5IAOA

Structure and mapping of spontaneous mutational sites of pyrr from mycobacterium tuberculosis
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
182
structure length
171
Chain Sequence
ESRELMSAADVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGVTLANRLAGNITEYSGIHVGHGALDITLYRDSTSIPAGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional protein PyrR
publication title Structure and mapping of spontaneous mutational sites of PyrR from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis (strain atcc 25177 / h37ra)
molecule tags Transferase
total genus 50
structure length 171
sequence length 182
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5iaoA00
2DY0A 2IGBA 3N2LA 4LYYA 4RHUA 3OZGA 1G2PA 4P84A 4P82A 5JSQA 1ZN9A 4M0KA 1QK3A 1XZ8A 1DKUA 3ACDA 4WN3A 1JLSA 1I14A 4P86A 5ESWA 1NULA 4PAWA 4RACA 3KB8A 4X44A 5JV5A 3QW4B 4RABA 2EHJA 4RHYA 2H08A 3GGCA 1DQPA 1QB8A 1GRVA 2JKYA 4JITA 4RADA 1VDMA 1WD5A 4P80A 1QCCA 3NAGA 1JLRA 1UPFA 2JKZA 5KAMA 1ECJA 4RAQA 4ZFNA 1LH0A 5HIAA 1G9SA 1I5EA 2JI4A 1CJBA 1P4AA 4LYGA 1ECFA 4RQAA 1YFZA 1XTTA 1A97A 3HVUA 4X45A 1TC2A 2WNSA 4RHTA 1D6NA 1A3CA 1NONA 4JLSA 5BQOA 3H83A 3O7MA 4P3KA 1P18A 3GEPA 1L1RA 4QRIA 5EUCA 5BSKA 1A4XA 1MZVA 2E55A 3MJDA 2PRZA 4RANA 1XTVA 1I0LA 1QK5A 1BD3A 5HKLA 1G2QA 3DMPA 4PFQA 1L1QA 1UFRA 5IPFA 2P1ZA 1BZYA 1AO0A 1ECBA 1ZN8A 4WMLA 1QB7A 5BRNA 1GPH1 1I0IA 4M0PA 3M3HA 1OPRA 1A96A 1W30A 4KN6A 5IAOA 3ACBA 3OHPA 3LPNA 3ACCA 1VCHA 3OZFA 4LZOA 4RAOA 1OREA 1V9SA 1ZN7A 2PRYA 1J7JA 1O57A 2H06A 1TC1A 2C4KA 2XBUA 4RV4A 2GEBA 1P17A 1Y0BA 1HMPA 1P19A 2VFAA 4QYIA 2H07A 4F8EA 1ECCA 1QK4A 3G6WA 3GGJA 3EFHA 1O5OA 5K51A 4TWBA 2PS1A 1DQNA 2FXVA 1FSGA 3S5JA 1I13A 3MBIA 4QYIB 1VSTA 1OROA 4LZAA 1U9YA 3DEZA 4MB6A 1DBRA 1ECGA 4S2UA 4P83A 1HGXA 1UPUA 2HCRA 2YZKA 1IBSA 2JBHA 1G9TA 1U9ZA 1XTUA 1XZNA 3LRTA 4P81A 3DAHA 1QCDA 1DKRA 4RHXA 1BD4A 4IJQA 4LZNA 5BQPA 5KAPA 1R3UA 2AEEA 5E38A 4OHCA 1A95A 4M0UA 1Z7GA 1PZMA 5ESXA 4Z1OA 4RQBA 1STOA 4FYMA 1A98A
chains in the Genus database with same CATH superfamily
4Z0TA 2G9NA 1FLNA 5EQTA 3N2LA 2O9JA 1ZEJA 2E4XA 2H9YA 1W0JA 4WZBA 1SUFA 2KW5A 4YO8A 4F9FA 1GT6A 3ZXIA 4WCVA 1OH7A 1QK3A 1FSZA 3HTXA 1VMEA 4ISCA 3CU5A 4OHVA 4DW8A 4XWKA 3D6JA 4FDLA 4X5OA 4DCOA 4M1OA 2PL9A 3F7MA 2XQVA 3TJMA 2MYUA 2VJQA 3E22B 3IUBA 4IRUB 3DKVA 1SU4A 4X1OA 1ZXLA 5E7QA 3ZNNA 4DXHA 1X7DA 3I0NA 3K05A 4HI0E 4NABA 2MIIA 2QMZA 4RY0A 1UBSB 3EA0A 3HBMA 2IHUA 3G2MA 1G1MA 4KBFA 1JLRA 2CXOA 4OAOA 4OQXA 4YJ3A 5DHRA 4YAFA 5E0OA 3KYDB 4DDWA 1H2YA 3ONNA 4GWGA 4IDAA 4MKXA 1KH3A 1MX3A 3ONEA 1J0DA 2I4RA 3DNMA 1R6BX 1PSZA 1P9WA 4O2AB 3GIDA 4O2BA 4OHUA 4TN1A 4OK3A 3D8SA 2A3NA 1E3TA 2AXPA 5DLYA 2PANA 1RPJA 4Q4JA 4FGLA 1X1AA 4AQYB 2EP5A 2FRDA 4UEWA 2XUZA 4REQB 1M10A 4WXMA 1I1OA 1K1EA 3M1AA 2W2KB 2YIVX 4ANFA 2PH1A 3ZHSA 4F4DA 1A4XA 3K9CA 3E3AA 3UJ7A 4BNJA 1MAUA 2FMIA 2H85A 3AH8A 4NLLA 5KQMA 1YASA 4KQKA 1XX6A 1FP6A 3IP7A 2KSQA 4HLNA 4LTMA 2LVBA 2P41A 3T7EA 5FRDA 3AVUA 5D01A 1G7SA 1A7AA 4G8CA 3BSSA 3I5YA 4GC9A 2QYSA 4B46A 3QVWA 2R97A 4ZIRA 1GPH1 2YL2A 2FX5A 3RSHA 1U7XA 3DC7A 5I9SA 5JH7B 1KI9A 2UUOA 4BS9A 1P0IA 4IV8A 3SBDA 5B4TA 4XI9A 2VPPA 3HSSA 3NHJA 1NE7A 2IYRA 3CLKA 2ZI6A 4P7BA 3GEMA 3CNBA 3KJEA 4KLRA 4MQEA 3WR5A 1YJAA 4YCSA 5CVDA 4DDUA 4IIDA 5CM2Z 3DPIA 3TKAA 2BFDB 3MRXA 1QG4A 2WAMA 1JTFA 1TNDA 3VPAA 1R27A 4XEUA 1N2XA 2JAWA 2FEOA 5J4YA 2R0QC 2GXSA 1VA4A 2G4LA 1VPWA 2D2IA 2O1SA 4U63A 4DT1A 3NEPX 4P6VF 4LMPA 2G83A 4EPYA 1FSGA 4JBIA 5CA1F 1B41A 2I78A 2CFTA 2ORYA 4PGAA 5ULLA 1E92A 3M5CA 3TQSA 3KPUA 4W5NA 1WWKA 3V2UA 1DAPA 4I1UA 1JQKA 2VO1A 3W4IA 1FS5A 3MLBA 5KYNA 1E0SA 2OVBA 1KEUA 2HHLA 1LS6A 3BMCA 4FE7A 1X1DA 2P40A 5IM4F 2UYGA 4WH0A 5A5VA 5J4KA 5LOVB 1MC8A 2G5CA 1PUXA 1XTUA 2XODA 4QGBA 4TSFD 3D8BA 3WNVA 4HYTA 1N77A 4GAEA 4QBTA 3LDUA 1L8AA 3BBPA 3WFJA 3WQHA 2O2HA 3L5KA 1EBBA 3ZZ1A 5BN3B 1GFSA 1U9IA 1YQDA 4FXPA 2Q9BA 3AV0B 1JPVA 1SIUA 4G09A 4M0UA 2LV8A 4WSOA 3V80A 5ALVA 3V34A 3KP1A 2VCEA 1P72A 2CXTA 3ZV5A 4EMBA 4ZK2A 4MWDA 1YVEI 4EOGA 2ZJ3A 2ZVPX 1G5QA 5FPKA 1EVJA 3AM1A 2FR8C 1U1EA 1RYHA 2DHQA 2OD9A 2Q2OA 3KJIA 1K8QA 1RRFA 2AC7A 4GKVA 2XB4A 5EWJA 4AO6A 4QJIA 4QDUA 1SUBA 2EKPA 4DE5A 5F1OA 4C0WA 3MB8A 2F17A 5JV5A 2GBFA 4I5EA 1G59A 1LLQA 1U0FA 2OZEA 3AK4A 2NUPA 3I64A 3JWGA 3GZTB 3O6VA 4NI5A 1YB6A 4G1VA 4MTLA 3UA3A 3R6GA 1KEEA 3CRMA 1S8NA 1X0XA 1I5OA 1OWPA 2ECFA 4YRZA 3G9UA 3EW9A 4HUTA 4G5HA 4PZ0A 5CAEA 3HCDA 3AVOA 1XVTA 2QRPA 2ZE8A 4IIXA 4R1PA 2LKCA 1J0XO 4MQBA 4X9XA 4DR4B 1ACMA 4TLAA 3PZRA 1H1DA 1QVAA 4FZ5A 4K9MA 1CJBA 1K89A 2WP0A 3EZYA 4DMCA 2WF8A 2ZAOA 5FBWB 5AI9A 2ZWAA 2DG2A 3P2YA 3RG8A 5AVSA 2HY7A 4B9AA 5KYYA 4KZKA 1MZPA 3HRIA 5KSPA 3WICA 3FNBA 4OL0A 4MUIA 1L5LA 1RZUA 1USWA 4KYTA 2FPGA 4DPLA 3SYLA 1SXQA 3TLCA 5FI5A 2YIJA 4HAYA 4JSTA 3PGJA 4UHCA 3OAAD 3QLUC 4IY1A 5BW5A 1TIKA 3PRHA 4U5QA 1HQYE 3R3YA 1IHYA 1ZK0A 3L41A 3ZIDA 2I76A 3O1LA 2DCMA 1HTTA 3L1HA 1YE8A 3OFJA 2PVSA 2OCYC 3AL3A 5DSZA 1RW4A 4UHKA 1CE8B 1S5PA 4C7OA 2HQBA 2VWPA 2YNMC 5FO1A 5E3HA 2Y27A 2QDXA 2QTZA 3HJAA 5LA6A 4ZZ1A 1WO8A 1G21B 3ZBUA 5KYXB 3B9BA 4LJAA 1E4VA 5INTA 5DI3A 4JUFA 3N6VA 1AK9A 2X22A 3IBTA 4YJ3F 1TEVA 3QPBA 1OSNA 3N5KA 3F6SA 4DEYA 2WOOA 4V1CB 2G8LA 1QRTA 4UJ3A 2HOQA 4I5DA 1TUBB 3IEUA 1E0DA 1QRRA 2PQ6A 2RG7A 4ND1A 2W42A 2A0FA 1I3KA 5FUXA 3BAFA 4GOXA 3TD9A 1BWQA 1TIPA 2WU4A 1EQUA 1VI6A 1T8PA 1VPLA 2UAGA 5FPHA 4BO9A 4H08A 1UBGA 4GI3A 4OD0A 2JCBA 5BW6B 3DMGA 4KB5A 3TSOA 2WT4A 1F6DA 4LFBB 5F7JA 4B45A 2YKGA 2HADA 5BNWA 1E9AA 2D7DA 4DV2B 5KYKA 3IT0A 1DWQA 2X2OA 4PGGA 4RA9B 3RD5A 3TZQA 4BVEA 4Q9NA 1RPNA 5DNYB 4AT1A 3U7FB 4MJ7A 3OA2A 4EO7A 1B76A 4R9VA 1U0RA 1KBQA 4YP5A 3ZD9A 2EFDB 1TJNA 1Z6XA 3E3OA 1B15A 1SG9A 3VA7A 3OFSA 1KJJA 1ODSA 4JL5A 3UXYA 3P0FA 4L08A 5CT4A 3OZAA 2PZLA 3SVZA 2CT8A 2JIZD 3I83A 2OXRA 1WZUA 4UTPA 1E64A 4TWAA 2AR7A 1CJKC 4H3SA 1BCSA 1DL5A 2CCGA 3W3AH 1N0HA 1BQ3A 3DH0A 4DMHA 3NOOA 3ED5A 5AVQA 1RM5A 2GFQA 4F91B 2ADMA 2NWQA 2WVGA 2QE6A 3FX2A 1NFFA 1Y8QB 3L8FA 3UW3A 4R0MA 4MKGA 2VBIA 2QX7A 4I5GA 2HSEA 5HTOA 4AWXA 2A84A 1TF5A 2EW2A 2B37A 2H31A 1FL9A 4BZZA 4QODA 5KQGA 1JJVA 2ZDGA 4CM4A 2ST1A 4MQ4A 5B37A 4FEEA 4E5YA 4X7MA 5G4KA 1Y8CA 3LDGA 3ZOKA 4D80A 2YBDA 4EA7A 3KAPA 5B58T 2DP4E 2C4MA 3IAXA 4F4HA 4I3FA 1XZQA 2VDOB 1O95D 1V11B 3RVQA 3PPYA 1CIJA 3HY4A 2WW8A 1KJZA 3E1SA 1SR8A 2YR0A 4PW0A 1QYDA 5TR9A 3OJLA 2MU1A 4HUQA 3T3HA 3SX4A 1RU3A 2FFRA 3D7MA 2BTQA 3FUVA 2ZWIA 4HCJA 4LBYA 4WAUA 4B6PA 4F06A 1IHPA 4HX2A 4DUZB 2VWHA 2P7IA 3HU5A 2LUOA 3TOCA 5K8CA 2D7CA 1JBKA 3DQQA 4ZVNA 4RKEA 3RRYA 3GMDA 1PNVA 1JR3E 3W90A 1DQRA 3LQ1A 3LRPA 1LSUA 1PAUA 4NVRA 5C52B 3R3SA 5C3UA 4TOIA 4OTZA 4AMZA 4H7EA 4CLRB 3RG2A 3IP6A 4NCAA 1J25A 2PWAA 1XP8A 2VF4X 4LIPD 2PA0A 2CE7A 3MHPA 1KHTA 4Q9DA 3ZW8A 1T9CA 3R77A 4BN4A 2O6HA 4NE9A 4GBGA 2B4AA 4IH9A 4FSDA 1DQZA 4AKSA 1XELA 2C42A 2FMKA 5DN6A 3CO5A 3ACCA 4KH0A 3CJTA 5CK4A 3VMFA 1W0JD 2Z56A 4QJ4A 4BLRA 3FWYA 4WZAA 2NNWB 2C2YA 2ZJ0A 3A9UA 3VQTA 2KX7A 1K9VF 4DV3B 2IDKA 3CLRD 2A88A 5JE8A 5CLLA 1I2AA 4WLEA 1K7SN 2A94A 2CNKA 2REQB 4B4DA 4DJTA 5ELXA 3LZCA 4FC6A 5FWXA 3ZHYA 4HLUA 4BKQA 4F38A 2QX9A 4IHKA 2QRHA 3S27A 1ANKA 1OC4A 4P35A 4KN8A 1OAKA 1M7HA 2ZYHA 4KQHA 3CC8A 2IU4A 2D62A 3ZV4A 3T94A 3A06A 4Z7NB 5KNDA 4XGRA 2RK6A 2WSMA 3F6BX 4EO4A 2DHDA 3QTLA 2PCLA 5BMVF 4BRWA 3W5SA 1UFKA 1OASA 1TYZA 3LQRA 3HN7A 1M6VA 2JRLA 2RDMA 3CRRA 4K9LA 4MPDA 4XD7A 1MXHA 1TT7A 3GNSA 5AOBA 5FFMA 3TGPA 2ONJA 4E6EA 1KJQA 2V3WA 5TXGA 1LRLA 1AXRA 2J0UB 1TQDA 2J32A 3AERA 1TU4A 5GONB 3ZWYA 2GPNA 2FFBA 1A2BA 3E70C 3L8HA 4TKUB 1YUMA 1MVLA 1PG5A 2QSZA 1DMSA 1QOPB 2GETA 1KAOA 3I6YA 2O8FB 4IOJA 4RV9A 4YMIA 1Z15A 4HR7A 2FR0A 1A98A 2BMDA 3FE2A 5HDBB 1XBTA 1OXBB 2DJIA 1QNLA 3B53X 1IBMB 5GP1A 1TU0A 3C0KA 1TVKA 2JZCA 4GUDA 3RNLA 3FOEC 3IESA 3HKCB 1T3TA 5IZCA 5HF6A 3ZCPA 2QORA 1DCFA 2ZR8A 3N75A 3VI4B 4ESVA 4OM8A 4YBZA 4Y1GA 1E66A 1WOMA 2NM0A 2Y0DA 3H9UA 4GLLA 1UKYA 4KR0A 1MN6A 4NU5A 2EJVA 4R3UC 2CNOA 4CL0A 2PV7A 3UB2A 4YJ2A 4RYDA 3PIIA 1DQPA 1DKOA 4AUNA 4Z3DA 1FFBA 1GAXA 4AZVA 4MKIA 1EZ1A 1SIOA 2W98A 1VDMA 3FYSA 4HDKB 4I50F 1QV7A 4ICIA 1TM4E 4QOGA 3P97A 2ZBFA 2FG7C 1UBFA 1T4DA 2FKNA 1VIAA 4O4LF 1CNEA 4MLDA 1OBFO 4ZCQA 4D57A 2IEBA 4WOBA 3ZH2A 5BUSA 1TLLA 4N5NA 2VK8A 1LRJA 4IUCS 4Y2QA 1C8VB 4A9AA 3DZ8A 3H99A 1T5LA 4XM0A 4K46A 2NG1A 4P4TA 1GPUA 3JPYA 2I8CA 4IRXA 2B5WA 4OKIA 4MA0A 4Q4HB 4FGKA 2CW5A 3K9GA 4FDMA 4J16A 2IS6A 5K9ZA 1DDGA 2HREA 3JD1A 2QAJA 2P1DA 1C9KA 3A3PA 2G07A 3AL2A 4M1EA 1SXJB 3JPWA 3S4YA 1CJSA 5CEJA 4PRZA 4CG2A 3GD5A 3EX7C 1W36D 4CEIA 4GOMD 4Q24A 1C41A 3K35A 1IXSB 3Q3VA 3QXSA 3GLGB 3N8GA 2HQ1A 5UKDA 2ZVDA 2OR3A 1T9ZA 3E81A 3FMVA 2C2GA 2HMWA 2LWIA 3OJOA 4CDGA 5HKKA 4AG3A 5JZOA 5C37A 4M0PA 4BASA 1YKFA 3FVQA 4AY6A 2E5LB 1SOMA 2V59A 4OLHA 1EX9A 4YAIA 1OH6A 2NU7B 4I8XA 2BKEA 4KN9S 1ZCZA 1AD2A 3LO5A 4X7BA 4LSWA 2X76A 2YJ6A 3LXUX 1P81A 2NNLD 4MGHA 3QVLA 4U7GA 3FSEA 4OXYA 1RAGA 4J91A 1CY0A 2C1XA 1CUWA 4OSPA 5LQUA 4LK2A 3M2PA 2EQBA 4JZYA 1BAPA 1G8FA 4H0NA 4HRXA 1BCRA 2BM0A 2XH8A 1J7KA 4N3NA 3C6KA 4FHDA 1I6WA 1R0ZA 2AWOA 3RREA 3DBHB 2Z83A 1E5QA 2IXBA 5FPPA 1IQUA 1K86A 3PDIB 3GQBB 4XR4A 2XAAA 2AFIB 3R3XA 4QYIB 1AU9A 1UBKS 4WZZA 3ASZA 4CODB 1DINA 4IGIA 4AN0A 4BX9A 4HGPA 3UYLA 4LY9A 3EXHC 4HEJA 1C9JA 1FQJA 2OCGA 2ZDQA 3C43A 5I7SA 1OLUB 3ITEA 1ORIA 3FUWA 3NRBA 3QE0A 2HYDA 4MO2A 4YY3B 4ZCSA 2Q4TA 4N82A 4WINA 1TF2A 3PFBA 4JBYA 3UJ9A 5LZ2A 1DHRA 3L0YA 1J42A 3R1IA 4QYXA 5FH9A 4OYRA 4RLHA 4JLBA 1ZUNA 5CB6A 3ZV3A 1KF0A 5ALTA 4ZI7A 4G0MA 2LR0A 3KEFA 1HNZB 1U6JA 4XEHA 5EJMA 4WCFC 3KQMA 5FPQA 3RV4A 2MMGA 5E3IA 2EW8A 3SLGA 4DSUA 1ZGZA 3JALA 2I3AA 5CJPA 5AUOB 4X6UA 5JYBA 4M0FA 1Y6QA 3O47A 4RL6A 1NUSA 1WMBA 2XF8A 2JLWA 3OZTA 3L4EA 2YWXA 1Y6ZA 4N0EA 4DKJA 2IITA 1ZNQO 4RJIA 1YBMA 1LJUA 4L50A 4OFBA 3B1KA 1UJCA 3HFGA 1JFVA 1MH1A 5M2QA 5K6RA 3M6FA 2HBRA 4KXVA 2VPIA 1OGIA 4OHRA 3WTBA 2GKGA 4J0CA 2E1PA 3HXLA 1CRWG 5BY2A 2OTCA 5C1DA 3PDHA 2YIMA 3KKEA 2WJYA 3GCWA 4Z9FA 5JNWA 3TCNA 5LZ4A 1EB9A 1EQAA 2P6UA 2ZATA 3NM4A 5EWMB 1U3FA 3RHTA 1OYWA 2B21A 1U7OA 2IYTA 3KVOA 5F3DA 1KZ1A 2LRHA 3H3FA 4RM2A 4U7FA 3IAS6 4IIVA 3WK4A 2REXB 5EG5A 4B7AA 2ZJZA 1IY9A 2O19A 2IW1A 2GESA 1BA2A 2NZXA 1GAJA 3VH2A 4B35A 5BSFA 3RHSA 4GOLD 2XHZA 2YYAA 1M76A 3ILHA 4XIFA 3QKSB 5CH8A 5C8YA 1KP9A 5AHXA 4G07A 1AZLA 3JYLA 4B6EA 1OFUA 1PEAA 2ATEA 2VJNA 1KSFX 3HGTA 3M70A 5AKHA 3QEAZ 1K06A 3IQDB 2CYBA 2WNSA 2HK8A 3QMVA 4Q48A 5FI0B 3ZQUA 1NYLA 2GRJA 3ID6C 1MH9A 4NC9A 3SC6A 4UZEA 4KBGA 1CYEA 1EFTA 4UUMA 2AMVA 3DW3X 4CLEA 3QBTA 3IODA 1G55A 2OVFA 3LIPA 1A0OA 2QTHA 4RD1A 1BOFA 2PMEA 4M7PA 1N36B 1E3MA 2RKWA 2VEDA 3FPCA 1BKSB 4FWTA 2IYVA 2VXCA 4MWZA 4N9QA 4S0XA 1ESDA 4Z4IA 1UEJA 2E4UA 5ICSA 4KQ1A 4DJEC 4YJ2F 3O3CA 2W37A 4D9IA 1GG2A 4BGVA 3AFIA 3DZKA 3U7IA 1LX6A 2CVQA 5AI6A 1FDSA 3EC7A 3D3NA 3M6UA 3L3BA 1GL3A 1XTSA 5DMHA 2BKVA 4DL9A 1TC1A 4L3VA 4V0OA 5IKOA 2OCPA 3CVWA 2J5KA 2PGAA 3AUJB 4L8FA 3B6JA 4AIIA 1QDEA 5EUMA 1YZHA 2QK4A 3FI9A 3DKKA 3MRVA 3TMYA 2FMFA 1NQXA 2C7BA 2EBFX 5I8WA 3RF6A 4B3IA 4BO0A 3QY9A 5EERA 2QTNA 2P3LA 2IYXA 3TR6A 2X1HA 5CIWA 3IAM1 3L7AA 1MB3A 1FDWA 2V4MA 2PBLA 4I99A 1W4CA 5LXTF 2FFQA 2DUWA 1JJAA 1V45E 2WIGA 2DBRA 4IMPA 4JQOA 4Q9KA 5CD1A 4PG7A 5EGSA 1ADGA 1GPWB 2XDYA 4UAUA 4YAEA 4KDEA 2AQ8A 1V6SA 3QXHA 2PO5A 4Q16A 5AMXA 4DRZA 1JHOA 2YTZA 3OTHA 4N3CA 1DARA 1XTRA 2B98A 2VH1A 4UZFA 1IUOA 1JWLA 4FX2A 2B5OA 2R62A 1WR8A 3G2QA 3RSLA 1QTIA 1CUBA 4LSZA 4HH4A 3U4IA 3N0VA 3KSRA 4W1SA 4RTLA 1S3GA 4N41A 2HU8A 5KVQA 1Z5OA 3CPJB 3GJSA 3DAFA 3FPSA 5DHSA 1SIWA 3VR1A 4AJLA 3OOEA 3PJGA 1B74A 1ODTC 1MA3A 2XUQA 4G4GA 3VTFA 5EJ4A 3HN2A 4X6LA 4NQZA 3K2BA 3V5NA 4C0LA 4TYQA 5CLGA 1UDWA 2R8BA 1GNRA 1I7DA 5JFGA 4UAJA 4FYMA 2WAYA 2EJBA 2QTTA 4HK4A 3QVSA 2DCUA 3B1JA 1MAWA 1Z5UA 2VA9A 1UMBB 1FDTA 5CYOA 3PEYA 1IL0A 1NXWA 3G8AA 1AHPA 2J3JA 4MDFA 1EIWA 2V6FA 4RA6B 2DUUA 4I8DA 2X0FA 1HNXB 4E5SA 4AJ9A 2N0SA 1GL9B 1VJ5A 4ARUA 5FT9A 3ZWMA 2FHSA 3AEZA 4D5GA 5JD3A 1F7VA 4RACA 3RR2A 1Q0SA 1ECPA 1XRLA 2ZUUA 2OHVA 3N74A 5A3VA 2BMJA 3SLKA 2FPLA 4ZC8A 1IXYA 3AVYA 2ZRPA 3LX4A 1YE5A 3NR2A 4KHZA 4BU0A 1TLFA 2J3MA 4D8UA 1YKGA 4HYYA 2V7XA 4L0DA 3QUSA 4LX0A 4PCLA 3UAZA 3G1TA 1NRIA 3D8UA 2FGJA 2R8YA 5KNDD 4EUNA 3CE9A 1OUMA 5IC4A 1SCQA 3CBGA 4BNFA 2OFXA 2FRXA 4ETWA 3OQIB 5B1YA 4QM6A 3V46A 3S8YA 2QB5A 1J39A 4XCVA 4BVKA 3AX6A 4Q03A 3AHGA 1E2BA 1JHUA 3BTOA 4OBWA 3U40A 3UWMA 2GDZA 3DV0A 4QPJC 4XD7D 1N3LA 1L5RA 1DKNA 4I4LA 2BM1A 1HBJA 4L4SA 4PBTA 5TE9A 4Z4HA 5JJKA 4ZEOA 3HI4A 4E31A 2HRBA 3RGGA 1UKAA 3UJ3X 1J2TA 3PWTA 4H7JA 1E4EB 4NE2A 3RJ9A 5BRJA 1NJSA 2OHJA 2YC4C 4I4TA 4YA6A 4PFQA 5HJ2A 1GWNA 3VAYA 2JHFA 1UANA 1NX6A 2C8JA 2PAAA 4ZAYA 5ES4B 1QFZA 2Z08A 5I7HA 1XMQB 3PD0A 3ZKAA 3NOXA 3JAWA 4CIAA 4PN3A 3PNYA 3FNHA 3OJCA 1U5BB 2XZDA 1Z2CA 1M1ZA 3Q9SA 3DGFC 2J08A 4C6SA 4D92A 4EHBA 1VSBA 3EVFA 3I61A 2Q3MA 3G68A 1Q83A 4GMFA 2C2WA 4NV0A 3HMQA 2PHZA 1DKLA 1VECA 1RRMA 3N8DA 5JSYA 5KX5F 3M8KA 1U3DA 3E61A 1G0NA 3VC7A 5CDUA 2F90A 3OZ7A 3C8MA 2LIPA 3NV9A 3GHHA 4E3ZA 2JD1A 2AN1A 4KSBA 4MWCA 4P3OA 4ZEVA 2OV3A 3THWA 3G9QA 1RQXA 5EZ6B 2R1VB 4D4LA 3CH6A 1JG1A 3H84A 3IKTA 3GB9A 1E6CA 1G6OA 1YE3A 2O0HA 3IVCA 2WYWA 3TX6A 5IK2A 3TXXA 3V1TC 5JSZA 5KU7A 1ST2A 2ZRNA 2B3DA 3LDAA 4MB2A 3DBLB 4YPFA 2H5LA 3IVMA 5IAKA 4DLXA 4MUNA 2O2IA 4WXRA 1EXWA 2VP5A 4MWEA 4H1HA 5KDDA 4UE3S 1SC3A 1J00A 2BMWA 1Y89A 3HXKA 4N5MA 3T9BA 2GSDA 2QWXA 3PQEA 1T3HA 3ANSA 4BQEA 2DC1A 1GZ7A 4BEVA 5KPJA 1E4OA 2PJZA 3JQ8A 4QJ5A 3UUGA 2Q0XA 4O02B 1IEVA 1SC4A 1TD1A 3I04A 5A5DA 2C54A 4GYKA 4K88A 1NUPA 4RK5A 2VOEA 4ZTBA 3SC4A 1W6RA 3RK1A 3DMNA 4GC5A 2HLNA 3T9FA 3FNIA 3W4KA 3EQ8A 3M83A 1CR1A 3FYDA 1ZMXA 3QELB 1HFKA 4M9ZA 4MRNA 4ALMA 4DCGA 3U0BA 5H83A 4YASA 4XZ3A 4G86A 2YJ5A 3FZGA 3O7WA 5CT6A 2X8LA 3O9MA 5HKKD 2FVYA 1XDGA 3FBWA 2DY0A 3IPYA 3KD3A 4G4JA 2BZ1A 4JL6A 1N7IA 1M74A 2O8DB 1A50B 3I9V6 5E4TA 4P4SA 3SF8B 1OLSA 3DPSA 3UAVA 1F4VA 1VHQA 2PS9A 4MV7A 4S1NA 4ND8B 4NECA 5AW6A 3TBFA 5KVSA 4HNUA 2GZ1A 1GYPA 3WFIA 5BV0A 4XPIA 5D84A 1IY8A 3WHIA 1RCUA 1AUXA 1X3SA 1I7LA 4NG4A 1WSDA 2IWHA 4M2LA 1JI3A 2GPYA 2A0KA 3AMVA 2GBIA 3FGNA 2OLEA 4G25A 4E32A 5JJLA 3K0HA 4PBRA 2UUAB 3SQXA 4J1TA 1AKUA 1KU6A 2WPDA 1J2UA 3OSUA 4IDDA 4MKZA 5LP6B 1EWTA 5TQ0B 3HVHA 4EKNB 3HG7A 1GTVA 5AI4A 1TZJA 4EI9A 1NW3A 3I34X 3IR7A 3U80A 5TVGA 4HNVA 1VL5A 1ORWA 1U0LA 1ZW1A 3BDAA 3GI1A 4RDCA 2QRLA 3KOOA 1ONPA 4LJSA 1DRVA 3EISA 1FVXA 3AB8A 1FFWA 3QPDA 1UJNA 2NZVG 4D42A 2PZ8A 1QO7A 1BW9A 3EGCA 1QFSA 1NVMB 2YN2A 4IIJA 2I2WA 3AM4A 1K2WA 1MFZA 2O4CA 4I5FA 4TYPA 3W5VA 1XMJA 1L3CA 1Y9DA 3KKPA 1EDZA 1PR1A 1T8WA 2Y6VA 1LPMA 2JL1A 3EZ9A 4ENQA 5J1SB 4Z53A 1TGYA 1INLA 1TGVA 1YZUA 4JGGA 4FFVA 4YK7A 1FFGA 4RXUA 1S2OA 3NLLA 4QBGB 2ZTMA 1SC6A 3IAAA 1ULHA 3PQ6A 4QUEA 2GMWA 3UYKA 3T5MA 2IA5A 2LKDA 2ZPAA 3WHPA 1PL0A 4MV1A 3NS7A 4ZMBA 4HEHA 2VKTA 1UT8A 2Y1OA 3KUDA 4QVKA 3DYVA 3NUGA 3ANMA 4DIDA 5CCBA 1WETA 2R6GA 1MEEA 2GSWA 3KUCA 2PTHA 2PN1A 4NBUA 1VMKA 2AFVA 3OQ6A 4TVKA 2HMVA 2H6EA 2O3TA 1T5DX 3P9KA 2HJRA 4KHPB 1N78A 4D3DA 3AEUB 3DHEA 3HKEB 4YO7A 1GNLA 1Y1TA 4B8WA 2W8BB 3EE6A 3WL5A 1DC4A 1WP4A 4PS0A 2QAGC 5TIIA 3AI7A 4O8ZA 1GLGA 1DB3A 4C14A 2ERYA 3SAJA 1WE2A 3BMQA 2WUVA 5G0TA 1P2SA 4ZOLA 1AQNA 1C14A 3OLYA 3AIKA 4BP1A 4DC0A 1NV9A 1DQSA 3INYA 3VPCA 2OMKA 2ASEA 4YHHB 3WB1A 4HRYA 2FI1A 3FJOA 5KYUB 4R2WA 3E3NA 1XHFA 2GK7A 4NCKA 1P3Y1 4GPTA 1TPZA 2UKDA 1T9AA 2ODAA 2FHPA 3NHSA 3TEMA 3WL8A 1JR6A 4AF8A 2Q4DA 2EARA 3L6CA 1UQTA 1HE1C 3ZU3A 2II6A 5FBHA 1ADJA 4C3VA 4K6MA 4I14A 2E5WA 5E1MA 3U16A 5EQFA 2X1LA 3WJ2A 4BRSA 2ZWOA 2D1YA 5TGDA 3LQYA 1WLSA 1M8FA 2BFAA 4G1UC 2BHLA 4A7PA 3EZLA 2Q6LA 2ECQA 3DZJA 3OPQA 5CGQB 2CMHA 5CJJA 3N6RA 3SC3A 2Z4RA 5IKPA 2RGRA 5IKMA 1OXTA 1XCLA 4JBLA 5CX4A 5FOUA 3TTUA 1TAHA 1PR6A 3TCXB 2HJHA 4AN4A 1CRZA 1KZ7B 3SDSA 3TUIC 1TQHA 4LGVA 2AOVA 2IIPA 5FOQA 1O5IA 5J5VA 5A4AA 8ABPA 3T5CA 3OCZA 2Q1XA 1TXGA 3QWIA 4UM5A 1YMQA 2YHSA 2WM3A 2K7ZA 3BB1A 3HBNA 3L4BC 4N6GA 2JGJA 5FPYA 4E5MA 2BGNA 4YRKA 3DW1X 2RAPA 4CIVA 3AKZA 1WIWA 3BAZA 5JAPA 3DE6X 4NBSA 3R0IA 3R5SA 3TLEA 2WD8A 1J1ZA 3FSGA 3T54A 3HE3A 1BFUA 2R5FA 1GM5A 3HDVA 2NVUB 1M1NA 2VTKA 3DC2A 4MVJA 5KDOA 4GX5A 1KVTA 3K70D 1ONSA 2JJQA 1UK7A 2NO7A 4PPGA 3RJTA 3W04A 4ROTA 1ZNXA 3Q6MA 3QF4B 2ZREA 4OM7A 1M0TA 1QCCA 1COZA 2O4UX 4GI1A 1V25A 2IKSA 4WLOA 4MZDA 2DHCA 4QXPA 1DBVO 3GLUA 3DXYA 1XEXB 5EQJB 2NZ2A 1C1DB 2HPVA 2ZB2A 3C70A 4OQDA 1H65A 4QPNA 4Q3BA 1L5WA 3IAHA 1DUIA 3U81A 3B36A 2FW7A 3DEKA 4OAQA 4TLCA 1XRSB 4IOKA 3SQWA 3TW8B 1NT4A 4BX2A 2Y67A 2ZIFA 2FPSA 3NH6A 5IFKA 3MWLA 1SHJA 1JDSA 2OV4A 3COZA 4MJLA 4DA4A 1JSRA 1ZLYA 4IV5A 4FD3A 5AXCA 2W0SA 5SYNA 5IPFA 4JV5B 4ZJZA 4RMNA 2Q4EA 4P58A 4IIEA 4C76A 3EY9A 1X2EA 3KFXA 2JFYA 1E5TA 5JDIC 2H2WA 2CSXA 2OFWA 1JR4A 2CDBA 2Q4OA 2ZJBA 1VCOA 2B94A 5HPYB 1WLYA 2WC1A 1CUHA 3H8JA 1RHMA 4WERA 2GEKA 4UDNA 5KNLA 4MS3B 2OV2A 3IVXA 3P32A 4CIXA 1JHPA 3EPKA 1SIBE 1T36A 1GITA 3MLEA 4Z4EA 5DCLA 2BFFB 2X6RA 3A4TA 4I0WB 2FDXA 3LCUA 4TTVA 1TX4B 2F3RA 1JKJB 2IY7A 5D6NA 1GRCA 1I3MA 1MG0A 2XQGA 5E4FA 4CKBB 3BMNA 3QENA 4MQFA 3TFWA 4MW7A 3I12A 4DC9A 4NZPA 4HWTA 2H1WA 3D6HA 2A9VA 4H59A 1JN0A 2B0CA 4IWNA 1LI5A 2ZBPA 4NCIA 2QQGA 1PLLA 1POWA 3S8MA 4QOJA 2WKQA 1DPFA 3HJBA 5DB4A 2G5GX 2FXIA 1MX1A 3GVPA 1AUOA 4DLBA 1NGSA 3FCAA 3GLRA 3O92A 4N1AA 4RE5A 1NV8A 1W87A 3KALA 4WX2B 3K30A 1RI3A 5C46F 1N2EA 1SPXA 4C88A 1U8YA 4ONEA 2W22A 3OCYA 1HSZA 4JOCA 4O5AA 1NXVA 1Q74A 3ETLA 3C6MA 4N48A 2QP4A 5TY0A 3AUSA 3JQAA 1BD4A 1D5CA 4MVJE 2W8ZA 2HFJA 3QBJA 2J5XA 5TMPA 2H1HA 2B8JA 3PSAA 4ZHQF 3LHIA 3LWNA 4FLFA 3LC0A 4O4JA 3UCEA 3WLSA 3B6IA 4H7PA 4EMSA 1SVWA 4NK4A 4ZI3A 3S8EA 1FMFA 3ZI4A 4EAQA 3GFOA 1DO2A 3GLHA 2K2QB 2QGNA 4QSHA 4KQEA 4ZT7A 4XVQA 1P5RA 4X6XA 2DBQA 3FR8A 3IKVA 2XXAB 4FP9A 4DWJA 1J8QA 1UOEA 5DCYA 1LW6E 4WN9B 5SYAA 1ENPA 3LCRA 3Q2KA 4O1HA 4BL5A 5BQFA 2XRFA 1IY0A 4D98A 4YAOA 1WSWA 4XRRA 1R8SA 5GVSA 1YOVA 3O0DA 4R1UA 2Y1WA 3TVDA 5KJFA 5DVZA 4ETNA 2JFQA 2VSOA 5EJ7A 3RJZA 2HF8A 3DSRA 1GTL1 2PEZA 3QA3E 3R5HA 3WLRA 5MN5A 2HRQA 2AUTA 2F9LA 3SHVA 5LQJA 3BCHA 3ITNA 1XZJA 1AKWA 1BHQ1 2FLWA 3ZE2B 5HSGA 2UXCB 2XD4A 4KQXA 3K4PA 5IHPA 3AI3A 1YC2A 3FCUB 3DLPX 4KE9A 3VKVA 4ERXA 1ZGCA 3CJRA 2BRUA 3BRSA 2C5AA 2AC4A 3A2LA 5BSRA 3RIHA 3SIWA 4B34A 4I1SA 1XROA 4GMKA 1Z08A 4PPYA 2V97A 5IK2D 5JD5A 1RWBA 1W5EA 1AE1A 2JH8A 1JVBA 2WY2D 4C05A 2KBFA 1GAEO 2JB9A 4KQCA 4IKOA 4BATA 2QROA 3THOA 3U44A 2HIMA 1UZUA 1XL0A 2JCVA 3WLJA 3DO8A 4NPCA 3I53A 4D3ZA 4Z51A 1X7WB 3ORRA 3SYKA 1ZXBA 2H4YA 2ZI5A 3R09A 2JD0A 3R3JA 4WD3A 3VJLA 4JQCA 4WKOA 2YWBA 1G60A 1RLMA 1JIJA 3DZGA 3DLTA 1W0CA 4O08A 5HIMA 5FL7A 5FQNA 2CDRA 5LNK6 1XTVA 1ZW6A 5JXHA 1HO3A 3W05A 1LK0A 1XWIA 1WUYA 2J46A 4PXYA 1GVNB 3JQGA 2ZRFA 3ET5A 2O23A 3PNQA 3WDMA 5I48A 1AKMA 5L7TA 1SXHA 1XO1A 1MT0A 1QIMA 5AW9A 2FSVA 3Q1LA 2ARKA 4N7BA 4FT4A 1L7DA 4M1MA 1RC8A 3HJFA 5ERGB 4GFDA 2ZG6A 1SRRA 3QP9A 1I3LA 1VHDA 4HN2A 4X00A 3Q85A 4F4IA 5KYTA 3P9SA 3KCQA 4JEMA 1X15A 4YLYA 4C2UA 3LX6A 5FULA 4JHLA 3OPNA 4I08A 3CUTA 3AUKA 3D6MA 3TW0A 1UP4A 1U8FO 4HNAB 1EWVA 3RS8A 4QO7A 1Z7WA 1FVFA 2AHRA 3VR3A 1YCFA 2FMHA 1NYRA 2AXNA 4GNRA 2QLJA 4YHBA 5C8ZA 3RVJA 2A7QA 3L8DA 1VKRA 1YB2A 2WPDD 3HY6A 3MELA 3NYIA 4D41A 3SCZA 5KQRA 3O4HA 3EBPA 5FLYA 2GUWA 3OJWA 1BXRB 3GJZA 2PU7A 4FN4A 3ZY6A 5A2QA 3EVTA 3ET4A 3Q12A 1O96B 3HR7A 3QLTA 4HNQA 1E6LA 1H4TA 2FEAA 4OK5A 3TL6A 1R5JA 4IIYA 3ZDXB 4EIWA 1ZSNA 1U6IA 2XNHA 2WJWA 2CN1A 3EW7A 3GMIA 3LF1A 1DJQA 2GWRA 1ACJA 4AMUA 4JBGA 4R2KA 2NUBA 5DHTA 5I9NA 2Y92A 2ATXA 2J9XB 1B43A 3K2IA 3LT1A 5EIFA 3U31A 3JZMA 1TRHA 2X0JA 1PSWA 3TEJA 4O2AA 4H3KB 2O48X 3SY8A 3OZRA 1SXGA 1Q0ZA 1C3LA 1HTWA 4E1BA 4CBVA 3B3GA 5CMLA 3V4PB 2R8PA 2VF7A 1GG5A 1NLMA 3GVCA 3IQZA 4LMRA 3SD7A 4CCSA 4LYYA 1ZVQA 5L4LA 2IY8A 3C48A 3FLMA 4Z9BA 1I2DA 1MJGA 4FFOA 1JWAB 2A6PA 3HL0A 5C0OE 1QTRA 1WXDA 4A91A 3WLMA 4KE8A 4MQ6A 4JB3A 4EUSA 2XYHA 4UPVA 2B6NA 1Z6ZA 1NKSA 2DFNA 1ZPDA 2FE4A 2FCAA 3V1YA 5JH7A 2EGHA 521PA 3AOEC 3REOA 4B85A 3SBEA 1JP7A 4IVPA 3DMTA 1SQGA 2WTBA 1D0VA 4KQFA 2XGGA 3TTXA 2BFDA 3W5IA 2YN0A 4QPZA 4AK9A 1RR6A 3R0JA 5F5LA 2WIKA 4IGKA 3ZDZB 4CNBA 4DUGA 2RHWA 1J09A 2ZANA 1CJUC 1JKFA 3PDCA 4JSRA 3ZN2A 3RF7A 3CX6A 4XQCA 1GG9A 2E7ZA 3J80A 1NQAO 3QOFA 2HBYA 1DCTA 1WDTA 3K72B 2H1FA 4WK6A 4J0QA 1QGED 1YFZA 3PWSA 4O4JF 4Z6KA 2ZUEA 3W2FA 2OZVA 1GVHA 1MENA 2AJDA 4PQEA 1E6KA 2BFMA 1AMNA 2F4VB 4Q4CA 1IVNA 1QG0A 2MYNA 3FWPA 3JQFC 4LBWA 3CEAA 5M3BA 4XYLA 4Y6OA 3X44A 1D3AA 2PGOA 4U3JA 5FAKA 5GM2A 1S6YA 1FPQA 3PC7A 1XTIA 3MWEA 3C6ZA 2HU7A 3QHPA 2POCA 3BJMA 4ID9A 2WHPB 4R9NA 2PMBA 3L92A 4Z8YA 1C1XA 1T29A 2BHTA 3AB3A 5LOVA 4RVGA 1YI0A 2QENA 4RHEA 4M87A 4LY6A 3SE0A 3FPHA 2Y1EA 2D59A 1X42A 2NTEA 3Q7IA 3H9BA 4KX3A 1AA6A 4NJEA 2GCNA 3BSFA 3UJ8A 3GCGA 1ZOOA 3H05A 1KMHB 3COWA 1XV5A 2OCDA 5BN3A 2X14A 4DN6A 3MUOA 2JFVA 1CUSA 5A2GA 1ZSVA 3PXCX 2EP8A 1KBOA 1T2UA 3MJSA 2CDNA 3E7XA 4NIMA 4B6SA 1I9CA 5JS1A 3EAQA 1NA5A 1ZJ6A 3VHRA 4CTOA 3TW4A 1EUDB 4E5KA 3NFRA 3DVSX 1A9SA 4WGFA 3ER9A 2IYWA 2MDTA 3FSGD 3S1LA 3TW6A 2G71A 2PIAA 4KWIA 1UWLA 3A4YA 4B44A 3FPBA 1M2EA 1YIOA 2A1UB 2GVNA 4MVJD 5JYCA 2QTWB 3PNSA 4UASA 4EKIA 1F2DA 3JASA 4WUTA 5B64A 4MITA 4RLSA 1E2HA 3DLHA 2JCSA 1N9ZA 4FILA 4R7ZA 5IUJC 4JLMA 1IUNA 2HK7A 3V3KA 3BQMB 5CNMA 4RPKA 3T5TA 4J0FA 1YZKA 2PSFA 2YZNA 1SB9A 3AFHA 3BOSA 2ZTLA 2C7PA 3TLGA 4QU0A 3PE6A 2B6HA 4RFLA 4O59O 2PX6A 4YV7A 3ETGA 1G9TA 4QQNA 4WA8A 3TIIA 2QRKA 4BDSA 2PD6A 1ZS9A 2BHRA 4BFSA 4YRBA 4A36A 4BUJA 1QH1A 3ZJUA 5ALXA 2QD4A 3FJ1A 4HJXA 4OSOA 4P32A 1SC9A 1C4WA 1X1BA 1P5JA 1Z0IA 2IYFA 2NTJA 1GU7A 1QORA 2OWDA 2UDPA 3JQ6A 4P9NA 5B2ZA 4AKTA 3WLPA 4E2FA 1B73A 1DP4A 1Y7HA 1O0SA 3ICOA 1LEHA 5IDQA 3CSDA 3B3QA 1NSFA 3DT6A 4Y9SA 2OMEA 1QR2A 3T1YB 4WJKB 4M1ZA 4DM3A 1VYUA 2C4TA 1CE8A 2GF2A 1IG0A 4GMXA 3V8QA 1B16A 1B2LA 1E1YA 1AGNA 1LF5A 2YXDA 3OFVA 4BNGA 4KEAA 4YRMA 2B34A 2OXEA 1P8JA 1Z4LA 2VLIA 4W1PA 1GTRA 4OQMA 1G21A 1V6CA 4WDQA 4LOKA 2VJOA 1M2VA 1MO6A 2DPHA 2I55A 1BGVA 2FPPB 2IQ5A 4J2TA 4ZAXA 1JLMA 4EGAA 2WZDA 5AUQA 1KZ9A 3MJTA 4V1CA 4HLQB 2IEDA 3OETA 5DTIA 2Z98A 4JA2A 1O95C 1TUBA 1UK8A 2GLTA 2ZS9A 4O2AF 1BVUA 4QHYA 1YOBA 1IN5A 5H16A 5ICCA 1C81A 3K9NA 1RACA 3VU9B 3QY0A 3FPJA 3UNXA 1AURA 4AJJA 4ER0A 3ETJA 1N92A 1EPUA 1TW2A 4WHMA 5EE0A 4ZVUA 2XUHA 1VG1A 3H3XA 4Y6RA 3V4VB 5JJCA 1NNSA 1K7CA 4F4CA 5L45A 2PU5A 4FFPA 5CB4B 3ABQB 3OQPA 4RA9A 3VR6D 3VO2A 4QUDA 1PZFA 3RS5A 1WB5A 5DM0A 4HDSB 4MS4A 1FJ2A 3ZDEA 3JQAD 1UT6A 1UXHA 2CL5A 1NDQA 4TRMA 3ZY3A 1Q77A 4CMEA 3D2AA 3ZKWB 1V1MB 5ADUS 3RS2A 2JAXA 1O0CA 1QQ6A 1MVNA 3AEQB 3LBFA 3RQIA 3S44A 3GEHA 1UBTS 2CNBA 1PNOA 3WIEA 1NE2A 7MHTA 2WSBA 2CXUA 2EGGA 2JGFA 4TLLB 1KPGA 5KKAA 3OIVA 3UOGA 1M2GA 4RNDB 2PCJA 4D5EA 4M99A 3RRJA 4ZO7A 4QOFA 4BP9A 4EGFA 2L18A 1JEOA 5HIJA 1CQIB 1FZQA 3GGSA 2FY8A 4DNPA 2OWEA 2IIBA 1TQ8A 1XLTA 4C3OB 3ZVKA 3L0ZA 1EGVB 5DTEA 2VUIB 1YCHA 1V41E 3BD8A 3VM6A 2B99A 2WE8A 1EXDA 1L5VA 4EA9A 3SN6A 2AW3A 4GPD1 3UMJA 5KOIA 2H16A 3GWZA 3QXXA 9MHTA 3KAQA 2PZFA 3R40A 3SS8A 1U2RA 1Y1LA 3WYCA 4K9DA 5HRUA 3LLVA 1QGZA 3UAWA 3HO8A 5F4BA 3P2KA 2V58A 4XDGA 3E9QA 3UC9A 2IIVA 5HQ3B 1TKBA 3U56A 5GIOE 2ISSD 2E4YA 3VNVA 2QX4A 3WKDA 3GJRA 2JAOA 4P3PA 2BJVA 5FL7D 1O54A 1PS0A 2D3WA 3BTSA 4U2DA 5KJEA 5TPZA 2ZUVA 2BBSA 1A71A 4GU5A 3ROQA 4ZMRA 4DA9A 5CDTA 3D43A 4M60A 121PA 2ALJA 2JLSA 2PFGA 2XCTB 3EEQA 2PBZA 4JC5A 5DJ5A 5JAOA 5DYIA 2Z2KA 4BAGA 2PK3A 4WLUA 2JLCA 2L2QA 1L3IA 1NNI1 4R2IA 4F21A 2Q5LA 1DIAA 1OPXA 3QJGA 1QZTA 3VDXA 3WSWA 4BFCA 5EEHA 2O5VA 4EY7A 2WQ7A 2PD3A 1JILA 3DFIA 1KAHA 3AHJA 2GEDA 3PUZA 2QIPA 4RK4A 1DAIA 4A0FA 3IMEA 1V7QA 4B75A 4RJLA 4DWVA 5IJ9B 3L1KA 5E6UA 3EIQA 4GXNA 2AYYA 4FINA 3EAFA 3KQSA 1L4UA 3GG2A 4JZKA 3Q0IA 5IWCA 3U19A 2X86A 4LKOA 2ATCA 3HUDA 3NVDA 4FPXA 2VPYA 1YULA 1KYWA 2W2OA 4LSGA 3VR3D 4F7WA 3CRNA 2GBGA 1CR4A 3IQFA 2CXRA 1BGWA 3E48A 3WWDA 1XCMA 1Q0HA 1I33A 1RHJA 2RCYA 3GJ7A 2ZJYA 3FETA 4RW0A 1Q19A 3D6UA 4G65A 2ZS7A 4WESB 1ECJA 2XB6A 3HXPA 1LQUA 3I23A 4PANA 3SMQA 4JI3B 5TMBA 5C5CA 3HVRA 3BGWA 1DE0A 1CUEA 3DL0A 4EJSC 4G01B 2QPTA 1N4AA 4L4ZA 4D44A 1FRNA 1YNOA 1QRDA 1UMCA 2MINB 1I9GA 2R1UA 1A3CA 1MB4A 1PDOA 4XARA 1OTYA 3UOWA 3WFZA 4ENTA 4ZYUA 3DAPA 2DSTA 3DTYA 1S0UA 3K1JA 4C43A 2IE0A 4CW7A 3AM3A 1T15A 1XTJA 1LSOA 3Q2IA 1VCMA 2WKPA 3C5WP 4PTYA 4G81A 4WK4B 3DOHA 2YQ4A 2P2SA 3RYCB 4D3SA 3MW8A 2J0UA 1OHHA 3DZFA 2O20A 2GFHA 3T7IA 1IJEA 3DMFA 3JW8A 4LJKA 5J2TF 1WF6A 1U9IC 4ZPJA 3TK1A 3WA7A 4B74A 3MCTA 4J0IA 4FB4A 3HRHA 1Z82A 1OAOC 4UM9B 5HXAA 1SBNE 2NOAA 3NX4A 5ER6A 1OBHA 2ODWA 3DYIA 3T9EA 2ZB7A 2XBLA 2O8FA 3PP8A 1Z5PA 2WNHA 1V3VA 5JPIA 2V7QA 3PKIA 1QE3A 4EB8A 1ZISA 3U49A 2MTBA 5EA2A 1Q0PA 2B61A 2X42A 3HS3A 3L06A 4J3JA 1L5FA 2AXQA 1LWOA 3U7QB 1Q0TA 4PQGA 4Y30A 1ZOLA 1RWOA 1PDWA 3C45A 3G6WA 3PXXA 3G2OA 3MJCA 4Z7QB 5JTTA 5BYKA 2CK3A 3HKCA 1YZFA 5E9WA 1EDDA 5CYFA 4OBBA 2VL7A 3UT6A 4RHCA 1VL8A 2EFGA 4LJ4A 2Y99A 5LSAA 4I9NA 5H5JA 3DAYA 4ARIA 1Y8ZA 3E2MA 2VUUA 1U0SY 2XUIA 5ALJA 1KAMA 1TCAA 4N7JA 4YC7A 2WD9A 3LBIA 1LDEA 2IU3A 1C1HA 1XQ9A 4QQRA 1OIXA 4W8HA 1I80A 5IDYA 1QZXA 3U0VA 1KY5A 2TMDA 2Q9CA 4EUKA 2RAUA 5TQ2B 1EJ0A 3IR6A 3RK4A 1QKKA 2HCBA 2QVCA 2WI8A 4XQ0A 4E2XA 2I03A 3OE1A 1XOIA 3GOQA 2D4HA 3V7FA 1QQAA 1U4SA 3ZGLA 2MR5A 5GMOA 3WRXC 2IS4A 1Y3CE 1ZINA 3CIFA 3IDQA 5BSTA 1B6GA 5ALQA 3UK1A 3IHWA 2ATIA 4FDAA 4XQEA 3WZLA 5BSHA 2BF7A 1REQA 2FSSA 2DUMA 2RGNC 4DA0A 3G59A 1Y9AA 1IMOA 1N2HA 2J9FB 1Q1GA 2L82A 1MW9X 2Y1GA 3BHJA 3NHWA 4Q4HA 2UYQA 6Q21A 5PNTA 1AB6A 4K6HA 1BVRA 1NJ8A 4NG5A 5JQWA 3GUCA 5F3RA 4LJLA 4Y2VA 1SXJA 1UADA 1PJQA 4Z0HO 4F96A 3ZU4A 1N8TA 1JFTA 3OQHA 5K0GA 4Q1BA 2P6MA 1JJIA 2JJ8A 3AJAA 4K86A 1DEOA 4X8LA 1SD5A 2HRRA 4NOJA 4EVQA 1S2LA 2ZBVA 3HBJA 2J07A 3U3RA 2BI4A 3CUSA 1GQYA 1WF3A 1P77A 2VDQB 2WUEA 4ROSA 1BH6A 4BWGA 1A8UA 3P2OA 5H82A 1XQ6A 1IM5A 3TSWA 1SRQA 1N3BA 2NU7A 4HYEA 1AJEA 3CRZA 1ZCAA 1GGNA 1MX9A 2H08A 4TMVA 4R1LA 5ETJA 1VJRA 3SKVA 3LVFO 4Q3EA 4WIAA 2VK2A 4IXDA 4WW0A 2Q2WA 2Q6IA 4JENA 1F1BA 2TSYB 4D7AA 2O8CA 4V2IA 3ESRA 3AEKB 4CT4B 2YZ7A 2VQSA 4UTNA 2EFCB 5L3VA 5LR6A 2ZZNA 4DRXB 3I76A 3QE3A 3F7NA 1PR0A 4LWOA 3RTDA 3M4JA 4EECA 1HOTA 5KHAA 3PITA 3OMLA 4NPHA 2GPAA 3E9DA 2PT9A 2O3RA 1X86B 3T1OA 5T4FA 5T4EA 2QVZX 3A9CA 5CU7A 3EIOA 3PDIA 4GLOA 4GGOA 4LYAA 2AFIA 4JYMA 4NBKA 2BV3A 1RWQA 4GNKA 3KC2A 1UAYA 5FHRA 1LQ2A 2V7GA 1RXYA 2GVZC 2P9FA 4BVFA 4PFSA 4HN9A 1NN1A 3EVBA 1EA7A 3R2JA 4DZTA 1OLUA 2J7KA 3E0XA 5KYWB 2YINC 3TRJA 4RK1A 1G5PA 2QL6A 2TS1A 2WJGA 4L0QA 3FW1A 4RXTA 4URUR 5TVKA 3DWGA 3TLZA 4LVNA 4BJ1A 1Y4UA 4J29A 5E4YA 3SEZA 5GV7A 1F4LA 4FYVA 3HB0A 2BCEA 1PUJA 1P7YA 3USES 3O90A 4G1BA 2HQRA 4M9QA 3NC0C 2RHDA 2KI5A 3WOVA 3H5IA 3ZEIA 1BRMA 2EKQA 4O4IB 2OYRA 2ZWPA 3TD6A 1CY8A 2VPZA 4FFSA 1TPYA 3Q1KA 2QA5A 1I01A 3IUSA 4GM4A 3UC5A 1NY5A 1R6AA 4MVJP 1EVZA 2G1KA 1QX3A 3B82A 4U5XA 1KMMA 1W5TA 3G23A 3GLVA 2ZRMA 4I55B 5CH3A 4E11A 3G2HA 1FVHA 2HU2A 1L1EA 2EGUA 2FGKA 3KZKA 5HCNA 4Y18A 2EC5A 2NTNA 2A14A 3Q88A 1IB6A 1XHLA 2PL5A 4HB0A 2XQKA 3MIIA 4KWTA 4AXBA 4EUFA 2VK4A 5J58A 1NVKA 1B8VA 1L6IA 1NASA 2IUYA 3NB0A 5JS8A 2YFHA 1O3YA 4G84A 4NFHA 1IVYA 4ISBA 1UJMA 1YJ5A 3VHQA 4URZR 5C8XA 3DT8A 5EWMA 4RMGA 1KVRA 1X7ZB 4IXMA 3EIWA 3BXXA 3KBBA 4A6PA 3TB6A 5GONF 5KSWB 2HNBA 1MC5A 2JAPA 2CMGA 2QGFA 3QUTA 2L19A 4E4TA 2C61A 4WKPA 1VA5A 1JLHA 4GOKA 4JFAA 3GPDG 3QKSA 5EJIA 3NEJA 5L7YA 4R83A 5LBIA 1QQTA 4GGPA 3JYHA 4C6RA 2XWBF 2MSDB 4OP2A 2VXBA 3VSDA 2ZJ6A 3GP8A 5C3MA 5ED4A 2GYUA 3B9QA 4ZRNA 3JWHA 4I9HA 4M7OA 2M2IA 1JU4A 5JPCA 2L17A 3IDAA 3V1NA 1WHTA 3PCXA 4IIHA 3DZHA 4HRVA 3RHFA 1Y81A 4HDOB 9GPBA 2I1VB 1HWYA 2Y6UA 3SSNA 3BFPA 4IDFA 13PKA 1ODKA 2DOKA 2RGWA 2O06A 2BFOA 5KTMA 5EJAA 1AK2A 1BDMA 1AF7A 1D6JA 1WXQA 4L16A 2HKIA 4ND4A 2A57A 4KXYA 3KQNA 1RXUA 2C4NA 2ZYUX 3D2BA 1V37A 3HJCA 3MJHA 3OKCA 2HPHA 3BULA 4Y98A 4LJYA 3WLAA 2P2ZA 4FHFA 1GOTA 1JPUA 4V2UA 3E82A 1CQJB 4OG2A 3IL2A 3RS9A 4OH1A 4B8YA 1QAOA 5HJ5A 1NJ5A 3G9ZA 1GZ5A 3AF2A 4KGZA 4ODIA 3REFA 2KHZA 1QTNA 1XMPA 2FH5B 4ON9A 2ONKA 4RQTA 5HM8A 3ICEA 3BEDA 4V0QA 1QGYA 4PAOA 2NSDA 1I94B 1M34E 2IOQA 3JVUA 1GAQA 2BISA 3KS9A 4QULA 2QVLA 2FFHA 1KPIA 4XCQA 3B3AA 4GRIA 3SHQA 2R47A 4Q3OA 3W4JA 5HFJA 3KZXA 4XVUA 3R0QA 4I7EA 2ZETA 3BL6A 4EQ6A 3F4KA 2C83A 1K5PA 1UDAA 1J2JA 3BXOA 2O8BA 3BK7A 3LYAA 3ZXXA 3H83A 4DG5A 1XDBA 4F3CA 1EXMA 3GA0A 4JVLA 3ICWA 1B26A 3IVGA 5L3RA 2MYTA 5TPWB 6AT1A 4BVAA 2CVFA 2I6UA 3AG5A 1ZN2A 2GDJA 3R3WA 3A05A 3OPYA 4IH1A 4OXKA 3U3MA 5AD1A 2ZBGA 3BVPA 3L7YA 3QWBA 1NURA 4FEGA 2BP7B 5DK4A 2REOA 2G3YA 3WMXA 5TRTA 5FL3A 3AU9A 2AV6A 4K81B 3HJRA 3HKDB 4US0R 5TPZD 1ECBA 1GUBA 2ADOA 2WWRA 3LTEA 1ONNA 3CIOA 4ZU3A 1O03A 2NZYA 5ALRA 4QPPA 3S1SA 2GBCA 2PKRA 1U3GA 3AP3A 3C3PA 2NZJA 1IH8A 1WVMA 4H35A 4PQRA 3NNSA 4UULA 1TW3A 2EERA 4W8GA 5IT4A 1S9HA 4U2GA 4FMDB 4OF4A 4JI6B 1BH2A 3AF5A 3IKJA 2ZUCA 4GD3Q 4YRDA 3GPIA 4AUMA 4FR0A 4HD8A 1OLOA 1W35A 1YZ3A 4NONA 2Q6TA 4CQLB 4O25A 2ACKA 3TRHA 2O59A 5AW5A 1QRUA 5JW6A 3Q9UA 5EIOA 2XCIA 3PXUA 3RVOA 2PRJA 4GECA 2QQFA 1SK9A 1BJRE 1GSOA 1Y3HA 3BE4A 2ZB4A 2W6MA 1YAHA 3M7IA 3IVAA 5IJ0B 5LQRA 3QW2A 3JYPA 1UKBA 2HX1A 1LBIA 3NWBA 3NBQA 5CW2A 5JY6A 5JWRA 1Y5MA 1E5XA 3L7BA 4HSGA 1QPBA 2PRKA 3J81k 1E3SA 5AJWA 1QZ3A 3STUA 4EITA 3H9GA 2J59A 4HADA 1G8AA 1HRKA 3ESAA 1YB5A 3D7LA 1FC0A 1LJLA 3MUNA 5BT8A 3K71B 1NPYA 2I7DA 3WNQA 5LQMA 3AKCA 2FZGA 3WO1A 2CV0A 2OA0A 4WBNB 1N2BA 1MRZA 2ZAGA 1VYTA 3KKLA 3EEBA 4KXQA 1NQ5A 4J16C 1Y48E 3OQIA 4XX1A 3UJBA 3KHUA 4E4YA 4QGSA 3DLBA 1HM5A 2X1VA 2A2ZA 2GN2A 3RV3A 1GDHA 4ZCTA 1W46A 2DWPA 5DI9A 3S70A 1J2RA 9ABPA 3BIWA 3L7IA 3ZR4B 5IABA 5IULC 1R16A 3CZRA 4YCDA 5SZHB 1OHHD 2G4CA 3PEVA 1T0BA 1RWWA 3LT0A 4UCQA 4V03A 3TQQA 3WSVA 3JWEA 3O93A 1QHEA 2O3SA 2V9PA 3FYTA 4ZZIA 2EAUA 4JKYA 2D06A 5BXQC 3LBHA 3VYVA 2JGRA 3MAJA 4NYIR 4P82A 1N2ZA 4H27A 1AS3A 1QH8B 1B14A 2NO6A 2NPFA 4B33A 3GN1A 5AR1A 3ESDA 3VPHA 2ZSHA 4JB2A 5SZKB 4HVCA 3JTMA 4MI6A 2QV7A 2V7QD 2UYOA 2RHRA 5ADWA 2AG0A 3QYFA 1BYUA 2PLRA 2WWVD 3RRBA 1U5BA 4BIMA 1TZCA 2OKCA 3IP8A 1PR9A 5EJFA 4A15A 1WCXA 2EX0A 5A6SB 4CM6A 1S89A 5FTMA 3R7SA 2OOKA 2DZDA 3QWFA 1EFKA 3PXEA 5CM9C 2CK3D 5JTUA 4YV0A 3ZDBA 2P6PA 4C7BA 2VNSA 4MUYA 5KKNB 1Z06A 3KT0A 1J0EA 2GCEA 2MSWA 3KQKA 1N6KA 4LF9B 3B3JA 4BJ3A 3BKWA 4G0WA 3L8CA 4PG6A 4JMPA 3Q8LA 1OT3A 3WLTA 2PMDA 4YT5A 4ZC1A 1I1QB 2C07A 2WMDA 5CHYA 1KQPA 3PE4A 4LYFA 3DBLA 2VDJA 4L51A 4NRDA 2HWWA 3MJEA 4ZK6A 4RDXA 1T5TA 3HZZA 4NYIQ 1KNXA 1R74A 2OO3A 2BTOA 3RT1A 1FDRA 4N7RA 4E03A 1G4UR 3AR3A 5JWHA 3WZ2A 2PJUA 5F7ZA 2A58A 4G5XA 1WUTA 1YR2A 2FPMA 5AKYA 5DGDA 4PSUA 4B84A 1BZYA 1WU8A 3LWDA 1RZRA 1E89A 1NVTA 1QHXA 1W94A 3CW2A 3H65A 4UUQA 3DOCA 2J3KA 2ZKIA 3SM9A 1SXJD 1SVUA 2WQZA 2RGYA 1JDJA 3CYFA 1MABB 4C22A 5FBQB 3IOCA 3QG1A 4DC1A 5B58C 2I2AA 2CBXA 3HLKA 3PFKA 1NPTO 3QU4A 1X74A 3QELA 5L9AA 3OU7A 2W2PA 4IS2A 1XZEA 5KDLA 2DERA 2VBFA 2FZKA 2E6KA 2EU8A 4Z49A 3TI7A 4PM4A 4G63A 3UT0A 3T8YA 1GZUA 3M34A 1OD6A 3WKAA 3CCFA 2C31A 4KR3A 3A6LA 3DTVD 4QAJA 4KV9A 4O4HF 5J2UB 1BXGB 2E5FA 3X1DA 3H6HA 4B32A 3I37X 4DUPA 4ND8A 1J22A 2PRIA 3GRZA 1WCIB 1L5MA 3BXZA 3DDCA 3UAOA 2JFHA 2ID8A 4JLPA 5U4XA 4J43A 4B0OA 3EVEA 3IEKA 2VK1A 1U04A 2HMUA 1VHJA 3IA2A 4UHFA 5A7FA 2ODPA 3QFHA 4OJYA 1T6NA 1EHYA 2P2GA 1J0CA 3K0AB 5LP6A 1CZUA 1H2FA 1QFYA 3L6UA 4KIFA 4JBNA 5TQ0A 5KREA 4ZAWA 2H65A 2NPIA 2ZYTX 3V4FA 1IN1A 4BYMA 1E8MA 1ETUA 1HGXA 1O8BA 1TT5B 3H4TA 3B6MA 2HCRA 1M2HA 3ORYA 3OZDA 5TT0A 1E2DA 3AY6A 5BN1A 3K9HA 1T2VA 4Q6BA 1JYEA 1W8IA 4X92A 4BQQA 1ZD4A 5AW3A 1XMVA 2I33A 2I7VA 1DLJA 5A3SA 1JGTA 5AP9A 4EVIA 3S29A 3L0CA 1EFHA 3LW7A 4CN8A 1W48A 4MR7B 3RAEC 1RLJA 2NN3C 2XB8A 4QUAA 2OXFA 3I30X 1TEXA 3HCRA 1EFRA 2FEMA 1DAMA 1F8GA 3BICA 1NOJA 3CRVA 3NOQA 4PYOA 1G4HA 1ODLA 5K3AA 4DA8A 4AY5A 3D1LA 4G0UA 4JUDX 1A5AB 2I4LA 2OK7A 4E22A 1O58A 3VSEA 1BROA 4KXNA 1G3IA 2EBHX 4LOIA 1KU0A 4GDFA 5FI1B 1YS1X 1N5JA 1ORRA 3W3ZB 2XECA 5FAXA 4B4VA 4DR6B 2R751 1W581 4N40A 2GUGA 3AR7A 4AJ1A 3DOJA 1YS6A 3K70C 2EATA 4D1YA 3AEUA 1YS7A 1CY7A 4TV8B 1NAIA 4J07A 5U4QA 1RAHA 2Q5QA 2Y1CA 3I3OA 1R66A 3GHYA 1KSGA 3WY9A 4LV6A 2PWBA 3QVUA 4YRFA 4L5JA 2VZEA 1N6LA 1M6EX 3HDYA 1Z18A 5AI8A 5LVAA 1OWMA 4H18A 2WIFA 3X3HA 4C21A 4CF3A 1FFSA 4MYRA 3CNNA 3V7WA 3MWDA 1IJKA 3KBOA 2OG2A 5ESRA 4E7PA 2GAAA 4UHEA 3TXYA 5GV8A 5D51S 4NNOA 4IHJB 1RLOA 3UK6A 3UM9A 1HYQA 4X60A 1K5GA 1SKYE 1U2ZA 1ZSYA 2CLKB 2IUTA 3GROA 3KZOA 3OZIA 1QLHA 4LJRA 2O8EB 1V39A 1BD3A 2R44A 2X4DA 2ZIXA 5THKA 3OURA 2ZTVA 1SM4A 4N3GA 3Q3HA 2IDZA 4XYGA 4YS6A 5DHUA 3VX4A 4WNYA 4NAVA 3MIZA 4PG8A 4S04A 5IJ0A 3LF2A 4LV8B 1ZX1A 1XTPA 4OH7A 1E3DA 3N59A 3O4VA 2ZE6A 1C4KA 1ZITA 1ZXXA 4JCCA 2HJWA 3OBIA 4MH0R 4UVEA 1VPDA 5AHRA 5K8VA 2R6JA 1KNQA 1LNSA 4NCBA 1B0AA 4PIMA 3NANA 4R51A 3JVVA 3AR8A 4NCJA 4P54A 1OIVA 1PGNA 1AS2A 1LI4A 1DO0A 2VJYA 4OGGA 4X65B 1F20A 1EAMA 2E4AA 1RBZA 2FYTA 3A7DA 4RS4A 3EB9A 3IUQA 3RVPA 2C88A 3NDRA 3O3NB 4F6LA 3K1YA 3AUFA 3CEMA 5CCDA 1P1RA 4Q9AA 4NYJR 4AJKA 2NT3A 3IT1A 4E46A 1TZKA 3K6JA 3N70A 4ZV9A 1WKBA 3EY4A 4BFUA 1YL7A 1DXQA 4DIUA 3FDJA 2NVUA 1YZLA 2QN8A 1V8OA 1HSOA 2YWJA 4JJAA 1FJHA 4DBLC 4Z4GA 1HI9A 4EGSA 2H4WA 1WUJS 3P26A 3RVMA 4BEJA 2YUTA 3LUDA 3QKTA 5AWFC 2H4HA 3KJNA 3MTIA 1ZH8A 4YPOA 2EBUA 2P2CA 4PRLA 3MJRA 3GXOA 3G2KA 3C3WA 4JI4B 2P6NA 5THXA 3FKQA 4BB0A 3KELA 4YMUA 4AVYA 4OQLA 1EUYA 5CXQA 2IIQA 5ARCA 1C1DA 1BDJA 2DKFA 1SOWA 5GOZA 1EFPA 1J33A 1SBIA 4MMXB 4OP1A 1POXA 4YDHB 1MORA 1RM3A 3L7MA 2QNRA 3TW8A 4UMFA 3VJMA 2SECE 2CLLB 3GFBA 1YDFA 1E2QA 3FLEA 4F5EA 2ZJ4A 1GPYA 5EOVA 1ZK4A 2BD0A 2HB6A 1Q7EA 2JJYA 2V0NA 4DJFC 4W5TA 2Q3LA 4RHUA 2BFEB 4M98A 5AVRA 2E0IA 4S24A 4W6ZA 3L0BA 1IN6A 1L7VC 1CP2A 1T3GA 5K6AA 5ISMA 4KRFA 4NYJQ 3ELWA 3W2HA 1Y1RA 4FFMA 4PFJA 1FQOA 4B1FA 3PYXA 2QTMA 3TAUA 1COWD 4TXLA 3RIMA 1QKJA 2G5TA 2Q1TA 1QP7A 1UK9A 4MS1B 2FQ1A 4RHYA 2O3QA 1ISHA 4W5QA 4D9KA 1FTNA 2SCUA 3IIEA 3ASUA 3GPLA 3UMFA 3PDJA 1V26A 5FJJA 2BFFA 3FB4A 4LGYA 1NMSA 4UNIA 3U7HB 1Y5NA 5KAMA 3CS3A 3T7AA 3GRYA 3IEMA 1SY7A 4EFLA 1GCGA 2DKNA 4PYKA 1Y82A 5L3ZA 2F1RA 2O2JA 1R0BA 4G5SA 4YJKA 2R66A 3B7PA 4M0EA 4I4CA 4N4AA 4A8JA 3VFDA 4RD6A 1OBCA 1MIOB 4MUKA 5DYNA 2DR2A 3CKLA 4RZXA 2QTFA 4DGSA 1JEJA 3OZXA 4YIKA 2E4WA 4G0VA 3FWHA 1YI8A 4OFXA 3V1UA 5EE3A 1PF7E 1AGYA 1JQ3A 4INPA 4F5DA 4QJ3A 5DBGA 3B2EA 4YR9A 1RJ9A 1WDKA 1XYGA 4FW9A 3WQSB 1E1MA 2GLUA 4DLWA 4TMTA 1TM1E 3VKWA 3LNCA 3BJIC 2HCTA 2JH9A 4BZPA 4DBLE 4IIGA 5JXGA 3IC5A 3ZNOA 4QGAA 5FUYA 4DIBA 1TUIA 2X8JA 1E2KA 1EUCB 2W6QA 3WLHA 1W8DA 2QOEA 1R9NA 3KE8A 5IP5A 4G41A 1UZAA 3EEOA 1N6NA 5H7XA 3PF8A 3OY7A 2G7ZA 1M0WA 2VDPB 3L01A 4WN9A 3U3OA 3WG9A 1Y6GA 1PHRA 2VAVA 5ECGC 4KU4A 1L4EA 1Q0LA 5K3SA 1Q84A 2HBZA 1VPTA 3UJNA 2CGEA 1VIYA 5H9WA 1MJFA 1AGPA 4BKRA 3JQBA 4HEA1 4DV4B 3L0SA 2B1IA 1BEUB 4MV0A 3O1IC 1YB1A 1P45A 7GPBA 1A5TA 1RBMA 1ZRHA 1ZRNA 1ISGA 2FSUA 4QTTB 1Z3CA 2HSJA 3EOBI 2JFUA 3IYLW 4OJNA 5FWYB 3X1ZA 1DFHA 3S0JA 1YL6A 3P9QA 1ABFA 4U0KA 3P9PA 4ITVA 4ENUA 1ECGA 2X4GA 4PAMA 5JZSA 2VZLA 3B2NA 4U9HS 1Z0UA 3ZJVA 3ELDA 3O82A 2JEOA 3E2IA 5JNVA 1KJIA 1D4OA 1NU8A 2FSFA 2J1LA 2REBA 3A3YA 4JDUA 3WWCA 4D9HA 1QHYA 1N5KA 1YHZA 2HRCA 3WL7A 5LWHA 2WG0A 4BRZA 1L0BA 4JD5A 421PA 1F17A 1TO1E 4DLPA 1XNJA 2P4UA 4DA6A 1X7WA 4P4UA 2NSLA 1VYVA 2EX4A 2GAFA 1I6LA 3EDYA 4KZPA 3TRKA 3T1TA 1RZRD 5IVKA 1A7UA 1DC7A 3H9EO 1H0KA 3B6KA 3MN1A 4L78A 4TL9A 1SCUA 3L1IA 4XUCA 5IG2A 2F55A 4PLPA 3WGQA 4QOEA 5DWQA 1JT9A 5JO9A 4Q3DA 3VYWA 1NW5A 4R54A 5JOQA 3P5SA 3ACDA 4F86A 2XUGA 4PAQA 3AKDA 2PUHA 4IRMA 4C7VA 4ZAZA 1CR0A 3GRAA 4KTVE 4PCUA 1Q2XA 3MMSA 2C92A 3P0EA 4L3WA 1UPXA 4N54A 2FR1A 4ES6A 2GX6A 2XCUA 3EZGA 4LYHA 1UKVY 2EOAA 2WOJA 2QMUA 4Z9YA 4YRJA 5D7BA 4BXOB 1UMDA 3ND9A 5JSKA 1D04A 3H1PA 3F6EX 5TGZA 5JS6A 2PGIA 4HNAA 1TAQA 2AJCA 3TQRA 2IHYA 1PIWA 1CF4A 2FZ5A 4HY3A 2N75A 4YJFB 4DYVA 1HYGA 3NIDB 1YQ9A 4NXMB 5A4FS 1IZ9A 1W0KA 1OJLA 5IMBA 4C89A 4M7RA 4R81A 4BO8A 2QBYA 3EGIA 1RI5A 1U7UA 1JHXA 1K27A 1GYQA 4V0KA 3Q41A 5EXSA 1O96A 3IAUA 2OQRA 4FMCB 4INZA 1NVDA 5J23A 2IPOA 4IW3B 2FW9A 2WP8J 1CZKA 1QIDA 1RXVA 1XT6A 2PKCA 1NN0A 8AT1A 3T3DA 3KRTA 2RKOA 1XQVA 1ZBQA 4RPCA 4FLEA 3A27A 1VGQA 3KJQA 5EZYA 2W6ZA 1QP0A 2I62A 5E95A 5BVGB 1N6OA 2QXTA 3UFXB 2A0UA 1IOZA 4XDZA 1AKTA 3LHSA 2CUNA 1M1YB 3GA5A 1EFRD 1RJWA 3OHPA 1XRRA 5G1PA 4ZOEA 1QUFA 1VBMA 4XPZA 1FX0B 4RTMA 1USGA 5FTWA 4K9NA 3M1YA 4RIHA 2E18A 4B3GA 5KHOC 5DASA 1M73E 1ADBA 2F4NA 1EG2A 2FWMX 4GG1A 3WWOA 2H7CA 1S3IA 2HEGA 3VMMA 3O8OB 1QRSA 2WJ4A 2RGAA 4CIBA 2OYCA 4WJZA 3PBKA 3SSOA 2COKA 1W5BA 5EJ9A 4PE5B 1U8UA 4EF6A 5B6JA 1TDJA 3C1TA 3HHEA 4UTOA 3ZZMA 1K8RA 1KH1A 1Z5WA 2FZVA 1S4MA 4W7IA 3DP7A 5TC4A 2V8BA 1PKXA 1YUBA 2JCYA 4X1IA 5I7OA 3RC8A 4J4BA 4KPFC 3R23A 2V3VA 2I71A 1JECA 4GZLA 1SG6A 4H31A 1SHKA 1Y3AA 2X40A 2NAPA 2ZRQA 5E9QA 3DE7X 4EG7A 3NBKA 3GEGA 1ESMA 2P78A 4KRYA 2F8LA 4QFCA 1PUIA 2I87A 1PX2A 1R7RA 1OQAA 2J48A 2BFCB 2IELA 4I46A 3ZK9A 3LCCA 1O4WA 1XL1A 4DDMA 3KQUA 4B3MB 3GUZA 5JANA 3FAZA 2QM7A 2QG4A 1L4FA 2VUSA 2WF9A 3LUBA 4ILKA 4Q7MB 4YACA 3DTNA 3PUWA 2CHFA 1M3SA 1NUTA 2O1WA 2BI7A 2XIJA 4M0CA 4WNIA 3FYUC 1W47A 2QKYA 4QYTA 1AQLA 4HG2A 5GJBA 5CFOA 2WHPA 2CZQA 1YDMA 3P0HA 4D8VA 5E9AA 4QHTA 3SVTA 2CHQA 3E5NA 3HQ4O 4XUEA 3PHBE 5JXWA 1QHHB 1RHRA 2VCHA 3B7WA 5J59A 1FFCA 4M46A 3B78A 1J1IA 1V5EA 3P0RA 1VQ1A 2XYGA 4LRQA 4ZYTA 3PHIA 4NS4A 1NULA 2D5BA 4P7JA 3UCFA 3C15C 1KMHA 4WK2B 4DREA 4DCJA 1ONOA 5L53A 3UQZA 3U3JA 1TRKA 3HPRA 1VZ3A 3RVBA 2JKYA 1EEHA 4IVQA 3KEMA 3JR3A 1SKBA 2QQEA 4Q4AA 1Y7IA 1A8PA 1P31A 5FYQA 1J07A 1E3LA 4F97A 1Y4AE 1OX4B 3ROGA 3FPEA 4YUAA 4OKNA 4LQLA 2JGNA 3VH1A 3IIKA 4JP1A 1U8EA 1YS9A 3EWAA 4NV3A 3WYDA 3I1YA 3RANA 4UFPA 4OREX 4AO7A 3FTFA 3AQIA 1ZZEA 3SQOA 4EA8A 1C30A 2OBBA 1HT2E 1AF4A 4ALIA 4F2GA 1O89A 4ADSG 3CUWA 1L4GA 2ES4A 3BH6A 1KDVA 4CUKA 4F12A 5ILGA 3ZHTA 3TD2A 4RD2A 1Q17A 1XNQB 1KI7A 4IWXA 1KP2A 1XHEA 3IDOA 4O2BB 4AECA 4L7VA 2IVFA 4ZYXA 5IYZB 1SKAA 1X7GA 3BWDD 4DDKA 4Q4JB 1PFKA 2LNDA 4PO9A 4YJHB 3I05A 3RUHA 2AKEA 4H77A 5KQPA 1DC5A 3LNTA 2HCFA 1BN7A 1C80A 3FTNA 5TLSA 1BX1A 3UMBA 3GFRA 1QFMA 1D0IA 2B4KA 1HK7A 3FMOB 3QMWA 1PGJA 2QUIA 4GX1A 3VI3B 3WP0A 5BWNA 4B73A 2GCPA 3P4XA 3P7MA 4OQYA 1E9EA 1XD8A 2HJVA 3OD1A 1QC5A 4MHOA 4XXHA 1DX6A 3CLUD 3STHA 4ZIRB 2D7JA 4BIIA 2BGRA 1ESNA 1RD4A 4M3NA 3MF4A 1GQOA 3L4KA 4X7PA 5IAGA 2IDMA 5AUPB 1SUCA 4ZOCA 2YQ5A 4MVJM 3CONA 3AJDA 2O2GA 2W6PA 4MQEB 2W58A 4O3FA 4XASA 4TTJA 5EZSA 5I5EA 3EEYA 4UXHA 1KZ4A 2AZ4A 3PWKA 5F9MA 2BRUC 2FPPA 4YCLA 3EH2A 2GTIA 4AX4A 3GEDA 3ZWXA 2JJMA 1ML4A 1WEKA 2Q0SA 1YTUA 2DJ5A 1XEAA 1CFZA 2NSYA 2QLMA 2XW6A 4I36A 1SN7A 3BRQA 1JQDA 1X7HA 2FE1A 4LZPA 3MWGA 3TH5A 4TYWA 4KNWA 2OCBA 3VU9A 1EZ4A 3QVKA 1IHXA 1NZFA 5DBIA 4MRMA 1LZLA 2B4YA 2IEGA 2V0CA 3QFFA 4MR9A 3BN3A 3NOVA 4R1SA 4LGCA 2SBTA 5IJXA 3VPBA 5AW0A 2B5VA 1SVSA 1Y7TA 2QP9X 4JQYA 1DKMA 1GFIA 1RZ3A 3EMKA 4JC0A 4DLSA 1Z2DA 5CB4A 5DT9A 3VTKA 2GFIA 2ZYSA 3F5DA 4K5QA 1AX9A 3MLAA 4I6JA 3O2JA 4JWTA 2IUSA 1NJ6A 4GH5A 3GRCA 1DWPA 2D8AA 3BHNA 3C7AA 5IAJA 1GCAA 1W36B 2NXCA 4P4GA 2FSVC 3RFCA 1FQWA 3MFYA 4HPXB 5GY7A 2Y0CA 1OYVA 3RAPR 5K4GA 4YECA 2JAQA 4YONB 1V1MA 2FUNB 4W5RA 2R00C 3QUCA 1K5DA 2Q3BA 1RADA 2LP4Y 3AEXA 3AEQA 2QYOA 3I72A 3MQFA 5DU2A 5J5AA 3HH8A 1SUPA 3I6BA 4FT2A 3FMGA 3LK6A 4HAWA 4M0MA 4LRSB 4RTOA 4CQNA 1E59A 3PT5A 2DX7A 4QM7A 2PMCA 4DABA 5JNRA 5KOHA 3JSXA 1J9EA 2ZU0C 3II6X 2A9PA 2OHGA 1ZM9A 3RVLA 3L4JA 2CBGA 3GVIA 5IU6A 1W73A 2IDJA 4ZWNA 1DIRA 1LKZA 2ZJ1A 2J9ZB 1HT3A 4IDNA 3IUEA 1P2TA 2JHPA 1IC6A 1KI8A 1OXXK 4G36A 4PPFA 3W9YA 4C7KA 4DMGA 4FDUA 2JI4A 4DR3B 3D6FA 1SPBS 2NUPB 3CB2A 3KFLA 3P4YA 5EL0A 2VJLA 2O52A 3CF0A 4I1RA 3TPFA 4WI1A 1KEEB 1YR3A 3HVUA 4X45A 4JJGA 4YV2A 1NC3A 4OLFA 3UA4A 3KT3A 4NEGA 3E9CA 5BW4A 1V0JA 5F1KA 2OG1A 3I01A 2F9MA 1P80A 4KPUA 5HEKA 2PKWA 2QT0A 1GUDA 4KPGA 2IQIA 4AAYA 3K73O 5JPDA 5K3DA 1FEZA 1ZM2A 3CX4A 2BGKA 2P1ZA 3QA9A 1XQXA 2Y4OA 2WUWE 4GZ5A 4MUEA 4FKZA 2IXTA 3K9LA 4MW4A 3ROPA 5HQ3A 1MHTA 3P20A 1F48A 2R25B 3HI6A 2PX2A 4LNHA 1G3MA 2DQ4A 1LVUA 1NP6A 4UW9A 1WVGA 1E1DA 1XR3A 2B9EA 3FLBA 1RCFA 2GYWA 2WRZA 5EKXA 2WLSA 1NI5A 1W2WB 3OZEA 2QL7A 4MUAA 2ZCJA 4YJGB 1OOEA 2QPLA 4ASUA 5IF3A 4B3HA 2ZROA 5CDHA 5A5FA 3DVRX 2C95A 4DM7A 2IYPA 1Z38A 2PX3A 5DF1A 1E20A 5FF9A 5LA6B 1JXAA 4UE2A 4ND5A 2G0TA 2FN4A 4DIEA 3FMPB 2JIBA 5DI3B 5IJ9A 3K4QA 2XOEA 1DWOA 4NESA 1H3NA 2FX2A 2IC5A 2V6GA 5JD4A 2XQFA 4WTOA 4BCDA 4MV4A 3TSZA 2LE0A 2NO1A 1PJBA 2Q4BA 1XZMA 3LUGA 1C7FA 3B38A 3D2CA 1PJ8A 1PT7A 4XDYA 1GADO 4MW6A 2HIGA 4KO4S 1D5WA 2VH5R 1EE1A 1W0KD 3QLVC 4AZTA 1JEEA 2QY6A 2ZWMA 1D4ZA 2RMKA 4WESA 2Y71A 3KVNA 3TNDA 3JVDA 3KJFA 2PR7A 2IVZA 2YXLA 1Z13A 2EXXA 3A70A 2C5BA 3LRTA 5REQB 3PS9A 3TM5A 1F6BA 1P7WA 2HLHA 4I6GA 1KYYA 2G0NA 2Y1LA 3G0HA 1EEXB 3Q98A 2R3SA 2IU0A 4ZT4A 4N39A 1GDTA 3CNLA 4FYXA 2CSUA 2A86A 3SEQA 4OQFA 2I65A 2Q07A 4CMIA 1IPHA 5I7RA 1M83A 4PLFA 3ZEAA 2C96A 1J0BA 5IX8A 4CXMA 1A5BB 4FOOA 1J5XA 2IV2X 3TAXA 3BWBA 3HUUA 3F90A 3ZCQA 1DT3A 1VG9B 3NNDA 1UINA 2PZGA 1JBQA 5FX2A 4EKGA 4URXR 3TG2A 5EIXA 1ZEMA 2Y66A 4RF4A 4N18A 3TBKA 3O21A 4L5YA 1P7ZA 5BV1A 4RIIA 1YRQA 3X43A 3GLFA 4DZZA 1RFLA 2QM3A 1Z2EA 1Q6ZA 4LJ9A 5GADl 3P45A 3VHXB 1T0PA 5JEDA 2X0NA 2FNAA 3MWYW 1EA5A 2YJGA 2QVYX 3ZU6A 1WSAA 1RXWA 4DCCA 3FZNA 4LOLA 3C6YA 4ZOQI 1FTWA 3AV3A