2JKYA

Saccharomyces cerevisiae hypoxanthine-guanine phosphoribosyltransferase in complex with gmp (guanosine 5'- monophosphate) (tetragonal crystal form)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
210
structure length
207
Chain Sequence
DKQYISYNNVHQLCQVSAERIKNFKPDLIIAIGGGGFIPARILRTFLKEPGVPTIRIFAIILSLYEDLNSVGSEVGVKVSRTQWIDYEQCKLDLVGKNVLIVDEVDDTRTTLHYALSELEKDAAEQAKAKGIDTEKSPEMKTNFGIFVLHDKQKPKKADLPAEMLNDKNRYFAAKTVPDKWYAYPWESTDIVFHTRMAIEQGNDIFI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
publication title Functional Significance of Four Successive Glycine Residues in the Pyrophosphate Binding Loop of Fungal 6-Oxopurine Phosphoribosyltransferases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 65
structure length 207
sequence length 210
chains with identical sequence B
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2008-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2jkyA00
1UFRA 4RHYA 1U9ZA 1XTVA 4TWBA 1UPUA 3ACDA 4LZNA 5BQPA 1ZN9A 4RAOA 2JKZA 1JLSA 4M0UA 1NONA 4RACA 3DEZA 4P84A 4F8EA 1HMPA 1CJBA 1ECCA 1L1QA 2XBUA 1QK4A 2PRZA 4RANA 1OROA 5ESWA 5ESXA 4RHXA 1A97A 1A98A 1QCDA 1G2PA 1V9SA 4P83A 4RAQA 4RHTA 2VFAA 3N2LA 4LZAA 1D6NA 4LYYA 5E38A 4ZFNA 1G2QA 1UPFA 2JKYA 1OREA 1TC2A 2H06A 4PAWA 1J7JA 5BRNA 4P86A 4IJQA 1I0IA 2WNSA 3LRTA 4MB6A 1VSTA 1GRVA 1VCHA 1Z7GA 4RADA 1MZVA 2HCRA 1P17A 4JITA 3OZFA 3KB8A 1A95A 1L1RA 1O5OA 1QCCA 5BQOA 1QB7A 1XZ8A 4RQBA 5IAOA 1FSGA 4WN3A 4RHUA 1G9SA 1ECFA 1QK5A 1A3CA 2P1ZA 1A4XA 1P18A 2GEBA 2H07A 4Z1OA 4S2UA 5BSKA 3GEPA 3OZGA 4RV4A 1WD5A 1OPRA 1QB8A 4RABA 4LZOA 2YZKA 3ACCA 4QRIA 1GPH1 4FYMA 4KN6A 2H08A 1TC1A 2JI4A 3EFHA 4P80A 4WMLA 4X44A 3NAGA 1VDMA 1DBRA 1ECGA 1I5EA 1XTTA 2E55A 3LPNA 3OHPA 5HKLA 1P4AA 2PRYA 4P81A 5K51A 4M0KA 3ACBA 1ECJA 2DY0A 3GGJA 3QW4B 2EHJA 3M3HA 2FXVA 4X45A 2JBHA 5JSQA 1DQPA 5JV5A 4P82A 1LH0A 3MJDA 4P3KA 5KAMA 1NULA 1HGXA 5KAPA 1A96A 4JLSA 2PS1A 1P19A 1XZNA 2AEEA 5EUCA 1ECBA 1R3UA 1XTUA 3GGCA 4QYIA 3S5JA 1IBSA 4RQAA 3HVUA 1DQNA 5HIAA 1STOA 3H83A 1QK3A 5IPFA 3MBIA 1BD3A 2IGBA 1I13A 3O7MA 3DMPA 1I0LA 4OHCA 1PZMA 4PFQA 1O57A 1Y0BA 1AO0A 4M0PA 1DKRA 1ZN8A 2C4KA 3DAHA 1JLRA 1G9TA 1BD4A 1YFZA 1U9YA 1W30A 3G6WA 1ZN7A 4LYGA 1DKUA 1I14A 1BZYA 4QYIB
chains in the Genus database with same CATH superfamily
2Q9UA 3GARA 3W3AD 3EDOA 4MUYA 1RQPA 5LDGA 2IL1A 4MIKA 3TSAA 4DA9A 3L6OO 2HR1A 4FYXA 1WKBA 2NO9A 2X77A 3AH8A 3V34A 3PGJA 2IIBA 2Q3MA 3CLKA 1M74A 3G3EA 4B0OA 4PZLA 3X2FA 4F96A 4GDFA 5A4DA 1XZBA 5ALRA 4GLBA 4GMKA 2O59A 4UDYX 1Z3IX 4DPMA 7MHTA 2FQWA 2ZTLA 1SIWA 4G0WA 3OWHA 1GLVA 2P2SA 3BUSA 1N34B 3EW7A 1M6HA 3H5RA 2QVBA 1PJ2A 1LI4A 2Z1NA 2GZ1A 3HCBA 1Q5PA 2DPHA 2REQB 2GSWA 2VHEA 3RS2A 2Z04A 4IXMA 2QBYB 1IXZA 3GOQA 1RKUA 1SVNA 2GN8A 3DEJA 1I2MA 1XZJA 1CE8B 1H6CA 2WICA 3KB6A 4BJHB 1WBBA 2LWIA 1HNWB 2VF2A 1Q0SA 1KI6A 3A4IA 4GP9A 1X80A 2ZIUB 2MYTA 4MCJA 1OA1A 3RVOA 1NXQA 2P6MA 3UGKA 5A9SB 3LLCA 1U0RA 5JISA 1E7SA 2ISCA 2NMVA 1YDHA 1MT3A 3RVDA 4FILA 3TLKA 3CX7A 2YVLA 4CM6A 4Z51A 5I7RA 4KRFA 1DG1G 3MJVA 3OCZA 1P2TA 3I37X 3ZJ4A 2AMFA 3I2KA 1T43A 4NYIR 3B7WA 1SCAA 2IH5A 5LYJA 4N39A 4LYHA 3HB0A 3HRHA 4N40A 3ZOKA 2D5CA 3BREA 3PQ8A 4R0VA 4S2UA 4DR7B 2A5LA 4K26A 3K9CA 4FCTA 5J2UA 1AKWA 1DO8A 3OLCX 4UAGA 1J6UA 1ZM7A 1AHHA 1ZK4A 3ZY2A 3ACCA 3B7GA 3MB5A 2PH7A 4UBMA 3GU3A 2G6BA 2GLUA 1A9XB 2R8YA 1ZK0A 4MW4A 3QPBA 4GOLD 4MYUA 5JNWA 2ZPAA 3OPYB 1KK2A 2WLTA 1YOVA 3CZ4A 3LY7A 5AW2A 3H86A 2QTVA 3M6FA 4FYYA 3KS9A 3NZEA 1JB1A 1XXHB 3OQIB 3Q98A 3WXMA 5K3OA 4JXZA 4RK0A 1TCVA 1DADA 4A03A 1DUVG 2EV9A 3BWEA 3E81A 4M6WA 4WXEA 1MDBA 1S1MA 4JYPA 4MUGA 5CVUA 2FUG1 3U37A 1L7OA 3U7RA 2WOOA 1TJ3A 2H7XA 2WUVA 3GNTA 3Q72A 4TX1A 5KAMA 4DANA 5CB8A 2VJLA 3CNOA 4XPZA 4KHPB 4P36A 4CCYB 3CRNA 1N5LA 2VXBA 3BVPA 3DXYA 1IHUA 4A0QA 1P5ZB 4J0DA 2XDYA 4B7UA 1ZD4A 4IQ8A 3K6SB 5JU6A 5GVRA 3Q8MA 4LJKA 5JEDA 3GN2A 1DBVO 2HSEA 4QU9A 3I09A 1F0PA 4IKOA 3HADA 3T1OA 3CVOA 4J0KA 4KQ6A 4RMHA 4EHDA 4BO9A 3AHCA 4KZPA 1UMDA 4ZDWA 4DLPA 4Q24A 1DCKA 2HA4A 4Q4HB 4YRDA 1ADYA 1YZLA 3EN0A 2ZANA 1BDJA 3EQ2A 3HH8A 2JA2A 3M6AA 3FDJA 4HGNA 2OGZA 2PKQP 5EHNA 2OXTA 3RBZA 1NX9A 5HRCA 2VG8A 3G2JA 4GPBA 4RXMA 5CH3A 4HEA6 4TSRA 1NASA 4LSWA 3FTQA 4N9QA 3W34A 3T7IA 5ADWA 2C4KA 4EUFA 3P9RA 4E2XA 2I2BA 4ROTA 3AHFA 4CEIB 3B6IA 1BD4A 2HLNA 1RXYA 2VYFA 1ENZA 1W30A 1G6OA 1Q16A 1G8KA 4CMAA 1PAUA 2F90A 2R5WA 2YFYA 1YF3A 4L9WA 5DHAA 4FX2A 4Q1VA 1NUAA 3KKZA 1U5BB 3MBOA 5L45A 1ZUNA 1I6WA 2XECA 3E05A 1FMLA 3KD3A 3A1WA 3MJEA 4JJEA 1AURA 2XKJE 2I3DA 4L8YA 1PVDA 1J5PA 2HBZA 3N8DA 5A5FA 4HTFA 2OCGA 2ZATA 1FVXA 4V1CA 3I2YX 3LL4A 3CONA 1HFJA 4WEOA 5IMBA 2WM9B 1LFAA 4KOEC 3KU1A 4GPD1 3C8UA 3TQTA 1XCMA 1S2OA 2Q3DA 4EO4A 1V47A 3EGOA 3L7OA 2FG5A 3QI2A 2WV7A 5CT6A 5CFLA 3UG6A 2DT5A 1N92A 3QMVA 4N3BA 5G53C 3NTOA 3ED1A 3DE2X 1P8AA 1ZRSA 4LYYA 3N2ZB 3VR2A 4EO7A 5CLQA 1EGAA 1Q7BA 1W35A 3TUZC 2QK4A 4JN6B 5IKXA 1S9DA 1E69A 4L8WB 3DHYA 3A14A 4M3NA 4QHTA 1CY8A 5F5XA 1BHSA 2VHQA 3TTVA 3PT9A 1LTHR 1MRZA 2R4UA 1KIMA 4F1KA 5DNUA 1GRVA 3AB7A 2BHTA 4HS9A 1DB3A 5KWIA 3CO0S 1QRAA 4LDJA 4Z1MA 3FLMA 5U4QA 3FOEC 4N8DA 3K96A 3LBFA 4OVKA 3WIUA 3F9RA 5DNVA 4D9NA 1QRTA 4OHPA 3L43A 4I8XA 1GN8A 3W5IA 4OQNA 2DKNA 1N2CB 4IYRA 4U39A 4R0MA 1X9IA 2RGGA 1RC1A 2SICE 4I0WB 4KXQA 4LBYA 1YO6A 3DQPA 3OSZA 1WDKA 4UHKA 2AOWA 3DB1A 4G0QA 3IULA 3TL2A 1L7PA 3IMFA 3JD3A 1TVMA 2CJWA 4WCFA 3D4PA 2C0CA 5FRDA 1KTVA 1U0GA 3I12A 4GLJA 4ME6A 3V4ZA 5E9JA 3WNQA 1PG2A 1YRBA 2P2YA 3HYRA 3PDWA 1E3LA 3WLMA 2HLPA 3K0AB 1ECGA 2CFSA 2BFBB 2QD2A 3RT7A 5DX8A 4UZEA 4H3KB 3TIGA 1XPJA 3M3HA 3E22B 1GAEO 4Z53A 3TSWA 4KYVA 4JFAA 3AEYA 1P5JA 5B2FA 3ILHA 5EIAA 4ND5A 3FR8A 4K6GA 3D54D 5FP0A 2NUTA 1E4OA 4GM4A 3CF2A 4S3MA 3STYA 3ZEAA 1FL9A 2O6HA 3GPDG 1BEUB 1YFJA 1Q7GA 5SZKB 3TTXA 4TLBA 2BTQA 2HXSA 5KTKA 1B23P 1FUUA 5KVSA 1M2FA 5AT1A 4HWTA 5COBA 4JC0A 1C3VA 1E0AA 4IJMA 4ZZ3A 1BYIA 2XT0A 3K0SA 1UBJS 2IXFA 4LQLA 3WL5A 4G09A 2XDWA 4XIIA 4Y0VA 2AZMA 5DEIA 5HBRA 2A0KA 3SK0A 5MF6A 2ZIAA 1Y3DE 1MO5A 1K8RA 1YBHA 4ZO8A 4D0RA 2FX2A 1WB4A 1ZS9A 3OICA 4XQGA 3FVVA 1CVIA 2ESRA 2F9FA 3F3KA 1UDXA 4MRAA 4O59O 4O2BF 4UARA 3S2FA 1Y3AA 2QZ4A 5HG0A 1P62B 3KVNA 3GCWA 1U8TA 5DI9A 1YFZA 1USKA 2OBMA 3LT1A 1CZNA 4Y67A 3STXA 2IP1A 3G6WA 4KPYA 5EHGA 2C5EA 3IL2A 3IXQA 5CYPA 2NXEA 5J3JA 3MJHA 2IYZA 2DLDA 4HQLA 3VC1A 3OFND 3TSCA 1LBEA 3V1TC 2VAWA 4H08A 4AM8A 4B82A 1Z7WA 2XUIA 2CKDA 1BDIA 2ST1A 1KI2A 5EVCA 5H81A 3DE0X 1SC4A 1W47A 1LDNA 3BN3A 3T99A 5EIXA 1ILWA 4ZI3A 3QV2A 2A1UA 4R8SA 1XCBA 3LHDA 4X92A 1IPEA 2YVAA 2X1HA 2AI2A 2GN1A 4MUIA 3DF7A 2P5UA 1HLDA 1SCQA 4D9FA 1VP9A 1KGDA 1ZL2A 2ENUA 3GRZA 3TQOA 1K0UA 2HKIA 4R9SA 4N0EA 4CTKA 2Z6UA 1E3MA 2Z6AA 3HXMA 3MIZA 3OZUA 4YJ3F 2PRJA 1IEWA 4RM3A 5EJ9A 1LCIA 3ETDA 3IV7A 3QKSA 5HIKA 1BQ4A 1HKUA 2ZYDA 4W6ZA 4IH4A 4F3CA 1XPRA 2IU6A 1YQDA 5FWAA 4IJQA 3UWSA 2X2OA 4NXMB 4DBLC 3TPZA 4FB5A 3WB1A 5H9VA 5EJ6A 1FDIA 3AP2A 3V7UA 3ZE1B 4EG1A 4YCSA 2AA3A 4G56A 1JEQA 1W5SA 1X7YA 2E37A 1HBJA 4KIGA 1KF0A 4MWZA 1G98A 4BGVA 3E3MA 5HQ3A 3Q12A 3J80A 2R1TA 3LYUA 2P1ZA 3O3OB 4L9AA 2WWIA 3LKVA 3A3KA 4CLEA 5K99A 1IDN1 1QH8A 2VDJA 3MG9A 1WUTA 4G86A 1CFJA 4H7HA 4P93A 2EF1A 1KA9H 1N9GB 4QUJA 3TQCA 4Z1OA 3H1EA 3VR4H 2CL6X 1ZM9A 3WSTA 1P0QA 5EZSA 1WMDA 2V6MA 2CXQA 2ZB2A 4A6XA 1NVVQ 2VAXA 1NN5A 3B1XA 3DA8A 3P9KA 3UHAA 1OB5A 2RIRA 5EKDA 1WZ2A 3H5NA 2X0EA 2O8NA 2RJNA 5KU1A 4IXTA 3TXAA 4R9VA 3BXPA 1D4ZA 4CCSA 3QWFA 4UUQA 3RVMA 4AKIA 1SM4A 1ZCFA 3MOSA 4B7AA 4L7VA 4AJPA 1LPOA 4JNCA 1G3QA 4GBED 3C39A 3KWLA 1C14A 4UNQA 4V1CI 1K86A 2UKDA 1MRSA 4GQAA 1Z0SA 1OWOA 2O0MA 1KBOA 1T24A 1RXEA 3QE4A 2YHSA 4K40A 1CKEA 3C2QA 4YDSA 1BDHA 1WMSA 3IVMA 1IM5A 1ZXBA 2FQ1A 1ESEA 3GH1A 4FB4A 9MHTA 4TXMA 4CVNA 3SOPA 1GCIA 3OQHA 1SXJA 2HF2A 1Z15A 5ALNA 2FWIA 3NXSA 4HUQB 2G4LA 3FGZA 1KAEA 1DQSA 2IA5A 2JIOA 5B7QA 1VGRA 3NUQA 4GU5A 3E2IA 4MQFA 3CNHA 4WNIA 3KG2A 1H69A 1MC4A 3BGDA 1XA0A 4MPDA 1LBQA 1RHKA 1L8XA 4LJ5A 4WH0A 5EINA 2MINA 3NATA 5A6VA 1MO6A 3A0UA 3NHLA 4V3BA 3GLGE 2P11A 1YS9A 4RORA 1LQUA 1DOZA 3ITKA 3EC1A 4EY3A 1AVTA 1YASA 5BN5A 4XQCA 5EIBC 4DV7B 5JXJA 4F4UA 1FQKA 1WSBA 1RJ9B 2WZBA 4TZTA 1Y8ZA 2CF5A 3T1HB 4IS2A 4KO4S 4HMPA 3SIWA 4OHWA 2VT3A 4NMWA 1A7JA 2OFWA 2IXBA 4BX0A 3NASA 1L3BA 3QV1A 4M0EA 3GAMA 1CRPA 1H0RA 1IHYA 4NWIA 3AGPA 2WAYA 3PSHA 4QXRA 4YIHA 3OMLA 1QGED 3L8EA 3PQ3A 4KDCA 3WK7A 4OLHA 4XI9A 2OBLA 3DPIA 1RLJA 3LCVB 5JI2E 2WG2A 1JR3D 1Q77A 5L8VA 1KYZA 3HDGA 4I6EA 3TFQA 4LWQA 2EKDA 2HRDA 2BTEA 3H16A 1QCDA 2PKQO 1JHDA 1MV5A 1UJ5A 4IH9A 3WKAA 3H1FA 1T9DA 5KI6A 5G0TA 4KFCA 1YAHA 4E4TA 2G17A 1ZONA 5JDCC 1Z7EA 4OOEA 1JGTA 3O75A 2Q6LA 1MR3F 5LA6B 1CFZA 1SKAA 2EU8A 2P2NA 2IYTA 2WIDA 3G0CA 3KIPA 3M6VA 3N8NA 4L2IB 4Y8VA 5CXSA 3R9KA 5A1TA 1P31A 3H0EA 1N2GA 5AIBA 5EKSA 1TCCA 2GKSA 4N8SA 2HCRA 2JLXA 3LVRE 2P35A 3BG5A 1RXUA 3S1LA 4DXDA 3GJTA 3RWBA 4DLBA 2G9UA 4KMRA 3FPSA 3IESA 1JQLB 4Q05A 4WDRA 3VVMA 2NQ8A 4JODA 3V7NA 3D7SA 3QOYA 1FNCA 4HLDA 1VL5A 1GITA 2DZDA 1X2EA 1XN4A 1UT8A 1E99A 4XA8A 2I7XA 3ZQKA 3CNLA 4WUVA 4B40A 3ZDBA 3FD8A 4PNPA 2VTBA 3NNSA 4QSMA 3PNLA 5AKJA 2ATCA 1VL6A 3R1IA 5IWAB 1KJWA 3I23A 3OEHD 4QOFA 2I7TA 1NXTA 1YTLA 4N7JA 3V8MA 2NLOA 2HZ7A 3PNQA 1BMQA 2GUWA 3VPGA 3NT4A 1KI9A 4AYTA 4TM7A 1G5HA 1V26A 1K8ZB 2PZJA 3W5JA 1AZSC 4CWAA 3EJWA 1XRMA 2PQMA 5H68A 4I4TA 4F04A 2F3QA 2P2LA 3GDGA 4HNHA 3BXEA 2BFMA 4P3KA 1E6UA 1O08A 1UEIA 4XYEA 2WPNA 5F2OA 3GIWA 1G38A 4GI7A 2BHSA 2QP9X 2CCJA 5LR6A 2Y1DA 2VRWA 2O19A 4IHQA 1L7BA 4CNQA 3LC7O 1N5IA 2ASEA 1QQ5A 2A4KA 4MSUA 3OEYA 3S27A 5B12A 4BQOA 3T7AA 1MRNA 1JG1A 4MICA 4OFBA 4EL5A 1JW9B 2IE8A 2QVCA 4NFHA 3CE6A 1C5KA 1YCDA 1UKEA 2XLBA 2G9NA 4C0JA 4HAUA 1KQFA 1GL6A 5ES4B 3HR8A 3TQFA 4C05A 3AM1A 2D54A 1VECA 3RBAA 1DL5A 2JGJA 1QONA 4MK4A 4UM7A 4Y6LA 4IXWA 3UXHA 5JPDA 2PGDA 2QVZX 5IDQA 2QX7A 3T9CA 3N8KA 1KGSA 1YSCA 2E4YA 2H31A 3C7AA 3I76A 3JQ8B 5K0TA 1D6MA 2P1RA 2FDCA 3E0XA 3U61B 1IPFA 1PSDA 3GEIA 3T5DA 1ZGZA 3F78A 4LOHA 2HSWA 1NT2A 4BFWA 5E7MA 4MAFA 2F8MA 2EZ8A 1R0RE 3BB1A 1QGOA 2GSDA 2AJDA 2KLBA 1E3WB 1CUXA 3JVIA 4R8VA 3REQB 2XRFA 1QQBA 1CTQA 5KWEA 2OT3B 1Q74A 2C2HA 3EVZA 4RD4A 5IT5A 2BGLA 3NQ41 4BU0A 1JG7A 1L0BA 4H2DA 3PR3A 1TKBA 4FZRA 1O5TA 1JPUA 2DP4E 5SZHB 2B1JA 4FQ7A 3TD6A 1I1HA 1T3GA 4A9AA 5HTOA 4DMHA 4C5BA 4NBNA 1JAHA 2MYUA 2HPAA 2BR3A 3T3OA 2VC2B 2YZ7A 3IDOA 4J9UE 2CWDA 3RTGA 4ENRA 5AYVA 4YASA 5DMXA 2BMAA 3SIXA 2EWVA 5CW1A 1C30B 1G5QA 1TYCA 1NP7A 4ALIA 5CG2A 3WRXA 4DA7A 4GZLA 3TN7A 2EBUA 5BWLA 5ANRB 2OPHA 1QWSA 1D6NA 3QA9A 5HJ2A 4QZVA 5BWBA 3EARA 1JLLA 3BIFA 2Z8YM 3PVCA 5E6RB 4BLRA 5L53A 4AY5A 3D6HA 5KOJA 3P9PA 2G71A 3FCXA 2JIPA 3WB0A 1KMHB 4IIJF 2FMHA 1PJLA 2Q2NA 3MRVA 4YP1A 2WIAA 1GTJ1 3NCTA 4X93A 1U3CA 4IEFB 1OZGA 3VO2A 2RHJA 2PKRA 4MWCA 3EPHA 4NENB 1QPBA 1T0IA 2VYVD 1P1BA 3B78A 3KYDB 5KOHB 2W83A 4PYJA 3CRZA 4MR8A 5IAOA 1GFSA 3K8ZA 5K7SA 3VAAA 2V7EA 5LLTA 1L5GB 4WX2B 1ZK2A 3RREA 3KSAC 4KOAA 3HMKA 2XODA 4O4IA 4DY6A 4B3XA 2I3GA 4ER7A 4NFSA 1TO1E 1K68A 3R0XA 4M83A 2IEAA 4BGEA 1OKKD 1CQXA 3KM0A 3B3QA 2VATA 1FLDA 2WJZB 3LPAA 4RZQA 4UBIA 1T9KA 2VNSA 2ZK7A 3OHPA 5ARBA 4OHYA 3EISA 5FL7A 1GP2A 2FDRA 1A88A 2DUUA 3BK7A 2ZYRA 3ONNA 4KUHA 3ACBA 3VNSA 2ZWOA 2JIZA 1RQ2A 2Z8YA 4E1AA 1OH7A 3WQRA 1U02A 3ICCA 1PZEA 2ZIZA 3K1AB 1NYTA 5LU9A 4H31A 2HJGA 2PBLA 4KR6A 4P82A 3WIEA 1YU9A 1R5NA 1W4LA 1KRHA 1LXCA 3AT1A 3A05A 3KSRA 4OSEA 4RS3A 3WRYC 5A4KA 4K0RA 1LDMA 2OR3A 4KQMA 4TKVA 1T2NA 3CLVA 1ISGA 4RA9B 1AQYA 1DFGA 1J9EA 2QTTA 4FGUA 3GT7A 1IBSA 3ES9A 3OQ1A 4M8NE 3K6KA 3T7EA 1SEPA 1GQSA 4TL6A 2MSDB 4DSUA 4DY4A 1JHYA 1NMXA 2V58A 3AP3A 1OT3A 3IE2A 4JLDA 5CX1A 2I8CA 1PL6A 1TDJA 1RI5A 4C20A 3F6YA 4PLWA 3KVOA 4DLKA 5AVXA 1UKBA 1JYEA 3KEMA 4RETA 3PS9A 2ZJAA 4NBKA 1WUJS 1YRLA 3QXXA 4RSRA 4ZZ1A 3WSVA 3VR4A 2P9JA 1YZQA 2PQ6A 3BWDD 3GRAA 3G9UA 4J16C 5BN3B 1DU4A 2DBRA 3CFYA 4NIMA 3UAGA 6REQA 1E9AA 1YR8A 2NX2A 2XUAA 4EIWA 3IKTA 1KXZA 1U0JA 4PPFA 4Y98A 3U62A 4BQNA 4CMGA 4HBGA 2EG5A 3X1KA 4EHFA 3FTCA 2CB9A 1GL3A 1U28A 4BJ6A 1X38A 3E15A 4OGKA 4PZEA 4UVEA 1MHPA 1UBLS 1RCTE 4PRYA 3SU8A 1NIJA 2PUEA 3G1TA 4YPFA 5AW8A 2XB2A 3VJMA 1Q1AA 4M76B 2IV3A 3TOSA 4ZHQA 2VZ9A 5CJJA 1VLHA 1SXGA 3HE3A 1NOKA 3TZBA 4L57A 3GCDA 3WLSA 6NULA 4EGJA 4FCVA 4U3JB 3FYSA 3SR4A 4FKMA 3T3GA 1M5RA 3L9WA 2QB5A 5T8KC 1Z5NA 3E9DA 1FFXA 3EXEB 2PSSA 2IDKA 4X20B 1RYYA 1SC1A 4IAOA 4YJFB 4YECA 5EHIA 2OZLB 1QHNA 3DDUA 1S8NA 3NOOA 3IJ5A 3K0CA 4KP7A 3PC3A 4YRMA 5F9FA 4NPCA 3SEFA 1NG9A 1FF9A 2BIFA 3MCTA 2XMDA 3D9QX 4FN4A 3RG8A 3AEQB 5AI0A 1ZW1A 1D5WA 3EQ6A 4YB8A 3BMOA 3S1SA 1GA4A 2AG1A 3WQSB 4XVCA 4A0HA 7ABPA 3E2PA 1P9OA 2XBLA 3QE0A 3U1TA 4HFNA 5FLXA 1Z0FA 2AR7A 3TO5A 2OO5A 2I71A 3AQIA 1L4NA 3V32A 2FOIA 4BNNA 1MTOA 2OFOA 1VI6A 2PVCA 3IBSA 3NRJA 3W78A 1F17A 4AMGA 3GJYA 1NMYA 3TH5A 1Q2UA 5CVJA 1NW6A 3CKMA 1V1MA 3IV6A 4KQCA 3K09C 2OGWA 4E3ZA 3I5UA 2FFHA 3ZXXA 2VZLA 1L5QA 1E6MA 4M7PA 3GP3A 4XB6B 2BKAA 1DCTA 4RV9A 4UHCA 4ZAZA 3HJCA 4BLPA 5M34A 1TF7A 3WJ1A 2ALJA 1QB8A 3FTDA 4W7IA 5CH8A 4F46A 1ZD8A 2Q0SA 3D31A 1F4VA 4AKHA 3TJMA 2ZXFA 2G6TA 2IEZA 4RVNA 2JFVA 1JPVA 4RELA 4P80A 4WMLA 3EYAA 3MT8A 3U1BA 1WPRA 1NFFA 2WUEA 4ZC8A 1Z3CA 2A67A 2AMVA 3MYRA 3USES 1BEZA 1KEVA 3HN2A 1AKYA 2O3QA 2I91A 4QPPA 3EYWA 1NQTA 3W0LB 2I7VA 2J3MA 4URXR 1EWRA 1T10A 5AJVB 1U8XX 2JJ8A 4J6FA 2EAUA 3WKBA 3BRWA 1SKYE 4IVRA 1A1SA 1NULA 4Q7MB 4BMYA 1Y4SA 3FNGA 3KB2A 3T06B 2VH1A 4DWWA 3MEQA 1B7GO 1UP6A 1XA3A 2NTEA 1N8TA 1ZINA 3OZXA 4ZQBA 1YQQA 5DWVA 3RR2A 3T1QA 3THWA 5HDBB 3FRJA 4UZFA 3UPUA 1NF3A 4RQAA 1F14A 1I9CA 1EDOA 1WF6A 2BUBA 2XT9A 1ZGAA 5REQB 4A8JC 3FDXA 4MINA 3Q41A 2ES4A 2YINC 4C78A 2L19A 2E4UA 4ZVOA 2YNMA 1CHDA 3ZNQA 4JY7A 1OFTA 4CM9D 4UVIA 3CVWA 3CB4A 1KPGA 4YAFA 5A3SA 1HV8A 6LDHA 4G97A 4GMXA 4C04A 3IMGA 1O6BA 4W8OA 3ZV6A 4Q1EA 4YJ2F 4C1NA 1PNVA 1QKJA 1CS0A 1T4GA 4YJHA 1Z36A 2MYPA 2V7PA 3PXAA 4MI9A 1WXWA 3P2IA 3E3LA 5ALWA 1KY2A 4W1PA 1W0JD 3STHA 4XB2A 5AVTA 1XPOA 2FW6A 2HSGA 1Z5ZA 2AWNA 1JKJA 3LLMA 1E1CB 4R6XA 4RIGA 2JGDB 1Y5MA 2XMRA 2R7MA 2YWJA 3ICWA 5JWHA 5CNKA 5TVGA 3R6GA 2Q0QA 3N7AA 1OYWA 2QN7A 3G9ZA 5K6RA 5KYXA 2ZQ5A 1CJTC 3IAM1 4U2EA 3R9XA 1QIFA 2PS0A 2AR0A 3DZGA 4KQWA 2DPXA 5DFAA 3RJMA 4L27A 1O1YA 1JSXA 2JFWA 4PCAA 1U4SA 3PNVA 3DMTC 3KDSE 4E5VA 5B6IA 3DOIA 1I01A 2RBKA 3D3JA 1DOHA 3EGCA 4GOOD 3AFNA 1M1NA 2V7VA 3LGAA 1NOJA 3MNFA 5H02A 1EFAA 2O3TA 4N6NA 3DXZA 1Q6ZA 3NFYA 4HC4A 2G3YA 4LDRA 4QXQA 3TTUA 3AUKA 1ULAA 2R8EA 2VDRB 3TNFA 5JZSA 3LIPA 5A4MS 3FYUC 1IVNA 3A2NA 3D6NB 2WFLA 2XSZA 2YC4C 3EIWA 1Y8QA 3QFHA 3V2UA 4Y9RA 4LXXA 2X5XA 5D87A 3RE1A 3WIOA 2AG6A 4PAWA 5B1DA 5HF5A 1E7YA 3SYMA 2D0DA 2ZR0A 3ZTYA 1NIPA 1RAIA 1EUCA 1JQBA 4UTOA 4MYHA 2JD1A 4H7DA 3TZKA 2AXPA 4HO1X 5GPBA 3R5JA 1Q83A 3ZWKA 3I5MA 3K9LA 3AU8A 1WUKS 3DDWA 1JYFA 1QHHA 4LPKA 1T2UA 3KB8A 4CTNA 1HZJA 2KMLA 3QYPA 1V96A 4B8ZA 4W5HA 3COWA 5LOVA 2ZB7A 4BQRA 5JWOA 2BMJA 5DXFA 3UY4A 3I6IA 2YV1A 2ZS9A 3JWGA 2CBZA 1GYQA 1SCDA 1FYDA 2I4TA 3RQSA 2QYOA 3CIFA 5F12A 3L93A 1DT5A 3ZY3A 4OLAA 3V1MA 2OMKA 3WP1B 2AKEA 4ZZIA 1WB5A 5E0KB 4OO3A 3JQ6A 3G8CA 1QUFA 4J3JA 4RYDA 1UMCB 4AZ0A 5KIAA 1S5PA 3NIFB 1QIHA 4KC0A 5DLEA 4B6PA 3DKKA 1D2AA 3O92A 5HUJA 1TJPB 2NG1A 5JASA 1IWBB 1UKAA 1F8GA 2REOA 3EH1A 3CGWA 1HEIA 4WSOA 5C1DA 4YONB 1LUAA 4WACA 1CQZA 5D5PA 4EENA 2HHJA 3RBXA 1BNCA 3OBIA 4G5HA 4OEHA 1Z0IA 3CMMA 3M33A 5FB3A 1XWIA 4NE7A 1ZUD1 3NBQA 4FEEA 4WADA 1YNSA 4FONA 4F45A 1VCIA 2O0KA 2WIKA 2F1KA 3DLIA 3CBQA 5JS7A 2F3SA 2BKXA 1I6MA 3L8GA 2VS1A 2WE7A 3ZX5A 4ZI7B 5IFLA 2PR2A 4FOPA 3AFGA 2YOHA 4Q3KA 4TTSA 3KT6A 4E30A 5AW6A 5BMOA 2ZBRA 1X8XA 3AU9A 4GQBA 1CRQA 1VKOA 3BB3A 1T29A 5SZJA 3VR5D 5EY5B 2XGSA 3UT5B 4PSVA 1S3SA 2OO3A 4Q1AA 4BNXA 1K7CA 1P73A 1X7XB 2JHPA 4IW3B 3E70C 1CR2A 1QJ4A 1JA0A 2O50A 4U02A 3ZD9A 5LQUA 1W75A 4MB2A 2GPJA 1NF2A 4XDZA 3T3IA 2C42A 2WU1A 4S35A 4EKEA 1IBLB 4CUJA 3GJSA 1R4NB 3O8OA 3KALA 1JHMA 3TZ6A 1M6EX 2VHTA 3EG5A 1T34A 5F4BA 1G20E 3DQQA 1ICEA 1ZJYA 3EZFA 3H9UA 1ZN2A 4JQZA 3RVJA 3I5AA 5GIPE 4I08A 1U2GC 4NTZA 1EFLA 4L8VA 1YK0A 2OQVA 3TZEA 4TZ6A 3HCDA 1WWKA 3C3BA 3TXXA 3R3JA 5BV7A 4A15A 1BDMA 4F72A 2E21A 4P4UA 4QYTA 1PWHA 4E32A 3L4BC 5HOEA 2GAFA 3JYOA 3D0QA 4NEHB 3S8MA 1VL0A 2JD2A 5TEWA 1O77A 1Y9DA 5A05A 4KLNA 1WMAA 4H7KA 5IZCC 1X1EA 1NSFA 4YROA 2VSFA 1ST3A 1NAIA 4RVHA 2X8JB 1UKYA 1N36B 2VTKA 3H2SA 3C1TA 1TADA 2WJ3A 3KOUA 5EVJA 4EY6A 1QQTA 2H54A 4CTMA 1PG0A 1KI6B 2O3UA 3CJRA 3NHSA 1MAWA 2VJMB 1GILA 2QJTA 2IDJA 1YJXA 3LQ4A 4NU6A 4X71A 1B41A 3K0FB 2QW0X 1W6RA 3RSSA 1ZP6A 2VT6A 1ZIOA 3A4YA 3MGBA 3CJTA 4N3CA 1A3CA 3W7VA 3X2EA 5EXEA 1QZTA 4TRNA 4B75A 4IIGA 1KYQA 1COWA 4RDHA 5BSKA 1JVNA 2G88A 5EZYB 2RHWA 4M1QA 1CX9B 3LQYA 1FS4A 3PC4A 1LY1A 4TYMA 5IBRA 2QAGC 1R37A 4RFVA 3KR1A 1JEYA 1DTWA 3I2GA 3ETNA 1GUZA 2GNPA 2OZPA 3G23A 4RPKA 4XWTA 4CIYA 2CUKA 2A57A 4XM1A 1TPYA 5FFNA 821PA 1DCMA 3F74A 1QHXA 3P0FA 2MHCA 5CA0A 5KDLA 5BQXA 2PQ2A 3ZV3A 4ZAWA 2QTVB 1QIJA 1GZ5A 1X1RA 2RK3A 1GCOA 3EOZA 3D6UA 4HAVA 1DX6A 1U2DC 4CLRA 3N1UA 4YUZA 2GJSA 5EUBA 2X1MA 2NNLD 2YTZA 3JAWB 3RYFA 3STVA 3CX8A 5BQ3A 1KBQA 1U2QA 2J45A 4OMFG 1XNHA 4D46A 4KACA 5BMVB 3ZE7A 1XEWY 5CVVA 1A71A 2PG3A 2AF3C 4CFSA 3QQPA 4M54A 2OHJA 3NR2A 1EUZA 1YI8A 2XYVA 4ZOQI 1WETA 4GRAA 3VPCA 3WNZA 5ELMA 3ZIAA 4NCHA 4MMZB 3G9QA 2G83A 4NABA 3WIVA 3IEVA 2OVFA 4B76A 4HGOA 4V03A 2QTGA 2MT9A 3F8WA 4AO7A 4CEHA 3E35A 3MTBA 2XWPA 5FA8A 2CW5A 1IHOA 4DMCA 2ZRQA 1JAYA 2BE9A 1H3NA 2XA2A 2G1KA 3BH6A 4W8GA 1I24A 5HM8A 3QIAA 7GPBA 3KQUA 3B5EA 5GY7A 5HX7A 4TV8F 2AW3A 5CEJA 3MLEA 4OL9A 1QX4A 2OYCA 2YFHA 5TPWA 4US0R 2AOUB 5I9BA 1EX1A 4OQEA 1GTZA 1SC3A 4QO8A 2IPNA 2NUAB 3S40A 2X3YA 3QOFA 4HMQA 4Q3AA 2JAHA 1BFDA 4LHEA 1Q0UA 1LK0A 3HCEA 1O0BA 5BOSA 2WF8A 3O2SB 5AXAA 4PX5A 1T0BA 4RS4A 4L4XA 2HZBA 3OOEA 2BFCA 2LUOA 3DAGA 3IOBA 4QAJA 3S68A 1T5TA 3FSGA 3IELA 1V39A 3LIIA 3HFRA 4DLUA 3RUFA 4LFAB 1DJQA 2QM8A 4C87A 5IC4A 2WILA 1RYNA 1U2SA 5PNTA 5EP2A 2V8OA 3O95A 2OHVA 1TZ2A 4MRMB 5AW7A 5E7JA 1RRCA 5GJBA 5IT4A 4HX9A 4QOSA 4D0SA 1JJ7A 2PX0A 3AIOA 2XNDD 2FPGB 4TMKA 1DKLA 1ULHA 1O87A 3ZJUA 4LYDA 2QRUA 1KY5A 4TSFA 2CT8A 3RS7A 1XLUA 3EVNA 4BRZA 1F60A 1POXA 1JG6A 1KFJB 2BPOA 3DZBA 1NUTA 4J2TA 2WJJA 2WMOB 4CNBA 3V4SA 4NI5A 1IZ9A 2BGJA 2YRFA 4C4YA 3NH6A 3JQQA 2HEGA 1B16A 4QEDA 4DR5B 1J7JA 1M8GA 2GJAA 1YGPA 2QJWA 2H8KA 3CPHA 2W6MA 5FAKA 5K4AA 3RC3A 3A7EA 4HGPA 4UMVA 5AHRA 1M6VA 2GYVA 5CDYA 3ER6A 1W87A 3OKFA 1E6KA 3NPMA 3PUKA 3HU1A 2JDID 2P9EA 3C70A 3TD9A 1FDVA 4AS1A 2XOKA 4R1NA 4MGZR 2ZI5A 3N2KB 4WHMA 3R7LA 1Z6TA 3WGVA 1P3DA 5AVZA 1NBMA 3Q1KA 4I5EA 1W4CA 4C01A 3E3NA 2IYEA 4TQGA 3OFJA 4EKNB 2YQ5A 3HYTA 3CG4A 2NUPB 3O26A 2FW9A 3E2MA 5EIBD 1DJLA 1TM1E 4GPZA 1DO2A 2OL4A 2P91A 4K6CA 4M1WA 3VPAA 4G5OA 4BO5A 4D4JA 2PWZA 5FEUA 2LE0A 3OM0A 1Q21A 2B69A 2PCLA 3CWCA 1IZ7A 2QRVA 2XE8A 1WLYA 2YJ6A 2JCVA 4NZNA 1L7XA 2Z5FA 4HJRA 4ZOEA 3L77A 1KI1A 3GXBA 3L8HA 4OGWA 2DVMA 1M0EA 3CLHA 1YCFA 4OYYA 1U99A 1JKXA 3ENWA 3GRCA 3PJEA 1F2TA 2JHAA 4MEBA 4NONA 2PGNA 1MC8A 2JZCA 3ECSA 3WISA 4EUEA 1DJPA 3QH4A 1Z0DA 3DE3X 3BSWA 4FZ5A 1XZGA 5IBQA 2Q1TA 1JFFB 2B61A 1AZTA 4BMNA 1R1DA 1F3LA 3GRVA 2B92A 2NUTB 4M53A 5HRAA 2YOFA 4XCVA 1QGAA 3GGCA 4X64B 5L3SA 4JLUA 2YRXA 5FCDA 3HVRA 1W36B 3AR8A 4QATA 2VN8A 1UMKA 3H9EO 5G41A 2HDNB 3PUHA 1WM1A 2FPIB 4EM6A 1FDRA 3LZ6A 3R6TA 5AK3A 2C83A 2GAAA 1SCJA 4NG4A 4FTWA 2G1PA 2HI0A 2NZ2A 2OHGA 3QPAA 4RK4A 4AN0A 1OV6A 2C4HA 1GEGA 3CE9A 4OI4A 5C3MA 2GCNA 1AQJA 1ESCA 3RUPA 2JAQA 4BHTA 1GNSA 3F0TA 3RKSA 4Q9LA 3VNBA 2X41A 4MV8A 1EDDA 1VBKA 5DRTA 2OTCA 3B2QA 5M7EA 1RDFA 1AKEA 1M9NA 2GX6A 2VRCA 5TMBA 4EY4A 5FTKA 1AOXA 1NYRA 4UQOA 5GP1A 2PLNA 2JI6A 1P1IA 2QMQA 4J6EA 4Z8YA 2XI4A 2PBRA 3DKRA 4NZPA 3ABIA 1EB9A 4ZJUA 3IO3A 3P2MA 4IIVA 2O14A 1CG6A 3G7NA 4WN9A 5C8YA 4EA8A 4CLOA 4IDQA 3CR3C 2VKQA 3G8YA 3MUFA 1LW6E 3TQQA 1A2OA 2UYHA 1TEHA 3H19A 5CVTA 4HDMA 3X44A 4F8EA 3AHJA 1T2EA 1CUDA 1XVLA 4H4CA 4E08A 4HD8A 1SHJA 3V7YA 4FT2A 1CJBA 1OAAA 5KINB 4NJOA 1CUJA 4Y2JA 1TW3A 3S2EA 1CUVA 1IEXA 4TWJA 2XWJI 4WQMA 1M2KA 4EB3A 1G8AA 4YRKA 5JFOA 5KNBH 5HNKA 5H59A 4YUVA 2ZJ4A 5DYTA 1ENPA 1CZOA 1KZ7B 2BRUA 5I9TA 4X1YB 1JHVA 2ZB4A 4K3UA 4RFLA 3NDIA 2EP8A 4PIPA 3ELDA 4LJ6A 3QUAA 3SXUA 5MFPA 3ZU2A 1PR2A 4RCYA 3UB2A 1V5GA 2YICA 3P7MA 3LKDA 1ADBA 2QVLA 3QKSB 2JARA 2YH2A 4ARBA 3EFOB 2Q46A 3TIVA 2QXTA 3HA5A 1Z5UA 1TVKB 5EUQB 3K8OE 4TT3D 1KEKA 1KWKA 3QGMA 3L0BA 4HYQA 1GAJA 4NAVA 4XQ9A 9LDBA 3W4JA 3N39C 5THXA 3C0KA 3VXKA 5IJZA 2CZQA 2AGVA 1X7YB 2O0LA 5K5EA 1R50A 2GBLA 3G8BA 4JD5A 3MGGA 4PHCA 1M34B 4UXIA 1UZMA 3ZEIA 4AY4A 4ZCMA 4KIUA 5LDHA 1PNRA 1J07A 4Y1RA 3WDKA 2DULA 1T8PA 4FW9A 5B4VA 2WNHA 2UDPA 4LRSB 1XMXA 4K9QA 2RIPA 1KE1A 4UPEA 3KJQA 3ZBQA 5ITVA 1ZOSA 2LIVA 3VX4A 5IU6A 4BFYA 5ITWA 3CT4A 1UK8A 3NI2A 3ET5A 4JGGA 1CETA 3RJ9A 1Z33A 1HZZC 1PKEA 1L4BA 3I0ZA 5EJGA 4BGDA 1U3UA 2VDUE 4RY2A 2Q8NA 4HRYA 1GPJA 3IEXA 3U13A 1DMRA 4TKLA 4BPBA 2FZCA 3MWFA 1W25A 2XNJA 3D2BA 3DMHA 2EIXA 4IFIA 9ATCA 1UBSB 3GD5A 3U9TA 4NYMR 1Y6JA 1OBCA 3GVXA 3VU9B 1Z7YA 2YR0A 4HZGA 1TTPB 2IY9A 5DM0A 4WOPA 3S4YA 1HF3A 3V33A 2G36A 1IOWA 1ICIA 1X1SA 4F21A 4JJ7A 4Y2VA 3UYLA 3SC2B 4DM3A 3W5BA 1MGPA 1O9BA 3QHPA 3H8JA 3CKLA 4CKZA 3H75A 2H63A 1HEYA 1ZVMA 4ILKA 2ZYSA 4AQ7A 2N0SA 1CRWG 4RIHA 1W9HA 1YRQA 3S3TA 2G0TA 3OJWA 4H27A 1XFAA 1EWVA 4LXGA 3LVQE 2ZUSA 4NOKA 2FNAA 4NMXB 1AD2A 2BBWA 2MINB 4DT1A 5KQGA 5KYUA 1C7JA 2JH9A 3HZOA 4LOLA 2CVFA 2GRJA 1AUQA 3KCNA 3KZMA 4MYTA 1BX3A 3WRVA 3PHHA 4J9VA 3L8DA 2QG9A 3A1SA 3U4GA 1JDNA 2AN4A 2QPTA 4KQEA 3NVKI 5C80A 3HG7A 5ALSA 2XMZA 5KSPA 4FYPA 4UFOA 4ZALA 2GZ3A 4MKHA 3U1VA 4QUAA 1QX3A 1IIRA 2X2PA 3HM2A 3CY6A 4O4JB 3IRVA 4HOYA 2B4YA 2NPOA 2E4VA 3KJZA 4IKEA 1PQYA 1CJVC 1SPBS 4IDHA 4K28A 4DCTA 5K0FA 4C30A 3Q8LA 4CHTA 3NBUA 1J4AA 1W5AA 3T7SA 3O4GA 3CW2A 3UKDA 2JATA 3HXTA 5HR5A 3A3OA 4I5FA 3DDHA 4N6GA 1ZUWA 2HC9A 5SV2A 3C6YA 3IPCA 1EZ4A 3BRQA 4B09A 2F48A 2I6XA 3FAZA 4ZOLA 2IW3A 1RQRA 3S70A 5I7HA 4BKRA 5C4MA 2Z95A 2Q6VA 1PFVA 3JVDA 4EFDA 5BSFA 2IHYA 1NLUA 2IHJA 1D7AA 1UXJA 2H65A 1BJRE 5TQ0A 3ZDQA 2WPDA 5LQCA 3B3FA 3N7TA 3I0MA 4K2AA 1JE0A 2A9RA 4QFCA 3GROA 1U7TA 4B3TB 3RF6A 4DMRA 1EVQA 3IR7A 1T2DA 4M0LA 4TUYB 3R3VA 1C1YA 5JSHA 2WAAA 3OUZA 4E07A 4U7DA 2C2MA 3P32A 4IQGA 2KM1A 3RC8A 4M0FA 2J9YB 1EFRD 2IPXA 2PJZA 3CA8A 1R12A 3GP8A 1FSPA 1UQTA 3IIIA 2ZJ0A 3PHBE 1R0CA 2EDAA 3CHYA 1RKXA 3X1JA 2BF4A 4HVCA 4ZN6A 4IRUB 5JWRA 5DTIA 1TCAA 1XKXA 3T15A 4AJLA 4F85A 3HYLA 2D3WA 2XKBA 3AJ9A 1W88A 2P90A 3JYHA 2GM9A 1FB5A 2W90A 1T36A 2R7KA 4QPDA 5EIHA 4GE0A 4XX0A 3M2TA 5IM4F 3H5LA 4FK8A 2JFOA 1AM4D 3KOXA 2I03A 3CNNA 3MFYA 3IP1A 3E03A 2QUAA 1XEXA 1OLUA 2R8XA 2RONA 3CLTD 3GJ8A 2QW1A 1EKXA 2WD9A 1MJFA 3LSYA 4UD2A 3DM5A 4ER0A 1MTZA 3EWAA 5TS2A 3BMNB 3WR5A 4CM8A 4WW0A 2PBFA 2M98A 3MTGA 4OJKA 3WFIA 1MVNA 2X0NA 1E0SA 1JG2A 1P4GA 2RDMA 2XZOA 3KE9A 3LO8A 3O0DA 3SM9A 3WZ2A 4QUEA 2HWKA 4ND6A 4JOBA 4NV1A 2B6NA 2PS3A 5CVEA 4EB0A 3NIBA 3QUCA 1NLFA 5H9WA 3KWFA 1ZVKA 3D0KA 4ML3A 3RRJA 1JA9A 2Q50A 1BHJA 4WLEA 2WWHA 3AHIA 2WYIA 4ZVQA 4BRUA 2WHPA 4G6ZA 4CIDA 4D8TA 3F73A 1BC5A 4R5HA 3UXMA 3PXBA 1KP9A 2APJA 2E89A 2I3BA 3GD7A 4KBYA 4ND8A 3WYAA 2DRIA 3OFSA 1OWPA 1C1XA 4EUNA 5LQRA 5AKHA 2WKPA 1SUSA 3NYQA 4IEIA 4KX5A 3ZI4A 4RTLA 4JB2A 1X7ZA 2D4AA 3FBTA 1Y82A 1AQ6A 2HTEA 3GHYA 5H4HA 3UK0A 2ZDQA 1A7UA 4DLNA 3LKBA 3K70C 2BEWA 1AF7A 1E7QA 2ZJBA 4F3RA 2Y8EA 5K3AA 3PFIA 2O05A 3HVKA 3C5HA 4O6VA 4G67A 5I9LA 4AN1A 3LVBA 4O1HA 3TTSA 3HFSA 4CF6A 1S0UA 2W4QA 4U5QA 2DTEA 3G02A 3MTAA 4GWGA 3O3NB 4NU0A 2H6EA 3IPRA 2QTAA 3D64A 2J85A 3I52A 4J75A 1U6JA 4B2YA 5FPHA 5JS6A 3Q5DA 2FMKA 3ZGXA 3ZI0A 4F4DA 1KDZA 3NH9A 2FG7C 4PVCA 3N53A 1O94C 5IP5A 3CX3A 1MENA 1REQB 4D80A 4DIDA 5DNWA 3ESZA 4ZP1A 1M76A 1ZGBA 1KOLA 4ZQEA 2ZRMA 2O5VA 2AQKA 2IYUA 3PHCA 4HVAA 4IXNA 3U49A 5DT2A 4J07A 3JQBA 1J0EA 1ZSVA 5FQNA 1OPXA 3DDOA 3HJTA 3FIJA 3UJBA 4RVOA 4X85A 3FW1A 3HU5A 1PV2A 1PV4A 1QU2A 1YCHA 3A1EA 2GZHA 2XH8A 3QXSA 1K7YA 2G08A 4FMCB 4A0RA 1TFUA 421PA 1SB8A 2HLDA 3RSGA 1QXSA 3CRW1 4W5RA 3IQWA 1NHWA 2AFIB 2HQBA 4XUGB 3AV0B 3FCAA 3LUGA 1QLHA 1P5HA 4PU0A 2WJVA 4RH3A 1VRVA 1YRWA 1GNVA 5A06A 4LEIA 1FFGA 4EJ6A 4DTIA 2W2QA 3AEXA 3W3AH 2ZVQX 1L1RA 4KUEA 4HF7A 2C3MA 4GYWA 3W7BA 4E1VA 3GLIA 4AWAA 4QVKA 4WFKA 1LSJA 2IP4A 5KQRA 3ROPA 5MN5A 2MOKA 3H11A 4G0MA 1JHQA 4GZ3A 4UW9A 4ZDKA 3LC1O 1NXSA 5JI3E 2YCLA 1GUYA 4WVFA 1AK1A 5HEKA 3JASA 2FEOA 3OSUA 2QLLA 1EP3B 4WTOA 4KB5A 1NYLA 1W2WB 1TEZA 2JJYA 3D5QA 3TLGA 4BKPA 1ULSA 2E1PA 3V4PB 2R84A 4L85A 1BS2A 2AFHE 5J58A 1JHAA 1QIDA 2AOTA 4U2CA 1VTKA 1NWHA 4WKNA 3FWZA 2E55A 4G37A 3JPWA 2X40A 3I9MA 3K16A 5KNBA 1UDWA 4Q6WA 3T3DA 1NFRA 1OFHA 2Z83A 2MR5A 3QEKA 2IYOA 4CGYA 2Q2OA 1R64A 4J7CA 4BCDA 1G291 5IXJA 1FP1D 5T64A 5F52A 2B21A 1ONOA 2HJRA 1HDCA 3ZU5A 5D7BA 4XH9B 1U65A 1XQ1A 4ZJPA 2ZUUA 3VVLA 3OC0A 2VUHB 2ID8A 2H1HA 1YRHA 1UBNA 4C06A 2XUFA 1Z07A 2C78A 2GEFA 2RGEA 3BILA 4YLEA 4AUMA 4H7PA 2WT4A 3W05A 3N76A 3ZH9B 5LMZA 6ABPA 2Y71A 1PGNA 1E3JA 3PT5A 5KYGA 4OM8A 5CRIA 4GX0A 3W4KA 4MTLA 1C8KA 3EIHA 3DMDA 4ACBA 2J48A 3ZV4A 1THGA 3O3MB 4EHBA 1RMTA 1L5ZA 1XC7A 3CSSA 4JBWA 5AKGA 4EF4A 4MVJF 4F12A 1TAHA 3I9V6 2VXYA 3D2CA 3DFFA 4YCBA 1ILEA 6REQB 2K2QB 4DWVA 2PT6A 1XTKA 3EVEA 4AJ1A 5ICMA 4EFKA 5BW4A 2GLTA 3QIVA 4EVQA 3GNLA 4GXNA 1NTOA 2Y92A 1T9GR 2HO5A 4G5FA 4CODB 4IIFA 2GM4A 2XCLA 1YFLA 1PT5A 4TWBA 4FHFA 1K0FA 4JH0A 3DNMA 1ZLYA 2FMXA 3NDRA 3SS7X 3DUFB 1NRXA 4PYLA 2FRXA 2VEOA 3TLEA 1WPGA 3NC4A 3WLPA 1QYXA 3PB3A 1U8YA 1QO7A 3KPWA 4RHEA 4WBNF 4JOSA 4GBGA 5E1MA 1JR3E 5LZ7A 4DIFA 4KI0A 4NFLA 3SFZA 1VPLA 3U3DA 8OHMA 2UZ4A 4YK7A 1Z39A 3THRA 2GDZA 2PX8A 3T52A 3AF4A 4DCPA 1FTSA 3EXFA 4FMDB 3S0JA 3ZW8A 4U6SA 1O95A 2E5FA 1FX0B 3C8MA 4B33A 4Q9NA 2QN6A 4UCQA 4BTVA 3S2YA 2H1RA 4QGAA 4L5IA 2V9ZA 5EP1A 2ZRPA 2CDBA 3U7IA 1NUHA 3JR7A 4Z8XA 4RLSA 5A2GA 5MN6A 1JFRA 4U2KA 1GXSA 1FXSA 1OFGA 2D1FA 1W49A 2WFAA 1WULS 2WZDA 4KIWA 5I4IA 1EX9A 2ORED 3C16C 3G0DA 3UIEA 2ZE7A 4CE6A 3K8QA 5GWXA 3ZXUB 1G21E 3DKPA 4RQBA 1TU4A 4EA9A 1AO3A 1WCXA 2IQIA 1L4EA 2HK7A 1ZD5A 3HCCA 4J0FA 1RIIA 5IHPA 1HSOA 1VG0B 1CUHA 4RV4A 2IS6A 1T35A 3P0RA 5JVDA 4IFEA 2W8BB 3O8BA 4GPAA 1XDZA 4ARAA 4CLHA 1F2DA 5ALJA 2NWQA 3PIDA 3QBTA 4P33A 1U1FA 2P3SA 3K35A 2A5DA 2BONA 3ZZTA 4F7WA 2I2DA 2KX7A 5C52B 3AF1A 5AVYA 4RNDB 1P4SA 1Z12A 1ZQ1A 3DZFA 4L4RA 3RS8A 3TMKA 4L50A 3DS8A 2XWBF 3CM0A 2C5AA 3M5DA 2NTNA 3MWEA 2ZIXA 5TGZA 3UF0A 1G41A 3K30A 3I9V1 2XVMA 2JGLA 2COEA 4EBFA 1HK7A 4KXWA 5L3QA 2C0QA 2VK8A 4R3WA 4CF5A 1P7WA 2C5SA 2Q6IA 4RMNA 1IQUA 3NHMA 2VNKA 5T57A 1RYFA 2QIPA 1AH2A 1II8A 1TM5E 1OU4A 3COPA 3MM4A 2JFNA 3B2NA 1EX7A 4TMYA 2KSQA 5IK2A 3TQRA 1MZPA 4X7BA 4CJXA 3DWEX 4EJ0A 3PCTA 4YCJA 3HB7A 2JC3A 4DNOA 2FX5A 3ZLTA 2ZW9A 3EPJA 3ZVNA 3I2FA 4W8HA 2ID4A 4UEQA 1V11B 4AJHA 3HK2A 4GIBA 4BC1A 2Y0DA 4FOOA 2EFJA 4KMMA 2FP3A 4YYEA 2YV5A 2WNIA 3D4LA 3OU6A 5FNVA 5TC4A 2R6DA 3TW8B 3E7XA 1Q22A 5C5DA 4KAJA 1ZQ9A 2CUNA 2Q28A 3N05A 1PJRA 2JA1A 4C6TB 5EA2A 2ZWPA 2FVXA 3IEKA 3V3KA 4IL5A 2W4IA 4D0NA 4DM7A 1CS0B 5GZ6A 2G1JA 2O8VA 1HTWA 1JSRA 1CY4A 5HMLA 5KTSA 1OH5A 1W4RA 2O7QA 2NO5A 2PMDA 3V80A 1B6TA 3F7OA 1QCYA 4GZ5A 4CPDA 1GM5A 4IGAA 4P0TA 1LPBB 5AQ1A 3UXEA 1AHPA 4LS3A 1H4QA 4AJ2A 1DRUA 1YULA 2J30A 4KAFA 2VAPA 2C8VA 4OA8A 1R3DA 2AN9A 2PYDA 3LHFA 2SNIE 2RK6A 4HNSA 3C41J 1Z74A 1KH1A 3A9SA 4DDTA 5ENDA 1KNQA 2PT5A 3QXHA 3TMAA 4BS9A 1PT7A 2HLHA 4L6CA 1LWOA 1RZUA 4Q37A 4JI0B 1NKTA 1RKQA 2IK8A 3QLEA 1YVEI 1ZNWA 2GHIA 4U6NA 2WWXA 2UAGA 4IIDA 4M21A 2IXGA 5A02A 2D4HA 4AMZA 4B84A 1IEQA 4M87A 3W04A 3OQJA 4WA7A 1GG8A 2FSVC 1ISJA 1E1NA 2QTZA 3ETCA 3LECA 3PPYA 5DTJA 5IYZF 4M1YA 4AJEA 5BR1A 1WBJB 4E6PA 1XUOA 1F4LA 1BA2A 2GFIA 4YMUA 1B8NA 2A2ZA 1JKFA 1FRNA 3DP9A 1IJKA 5EOVA 3FNIA 1FTWA 3HB5X 3N5KA 3JQGB 3FE2A 4ER5A 2N1BA 2AXEA 1Y8QB 4PWZA 1DHRA 3EQ7A 5A3JA 1NUUA 1EGVB 2R48A 3Q7EA 3W5SA 3N6RA 4JHLA 4UUOA 1X15A 3LRTA 4KE9A 4WLNA 2EJCA 1T26A 4DC9A 1ZI8A 1NMQA 3OH8A 5BQ5A 5I6DA 4E2WA 3QUBA 1VE5A 2B8JA 3D3WB 1SH7A 4HLUA 1EUDA 2EVWX 3A6ZA 4D3DA 1M7GA 4QTUB 5BQOA 1X19A 1FOEB 1FS5A 4TVOA 3TUJC 1X86B 1W0KA 3QVSA 4J43A 3I32A 4V0ME 3VTAA 2IOYA 3A4VA 2F1HA 4W9NA 1GYPA 5BWOA 1X7GA 5LOVB 4D25A 4ARVA 1K6EA 4FGJA 4O5OA 4OSOA 1P1FA 2WSBA 3EUEA 2Z0MA 5JCJA 1U7OA 4Y6OA 1NNSA 3UBMA 1ITZA 3OPVA 4L5YA 5EG5A 4AYXA 3ZLJA 1WCIB 4X3OA 4E13A 3G5LA 3EC7A 4P92A 4YT2A 3AOEC 3EFHA 5L6MB 2YL2A 1JLMA 5D86A 5WRFA 3KVVA 1O0CA 4MKGA 3Q6MA 4ODIA 3M5WA 3MQ2A 1H2EA 1G3RA 4EG4A 4MJLA 3INNA 3GLHE 5JHGB 4HDKB 2A88A 1QV9A 1AK9A 2BSXA 2ZTHA 4D4GA 1OVGA 1FEZA 3GDHA 1J5EB 4RL6A 4QBGB 5NLLA 2RHDA 2PMCA 3KZVA 1GNQA 1IAQA 4L6AA 2PZMA 3QVVA 3OESA 4JJGA 1JHPA 2GETA 2BMVA 3GX1A 2X1VA 3MAJA 5EKTA 3MERA 2OFXA 1ZAYA 2M2IA 3E7FA 2G67A 1RM3A 4JKIA 3K1YA 2ZB8A 4LBZA 1J0XO 3PWTA 4QDTA 2FSGA 4JOCA 5FHQA 1MORA 4B73A 3TLJA 1V8PA 3ISJA 3W3AA 4IY1A 4PWYA 3TDNA 1A8SA 1R4AA 2Q5HA 2F62A 3EXHC 3GWGA 3K9QO 5A04A 3UMYA 4EI8A 2HRZA 1U2TA 1GN9A 3L02A 2DFVA 4GZMA 1LSOA 1LDBA 3EPLA 4Z0PA 5JCOC 1FNDA 5HQJA 4X6YA 1XLVA 4BJ5A 1RXVA 3K5IA 2OXFA 5JH7F 2QVXX 2BBOA 1W46A 1DEAA 2P2DA 3AG6A 4PINA 5JCZA 1S89A 1H2XA 2UYQA 2C29D 1XZIA 2WTAA 3ODGA 3QQ5A 3EGVA 4IRXA 3RNOA 4WD3A 3KJXA 5EJEA 5M2QA 1KDOA 4K9LA 3UTDA 1SKMA 4OYHA 2JGEA 2RKOA 4WXPA 4H1WA 1D04A 3PEYA 1J7KA 2QLMA 3QX9A 2XYHA 5JIBA 3O8OB 1N2OA 3GUHA 2RCNA 2DBYA 4IIEA 1SCKA 2HMSA 2EW1A 1WV0A 1K89A 2WMNB 2Y1WA 2QN2A 4BO4A 4N76A 1W1IA 4Q9HA 1XPUA 5E0OA 2ACKA 3TKAA 1PW5A 2R1ZA 3ORHA 3U7FB 4ZPXA 2G9QA 1X3LA 2GVNA 4RCZA 3V46A 3PDUA 1UPTA 2VHWA 4GYKA 1OX4A 1JSLA 2IUTA 3HPQA 1QZZA 2NSYA 4KRYA 5DM2A 5EYPB 5I9NA 5F35A 1YR3A 2ZR7A 5C18A 2JRLA 5LXTA 1G2IA 1Q7CA 2EXXA 2I0FA 4CFYA 2I8LA 4Q3NA 1EFTA 4CG3A 1TYZA 2FW8A 3QX3A 3ZWWA 4DWJA 4LJYA 4D42A 1MO4A 4MITA 2ZYHA 1JT2A 4QXMA 4P86A 3F6RA 4KREA 4CLOB 2FLWA 5M29A 2WFMA 4B2PA 3DZJA 2QTBA 1S01A 3DKIA 2DUNA 3L6BA 3GJ0A 1PJ4A 3OWOA 1IN6A 2FFQA 1C7IA 2VTEA 4HGQA 3T5TA 5LNK1 3CPEA 1W7AA 3N8IA 2A9QA 2ZLBA 1QS0A 1ISSA 1VE9A 2HQSA 3FHLA 3IPLA 1TZJA 3KUCA 4BNHA 3MINB 3TM4A 3Q8KA 4IHJF 4BWVA 3RAJA 2XB9A 5FI0B 5IJ9A 3ZXYA 4CEJA 3O84A 2H07A 2DWPA 1O6ZA 4Z6KA 2GCIA 3F5MA 1OPRA 5C3UA 3K2QA 4NQRA 4BP3A 4XDYA 4XIGS 1P9NA 3B3JA 4KNVA 3O2NA 3F47A 3IT3A 1P2VA 4LNUA 3U4QB 1DRJA 3E84A 5GONF 3GJ5A 2YZMA 4QG7A 3UWDA 3WI7A 5DX0A 1YZTA 2FXVA 4G84A 1OUMA 3FJOA 3MC1A 4RQTA 3T7DA 4CLRB 2ACWA 3DMRA 3GAZA 1KQNA 3QKUA 1VA4A 3PUYA 2FG6C 2ZSEA 4TL8A 3WL6A 1U8FO 3PD7A 4QELA 1GAXA 3TX2A 4C7OA 1ZH4A 3HBAA 5LP6A 1F8XA 1H9AA 3ZQJA 1Z5PA 3LUAA 3KUKA 4QJ3A 1IMOA 4Y6QA 1H6AA 4W99A 3RVSA 2WD7A 3FYHA 2NSDA 1DWOA 3GRUA 3CR8A 3QKRA 4YJGB 1K6JA 3N0VA 3G5AA 5I7EA 4RPIA 4GGMX 3B89A 4NJEB 4NV0A 3T3HA 2OILA 2PZKA 3VPFA 3KT0A 3TECE 1K4KA 1W85B 4G4SO 1E2JA 1Y5LA 3MVEA 1VDZA 2J33A 3GDOA 4UPDA 4YJKA 5DBEX 2O2IA 1GPDG 4PYMA 1BWPA 4Z0HO 4AMYA 2HO4A 4NF2A 3KFLA 3OU7A 4IFBA 5FBKA 3QVLA 4EWLA 3O8RA 1YUNA 4N12A 1FRVA 1XK6A 4GX5A 3BL5A 1HPLA 4O2AF 1V7QA 2V4MA 2X0IA 4MQ4A 3KQYA 1E2FA 4QDOA 4D5GA 2VDNB 2NZJA 1TECE 5CEFA 1E79D 3VKFA 1DFHA 3WX0A 1SUIA 1U8UA 3Q0IA 4Q7EA 4BC0A 4UTVA 3OJOA 4YT4A 2CDCA 3BHJA 3GJ7A 3SR3A 2EFCB 2PN1A 1TCBA 3G68A 1FXWA 2ORYA 1EJ2A 1I14A 4MCIA 1R9NA 2GJ4A 4YRTA 2BMFA 3EXG2 4L9SA 1NI4A 2C4TA 4DG9A 1ZW6A 1NJ5A 3AL3A 5AJZA 2RKBA 3H1TA 5D3QA 1MVOA 4N9WA 3MJCA 4N65A 1RPTA 2CXXA 3ABRB 1SFRA 2VP9A 1Z2DA 3QNMA 2ZJ2A 4ABYA 3ASYA 2HJWA 3U26A 5CYGA 4BQQA 1NOIA 4GVPA 3GFPA 2O8FA 2FN8A 3NWPA 1S7GA 5ALZA 3TLYA 4A4DA 1VHLA 3HRKA 1E8NA 2EZUA 1OILA 4RANA 2PD4A 1PN3A 1YZFA 2WHXA 1NPYA 3THYA 5AVQA 2WIGA 4KODA 5DWDA 5DTQA 5IJ0A 4LZAA 3DFMA 3O8QB 1M73E 3QBVA 3B1ZA 3UJPA 2I4OA 2W6CX 3D7KA 3K5WA 3RUDA 3UNXA 1L5HA 1B8PA 4HADA 3VH1A 3ZIUA 1OFUX 1QHGA 4Q9AA 3DV0B 1Q2XA 4TQUS 3GB9A 5GM1A 4UUAA 4CV0A 4NAUA 1F06A 3T4UA 1PVOA 2EKZA 1TMYA 3UQYS 2HPZA 3AZOA 2ZSUA 5IVPA 1MFPA 4OBBA 1QZXA 3KTFA 1Q3TA 4WN3A 2EKBA 2J5XA 4JQSA 1RLOA 1DQZA 1MIOA 3CH4B 4XYGA 4DHEA 2QRJA 4C0QC 3WGMA 1Q11A 4N41A 4WXYB 5J43A 2J6BA 1DGQA 2PEYA 3H4TA 5KO2A 1DWPA 2GHRA 1VYUA 2IF2A 3K05A 3WKDA 5JSUA 5LUAA 1AV7A 3I05A 4TMTA 2QDXA 3AI2A 4PC3A 1KO4A 1EH5A 5CB0A 3Q2IA 4FSHA 5FOWA 2QRVB 2ZXUA 3E3OA 3KVRA 2CXPA 3QW4B 2G5TA 1BRTA 1EJ0A 3ET4A 4QJ4A 2CLEB 4Z7QB 2X1LA 1RD4A 2VJAA 1UR5A 1BS9A 1CUAA 1VBNA 3BBPA 1DQPA 3LBIA 4O25A 3L3BA 4JU8A 2C4MA 1ORVA 1QOPB 4XSVA 1IBKB 5DCUA 4EW2A 2AVDA 5FWDA 1I7NA 4JVSB 2QRNA 2WHYA 4UASA 5FOXA 3BIJA 2GYYA 4WESB 3C3WA 1N6KA 4P35A 3RQIA 2A1IA 1MD9A 3VR6D 2D6FA 3I9KA 1JQ3A 3LBAA 3M4NA 4JP1A 3BE6A 4A92A 3DEFA 5DHUA 2WVHA 4BLSA 3IAHA 4YLYA 4B3BA 5CMLA 4F97A 2IP2A 3OFNA 1YFKA 2ZITA 2ONKA 2Z9CA 1WL8A 3H6HA 1KDRA 3W5DA 4GOMD 3NIDB 3LX5A 1UK9A 3TRJA 2XUZA 3V3TA 3ZE0B 2YQ4A 3H83A 5TQVA 2V6JA 3RT1A 1VBFA 1MAUA 4YRAA 3TGLA 3DTVD 1GZDA 5CP8A 1H2AS 1GZSA 1FUYB 2PL1A 1AKRA 2V98A 4HX2A 1H1LA 1GKIA 1AO0A 2JHFA 2QENA 3MUEA 5F78A 4EOGA 2ZJOA 2ECKA 5F1KA 5A5VA 4NL4H 5FTLA 2Y1XA 3IP5A 3A3YA 5CFOA 1VSBA 1Z75A 5K8JB 5K9ZA 2UZ3A 1G9TA 2HGZA 1JHRA 2MYNA 4TTPA 1V8ZA 1G19A 1KOJA 2G1AA 3SBXA 1IFXA 3F7MA 3LDHA 3WWCA 1A2BA 1T9HA 3U6KA 3GPIA 3JTEA 2XTAA 3GLFA 3K15A 4QQFA 2BELA 3NYWA 4K9KA 1UMBB 2QT9A 3ZCRA 4E6EA 5ETJA 3L7JA 1H0HA 2V5UA 2WTUA 2VQDA 1Z0KA 3AFIA 1Y7PA 1Z2OX 4BAGA 2CFCA 4DL9A 4HZUB 4EPWA 3PQCA 1ZIDA 1G6HA 4B9AA 5DP1A 1LBIA 1QGUA 2XQKA 2ADOA 4MI6A 1OROA 4BTEA 3ZWQA 2X7JA 3AIIA 4A5SA 3BMCB 1JHUA 5IABA 1Z4IA 2Q6OA 2DQ4A 2D3TA 4YCMA 3QYAA 1JQJC 3HWX1 1DWQA 4GSLA 1DX4A 4HLCA 1ZY2A 3L0ZA 4NCKA 3UICA 1OGJA 3B3AA 4IGKA 4EMTA 1QH1A 3SMVA 2YJ4A 2OBXA 3CO5A 1XQ9A 4S1WA 4AZTA 1CUGA 1NVTA 1N77A 3SZOA 4EEZA 2W2OA 1UQUA 1VKHA 1Z16A 4QFMA 1EFVA 1I10A 4PC7A 2A7XA 4JSYA 3U17A 1T5BA 4HDRA 3N75A 1FDUA 1YD7A 1TFRA 2BFAA 2PRKA 3CBGA 4L5AA 5AXBA 2QJRA 5KTNA 3QFFA 1XL0A 1V9LA 1A9TA 1PSZA 2PDAA 3EGDA 3H97A 4HN4B 1JXQA 2GOYA 5AD1A 4JXXA 3HDVA 3R8FA 4TV9A 4OHUA 1OY1A 1OOEA 4NBLA 4WLUA 2QP3A 1ULZA 2D7CA 3LBNA 5KTYA 5FLKA 1SBHA 2V1XA 3GUZA 2F1IA 5LBTA 3JARB 5FORA 2NPFA 4DIEA 4K9RA 4LRTB 3RHTA 4DARA 1OH8A 1MHTA 1HT1E 1PWZA 1US8B 2J5RA 3BEDA 4Q9DA 4TTJA 5CT4A 2RGNA 3GGDA 3NAGA 3RODA 1DBRA 1CNEA 1KKMA 1JHOA 3PF9A 2XITA 3D2LA 1QANA 4JBLA 3IC5A 4DA0A 3OLXA 4RKRA 3Q85A 4XIFA 5CDTA 4RTMA 4QD3A 5IARA 4LOIA 3GEDA 5I7UA 3WGZA 3RYCB 3GUVA 2RC5A 4NCNA 1LH0A 1MO2A 1W581 3WWDA 3ABOB 4B6GA 1EFUA 2C96A 2AZTA 4IJUA 1JRLA 3L4KA 4MHTA 2X8LA 2O1SA 4Q4JA 1LF5A 2FZ5A 3OTWA 4TVBA 2YJ3A 5AM0A 3ME5A 3K71B 1C1DA 1YJAA 2HL6A 3OPMA 1T2AA 2Z09A 4GOXA 4LX8A 4QYIA 1LD3A 4WECA 3D43A 4LMPA 2DQZA 5DNYB 1CQIA 5JCJD 1KKLA 4X6UA 1Z26A 1I2DA 4WT7A 1DKQA 2RHCA 4EJSA 1BQEA 1GNLA 2EZ4A 1L8LA 2V6IA 4MS4A 3UV6A 2I62A 4RJ2A 4DBLE 4X8OA 2IEIA 4IS3A 4TTRA 4YWJA 1P45A 1LI5A 5TVKA 4CG1A 1JE1A 3QW2A 4ALKA 5DI3B 1EZ1A 4F5YA 5ILGA 2AS0A 2IZ7A 3IGFA 3LT5A 2Q49A 1B42A 4AQYB 4DR6B 2VJPA 1NHGA 2GA9A 2DUMA 3QUSA 5ARCA 1C9MA 1WB6A 2Q29A 2CVPA 3QG5A 1HE8B 3RARA 1LB1B 2XXBA 2IT1A 5DIZA 1W5TA 4LDNA 1NVMB 3O8DA 4MS1B 1KMIY 3QEMB 4P58A 5BUZA 4WZAA 3NKVA 3DZHA 4QASA 4C03A 1TJ4A 3EIQA 5ALOA 2H0QA 2WLSA 1N5JA 1LC0A 1YNOA 1DAFA 4H6VA 1EU1A 1DMSA 1EQUA 3D1VA 1RMQA 2QUKA 3EWIA 1ISHA 1WX1A 3I3SR 4W1RA 4M1OA 4Y2XA 2HQ1A 2PX4A 1EK0A 2O23A 1KO7A 1XD2A 1UWKA 3AUSA 1T8RA 3EWSA 3GO4A 3LF1A 3FZYA 3W2IA 1SWVA 1KEPA 5ESWA 3HKDA 4BFZA 1WQ1R 2HYIC 1EWKA 5TE9A 4GP6A 3H3FA 2P69A 2QUJA 4H6XA 1C9DB 4R2WA 4F8JA 3JQ9A 2PTHA 4JLVA 4RWZA 3I2IA 4JLWA 2XYRA 1NLYA 1N0UA 3HXPA 1NVWQ 2JAOA 4ZOLB 4EYOA 5BV0A 2ADFA 4WJKB 5DM60 3ETLA 3OEHA 3T54A 2FQQA 4Q00A 2AUTA 4CM3A 1IVYA 4HY3A 1O0SA 3U2QA 4B45A 1JIJA 2P6RA 3INRA 3PQ2A 4FDUA 3Q3EA 5TQ0B 1M2JA 4MS3A 2ZRGA 1K75A 4DZTA 3WOHA 1P4RA 1D9ZA 2Z56A 4H16A 1OW3B 2LDXA 2O0HA 1OI4A 3V2IA 2C4WA 3TD2A 5JROA 4BDSA 3CLUC 1SKYB 3ZU4A 4GYJA 2HA3A 3UJ3X 5ECWA 2RH4A 2X86A 4QGHA 4E09A 2D2VA 4K86A 3RAGA 2QAIA 2PGXA 3FZNA 5FUBA 4OBWA 1V9CA 1NZFA 2JZNA 1EP9A 1ZA2A 3A9TA 4OSPA 4XX0B 4M1KA 5IEBA 1YB5A 3OKAA 2B4TO 4HPWA 4GI5A 4BBAA 3FGPA 3LYLA 1IBMB 4DQVA 2WEKA 3EPRA 1SVUA 3WNVA 5BSHA 3DZKA 1MW8X 4DM4A 1XEXB 2MMGA 3KKKA 4PZ0A 4A82A 5DNDA 1TIBA 3TQSA 5BUCA 2YVQA 2OV3A 4OXRA 2X5OA 4CM8B 2OCBA 2IEGA 2PMEA 5DE3A 2IYNA 4RZXA 3WVNA 4C6SA 3EEYA 3SJAA 2DERA 3WL4A 2ROQA 1QP0A 3LPLA 4TM8A 1JQAA 1P3JA 1UKZA 2WF5A 4GGPA 3GP5A 4FJ1A 1L5KA 3LC0A 3BE5A 2XRMA 4MI3A 3A4TA 4RVSA 1L8OA 4AZVA 5K03A 2ZDGA 5ALDA 2IS2A 2CKMA 1SBCA 2OKCA 3UFXB 3KLPX 4XFDA 4HL6A 1JKMA 4ZANA 2FPPB 3RYIA 2VQEB 3G79A 3NBMA 3PUZA 5IAJA 3QE2A 4ZARA 2OK8A 2PZEA 3PQFA 2W0SA 4QGSA 1ZCJA 2CHVA 2RGAA 4YT8A 1X7ZB 1YRAA 3DDCA 3E9ZA 1COZA 5HGXA 2O2EA 2OENG 1M6YA 3DOHA 3K5HA 2BEWB 4GX1A 2EFHB 3K9HA 1HT3A 1WSWA 4PYOA 1VIDA 4MEAA 3W6UA 2WE8A 1GUFA 3R7DA 5AW9A 1K6MA 1OZ0A 4PYRA 1J0CA 4JJKA 1Z2NX 1ONNA 5F4ZA 3A0RB 3MYYA 2R6AA 4GBMA 4C07A 4CU2A 3OECA 1LV7A 2QT0A 5D1HA 4LBWA 4EGAA 5ITZB 1ODSA 2D0IA 4KSYA 3I92A 3B1KA 3BL6A 1B26A 4H1TA 1YK1A 5JSZB 2A94A 2KE5A 3IEMA 2GN2A 2BYTA 3B5JA 4LDQA 3W9BA 2VYVA 1NNI1 2WSMA 1FDOA 4FWBA 4LC0A 2J7PD 2WK1A 5E9AA 5G1NA 2OAGA 3ZLUA 1NLMA 5CJPA 2OAEA 2GPWA 3OAAA 1YDEA 4C3UA 1JDBC 3FNQA 4CKWB 2AFVA 3FTPA 3FVRA 1AUPA 1V9SA 4KE8A 2P9QA 1EXWA 4Q39A 4ENTA 3U3XA 3VR5H 2DUWA 2J0SA 1V8OA 1FLVA 3EPKA 3RRFA 4EVIA 1HYHA 1O6GA 1OKKA 1EAMA 1U7DA 1HI9A 3ML1A 4NDNE 3WOVA 4BZQA 5TJ9A 5ECYA 1DEHA 4Q03A 1L1FA 1NPTO 3PF8A 1YR9A 2K4MA 2VDPB 3HKEB 1UADA 3GC6A 1U7UA 3NFRA 3WHLA 3JAKA 3FN4A 5C8XA 4RU1A 2QTFA 1QP7A 4X54A 5I3ZA 4LJ7A 2GN9A 1QHIA 1BCRA 4EW1A 2HD4A 2X2EA 4G65A 2Q45A 1K5GA 5KYNA 1SCUB 5EJ8A 3OI7A 4DZRA 4WXMA 2J0UA 3DKVA 3LW7A 5F7ZA 4PHGA 3B3GA 2P0YA 4N5HX 1TLFA 2F3TA 5E4TA 2P4UA 4MQUA 4DJ5X 3OC6A 3AJDA 3OLQA 1EBBA 2QDKA 4J03A 2PWPA 4CRWB 5C46F 1SZDA 2W8ZA 3TLGB 5K8VA 2GTPA 1CEQA 3ESBA 4N7MA 5B3LA 1Z6YA 3GG9A 4MHOA 2V45A 1DBQA 4G36A 4P4NA 3Q9LA 2W22A 4FMDF 1CIVA 3ND7A 5BNWA 4JT9A 2Z57A 3V1KA 3VPBA 2CLOB 2AYXA 3HRIA 2AVNA 1QM5A 1NI3A 4RH0A 3OOHA 1PWYE 1VKNA 1UOPA 3M81A 3G2IA 2QV0A 1ZSYA 2BVNA 5AHXA 3B1VA 4ZQFA 1KEEA 3AERA 3CRMA 1OF1A 2AT1A 1I4OA 3ECAA 2E2WA 2Z4RA 3SI7A 2NADA 4YXWD 1WR8A 1VBMA 4HN9A 3BERA 3IALA 1FTYA 1I3OA 3AFMA 3T1TA 1RI4A 4YAKA 2J7KA 4XUCA 5KMGB 1G20B 3E9MA 2B2XA 1V35A 2PIAA 3TOCA 4UNNA 3VZCA 4DIOA 2GLXA 2JNWA 3LOPA 3N6XA 1ZU4A 4BRWA 5B2ZA 1NJSA 2NXCA 5FPQA 1XOIA 2VWHA 3ZDZB 3TX6A 3WDLA 4YO8A 1PZMA 2F6RA 5GMOA 1Z18A 2B1QA 3LL7A 1MB9A 3QVGA 5G3ZA 4II7A 3ABQB 3RYHA 2POCA 5IFKA 3ELYA 3C3MA 4FWTA 4M89A 1FMTA 4UHBA 2W2LD 4ZKDA 1UPCA 1F6WA 2YDXA 5HFNA 3O03A 4PYNA 2DMRA 3UAWA 3CW9A 4EHJA 4DQXA 1P1KA 3IDSA 3HGQA 4HLQB 4RKEA 1NZDA 1GTG1 3DVSX 2NV2B 3IFSA 5C34B 4IWNA 4US1R 4F0JA 3LOUA 1TD1A 2LBPA 2QX4A 3PDHA 4LE0A 5EWLB 3NW9A 2I5PO 1J2EA 4D82A 2LRHA 1MOSA 2UYYA 4WPGA 1PJSA 4M0UA 5GV7A 3NGMA 2ZRJA 1HMPA 1EEXB 3LDFA 4RESA 1HYGA 4FE7A 1M2NA 1XB2A 1L1QA 3F6BX 3E4CA 2C5HA 2VP0A 3A36A 2R8PA 1A9ZA 1BTOA 3QVJA 4CLDA 4ENPA 1AKTA 1CV2A 2Q2VA 5HM6A 3WYEA 4YRNA 1SVLA 2JLSA 5J23A 5JYBA 2Q5EA 3JRXA 4RBNA 3BD8A 1R0YA 1MPXA 1U0TA 5DLYA 3ZHUA 1E2QA 3G13A 1A8PA 4AJIA 1OREA 4H59A 3SVLA 2FN7A 1RZVA 3VPXA 5DH9A 1W48A 4MAMA 1ISMA 1V5FA 2VLIA 1OFUA 3H13A 1GXSB 3A4NA 2PXCA 3BE8A 5DM70 2QM3A 2DH6A 3PHJA 4WXHA 4ZXPA 1LLUA 1EM8A 2QN9A 3L46A 4Z3DA 4DRZA 4RJJA 4MPPA 5KC9A 4Z54A 1X7WA 2JBAA 2GPSA 3DEAA 4PSUA 1KO5A 1FDTA 5EC8A 5EXPA 1IN1A 3KR9A 4DV2B 3LXUX 1HLGA 4HQKA 1V2GA 3KLMX 1RXCA 5DTEA 4I99A 2IOFA 5EJ4A 2IZZA 4KKXB 4AF6A 1OB2A 5HUHA 3JQAB 4S1NA 3IB3A 3CSUA 2QN3A 4EHAA 3QU5A 4XWOA 1E1DA 2OM2A 1U90A 2R6JA 1H4TA 4NJMB 4CM9A 4WCFC 4J0QA 4LMBA 2IIVA 3I2HA 4UU1A 1J1IA 3UB4A 4CIWA 1OLXA 4I1SA 2EW8A 1TLLA 2XDQB 2WF9A 5DK4A 3A9RA 3TDKA 5JD4A 1QZ3A 3QU7A 3DXXA 3VH2A 1PUXA 2W70A 7REQA 3Q3CA 4FP9A 2V7XA 5LIRA 1AS0A 4CL8A 4UOZA 3RU9A 5DDIP 5IDYA 1XLWA 1GZUA 2CMGA 3A32A 3IJPA 4TGLA 1RBQA 2W6ID 2OUKA 2Q4EA 3IT2A 1M2WA 2V7QD 4YVFA 2QYTA 4CMEC 1G7TA 3CWZA 3WZMA 2NN3C 4BO6A 4H6PA 3L4EA 3NVAA 5LQJA 1L6IA 1DIOB 5T3YA 2ZB3A 4QU8A 4KE7A 1SD1A 3D7NA 5T41A 1XSEA 1OXSC 2FCAA 1AC5A 3QHAA 4C3OB 4DR2B 3RC2A 1NE7A 1CEXA 1Z2PX 5J40A 3DGEC 2KI5A 2ZUCA 4P5PA 3UUFA 2FY8A 1A04A 2LP4Y 4XKJA 2C8JA 2QTRA 1PDOA 2A0YA 2HXGA 3P5SA 1DO0A 2ZE8A 5KUTA 3HKCB 1DIGA 1FJ2A 4P2GA 1ZD2P 3UHPA 5BVHB 4FPXA 3VKUA 4JUBA 1QFJA 4BRSA 3IEUA 3MS7A 2REQA 5LD2B 1K3FA 1YDGA 3UBTA 1I36A 2QBYA 1IU9A 4I55F 3KL4A 2ZSHA 2Y05A 3I53A 2CNWD 2I55A 3ID6C 4L9RA 5TF0A 1CE8A 1TVCA 1RBMA 4FLEA 3EZGA 3DAOA 3NEJA 1ZHFA 3DAPA 2EKQA 1DKUA 4BNDB 4QXAA 1IY9A 1OV4A 4MV6A 1I3LA 1KZ6A 4ND4A 3QPWA 4TQAA 4WOBA 3SLRA 3PHLA 4DIBA 4LXYA 5BQPA 5A9SA 1ZM3A 5DTMA 3SF8A 2WW8A 4R2JA 4NK4A 5HTKA 4ETMA 4EZIA 2CHGA 2QW8A 4M1MA 3IUBA 2XOEA 2FFBA 4D4LA 3DBVO 1ANKA 5K3SA 3QJGA 2YXPX 2OC4A 5AOAA 4AY3A 4L75A 1FFSA 3PL5A 4M9SA 3KEOA 4ND3A 2NU9B 2FR1A 3W6OA 4K03A 3I42A 3MRSA 3EAQA 3HY3A 3FTNA 2J6HA 2XADA 4BLVA 5CDSA 4XGIA 2UUPA 3GW8A 3SBOA 4CUKA 3WICA 3ZWBA 3IDFA 1J0BA 5E6SA 1A9XA 2G8NA 5CTAA 2CGEA 2UXCB 1OXVA 2ZYWX 3H2BA 4GVXA 4LHZA 3L4JA 1ECLA 1XXHA 3OQIA 2OXEA 4E3WA 1HNXB 4BJ1A 3NX4A 1RT9A 3D3NA 5A3VA 4FLMA 3L1JA 3RCBA 1WU8A 2Z8XA 2W71A 5K8IA 1E2DA 1VLMA 4DABA 5JXHA 4CMEA 2DB3A 2DECA 2R44A 4FFOA 4FGLA 1QCCA 2QX8A 1UDCA 2QF7A 4DXAA 1EUDB 2J4FA 3LT4A 4BZZA 4EMUA 4A26A 1DJNA 3GRFA 5C7IO 4CCYA 2P9CA 5AJXA 3T5PA 4RPHA 2P9YA 5CK4A 3K6SA 4RL4A 1S2NA 1X1AA 3NBKA 3ZGZA 4DLAA 4EYSA 5CYFA 1BGVA 3NEAA 4MVJE 1YB2A 3BICA 1UBCA 2BFFB 4F5ZA 2QZ9A 2GERA 1NQXA 3FAKA 4HB0A 1F7VA 4FFLA 1RR6A 3WWZA 3KAPA 5LCXA 2BZGA 3A28A 1JXOA 3L7MA 4Q4HA 4F8YA 1YDWA 4MQLA 1OBHA 2FH5B 3Q8XB 4ZU1X 1E5QA 3N5CA 3PIRA 2IF0A 4DDMA 1X0XA 1XZPA 3O2QB 1XXLA 3P9IA 3EIXA 4J76A 3NS7A 1T9CA 3I1FA 5CJ2A 5DHFA 1G42A 4MP3A 3VR5A 4YRIA