A 1TC1A 4OHCA 1A98A 5BQOA 1I0LA 1L1RA 2JBHA 3GGCA 1I0IA 2GEBA 1G9SA 1QCDA 3LPNA 3ACDA 3DAHA 4JITA 3HVUA 1XZNA 4RQAA 2JKYA 4M0UA 1A3CA 1ECJA 4LYGA 4P80A 4F8EA 1ZN7A 1BD4A 4P82A 1QK3A 1XTTA 3GEPA 1CJBA 3OZGA 1G2PA 1QCCA 4RADA 4RHTA 5KAMA 1OROA 1W30A 2FXVA 4P3KA 4P84A 5IAOA 5JSQA 4IJQA 1G9TA 1XZ8A 1MZVA 1FSGA 1HMPA 2HCRA 2VFAA 1JLSA 3NAGA 1BZYA 2E55A 3MBIA 2AEEA 1ECBA 3KB8A 2YZKA 5E38A 3LRTA 2JKZA 1A4XA 1DBRA 5KAPA 3DMPA 4Z1OA 3H83A 1OREA 1J7JA 1IBSA 5IPFA 4QRIA 3EFHA 4M0PA 5HKLA 2P1ZA 4TWBA 1DQNA 5ESWA 4LYYA 1UFRA 4RHUA 4WMLA 1DKRA 5BSKA 3MJDA 3QW4B 1AO0A 1QK5A 1U9YA 3M3HA 3ACBA 4LZAA 1XTVA 4PFQA 4RV4A 4QYIB 1XTUA 1HGXA 1GPH1 5EUCA 1L1QA 2H07A 4X45A 1NULA 4LZOA 5BRNA 2EHJA 4ZFNA 4MB6A 3G6WA 1GRVA 1JLRA 1ECFA 2H06A 2JI4A 1ECCA 1VDMA 1ZN9A 5JV5A 3OHPA 4RACA 1A96A 1DQPA 4M0KA 4RABA 1OPRA 4QYIA 1YFZA
chains in the Genus database with same CATH superfamily
1HNZB 1TEVA 3O74A 4QM6A 2W2PA 3HNPA 2GARA 2WDPA 3K2QA 4CV1A 2ZDGA 3WADA 2JHGA 1JIIA 2OHGA 3H4IA 5FWYB 3VHRA 1QWSA 4X8MA 1GV0A 4CXMA 1G8SA 3BEDA 3OWXA 7ADHA 3HK2A 3DCJA 3IP7A 3DWFA 3W6PA 4WCFB 5M34A 2Q0XA 3AESA 4FCTA 4PG8A 5A4MS 5LNK6 2COUA 5HKOA 1QO9A 1LZKA 1T25A 4MVJA 4TQGA 3H6GA 4NDAA 2VUSA 2GJSA 1KVQA 2FF5A 4P83A 4RS3A 1Z5VA 4ARAA 2EQAA 2FKNA 2QVBA 3JQEA 1SUAA 4ZYZA 1HNWB 3V2HA 3ROZA 3KSDO 5LVAA 4DIEA 3HSKA 4UDXX 1NBHA 2GKOA 3DLTA 1ZRHA 2AOXA 2OQRA 1L4YA 3R3WA 4K7JA 3TBKA 3SIWA 4R2MA 2VJBA 3BHMA 3DP9A 4ZZ3A 1IXSB 2D0IA 1LLQA 1ZD8A 2C54A 2X5OA 4ZAFA 3S1LA 1QB7A 4NESA 3EQ2A 1CPYA 4HZIA 4C4AA 4LTDA 1CY8A 3BBPA 1VM6A 4FS8A 5DNDA 4BE9A 3QXJA 2VJNA 1Z4NA 5LC1A 4LEIA 3V34A 2Z6AA 2WYVA 4GPTA 2C8LA 4E5VA 3RJ5A 5LYJF 2C1EA 3FDJA 1TC1A 3ZQ6A 4E94A 4IIHA 5DT9A 4IV8A 4A0SA 1L8LA 5SYMA 4R1PA 1ZK4A 2LWIA 4RV9A 4KSBA 3GLIB 4IIFA 5EIOA 4L6AA 1FQWA 4RNDB 5CMLA 4GR4A 3OC6A 2OBNA 2ZI7A 3B3JA 4FBLA 4QEZA 3U49A 5B4TA 1P0QA 3OH8A 2BGNA 2D1QA 1IUOA 3HB0A 5BYAA 4YY3B 3ZNPA 3AKCA 1GPKA 1G2PA 4MW0A 5E4TA 1OI4A 4IRMA 3L46A 4I4NA 2BF7A 1WABA 4UPDA 1FDUA 3E6AA 4KLRA 2J0UA 4X66B 1M6YA 4KK4A 4X6UA 3R9XA 1DIGA 2IHYA 4M7RA 1K92A 2J7PA 4IPTA 1TRHA 3TRHA 3OQPA 4ZCPA 5D7BA 2CK3D 3G02A 2DHCA 3VSAA 5B4VA 5FD8A 1NF8A 5A7HA 2IXAA 1N1DA 1RFLA 2GNAA 2NZXA 3FPFA 3U1VA 3W5CA 2O8BA 3VFDA 4FT4A 2ZVPX 3DMPA 2FI1A 1D5WA 4PPGA 3UOAB 1S3IA 2QTRA 2WWIA 5LDGA 2AN5A 3CZPA 1PSWA 3RAJA 4ETWA 1N6RA 5BSVA 5BXQC 2JJMA 3CH7A 3JQRA 3L6EA 1HURA 2R86A 1EFUA 1Y8QB 2ORED 4Q47A 5JFGA 3AB8A 4JASB 2CSXA 3L6CA 1F5NA 4GYKA 4EB0A 2DPMA 3FOAA 2EYUA 2FPPA 3NBKA 3PX2A 4PGGA 4WVLA 5EIEA 3S8EA 4AJ2A 1OLUB 2WWWA 4H2DA 1GPH1 1OAOA 3ZV3A 3FDFA 3KOWA 1RKQA 3QPUA 5ARBA 1PR9A 4O2BB 4QYXA 2AG6A 4OJYA 3VR1A 4RPKA 4OQMA 3KKPA 4M1KA 1OTXA 4KUHA 3ZLUA 3K0EA 3OFND 5GOZA 5B1DA 3B12A 1GVHA 1HORA 4H27A 3CVVA 2CLHB 2VLBA 3QVGB 2E89A 3DHYA 1CYEA 4A6XA 2JAWA 6ADHA 2NO0A 1H4SA 4DLSA 1R8YA 4U2GA 4JT4A 2P40A 3VR6A 3WJ1A 3RRBA 3U31A 4YXWA 5K8TA 2E4XA 1NM5A 3P9IA 5JE8A 5A5DA 4CF3A 1D1PA 4O4HB 3CZRA 4TWAA 1VJ5A 1G5QA 2FZCA 2VP0A 4FSHA 5B2EA 1TLLA 2HIAA 2XEXA 3HB7A 5AH0A 2FR1A 1LPMA 2ZJ6A 3G8AA 2J9FA 3WA6A 2OESA 3EDMA 2RCYA 1NR1A 2OB2A 2FEPA 2X0RA 3SS8A 4F6LA 5AFSA 2X8LA 3MLBA 3AR4A 3V7WA 5LMZA 1MOZA 4LE0A 2XKKA 4JQSA 5AMXA 4R8VA 3ZZUA 3GVXA 1YHYA 1UBOS 3H4TA 2WAAA 4L8WB 4ZRMA 1U2DC 1WS6A 2Q2WA 1WD7A 4X7MA 1YL7A 2VUIB 4P9NA 5FRDA 1RCUA 3WBBA 5KYYB 1DC6A 4MLDA 4TTRA 2H2FA 2VN8A 4QPDA 1HO3A 4AU1A 2H57A 3H13A 3KZKA 2LBPA 2PKEA 1C9YA 1SU8A 2GO7A 3I6MA 3MB5A 2OB1A 2QL5A 1KL7A 3NM5A 3WLHA 3GRZA 3ABQB 1G8PA 1AHHA 2B0JA 5CX4A 2JFGA 5GM1A 2H48A 2R84A 3H9JA 4ZWNA 3ZIDA 3OZ7A 3OMWA 2UZAA 1WHTB 2GPNA 2Q0SA 1SXJA 3SSNA 2XNHA 2Z1NA 3WBFA 3CO5A 3EMKA 3EPKA 3B60A 2QBYA 4QPZA 3B2NA 5KNCA 3MTDA 4D8XA 3HH8A 2HWWA 1QHHB 3EZNA 3RFUA 4P08A 1OH5A 1IY1A 5CAEA 4LRQA 4Z9YA 4EMSA 3QKSB 3HTXA 3QWIA 1GZ6A 1GKLA 1T9CA 4MZXA 5AK0A 4CBVA 1TKRA 4JLDA 1XMJA 4IDOA 1KDVA 1LLDA 4JC4A 3LGXA 3KLBA 2SCUA 2GEUA 4F4IA 3QYFA 5LB4A 1NVAA 5DHSA 1E6WA 4G0OA 4N40A 1C7QA 1ZCBA 2H7VA 2OFXA 5FL7A 3X1KA 4HS9A 1N2XA 2NMVA 2JIDA 2CV1A 4IIJB 1QONA 5IMBA 2V7TA 1NMZA 3R8FA 1I6KA 4PQYA 1GG2A 1MQAA 3CXUA 3T1QA 1CNEA 3GNTA 4QPJC 2ZJYA 4C89A 1JA1A 2D8MA 2V9PA 1FJXA 4PCUA 1Z6XA 3CLVA 2J7KA 1N5DA 1Y8CA 2WKPA 3NWBA 3CLHA 3FA2A 3BMXA 3CLRD 3WGVA 4OLJA 4BWFB 5LQCA 4Q7MB 3E5MA 5BT8A 5ITWA 3Q3GE 1TF7A 3R24A 3WE7A 5BVGB 2B94A 2PSEA 4NC9A 2CF5A 5AHXA 4ZARA 3ROQA 4XYEA 2HY7A 1E2BA 4PFJA 3DJFA 3IVRA 4YCCA 4FLEA 4BP1A 4L4XA 3K16A 4YO8A 3D6UA 2FFAA 3K2IA 3O8NA 2ECQA 2O7SA 1JSCA 4KI0A 4YJFB 1P9RA 1U1IA 2GTPA 4E22A 1YJBA 1G2IA 1WKBA 3K5HA 3SQXA 4ZGWA 5JRZA 4KR6A 4Q66C 3NG1A 1XHEA 4YRDA 4JQCA 4HRXA 4NYMR 4RACA 1F3OA 5CT4A 1CJUC 2F4NA 2VHVA 3F9IA 4JUAA 4YGXB 5TVGA 1D0IA 3PGVA 2PWYA 3M1YA 3L7JA 5AVVA 1R3DA 3VO8A 1S1CA 2XUGA 5TNXA 5COBA 1XFAA 4OSEA 3R7DA 2Y66A 3W1EA 4F2WA 1MV8A 3TLCA 2QRJA 1EESA 5JD5A 4BC1A 3RGWS 1QE5A 2MYPA 1GZSA 2XD4A 4F84A 3LKZA 1T2CA 5AVUA 1CUHA 3H3XA 2XKAA 3RASA 4FOPA 3LWNA 2AX4A 1N0IA 3AHJA 4EK9A 1U02A 1Z74A 2D1FA 1ILWA 3EA5A 2QR5A 3ADKA 2Q5IA 4ZJPA 1IHDA 2ANCA 2VAPA 3H8VA 3MLEA 1GTSA 3DC7A 4WY5A 2ZIZA 1YB6A 4C4SA 1XNHA 1XZLA 3KIPA 3KJGA 2F48A 1UPFA 1V71A 1CUYA 3ZE2B 3M7IA 4HN2A 1CP3A 2RC5A 3T52A 3L0SA 1Z88A 2RIRA 2RH5A 2RB5A 1ZOSA 3Q10A 3WWPA 1GNVA 1A7UA 1D09A 2BEVB 2FR0A 3LPMA 1RD4A 3PIIA 1OSNA 1XJ5A 4OXXA 1C7EA 3PQFA 3X1XA 1XRSB 4W5OA 3C5VA 3ZHZA 1HY3A 4UBKA 1V9SA 4OSOA 3SYKA 2I9KA 5AJYA 3HSYA 4RAQA 1PJ3A 2VPWA 2H29A 2NG1A 2X8JA 3Q7QA 2ZETA 3VZQA 3S2UA 1PN3A 3I9NA 3SZMA 3DVAA 3HKDA 4C0LA 1NMSA 3MLAA 2WMOB 4IH1A 3WMRA 3LDUA 4MULA 1RZRD 3PJDA 3TIVA 1PR0A 3TQHA 1QBGA 1TA0A 3T34A 3N7UA 3U4QB 3RTBA 1KEKA 5LJIA 2YIMA 2O5EA 5CDUA 1S4QA 4ZCQA 3TTVA 5ECGC 3L6OO 5EMMA 2OZLB 4E09A 1XKTA 1V1RA 2ADFA 3V4VB 2Q5FA 2CDRA 4PTYA 1M34A 2Y1LA 4TRMA 3T7CA 4MGKR 1G3QA 4MI1A 3ZU4A 3A1TA 4Q1BA 1AY0A 1DADA 1VRWA 2EIXA 2OGWA 1JECA 1Y1RA 2FTKE 2J30A 2WLTA 3M5DA 4MUIA 3W8NA 3UENA 4GQIA 1Y9AA 1UBRS 2QNIA 4JZYA 1CQJA 5DLYA 4A2WA 4JI8B 5G40A 1WVGA 4MKGA 4JBIA 1FFHA 2C2WA 3TG2A 4LHSA 4BX2A 1YJCA 4L07A 4MVJI 4YJDA 4EW6A 4F2PA 3QUSA 1KI7A 4NMMA 4BN0A 1MJNA 3OQJA 4FN4A 4OQLA 4UW9A 2H1LA 2E48A 5A9TA 4RD3A 4IQ8A 5KX5A 4J8PA 5JAZA 4XUDA 2I4MA 3RJZA 1JX6A 4LE2A 2WJYA 3VU0A 2IBTA 1Z7BA 2DECA 2FETA 4M9UA 5KYWB 3A4LA 2G5TA 1DOZA 5KOHB 4YGYA 1LDEA 3VO9A 2BKEA 1U0FA 2HHLA 2IUSA 3H11A 3CURA 4RIEA 5C3UA 4KXFB 3SXUB 4CM8A 4D4GA 3RVSA 2GN9A 2B25A 1U3UA 3QBVA 5FLXA 3LX4A 2WUFA 2FP3A 5GZ6A 4E5NA 1L5WA 2WU3A 3GQVA 4IOMA 4WDQA 1QH0A 1E32A 2VXYA 2HU2A 3PXBA 4EPRA 5C5DA 5GVSA 2VWHA 1M8PA 1P0FA 3K5IA 3I62A 1Z5WA 2P2LA 2XADA 2VJDA 2XVAA 3GVHA 4POOA 3MD9A 3WB9A 5FFNA 3DLBA 1GCUA 2Z3VA 4AJIA 4GR5A 2HPHA 4WPGA 5IXSA 1L0BA 1PK7A 3E0XA 2G4VA 4Q39A 4QOFA 4XGNA 2CHQA 1M1YB 1R9MA 2B1GA 3A1DA 4JL5A 3U7QA 7ABPA 3OJLA 2VATA 4AROA 3KEMA 4C20A 3ZZMA 1Z06A 1ADYA 2JL1A 4YBZA 2QY6A 1RPJA 4MVJE 1ZO8A 1OLSA 4KXXA 4RNCA 5BY2A 3VUFA 3RKUA 1J1ZA 2AFIB 1JEQB 5F3RA 1IBLB 1RKVA 4UNSA 1EQAA 3EEIA 5TQ2B 3CBQA 2NXEA 1X9HA 2CK3A 3KPVA 1CC1S 1EVQA 3N0XA 4CQLA 5ICCA 2LCIA 3D8UA 4RKYA 4UREA 3Q3IA 1KH1A 2GVDC 4ES6A 4V0MA 2QTCA 3OT5A 2YZNA 2W8BB 1KYVA 1H9BA 3ZLTA 4HD8A 2POQX 3UV6A 1MOPA 1K1EA 1M1ZA 1PS0A 1QPGA 1BCRB 1CRZA 1TFUA 2C2OA 2ZOSA 3STXA 4BNDB 4TMVA 4YN3A 1QGUB 3JSAA 1X1RA 4GBMA 4KUGA 5DNYB 2YDYA 3OTHA 3QSGA 2AD1A 4XIJA 2DAPA 3QU7A 2CKMA 4R9NA 3U17A 2GETA 4QUHA 4B2YA 4J0GA 1Z8NA 4J0EA 1Z6PA 2X42A 2C5SA 3MQFA 4TTVA 1QZUA 5J2UB 1NF9A 5AVWA 1N2JA 3PVZA 5B7NA 1XJCA 2DR0A 2G5GX 1DXYA 2QG4A 2NYAA 4TPKA 1RJFA 4CKXA 4MW2A 2AQIA 3K1AA 3V97A 4W7IA 2H7CA 3WKAA 1XVLA 4P34A 3OFNA 1W0JA 4CLOA 4NBKA 3QF4A 4KVFA 4ARSA 2FN7A 3URMA 1EDBA 2G4LA 5HP4A 4DQVA 1ND6A 3QBEA 4ON9A 3WHKA 1FBNA 1C1DB 3Q7RA 3K0AB 4IR7A 1JPNA 1TO1E 1UXJA 5AW9A 1HBJA 2IUTA 4XB6B 4EG6A 1NHGA 5H4GA 5K8UA 1FP4B 4CLRA 1RHKA 1SEVA 4AQYB 2EJUA 4EH1A 4PRYA 1JG2A 3IS3A 2NP6A 3IBTA 1W85B 4O4HF 1QIFA 5H70A 3IQIX 1KEVA 1TTHA 1T4CB 2VF8A 3DMDA 3RSZA 4OO3A 3QVLA 1OFVA 2R6AA 2C4MA 4LV6A 4I8XA 1BS1A 3CA8A 1F38A 1B8PA 1DXOA 3N1UA 4D9MA 4CKWA 2VH1A 4M99A 4KYTA 5HCNA 2ZS7A 1R0CA 2QXUA 4AQDA 1DTWA 3ILXA 1UXOA 4KQEA 1CR4A 1RQLA 2CD9A 4IG4A 5D7NA 1O6ZA 1G21B 2P3SA 3ZWAA 3ICWA 4OGKA 1U1EA 3AEUA 3MELA 5KOJB 3R41A 4XVQA 4ALMA 3EUFA 3DDZX 4JR0A 3D2AA 4BGVA 3ISVA 4B40A 4ZIRB 4HNUA 4GXRA 4EB6A 2AD5A 4BWVA 2IH2A 4FKZA 4Y2HA 4ER7A 4XA8A 4B3SB 2XW6A 3T5PA 4DGQA 2GHQA 2XTJA 1RXEA 1RXSA 3QBTA 4B3XA 1TMYA 2J6IA 4Q4JB 1EZZA 4I4LA 1Z29A 1FOEB 3HO8A 5EJFA 3VPHA 1ZGAA 2JIQA 5DT2A 3Q0EA 1Z73A 4GFDA 3EARA 4CJXA 5AI9A 3SM3A 1PG2A 4GT1A 1RKUA 4EPXA 1B8VA 3E3MA 1CCWA 1LQ2A 1E1LA 3BB4A 1YBAA 3DZFA 3IEVA 1O97C 3QMVA 4BPBA 1WCYA 2OV8A 4R2XA 5ILOA 4G8CA 2R25B 1R4MB 1V6CA 3U3ZA 4WVFA 4W9MC 1D6NA 1Z0FA 1M7BA 2PNFA 4FR2A 4IZ6A 3TX2A 3ZE6A 4DCCA 3UANA 3BKWA 3D8RA 1W36D 1LPNA 1KMQA 1VJ1A 3P96A 5C8XA 1JEJA 1QQ6A 4R1NA 4IZIA 4IIJF 3HUFA 3PRKE 4ZV4A 4GMGA 5JZMA 4DSOA 1PFWA 2QRVA 4A6EA 1H6BA 3L18A 4XYBA 1UQRA 3VYSB 4J1SA 4H18A 4FQ5A 3HB4X 3INGA 1T0HB 2OAP1 2VR1A 1P17A 3JQGB 1JBKA 3PHJA 3GRKA 3ETDA 4OGFA 4R4JA 2CBZA 3JRWA 2OL4A 4Z9AA 4AG5A 5THXA 1I7PA 4ZCIA 4IBOA 4WZAA 1HE1C 5AVOA 1RI5A 2A0FA 4HPWA 7YASA 1VYUA 1X1TA 2X9LA 1SXJE 1KO5A 1WW3A 4HDNB 5JCXA 4US2R 1L7RA 2AFHB 2GX6A 3BXZA 5MHTA 3KOXA 3ZI7A 1KAEA 1UKCA 1ZGZA 2C2YA 5DBFA 5DNWA 4MTLA 3TQCA 5L45A 1N57A 2ZSFA 1WXWA 4PZEA 5BNFA 1HSZA 5KWSA 1SAYA 3IE0A 4PV7A 3ZHOA 5AK4A 4YV1A 5IBQA 1GTJ1 5LKAA 4YREA 4TMZA 1ILEA 2WWHA 4M9RA 3BILA 4LW8A 3OZCA 1K86A 2XV1A 2O2DA 2PT7A 4KXWA 4DQKA 1D8TA 3R0JA 1PRYA 2E4WA 2X4GA 2VQ3A 2V7EA 2RAVA 2ZXFA 4DHWA 1G4HA 1VE7A 1V16B 3MILA 1QYWA 4LNAA 2Q27A 5DPMA 4YQEA 5BMOA 2JKZA 4B31A 3MNFA 5TVKA 2IIQA 2Z2XA 4JT2A 3ZVKA 4BMCA 1WPQA 1XZMA 1T3TA 2DTDA 2UVQA 3RHZA 1KK1A 2AQHA 5JJIA 1S2OA 1DXQA 2ONKA 3KC2A 2IH5A 5IXYA 2P9JA 4Y2VA 3USZA 1EUCB 1VB3A 4P0QB 1XZDA 1RWVA 4AB1A 2VQ6A 2VAWA 3MFYA 3PXDA 3AETA 5H0IA 4J2TA 4WECA 5EUCA 5C3MA 1Q57A 3KWFA 3ORYA 4EW1A 3HXKA 1LI5A 4GR9A 4EX6A 4COOA 1QKKA 3AKEA 3KFVA 4E15A 2OCPA 2EFGA 1GR0A 2QTAA 2X2FA 1J0DA 2NO4A 3QVXA 4RKEA 4Y6OA 2P6UA 2ZROA 5KC8A 4II7A 3ZVNA 5BVGA 2WSBA 3PQ3A 4RUKA 4G56A 4F45A 5LDHA 3N2EA 3M4NA 1Q15A 4TZTA 3KSBC 4C22A 8AT1A 2HSZA 5FOTA 1Q22A 1M0TA 2I7DA 3D6VA 3EG9A 2IIBA 3CXRA 3QXCA 1K7CA 2D0DA 3EWIA 2I2WA 2RAUA 1VJ0A 2FPSA 2RGWA 3O4RA 2PS1A 3NALA 4UVIA 2OCGA 3RE1A 2C96A 1RABA 2RGNA 1KKMA 1P4HA 4V0LA 3IAS6 5KQLA 1YJQA 2OG1A 4Z5XA 3E2MA 4BB6A 1PQWA 1X1AA 3V5NA 1JYFA 2Y0DA 3OPQA 1QGAA 2G0TA 1SZDA 1NVKA 3COWA 5HQTA 3R09A 1U0BB 3AESB 3BIJA 5AW8A 1G16A 2ZI6A 2RK3A 1CB7A 2IITA 4PAQA 1F0YA 3KAPA 2E3JA 4L85A 1XVVA 2RI0A 3SLKA 5I7HA 3A6FA 2XZLA 3RS0A 3QEJA 1SU6A 1N2GA 5A62A 2XWJI 1CY7A 3HU1A 4XTCS 3PFIA 1WY5A 2WHEA 5B64A 4Q7KA 5HIAA 2FFBA 3URKA 1JKXA 4EYGA 3B53X 1Y5RA 3EUWA 3IIMA 3O7MA 2SKDA 2Q29A 4MHSA 4TLDA 4BV9A 1IL0A 2YV4A 3RT9A 6YASA 1OT3A 4YUVA 3W2FA 1RZUA 1WXFA 4LX0A 1MB4A 1RPZA 2I5PO 4F8YA 1Y4UA 1ZR2A 1TKBA 5ELXA 2YJ6A 3PX7A 3GT7A 3HWRA 5DBOA 4JP5A 1WUJS 4B82A 5IYZB 5AM4A 4TXLA 2R6DA 3OLWA 1RRPA 4Z99A 1P4RA 3DHVA 2PN1A 2W22A 4HAYA 4Q9HA 2JBAB 3IP3A 1RLTA 3WBJA 3LY7A 1GG9A 1M2NA 3LGAA 3QXSA 3F6YA 4UVGA 2ZAOA 1W75A 4R16A 3C3JA 4B81A 3B9PA 2BEUA 5DSZA 3RWMB 1C30A 1YQXA 3TLYA 1FNCA 1ODCA 2BI4A 3CHYA 1PLKA 3NIBA 4IS2A 3BHIA 5DHRA 3TFQA 9ABPA 3P71T 2QTVA 4ZJUA 4XARA 2G5CA 4JLKA 4JJFA 1OXVA 3B52X 4NYIQ 4XM1A 3H2IA 3MCWA 2J0UB 2J3LA 4UHHA 4YI5A 1P5FA 4C7VA 3R9XB 3JQBA 4QEDA 5IMSA 4HG2A 1CQXA 3WLEA 1II9A 5KYGA 4AY2A 1W29A 3KSMA 4ZCLA 4C0HA 4ZQBA 3EC2A 4PINA 1HR0B 3EMBA 4JD5A 3ZQKA 1NAIA 3MJ4A 3SYLA 3TCXB 3EVFA 2BN4A 3LDHA 4IL5A 4HNHA 1NFQA 1XP5A 3BX1A 2R6JA 3RYCA 4NFLA 3DPSA 4G37A 4K3UA 5COAA 1AQNA 1SQ6A 1LSOA 3C6YA 4NOJA 3KZXA 3NGXA 1F2DA 3KZCA 1DCFA 4UEJA 1HTWA 1RMYA 1R18A 3ONDA 4NJEA 3TSAA 1H23A 4EX7A 1EI9A 1PQ4A 4KEAA 2GAOA 1F2UA 4NE2A 2AG5A 3HUDA 2GEJA 4PZUA 2YW2A 1M1XB 1R27A 1C7JA 3U9SA 1JHMA 3OKAA 4GKJB 3RAFC 4F5EA 4BVBA 1C7IA 2BM8A 2CLIB 2OUIA 3FVRA 2XYQA 3MJSA 4MR7A 2NQ2C 1PWEA 1H2EA 3HKBB 1JSXA 4EJMA 4F4JA 1QR2A 1K27A 1XN4A 3R2JA 5DBEX 1U5AA 1A96A 1KMNA 1OGYA 1OMOA 1G4UR 3S70A 5JSYA 4PO3X 1EFPA 4N5NA 2JCXA 4UHCA 3ZDRA 1T6BY 4QU5A 1L5HA 1CF2O 1E2LA 3D43A 4PBSA 4NCNA 4FC7A 3ROKA 1Y89A 2FMHA 3W6OA 1NW7A 4TMKA 5J2UF 3ULKA 1LU9A 3ZHRA 2MU1A 3V4SA 3W5HA 4RK5A 2N1MA 5F64A 3LUCA 4CM7A 2I78A 1CUBA 3TLGA 2QU8A 3V4ZA 2Z9BA 4Y3UA 2FY8A 2YJ3A 3ZW9A 2QRNA 3TUJC 3BIXA 5FEUA 3TQTA 2ZYWX 4NZNA 1K3FA 4QFMA 2D7JA 3TZ6A 1AGRA 4PBRA 5EE3A 2BFDA 2F3RA 2XYHA 1ZAKA 5DHFA 6GPBA 1U7WA 3BHJA 5IJZA 5L4NA 2IOQA 5J1SB 1AB5A 1B43A 2I3BA 3HQ4O 1TEHA 3TDMA 2ZKIA 1OI2A 3H9EO 3IDFA 4JYZA 3ZV4A 4E46A 4EF4A 2GXAA 4DA9A 1D9XA 1HG0A 1W4BA 4MO2A 4DDHA 3AVYA 3FIUA 3PEEA 3Q11A 4MQ5A 1AMUA 3CRZA 3H2GA 1O0CA 2FSVA 3P97A 5JC1A 1TVCA 3VAZA 3KQMA 4UNIA 3KHUA 3PHBE 1P29A 1FYDA 4CIXA 1B73A 3BL8A 4HTFA 4ARCA 1L4LA 2GZSA 3KPUA 3LIIA 4IQFA 4WFKA 2QSUA 3CRMA 4G1FA 1CUFA 1NA5A 2HREA 1W9HA 3C85A 2VEDA 3S2GA 1PUJA 1EDEA 1RC1A 1Q2UA 1KSFX 3OX3A 4WNAA 4QGSA 1DT3A 1M3SA 2IEYA 1KTVA 4AI6A 1G8KA 1PFGA 4BMPB 4HKTA 4QT0A 4XR4A 2A7QA 2F8SA 3R5TA 5CAEB 1Y3DE 1DNPA 1JUDA 3ED1A 2J9XB 3WHLA 3N3AC 5D3MA 1QTIA 4AXXA 1ZM3A 3RC2A 4I55A 1FXWA 1PL6A 1DQSA 1ECPA 1A72A 1DHTA 5UKDA 5K4AA 2YWRA 2YZ7A 5ADHA 1JZQA 1O58A 5FQNA 3EPHA 4PZ9A 2EP8A 1N33B 1IPEA 1SM4A 4JB0A 2W4IA 5JNWA 4PGFA 1FTWA 2IKQA 1I9CA 3D3EA 4EG8A 1JZTA 4QPNA 3PCRB 1WMFA 2Z1DA 3L7MA 5KAPA 4AKIA 2A5DA 4DIBA 1P1CA 2OFPA 1R12A 3D0OA 2HK7A 4GI3A 4M36A 4MI6A 1K97A 3G9UA 4FYKA 1JIXA 1U04A 2VT3A 3U3OA 2HUPA 2A8YA 1QGZA 4MQ6A 1A9YA 1YAHA 4OQ4A 4ZOEA 5EUBA 5HKLA 4AZTA 4CL2A 5IM4F 4TMYA 4Q4AB 1PO7A 2PKWA 2AC2A 1QG4A 1CF4A 1RBMA 2A35A 3DO6A 1LD3A 1TVKA 1BE6A 2VP4A 3N58A 4RV4A 2WD7A 4KODA 1C4WA 3S7TA 3LH5A 2IYOA 3LYAA 2KLHA 4UHBA 3I5XA 5C7IO 1DJMA 4E4RA 4QC2A 3R5FA 4QU9A 3EDYA 1ZNZA 1YFKA 1GPYA 1U1FA 3A1FA 2PD4A 2IJGX 3HEAA 3K15A 3EB9A 2O2GA 4F2HA 1F17A 3WXBA 3UB2A 2B5OA 3B8EA 4HV4A 4L5BA 4HEA6 1TAUA 1ZA1A 3AWIA 4CW7A 5TE9A 1S7GA 5JV5A 1QAQA 2BUAA 5BYBA 1KRHA 1FTNA 4DCJA 1N34B 3TTSA 2WD9A 5IW8A 4CN8A 4A0RA 5M7EA 1ORWA 1N7JA 2O52A 1TI7A 3LM8A 1EFAA 5I7SA 3F3YA 2DY0A 2HWKA 2X0NA 3SBOA 4GECA 4X65B 1I36A 4UBNA 2O06A 1I4DD 1GNTA 3WL8A 4TVKA 4MCAA 4MIYA 4PSDA 2NZ8A 3IPRA 4FNOA 4G4JA 4OVKA 1IDN1 3UA4A 1XGKA 1FDSA 4M0CA 1KP3A 4BVGA 3JRNA 3B1JA 3I53A 3ICVA 3KJIA 3SQLA 4AJ4A 2ZXUA 1BSVA 2EW2A 2AMFA 2FXIA 1A5TA 1U8TA 2N46A 2NUTA 3ICPA 5IHXA 3NTQA 3B3QA 1MH1A 3SYRA 1YQEA 1R6UA 1QANA 2QX9A 5FV7A 1ZSYA 4PCLA 3DEAA 3NB0A 1NFRA 1PJTA 4CV0A 3HUUA 2F1RA 4CCYA 1I5EA 2ZE8A 2JCVA 4BP3A 3GARA 4LRSB 4E3WA 3ZI0A 3ZCSA 3UKJA 2PX8A 2X41A 3KYCB 1QMGA 1HM5A 1LXCA 1ZNYA 1U8EA 1L1EA 1WBJB 1FYEA 1GQOA 3I6QA 4U02A 4XX0A 4DA7A 3FIJA 1A4IA 3ODPA 3GGCA 3QVWA 4X1YB 1MD9A 3LAWA 3OKPA 5AIAA 1WEHA 1IWBB 4A26A 2RARA 2GXSA 3GN2A 1USUA 3JPYA 3AGPA 4NYIR 1EE1A 2X8BA 3NHRA 5KQMA 4ZO9A 2XMCA 4BO7A 3ZU6A 3GB9A 3DVAB 3HKDB 1SNYA 1T9ZA 2JKYA 1WE2A 3CPJB 5DCWA 2PKXA 3E84A 3S2IA 2VT6A 1UFKA 4MUXA 5JSQA 4P3KA 5K3EA 2QN2A 4CIAA 3ZOZA 2EZ8A 4CG1A 2HSDA 5CNJA 3O4JA 1VHQA 3QU2A 3VR4H 5ALVA 5JYCA 3ER9A 4G6ZA 3CVJA 3L05A 4Z0PA 3W79A 2D1YA 4URXR 4FHZA 4JXXA 3WV5A 1Z68A 1IY0A 5F33A 2A30A 5GWXA 1DC5A 1Z3IX 4IGEA 2NU6A 2WJGA 1M34B 3T35A 1FNNA 1QFSA 1W5EA 4JODA 5G1NA 4ZVSA 3IILA 2A33A 5BWNA 4F4HA 3WQQA 1ZM4A 3DBLB 4RZXA 4N0PA 3ZCXA 2CHEA 4C6TB 4MYSA 4R71A 5TF4A 1JHPA 3FLEA 1CQJB 4ZK2A 4KPYA 1O94C 1AGNA 4OV6B 4ZT7A 3TO5A 4B6PA 3WO0A 3RRFA 3ANSA 4Q4HB 5LOVA 1X13A 4EP1A 4S05A 3O90A 3SQNA 2ODAA 1TZJA 2X3UA 1T36A 4JBLA 2QNBA 4REOA 4CEIA 1NVMB 1P3JA 3ILVA 1K3TA 3QQ5A 1YE8A 2FZKA 3OKFA 2EKPA 1CDOA 1FW8A 1O6GA 1X7DA 1ZD4A 2D1RA 2O7NA 2VJKA 2WT4A 3IP8A 4BBJA 2HQOA 1U0SY 2P2NA 2W98A 4J1NA 2A9QA 4FGUA 4DA6A 5A9RA 1TM2A 1W87A 1CZOA 1H1TA 2ATIA 3M82A 4ZODA 2E6UX 1NURA 4BLTA 2G3YA 2OM6A 1E6CA 2RHWA 5EJEA 3AUJB 4UDYX 1TGVA 4DEYA 4XX1A 1GDHA 1WZCA 1G291 2BEWB 3H11B 4TKMA 5H3HA 1LDMA 4CM8B 3SQWA 5H8WA 4LGCA 4BO6A 4RIGA 4KX5A 1GCOA 1ACJA 3B1WA 3AR8A 3HL0A 4GVLA 4UXIA 4Y9DA 5FOWA 4JLSA 3U3JA 4H1WA 5JZBA 2GJKA 5IYZF 4PO8A 4X90A 3AVXA 1CY6A 1GT6A 1LJLA 4TLCA 4PS0A 1T2AA 3H9QA 1NNEA 4U7HA 4AMVA 1XZQA 3D4OA 3OFKA 3U7EB 2NO9A 2WFZA 1O89A 4FXOA 4Y9UA 2O2IA 3GR6A 1OQAA 4BQIA 2HIMA 2QJFA 3IP6A 4KE9A 3ESCA 5CVTA 3K8ZA 1KFEB 3FBGA 2JAOA 3IESA 4BUJA 2B4KA 2VBGA 3HN6A 2V1UA 3G49A 3I1YA 3O26A 5CYGA 1VHLA 2RHRA 1I2AA 3NM6B 4IWXA 1WXDA 1DX6A 4ZOQI 4OXQA 2FV8A 4IIUA 4ZHQB 3KEFA 2XVMA 1QZTA 3WGQA 2BUCA 2VNHA 2IW1A 4B3DA 1ZMXA 2J8ZA 5GMOA 4KWIA 5HCIA 4CQLB 1NMXA 4JA2A 4DCPA 2OCBA 5F3WB 1UXIA 1DXHA 3EW7A 2ES4A 2LCFA 3QVJA 4YJ3B 4NBSA 3UPUA 4W8HA 2YHIA 3FHTA 1K9SA 2AS0A 4FE7A 4Q24A 2CEKA 3CUVA 2PZGA 3PFWO 3GBSA 3CKYA 3TD6A 1GEGA 4BP8A 4I36A 3GBVA 4EZIA 4LOLA 3RBZA 2ZS9A 2J59A 4G4SO 4Q9IA 3FPLA 1XTJA 3ZBTA 3HRKA 4BX3A 5CA1A 4G5GA 1N7IA 4RMHA 1X1SA 4UAJA 1SEPA 2P5UA 1N2EA 2PUEA 2G08A 1RYNA 2Y9PB 3Q2KA 2DFNA 3FPEA 1F48A 1Y7PA 4N0EA 4TMXA 1PP4A 2VIIA 4N0DA 2FVXA 1EP2B 4H7FA 3M83A 4CVNA 3ZTYA 4DLAA 3U09A 3K71B 2I67A 1ENZA 2ZATA 3NNDA 5CLLA 4DV7B 2H1HA 4G9GA 1RYYA 4XAQA 4EFMA 4KBYA 4XUCA 2Y0PA 4MUBA 2QMHA 4JI1B 2NNLD 1KZ1A 3GC6A 3C3XA 2FWNA 3EC7A 3RF6A 2N0SA 1O54A 2V7WA 4BLRA 3VZSA 2OAEA 4DDMA 4AY6A 5DYGA 4AJ1A 3X0DA 3M4YA 5JISA 1NQ5A 3V7FA 4P3OA 4C01A 4ZN6A 3OEWA 1TMOA 4J49A 4U7GA 2W11A 2XCQA 4DLZA 4QPPA 2IYFA 1DTSA 4YRRA 5DBGA 4CDRA 4AJPA 4C08A 1SU4A 1AHNA 3EN0A 4E51A 1X8XA 1XZCA 3ZE0B 1TJ4A 1C9NA 2CY0A 5HK9A 4GRDA 2J0SA 2JK1A 2CNLA 5AJTA 3A58B 4HX9A 4YVFA 3SNHA 4XIGS 1NLUA 4D8WA 3D8BA 4RWZA 1D1SA 2O4CA 4NEGA 3A37A 1HGXA 4K1LA 3JQCA 4CLEA 1X7WB 1TQHA 2QORA 1DV1A 3OPXA 4NWIA 1X15A 3JZAA 4K40A 4P33A 3ND9A 3NV7A 3NKVA 5KTNA 1EG2A 2AXNA 2DFVA 2HYDA 4NBTA 3W3AH 4CKWB 1ZJJA 2X7JA 1FP2A 2H4WA 2VNSA 1QIHA 1DTWB 4PPQA 5HEKA 1DEHA 3LBNA 4YFVA 5BSMA 3GLFA 1MX9A 1F9AA 1PZGA 4PFSA 2WU0A 5JS7A 1PVDA 3OY2A 2GTIA 3C5HA 3HYTA 2GHRA 2HCFA 4JP2A 4QGFA 4ALNA 4DJFC 1PFUA 4IY1A 4YTEA 5FWAA 3HHPA 1EFVA 1IONA 5TQ0A 3B7WA 3VOAA 2VHYA 1KYYA 1W52X 4RY0A 4CPDA 1IZ0A 1BDIA 4EB6B 2GK7A 4AWXA 1E1CB 4DREA 4OB6A 1ZITA 2QGFA 2YJZA 5G0TA 1X1DA 4TXMA 3P2MA 1J90A 1KFCB 2WF9A 2Y4OA 1ISSA 1RWNA 2VKTA 4MUAA 4BO9A 2XRYA 3V3TA 3V4FA 2AB0A 1LQTA 1B6GA 1QH8A 3GMSA 2OBBA 4P8RA 5IAEA 2P8JA 2W93A 3BWDD 4BU0A 3L7BA 1BWSA 1PQUA 2GUGA 3CS3A 2Q3JA 3HCBA 3K8QA 3PI6A 4P22A 4RQBA 3HDTA 4FZRA 4Q1EA 4EG5A 3CX6A 3MCTA 3NHSA 2ZWAA 5B53A 4I1YA 1QYCA 4QYMA 4X95A 5HR5A 4P1ZA 4X8OA 2K4MA 1JEDA 5HYVA 3BMOA 2CBGA 3PUHA 1V9LA 1EUZA 2G36A 4I2VA 3GAAA 3K1JA 3CZMA 2HMAA 4X0EA 5DCUA 4PLYA 1CHNA 4B83A 4GSKA 1H0KA 1AKMA 2CXOA 3PSHA 2NU8A 1U0HC 1KQGA 3Q6MA 2Q50A 3UHAA 4YLYA 3A9VA 2PRJA 4O4LA 5K4HA 4AWBA 3P4XA 3B85A 2C2KA 1AGYA 1OR8A 5GY7A 5D6OA 1V4NA 3VZDA 3BVPA 3DDCA 3R6DA 3TF5A 2V3WA 2W2MA 3WY9A 4KN8A 4R83A 4B1FA 3GDOA 5LIPA 5MN5A 3NHYA 2DQZA 2B1IA 3DM9B 5EP1A 1LK0A 4WZAB 3OOEA 3PQ7A 1B7GO 2NV0A 3E15A 1TAHA 5CX1A 5IDWA 5DHUA 2YOGA 3SG0A 1CLUA 2ECFA 4RQAA 5A9SA 1UT8A 2F1OA 1VGQA 3ONFA 2VWGA 3G2HA 3CSUA 3PNMA 4PE5B 2C8VA 2I2AA 2CFRA 4L08A 4BN4A 3HRIA 3WQSB 2D13A 1XAJA 2EFJA 2ZBDA 3I42A 3U9TA 3CLTD 3QLTA 4ZYUA 1GCAA 2EERA 5ISMA 3ADBA 2OHHA 3CSSA 3NHZA 1ADBA 1QLHA 3P9ZA 3QM1A 4M60A 5CGQB 3RG2A 1HMPA 2HLPA 2VF7A 4U7DA 4WOPA 1R1DA 2I8LA 2MSDB 1XVAA 1EE9A 1JG1A 3RKSA 2UDPA 3OZWA 1PX0A 1PV1A 2XR1A 4DV0B 4L5AA 3UY4A 1ZQ9A 4L2IA 2EBHX 4PR0A 4Y6QA 1YZKA 1NUAA 3NFRA 3ENNA 3P9YA 4ZEMA 3U7IA 3HEMA 4CR7A 4MIKA 5I3ZA 5F4ZA 3RFXA 1JH9A 4MHTA 1RVV1 3IGFA 4MPRA 5BNWA 5CJ2A 3HU3A 2G7ZA 4U2KA 1WDTA 3NJRA 1DKRA 3PUYA 4B6RA 5IZ4A 1W4LA 2X76A 2IYSA 4CIDA 1ULHA 3RNLA 3THOA 4DR2B 3ILSA 5AVJA 2C3MA 4YIHA 2YWHA 3BXEA 4B3FX 2Z9DA 1TPYA 2AXPA 1QTNA 3TOSA 1SCJA 4YMVA 5L4SA 2WHPA 4WHMA 3AP3A 3PD1A 4IKPA 5L3VA 1GNPA 3D7SA 2A4MA 1T15A 4M46A 3ZGYA 3A0UA 1Q0TA 2BCEA 3BXPA 1TUGA 3SC4A 5C1OA 3L4BA 5CLGA 5DYNA 3UHJA 3HA2A 4NXMB 4F6RB 1BHQ1 2PWBA 1HEUA 2GKSA 4LBVA 3K70C 3GYGA 1D2NA 4EFDA 3GBPA 1RNLA 4PONA 3EF1A 3HADA 5HDQA 2BR5A 1QWOA 1MB3A 1MVNA 1ZIDA 3QYPA 2JHFA 1ZGBA 3D3JA 3PUXA 1QU3A 1I6WA 3T5CA 4YDHB 1MO3A 4YP5A 2BH2A 2YMMA 3U9LA 4R7GA 1VE3A 1R4AA 4HNRA 1JB1A 4XJVA 4H3VA 4NBWA 1B76A 1PGNA 2Z83A 2F9FA 3CE6A 3DO8A 3EG9B 3LQ4A 3TTUA 4B48A 2PLWA 2VSFA 4GMHA 1T3LA 5HUHA 2Q3EA 3ZDEA 2BI8A 1JHAA 1WKCA 3TIGA 3CUWA 2DPLA 3TZEA 1E99A 3D5EA 3LUBA 4WOJA 2PKYX 5AM0A 4PR3A 2VTDA 4H0FA 4J6EA 3WMGA 2HO4A 3ZTTA 1TUEA 1HFEL 2IEDA 4IGFA 2P3QA 5EE5B 3SJBA 3WVNA 1O0BA 2QP9X 1B14A 4DTIA 5ES4B 1J99A 1PVOA 3G5UA 4KBGA 5KINB 5H3LA 1Q12A 4R8LA 4X7BA 1XMQB 1K6EA 1P4JA 4F8JA 1OAKA 1NN3A 3L8HA 5FL3A 1V11A 3QJGA 4YJGB 5E7IA 3X2EA 4R31A 1DKMA 4GBGA 3NHWA 3EEOA 2GERA 5I7FA 4MOWA 4X3CA 1IB6A 4BLOA 2ZYRA 3ZDCA 2J5XA 4WLFA 3REQA 4UQOA 3QIVA 1IHPA 4OYHA 5KJCA 4JWTA 2IXTA 3V1TC 1E9VA 4AIIA 5KX5F 1VXRA 1EJ6A 1FVFA 4AIRA 1DOAA 4HX2A 3ICOA 3OF5A 3OO1A 3K9NA 2GILA 4CTNA 5C37A 1C0EA 5L6MB 4B4OA 1T5DX 1ZM9A 4LV8B 5FPSA 3IQGX 3UBMA 2MINB 1KMIY 2J5KA 4R2KA 5IC6A 4C6HA 4KR3A 2RBEA 4YAKA 2B34A 4UMEA 1JA0A 3AFGA 3HKCA 3IB6A 4HHEA 2KPOA 2BEUB 1E0AA 2FQQA 5DW0A 1T9GS 3KYBA 4MUJA 2V0NA 1J06A 1KU6A 1I30A 1KI4A 1Q2XA 3L1KA 2A1IA 3KWLA 2C83A 2I9PA 1RPAA 2JA2A 1GZ4A 3AIMA 4GLJA 1CDEA 4RJ2A 4MO9A 3PLNA 3RQSA 1DCTA 1IBRA 1TGYA 3RG8A 2CLCX 4KXYA 5CEEA 3NC1C 2X2EA 4F11A 2C7OA 2QPAA 1WZIA 3AQ4A 3DPIA 1QHNA 1Z2AA 1DUSA 4X63A 2C58A 3AV0B 1IJBA 2QX6A 3ZH9B 3EMDA 1BJTA 1DEAA 1EWYA 1HV8A 3CN7A 5GGXA 5HFNA 3T7SA 5LQDA 4P7BA 5EL0A 3MGKA 1UZNA 3L1JA 4B5LA 2EAUA 1J2EA 4E2FA 4RTKA 1L9KA 4KO8A 3DAGA 5HIJA 4DUYB 1BTOA 2XDAA 4I50A 3D7KA 2BT4A 4QDUA 5J5CA 2R8RA 3TWOA 4ZHQF 1RHUA 2Z5GA 1H94A 3EIQA 5JVDA 3OHMA 4HOYA 4C4OA 3WMEA 3VJRA 1U2QA 4GG1A 4NJEB 4QSHA 1N8KA 4YJ3F 4GI2A 1MW9X 2IK8A 4DVJA 1ZGHA 5MGNA 1LV8A 1LDYA 1NG1A 1TJ5A 3JALB 3P2KA 5JMTA 3HFJA 4GI1A 3MTIA 4X61A 2FA9A 4XQ9A 4JSTA 2G9UA 3K9HA 4NKRA 3ANXA 4LBZA 5EWLB 1MV5A 4DNFA 3CLSD 4LMRA 5F2KA 4EHBA 1I13A 1ZDMA 3LV8A 4C30A 1G20B 4JB8A 1KMHA 1E7QA 2OV1A 3F71A 4HS4A 5BV8A 1F8FA 3ABRB 3M6MD 4FNGA 4GOLD 4CHGA 2O59A 2QAIA 2V7VA 4NCAA 4YCDA 2P9YA 4IZOA 3WXMA 3F97A 4IFTA 4H7HA 4CMKA 3HB1A 2JLYA 1SHLA 2A9RA 3Q72A 3GH1A 3PUKA 3MZ0A 3A2MA 4BGDA 2NM0A 3IIJA 3BWCA 4DILA 5BSGA 4LGYA 4BFSA 5CW2A 2IOFA 3TLGB 1OKKD 1Y37A 1EFLA 4R1SA 2ZBRA 1U9CA 1YJ8A 3RTEA 1WBDA 1T13A 2CNNA 2C5BA 3AL2A 1LBEA 3GEDA 4YAFA 3MHTA 3QKRB 1ISJA 4EENA 3ZPXA 5HWSA 1YULA 2J08A 2CNWD 2ZJ7A 3LHIA 4MIEA 4TMTA 3ETJA 3DGEC 4NCBA 5BOVA 1JG4A 2CLMB 3HBLA 1Z0SA 1VL5A 4Y6LA 3EIUA 3IAM1 5L7YA 2IW3A 3WWCA 5JADA 5FJIA 3UM9A 1IRIA 1ULAA 3HACA 2C4UA 3WYFA 4OP2A 4PYOA 5K99A 4Q7JB 1AXRA 2NV2B 3CT6A 4X44A 5L8VA 1GAEO 3LK6A 5CH8A 3G2QA 4LS3A 4X62B 1DAMA 1KKUA 4NVRA 3UOWA 1WP4A 2LVBA 1U3WA 5A4FS 8ATCA 3QMWA 2HD4A 2PLAA 3CNQS 4R8KA 5BUSA 5AW2A 3OQIA 4IDBA 4Q34A 4U1RA 1KH3A 1DWQA 1GGKA 2F6RA 3K9QO 4AAYA 2YWEA 4HTFB 2FPOA 4PQFA 3A1NA 3COSA 4JNCA 3C3BA 4QGHA 1G38A 4E7OA 4AZ3B 2X0KA 4KQHA 2XGJA 5A1JA 4U3JB 1X39A 2PUDA 5TPWA 3ADDA 2Q7XA 1QZXA 1P7PA 3G85A 4R3NA 4XPIA 4F3YA 5KYKA 1WU7A 3D5QA 2EP5A 3MUFA 1M73E 2B9EA 4C04A 2YNMD 2FUKA 2PO5A 3A31A 2BD0A 3CWQA 3GGDA 4Z9BA 2YWJA 4H7JA 1NZDA 1FTGA 1H8ED 4EL5A 1ZD9A 3LZ6A 4MS1A 3FPKA 1L4HA 1P2TA 2G9VA 1XUOA 2Y2UA 4H0CA 3SC6A 1DAGA 4XWOA 3O83A 1ESMA 2ZB8A 4RPIA 3V33A 3CIOA 3IUQA 5KWEA 4M53A 1B23P 4C43A 4DYDA 1KSGA 1THGA 3MA0A 3RUHA 5DM60 4C5CA 2CDAA 1HYQA 2FGKA 2RHLA 4OAOA 1NJ5A 4KYVA 3T38A 1GTG1 2GAIA 3SC2B 4KI7A 5IANA 2O8DA 3WL6A 3WIOA 4YT2A 2O5CA 1YS2X 2HX1A 2WHYA 3ISJA 1S89A 3IUSA 1C2TA 4FYVA 4KQCA 1M7HA 2AN9A 3L8ZA 3ECAA 4WMLA 4A0QA 4OI0A 4G26A 5HPYB 1TYCA 2OMKA 4HPXB 1P9WA 1E0SA 2VHUA 4BUZA 3ZGXA 1BGVA 1Y33E 3DLIA 2ZU0C 2KS6A 4XWKA 5HFAA 3T99A 2Z6VA 4IX1A 2IHBA 1H2AS 5FIUA 4IZHA 3ROGA 2JGDB 3OTGA 4KN9S 1R2QA 1WXEA 2XQIA 3Q9LA 4F9EA 1VP9A 1QUFA 1E61A 1TVKB 1CZRA 3DBOB 2OR3A 3L9WA 2X5JO 2ZSUA 1I7SB 3U4CA 4O2LA 5E4YA 1NBOA 1N1MA 4PWYA 3QOWA 4WTOA 2GKGA 3E27A 3PC2A 5AVRA 1UAYA 1V2HE 4IOKA 4Q02A 4P6VF 4BKPA 4TN5A 3GLFE 3KXPA 1YS7A 1ZH4A 4EEZA 1ZA2A 3E1GA 4GNRA 4HRVA 4OQPA 3VTKA 4V0QA 2X7HA 3TXXA 4COKA 1A9ZA 2I8AA 2W2KB 1YA4A 1GILA 2XUDA 4RBNA 3SVTA 2H1WA 3FMGA 3PA8A 1JQ3A 1JAHA 1AN9A 1CQPA 2QL9A 3FJ1A 2QXTA 2WUDA 1CETA 1WG8A 1A95A 3AXSA 4O1MA 5C5EA 1PKXA 5JSFA 5KSYA 2ORVA 4HQOA 5G4KB 2I03A 3G88A 1EMDA 1HMYA 3FVTA 3IVMA 2D2VA 2FWPA 1IEWA 4JOCA 4P81A 5F1OA 3WL4A 4QWMA 5J4HA 1WKVA 2BZ0A 5GAJA 4LXGA 3RADC 4XDHA 4FFVA 4CTJA 5TEVA 5CLQA 4R1TA 3IHKA 2P68A 3FPAA 4IWNA 5A5GA 1JAIA 2J3JA 1YGPA 2DM6A 1JDJA 2CFTA 5LB2A 4B6SA 2JJ1D 4KH0A 5HJ7A 1FPMA 2XZDA 5BR7A 4XGKA 1VMDA 1XXHE 2P0AA 3ELDA 3M2PA 3L8CA 3M9WA 4HQKA 2AN1A 3DTNA 4MUEA 2ODQA 2ONCA 3P32A 2DSNA 3UATA 1GV1A 3N39C 4CMEC 2A94A 2FEOA 1UT5A 4GOOD 1A9OA 2CHFA 2HU7A 4BGUA 3LT5A 3PVCA 3GUYA 4QEKA 4QXQA 3OLXA 4MQEB 4P4UA 5CLIA 1G7SA 4LN1A 1KI1A 1IWOA 5FUWA 3OOWA 1QH1A 1HF3A 3LCVB 2B8NA 3UMGA 1R9JA 1C0PA 4OL9A 2AYXA 3M6VA 3WYNA 4KQJA 5KNBD 5ER9A 4G0ZA 1K8ZB 2FW8A 4BVLA 4DBLE 1IEXA 4JLNA 5JJCA 1WM1A 4L74A 1OI7A 5FF9A 1XEWX 3GMIA 4D46A 1VGVA 4ZVOA 3KETA 4DYHA 1P4SA 2P7HA 4MCJA 3DV0A 2LXNA 3TMAA 3ODGA 2X15A 3FGPA 3UFXA 2ECOA 4FFOA 2AUNA 6CHYA 4OQYA 1WCIA 5CJJA 1XNQB 4LOJA 2WWGA 4HN9A 2CHUA 4IX9A 1TO2E 2Z09A 3DONA 3FWYA 4EVQA 3UW1A 1SHKA 3U3KA 2O7VA 1W1WA 1SZPA 4F3TA 3EYAA 3H86A 5D84A 3LTEA 4P98A 4ND8A 1RS0A 4ONEA 4PLTA 5AXDA 5DWQA 1XQ9A 3KE8A 3KZMA 1CZUA 1EWRA 1SC3A 1XTQA 2DKFA 2JATA 2NU6B 4GBED 4M0PA 2DR3A 3L7DA 3HJTA 1QNFA 2XTNA 3D8NA 4OOFA 3ASYA 5A1TA 3BFXA 1POXA 2ET6A 3AEKA 3BCSA 4LMPA 2BKLA 3T3IA 4YRKA 3OZTA 5BVHB 1T8UA 3DDNA 2PU5A 2FCRA 3SNKA 4WXYB 1U3FA 2PUHA 4MWBA 4E6PA 3ZDYB 5LOVB 1O5IA 4LRUA 2ZUSA 3KDAA 4TXNA 3UAXA 3QFRA 4LGMA 3QLUA 1T36B 3V4PB 4WKOA 2ILVA 3SJAA 2YQ5A 4IUBS 1KNXA 2JD2A 2RKBA 3I01M 1UODA 3DBVO 1M83A 3HWX1 3TZQA 3DSRA 2AHOA 3C0KA 3PQ8A 1DUIA 4Y67A 2JFNA 2PEZA 3ZWWA 1IN8A 3V8VA 3VOSA 3ZWDA 2BJHA 5AD1A 3Q12A 3UAYA 4KQGA 3PU6A 5JNLA 1UJBA 4YAJA 1UM8A 4FGWA 3PUJA 4MWZA 4DLYA 4DUPA 3G1TA 2V7GA 3SEFA 4H3KB 2EKZA 3DOUA 5AUNB 1X7XA 2HDWA 5U1PA 3ZLVA 2Q2NA 4V03A 1JU3A 4Z2AA 5JXHA 2IYWA 1ZJ5A 4HYQA 4KMOA 4G0QA 2NO7A 2APJA 4RORA 5C8VA 3AQIA 3ZY4A 1H4TA 1F3LA 5LZ8A 4X20A 3UMCA 5LQMA 2R7MA 1AUQA 3Q0IA 4HGRA 1W5FA 2R4TA 4YXFA 4FB5A 2YYYA 3KPYA 3FYSA 4LTMA 2J4DA 1H9AA 2I62A 3OM1A 4G86A 4R69A 2XCTB 4ASUD 4B6JA 4JI6B 3NGLA 4WCVA 4EFLA 3M70A 1EVZA 4DCNA 2FMTA 1Z4PX 4J9VA 4ZPXA 1O5OA 1TMKA 2WYWA 4KGVA 2H11A 3HCRA 1J1IA 1F1BA 1VMEA 4YRFA 1OVGA 5CCBA 4UNQA 4IVNA 1YTLA 4PXYA 2O2YA 3KV1A 2AMYA 2LKDA 2HMVA 5G53C 4HBZA 1ADJA 1DE0A 3LLCA 4UE6A 3VPCA 2BKAA 1DCKA 1QM5A 2VDRB 1GAXA 2XF8A 2YHIB 2YOHA 2WJWA 3AOEA 3IHTA 4EY8A 1Z5NA 5A3JA 1DP4A 3GFFA 1Z4LA 5E9AA 1NJ6A 1SBQA 4L4YA 3ZBQA 1RXCA 4YAWA 3JRXA 3SDSA 5CTAA 1ENYA 1Y6JA 1P5JA 3RHTA 3WLTA 1Q7RA 2P6PA 1OU4A 2WQ7A 3OLYA 2V5VA 3FOEC 2C5EA 1IZ7A 2AE2A 4D9JA 3AIKA 4B3MB 3NETA 2JFBA 1D4AA 5I7UA 3MGGA 1ZLYA 3DVRX 4PS1A 4PQGA 1VLJA 4PGMA 1D7AA 1TTPB 3MBOA 1R4ZA 3UB3A 1L5ZA 2G6TA 4LHEA 5KPJA 3D2LA 4JROA 2ICAA 4UHEA 4B35A 5B1EA 4Z0HO 1OD6A 1K5GA 4YR7A 2WTAA 5T4HA 3AFIA 3A8TA 2ODBA 4JKOA 4RCVA 1A71A 3PTZA 4OMCA 1YONA 1DO2A 1J5PA 2IYRA 1XVIA 3IOYA 2IPNA 3MS7A 3ZBPA 1TZKA 2H2IA 3LLSA 5BN3A 4N4AA 2QAGA 3DXZA 5HRAA 5EZYB 4YC7A 4LG1A 3A1VA 3W5SA 1ZMRA 1OKKA 2OSVA 4AUEA 1GGFA 1UBSB 4C3OB 1PV4A 3WNVA 3WZLA 3TR0A 1IY2A 2RH4A 4HMQA 2RKOA 3GI1A 1VZ3A 1ODFA 4MW1A 2RBGA 4XGRA 3RUDA 1PL8A 1BXGA 3IE2A 2IRWA 1CHDA 1ZCFA 4R81A 1G6Q1 4F0JA 2WB2A 2CNWA 3HLYA 3B89A 3O1HB 4Q7QA 4FFBA 2VQSA 2ZI9A 3B6KA 3TD2A 1JWLA 1PJLA 4LF5B 2HMWA 5IVPA 3LE8A 5KTYA 3KAQA 2H2DA 3PWSA 1C8BA 4OIFA 5A3VA 2PUJA 2VSQA 3GP5A 3R0QA 3A9TA 2RJ3A 1OV6A 5BNTA 3K96A 2FPKA 2P6RA 2W43A 2P4UA 3EXIB 3LG2A 1IK6A 3RVKA 1KAHA 4C7MA 2WD8A 2G06A 2WFMA 1XN1A 1O6FA 2XMBA 3M4XA 2FHPA 3E5HA 1UKVY 1F2TB 2AC4A 4FYHA 4UATA 2ENWA 3JXEA 3V2IA 2ZYDA 4L57A 3H2BA 1M7GA 3OA0A 5TQ0B 1YUMA 1C81A 1Y4ZA 3GMDA 1DHRA 1V26A 1WCV1 3I4CA 4FEEA 4HDMB 4OLHA 3AW9A 5FYDA 3E58A 1QFXA 1X7HA 1T8SA 1HFJA 5A02A 3JD2A 1R5OA 2J6BA 4NMHA 3L4JA 2IYLD 1RWKA 2PU7A 1RRGA 4JLOA 5DP2A 1B93A 3ZU2A 1IN7A 2J9YB 3DMNA 2YNMA 3DE0X 7REQA 2TMGA 4WNCA 3WLFA 1E6LA 1QH8B 4M88A 3GLHE 3HUTA 1H8EA 5DX0A 3ZNNA 5IF9A 1TZ2A 4M86A 2P8SA 1IK4A 4C05A 1R4NA 1FXWF 3LP5A 4IDPA 4QDZA 1XZGA 2B4RO 1DWOA 4EAQA 1XOIA 4JX8A 3B6EA 2LCQA 2OK7A 2FMUA 1W73A 3AP2A 4QUDA 3ZV7A 4N0MA 4I9NA 4EKNB 2EZ4A 3AUSA 4QQFA 1JBQA 3VNSA 2LP4Y 1RAEA 3BMOB 2OORC 2WF8A 3SZGA 3R7SA 2PMWB 3I37X 1OBVA 5KSZA 2BV3A 3E9CA 1Y8RA 4PM4A 5KCMA 4J4TA 4BEBA 4F86A 4UBLA 4YJHB 2HPAA 1Z5ZA 3X43A 4PNHA 3NYWA 1YL6A 4IDAA 2OCAA 2GZ3A 1P31A 2JGMA 4P0TA 1ZOIA 1QHIA 4K2AA 2VOJA 3EWSA 4RPJA 5DHQA 3V8NA 2XLBA 3KRTA 4MR9A 4DIDA 3W4IA 1J2UA 1FU8A 4EA6A 1P0CA 2FEKA 5FUQA 3AEZA 1J07A 4V0KA 3G2KA 4HXYA 5CX1B 5HDBB 3G8CA 3VBEA 2PVCA 4DJJA 1Z16A 1U1GA 5A9SB 4OY3A 1MVLA 3P9NA 4LJYA 3CZAA 4DNPA 4IILA 4BWYA 4P3NA 4UCXA 1CEQA 2QTZA 4Y0AA 5F1KA 2VG8A 2CVOA 2QLLA 1HC7A 1PT6A 1XQWA 4DR3B 5HGJA 2AUMA 3BWVA 3C3EA 4HYEA 4W9RA 5FWXA 3G0CA 1HOTA 3T0IA 2CMGA 2VL7A 4BFVA 5LNK1 3OBBA 3RSFA 1VE1A 4RVUA 5I9LA 3UK6A 4G1UC 4IIEA 3LHKA 1UP7A 5DDIP 5KNDH 4MRVA 3PPXA 1WPRA 3KJXA 1FMTA 4DC9A 5CGZA 2PYIA 3TVYA 3O2QB 3SQMA 3HZHA 5AK3A 1E3SA 3IOCA 4DY4A 3HDYA 4PFQA 3DNMA 5IF3A 2QT0A 5DRTA 1C3VA 4DXDA 1SVIA 1NSFA 2JJ1A 3I4LA 4OU5A 1RI3A 1WB6A 1V4BA 1XSEA 2JS7A 3O9VA 2WTEA 2F8MA 3DEIA 5FTJA 3O73A 4OGLA 1UPAA 2V55B 4NENB 1G7RA 3NASA 2HTEA 2AFRA 2GZAA 4YASA 2WHPB 2H06A 2HCTA 3E4CA 1CQIA 1A0OA 1IDOA 2YASA 1BMFD 3GFSA 3M2TA 4OYLA 2EVWX 3F7NA 4IG9A 4WX2B 3UIEA 2ZITA 1MZPA 3E70C 1JJAA 3BDAA 5DMHA 1X74A 3AF5A 2DPYA 5G02A 4BN5A 4TZ0A 3FGNA 1EHIA 1YR6A 2GPJA 2ZRFA 3HO6A 4MV8A 4RZ3A 4RM2A 5ERGB 5LYYA 4IGKA 1YJAA 4HCJA 2CV0A 2Q8NA 2CXUA 2ZQZA 4HDCA 3JVEA 4ABYA 5FOSA 2P5SA 3LUFA 2RGRA 5CLFA 3OE5A 1DWPA 1ZZGA 3BWYA 3W0LB 2HKIA 3KQUA 1WAMA 2IZ7A 5B1HA 5B2FA 4ETNA 4GGPA 3W7AA 3ZD6A 3RYIA 3MPUA 5FWNA 1SRQA 5K0ZA 2HBZA 2QUJA 1M6NA 2VNIA 2ZCVA 3EHDA 4MGHA 2XI4A 3X1YA 4A8JA 4C4ZA 3PC8C 5EQJB 3Q4GA 5AOCA 4F06A 5IT4A 1GCIA 1T5LA 1OF1A 4PHGA 3U26A 2ROQA 1YR1A 1G5TA 3CZ4A 1BWRA 4WN9A 1FYXA 2CDNA 2GUWA 2IU0A 3IP5A 1V3TA 3CLTC 1H69A 4QNRA 2P3OA 3KTOA 2RAPA 1L5LA 2J3HA 2NZVG 4W5JA 5C18A 3K09C 1OA0A 3O4GA 3NKFA 2RHOA 2NYVA 4DC0A 1QX4A 3G8YA 1ULUA 2VDJA 1OXKB 4M1TA 5BQOA 3J81k 1PK8A 3WRYC 2HIHA 1VPVA 2BDEA 4L8LA 4UTNA 5JNSA 3WLPA 1V47A 1YO6A 2P77A 4MINA 2OUKA 4M6WB 5NULA 4W7SA 4YYZA 5LXTA 1R74A 3B3AA 5EZSA 5LOVF 3QVOA 1JIQA 4J1TA 5ALIA 2J3KA 1HDRA 1VHJA 2CXXA 4Q19A 2ZULA 1QK3A 4OP3A 2XWQA 3G17A 2AW3A 3U4DA 3PXCX 2O1WA 3BM5A 5L40A 5IKOA 3UV3A 2W58A 4DA0A 1UDWA 1DIAA 2J85A 4UZEA 1W59A 2GN0A 1K4MA 4KIUA 5C52B 3ZV6A 2ZB3A 3D64A 3X2FA 2W2LD 2G9QA 3KQYA 4FX2A 10MHA 3H0KA 5IKEA 2PZAA 2BAGA 4AC9A 3A4TA 1Q17A 3H8WA 1AF7A 3HKCB 3IAXA 4JGGA 4PLWA 4Z3KA 1I1NA 2IZ0A 3L7YA 4Z1OA 3V8MA 3IKTA 3E2IA 3IALA 1E58A 2RGAA 3KQTA 4LXQA 4PGAA 3Q3VA 4RGBA 3UEOA 4NF2A 4QJBA 4BIMA 3BMQA 3QLVC 4P2GA 4U4AA 1II0A 2XVXA 3V7UA 4OF4A 4BFWA 1OFHA 3OCJA 1GCGA 4G25A 4DC1A 4ROTA 2FDRA 4L3OA 5LMCA 1QIEA 5FXMA 2F9LA 2GD6A 2V7XA 2CZQA 1CV2A 1MB9A 1I8TA 2QYTA 2AJTA 1CYDA 3FDIA 4ASUA 5FFFA 2REBA 2W2OA 4KAJA 4NV1A 4DBZA 4UASA 4D92A 4OXYA 3CIFA 3HP7A 1KERA 1EKXA 4P7GA 1EZ4A 4RDHA 5T4FA 5C1BA 4ZZ0A 1ZEMA 1P2VA 3UYKA 1F6BA 4I50B 1P1RA 3L0CA 4NRDA 4KFRA 4C14A 3GJQA 2WB4A 3FVWA 3KAJA 3GFRA 1FYWA 4GO1A 1IRXA 1ZY2A 1J8YF 4D4IA 5IABA 3DE7X 4AY5A 3D4BA 2FG7C 1NW8A 3PUVA 2I54A 1GYPA 4JLVA 1KDPA 4JNKA 4LCEA 4JLUA 4MMZB 2A9KA 3WK6A 2M9MA 1W88A 1S5PA 1WL8A 2P2CA 3EASA 2CXTA 3FNQA 2EFCB 3KTAA 5B6IA 3L0YA 3OIGA 2FJ0A 3QPWA 4EKGA 5EXSA 2XUQA 4OJTA 4W5WA 3IBCA 2PDAA 2C7BA 1P1HA 5JHGB 5FOQA 4I3HA 4HVAA 1KMHB 3LJKA 1U9JA 2YCLA 4HC4A 5BUZA 2YINC 3LPDA 3RLIA 1Z82A 4J75A 2VS1A 1TQ6A 3N2NA 2PBRA 3RREA 1U6IA 2B8JA 5C51B 3VMMA 5HJ5A 2HF9A 3KE9A 3DWIA 3JQFC 3AZPA 4F5ZA 3H8JA 5LKRA 3R3SA 3IIKA 1T2EA 1C14A 1KI2A 2VP5A 2YWCA 3FE2A 1JSRA 3JCZA 3QPCA 1VBMA 2P9HA 4FEGA 4H6WA 4IJUA 3AWDA 2NZJA 1TVMA 1PLLA 2QK4A 3W06A 3PHLA 4EG7A 2C4WA 1NBME 4LCJA 4LXUA 1PFKA 3A6EA 1J9EA 1BHJA 5DWDA 4ND5A 4RJLA 3BF8A 3LGSA 1LZLA 1Z7WA 5B12A 3GLUA 1JHQA 4UKDA 1EVJA 4MYUA 3V8QA 1N6PA 1Q3TA 1V37A 1TRKA 3AF0A 4QGBA 4YQYA 4DRYA 4U8GA 1EP3B 4ZYTA 4B0PA 5EZYF 3KJZA 2J1LA 1UL1X 3ZQJA 4IIYA 3O8OA 5IZCC 1ZMBA 2J4CA 4GDMA 1L6IA 3L82B 2VPTA 4U7FA 1ZJ4A 4LFAB 2WY2D 1Z33A 4Z2YA 2OK8A 5EYPB 5TB5A 1ECJA 4GOKA 5CUQA 3EH2A 5FTKA 4CM5A 3MF4A 2CCJA 2HYIC 3OCUA 3KTFA 3WL7A 1Y1TA 3E18A 3VH3A 4LWPA 2G88A 1DG1G 4FLFA 3IPCA 2IV2X 3RWOA 3QYJA 2XA2A 3DE4X 4XPIB 1XROA 3LA8A 3CX7A 4D7AA 1ZLXA 4PNPA 5CURA 3RC9A 1SG9A 3PJRA 2F1JA 1G8MA 5IJXA 4FCWA 3TECE 3OJ0A 3B82A 3KKKA 1PJCA 1M2HA 4L6CA 4HX5A 4ZGBA 3H83A 2Z04A 3NDIA 1L3BA 2WA2A 4TV9B 1XCJA 3ESQA 5D2CA 2ERXA 5FO1A 5TQVA 4CT4B 2L42A 3MS2A 5A2QA 3PDJA 3AVUA 1K98A 3IUEA 3ORFA 4ZT3A 2DX7A 2YJTD 4NJOA 2QIPA 4YRPA 1S3FA 4UM8B 4AMUA 3WTCA 2Z8ZA 1N9GA 1BDJA 1KK2A 5DU2A 2LV8A 4FFRA 1JI3A 3W2IA 5B37A 2H1SA 4PVDA 1IZ9A 2EZ9A 1M2WA 1THTA 1YR7A 2H8KA 2IEBA 1OIWA 4N7BA 3DV2A 4QG7A 1YZUA 3MWLA 1NE2A 1OC4A 1UP6A 5L53A 3THYB 5D3QA 1NGSA 2QUKA 2OHJA 5B5SA 4Q9LA 2M6SA 2JG3A 1YR2A 2XUOA 3RSOA 5K01A 1T4DA 2FN4A 3OIYA 5E7QA 5IAKA 3SGLA 4ZVVA 2F3SA 3W6NA 1OPRA 2G8LA 3TE6A 3DLAA 2DMRA 3JYQA 1K8XB 2HBQA 4EGSA 1NXXA 3U16A 3KG2A 1UOPA 3AFOA 3IUYA 3ACCA 3D4NA 3NBFA 3PDCA 3RVMA 1NT4A 1PEKE 4JXKA 3TGWA 1C9KA 3BSWA 3SE0A 4O4LF 5JCPA 3KDPA 2WJVA 5IC5A 3WLSA 3F7MA 2W5UA 2JIMA 4S1TA 3RUPA 2YMLA 2EJTA 4MAMA 2ZIVB 5K8VA 3U4MA 2YBDA 2MSWA 3VH4A 4URYR 1E98A 2P35A 3LWDA 3B1YA 3OQOA 2ZUBA 3MTGA 3P94A 1Z2CA 3OP1A 3FM9A 3HP4A 4FW8A 4NI5A 3WC4A 5F7XA 2C7RA 5MFZA 2HRZA 1DPFA 4WXMA 4C1NA 2VZ9A 1LX7A 3BWEA 3GGJA 4UHFA 2JVKA 3F78A 4KDFA 3VRHA 1IQPA 1AZLA 2FRVA 1G1MA 4AG6A 2A2ZA 5JCJD 1W76A 5DK6A 4F9TA 5E6RB 4YRMA 3AY7A 2WZBA 5JATA 3DTYA 1U2TA 1U8AA 1SBCA 2B6NA 4GMKA 4KE7A 1OGIA 2JAPA 2JANA 1EDOA 3JD1A 3WWEA 3BWBA 4LY0A 1KI9A 4Q48A 3U3RA 3ER8A 5MGBA 1JJFA 2XTMA 4DGSA 4XGIA 1NY5A 2VHCA 3TE7A 2BMAA 1PJBA 4OH1A 2V4MA 1GYQA 5KYXA 3QW2A 1OXSC 4YP9A 3LTNC 4A5OA 2W4MA 1JPUA 2B83A 1QH1B 3OEHD 3KXIA 3BC1A 3CCCA 1FF9A 1IYZA 1SOMA 2IEAA 4KC0A 2C0PA 4KCGA 3QEKA 3ZS9A 4V0OA 3BB1A 5B1YA 3CB2A 2AF3C 1UANA 3HB9A 4RA6B 2VUTA 2RGGA 4D8VA 1XWIA 2VH5R 5IFKA 3GUHA 1BWQA 4DV1B 4DIKA 2I6FA 4H4CA 3EAFA 2N75A 3BZBA 3DV0B 4KZPA 3SX0A 5ALZA 1SBTA 3BIFA 3CONA 4HFNA 2V4ZA 3X1DA 1XZKA 5B58C 1YD7A 1ZICA 3TFWA 1JIVA 2PS9A 1E96A 2Z1MA 1OB2A 4HAUA 4HDSB 1W47A 3PUWA 4BL5A 3EGDA 1XD8A 2IYTA 1NYRA 1FFDA 2WM9B 1UC4B 4RF3A 2FP4A 3GGPA 1PF7E 2C5GA 3H3FA 4C3VA 2OBYA 2QIOA 1QRTA 2Q1SA 3LUPA 1K7SN 1YHNA 2JH9A 5FTNA 3N87A 4CETA 1DVRA 1WQ3A 3TW6A 2ZBUA 2WG0A 3UWDA 1CG6A 4JLAA 5L3QA 3HBNA 4FDTA 2YH2A 5EJ9A 1X92A 4V1CA 4P53A 3FD8A 4D4HA 2QMZA 3AEKB 5CR9A 2ZTSA 1E6UA 3A70A 5LP6C 3C6MA 1GHTA 3OUUA 1ZYUA 1L5FA 3ENQA 4X9XA 1CUIA 3X44A 2Q9UA 4KPGA 4LC9A 4M22A 5DI3A 3K6JA 2D2XA 2BFFA 4QYSA 2JAXA 2ORWA 2XA1A 3T5BA 1GKIA 1QE0A 4Q3LA 5KSOA 3DKRA 2QN9A 3HVHA 3UJHA 1BE1A 1J33A 4M9ZA 2XB6A 1ZI8A 2J9RA 1XZIA 4KR0A 4PIPA 4JI4B 3JZIA 5DEOA 3S4YA 1LTQA 1DRUA 2ERYA 4GC5A 4DPKA 3DDWA 3FYUA 1LDNA 3JATB 4RVDA 3RJTA 1JL3A 4OKIA 1JP7A 2GA8A 3BWXA 4XEHA 9LDTA 1Q1NA 1WSWA 1Z2OX 2VF5X 4FFDA 5E6SA 4MJXA 1O2DA 3VVMA 2ZZMA 1JH8A 1YCGA 5EGNA 1A5SB 1PT8A 3DOFA 1KZ9A 1U2EA 2PSJA 2B82A 1PNOA 3IQHX 3LOPA 3UWOA 5B4UA 1EK6A 3OFJA 1OX6A 1X7XB 2NXJA 2IGTA 4BXOA 2VOEA 4K9OA 2E4VA 2DB3A 1IWPB 3J81A 5YASA 2I2DA 3FZYA 2W2LA 2V98A 3HN7A 5K0JA 4X20B 4L8GA 5L51A 2F00A 1SHZA 1NQWA 1PD1A 1P18A 2G77B 5D8DA 3KYDA 1X1CA 1N2IA 2Z4RA 1JJVA 1V2GA 3GNSA 1K7EB 4JI2B 821PA 1XEXA 2HF7A 5ARCA 3VPSA 4UUAA 4HLUA 1XLUA 3C48A 1DOHA 3GCWA 3LPCA 5I9TA 4CT5A 3EVCA 2PH1A 3TD9A 3I3SR 3DOEA 3NI2A 5BR8B 3IPAA 2NTYC 3OUTA 5DV9A 4ZAYA 3SKVA 3H8SA 1ZJZA 1UBJS 3O1LA 4LCBA 3CGWA 1Z13A 3RIGA 3AHCA 4Q6WA 4Y6PA 3FTEA 1X42A 3UJBA 3CWZA 4Q0MA 3R40A 1XALA 3FGZA 2FU5C 3D1JA 3KZVA 1Q1AA 4LXTA 4XB1A 4CMIB 5M29A 1DAIA 1E5XA 2H52A 4N41A 3T9CA 1C7FA 4C9BA 2IVZA 4ZT6A 1I3CA 1FDVA 2FVYA 4I50F 4EUNA 2JGRA 1EINA 3GA5A 4HWRA 1N6LA 5B2ZA 5JDCC 2BZGA 5IP5A 1SVKA 2W90A 1KRWA 4II2A 2ZVQX 3IA2A 4EFNA 4RXTA 3ZNOA 2E55A 2UUAB 1NXVA 1CZLA 2GCOA 2GN4A 2GNOA 2IP4A 2BM0A 1FY2A 3MCAA 1WXHA 2WIJA 3QLEA 5DO9A 4F04A 1HI9A 1GKYA 2EC5A 2PR7A 4Z7JA 5BMVA 2R8BA 1A8QA 3FKQA 3F7TA 1FL9A 1OFGA 5C1DA 4ZC1A 2XQJA 3GLGE 2CYCA 3EGWA 4RY9A 3EVBA 2BTOA 1CDDA 4OYYA 2B3DA 1V1JA 2JJ2D 4DZZA 1BU5A 3P2IA 4QVGA 1KGSA 2BGIA 2Q41A 2QP3A 3G9ZA 2WJ3A 1RACA 1TUIA 4MYDA 1ZH6A 4Q1DA 4HNSA 5ALDA 2HT1A 3TQSA 1YB1A 4MP6A 4TOIA 1ZC4A 2VDWB 1G5FA 2C9ZA 5BPFA 3M89A 2QAGB 3M4JA 3OWHA 4KAXA 3GLKA 1HK7A 4IHKA 1SD2A 3R74A 5JH7A 1F6WA 4EDFA 1TA9A 1FFEA 1O95D 3NO4A 2QQ0A 3EXFA 4Y6GB 2P4QA 1ESNA 1P91A 1PNQA 3I30X 1YKGA 1BXGB 2BFAA 3DFIA 1LLUA 2QJWA 2FG5A 3RS9A 1FSZA 4YAGA 1KY2A 1IG0A 4FW9A 5C8YA 3ZTWA 2C9BA 2VRWA 2O57A 2GLXA 2YVLA 3IXMA 1JDUA 3O8QB 5JMWA 1V5FA 4AKGA 1C3XA 2NLOA 5SZIA 2HXGA 4KRXA 2PS0A 4U7PB 4CV2A 5IHPA 2QI9C 3NM4A 1P80A 1SC1A 4TQAA 3HJCA 4LI0A 4JB3A 5E2BA 4Q3EA 1J9ZA 4LOKA 4QE3A 1MDFA 2Z57A 3QUAA 4J76A 2H6EA 1CVIA 3FLBA 3I2JA 3DZJA 4NCJA 1AF4A 1KNQA 2OY0A 3FDZB 3PFNA 1MIOA 4HDKA 2WYOA 4CU5A 1DRWA 2XOEA 3D4IA 1DC3A 2JLBA 2NWQA 2YOFA 3LFUA 3NRJA 4KMMA 3LI2A 3ZGLA 1DLIA 1Q92A 3I6ZA 4NK5A 2PSHA 2QF7A 4Z86A 1NDQA 2OKGA 3G8DA 5ALLA 1L7BA 3NEAA 4ARIA 4JVLA 4N3GA 1DARA 1WNFA 2GYYA 2CDCA 1NIJA 4X94A 2PZJA 1GXSA 4K6CA 7REQB 2ZE7A 5M2QA 1CRWG 4EUKA 5AVQA 5AUOB 1UOEA 3WIBA 5CM2Z 4FUTA 1I4TD 4XCQA 1R4NB 1OLXB 2AVDA 3D1LA 3K9GA 3B6JA 1J09A 5EIWA 4JL6A 1EUDB 2YWFA 3DQPA 2X9VA 3QG1A 4P4TA 1XMIA 4RKWA 1JZSA 1YVUA 4G09A 4BCDA 5U9CA 2KMLA 3ADCA 1CEYA 4RH0A 1A98A 2DZDA 1VGRA 2BKXA 3A4MA 4FUQA 4LHWA 4XGQA 3R7WB 4FB4A 2VDUE 3L0OA 3IB3A 3LBHA 3KL4A 1HETA 4RJIA 2B1QA 4UM7A 3BF7A 3RT7A 3OZRA 5GM2A 3U4HA 4DCGA 4OQNA 1NUHA 1MX1A 2H18A 2PGIA 5KZMB 1NP3A 4Z4HA 3ZUPA 5HS6A 2PQ6A 1Y8RB 5B3KA 1PWHA 2G0AA 1BS9A 1E3JA 1RJWA 2BHSA 1TLTA 2REQA 1HRKA 1KI6A 3EISA 4URFA 3WLRA 3AB7A 4PNZA 4AN0A 5CHEA 3AHDA 4XQCA 1LB1B 1A5AB 1H2WA 4OQQA 4WY2A 4JVNA 5GPBA 2PYDA 4PAMA 3U44A 4ALLA 3O38A 2R1TA 3JWJA 3I52A 2L0XA 4MR9B 2JFXA 2E7ZA 2JIRA 4HFMA 1ZX1A 3LRXA 3R20A 1ZJ6A 4PW0A 4YMUA 5ITVA 3PC3A 3ONWA 3OT4A 1TLFA 3PX3A 4GKKB 1I3MA 4JHLA 2JK0A 3HCOA 1QLWA 1QIIA 4J0IA 3HR7A 4YT8A 2HWYA 2GO1A 2Y6VA 2YN2A 4MVJM 2EF0A 3TIIA 4BLUA 4O4JB 1T3ZA 5J4YA 3GPCA 1PTJA 3IAS1 5BRJA 1KK0A 1XPUA 1NZJA 1NKVA 2CJWA 1YS6A 1R10A 4K6HA 3ND5A 1S8AA 3MB8A 1KO7A 1U7OA 4L0CA 1IVSA 2ZRKA 4F5YA 1VBNA 2PH7A 4MNTA 5LP6B 4D2IA 1CZKA 2B98A 5DGXA 4REMA 5EPUA 3PR3A 3WSTA 1S8FA 8ADHA 1IBKB 3VI3B 2YHSA 5EJMA 1GSOA 3SYTA 4MPTA 3TN7A 5JCJA 4CF4A 5JZOA 2ZIGA 4LZOA 1OH7A 5E7MA 1Q50A 1KRXA 3DZHA 3E3LA 3QE0A 4IF6A 4XPZA 3VKWA 1MX5A 4H1HA 3E82A 1NUUA 3HCNA 3TK1A 2ETXA 5EQFA 3R75A 1UP4A 4Q3CA 3OZSA 4G8JA 3LVQE 4N0QA 2Z3WA 3DOIA 1Z17A 4AZSA 1NJ2A 1C2YA 3PXXA 4BQPA 1N0WA 1NU8A 4OLAA 3K0SA 1ISGA 3SWWA 1OJ7A 2HPVA 3I92A 3JVDA 2BFCA 3L0ZA 2OO5A 3D02A 3OLVA 1P2GA 3ADPA 5AJXA 3ZH2A 1KZ4A 4QG3A 1YC2A 1N9KA 2AEFA 2H08A 2JRLA 5K0TA 4YAUA 3KWJA 1I7LA 1LW6E 3MMXA 5TQJA 1Z4MA 2IHNA 3NHLA 3WRVA 3I01A 2GTHA 3O82A 4PC2A 3OEHA 4MS3A 3WGKA 2XSZD 2ZAMA 3GEBA 4K9DA 4QX6A 3IDAA 1UJ5A 2BELA 1BXKA 3R3UA 2RC6A 1I9GA 5D85A 2MYUA 3GJ4A 1Y0BA 5EWJA 5HQ3A 1T1IA 4CKBB 4GPBA 4YUXA 3DS8A 3VSCA 3WWYA 3QWAA 4UTOA 3AKZA 1KBOA 3NOQA 4CM3A 1NQUA 2R8OA 2ZYAA 3HNRA 1H66A 3K8OE 1FRNA 2AIRA 1UJMA 4KHPB 4POAA 4A8JB 1UKZA 4M1ZA 2RI1A 1Z35A 5IBPA 1PWYE 2H9IA 2V45A 4OMUA 1IUKA 5ESXA 3IVAA 3BSSA 2NTVA 4WZBA 5CIWA 5B7QA 3WK4A 3KQLA 5K0FA 1U9IA 3T9EA 1MNAA 1Z0UA 3G0HA 4MUMA 3O5AA 3MM4A 1FFCA 4Q9JA 4I66A 4PLVA 3OZXA 2I4NA 3HPQA 4I8IA 4MWTA 5DULA 3L6DA 1FXSA 2QJTA 2ZK7A 4MKRA 4RD0A 4A9AA 4BX0A 1JVSA 4I4TA 3GELA 1G6KA 3KVNA 2DJIA 1NJ1A 2G72A 3GG9A 2D74A 4C03A 1R88A 2R0QC 1NUPA 1U0JA 2OG2A 4H0NA 4V1CI 3EIOA 2ZB7A 2Q3MA 3SSAA 1X80B 4PG6A 3N8HA 3NW9A 4FHFA 5JQWA 4E5DA 4OBBA 1GZ3A 5CVEA 1A04A 1OFIA 1FS6A 2NSLA 3FBTA 2VSYA 4K28A 4NAVA 4RHTA 1OROA 4FNMA 1IEQA 2WUVA 3T3EA 2VK8A 3FKSD 4EW2A 3O03A 3IQDB 3VNAA 1UUFA 4HXGA 2QTLA 1H8HD 4QUBA 2A5YB 3DD5A 4CKYA 3BIWA