2JKYA

Saccharomyces cerevisiae hypoxanthine-guanine phosphoribosyltransferase in complex with gmp (guanosine 5'- monophosphate) (tetragonal crystal form)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
207
Chain Sequence
DKQYISYNNVHQLCQVSAERIKNFKPDLIIAIGGGGFIPARILRTFLKEPGVPTIRIFAIILSLYEDLNSVGSEVGVKVSRTQWIDYEQCKLDLVGKNVLIVDEVDDTRTTLHYALSELEKDAAEQAKAKGIDTEKSPEMKTNFGIFVLHDKQKPKKADLPAEMLNDKNRYFAAKTVPDKWYAYPWESTDIVFHTRMAIEQGNDIFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title Functional Significance of Four Successive Glycine Residues in the Pyrophosphate Binding Loop of Fungal 6-Oxopurine Phosphoribosyltransferases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 65
structure length 207
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jkyA00
1I0LA 1IBSA 4P3KA 1P19A 3GGJA 1D6NA 1FSGA 4X44A 1TC2A 4IJQA 5K51A 4M0UA 1O5OA 2JKYA 4P86A 1QCDA 2AEEA 4RHYA 1O57A 1DQNA 2H06A 4RHTA 3G6WA 1A3CA 4RAQA 5BSKA 1UPUA 3MBIA 2E55A 1A98A 4JITA 3LRTA 4M0KA 5HKLA 1G2PA 5BQOA 1DKRA 4FYMA 1P18A 1A96A 1QK3A 3ACCA 3DEZA 2H07A 1UFRA 4WMLA 2PS1A 1ECCA 4Z1OA 1AO0A 1V9SA 4RABA 2FXVA 3N2LA 4JLSA 1G9SA 4MB6A 4RHXA 5BQPA 2IGBA 1ZN9A 4LZNA 2HCRA 3HVUA 5IAOA 1HMPA 1J7JA 1ZN7A 3QW4B 4P81A 5ESXA 4RACA 1JLSA 5BRNA 1DBRA 5JSQA 4X45A 1I0IA 1YFZA 4P84A 4PAWA 3LPNA 2XBUA 1G9TA 3ACDA 1DKUA 1VSTA 2PRYA 1A95A 3ACBA 4F8EA 4P80A 5ESWA 4ZFNA 3NAGA 2WNSA 1I5EA 1NONA 1PZMA 1R3UA 3GEPA 4LZAA 4RHUA 2PRZA 1HGXA 2EHJA 5KAMA 1ECFA 2JI4A 1A4XA 1ECBA 1LH0A 1I14A 1W30A 3OZFA 4P82A 1GRVA 1U9YA 1NULA 3O7MA 3S5JA 2GEBA 1BD4A 1ZN8A 1WD5A 1QB7A 1Y0BA 3OZGA 2H08A 3H83A 1QK4A 5E38A 1GPH1 1OROA 2VFAA 4LZOA 2JKZA 4OHCA 3KB8A 1L1QA 1MZVA 1XTUA 4WN3A 4LYGA 1UPFA 1VDMA 4RADA 4S2UA 4PFQA 1U9ZA 4KN6A 1JLRA 5EUCA 2DY0A 1XZ8A 4RQAA 1STOA 4TWBA 5IPFA 1XTTA 1BZYA 1CJBA 4M0PA 1QB8A 4LYYA 2YZKA 4QRIA 5JV5A 1BD3A 3DMPA 4QYIB 1XTVA 1DQPA 1A97A 2P1ZA 1L1RA 3M3HA 5HIAA 1QK5A 1OREA 2C4KA 4QYIA 1TC1A 1G2QA 4RAOA 1VCHA 1Z7GA 1I13A 1OPRA 1P17A 4P83A 1XZNA 3MJDA 3OHPA 4RV4A 1ECGA 4RANA 4RQBA 3DAHA 2JBHA 3GGCA 5KAPA 1QCCA 1P4AA 3EFHA 1ECJA
chains in the Genus database with same CATH superfamily
2VYND 4WCFC 4DIUA 1HTWA 4CM6A 3PE4A 1MDBA 1U0NA 3FNQA 4ER5A 5JANA 1U1EA 3UOAB 1W4RA 3LFUA 3K0EA 2JFBA 2V4UA 3EGIA 4H35A 5D84A 1YQGA 2H3HA 3M6LA 4RGQA 4PC6A 4K9SA 4LFCB 3WLOA 3L5OA 4G4IA 2R48A 4H6WA 2ONKA 5AHXA 4D41A 4JEIA 3BMQB 4MAAA 2C3MA 2HWWA 2QN9A 2P79A 2YZ2A 1HNNA 2Q29A 3D3EA 1O8CA 4ZALA 1E0JA 5K0CA 4RGYA 1YS1X 4L4RA 3TVYA 4YN3A 2GCEA 4IWYA 4IIHA 1KY2A 1VG8A 3CR7A 1H8HD 4YIKA 1ZD4A 1BAPA 3GJSA 3T3IA 3UXMA 3ZU6A 5KNLA 4PNEA 3FUVA 3L7IA 3O21A 3BXPA 5M5BA 5IFKA 2GK4A 4KBYA 3R7NA 3BK7A 1VCOA 4JP8A 4KTTE 3FMGA 5KNCD 2L0XA 2PKQO 1J8MF 3IOEA 3N5KA 1T1JA 2X9GA 5DYGA 4YR9A 1FFYA 1IVNA 1P1KA 3IT3A 4TOIA 4ESOA 4Q3CA 3CUKA 1WKCA 4A2WA 5B4VA 4JKOA 2JI8A 2NO7A 1LWOA 3MCVA 4I36A 4NZ9A 1JQDA 1PS9A 3HCNA 1L5HB 1NXQA 1CZHA 1Y8QB 2BI8A 1QTRA 1J2RA 1ULHA 3C6BA 3K1AA 3P9CA 3PKJA 3O3MB 4KSYA 2VT2A 2IZOA 3DMRA 4RV9A 5ECYA 3RODA 4B8WA 4HYTA 2XYGA 2Z6VA 3LWNA 4HZUB 2HK9A 3DYIA 3NV9A 5G0TA 3LJKA 2EQAA 2BV3A 5AP9A 2XNDA 3HO6A 1KDRA 3V3TA 2AFHE 1GTMA 3DQQA 2H2AA 5JQGB 1JA1A 4XGQA 5AM5A 4DA6A 3BK1A 3I4LA 4HRAA 2AK2A 2F00A 3HB4X 4D3SA 2ZZMA 4B6RA 5CGQB 3OTGA 2Q9CA 1KAEA 4NJEB 4FMCB 3DHWC 2JGLA 1IHPA 2YV1A 2A1UA 4FMDF 3O84A 2ZUEA 5A03A 1JLKA 1J25A 1BXGA 1W1IA 1YFKA 2AZDA 3HKDA 4NARA 4D80A 2FX3A 6REQB 2AQKA 2J41A 1PLKA 2VXCA 4LNUA 4CU2A 1N5JA 3PKZA 3ZJUA 2E5WA 2ZYVX 3SBEA 4RZXA 3UMMA 2MSNA 5KYVA 5TSDA 5BVGB 3WLJA 4QZVA 1HLPA 2YJNA 3ASUA 3S68A 2NSYA 4MW4A 3W9SA 4DAOA 2XDQB 4EBBA 3SWWA 5CU7A 1G3IA 2MMCA 2BELA 1N0IA 2Z58A 1JPNA 1YH3A 2P1DA 1UKEA 4YNBA 3GNQA 4O2BA 4XFKA 3CPJB 3WC4A 9ABPA 3KOOA 4YCJA 2I3ZA 3PEUA 2NUPB 2XQIA 4RXMA 2I7VA 4F1WA 3W2EA 4K9MA 3PT9A 2WFLB 3L7OA 4PPNA 3P9NA 4JZYA 1E3WA 1L3IA 4ZQGA 2JGDA 3F4KA 3KBOA 4KKVA 2P67A 3WXBA 3OFJA 1SN7A 5I8WA 1NW4A 3O92A 4K40A 2Z2YA 2JIRA 3UXYA 1K2VN 4BNKA 4W5RA 1XJCA 1KF0A 2GM5A 4RMIA 1PG2A 1NW9B 1RJEA 4FYIA 3FSRA 4W8HA 4U0KA 1IOWA 3PNQA 4OKIA 1XN4A 4I4NA 3UMRA 2X14A 3DE1X 4KIUA 5SV2A 1DI0A 3TMAA 2AT1A 2FJPA 2QGNA 3HHEA 5FA8A 1EDOA 1E6LA 2J9RA 4O0LA 5G41A 4GKAA 4A73A 1SVOA 4MPRA 2VYVD 4ZQHA 5GM1A 4X66B 4MYRA 2P6RA 1Q1BA 1RADA 3JARB 4JLOA 4M1QA 2Y2VA 2XQVA 1L6RA 1KIFA 3EBPA 4JOSA 2PS0A 4Y1RB 4EABA 1OJLA 3PE3A 5GIOE 5G4KB 3K05A 1JL3A 1ODIA 1HTTA 1QIMA 1TJ4A 1UMCA 2M6RA 2WWWA 4YQEA 5C4GB 4DVJA 5CG1A 2VF5X 5I9SA 3LUDA 1A5BB 3ZVRA 3DLHA 2FLVA 2P11A 1GNPA 4YP7A 1U04A 4R71A 5BWNA 2JHPA 5AR1A 3VKUA 3WVNA 4IX1A 2O8BB 5CP8A 1M6YA 1NAIA 2A67A 4LRYA 4QO7A 4XVHA 2VP9A 3R7WA 2IYSA 4MPJA 1GQFA 2V7BA 3JSAA 5TNXA 2Y0PA 3N53A 4E6PA 4C1BA 1XCLA 1PFGA 3PDIA 5CX4A 3ANSA 1X1DA 4JC5A 2OO5C 5LA6B 4DSAA 2HRDA 1PT9A 1YE5A 4XSHA 3M6MD 5DHUA 4EKDA 3P2OA 2NTNA 2FN8A 3N2EA 4LBVA 5LZ7A 4Z51A 3T34A 3CH5A 3EDOA 2DWUA 2O23A 3LW7A 2XVAA 1I4OA 2CJFA 3A3YA 1WNFA 4ZIRB 2JGNA 1ZCBA 4EG0A 2J6BA 4ZI7B 2JD0A 3EXAA 2R47A 2FZ4A 3KALA 4L5IA 5PGMA 4O0MA 4S1WA 5HHTA 4WLOA 5EWJA 2ECPA 4MV4A 1NZFA 2EJWA 3D31A 3VKFA 1WPXA 1Y37A 2HH9A 4HAOA 1WOMA 1DO2A 4TUYF 4HYYA 4JJFA 4W7IA 4LNHA 4EL5A 2HJWA 1DX4A 4DYVA 2FPIA 1BS2A 3WNBA 3E48A 3RAPR 1O95A 3HC7A 1FFGA 2Z56A 4TTTS 4BWYA 2X0JA 4QU8A 3Q8MA 4KR2A 1NMEA 3LW8A 1KMCA 4CL0A 4RORA 2XX3A 3FRJA 4E3ZA 3ICQB 1JMKC 1Z0JA 1SXJB 2Q5CA 2H29A 3R0JA 1E64A 3IPXA 2FW7A 5IHXA 3OTQA 4BGIA 2AMVA 5IBPA 2I6GA 5GMOA 1IXRC 2B98A 1T2NA 1Z9BA 4UE6A 3RSZA 2QI9C 4R8MA 4P5EA 3TMYA 5JTUA 3G0GA 4GNRA 5BQ5A 3AGQA 5I3CA 2FEWB 5IK2D 3S2UA 4NP6A 2HNKA 3NPAA 4YO7A 3K94A 5DM4A 1Z2EA 4HEJA 2FN7A 3VI4B 5BQ3A 5BSFA 4HEQA 5JZMA 3KUDA 4QU5A 4AMBA 1C5KA 3ICEA 5KYKA 4DBLC 3DEYX 2EFDB 3M34A 3MB5A 4OKSA 4BVBA 1V45E 1TYEB 2GASA 3VJMA 5LJIA 4KPEC 5THKA 4DR4B 2QQEA 4AZ3A 3IUJA 4N12A 1ODLA 3V9PA 3N9IA 4O4JA 4IJKA 1B42A 1TUIA 2YS6A 3TRDA 4E0BA 4IMJB 5AVKA 2KPOA 2C0QA 3TJZA 1GG2A 2GEJA 4W6ZA 3MCUA 4DOMA 1ZW1A 2HB6A 2F48A 3OQPA 4K5QA 2BFOA 4BP9A 3O0DA 3T0GA 2X0NA 3WWDA 3T3OA 1JDZA 3BSWA 3HBMA 1L7XA 4V0SA 2WIJA 3GELA 3T9BA 5CDFE 2QBYB 4YT2A 4GL2A 4YRJA 2GXAA 2B5WA 3IDQA 1HC7A 3OOSA 3QWIA 4OMCA 3A0RB 3ETHA 1IBSA 4KEAA 4XM2A 4ALJA 5BSVA 3C41J 3H11A 4RM3A 4JLDA 4X44A 3MA0A 4AFNA 1VE5A 3P9PA 4W5TA 2ZUSA 4WZBE 5K05A 2JKYA 3OT4A 4HNVA 3T3MB 3TKYA 4OI2A 3H42B 4X3PA 1FDIA 2P9HA 1MHPA 4QUAA 3QU5A 4BVJA 3WMGA 4MYUA 3W5DA 2JAWA 2I6QA 3EIOA 5FA5A 2QT9A 4XX0B 2YWGA 4YRDA 4DR3B 3EHDA 2R0QC 4MQBA 1B76A 1I3NA 4EMSA 1P7VA 3TBHA 4UFNA 1AQ6A 4EUHA 1NZDA 4R0NA 1G5HA 4HN9A 2I4TA 5AKKA 1DSSG 3K4HA 1J5EB 4CLXA 5E2AA 2P5UA 1UBKS 4K9NA 2Y3IA 4QELA 4WERA 1XDGA 1E58A 4YI3A 5AD1A 4CJXA 3T3GA 5BYKA 2OHIA 3L6CA 1Z75A 2F43B 5TPWB 4DCOA 3TB4A 1PR4A 4TWIA 1Q77A 3AILA 4IVRA 3H9CA 3A1SA 3A1CA 3A1WA 2AC2A 2WG0A 3KVOA 4QPCA 4XDYA 4XEHA 4DQ0A 1XLTC 3K0HA 1QH8A 4FN4A 1USUA 1RWKA 4UARA 5LOVA 4WKGA 3E8SA 1WCIB 3PV0A 1V26A 4KLZA 2Y1XA 3BWMA 1GILA 5BW4A 3U3JA 1DEKA 4Y2VA 3LUKA 1L7NA 1QAMA 3P27A 2IE8A 3OCYA 5EJ4A 4BEBA 1ODTC 2CV0A 4UE3S 1QUEA 4WGGA 1HTBA 1YZFA 6Q21A 3UAGA 2YIJA 1RXIA 3KS9A 5JCJD 4RM2A 2PTHA 2Y6UA 3MPUA 5KQPA 2CLDX 2QNRA 3A6KA 2AKAB 1SWVA 3AIOA 3ZTWA 10MHA 2W37A 5JS7A 1I7LA 2OBNA 1RNLA 2C59A 4NABA 1P61B 3UH1A 2QTTA 5ALLA 3MUNA 4JGIA 1O9GA 1TECE 5A7HA 1GGKA 5ITVA 3QGMA 3RYFA 1Q12A 5K4HA 3M49A 1GDDA 2IYAA 3E22A 4G56A 3UWKA 3ZDFA 2DVMA 4DUPA 2YINC 1GL6A 1PEKE 1XK6A 2GARA 4D45A 3H8VA 3HJCA 2IQ5A 3O73A 5FP0A 5HOEA 1N2XA 2IYXA 3T6KA 1L3BA 1EQUA 1VDMA 4FOOA 2B2NA 2Z1NA 2IA5A 3U5ZB 2PQ0A 3HV2A 1ZN2A 4M9UA 3OKPA 2WKWA 3WLKX 2Y92A 4J7UA 3RB8A 4DMKA 4EY4A 5IDVA 1QFMA 3EH1A 1L5VA 4C4RA 4DJJA 4KWHA 1Z0SA 2HA4A 1O97D 1YA8A 3PGVA 2C29D 2G4CA 4JJIA 3EN0A 5C3UA 3RHZA 3WLTA 2NVOA 3AERA 5JS6A 2DKFA 1S89A 3MLEA 1QSGA 1IAQA 1MAWA 1YB4A 2E4ZA 4IGKA 5AW0A 3K2EA 2WHEA 3MRTA 4O8CA 4DLLA 3ZK7A 2IYPA 3KKOA 4WK6A 4A0FA 1Z6QA 4RW0A 1AUQA 3H17A 5COBA 4GOKA 3GEEA 4RANA 2XTAA 1PG5A 4RSGA 4FONA 1JLLA 3BFXA 5I4CA 5LCXA 2G9ZA 2GVNA 3G59A 3VSEA 4BNDA 1QHEA 1VG1A 4ENWA 1OYWA 4KWTA 1VP9A 5TMEA 3D1JA 2CNDA 4FDAA 4EYOA 2OD2A 1YK1A 4ARVA 3CVWA 1UT8A 3RO7A 3KQMA 121PA 1VKNA 2PX0A 1YRYE 2WNHA 3EVBA 4RK1A 3TLCA 3K9HA 1SU8A 1NW8A 1YC5A 1PQPA 1TAQA 1VPTA 1CEYA 5D3QA 5A3RA 1J07A 2G1AA 3V7YA 1KFJB 1XK7A 2O3SA 2X58A 2YNMA 3A70A 5JSFA 4QTXA 1C7QA 5LQUA 1PFYA 1GUAA 4ACAA 1W5SA 3LRTA 1EA7A 3GBVA 4CW7A 1FJ2A 3IMEA 1HL7A 3MOSA 2AYXA 2I2DA 2A9RA 2BSAA 4FYMA 4HO1X 2NXEA 4AG5A 1VHWA 1PFKA 1V8ZA 1Z36A 2PV0A 3GFPA 1XJWA 2C58A 3GROA 3TLYA 3TZLA 4D81A 1RMYA 4ZEOA 4C5AA 4PXYA 1NUAA 1ZD5A 2V98A 2P8SA 2IV3A 1UCFA 2IH2A 4HSEA 2BFNA 3WTBA 2C3OA 3TEFA 3GRYA 5MN6A 1KK0A 2ODPA 2DJIA 1MEJA 4B4VA 2A1UB 4JLSA 4KRYA 3EXHA 3ETCA 3P32A 4FKMA 2R4UA 5F5XA 5A3VA 3TZEA 2F59A 4OMFG 1ZAYA 2Z9BA 3NYQA 3QLTA 2ODBA 4DCVA 4MUEA 3RCBA 1U7TA 4OA8A 3IUBA 2AD1A 4KWEA 4WI1A 4Q1AA 1GPUA 1DG3A 1XZIA 3PNOA 5BUQA 1EYZA 4BNHA 1EWKA 4QJ4A 1XOIA 2GO1A 5U4QA 3NBUA 3A6PC 5CHEA 3OIUA 3PQ4A 1WLSA 1CUBA 4FYXA 2ZB8A 3UWOA 1JG7A 3GG2A 1DLIA 1VIYA 2AZMA 3OLCX 1SXIA 2XYVA 4MQ4A 2FPGA 4H2DA 3CMMA 4H18A 3ZGOA 2VRCA 1K7CA 1O94D 3FLEA 3GWGA 2QL6A 5FQOA 4PC7A 1JYFA 1ZRNA 4R1UA 1A7AA 1XVLA 2R8RA 4O2BB 4Z0NA 5HP4A 5LQSA 3HUTA 2WM2A 3M4JA 4KVFA 1PQ4A 2XE4A 3LYLA 5B6PA 3U7EB 2JI4A 4MEAA 5FUBA 5GONF 1JZTA 1POXA 3QKSB 2WG1A 2OXEA 2J9FB 1BX1A 2GLTA 3VZQA 2BAGA 2CLKB 3DM5A 3BWYA 2CXQA 3AJEA 1HE2A 5EI5A 1JT2A 1PNVA 5E95A 3DEJA 1A9QA 1Q0LA 3F47A 4Q4HA 4BQPA 4AVYA 4JB8A 4MWDA 4RVUA 2ZJ3A 1UOOA 2LBPA 1RI4A 1SXGA 1X87A 4OTZA 5E38A 4M7RA 4CG2A 2XZLA 1KAHA 2FZGA 2OFPA 2WJGA 4LWQA 1VFPA 2GETA 4EB8A 5KOJA 4QBTA 3C3CA 4LSGA 3INGA 1VLMA 2WIAA 2V7WA 4KQHA 4QT4A 4FK8A 3BGDA 2DWOA 5AW2A 3LQQA 4IYJA 4U7HA 3VR1A 1O6ZA 1X8KA 3I2IA 1TIBA 3QPBA 4B5LA 2YZGA 2V6IA 4ETNA 4D0SA 1VPVA 1QBKC 2FN3A 2ONCA 4PX3A 5HCNA 3CRZA 1QHXA 4MP3A 4QDXA 2C4HA 5H9WA 3GG9A 1GSAA 5E9QA 2XKAA 1YS6A 1FFBA 1GZ4A 5H0IA 4A26A 3NR2A 1VRWA 3L7CA 2DG2A 3MJDA 1RAIA 1UMBB 3VMFA 4MMXB 3RTCA 4C0LA 4ZEVA 3DFZA 4GM4A 3W3AH 1E63A 3GJ4A 5EIXA 1GA1A 2DBRA 1MJHA 5B7PA 2WJYA 2ZBQA 1WCV1 1ETHA 1FSGA 1ZAKA 4JUAA 3WGHA 1ULZA 2TMYA 3OMLA 4M0UA 5EXTA 3FNIA 3O2QB 2ACKA 4FWTA 3MWJA 3PQ7A 4FYVA 2ADMA 3Q11A 4R5MA 3H9BA 1D7AA 3SS8A 1N34B 4NCBA 4C7OA 4J0CA 5D6OA 3UMJA 4HVTA 4CM7A 3OQJA 4Q9NA 4X92A 4F3CA 5IN4A 1KI6B 1M74A 2WJWA 3WGQA 3G0CA 2E55A 5AM3A 2QTVB 1CLEA 4KO4S 5FNZA 1JLHA 2PT6A 1EWRA 3PE6A 1ZGAA 3MERA 1QFSA 3RFTA 1DQYA 2O8FA 1IM5A 2PSSA 1ZS9A 2FI1A 2FPIB 2C94A 4OXQA 5BMVF 3TG8A 3IQIX 2P2CA 1IQPA 5REQA 2L18A 4DMGA 4ETWA 3HB7A 1OHHD 4CYMA 4RZQA 1WVMA 1UOQA 1UDXA 4IKOA 2DTEA 1JHOA 4TLDA 1T9GR 1ZCAA 3LPDA 4BKPA 4R41A 3CWCA 2QENA 3OI7A 5T8KC 5LP6F 4B74A 4EIWA 1T1GA 5DDIP 3GRCA 5ERGB 2JK1A 1C0IA 1L4HA 2QTWB 4MVJI 3MJSA 4Q34A 4AG3A 2PUWA 4B4WA 2D6FA 5JY6A 1N6LA 1HG1A 4OXXA 1RRFA 2A0FA 1JG1A 2ZJ0A 4HNUA 7GPBA 1RTKA 1MJGM 3L6BA 2WPNA 2VWQA 4ZT7A 3TUZC 1Y1TA 1O6FA 2KQUA 3GRRA 4TKVA 5B37A 1A72A 1QVRA 2X8BA 4G9GA 4PZUA 5A3QA 4GOMD 3HI4A 3LPCA 1PRYA 3CZCA 1JU3A 2XF2A 2GBIA 3A9RA 3GBPA 1G16A 3GFRA 4M98A 4AZ0A 3H84A 4BRZA 4FYPA 3IMKA 3THOA 2REXB 3I9JA 4HS4A 5DSXA 2NUTA 2QE6A 2VPQA 3HYLA 3IE1A 2EFJA 2NSLA 1YR6A 4LDNA 4YCCA 2ZBEA 4XPZA 1KFCB 4AJKA 4GMFA 4JBLA 3QI2A 4NPHA 5K2MA 4MHTA 1ZZGA 1TADA 2OBMA 1UJBA 4IBOA 4S04A 3UJ6A 3WLFA 4RA9A 4CCYB 1GQYA 1K7SN 1QIFA 2VDPB 4MRVA 4EBFA 1OPXA 1Y3CE 1AKWA 3R3UA 1JSLA 1FTWA 1LBEA 3C3EA 1UKZA 4GYJA 4EI7A 1RC8A 4KQCA 1U3CA 3I6BA 3CUSA 4OXNA 4MS1B 3HNRA 4Y67A 3SOPA 2Z43A 4B6PA 4AY3A 4JJ8A 5J9FA 1PVOA 4XGRA 3X1DA 5DIFA 3L0OA 3VYSB 1CF4A 1K6MA 3IEPA 4DNFA 1NASA 4DCCA 4HV4A 1Q7RA 4YUXA 4NE9A 3OZ7A 2B0CA 3COWA 3GQBA 4CKXA 2V1UA 3I8SA 1XX6A 4PINA 4E32A 2ICAA 2PQMA 1F2UB 3PQ3A 2AIRA 2X5OA 4B2IA 3KFVA 1UOEA 1Z74A 2R7MA 4LJAA 1G38A 4J3JA 3QJ5A 3KT0A 4L28A 4JYBA 5TS2A 3RRYA 5TS3A 2BVNA 3LL4A 4RHFA 4XFDA 3ST7A 5BT8A 5JFGA 3ABZA 1NKVA 1CJVC 1Y4SA 2QUJA 4ZAXA 3ZD7A 3B3FA 3DNFA 2FZKA 1DBVO 3W05A 5CXQA 1TKBA 3DV0B 4DIEA 5DMHA 1FTNA 1EP9A 2FP4B 3F5SA 4N9WA 4L07A 3KOMA 2HO4A 4G0QA 1O5OA 3A2LA 4BNUA 4LDZA 5AW4A 3B52X 4ME6A 2FZ5A 2C98A 1HG0A 2PPVA 4BQRA 3N2ZB 4BAUA 5JD3A 5AKGA 4YAGA 3P9IA 2BMVA 5CBKA 1WTCA 2JB9A 4RIIA 4EW3A 5CAEA 3L93A 4U6QA 5IVIA 4X90A 2X6QA 4IH1A 4XWKA 3QA9A 1RXYA 3HXTA 1G8MA 1D2MA 4RVSA 3S27A 4JC0A 3V48A 5LL6P 1DKRA 3ZS9A 5KSZA 4UM9D 1DGQA 2FWPA 1RWXA 3QKWA 4BIIA 4BV3A 2Z2JA 2HFKA 2IUUA 2HQOA 3ESZA 2PS3A 3F4LA 4W6QA 2HOQA 2XMDA 2IWRA 3RSHA 4WMLA 1L8XA 4YJFB 4AULA 1ILEA 4EUKA 3HXOA 4U0JA 4S2EA 5F78A 3BB4A 3CTPA 3LUJA 3WOVA 2I65A 4HNGA 2V3CC 4FEEA 3UA3A 1FC0A 4R9UC 5TT1A 3FFWA 3I92A 3RYFB 1GCOA 1YT5A 1SHLA 4CMBA 3E22B 1EGMB 1T2EA 4EELA 1XZBA 1O54A 2HV9A 1FBTA 3C4JA 4ZI3A 3DT6A 3PITA 4WUTA 3WRWA 4C78A 5DISB 4Z9XA 5A7GA 1PYGA 2P0AA 2YZMA 3PENA 3HA3A 3QKUA 4FW9A 1UJMA 3B6MA 4IDNA 3LPNA 1RM3A 4XX1A 1C4KA 1ECLA 2PUVA 3P94A 4MVCA 1H2RS 5DYIA 3DGFC 5KC8A 5ESWA 1AKMA 1Z63A 3HNOA 1J9ZA 4GI7A 3FPLA 1IUPA 1QR6A 1R3UA 4LV5B 4GUAA 2HQSA 4J9VA 2YVQA 5AT1A 3C6MA 3JQ7A 2WD7B 2B9EA 1H1DA 3TXAA 4A8TA 4WESB 2GVDC 2GEBA 3TYXA 1D9ZA 3RAJA 4G6ZA 4N5MA 2SKCA 3IIKA 2TMGA 1PQUA 2MYTA 2QMHA 3AESA 2A4MA 3IMGA 2PVPA 4DUGD 2CXTA 4BU0A 1B93A 4H0CA 4MLZA 2DBVO 1X7YB 1E2MA 2Q3MA 4HI0E 4X24A 3WS7A 1VGQA 4G4JA 1FNCA 4A2PA 3AKDA 3DONA 2UU9B 1SBQA 3KLOA 2QQ0A 3CX6A 5IC4A 4JSYA 1E2EA 3LUBA 3CO5A 2XV1A 2ZOSA 1WWKA 5I48A 4Z99A 3EMBA 1P2GA 1MA3A 3W9UA 1O87A 4UHKA 5JH7A 1NVDA 2P9QA 2O52A 1CQIB 3RG8A 2OK7A 2QTLA 4QXAA 3EZ9A 3RT7A 1UBFA 5B1SA 3FFTA 4Y6GB 1GG5A 2F3QA 2F62A 3TM5A 5K8JB 3QPAA 1OPRA 1EEXB 1RQPA 2Y0DA 1OLXB 3DLTA 1I7QB 2F7SA 4Z8XA 1N2CA 3BVPA 3LT0A 4Q39A 1JPUA 4TRNA 1FXUA 2XLBA 3FPCA 3AGPA 5LZ8A 3VPHA 3HJNA 1SELA 4JR1A 2JASA 2W4IA 4CQMA 1NFQA 3H2KA 4PLVA 5EG5A 2RH8A 2NM0A 2NV0A 3KB6A 4CTKA 2JFWA 3S44A 3ZKWA 3RV3A 3NXSA 1O97C 2ZITA 1AUXA 1VLVA 3CUUA 3G9TA 3QBEA 4FHEA 4Q4JA 4UVHA 3N07A 1QRRA 3V1MA 3RYHB 2HMTA 4M60A 2A84A 4X1IA 1VLHA 2YZ7A 4PCLA 2CVZA 3QRWA 4HMQA 1EAYA 5B30A 4GMGA 2YV2A 5BV7A 1YFLA 4R83A 4BVEA 4D46A 2IS6A 4C3OB 5FTNA 2BD0A 2OCBA 2OORA 2ZAYA 1U0GA 5AW1A 4UEWA 1N0UA 4TS1A 3ENQA 1LFAA 3ZWCA 3DSRA 4LHZA 3PXEA 4UKDA 4YHBA 1M5UA 2Q3HA 4BAGA 2QMOA 1IPFA 3VZCA 3V2HA 1E69A 4MLCA 3ZK9A 5B4TA 1Z7WA 2ERXA 2VDWB 2Q07A 2F2TA 3GDWA 3WB1A 2P77A 3OQBA 4AQYB 2JFQA 4BO8A 3LQYA 3W3AD 4QXPA 2CJPA 4LXTA 1QHFA 3L4KA 1OYYA 1WF6A 2C8KA 1CRQA 4P0TA 1UBTS 4US2R 3QVMA 4OYLA 1L5MA 3PP8A 5CNMA 1JEJA 1OIXA 5BO5A 1NWHA 5G4LA 4LHVA 1M2FA 1YVUA 2GK7A 3K5PA 3Q72A 1LWNA 4ZVTA 3RH0A 4QL3A 2AG1A 1BWSA 4O59O 3HM9A 4C4XA 4ZDIA 2JI6A 1GRRA 5J4VA 5FOVA 3EXEA 3FTNA 3REQA 1F6WA 2XWJI 2JEZA 2HF8A 4QXRA 2ZTHA 1A50B 5ADUS 2CJWB 2BMJA 4B35A 4B3RB 4MV3A 4QICA 2W2KB 1WL8A 2EL9A 4NY1A 2C7PA 2JA2A 3OX2A 4H6VA 1A9RA 4XW2A 4QBHA 1ML3A 1XPUA 1XCJA 1CRPA 3EPLA 4ZZIA 3RTBA 4E70A 3ZVNA 4J75A 4BTEA 3UT0A 3S2IA 1H3NA 1EVLA 2A3RA 2I7TA 2PHZA 3I6YA 3MQFA 3QW2A 2VF7A 3A3OA 4FHGA 1G8HA 1CY1A 2D1RA 2OUKA 3E70C 4J3FA 3IEMA 4Z53A 1AQJA 5HBGA 4CWAA 5K2OA 1NR5A 3H2GA 4IXWA 1WBDA 3T94A 4R7ZA 2WKSA 1VMKA 4WBNB 4HWKA 2QRUA 2O05A 1F5NA 2EGHA 2GXQA 3NXKA 4TTRA 1G5FA 1RPAA 2H5EA 4IQ4A 4EQ6A 1EX9A 5I7OA 1O94C 2GMWA 3UN1A 1GQRA 3VKWA 3P2JA 4RPIA 1J23A 1Q7EA 3D6VA 2AVNA 1A5AB 2BZ1A 3CZ9A 3P52A 3AR4A 1GA4A 5FNVA 4YJHB 2I99A 4HC4A 5I9NA 3QE9Y 3U1BA 3WYBA 3ZGXA 2PT7A 1T36A 3PUKA 3I62A 5BV1A 5LQKA 2Q4EA 1N7HA 4LYFA 4R6XA 4LEIA 2IBMA 3O3OB 3P71T 1DL5A 2ZZKA 3M81A 3VNAA 3C8UA 3STUA 1CUJA 4JUBA 4EJFA 4MVJH 5JADA 4OIFA 4KITB 3NALA 1CDOA 4EDHA 2I3DA 1P60A 3LVRE 2VT6A 1LKZA 3V1UA 4BX8A 1U7XA 5FV4A 1W36C 1OB5A 1ECGA 1GM5A 4QPPA 4H1WA 5JNVA 3I04M 4B3GA 2A35A 3HBAA 1EB8A 4PSUA 2XOKA 2JBAA 2J0QA 5AK6A 1AA9A 2F4NA 5HS6A 4P3KA 4ZOLF 5FCDA 4BPRA 3WJAA 3LTNC 2W6CX 1BHJA 1TTTA 5CTAA 2UZ1B 2VSXA 1CR6A 3VPFA 1E2BA 2XGJA 2XQKA 5D3MA 4DWJA 2J32A 1V35A 5DXJA 2W8ZA 1U9CA 3C4QA 1OZ0A 1A3CA 5ALQA 5EMLA 3A27A 3RWMB 1WUHS 3WJ7A 1T1SA 4KR9A 5T4BA 1LZKA 2QVBA 1OWMA 1T24A 2P4HX 4NV1A 2ZYSA 3EWIA 4JITA 5ITSA 4AN1A 4DV5B 1W5AA 1ZMXA 3W1VA 3WIOA 4I66A 5FV7A 1O0CA 5B1EA 4DJAA 1A8UA 2C88A 4L9SA 4MUXA 1KY4A 1RAGA 4KBFA 3KJQA 2P68A 4Q18A 2X5XA 4QHSA 1FP1D 3T15A 4DW8A 4D8UA 5BOSA 2OQIA 1JEDA 5AOAA 4WBSA 1J0AA 1QAQA 5GQSA 3TLBA 5B2FA 5HKAA 2H4XA 4HZIA 2AF4C 3PR1A 5CLQA 1OLSB 2NZYA 3UAWA 3CZ4A 5DTJA 1UDBA 4MR7A 4OGLA 5F1OA 5HJ5A 3IYLW 1E59A 4G0XA 4F6LA 2ZXEA 2X3UA 1HYGA 2YWXA 3BXOA 3L8GA 1YHZA 3FCYA 5LMCA 3F90A 2Z8XA 1Z8NA 3H2IA 2C8VA 1CY7A 2J3DA 2ZUTA 4KN8A 4B3SB 1WEHA 3KC2A 1AX9A 1Q0QA 1VBMA 2JAPA 3DWGA 4F6RB 3CUTA 2QM7A 2I80A 1RZ3A 2PLWA 3IPRA 2WUFA 1P1HA 4JIMA 4O33A 3TQFA 5DNEA 1H6CA 3ZEIA 3D0OA 4L6IA 4OY3A 4FB4A 4HT3B 1TJPB 1P31A 1ZMRA 4EHIA 3WB2A 3H0CA 2YOGA 2HU7A 4XTRA 2CV2A 2DHEA 2PGNA 4L8WB 3NORA 2OOSA 1IN7A 1RBQA 2W8BB 3OOJA 5E6SA 2XNKA 2AEMA 4IO0A 4R0VA 3GEBA 4ZU1X 1AUVA 1JHVA 1MEOA 1UPBA 1CUIA 2DHCA 2EOAA 4LXXA 3ZE6A 1NBIA 2C07A 4G97A 4OBXA 5EHGA 3IULA 1OX4B 1WUYA 1BOOA 4RQTA 3WICA 5DH9A 4UTNA 2C84A 5EP1A 3R5HA 3SYTA 2FSPA 1FFXA 4S1OA 4DBVO 5H8WA 1RXWA 4BYGA 1E9CA 3L0YA 4ZD6A 3U6KA 5KTPA 1GO2A 5IM4A 1RJGA 1W2HA 2Q28A 4KIFA 4OHCA 5EZSA 3A4LA 3RDPA 3RAEC 1HNZB 2YDXA 1KARA 4Q1CA 1CHDA 4K9DA 1NBAA 2JFGA 3EDRA 3UJPA 4EKNB 2Z6QA 5HQ3A 3TF5A 2XPCA 1BHSA 1EDZA 3DMTA 1D8TA 2W6JD 3DKIA 3VDMA 1J21A 2Q6IA 3QJGA 1XP5A 2RHBA 2M9MA 2FQYA 4IV8A 1U90A 2V0NA 5CCEA 4TSFA 1UEIA 1NVWQ 1DG1G 1ZM3A 3P5SA 4UTPA 4ZTZB 3PX7A 3O5AA 1AV7A 2HHCA 2BBOA 2QR5A 1IOVA 3GAAA 4W1RA 4NZOA 4XARA 4URVR 5C9ZA 2EATA 1SBHA 3U1VA 1DINA 1YASA 3IVAA 4R1MA 4ZXPA 5JSZA 2AEFA 2FHSA 4RSHA 3SYNA 3TW4A 1E0KA 2KBFA 1XTPA 2XECA 3EE6A 1DZ3A 1VE7A 2E18A 2XH8A 4MIYA 2XCLA 1AKRA 4H4EA 4MO9A 3RS8A 3VU9A 4LFAB 2H92A 2O48X 5ADHA 1A4UA 2ZULA 1QCCA 4PHGA 1QVVA 1Z17A 1XCOA 4QODA 3BB3A 1KFKB 1BE6A 5FBZA 1HFKA 4RD3A 3R7DA 1A4IA 2ZREA 3TW8A 4R9SA 4WNAB 4C6RA 4DIBA 1OKKD 1PFVA 4YUWA 5JMTA 3RRMA 2YICA 1OAOC 1OBOA 2H18A 4EJ2A 2OECA 3CT4A 3NCHA 3T5DA 1SC9A 2F9LA 1ESCA 1TJYA 3DQPA 1UBCA 1T15A 2E4UA 1FNSA 3IR5A 2DC1A 3DW3X 1D2EA 4UHJA 2BHSA 1ONBA 1UFOA 2J3QA 2ZVJA 1JF8A 1E4YA 4YGXB 5JARA 4Y6PA 1JHUA 3M0EA 2VJMA 1Y9JA 2P2NA 2CB0A 2BLNA 1AKQA 3AQ4A 3QM1A 3LHFA 3QU2A 3WLIA 1JKMA 1SC3A 3P4XA 3ROXA 2VDLB 3HKEA 3V4ZA 4NCAA 3GLUA 4HUTA 4BGEA 1O89A 3I05A 4J0HA 2FOIA 2ZWAA 1QO0D 1KP3A 721PA 1NF8A 1OD6A 3HZHA 3NONA 1HE5A 3KVVA 2DR3A 3EGCA 3PPWA 4IJVA 2HCRA 3M6XA 1XPOA 3W7AA 3ZCRA 5IAOA 4II3A 4AMUA 1RAEA 2CEKA 1SHZA 3FJOA 4IGIA 5DZSA 1V41E 1ZM9A 4ACBA 1P44A 4YUAA 5E1MA 3R3WA 4HP8A 1WDTA 5A04A 1Y7PA 1TCBA 3HG7A 3D02A 3INTA 2ODTX 3NHUA 4KI7A 2C3PA 2BEWA 3WRXC 1IZ0A 1J2EA 3O8DA 1BKYA 3OMXA 4IF6A 4CEIB 3QV1A 2O5EA 1W0KD 4G5HA 3ACDA 3UAZA 1JU4A 1PDVA 1X7XA 4EA6A 3DOEA 1O58A 2ZUBA 3NEAA 3WWYA 2V6GA 1IY8A 4EJSB 3GLFB 1EM8A 5BNIA 3M82A 2OY0A 3QH4A 4NKRA 5KI6A 3X1JA 1R8QA 1TZKA 2C5SA 1F60A 3HU2A 4JJ7A 2QJRA 3VYWA 2GBFA 3I9OA 5HIMA 1L5GB 4KBGA 3IQWA 4M8KA 2FF7A 3IKVA 2JDIA 3N2KB 1M6EX 4B80A 4FFRA 1U8ZA 3I5MA 3NJ8A 4IL5A 4QDZA 3CZPA 5CVJA 5L7YA 1QANA 2RK3A 3ZDAA 1KEZA 1DE0A 1R4MA 2VK1A 2R25B 3IT0A 4Q4LA 4MHOA 4R4JA 3BJZA 4R84A 3T1TA 4TT3D 4B48A 1IJKA 4J76A 3T5MA 2WJIA 1N2CB 3QYPA 4TV8B 3W5VA 1W88B 5DHSA 4FUTA 1GRNA 4BUCA 3BRQA 2BKUA 1KZ7B 1L1QA 1E6MA 1PP4A 2EYUA 1CF2O 1KDVA 4WOCA 1EJ2A 2OXIA 4EG7A 1TA0A 1DOZA 1KYVA 2Z0MA 3D6HA 3O8QB 3PRHA 4S2UA 5AKIA 5F3RA 2CL7X 1N57A 1RM0A 2ON6A 3OEHA 3IA2A 3RIGA 4YJ3B 3H2ZA 1OWPA 3WNZA 2UVDA 4DXHA 1ZNQO 4PSVA 1Z38A 4LWZA 1RAFA 2R2GA 3K0AB 1JKJA 3AXTA 3OHSX 3C6KA 3OO1A 3ZZTA 4AWXA 3NHLA 4BLQA 2H7VA 1CY0A 2ZWVA 4PZZA 2P27A 2C2ZA 2GD0A 4M1ZA 2INGX 3HBJA 3KQOA 2HSEA 2FPKA 1X7GA 2BHTA 4YECA 1DJNA 4EY6A 5DNCA 3ZJTA 3H0EA 4CKBB 3AHDA 5HG0A 1FQKA 3IIMA 4MPTA 4TTVA 5FWYB 5KHLB 3B9PA 3NYRA 3SJ7A 4YCMA 4YCLA 5E2BA 1EWTA 1CT9A 4IIUA 1MUUA 4HN2A 5J59A 3U17A 2D5CA 3HVIA 3UGQA 5LIRA 2DPYA 1UKAA 1E2JA 5H7XA 2BKEA 3O91A 2QW0X 4DR2B 4KWCA 2FKNA 3W8DA 5FQNA 5TIIA 3BMCB 3D6MA 3QUBA 1E7SA 1PUJA 4J91A 3DTVB 1FMTA 1JMVA 1KS9A 1DQNA 5JFOA 1Z26A 2YOFA 4L9AA 4DLVA 3GOHA 1K8RA 5F2OA 5IVKA 3L1VA 4CVNA 3E7DA 4B4OA 3T5TA 2BONA 5HUJA 4PYLA 3NRJA 4OGFA 2GZHA 4MWBA 1BG6A 1I80A 1SUEA 2VHXA 3AZOA 4I50B 1R0XA 2WPDD 1X1QA 4MVJD 3W6OA 4AY4A 3BRCA 1VXOA 3CF6R 4ZAZA 3U44A 3ORRA 2VF8A 2Z5VA 4EI2A 5F21A 2WTEA 2BWJA 4ZOCA 3E4CA 5DTIA 3NWJA 5FEUA 1RWQA 1G5PA 2XMSA 3QEMA 4CKEA 3NKVA 3PNVA 1KI3A 2QSYA 4QEKA 2P2LA 2WYVA 4NHEA 3S2YA 1YQXA 1AMNA 3UATA 2UXDB 4OQPA 1SUFA 1BO6A 2WJAA 2XTMA 3ISVA 4JUFA 4LK3A 1E1KA 3BCHA 3WP0A 4PR3A 5ITWA 1GEEA 3L0IB 3K30A 2ZGVA 2AOTB 1P3JA 2Z8YA 1FBNA 2J4DA 2JCYA 4Z4HA 2QTMA 4LS3A 5CT4A 1G3QA 1KETA 3U0BA 2Q6TA 4R16A 1HEIA 2NNLD 3CE9A 3ZNNA 3QK7A 3H1AA 1EK0A 4NFHA 2I55A 1T0IA 3BZUA 4TM8A 5HSGA 3E05A 4DIMA 3HL0A 3BCRA 4GO1A 1T36B 4ILEA 3GCZA 4NMWA 4ZQFA 5FLYA 3Q9LA 5KMGB 4OOFA 1B23P 1JE1A 4HTFA 4RF3A 2DT8A 2A7XA 1ID1A 3BIOA 1L4YA 1U3DA 2P3QA 5AK0A 1UH5A 5JCOA 2GWRA 2O8DB 2YVKA 3U5TA 1LK7A 2JANA 1ECBA 2CWWA 4RPLA 1A82A 3LOUA 3O95A 2PNJA 5JJLA 1ADCA 2HA3A 2IK8A 3OLYA 5AM1A 4FYYA 1XAHA 3EFBA 2VJDA 4P3XA 3NG1A 1XTKA 2QHXA 2ZB7A 4TMFA 5FPTA 1I5OA 2OFXA 1C80A 3ILVA 4O6VA 1J9GA 4BXOA 1Y3HA 4CKCA 1P6XA 1G8AA 2PTGA 2Q3JA 2QTRA 3JALA 3V4FA 1NW7A 4OHMA 1PR1A 1W29A 4J43A 4R3NA 4C43A 2BF4A 2IEAA 3LT2A 3FLMA 1YRBA 4JVNA 4LPKA 5AXCA 1ESMA 4MVJE 1PJSA 3F6PA 3R3XA 3PVSA 2GD1O 2FMKA 1DO0A 2XR1A 3KHTA 4H4CA 1DV2A 1G3MA 2BHRA 4URFA 2Z5FA 4XWAA 2VVTA 1N36B 2A78A 1Q1AA 2WIBA 3I42A 5HZHA 2RI1A 3Q9NA 4L02A 3NH9A 3PC8C 4MSUA 3RQIA 5DTRA 3GT3A 5JNUA 3ZE1B 3L8DA 4XIYA 3H5RA 1VGRA 4NNOA 4JP2A 1TC1A 5TPZA 4AYTA 5C5DA 4MB2A 1PBNA 2QUZA 2CNKA 2HK8A 2O2XA 4K26A 4Y9SA 4KX5A 4DRXA 3WNVA 1U8FO 1KKUA 1MNQA 2XLCA 1SURA 4Z3OA 3RC3A 3BMXA 4F38A 2XCOA 2AN5A 3KIPA 1NDUA 1GSHA 5CA0F 3EQ2A 5KYTA 3RAFC 2C2MA 2HLDD 2SCUA 1ZKMA 1CUSA 2Q4RA 3UENA 1LA2A 3WFZA 4EKEA 5B2EA 2A7QA 2GCNA 5DP1A 5CLGA 1KMNA 3R8XA 1SKYB 2M2IA 3DNMA 1PL6A 5TGTA 1KVTA 2OBXA 5AOCA 3U3DA 1F8XA 3R3YA 3KWLA 4RKRA 4GDMA 4CU5A 2H06A 1R5OA 3T9AA 5HKBA 1Q3KA 3BTVA 1BROA 1J0DA 5GGYA 5BVHA 3CEJA 4B44A 1EFKA 3ZUGA 5DHRA 3N58A 4UXIA 4KPFC 3GLIE 5LMUB 4URUR 5HE8A 4GOXA 1Z6PA 1X3SA 4N6GA 4TMTA 3BRSA 4N7RA 3VVBA 1EE2A 3G79A 4FM9A 4KMMA 4HNAA 1I51A 3R0QA 4PCAA 4QTYA 2QN1A 4XWGA 3ICWA 4ZOAA 2GCPA 3EJ6A 5EP2A 2JAXA 3HBFA 5A4DA 4WJZA 4QNNA 1KFEB 4HH1A 4DIOA 4Z1OA 3CNEA 4L7VA 2G63A 2RONA 3UT5A 1NA5A 1RBZA 2IU6A 4WBXC 1U02A 1ISMA 2VDQB 3EUEA 4DL9A 5DX8A 5KNBD 3T5CA 2VA9A 3FTCA 4BFZA 4RTNA 3QQ5A 2OP0A 4HH0A 4OG2A 3NETA 1ZVMA 3SXUA 2QV7A 4ZYZA 1BEUB 3ASVA 1DKQA 3DVAA 3LZ6A 4IG4A 1G8SA 2ZBUA 4UBIA 4EYSA 2VHJA 4HPXB 3M8KA 4D9JA 3WFIA 4C6TB 4H1UA 1FU7A 1U3UA 3QXHA 1JPVA 1YACA 2ID9A 3NAGA 1LQ2A 4YI5A 3OZEA 5HJ7A 2GBLC 3M6UA 4LGCA 2MSLA 2QRJA 3VTKA 4JJ6A 1V25A 1EFTA 4C0QC 2B4YA 2BMEA 4UOEA 1ECFA 2B7CA 1C0EA 2C2HA 3V2UA 2YWEA 3MS7A 5G2OA 1R0WA 4NS4A 4DG8A 4PSKA 5AM4A 2TECE 3Q10A 2ZR7A 4N8SA 3G1UA 3ND8A 1R15A 2VTDA 1TXGA 2IHVA 3I45A 4NFYA 5FRDA 5L3QA 3AQIA 4MDYA 2WJHA 1N6OA 4FBGA 3L0CA 4EFDA 3UMVA 1B15A 2FEOA 4CEHB 4DLBA 4NONA 3PJRA 1OXVA 2OXCA 2VP5A 4G89A 2QU7A 1TEHA 4Y18A 1A8SA 5AM0A 4DDUA 3UK1A 2HRRA 1RJ9A 3GLVA 4OJTA 1JJBA 5G02A 1NU8A 4MUNA 4O29A 5GP1A 1J56A 2BFEB 1DEXA 3C7DB 1MH9A 3FUXA 4YYEA 2O3QA 4HGNA 4B8ZA 3LUGA 4C3UA 2IPLA 1UJ2A 3ADBA 3CONA 6GPBA 2ZIXB 4DLZA 4LF5B 2IU4A 3SICE 1ZNZA 2FY8A 1WY7A 1KYQA 1TFUA 1I8TA 3H13A 4OGWA 4PX9A 1QE0A 2D3TA 1CRWG 1JSRA 1AK1A 1XZCA 4NCIA 4ND3A 5DI3A 3ZH9B 1VRVA 4AROA 5IDXA 2NT4A 2DKNA 1ORDA 2QRVA 4JXJA 3R9WA 1KI4A 4AY5A 1MC1A 1IJEA 3BH7A 2RGWA 2IZ6A 5CH3A 5K5EA 5U9CA 3FDJA 5AKHA 2R00A 3JD2A 1PQYA 2VT7A 4M37A 3DJFA 3G9UA 1ZIOA 1NLUA 1QH0A 1N5RA 2JRLA 2NUAB 4KYVA 5J23A 3I12A 4DV1B 3BA1A 2FW0A 2AC7A 2YHUA 3A1NA 3SPXA 1K1EA 1QDEA 4NK5A 4YASA 4M22A 4DV7B 3AEUB 4RTJA 3HCCA 4RX1A 2FH5B 1AGYA 3A36A 3FBGA 4PZCA 1DHTA 2RK6A 2PA0A 2WSSD 3TTSA 1EDEA 3Q8LA 2B30A 5FB3A 2DERA 3ROKA 3PPXA 3IL2A 3DMNA 4M0DA 5LBUA 1OI4A 3PQ2A 5DIZA 2GLUA 4LVUA 5F77A 4L8LA 1RZRA 1ZQ1A 2Z30A 3GN1A 4PGAA 4IV0A 4UU7A 2QF7A 2Q99A 5SICE 3GUCA 3IOCA 1A8QA 5FTMA 3LKVA 1KRXA 1TUGA 2WOOA 3F49S 1ARZA 2GCIA 2WYUA 4TL7A 4NCKA 3ITEA 4TMWA 1S2MA 1ZH4A 2TS1A 4DNOA 5KYWA 1LI7A 3ANYB 3V1TC 3N7UA 3OM1A 4UZSA 3WDLA 2X4LA 3WDMA 5INTA 5K20A 3M1YA 3BHNA 3DZHA 3VPXA 1VIMA 1E2UA 2OHVA 1V11A 4TKLA 4E5MA 2NSDA 4X7MA 2ENUA 1POWA 1LPBB 3FTQA 2G1PA 3ESAA 1NM5A 2RSLA 3SGLA 3K6RA 1EPUA 1OXTA 2P69A 1CS0B 3DGEC 2NXCA 3MWEA 2OYCA 1URPA 5KOYA 5FWXA 2WU0A 2CGEA 4BL5A 4PC3A 2QX8A 3CU5A 1E20A 1P9OA 1QIEA 1FSFA 3E18A 1P77A 4MUJA 3NDJA 3WIBA 4C08A 4PYQA 1VLQA 1JAZA 1SRQA 1IHUA 1B0AA 1PZMA 3OJFA 3K0FB 1F2TB 1RLIA 4QOIA 3AF4A 2X19A 4HLNA 4CCSA 3BYZA 5KNDD 3RSCA 3G0HA 3WK4A 1XSEA 1PJ3A 3W5AA 4IDAA 2P65A 5J1TB 4AKSA 3WHKA 3BXEA 3N8DA 4JT8A 1AF7A 5EZ5A 1FS5A 3JQFC 2C42A 1ESZA 4I1RA 2I91A 1ACLA 1W8IA 2W4MA 5JDCC 1TRHA 1UJ6A 2IYNA 2IKQA 5H3HA 2J7KA 4CN8A 4ERNA 3EGWA 5K01A 3LYHA 3EG5A 4F5EA 3JVEA 1NI3A 3EOAI 1IDOA 2AUNA 2EX1A 1TZMA 3RVMA 3V7FA 1NKTA 1N6RA 1SA0B 1N8KA 3C7TA 4Q7LA 1NUTA 2QVYX 2YDYA 1H3FA 4J0IA 1DKMA 2FSUA 3EDQA 4L8GA 3GH3A 4MJ3A 2WM9B 2XXAB 1B00A 1I5RA 2QTGA 1NLYA 2YFHA 4N3CA 3S2FA 3GDFA 1EQ2A 3VSBA 3AVVA 4TL9A 1STOA 1D9XA 3K7EA 3IV9A 4K2HA 1RMTA 2GYYA 4G0MA 4C06A 4DBZA 1G5QA 4RJTA 4W5QA 1U3GA 4NTZA 1QLWA 1YMVA 3KAJA 4FMDB 5BWLA 4UVDA 3FYHA 4CGZA 2P0EA 1C1XA 1XZHA 1JE0A 1TYBE 3AF2A 3O0TA 4JKIA 4EGFA 5L40A 5C34B 1EEHA 2XVYA 4MLDA 2UVPB 3BDAA 3ZY4A 5JSYA 3EXIA 3HCPA 1JJIA 4YV1A 2IZ5A 1NY5A 3NVDA 4TM7A 3WQSB 5IG2A 1P4AA 1I2DA 3DPUA 4D56A 2W4QA 5KSOA 3TI7A 1L4LA 5SZKB 5T67A 2I4RA 1EFHA 1ISRA 3FIJA 2X4GA 3EF1A 1O57A 3ADPA 3QLEA 4GI3A 2JH9A 4ARUA 4DJTA 4P4TA 1IN1A 5K6AC 1SXJE 1EFVB 1KEPA 4WEQA 1GV1A 1VSVA 4MYTA 4IDQA 2VF4X 3NHYA 3EPPA 3P0IA 5FADA 1ZUNB 2B34A 1GTVA 2X8JB 1H6BA 2GDJA 2J3EA 2O59A 3FYTA 4OJQA 5EE3A 1T5HX 2C0CA 2IXDA 1RHQA 2KX7A 2XA1A 3CF2A 3GA5A 5FULA 3EGXA 4FDTA 1BJTA 4N0MA 4WASA 3UF0A 1SPXA 3WL8A 2ZEJA 4KXVA 4YJ2A 1N9GB 2WAOA 5EKDA 1I30A 4COOA 3SFTA 3JRNA 5KZMB 3A1TA 2P2YA 1MJNA 3NTLA 3R6DA 1YGPA 1QORA 1ZIYA 2FVXA 3CEMA 2CZGA 1R4ZA 2FGJA 1OC4A 2WVHA 3DF9A 3K32A 4G25A 3V7UA 2OGTA 2Q7OE 1Y6RA 1OYVA 1T0HB 2C61A 4RZIA 3UYLA 3PFWO 3GN2A 4MW5A 4KMRA 4UM7A 1A76A 4ECEA 1C50A 1RHJA 2VWGA 5H80A 1IYZA 4L5CA 3TXYA 5C3MA 2FX5A 1CVLA 1VLJA 1RE1A 3A10A 1R6AA 2CXUA 1KVQA 1NR1A 4QEDA 2ZSJA 2DH5A 1DWPA 1KOGA 2H0QA 2EW8A 3DXYA 1BS9A 2V03A 4CI0B 2KI5A 1YL5A 5ALDA 2BJHA 2PT9A 4RUKA 3AIIA 4I4TA 3KPWA 2M6LA 1X7WA 4K1LA 3O31A 3CFYA 1OLUB 3B51X 2EF1A 4H27A 3JQ9C 2PRZA 2QN8A 5GV8A 4WHMA 4FD2A 1FXWA 3E2IA 3HCOA 4M1TA 4ZO7A 3WQBA 1Q6ZA 1XE3A 2X3YA 3EG9A 1NUPA 4YC7A 3A9SA 4DNXA 2DR2A 3FDZB 3ZNQA 4NBVA 5CLIA 1ORVA 1WD5A 1ZM4A 2B21A 2CLHB 2XMQA 2WFAA 3O1IC 2FUG6 5GIPE 1B14A 1KZYC 4DDHA 4AP9A 1T8UA 2A92A 3D9QX 4UOZA 5KOIA 2NO0A 2SCUB 4J90A 2QVCA 3JQ8B 3OBIA 2I1LA 2VA8A 3LT1A 4PBSA 4IFBA 4PNHA 5FBKA 3L6RA 3S1AB 4BJHB 2BKVA 3P8ZA 3VM6A 4DCSA 2WDZA 3ESCA 4U02A 3SVZA 1QGUA 4ROSA 3WNDA 3ED1A 5AHWA 2JLZA 4YIHA 3JASA 3QUAA 5HF6A 1USKA 4M0EA 4B71A 2XODA 3RJ9A 1KH3A 1LY1A 1UBSB 1CNMA 4YB8A 4DNPA 3AEKB 4QAQA 2O1XA 4WNCA 1GLGA 4U7DA 3C87A 2C2WA 1EUQA 1JS1X 1AKUA 1FRVA 4PLPA 1H1LA 4J8PA 4MQ5A 4IO1A 3HI6A 1CE8A 2Z1MA 3TLKA 4F1KA 1A27A 3E9NA 5K8TA 1W4CA 3EAGA 1D6JA 4ERXA 3SVTA 1WMSA 3DOIA 2M98A 3ZY3A 3A9CA 1UP4A 1UIMA 3GY0A 1FRFS 1VI5A 4TTSA 2JGIA 1HSOA 1HZZA 3DVSX 1FYXA 3EQ9A 5G1NA 3UJBA 2PUFA 4D9EA 1X9GA 2VJAA 2WAMA 1B4DA 3WGZA 5FBHA 2NP7A 1W85B 3MINA 3UMGA 1T9ZA 1RM4A 1P1RA 2I0FA 1G4AE 4I5DA 3Q15C 2OB1A 1Z35A 2VR1A 1YS2X 1ISHA 2L17A 2O3RA 2WOJA 2JLWA 1AH2A 2BFFB 2E5FA 1GFWA 1NVBA 1GAWA 2Q1UA 2MWMA 1PNOA 3T7JA 4ISCA 2NTVA 2NVUB 2TRSB 2TSYB 1G2PA 2BLLA 2OYSA 3MD0A 3PK0A 1QRDA 4ZXFA 4Z6KA 3AVTA 1ZCFA 3DZFA 4WFIA 3ZWBA 2CXRA 2BH2A 3T4UA 2VDOB 5BWCA 1CW2B 1PTJC 1MHTA 5BXYA 3QMWA 2WHXA 4NCJA 2W83A 3KV3O 4GAEA 1NQXA 2K87A 1UQUA 2CJXA 2YFKA 4NV3A 2ADOA 2GGSA 1G8YA 3A1VA 4FEGA 5IDYA 1V9SA 3G2IA 2I8LA 3I1JA 5L3QB 3AR7A 2MT9A 3C5HA 4PFSA 2VCYA 1ZSNA 3KOUA 4I3HA 3KKPA 1F14A 1A77A 1HF3A 1NW5A 3FPGA 3KL4A 1V3QE 1BE1A 3SKYA 5KJ6A 5A4IS 1W4AA 1Z82A 4N65A 1DTEA 4Y3UA 5AJZA 3HRKA 1W0CA 3E35A 5IT5A 1IBKB 1R8SA 1IATA 4IZ6A 1Z7YA 2HF9A 5C4IA 4G0ZA 5TQJA 1CTQA 1ZIDA 4DCTA 2F1KA 4N5IX 1WUTA 4MKZA 3J80A 1U2ZA 1LK0A 2A94A 5A1JA 3MCZA 5K3FB 5I7UA 3CNNA 5G1PA 3GVHA 2VHUA 3RIMA 3EWNA 1V4NA 4EFNA 3U3XA 1CY6A 1I7SB 1V95A 4BO2A 5FLXA 3HUDA 4CEJA 3O2SB 3EEIA 4AJHA 1JYEA 3TX2A 4LOHA 1KNXA 4J0EA 1YCDA 2BDUA 5DSZA 1CZOA 7MDHA 1MN6A 1NYTA 1JAYA 3JWEA 3EEYA 3HGTA 3HR7A 4F60A 2GZSA 3OAAA 1NRXA 3FKJA 3L7JA 4H4DA 4QOFA 3JWGA 3AONB 3SP1A 3SIXA 2ORVA 1KYIA 1WVGA 2OTCA 1GG8A 2XMBA 2JL1A 3N87A 4OK5A 3SN6A 3ZDCA 3AF3A 1MX3A 2PKYX 2V58A 1GPLA 1DC3A 2ZRGA 1N4AA 2QYTA 3BAZA 3DAFA 2FWRA 3U31A 4HXFB 3ZC3A 1MCZA 1EP2B 2XB4A 3FZGA 2WWXA 1GPJA 1JQ3A 3Q9UA 1U7HA 2AE2A 2Y0BA 1U0LA 1JBKA 3HU5A 2RGXA 4LJ6A 2RHTA 3UHFA 1NPTO 4QM7A 3B5JA 2C83A 5AVZA 4B3HA 3MTAA 3H4IA 3WJ2A 1XEAA 2GWHA 1FFDA 3MFYA 4QYIA 1YAJA 1XDUA 3TBKA 2PAAA 4MQEB 1JLMA 4P83A 3LBFA 1JA0A 1N2ZA 4NJMB 4O08A 3T1NA 2WDPA 4NYJQ 1TKCA 2FZLA 3LTEA 1IOZA 3HUUA 4HLUC 3D1LA 3TW6A 4LF4B 3DS8A 4G07A 4RD4A 3UUWA 1WJGA 3EA0A 1IZ8A 2D8MA 1C3VA 4BLWA 1BXKA 4EY3A 4JSTA 3KSZO 1TO2E 5DN6A 2D4AA 2JLCA 2GD2A 4FFDA 4JGGA 5HZKA 4RHYA 2IEZA 1B1AA 1XMXA 2OZPA 3FJ1A 3PUWA 4MWCA 5FHRA 2PL1A 4JP3A 4ENRA 4TRJA 3DBRB 3Q0TA 2X5JO 4JZKA 2O7VA 3KAKA 5EKXA 5CVDA 5JNSA 1MT3A 2AN9A 2VYNA 2HBZA 1E0AA 1XJQA 3IE2A 4TWJA 3HK2A 4B1FA 3DA8A 3OECA 4F84A 5IT4A 5DLDA 4K03A 3HP7A 4G4SO 3QMMA 2VDNB 1OXUA 1WPRA 2WUGA 1JXOA 2CLSA 1YNSA 3N2NA 3BX1A 4BJ1A 5KWEA 2FDCA 1UOPA 3KLPX 4ASUA 2J87A 1H0SA 2KJQA 2Y4NA 3AKYA 2W2OA 5E4TA 5D85A 4EJMA 1II0A 1X2EA 2ZRAA 4DJDC 3IAM1 5KX5B 1KNQA 3RJ5A 5DWVA 5GJBA 1XTBA 5FFFA 1XRJA 5I9TA 1NNLA 3MRVA 2UV8A 3DMHA 1NVMB 5L3SB 2I2XB 2HFJA 3CNQS 8GPBA 4LSMA 4BGDA 4EKGA 3S81A 1XEWY 1NLFA 1BA2A 2NU6A 3UMBA 3HCAA 1H8HA 3ZZ0A 1YVEI 4EX6A 5A6VA 4NVRA 4NBUA 3VRHA 2E82A 5FYDA 1EFPB 3ICCA 4BFUA 4E6EA 4MWGA 4GHWA 5ESXA 3GPCA 4DM3A 4CMAA 1V9LA 3BAFA 4HAVA 4YQZA 1XLVA 5HQJA 4UBOA 5DBEX 1PD0A 4JROA 1JIIA 4DZZA 4CLRB 2PBFA 1TOAA 3KWMA 4LZWA 4C4SA 1JVSA 1HFEL 2VXBA 4P80A 4UREA 1YCFA 4GX5A 5I7RA 3V9AA 2ORYA 1I10A 1WMEA 1UM9A 3DHYA 1D09A 1SOAA 2E89A 3DDSA 3JYHA 2FWBA 4ZCSA 4L50A 1QKIA 4HQOA 5IULC 1F6BA 1FXWF 4CQJA 4NL4H 5JXGA 1C4WA 2B1RA 4AMZA 3RAGA 4ARSA 4PN7A 3OX3A 3MJ4A 2QI9F 1Y5RA 5FI1B 3ZBUA 3GRUA 5IMSA 4AK9A 3UJDA 4AKIA 2B36A 4G8JA 4FOTA 2ZIAA 4FYKA 3OTHA 1WO8A 2YJ4A 2ZFUA 4RCYA 4PYOA 1L4EA 3BZWA 4HBZA 2JAOA 2IZ0A 4GX2A 1GLNA 1HMYA 2A8YA 3PC4A 4J29A 5JYCA 5JO0A 3DLAA 3RSFA 2HY7A 1GUBA 1K08A 3FUUA 4CLHA 4U7JA 1E1NA 1VKOA 1YIAA 4FFVA 1H3EA 4BKMA 2CF5A 3EY9A 1AN9A 3CSSA 3ELUA 3LT5A 3OZSA 1TMGE 1J8YF 5KJEA 3ZHBA 3QFTA 1E8NA 4NXMB 5GONB 1FJHA 5DLEA 4AL4A 3OO0A 1GTL1 2HW8A 4AY2A 4L08A 1R00A 2I1VB 2FFJA 4IDEA 2AA3A 3W4JA 2ZWIA 4YRGA 1H85A 1ZVJA 4PLFA 1FZTA 5AVYA 1G42A 2XZTA 1SHTX 3B6JA 2A0YA 4HQ0A 5FI0B 3WMRA 3VKGA 1XXHB 2AFVA 1YKGA 5IZCA 1AB6A 5IYZA 1A8PA 1EDDA 1XZNA 3UUEA 1Q19A 4HDQB 5CDYA 1VJCA 1H9CA 3F97A 4W7HA 3B5IA 1C3JA 1JEYB 1KY5A 1SZJG 1N7IA 2W6ZA 1L7AA 3GGCA 4X85A 2I78A 5D1HA 2QY9A 1U0JA 1FNBA 2DFNA 4IIVA 1GNVA 1T5OA 3LSYA 1H66A 4QJIA 4RFVA 1UWVA 1AIPA 3GGJA 2FR0A 3A7DA 1C29B 3MJFA 4W8OA 1UZAA 5DNYB 2R6AA 4YUZA 3IJ5A 1RRGA 4L1KA 5JOQA 1JFSA 1V7ZA 4JA0A 2OQVA 5LLSA 1RJDA 2IF0A 1WHTA 5AW8A 1G66A 3ZCSA 5ADVA 1NI4B 3QQPA 2FSSA 3LUHA 3RYIB 1L6IA 3WISA 5BNTA 2O2SA 4TXMA 3MB8A 3OZRA 5MF6A 2AOUB 3AFGA 5A6SB 2FK8A 2LKCA 5DBFA 4XUDA 5FLKA 1XA0A 5FL7A 3U81A 2FQWA 3MZ0A 4E46A 4B7CA 4QC2A 1PL7A 2GK3A 5F3WB 4IUCS 1ABEA 3G2HA 5H9VA 3VFDA 4XPIA 4KYTA 3VO8A 1RC0A 2BTOA 2J67A 4NEGA 5I7SA 4O02B 3RS5A 2P9EA 4F06A 4B34A 2CCKA 4O2AA 4CODB 2UYCA 4RF4A 1BKSB 4LNAA 4MS3B 2OHJA 3DMFA 5MDHA 1ZD1A 5EJ5A 1Z6YA 4D3FA 1E5VA 1TL7C 1XQ1A 1Z4OA 2JH3A 1EESA 2DFVA 1O1YA 3L4JA 4G0YA 3FM9A 4KXMA 4R8KA 1KQFA 2R44A 4ZYLA 2H57A 3GJZA 4NYMQ 4X7RA 3TLZA 3D7RA 1M7GA 5CIQA 4IJ6A 3JS5A 3PUIA 3QVWA 1VG9B 2REQA 2C5LA 2LKDA 3ETLA 2NU9A 4ZT3A 5BMVB 3Q8WA 4UVEA 3SE0A 3D7SA 2A86A 2IPXA 1X1RA 5CA1F 2WTBA 4ZYYA 2Y68A 1XLUA 2ZWMA 1JDJA 2JAHA 3QPVA 1XNRB 3NBYC 1TAGA 2V7EA 1TZCA 5LP6B 2ZSEA 2G9UA 3PZRA 4D4KA 5CDFA 3FX2A 3KE8A 3PFHA 4OM8A 3UIEA 3W0LB 3GLKA 1FLVA 1VHJA 3FG9A 3FPSA 4YMTA 2RGRA 4UHBA 1ZJ6A 2QLNA 2O19A 4JHLA 1AQNA 1Y5NA 2R11A 4R8RA 5IEJA 5K3EA 4CF5A 3OA0A 4HX9A 4NDAA 4PO1A 4QM6A 4KB5A 3NHMA 4CMEC 4EZIA 3DL0A 4C01A 5J3JA 4BGVA 4OAPA 3SYRA 5AI0A 2G1JA 3RC1A 2XTNA 3K35A 1ULSA 3THYB 3ZG6A 2GCOA 1A1VA 3CR3C 3PFBA 4G1UC 3RROA 3SZRA 2GPAA 5FH9A 2X6RA 4YV7A 4OFXA 5P8WA 5KQRA 2YNMD 1QPZA 3V2GA 2PFGA 2GPJA 5EINA 4TV9F 4PQYA 3II6X 3GRVA 4H7EA 3KUUA 1WQ1R 4H7HA 2G82A 3LC2O 3ON5A 2Y1LA 4KMOA 1RAAA 4ZCIA 2BM8A 2ASVA 3OQIA 4ZMRA 1ODFA 4PBRA 4DQXA 1FDTA 1E89A 2OYRA 3OPQA 3J81A 1Y8RB 1WX1A 2D3WA 4EJ6A 2PXXA 3H99A 3VKVA 3A9WA 5TT0A 4LAFA 1W44A 1GTSA 5L9AA 3VOAA 1D2NA 3BMOA 4MUFA 1YCHA 3C16C 1CWUA 3RC7A 4ZA2A 2HGSA 4FBMA 4NAUA 1IU9A 1TGYA 2CE2X 3TS1A 2RHLA 2CHQA 1R16A 4I55F 2PUDA 3QVSA 1QR2A 1E3SA 1TQ6A 2H2IA 3QPCA 3WQHA 5FKJA 5B1IA 1HK7A 3ZHUA 1YL7A 2NADA 1L4NA 1CQPA 1JHPA 4QUEA 4TXNA 1T5TA 3DBVO 3LWZA 3VC7A 1PWEA 2B78A 3IQHX 4X97A 2VRCD 4NBWA 3LLSA 1XTIA 1L4UA 4X20A 4Y1FA 3PHIA 5DMXA 5JG7A 2CFOA 4KG7A 3THRA 3AUAA 3AI1A 4DEYA 2C0PA 4AKTA 1A98A 1C9EA 3U49A 1QC5A 3ZHRA 5IN5A 3ONDA 2PD6A 3LS2A 1Y5IA 3KYDB 1YR7A 2WU8A 4J0DA 3LDAA 1GQOA 1RT9A 5JAHA 4WOPA 5M7EA 1HYBA 3C7CB 3GRPA 2VJPA 3QE2A 4M6WB 3OM8A 5ALKA 3DAGA 1X6VA 4LQCA 4P35A 3WMXA 4DYDA 2L19A 5FEMA 4UUBA 4DT1A 1SM4A 4ETIA 2OCLA 2FU5C 3JRXA 3BCSA 2GZ1A 5BR4A 5JALA 5SYAA 2JFYA 1XZLA 4MRMB 4AZTA 1VIAA 2CY0A 2G08A 2LD4A 3NNNA 5JZ9A 3GARA 3PC7A 1NC3A 2R1TA 3KQPA 3KZNA 4R31A 4MRSA 4XOUA 5KHAA 3R9XA 4NYIR 3CZMA 3FWZA 3QBJA 2BH9A 3WP1B 5CG2A 2GAFA 4X45A 4YREA 1GQSA 3D3NA 3B60A 2P2DA 4JUDX 5AJTA 2WM8A 5DEOA 1KJIA 5GZ6A 5SY9A 3OPYB 2QUHA 5BXQC 3IC5A 1NVAA 3R23A 1QPGA 4KVAA 2WLSA 4E4YA 3ETGA 3M33A 4F9FA 5IABA 3IDZA 1N75A 3QZUA 4IILA 1QZTA 1QO9A 2FX2A 2BFBB 1G18A 1WXDA 3KSUA 1VL1A 2X9LA 1OTYA 1I9CA 1N78A 3ILSA 4QU0A 1YMQA 2J6IA 3RVJA 1J90A 1MLDA 1I3OA 4CHGA 3PR2B 3PHBE 3TEJA 5CCDA 5J43A 4QFBA 3EVAA 3FXAA 4N3BA 4IS3A 3W5IA 3FR8A 2HU5A 3GCDA 5J2TA 3LG2A 2OBFA 3WIDA 4U5QA 1P2TA 2K7FA 1BWQA 4ZT6A 2XYRA 1U8AA 3U37A 3K1YA 1GTZA 5C80A 5AW7A 5H59A 1PGPA 5G40A 5C7IO 1OROA 1XD2B 4HWSA 2UZ4A 4M9SA 3X1YA 1B8OA 2H59A 2ZJBA 1EGVB 1R0LA 4HQFA 4QOHA 4DEVA 2C7QA 3MWGA 2X40A 1N33B 3GP5A 1NBMA 1U98A 2OC4A 1R6UA 2WF9A 4CIWA 5KDLA 3G1TA 3DC2A 4PLCA 5JXJA 1PT6A 3STYA 5EGNA 3UK6A 4AP5A 2CLEB 2OAGA 4KDCA 2BGKA 1BCSA 1VJ5A 1IXSB 3HY6A 5EYPA 2Z4TA 3E5RA 3PQ6A 4D57A 4MJXA 1QB8A 1TM7E 3IO5A 3L8MA 3TAUA 2KHZA 1N5KA 5L45A 1WCYA 4RDCA 4D9FA 4V0MA 1YOVB 2LRHA 3LNTA 1Z34A 3N6XA 4YLGA 1D1TA 3CH6A 1JXQA 1R0SA 2YV5A 4OAQA 3EZ2A 4DRZA 4MVJG 3KOZA 4AW9A 2YMMA 3DKVA 3QITA 3FHCB 2EL7A 1P91A 2QNIA 3DB2A 1R0ZA 3OHPA 3MD9A 3GD7A 4HNQA 2JPDA 2QW8A 2BKAA 3CQ9A 4UMDA 2G4LA 3U56A 1SH7A 1J97A 3A11A 1FU8A 3SBXA 1E4OA 3ZVKA 2Q5LA 2DMRA 3HDVA 3P97A 4TROA 4EL0A 2G9QA 1K9SA 3TL2A 1AF4A 1LLFA 2F9FA 4G86A 5FUQA 1HDXA 1WSAA 5CXSA 4WUVA 2EKBA 1F8UA 2GJ4A 4EMTA 3MTDA 4U9IS 3NIDB 3O8OA 3THXB 3HS3A 5C5EA 4RTSA 4JVMA 4MV5A 1XJ0A 1F2VA 2CDCA 1BVHA 2ACWA 1NF9A 1I4LD 1K8QA 4RVHA 3GW8A 1T0PA 3DFUA 4M0KA 4PYRA 2VZ8A 2W2NA 3DMGA 3EW7A 3FH0A 1M7HA 1V5WA 4L6AA 3EQ7A 3C3AA 2FUG1 5KKNB 2OBYA 1AXRA 4X8HA 4G0WA 1KJWA 3CXUA 3NM5A 1FX0B 4W9MC 4FSHA 3KYCA 2C2BA 2ZR8A 2IP1A 3G7NA 4RFSA 4ZCTA 5C81A 4DQKA 1T9DA 1EK6A 4ENSA 2R8OA 5HYVA 1PKXA 1L8OA 3DW1X 3OICA 4O5AA 1HH4A 4RYDA 2VK2A 1GQQA 4I2VA 2BM0A 1D07A 2YMQA 1A9XA 1ZD3A 4XJXA 1YZHA 1VYTA 4DXDA 3HVJA 3C85A 3IKTA 3T7RA 2FSIA 4OI0A 2ZRBA 2RHMA 3TZQA 2XWPA 4HX2A 4PCVA 1XCBA 4BFVA 1KEEB 2RGAA 5EWLA 2QAGB 2VCHA 1CJKC 1LJUA 1DBRA 5JAQA 3I52A 4F1JA 5JSQA 3NH6A 4X93A 3W7BA 3FB4A 3OX4A 4GFDA 4U2FA 1ENPA 5DSTA 4I8DA 1UFVA 3SU8A 2GPNA 2A5GA 1BU8A 3SFVA 4UW9A 1A95A 4GRAA 4HEA6 1C8KA 4DG9A 4G9EA 2YYYA 3GU3A 4NBKA 3GEPA 1T6NA 2WE8A 3H7AA 4MYDA 1R6DA 3JQAA 1B2LA 3QXJA 3L05A 4HNSA 5MHTA 2B69A 4CZ2A 1YDHA 3C3MA 5U4XA 3H6KA 4RVDA 1U9YA 5TE9A 1EUCB 2D7CA 2F3UA 3VR2A 3L7AA 5DWQA 1JYSA 5FFMA 1X1TA 1G5TA 4JVOA 4EB6A 4S1NA 3AEXA 3FOEC 3OUUA 1NMSA 3DZDA 1QRAA 2OV2A 1X7DA 3KB8A 5DYTA 4YPFA 2RGCA 4AM8A 3SSAA 1GD1O 2ODWA 3HEBA 1O96A 4E21A 3BUSA 1RJFA 1ENYA 4XWOA 3JATA 4GIBA 4QFCA 1SCNE 4IXMA 4QGAA 3HKCB 1EE1A 1JLRA 3RYTC 3DTNA 5JAOA 2J1LA 4P7GA 2YWRA 3FAZA 5BP7A 3EGDA 1LV7A 1QX4A 2UAGA 5D01A 3WNQA 3G02A 3QUSA 2I03A 4IDPA 1LRKA 3EIFA 3QLUA 1Q7BA 4QOEA 1H2HA 2WVJA 3KEMA 3RGWS 2WSIA 3UAVA 4AAYA 3MT9A 2H7CA 2QAJA 2JD2A 1RWPA 1PFWA 4IJMA 3RVRA 5I9BA 2GQ0A 5KTYA 4B46A 3WAJA 5GINE 1GNLA 2HIAA 1MFPA 3OE7A 4LVCA 1KXJA 2YOHA 1AOXA 1BKDR 4EECA 1QYIA 2BUCA 2R6CA 4W5WA 3GLSA 4TKUB 4LGVA 2W6PA 3AW8A 4LE0A 4K6GA 5K3BA 3IJRA 4CTNA 1BMFA 4IDBA 4BLTA 4EK9A 1UBRS 4OU5A 3RC9A 2XDWA 2ZIFA 3MLAA 3WK7A 1I2CA 1JDSA 1RWVA 1YQEA 3BREA 5E9AA 4ZYTA 4FNMA 3HLYA 4CRWB 1XMOB 3UAXA 3CNLA 4MIEA 2ORWA 1SD1A 2R9VA 3JWHA 1UXOA 4BFSA 4GR4A 2ERYA 3KB1A 3HZOA 2BMDA 5ESDA 2VATA 5TMDA 3WKEA 4AJ4A 4C88A 1H9BA 1JIQA 3FVQA 4C87A 4UDYX 2DUNA 4F11A 4MWEA 2XAUA 3KP1A 3RV4A 4BBZA 1FS6A 1PCXA 1DCKA 3E7XA 5JVDF 2H16A 1VHTA 5KYUB 3KOYA 4ZOLB 5IDWA 3PIIA 2E5LB 5KO2A 4UTXA 4Z9AA 3UHOA 4BMZA 1LDGA 1Z06A 3EXFA 4BN0A 3M6WA 2WTXA 3RK4A 2PBLA 1MGOA 4QYSA 2O2CA 1BW9A 3L8CA 4KHPB 1PKEA 2O50A 2GEKA 4UMFA 2POQX 2RAVA 3EDMA 3HRIA 3P20A 4LJ7A 5AI8A 1ZI8A 3D8BA 4GSKA 3OZAA 4HADA 3CW9A 1CZRA 4IQ8A 5CM8B 2GCOB 3TAHA 4HRYA 3GRKA 1YQ9A 2PBRA 3KXDA 1RBYA 1W4BA 4LF9B 3RANA 2M1XA 4DNQA 3A2KA 2UZ3A 5H3CA 3U39A 1ESNA 1QX3A 3ZEAA 2YW2A 1LNSA 1UJ4A 3VPCA 1NPDA 4H7PA 2HK6A 2RKWA 3ZDDA 1XUOA 1OVGA 1ZNWA 3X1MA 2O0LA 1WPQA 2O0HA 4RZHA 4F4UA 5IDQA 2Q6VA 3TRJA 1SUPA 4PLGA 1TM2A 3IODA 4PVCA 4C07A 1KJYA 1TF5A 1Y3FE 2PT5A 1JILA 2WUEA 4FIZA 4FJ2A 1DC5A 1P3Y1 4RV5A 2VPWA 2P4EA 1ZRSA 3SX0A 3LT4A 1QQ6A 4LHEA 3TN7A 3ESYA 2BR4A 1G21B 3WB0A 4PWZA 3RRZA 2D1SA 1G9XA 3BB1A 3QFRA 4IWXA 2J3KA 3C14C 4Y9DA 5EQDA 2L42A 1JIXA 4FGKA 3W34A 4TLBA 1ODKA 3PDWA 2EG5A 5FI3A 3WAGA 2BDTA 1P2DA 2DFKB 3QLJA 1YZLA 5E3IA 4BB6A 3I2HA 4YAJA 1XZMA 2GEUA 2VRNA 4L5BA 1FVOA 4QPNA 2R8YA 2JGKA 5JQWA 3BDIA 1JA9A 3L8ZA 1KJJA 2KSQA 2W48A 1KRHA 1N3YA 1XZ8A 2GAOA 1KOJA 2JCVA 3AZQA 3WLLA 2ZU6A 4RQAA 1N1MA 5BY2A 2J0UA 1SC1A 3NTRA 4OK3A 3KKLA 1Z29A 1KDOA 5EIBD 3LXXA 1KI8A 1KJQA 3AY6A 4QT0A 1CETA 1DTSA 1EBFA 4MKHA 4NBRA 3U40A 5EIWA 3GB9A 4RMGA 5A0VA 5HF9A 2YJ3A 4E3WA 2SKEA 4LZZA 2JD1A 3PC3A 4W1PA 2YWBA 2RFLA 3H5LA 2W2QA 3AC0A 4AURA 2GR9A 3R24A 1J1IA 3R5SA 4RKQA 3ILYA 1QFYA 2YNMC 5L7WA 1FP6A 2HWUA 3HV0A 3AUFA 1QQ5A 1YO6A 5CVEA 4KIJA 1GZDA 2B1GA 5EZYA 2OILA 5HILA 3GLFE 4WK4B 5DTEA 2JLXA 3EX7C 2NGRA 3KFLA 1OAOA 1B6TA 1S3FA 2NXWA 3PUVA 1P0MA 1YRQA 3ML1A 4Z8YA 1NN0A 3VZSA 4FR2A 2PV7A 6ADHA 3W6NA 2R4QA 4IH9A 1B73A 3QF4B 4QU9A 3WFJA 2J7PA 4I8IA 4TZTA 1LDMA 1PZEA 1FLNA 4FXOA 3TFWA 1CY8A 4HXEB 3KCQA 4FR0A 1RPJA 1N2CE 3I9MA 3EXHC 3OT1A 3PYMA 3PXGA 5ICMA 2VAMA 1VB5A 5AVUA 1Y1SA 4IYRA 2WV9A 4FCVA 5DHAA 4BZPA 3F0TA 4E2FA 1DC6A 5BV0A 4KU4A 4JI2B 2EJUA 2PXAA 4ZVOA 3TUIC 1BU5A 1UBEA 5LBTA 4JEMA 3WI7A 1OZHA 4A8JA 4AQDA 4BFYA 3W9BA 4X6UA 3N86A 5L8VA 4LBWA 5ITZB 1SG9A 3LGSA 3QJYA 3U7HB 1I4WA 1DIOB 1ZK0A 1TA9A 2GRJA 3ZX5A 1KMHB 1TPZA 3HY4A 5KYYA 2PJRA 3GEGA 3DOHA 3G0IA 3KKNA 4NBLA 5AMXA 1AQIA 4L6CA 3PPIA 3WRXA 1OI2A 1QIIA 4FSDA 4DCNA 2I3AA 2O3TA 5J2UF 5KKAA 3TIIA 4L5AA 5CTJA 3HWWA 2IH4A 4NPAA 5CCXA 1CR2A 1UZMA 2OHHA 2V8OA 2XBLA 4OATA 2WYHA 2DT5A 3W5BA 4HDSB 4M9XA 2AJDA 2HTEA 3IR6A 2JGAA 2O7SA 3U7GA 2XBUA 1OC2A 4MP6A 3T95A 4KQMA 2ZT5A 1XRMA 4ONEA 4XRGA 3L1JA 4LYJA 1Z6AA 3MCAA 1RACA 1UMDA 4DLWA 5JNRA 4R9RA 4PS0A 4ITVA 4LY0A 1G4HA 4GEKA 3GLRA 2IYVA 3C6XA 5DT9A 5I9MA 2WVAA 2FWJA 3FVWA 3STTA 4FLFA 3QHQA 5KYXA 1H9AA 2BJWA 1Q0SA 4LSZA 4C7JA 1GGNA 1TYDE 1GUDA 3OZFA 4HAYA 3DKKA 4YBZA 5DX1A 3O7WA 3K0KA 1TT5B 2XOKD 4K6FA 2ZDGA 3WB9A 3KPYA 2WB2A 4K8RB 3AB3A 5A9SA 4LECA 4YS6A 3F98A 5AVRA 2RH4A 2P9FA 1QJ4A 2IF2A 2XXJA 2ZCVA 4OQZA 4PO8A 4QSMA 5C18A 1JFFA 4HGYA 3UUGA 1N1EA 4IIJA 4U9HS 5LYJA 1Q7CA 4U9UA 4WN3A 3U2QA 3ZBQA 1K6JA 3COPA 1GYRA 3RGGA 2FUKA 3EB9A 4I08A 1LDYA 4C0SA 2F64A 4E09A 4EG3A 5LN1A 1TK3A 2P78A 1E1RA 1KQGA 3V97A 2GK6A 2KM1A 3M2PA 2PGJA 1XD8A 4CV2A 3F7OA 3I9NA 2X2FA 3CB2A 5JUWA 5CNIA 3KG2A 2JH8A 4BY9E 4MKXA 1AGXA 1U0HC 4BOYA 3WGLA 1QZZA 2BE9A 3ADOA 3HDQA 3SIPA 2BMFA 4GPBA 4PX2A 1QP4A 2HHJA 5IJWA 2OK8A 1M0SA 1U5CA 4HTAA 4U2DA 3AVOA 3X0DA 4EW6A 1NV9A 3NOOA 4O4IA 3VPBA 2IHZA 2DOKA 3LP5A 4RFSB 4UM5A 3MXOA 3N8IA 4PNPA 4XKJA 2W2TA 1MFZA 4UNIA 4R5HA 3EVZA 4RA6A 3QTTA 3C3BA 4PYJA 4MUGA 2OKGA 1L9XA 4X41A 2IHBA 2NQ8A 1HFJA 4CM4A 4IRUB 2BDEA 4JEUA 3FPAA 2B3DA 3TIFA 2ZJYA 1A04A 2B5VA 2R8XA 3JQQA 2V7QA 2XKBA 3FMIA 2C4VA 4EVQA 1DRWA 1LS6A 5C8YA 4BUJA 4CPDA 2IPAB 5K1ZA 1EJBA 5F64A 5BSGA 1FP4A 5CITA 5B3LA 4ECAA 3UWSA 3B1YA 1U8UA 1KEWA 4Z3DA 3C3PA 1KK2A 2B8NA 1HOTA 3HUFA 1KSGA 3PPYA 4F6CA 4FQ7A 4HSGA 5EKTA 1EUDA 2Y05A 2PZFA 1H4VB 2I2FA 1LSOA 4LMAA 5MN5A 5IBQA 5A3JA 1N9ZA 2IYYA 4TLAA 3DD5A 4JC8A 3UH0A 3HJAA 3PF8A 1M1YB 1W5TA 2JI7A 4KE6A 3NUZA 4UVGA 5CVTA 3RWBA 1EWYA 4UTVA 4U00A 1CEEA 1OMOA 2FGKA 1DVRA 1B8PA 1V1MB 3RS3A 3GLGB 2HMYB 1GKKA 3TH5A 4BLVA 2F3TA 3WSWA 3N28A 3DBHB 2BE7A 2Q2OA 3SC2A 1P7WA 1WP4A 3K20A 1GPNA 3I5AA 1GRCA