3SLGA

Crystal structure of pbgp3 protein from burkholderia pseudomallei
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
347
structure length
334
Chain Sequence
KAKKVLILGVNGFIGHHLSKRILETTDWEVFGMDMQTDRLGDLVKHERMHFFEGDITINKEWVEYHVKKCDVILPLVAIATPATYVKQPLRVFELDFEANLPIVRSAVKYGKHLVFPSTSEVYGMCADEQFDPDASALTYGPINKPRWIYACSKQLMDRVIWGYGMEGLNFTLFRPFNWIGPGLDSIYTPKEGSSRVVTQFLGHIVRGENISLVDGGSQKRAFTYVDDGISALMKIIENSNGVATGKIYNIGNPNNNFSVRELANKMLELAAEFPEYADSAKRVKLVETQNRVPKIENTMQELGWAPQFTFDDALRQIFEAYRGHVADARALVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PbgP3 protein from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords PbgP3 protein
total genus 127
structure length 334
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3slgA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3slgA02
4W9NA 4XB1A 1Q7CA 4CL8A 1E3WA 2VUTA 5AXBA 4MKZA 4IDFA 4EEZA 4PN3A 4PLPA 5GY7A 4EW6A 3RBVA 3DB2A 4BO5A 4F6LA 1DC3A 2O4UX 2QHXA 3DZGA 3GMDA 4YQZA 2WJPA 4W99A 3RQSA 2VOEA 1H93A 2CNBA 1XSEA 3TZCA 3RUAA 4XR4A 3WSWA 4CR8A 2PZJA 1LI4A 3QA9A 4P38A 2PD4A 4OSPA 1KC1A 2B5VA 1IPEA 3GUYA 4FFNA 4M86A 1JN0A 1DFGA 1ZMOA 2VYND 3OJFA 3D1LA 3COSA 4GMGA 1JU9A 2X58A 3C7AA 1T2FA 3R3JA 1U1IA 3DOJA 4QO7A 3N74A 3RJ5A 1AN9A 3P2YA 5KVCA 3QW2A 1GU7A 3JYOA 1D8AA 3C24A 1NWCA 1FK8A 3H2ZA 4I5GA 3DBRB 4MJLA 4OYRA 1F12A 2NACA 2W8ZA 1PR9A 1ENOA 1HE3A 5EQDA 4OH1A 4KDFA 2JHFA 4AJLA 3LU1A 4N7RA 4BO2A 2VHWA 4BNFA 5J23A 4LRSB 3OHSX 1R0SA 4Z9YA 1N9GA 1X1TA 1GUYA 5I7FA 2ZB3A 1V35A 5CG2A 5IZ4A 1Y6JA 1F0YA 4II2A 4E3ZA 1NPDA 1HE4A 2Q2VA 3N58A 3RC1A 4GGOA 1LEHA 2VCYA 4M55A 1ISJA 3PPIA 4UEOA 4XYEA 2CDBA 1OBFO 1FDSA 1KVSA 1FF9A 4OXKA 2IZZA 3WIEA 2DQ4A 3WMWA 4JBHA 2Z5LA 3BTOA 4LMPA 4XJSA 1HL3A 3HHPA 2B36A 4J49A 2YJZA 3O03A 3Q11A 3GMSA 3AOGA 1HYHA 1NAIA 1A71A 1PL7A 2FN7A 4MVJE 5DBFA 1E7SA 4EITA 2NU7A 3EDMA 1ZSVA 1HTBA 3JQAA 2C7VA 2VOJA 1YOVA 4DBZA 1P1KA 4Z0HO 3KSZO 3GVCA 3KXDA 4GWKA 5G0WA 1BXZA 3FNFA 4I9NA 1O89A 4J0EA 3KBOA 4M1QA 2JAHA 1LJ8A 4E5NA 4D7AA 3DFZA 1GFSA 1IHYA 2NVUB 1HYEA 1B8UA 1PS9A 3K92A 3ICCA 1IB6A 4RZIA 5ER9A 1M2WA 2PWZA 2SCUA 2V65A 3VZQA 3ZU3A 2UV8A 4E2WA 2BF7A 2Q50A 4CLXA 1GCOA 1ONOA 3GEMA 3JQ9A 4CMAA 1MX3A 1TI7A 4JCOA 4S1VA 3A1NA 2HKIA 5FYDA 5L9AA 4ZJUA 2NTVA 5IXSA 1KVRA 4I8XA 4RO0A 1R0KA 4PIVA 2E49A 2J6IA 3WQSB 5A03A 1CQIA 2I67A 1P9LA 1ZXBA 2VYVA 4W7IA 2TMGA 4MP3A 4XYMA 1O0SA 1E5LA 3WNQA 4YAKA 4YAGA 3IQDB 3ZNQA 4JP3A 1OI7A 2AG5A 1DBVO 1PJ3A 4KDEA 1ZEMA 1W4ZA 4Y6SA 3DZJA 3WJ7A 2WD7B 5TF4A 4CLHA 1B15A 4XQGA 3C85A 1GV1A 1GQQA 5EL0A 1RJWA 1A7KA 4DQXA 4E33A 3DHEA 4CM5A 4RQTA 3HDHA 3I52A 2G0TA 3RUDA 3I4CA 4YCAA 1HDCA 3KEOA 4DLBA 1HKUA 3PLNA 1VSVA 2YHIA 3PTZA 2BD0A 5G0TA 2HK7A 3BA1A 1ISIA 4IDCA 1A27A 1JDJA 1YWGO 3GPDG 3H6KA 3E48A 3PIDA 3VVBA 1GYPA 1BTOA 1EQ2A 4PG6A 2PV7A 4DMMA 5T64A 4CMEA 2I5PO 5B4UA 3GZ4A 1CF2O 5A05A 4QECA 1EZ4A 3DAGA 1I3NA 3ZWVA 5FI3A 4YT2A 5F5LA 2HRZA 4J90A 3WGIA 4FIZA 1DFHA 3ZWBA 2BELA 1SOWA 4CMHA 2GN9A 4BV9A 2F1KA 4NFYA 3RKUA 1HZJA 4W7HA 3ASVA 1L1FA 3LT2A 5HBRA 1I3LA 1VJ0A 1XGKA 3D5TA 3JQ9C 5CDSA 3NDRA 3TPCA 3JSAA 1KEWA 1Z75A 3AM4A 4RZHA 3WGYA 4J1SA 3MWEB 3T7EA 4BKPA 5A9RA 4GBJA 3BTVA 4YRAA 4FBGA 1KEPA 3PDJA 4DC1A 4YAJA 2EG9A 3IP3A 4C7JA 5T8KA 4YJFB 3IOYA 4AJPA 4FW8A 1PJ4A 1SO8A 2WE7A 3C1TA 1LTHR 3GZNB 5DULA 5H83A 3BMOB 4OSOA 4WJZA 1EE9A 4A03A 5KKCA 4AJ4A 4R69A 1MC5A 4INAA 4J7CA 4OHUA 4RDIA 5DCYA 5ILOA 5KNLA 1ENPA 1R16A 2GLXA 5DCWA 4BNJA 1Y8QB 4NBWA 3D7LA 5THQA 3OEWA 1HETA 1IPFA 4OGWA 4WPGA 1IYZA 2FP4A 2O3QA 4IQ0A 1YL5A 4R1UA 2ZYGA 2UYYA 1AXGA 2D5CA 1GADO 3MTJA 2C2XA 3O4RA 4BKQA 4WGGA 3OBBA 1FDVA 1YB1A 1E6UA 2IDZA 5L7YA 2IEBA 1K6IA 4Y8VA 4UREA 4HNGA 2HLPA 3ICPA 2UUOA 4YVFA 2B69A 4Q3CA 5G4LA 4F46A 5T8KC 1ARZA 1N7GA 5EIOA 4B4WA 4AJOA 1OOEA 3LT0A 4TQGA 2VWPA 3ZWNA 3AK4A 2GO1A 1WP4A 4E5KA 4E5PA 4UUOA 4RF3A 2VHVA 4FD3A 4WOJA 4AJ2A 3FPLA 1P77A 2ZTMA 2CUKA 3K6JA 3UCFA 3K8ZA 4AJJA 1XQ1A 4ZD6A 3PWZA 1WLYA 3TL2A 3ABIA 1KEVA 3E8XA 3WQQA 1HEUA 4LMRA 2DAPA 3DMTA 2X5JO 1PU2A 5B1YA 5JAZA 3V2GA 2GN6A 3HZZA 4YRDA 4YACA 4LSMA 5K6AA 2VUUA 3CXRA 4E4YA 1PTJA 1T1SA 5BSHA 7MDHA 1B26A 1R4NA 3D0OA 4RL6A 2Z1NA 2VNAA 2A4KA 3E5RA 8ADHA 3VZSA 5KJ6A 2YV3A 3AY3A 1WDKA 3VHRA 1U7HA 2DBQA 4E30A 4EEXA 2W2LA 3BMCB 2OBYA 1LDGA 4DIBA 1W6UA 4OXYA 1IULA 4J3FA 4BNWA 2WD8A 4U7WA 2HCTA 2Q99A 4Y9DA 2VWGA 3NT5A 4CLOB 2OOSA 1Y9AA 4CMIB 2UUPA 3K2EA 4FQ8A 3SXPA 4J4TA 2G76A 1EK5A 1HF3A 2DC1A 2EXXA 4PZDA 4DQUA 3MZ0A 4C7KA 3GOHA 4CV3A 4CQLA 2ZIZA 2ZB7A 4BOYA 4J9VA 9LDTA 2QIOA 1F06A 4CV1A 2FRDA 1LU9A 3B1JA 4UUMA 5KVQA 3AUUA 1A9YA 2ZTVA 5BT9A 1DIRA 1K0UA 5CHEA 4W6ZA 5HWSA 5BQFA 1W73A 3RBZA 5JW6A 4LW8A 4MP6A 1I5RA 1HDZA 1X7HA 2P91A 2FSVA 3AY6A 4NDNE 2IODA 1YB5A 5JDIA 4BNXA 1H2BA 1EVYA 3QVXA 1JW9B 4WASA 3AUAA 4N54A 1F8GA 4IS3A 2A92A 1X0XA 4CM4A 3DTTA 1IY8A 3JQ8B 3QVSA 4RPLA 3PQDA 4BNYA 4HFRA 2IXAA 1MUUA 5AQ1A 4R51A 1RYDA 4TRRA 5L40A 3QIVA 3BZUA 4K6CA 1SNYA 1WDLA 5I7VA 3NX4A 4XIYA 3S1LA 5F3RA 2Z1MA 5AXCA 4D43A 3GAZA 1DIBA 4IJKA 5ER6A 1YDEA 3G1TA 3TN7A 3QP9A 1H6BA 1PIWA 2RHCA 5ADHA 2AQHA 2Q45A 2ZTLA 2G5CA 1ZO8A 2H63A 1PJLA 3QQPA 4X54A 3TSCA 5JBIA 1NAHA 3ZNOA 2UAGA 3P19A 3R3SA 4CMKA 4M8SA 1HE2A 3ZWXA 1DIAA 1K2WA 1V0JA 4BGIA 2HAEA 4GPD1 1P1JA 1HWYA 1R4NB 3DBVO 2Y1EA 4GX1A 4Q3BA 1PZHA 4O63O 1E5QA 3H9GA 5HRUA 4R68A 3GT0A 2HK9A 1LXCA 2P9CA 5BNIA 4WLUA 5IAAA 3MOGA 3F3SA 5DF1A 4DYDA 1I2ZA 2GNAA 2ZCUA 1M76A 2GN4A 2Y1CA 4I9HA 1V3UA 1VKOA 3E18A 5BSFA 5TGDA 3NJ8A 3BXXA 1RM5A 4UVHA 4KTVE 4W9NC 1C0KA 4JROA 1Y5MA 1OZAA 3JQGB 3L6DA 4GWGA 3Q9UA 5JY6A 2JFFA 4IGFA 2D59A 4R9RA 4L0QA 3GNQA 1EFKA 1ZEJA 3C8MA 5KJFA 1V3TA 1ZK4A 2PKQP 2CDCA 2YHUA 3KUXA 3I23A 5JLAA 3PVZA 2OXIA 1V8BA 4B79A 4HADA 2YY7A 4M89A 5H81A 1TT5A 3RD5A 3UXYA 1T1RA 1IHXA 4D3FA 1U3TA 2Y0CA 3WSVA 1YXMA 2BFAA 4MINA 2BGKA 4D79A 3NGLA 2FPGA 3H8VA 2GF2A 2DPGA 3RKRA 3HB4X 2R00C 2FOIA 3RU9A 1QYXA 3S55A 1YS4A 2C2YA 5BSEA 3SC6A 5I9LA 2DU8A 2GZ1A 3DAPA 5BSGA 3IC5A 4GKBA 1E7RA 3PWSA 5JFOA 2VRBA 1DHTA 3PEFA 5KKAA 5JDIC 1XIVA 1ISFA 1AUPA 2Y0EA 3D3EA 1PGJA 1V9LA 4PZCA 4AJ1A 1QKIA 2C29D 2GGSA 4DIOA 1CQJA 2C5AA 1PGOA 5ENDA 2HMSA 3AJRA 1H9BA 4JJGA 3VPSA 3ZN2A 4FB5A 3LC2O 3GG9A 1B2LA 1T4DA 1E7MA 1H6DA 1WAMA 4L4XA 1E6WA 2BH9A 3D3WB 1VKNA 3V8BA 5JCXA 2ZQYA 1UAGA 5IJZA 1SEVA 4J4BA 3BHJA 3KLMX 2GPTA 3L07A 3DZKA 3UF0A 3FBGA 4D3SA 3KZVA 3QY9A 4MDHA 3ROPA 1A5ZA 3K30A 1T2AA 2BFOA 2FWMX 3JYLA 3ULKA 1ZK2A 1MFPA 2BGMA 4BNMA 5JNLA 5KIAA 1DJNA 4FR5A 1DPGA 3RSHA 1DHRA 3W4JA 4UULA 1MB4A 5F1PA 4A26A 1GQ2A 3TJRA 3AUTA 2ZTUA 2DTXA 4FJ1A 4D41A 5KJCA 2DUUA 1DB3A 1Y9EA 5JCJA 2YDYA 4NMHA 2JKVA 4BO4A 2EW2A 4HKTA 1W0CA 3ZW8A 5FF9A 1YQDA 3K96A 3W8EA 5C7OO 3ZV4A 3H9QA 4ZQEA 3GDFA 3JD2A 1ZK3A 3VDQA 3OA2A 2J3JA 4NNJA 3WDSA 4B3JA 5T5QA 5TQVA 1J0XO 4YQYA 2VTDA 3ZWPA 4ZQHA 4Z0PA 3ETDA 3B6ZA 3UOGA 4XR9A 3G79A 2VT2A 1YJ8A 1XU7A 4XJTA 1EVJA 5DNAA 3DTYA 3ZNPA 5G0VA 1D4FA 3MCVA 3RFVA 3SLGA 1VSUA 2JD2A 2BKAA 2VZ8A 2BRUA 2D3TA 3L4SO 3GHYA 3P5SA 4XGIA 4B4UA 4NU6A 3PIIA 4Q3DA 5EPOA 3VTFA 3LLVA 1IZ9A 4WK6A 1XYGA 4KQWA 5C3MA 3AI3A 2EHDA 1ZJYA 2NM0A 5GMOA 1MG0A 5A9SB 2EIHA 3FF4A 3GGOA 3F1KA 4M49A 3QRWA 3ITKA 2WYUA 1NASA 3WWYA 4ZN6A 3OEYA 5TJ9A 1C0IA 1P0FA 4WKGA 1QRRA 1PJCA 2Q1SA 1NX6A 2IRWA 2ZCVA 2Q1WA 3T7CA 3C3XA 4RJTA 3FBTA 2CDAA 1ZK0A 1YE3A 1SMKA 3CMMA 5IDXA 4S3MA 1ZJZA 3TZHA 3RI3A 4R4JA 3RAJA 2NSDA 1HDXA 2G17A 3FCOA 2PGDA 4G2NA 4CLDA 3WGHA 3SVTA 4E13A 1O95A 2J5RA 7ADHA 2XXBA 4IINA 4KMSA 3KETA 4FOOA 4BMVA 4YR9A 1MG5A 3ETEA 2VYNA 2I76A 4BVAA 3TOZA 2B83A 1NR7A 1OAAA 4A27A 1Y5RA 3L9XA 4CR6A 2V7PA 4E6PA 1LDBA 2J3KA 1UZNA 4NZ9A 2QYSA 2V6BA 2JHGA 5THKA 3WTCA 1U8XX 3D4PA 4ND5A 3EHEA 4OKIA 3WMXA 2GUGA 1NHWA 3JQGA 1MC4A 4R1NA 4JBIA 1JKFA 4CR7A 4YPOA 5I9NA 3MOIA 5IXYA 4XCVA 3STHA 1QYWA 3PWKA 4PG8A 5JS6A 2O3RA 4N5MA 5F5NA 4BNGA 3V2HA 4E0BA 5DDIP 2EGGA 4CQMD 1D1TA 1L7DA 3KO8A 3OIFA 4ALJA 1UJMA 3E9MA 5B4VA 4NPCA 6ADHA 4ND1A 1BW9A 1O94A 5DZSA 2J3IA 2FZWA 1GY8A 4GSLA 2B0JA 4RVHA 1FMCA 3LT1A 3UFXA 1GDHA 3M2TA 3G3EA 1YBMA 4CM9D 2EGHA 3CE6A 4OL9A 5IDYA 2Q49A 2P9GA 3VKUA 3L4BC 2C59A 1ORRA 3ZHYA 1P1RA 4IDGA 4EI2A 5KJEA 4MKXA 2UVDA 3K31A 5U1PA 3ZHZA 4K1LA 4ZU3A 2A9FA 3EW7A 5GZ1A 1BVRA 3IUPA 1JVBA 3TFQA 3VH3A 1T2EA 1BMDA 4BB6A 4B3HA 2AEMA 4ZQFA 1DEHA 1LUAA 3L0DA 1TVEA 2C0CA 4F45A 3DL2A 4PVCA 3PHLA 5AVOA 3WIDA 1FXSA 4ZQBA 2QG4A 3F1LA 1P31A 1G6KA 1H9AA 1U3WA 4IJVA 2YFQA 1RM0A 5A3JA 2GRAA 1DIHA 1ZW1A 1XLTA 1KOLA 2YHIB 3NUGA 4I1IA 1ZK1A 1EQUA 2FR8A 3VH1A 1X14A 3H65A 3PJDA 4JLWA 4XD2A 3CZRA 3KTDA 3OH8A 3S2GA 2Q2QA 4MO2A 4WNCA 1VM6A 1Q7BA 2YDXA 3KB6A 3HN2A 1NHGA 1L7EA 1S7CA 4RDHA 2O3UA 4NIMA 4PLZA 3L9WA 4GVLA 2NLOA 3KHUA 4Q3EA 5I8WA 2X1HA 3QLJA 1M66A 5JO9A 1LSOA 1WWKA 3IAHA 4U6QA 4UEKA 3E9QA 3EAGA 2X86A 3NDIA 2VYVD 3A4VA 3F46A 4IIVA 4MIOA 4C4OA 2JD0A 3QHAA 1JWBB 3I9NA 3JQBC 2TMDA 3P7MA 1CEQA 4YYZA 2PKQO 1E77A 5G0UA 2EP7A 1BXGA 4NG5A 3H7AA 4BGVA 4IXWA 4H7PA 3R1IA 4CPDA 2HK8A 5CEJA 1QG6A 3WBFA 4N18A 4J43A 4DBVO 4XYBA 1E6EA 3DZIA 4TZTA 3P2OA 4OAQA 3ZHBA 2IYPA 3FN4A 2QQ5A 3BTUA 2ZATA 1GAEO 3GVHA 1K5HA 2VWHA 1U4SA 4LRTB 5JE8A 1XHLA 1C1XA 3GVXA 4FPXA 1ISMA 4FDAA 3FNHA 3V5NA 4P4LA 5BR7A 5HM8A 1GUZA 4WUVA 4L4RA 1R15A 3UVEA 3F9IA 3A9WA 4O59O 3LQFA 3OIGA 4IBOA 3WWZA 3U9LA 4ND4A 1E0DA 4L4SA 1XDWA 4IJWA 2NVUA 3DBLA 3DONA 3TOXA 3GEDA 4FS3A 2OL4A 2GZ2A 4KUGA 4RVUA 5CDYA 1OC2A 3D3WA 4NBTA 4QEDA 4YJDA 2FY8A 2BMAA 4AJNA 1RYEA 2H6EA 3WXBA 3ZZNA 1R4MA 4R3WA 1LNQA 1PGNA 3OP4A 3VC7A 3E5MA 3W1VA 4K9DA 1N5DA 2AQKA 1G0OA 3ONFA 1ULSA 4IUYA 4MIYA 3EMKA 3U4HA 1KS9A 4YEDA 2B5WA 1O8CA 3RUCA 1FDWA 3QJ5A 4D0SA 4YT5A 2Y05A 3QVOA 4NFHA 4U5QA 4M87A 1ML3A 5AOVA 1X7DA 1KERA 5CEFA 4NU5A 4WCFC 4RPJA 3H9EO 3WNVA 1ENYA 4BMNA 3LSYA 2Y1FA 4DRYA 4XA8A 3MJ4A 3E03A 3KOUA 1NFFA 2PZMA 4DUPA 4L9RA 5F1KA 3DZFA 4TRNA 4BO9A 3WYBA 1XA0A 4BO1A 3AY7A 5IFLA 3MJVA 1A9ZA 3BMCA 1GV0A 5JAMA 5L4NA 3IJRA 3Q2IA 2XPCA 2HU2A 4A5OA 2CMDA 3O9ZA 1W8DA 3RUEA 3K73O 5TT0A 3OQ6A 4J2OA 1RKXA 1WDMA 4E31A 1DC4A 4DA9A 5A9SA 4F6CA 1N2SA 2FPIA 1FDTA 2E6UX 4GL4A 5KCZA 1AHHA 1LA2A 1EUCA 1N8KA 3N7UA 3NYWA 4QFCA 1XG5A 3L6OO 2Q46A 3H9UA 4QSMA 1KVUA 1AHIA 3H3FA 3GFBA 3FWNA 3ZHXA 1ID1A 2D5AA 1BW9B 2EEZA 2EJWA 1WVGA 3I6QA 4U0JA 4YAIA 3PZBA 4LSWA 2I3AA 3CKYA 4G65A 4GI2A 1KVQA 3O8QA 1GZ6A 1WPQA 3GGPA 5CEEA 2JFHA 2QX7A 2FR1A 3ADPA 3O38A 3GRPA 4UUNA 4WLOA 1O6ZA 1G1AA 5AXDA 2B37A 2Y68A 4LK3A 4M54A 2OGUA 3JYPA 3OQ1A 1XWFA 2F00A 4J1QA 1MV8A 3AM5A 2OMEA 4WEQA 3VPXA 2VTEA 5IN5A 2X5KO 4CM7A 2V6FA 1GR0A 1QYVA 3I5MA 4PG7A 2VHYA 1LRKA 3U4IA 3EK2A 3F5QA 3RIHA 3MJCA 3O26A 4GQAA 1J4AA 2X9NA 4RVDA 1S6YA 4BIIA 4DLLA 1IL0A 5JDCA 2PTGA 5BNFA 2NU8A 4JN6B 2POQX 4D42A 1GEGA 5U9CA 2VUSA 4GLOA 4R01A 2OZPA 2WE8A 3WLEA 2YUTA 4BO7A 4D0RA 3A06A 2D2IA 3KSUA 3LC7O 3DHNA 4NJMB 3GEGA 1ZBQA 1GPJA 5JAQA 4WEOA 1KC3A 4N5LA 1E3IA 1SOVA 4P4NA 4G81A 3ADOA 3ANNA 5A06A 5T6BA 1E1NA 3NTQA 4QXMA 1NVTA 5TX7A 2O23A 3U4DA 2DLDA 1PL6A 4ALIA 4DTIA 4J91A 4B7XA 4DQVA 1YL7A 1EUDA 1PJQA 2Y99A 4J6FA 3U0BA 2VRCA 1VC2A 4EGFA 4PRKA 4WCDA 1DAPA 1XR3A 3ZV6A 3UICA 4AJIA 5IG2A 4MVJP 4LGVA 2HJRA 1NR1A 3JD4A 1R12A 2FZEA 3VTZA 2I9PA 2Z95A 2ZJ0A 1QXSA 4BGUA 2A94A 4FC6A 3W4KA 3RBXA 3DEYX 3AOEC 3R6DA 4J9UE 2QYTA 5T67A 3GVIA 1N1EA 4BKUA 3E1KA 1B14A 4U0KA 3INGA 4XGNA 3RVDA 1X13A 1Z82A 4MP8A 4XQ9A 4EZBA 4XDYA 3Q6IA 1KETA 1JKIA 3OFSA 1EBUA 4BNVA 1BG6A 2CF5A 5JYDA 4YT4A 4CV2A 4KP7A 2Y66A 4NJMA 1H5QA 4QFDA 1HDYA 4AFNA 3U09A 1Q0QA 4MVJM 4RPGA 1J49A 3C7DB 4BO6A 4NFSA 3DO5A 5EMHA 1UXJA 2W98A 4GSKA 4I08A 3WB9A 4CV0A 1EVZA 1PEDA 4YWJA 3HDYA 1HE5A 3T4XA 5MDHA 5EERA 3H5AA 4IDBA 3VZRA 3GUCA 1QP8A 4R1TA 4D44A 4TRMA 1NBOA 1XQ6A 1O5IA 2E4AA 2AA3A 2HSDA 2HUNA 2YQ4A 3SJUA 1DLJA 4XRRA 3GVPA 1DLIA 1BRMA 1ZVMA 4FFLA 1P0CA 1VJ1A 2ET6A 1TLTA 3FWZA 3QWBA 2AG8A 1Q2XA 1QMGA 4MOWA 3OMLA 1I33A 1HYGA 2WMDA 4OQZA 4R1SA 4UVEA 3UHAA 2XOXA 5COQA 3PZRA 1WNTA 2PD6A 4P22A 4BQPA 4DIFA 3PHJA 1P33A 2D4AA 3QWHA 4FFRA 4GMFA 3TNLA 2JAPA 1CERA 2GR9A 5JDCC 2WD7A 4HFMA 4TMFA 4BNHA 2QZZA 4L73A 1C1XB 3QV1A 4XDZA 3ZWYA 4BKOA 1U3VA 1P1IA 1JQBA 3PJEA 3U4CA 2NTNA 3DBRA 3ZNNA 2Q3EA 5C5IA 4CJXA 4W4TA 3JQDA 1ZIDA 3OSUA 3BAZA 2NVWA 4NBRA 4D46A 2QRKA 1NNUA 3NT4A 4RQUA 1LRLA 4WE3A 1SB8A 2OO5A 1EVIA 2RIRA 2IZ0A 5CP8A 2O7SA 1N9GB 4DMLA 3ENKA 2FR0A 3JQEA 1B8VA 1J6UA 1GYQA 1T25A 3H4VA 4RPHA 4ZQGA 3UGKA 5TC4A 3GHHA 2CD9A 3V2UA 1ZNQO 1Q0LA 2VZ0A 3WGOA 5IZCC 3L4BA 1I24A 1YBVA 1P1FA 2CVOA 1GL3A 2DUWA 1FJHA 1BVUA 4A10A 4EJ6A 3RFTA 3G17A 1HSZA 3QSGA 3E82A 2DPHA 2AEJA 1ISHA 2H9IA 5JMPA 3MEQA 4OIMA 3AW9A 2YYYA 4FSHA 3NAQA 3VOSA 5I7SA 2HMTA 3WS7A 3TL3A 3TF5A 4AJHA 1I32A 1PGQA 2X9VA 2I66A 4HWKA 5GZ3A 3I9LA 3JQAB 4CUJA 3PHHA 3UW3A 1UZMA 3DBHB 1K3TA 1TT7A 1U5AA 2NWQA 5L45A 4ZRNA 4LVUA 4IGEA 2EWMA 1YJQA 2C82A 2Q1TA 4TKLA 3U3XA 4XWYA 4DPLA 1I3MA 2BFMA 2YV1A 3HWRA 4K6FA 3OJEA 3DOCA 3K9QO 1PZFA 1SEPA 2O48X 4CQLB 2ZKLA 2DVMA 1E1KA 2OORA 3ENNA 3I4FA 3PYXA 3GH3A 3RFXA 3HG7A 3U5TA 4CMEC 3W8DA 4MVJH 2CF6A 4CUZA 4RLSA 3KYBA 3W6ZA 4CM9A 2NTJA 3DZBA 3UCEA 4K28A 5EINA 2QRJA 1QR6A 1HT0A 4IQ8A 5A1TA 2HMWA 5ICMA 2O3TA 3G49A 3NT2A 1KEUA 4UAGA 1LLUA 4J7XA 3ZDFA 3GZNA 4J4HA 3KV3O 1YGYA 3O8QB 3PP8A 2X6TA 4XYGA 5AXAA 4GH5A 1PJ2A 3OM9A 3EC7A 3GR6A 3DFUA 8LDHA 1HDGO 4DWVA 2HDHA 3C1OA 3E6AA 1A72A 3WYCA 1NPTO 1ZMTA 2G1UA 1I2CA 4R9SA 1MGOA 4TKMA 4PZEA 5JCJD 2WYVA 3SLKA 1UXIA 2GCGA 4TZKA 3JQ8A 4YXFA 2AHRA 4RPKA 3NGXA 1PR3A 3I6IA 4DYVA 5HS6A 3VVCA 4R3NA 3TZQA 5L4LA 4B4VA 1U4OA 4NR0A 1I30A 1NQTA 1OC4A 2NQTA 1PX0A 3VAZA 2O2SA 4CLEA 1H94A 1DC6A 4XKJA 4ZICA 4JQCA 4J16A 5F1OA 1VI2A 2YV2A 2RHRA 3B1FA 4E2XA 3F4LA 1DJQA 2E82A 3OF2A 1SZJG 1CIVA 1X15A 5JY1A 2GDZA 2WEKA 1NFRA 5DN9A 5G4KA 3GRKA 1NPYA 1YL6A 1ADGA 4ALMA 4A7PA 2B4RO 4YT8A 2DTDA 1PQPA 2XAAA 3QVTA 2P4QA 3JQ7A 4OMUA 4QT0A 1U2DA 4R54A 1UXGA 4OOEA 4JBGA 3K2BA 3LYLA 4XX0A 1EE2A 3GDGA 3TWOA 3BMQB 5ITWA 4MIEA 3OJLA 1LRJA 1C0PA 2DFDA 4AVYA 2OFPA 2NNLD 4CUKA 1JA9A 3GC6A 3AWDA 1EDZA 2C07A 1FDUA 3I83A 1CWUA 4J1NA 4RLHA 3OJOA 1LC0A 1PJSA 1RM3A 3PQFA 2WWRA 4IM7A 3ONDA 1DRUA 2C5EA 1ISGA 4EJ0A 1DXYA 3LVFO 1R4MB 4YJHB 1CRWG 1RPNA 1P45A 2VHZA 1UXHA 1VL6A 1Y1PA 4E21A 2X4GA 1GCUA 4CODB 3OA0A 4WCFB 3B1KA 4AL4A 1ADBA 2RH8A 2VZ9A 4GAEA 1Z6ZA 3HQ4O 1B7GO 1CYDA 2JD1A 1KBZA 1LDMA 1U7TA 4XIJA 4L8VA 4YAEA 4AJKA 3DHYA 1GPDG 4P4GA 1NYTA 5B37A 4G5HA 3DBLB 1Y7TA 3QWFA 3FTNA 2UDPA 2DTEA 3HFSA 2IYOA 4IS2A 4TRJA 5IF3A 4FC7A 4NBVA 5DP1A 3PRJA 3NJ4A 2DBZA 3JQAD 5ES3A 4NHEA 3TRIA 2P68A 3M1LA 4B4OA 3ROKA 2FSSA 1IOLA 3H2SA 1UAYA 4ALKA 3EVTA 1MXFA 3LC1O 3NRCA 2GERA 4NQZA 1PSDA 3CTMA 4MVJD 1E3JA 3WJAA 1O9BA 2AQIA 4BNZA 1EFLA 2P4HX 3IIEA 3PJFA 4YDRA 1VL0A 4FGSA 1YONA 3PHIA 4MKRA 4B8WA 2YZ7A 2BI8A 3JQ7B 3DR3A 1MP0A 2PFGA 1EDOA 1B3RA 3LF1A 3PK0A 4JNKA 4O6VA 4R41A 2O50A 4EUEA 1BWSA 3WBBA 5F21A 2QRLA 1EBFA 3ON5A 1NQAO 3OECA 3IKTA 1OMOA 4UVIA 4DC0A 2AE1A 1V3VA 4PGFA 4WLFA 1F14A 3NV9A 4BL5A 1H6AA 4B3IA 4EDFA 1C0LA 1BHSA 4JJIA 4R16A 4O5OA 3DMTC 3U62A 3MWDB 1PL8A 3OETA 5A02A 3AOEA 3B70A 2R00A 3KYDA 1WXDA 3CMCO 3GDOA 2O3JA 5FFFA 4EUFA 4NI5A 5JMWA 3Q2KA 1LSUA 3WGGA 2Q1UA 3RC9A 3RUFA 3ZWWA 1Y81A 4QX6A 2LDXA 3DAFA 1LX6A 1XEAA 3E9NA 4EBFA 2Y67A 4RORA 3IL2A 4D3DA 1OFGA 1T2DA 3HN7A 3F5SA 1R0LA 3K5PA 3JV7A 4Y67A 3OQBA 1GZ3A 5HA5A 2X0RA 5L7TA 5DOZA 2VNSA 1HZZA 5KTKA 4CM8B 4YJGA 3GFGA 3ZWMA 4IDDA 4F3YA 3WGQA 1VPDA 2PGJA 4QTZA 2O7QA 2I99A 2NVBA 5I8ZA 4WLNA 3V1UA 1R66A 3F6YA 1WMBA 3EYWA 4TSKA 1D1SA 4PLHA 4UUPA 4DLAA 4MVJF 2H5LA 2C7GA 2X7HA 2BI7A 2X0IA 3JQ6A 3D64A 4TVOA 3EZLA 4WOKA 1UDBA 1E7QA 4XRGA 5IN4A 1B8PA 3EUWA 3LK7A 3MJTA 3OJ0A 3FRJA 4IJUA 5LC1A 4E2YA 3CINA 1Z7BA 2LDBA 2P5UA 2NV6A 5IDWA 3AI2A 3I3OA 3IKVA 1SPXA 1NFQA 3AI1A 2VQ3A 1ZXLA 5A3VA 1WZEA 4XQEA 2GSDA 1KY4A 1ZUD1 3QWAA 2ZYAA 4KUEA 1C1DA 3JQBA 2OHXA 2OP1A 3DXFA 4YBZA 1C3VA 3ZU2A 5L53A 1HDRA 1I3KA 2W2KA 2PKRA 4ZGWA 3CUKA 3S8MA 1LLCA 3CH6A 5C37A 4KTTE 3DWFA 2H1SA 2CVQA 2X9GA 4B8ZA 1LQTA 4HP8A 4IMRA 4EYEA 2VRCD 2NADA 3GG2A 1V6AA 3CZMA 3TDKA 3ZGYA 1E1MA 1XCBA 5GZ6A 1UP4A 3PXXA 5FEUA 3KRTA 3FI9A 1ZSYA 3GN2A 4NK5A 3ASUA 5CDTA 1R37A 1QLHA 1EK6A 1GEEA 3AM3A 3MTGA 4PRLA 4YTEA 5JC1A 4JK3A 4PLGA 1LQUA 1RWBA 1SAYA 1XELA 2GN8A 4IMPA 2EF1A 4P8RA 5KVVA 3HDJA 3X2FA 4BQRA 1EUZA 4CM6A 1NTOA 4IZIA 3EVNA 3PI7A 2DM6A 2EP5A 1PQUA 3CIFA 3ROQA 3FTPA 5L7WA 3R0IA 3S2IA 1DSSG 1PQWA 2Y0DA 4GX2A 4H3VA 4KQXA 4ZHSA 4Q9NA 2EKLA 4CMJA 1UDAA 4IDAA 1Q1NA 3FHLA 2D0IA 4WLVA 3W8FA 1YB4A 3KYCB 1YDWA 2JL1A 2GZ3A 1DIGA 4RGBA 1B0AA 3HADA 3PLRA 1F8FA 1I01A 3KVOA 2NUAA 3FNGA 1QSGA 3AU9A 3M2PA 5MGBA 4J2HA 2W4QA 4QO8A 4K26A 1I36A 4DPMA 2O3SA 1BSVA 2FMUA 4BNKA 2O2YA 9LDBA 1AGNA 2XF8A 1P1HA 2IEDA 4BS9A 1DOHA 4RF2A 5LCXA 5A5FA 4HXYA 3I9JA 4UEJA 3UH1A 4H16A 4PCVA 5A4DA 4CMIA 1LDEA 2IXBA 3BIOA 4HV4A 3GNSA 2OP0A 1TEHA 3JYNA 3GNTA 1BDBA 1QYDA 3JD0A 3SBOA 2CY0A 1E3EA 3HFGA 2IE0A 4ND3A 4O0LA 3ANMA 3DBHA 3L77A 3NKLA 2AEFA 2RAFA 2AE2A 2VWQA 1GYRA 4PFJA 1I10A 2J5QA 3TQHA 5B4TA 1ENZA 3ROMA 1ZSNA 4RCVA 3IJPA 4CLRA 1F17A 2PZLA 3A14A 3I9KA 4UVDA 3RROA 2AXQA 4TVBA 3UUWA 1T4BA 1PZEA 3HNPA 3BMOA 4LISA 4KWHA 3GLQA 5CPBA 3EZYA 1WZIA 2PLAA 3D4NA 2WDZA 3ONEA 3EY4A 4GVXA 4ZRMA 1NVMB 4A73A 4CMGA 1X1EA 3UCXA 1E3LA 2WSBA 3ST7A 4B7CA 3AFMA 3ZWCA 1PS8A 2DKNA 1U28A 2CFCA 3B20A 5G2OA 3WYEA 1UP7A 3PGJA 1GZ4A 1LC3A 4YJFA 2NQ8A 1ZH8A 4PG4A 1XKQA 3JD3A 1IE3A 1M6WA 2HRBA 4ZA2A 1PWZA 2I65A 3H5NA 1YQGA 4OKNA 1QYCA 4RVSA 4PLTA 1ADFA 5FWNA 1GQYA 1D7OA 4NK4A 1YRLA 4E2ZA 3JYQA 2D1YA 2HO5A 3RASA 4BKRA 2Q2WA 4Y6RA 1HSOA 2VHXA 1I0ZA 2DBVO 4B7UA 4CLRB 2CZCA 1UR5A 3JD1A 4MVJI 1SB9A 5KVSA 4KWIA 2BFPA 3RU7A 2BHLA 3G0OA 4Y6PA 3IMFA 4DGSA 4BGEA 3UN1A 2R6JA 3IUSA 4I5DA 1AXEA 1CETA 3OICA 4Z6KA 5B12A 3VPGA 1N7HA 1U3UA 1KVTA 4HUJA 4UVGA 1IUKA 4AJEA 3CEAA 4QUKA 4RV9A 5DOVA 1Z45A 4XYLA 1QORA 4FJ2A 1XU9A 3PHGA 1NQ5A 5TNXA 3DDNA 3PYMA 4BNUA 3Q9NA 4CLOA 2DFVA 1YKFA 4JJFA 3UAGA 4DXHA 5DP2A 2VT3A 1QLJA 1JVSA 4PLCA 1LDYA 1NXQA 3MJEA 1Y8RA 5ENVA 3QE3A 4LCJA 2J5KA 4BO0A 3GY0A 2HQ1A 1DC5A 1DO8A 1UDCA 2E37A 1H0KA 2C54A 2DBRA 4FGWA 4U6SA 3KLPX 3T4EA 1CJCA 3X2EA 5A5EA 3UKOA 5HS4A 1HXHA 5EJ2A 1NM5A 1PJTA 1VJTA 3Q1LA 3VH4A 3AU8A 2PA3A 3ZH2A 2NU9A 4GLLA 4OJNA 3Q0EA 5ICSA 1TXGA 2Q4EA 4TROA 4XEHA 4JXKA 2WM3A 3MJSA 2PH3A 2X23A 5TS3A 4D45A 1DFIA 2FPPA 3C1AA 5ITVA 1LBEA 3JQFA 4FCCA 3BYZA 2BLLA 1JAYA 4LVCA 5IDQA 3WGTA 1CDOA 4N5NA 1IZ0A 1GTMA 3ZV3A 3ORFA 1JWAB 3FR8A 4IXTA 4WLEA 4YA6A 1BGVA 3ZV5A 1JKJA 4TWRA 3VPHA 2P9EA 1MXHA 5TSDA 3SEFA 2VN8A 4NH4A 2GASA 3DQPA 1AE1A 2FHSA 4WECA 4RVFA 4Z0TA 4HNHA 3PFFA 3TZ6A 3DZHA 2NU6A 3DC2A 4Z3DA 1GD1O 1UUFA 3BMNA 3JQFC 3KYDB 4PLWA 4ROSA 1KYQA 5L51A 3WX0A 2ZK7A 1P74A 1ZCJA 3LDHA 4IIUA 1E3SA 5DCUA 6LDHA 4GKVA 1PJBA 1R6DA 4CMCA 5CDUA 1UXKA 3WTBA 3WG9A 3ZWOA 1Q0HA 4ZVVA 1E1LA 2RH4A 4CM1A 1NP3A 2ZQZA 3IS3A 3HJAA 1I8TA 4FJ0A 2ZYDA 2W2LD 2YW9A 4XZ3A 2E48A 4ITUA 1YOVB 2EV9A 3L6EA 1VE9A 4J1TA 4L74A 4RF4A 4L75A 2O4CA 1WMAA 1NWHA 1WW8A 3RC2A 3H5RA 1QV7A 1HLPA 4DVJA 1KY5A 3GK3A 2Y1OA 1KIFA 5DT9A 1K6JA 4Z9FA 2QW8A 3LT4A 4L76A 3HUDA 2YFHA 4RVGA 1PWXA 2W90A 3HDQA 4XQCA 5K9ZA 1NVGA 2V6GA 3WFIA 2HMVA 3BMQA 1QV6A 2CVZA 3GF4A 4BHTA 5JC8A 2AW5A 4BO8A 3PJGA 1NQOA 3BMNB 1JLLA 3M1AA 4YJGB 2PK3A 3WICA 3A28A 4DREA 3LZ6A 5CG1A 2OBNA 5A04A 1LSJA 3PDUA 5T57A 3INRA 3H9JA 4Q3NA 3GGGA 3ITDA 3VZPA 1T24A 1LSSA 1N1GA 5COAA 4HBGA 4BV8A 3RC7A 5LDGA 5CPFA 2Y1DA 1UP6A 3NEPX 1GUFA 1JAXA 1P3DA 3JTMA 4CM8A 3GQVA 4BNIA 4O1MA 2B4TO 2ZJ1A 3RUHA 1VLLA 1K6XA 4GGPA 3S2EA 2ILTA 2JCXA 3PQEA 3S2FA 3VDRA 4MVJA 4HY3A 1YBAA 2PZKA 4CM4B 4LCEA 4XB2A 4AICA 1HLDA 1VRWA 5FI5A 3FSRA 4DPKA 3BTSA 4ONEA 2X5OA 3OIDA 3HSKA 2Y1GA 1HDOA 4MPDA 4ID9A 2W2KB 4E5YA 5CFZA 1ULUA 3PGXA 1PZGA 4HX5A 4CL3A 2PR2A 2AMFA 5G0SA 4JX8A 1EMDA 3NTOA 1BXKA 1Q7GA 1N92A 3JQCA 4II3A 4LN1A 4PVDA 1A4UA 3RJ9A 4Z3KA 5JAIA 3F47A 1J5PA 2JCYA 1E3WB 4MVJG 3SX2A 1G0NA 2OUIA 4BNLA 4GX5A 2V6MA 3DOOA 2EKQA 2WYWA 3SC4A 3NTRA 4R5HA 4FOSA 5KWEA 3KYCA 5DBIA 2PGLA 1U5CA 1M6HA 3SJ7A 2DT5A 2I6TA 5U4QA 1D3AA 4PLYA 4JIGA 5L3ZA 4BO3A 3VH2A 4HFJA 2R2GA 3VPFA 3G1UA 1VL8A 3JCZA 5TT1A 5ILGA 4J7UA 3U49A 5C7IO 3IP1A 1DDOA 3WGZA 2JFGA 2ZB8A 3TFOA 3FPCA 3ZCXA 3FR7A 5C7LO 4OO3A 1YVEI 4FFMA 4OM8A 1Z74A 4IPTA 2X8LA 4FFOA 3V1TC 1E7WA 1ONNA 1TA4A 2GD1O 3GN1A 5EESA 3V1YA 4U8GA 5L95A 5I9MA 3NDJA 4E5MA 3FD8A 1ZKMA 5CAEA 2B4QA 4A2CA 2JCVA 4I5FA 1RM4A 3AFNA 3W6UA 2CSUA 5I7EA 5KJ1A 2J8ZA 3RCBA 1EEHA 1C14A 4JGBA 3CPSA 3KEQA 4DL9A 4Q3AA 5CDGA 4E32A 1SCUA 1LDNA 3GAFA 3GPIA 3W4IA 1H2HA 1Z7EA 2Q4BA 1Y8RB 3INTA 3KM0A 1K89A 1MFZA 4IDEA 2EJVA 3ZWAA 3ZU4A 2D8AA 4BB5A 3ZU5A 2IZ1A 1PS0A 4AG3A 2RCYA 2P5YA 4PLVA 4KOAA 3ZW9A 5JO0A 4WCFA 2A35A 3AUSA 5TIIA 1YQXA 4OOFA 5JYEA 3I9OA 5K0ZA 2B35A 4WNIA 1BXGB 1U2GA 4ILKA 1I2BA 2Y93A 1MLDA 4IY1A 1DRWA 5EN4A 2QZ9A 3D4OA 5JSFA 3WOHA 5AYVA 1B3BA 4OQYA 1TB4A 3IDSA 1LLDA 1T26A 4R5MA 3WR5A 1P44A 4CQMA 1UZLA 1M67A 3RWBA 4YRBA 3FNEA 3HB5X 4RF5A 4W82A 1A7AA 2C20A 1DAOA 4NBUA 2HJSA 3QVWA 3Q3CA 3BHMA 5A9TA 4J0FA 3WFJA 2X0NA 1TT5B 2WTBA 3DMYA 4NJOA 4QQRA 5L4SA 3I1JA 3CSDA 3F4BA 1LLQA 5DBGA 4EUHA 5G4KB 3LLSA 3H3JA 5COBA 2I3GA 3LF2A 2PH5A 1C1DB 4A0SA 4FFPA 4BNTA 4CM3A 1MA0A 1PGPA 5HTOA 3WQRA 1ONPA 2JJYA 3ETGA 3QWIA 4YB8A 2HMUA 2AQ8A 1E92A 1ZFNA 2EKPA 4KZPA 1M75A 5EQFA 1JTVA 2RBEA 4FN4A 1A4IA 3VKVA 1HRDA 4PLFA 3WLFA 5JXWA 2XXJA 3RUIA 1DRVA 2ZB4A 4ALNA 5KOIA 1ZZEA 4XGKA 5K6AC 4CMBA 4HFNA 1X7GA 1B16A 2J3HA 4IQGA 4JP2A 3ANLA 3D5QA 3ZI0A 1Z73A 2GYYA 3KSDO 4ESOA 4BNNA 4OXNA 4KUHA 5TRTA 4PG5A 2PNFA 4YJHA 4BMSA 4IZHA 4BUCA 1T2CA 4I9UA 5BNTA 3TZKA 4CQMB 2G82A 1UH5A 3M6IA 1ADCA 4Y98A 4H15A 2PY6A 3C7CB 4EJMA 5TLSA 1H6CA 3BHIA 2P2SA 1U9JA 2EW8A 5H82A 3HE3A 3PFWO 4E12A 2X0JA 2PD3A 5IZCA 1BDMA 1YH3A 2EERA 2X22A 4ND2A 3I9MA 4URFA 4ALLA 1SC6A 5JPIA 4GX0A 1E7YA 1U8FO 1Y8QA 3EGOA 4Z9XA 2YQ5A 1X0VA 1YO6A 3PYLA 4I5EA 2BGLA 4Q39A 1SBYA 3GA0A 5LDHA 5TJHA
chains in the Genus database with same CATH superfamily
4DRXB 1UM8A 3QBTA 4XB1A 4MS4A 4BMPB 4O5AA 2NUTA 1N0HA 1T3TA 1Z17A 4KQKA 2EFJA 5DU2A 1C2TA 1Z38A 3ZX4A 4IDFA 3RHSA 3K05A 4LFBB 1CZNA 4EEZA 4HQ0A 1TW3A 3ZZMA 5ADWA 1I14A 2WTUA 1HOTA 2PLNA 4EW6A 4F6LA 2XR1A 5HZGA 2JJQA 3L7OA 4D0GA 3K4PA 2CLDX 4Z9AA 2O4UX 2B8WA 2XNSA 3DZGA 2IBTA 4FNOA 4F0JA 1FP1D 2PJRA 2P9JA 2EG5A 2VOEA 4OK3A 2ZUFA 2JCBA 3WLTA 3OZBA 3W2EA 1LI4A 3QA9A 4P38A 2ANCA 4AYWA 4B6FA 1H3FA 1QAOA 3OY2A 5JJLA 4YDHB 2ZTSA 1NMEA 3AR2A 2IXGA 3RRYA 4NCAA 1EFVA 1Y42X 2G63A 3CKMA 3G23A 1YMUA 2E4YA 3OJFA 1GG9A 5DYIA 3H13A 1X9GA 4FCWA 1CZOA 3COSA 1A4RA 2I6FA 1JU9A 4BVEA 3C7AA 1T2FA 3RJ5A 1U1IA 3DOJA 2QN3A 4LC1A 2GPBA 4B40A 2XCSB 1VB3A 3QW2A 1XEXB 3ZBTA 1VLZA 3MTAA 3WP1B 4YJKA 1UF9A 3C24A 3Q1KA 1NWCA 3A9SA 3JWIA 5HCIA 4I5GA 3U48A 2PIAA 2YJ3A 2W43A 2M6RA 1F12A 1PR9A 4QM7A 3FKJA 4HAUA 4V2IA 1YCDA 4MGYR 5EQDA 4A0GA 4YMTA 3WKDA 3HJFA 3U16A 1KHHA 1SA0A 2Z30A 3F8SA 3LU1A 5JOQA 4A15A 2D1TA 4N7RA 5DX0A 3ZDBA 1LPSA 3M49A 5ANRB 4BNFA 4DG5A 1MW9X 4LRSB 1X1TA 1KBOA 2C31A 3O8OA 2ZB3A 3IELA 5CG2A 5I7FA 1XPJA 3P71T 1E3MA 4QPNA 1T6BY 1M6YA 2Q2VA 3N58A 3RC1A 4GGOA 3UFBA 2VCYA 4XSVA 1RWOA 1YZHA 4DG8A 3ORSA 3REFA 1ISJA 2ESRA 2ZITA 4BJHB 4UEOA 2FQXA 1J70A 4XYEA 1EKXA 2V0GA 4NF2A 1FDSA 1Z2OX 4OXKA 1QK4A 3L4EA 4AP5A 2Z5LA 4EG7A 2Z98A 2DHCA 2WYHA 4XJSA 2HN9A 2GVDC 1Y5LA 2YJZA 4EG5A 4K6OA 4R7ZA 1ZHHA 1AXRA 1NV9A 1CZUA 1I2DA 1WTCA 3C3WA 3Q11A 3TK1A 1RQ7A 3PRHA 3IAS6 5D3QA 4A8HA 3OT1A 1LPNA 4HVCA 4S12A 1PL7A 4MVJE 2CXXA 5BSKA 2PXAA 5JTTA 1TM5E 1E7SA 2DHQA 1IBCA 3ICEA 4RXTA 2GS9A 3EZ2A 3OTIA 3DVQX 3EDMA 1ZSVA 1JXAA 4XSGA 4RD6A 3WGLA 4OYLA 3CC8A 4DDMA 3LQQA 4Z0HO 4EKEA 1ZM9A 5L3SA 3GVCA 4DR5B 3PBKA 4YP0A 4Q01A 3ZVMA 3CVYA 3FNFA 3RAEC 3MHPA 2ZOSA 3KJQA 3BA6A 3K20A 2GJ4A 1SKMA 1V37A 1LJ8A 3IR7A 4D7AA 4WN9B 2DPMA 4GRAA 1IQ0A 3VR6H 1F2VA 2BFCB 4YMIA 2BGTA 1IHYA 3OIYA 4P98A 4GRDA 4LFAB 4GRIA 4BY9E 4OGFA 4BATA 5KX5A 1OLXA 1WV1A 4X64B 1A5AB 4W1PA 4DIMA 3QFFA 4H7KA 4MYHA 2E7ZA 1SVMA 2VBIA 2XMBA 1XQYA 3O3OB 4ND6A 3WXMA 3L8EA 3X0DA 2ODEA 2QT0A 3R7DA 3QU9A 4X0EA 3E22B 1XT6A 2NTVA 3MTIA 3SZUA 5IKMA 4RZUA 3J7AC 1KVRA 5DTMA 1H85A 3AYXB 1M6VB 1R0KA 4FINA 2E49A 4P80A 2J6IA 5T6MA 3WQSB 3CCBA 3JZFA 5A03A 5KNDD 2XEDA 4YMHA 1J39A 1UIRA 4FZRA 4J0KA 4URXR 1ZR2A 1G9TA 1P9LA 1ZXBA 2VYVA 3MERA 3PEVA 3PVCA 3TB6A 4G3XA 5D6NA 4TTQA 5FPKA 2ASVA 3WNQA 4YAGA 3GP5A 1GIAA 5CYPA 2P62A 4LRXA 1QM5A 4BKMA 4JI7B 4O2BA 3L8CA 1U7PA 3IPYA 4RVOA 1UIMA 2PCLA 1OV6A 1DBVO 4IZ6A 3HA5A 4JB3A 4Q18A 4R8VA 1EDDA 1RQNA 4L8FA 4L9AA 3CNNA 1W4ZA 4NWIA 5TXGA 1QIKA 3P8ZA 5DB4A 4CLHA 1GPBA 4KQFA 3TLCA 3WJ7A 5CD9A 4OB8A 3SDSA 1DAEA 3ZZTA 5DGXA 1YQTA 4MV5A 2O8BB 1Y1RA 1KFJB 4KO4S 4R2HA 1A7KA 4HH1A 3UK0A 4DQXA 5HILA 4CIAA 2FRVA 1E1CA 3D2AA 3NKFA 3FM9A 2VSQA 5IXJA 3HWX1 1RCFA 2VUIB 1HURA 3CBQA 3OSZA 2ZAMA 5KSPA 4D9EA 5JH7A 2G0TA 4JYAB 3M4ZA 2GZRA 5DTRA 5FCDA 3KEOA 3FYSA 3G13A 2IKQA 2YHIA 5F4BA 3T9BA 3BA1A 1JT2A 4R6WA 3ZS8A 1HDEA 1HFJA 1JQ5A 3WDLA 4B71A 1A7JA 3RADC 2JLVA 1AJEA 1AS0A 3GPDG 4JLVA 4BDSA 5IYZB 4QLOA 1PDVA 4PG6A 1EQ2A 1E0SA 1OLUB 2ANBA 2C2ZA 4DDVA 1AS3A 2B2XA 2PV7A 3CCFA 2BFBB 4EHDA 4JLDA 3A3PA 3RS7A 2I5PO 5DW3A 1KJJA 3SBXA 1GPLA 1PT9A 5K0LA 1BA3A 3BBLA 1R74A 1WDWB 5FTKA 2YINC 5CCEA 5A05A 1AURA 3K9NA 3GJRA 1I3NA 3Q5GA 1K7SN 5FI3A 4H6PA 4YT2A 1O1YA 3FLMA 4JA0A 2HRZA 3O3NB 1UJBA 4HGNA 3DKRA 1FW8A 2R47A 2PXXA 3CO5A 1J0DA 2JVJA 1Y7PA 2RAVA 2QORA 3DL7A 4FIZA 5D7NA 2B94A 3T4PA 4QLBA 3VR4D 3ZWBA 2BELA 2WICA 2BDTA 5E3IA 5JWHA 4EZEA 2IOFA 4EF5A 3ZVLA 3UB3A 1OX4B 1L5OA 2H4JA 1XEXA 4G0NA 4C01A 1DKLA 3I92A 4ZYXA 4Y1RA 2O1WA 1KP2A 4JLSA 3SU8A 3WA6A 2RI0A 2K7FA 5DNWA 3LT2A 5EKXA 2PX4A 1D5CA 3OHPA 4W6QA 2C0PA 3D5TA 2HV9A 2RJOA 2JKZA 3DOUA 5E38A 1NBMA 1ACLA 3ACBA 3AHIA 2AN5A 3FYUC 1WZCA 3NDRA 4IIHA 3ZIDA 5BXQC 4J1JA 2FUEA 4WZBE 3QE2A 1U9YA 3KJNA 3BQMB 3MWEB 4KITB 1H3NA 1X1SA 3PKJA 1Z16A 5HK8A 1FU7A 1EP2B 3ZHOA 5F12A 1Y4ZA 3EEQA 1WR8A 4C7JA 4QBFA 3R6LA 5E8RA 5T8KA 4C30A 4MUHA 1D6JA 3M7IA 3IOYA 3DFFA 4YJFB 2POCA 3CO0S 3NALA 5HEKA 4M83A 2H1OA 3CRRA 3DE5X 4MW1A 2QTAA 1GNLA 1FX0A 1V8OA 2JIQA 5EWJA 3CNBA 4OSOA 3D3NA 1EE9A 1OXVA 2VP3A 4HUQB 2V03A 4QQNA 4R69A 2D5LA 3L79A 1LF5A 4RDIA 4PS0A 4J7CA 4OHUA 5FFNA 3ZDRA 3V97A 5ICGA 1R16A 5JD6A 2DQYA 4BNJA 1KK2A 1I5OA 3BIFA 1Z6GA 4KBYA 4YRCA 5T7BA 5ECWA 4WPGA 3EIEA 1IYZA 2FP4A 2O3QA 2CFRA 1NN1A 1JFFA 3JAWA 2DKFA 1KRWA 1ZITA 4LQDA 5BWLA 2QTBA 3R23A 4QAQA 1CRLA 1BWPA 1L8AA 1N0WA 2JIBA 3D8BA 1A5TA 2H51A 5IAGA 3W3AH 2HRQA 5AVXA 5MFPA 4YPVA 3QPUA 4ZIRB 2KLHA 1KMNA 4M76B 1NSYA 3EGVA 1SVUA 5JZMA 3U61B 1GO2A 3HKBA 3T35A 3VYSB 2D5IA 3TUJC 3OZXA 2WSSA 1FP7A 4QJ3A 4EWLA 2IEBA 4K46A 2B3DA 4Y8VA 1QYRA 4HNGA 3ICPA 3NOVA 4JAVC 2NXNA 2B69A 1EHCA 4Q3CA 1A69A 1ARZA 4MGIR 1RPTA 2WVHA 3IR6A 4AN4A 5JIBA 1KTIA 1NF2A 1OOEA 3WMFA 1V7ZA 4C6TB 3EUEA 1F2DA 1AO0A 3M34A 1L4GA 3NP9A 1YBFA 4HI0E 4L5JA 4UUOA 4RF3A 2BI4A 2WJHA 3A3KA 3HUFA 5CHYA 4FD3A 5LJIA 5B7NA 1NRXA 4MDFA 4LRWA 2OAP1 3B9QA 4PTZA 3E27A 2FPWA 2R1VA 5DNEA 4LZLA 3UCFA 1V5WA 3NOQA 5JXJA 2IYSA 4JKIA 5EJGA 1W4RA 2JHAA 4MHSA 3M6LA 4QKQA 4IH9A 4ZD6A 1WLYA 2C7BA 3N07A 5BMVF 2EFCB 3E8XA 2GD2A 1HEUA 3FCYA 3RHZA 1XLWA 2P2DA 5DLDA 5B1YA 4IMJB 5JAZA 3V2GA 2IL1A 1CJUC 1WSAA 3HZZA 1PV4A 4HK4A 2E4XA 3I73A 3PENA 4OJKA 4YACA 4G0OA 4LSMA 4OA5A 3TTSA 2QTFA 1JIXA 3SFVA 3AINA 5K0GA 3ZY2A 4MQEB 1DL5A 1Z8HA 1RI1A 4R1LA 4QTYA 2PRSA 2WSLA 2N1BA 3JW8A 2WP8J 4ED9A 1T1SA 1SUPA 1R4NA 3VR2A 4IDNA 2WKRA 5LQMA 3VPBA 4KQ6A 3OQMA 2CVHA 4G4SP 1RZUA 5FLYA 2ORYA 5BNWA 2XYGA 2A4KA 1W8IA 3PUVA 1GGVA 2XHZA 2O8VA 2YV3A 1N3BA 4B81A 4E30A 2W2LA 2V7XA 3EGDB 2OBYA 2AD1A 1RQ2A 2A7XA 2WD8A 4LS3A 3EDYA 1CT9A 2XE6A 1UK9A 1HNNA 4M7PA 4RQBA 3QTTA 4Y9DA 4BVLA 5IULC 1OBOA 1L4EA 1CQWA 4CMIB 2DETA 3O2NA 3NPMA 1PR0A 4QVKA 2G76A 5SV2A 1QONA 4PZDA 3DUFA 4M53A 3MZ0A 4C7KA 2XNDA 1D2GA 2C7RA 3V1NA 1H5NA 1WVIA 2LXNA 4BOYA 3FMFA 2QIOA 1F06A 3OMWA 1MX1A 2GFHA 1J99A 3CRZA 5F1YA 1Z6QA 3GP3A 4UUMA 2H29A 1QF6A 4EELA 1CFJA 1N2EA 4Q12A 4DR1B 1FYEA 1HA3A 2I2DA 3R0VA 2VK1A 3ZE0B 1E9CA 3UJ9A 4D4LA 1ZNXA 3G0DA 1GKYA 4XJXA 3VXKA 1UKAA 1I5RA 1HDZA 2EATA 2Z9CA 5ERXA 2P91A 1JHRA 2FSVA 3DMDA 4G0YA 2ZUDA 2GTIA 3TNYA 4JBXA 2IODA 3HCCA 3KQUA 5D1NA 3AY0A 4TVKA 2R66A 1KU6A 2GM3A 3LUDA 5LA6A 1BAPA 1RHUA 2GDJA 1EVYA 3P9XA 1JB9A 1JW9B 1QHFA 1T0BA 2D06A 3AUAA 3QVXA 4N54A 4NENB 3PPXA 1RRKA 821PA 3A7DA 1QKJA 4G89A 2IT1A 4G0PA 2SKCA 1X0XA 2QZPA 3DTTA 4IHKA 3NHLA 5JHHB 3JALB 4LHEA 2IWRA 4X7MA 2JFQA 2QQEA 4FMDF 3MMZA 3QVSA 4M8KA 3BCRA 3KZNA 5DGHA 2FPRA 4BNYA 4F38A 2RHLA 2IXAA 3GLIA 3T3HA 5AQ1A 1C80A 4TRRA 4AIIA 3PNMA 2FNAA 1WSBA 2BJWA 2FW9A 3D6JA 1KIMA 5IG2A 3GFVA 4G09A 5JRDS 1DU4A 1KE2A 4HUQA 3PKZA 4MLPA 1YDGA 3LL4A 4X3CA 3GROA 3ZQJA 3BZUA 1SNYA 1VMAA 4XIYA 1V16A 5BVHB 3TQQA 1SCBA 2I4NA 2ASEA 5AXCA 3DCJA 3AVWA 3DKVA 3GAZA 2OBFA 1C41A 5ER6A 3SSNA 4OEHA 4FMDB 1O5TA 1PIWA 1E1RD 5A0VA 2XQJA 3QFTA 2AQHA 2D0OB 3IDAA 3SC2A 1II8A 1FL9A 3E7PA 3QYFA 4QUAA 4HRYA 3RSCA 1CEEA 1PNTA 1YA8A 2DSTA 1YJ5A 3MXTA 1D9ZA 1LBIA 1NAHA 3ZNOA 3R3SA 2OESA 2FHPA 4EHFA 4YGYA 3EZ7A 3U4GA 2GZSA 4CMKA 4TZ0A 1DIAA 1K6EA 1OE0A 1V0JA 1VP9A 3MQ2A 3N87A 3NFRA 2J85A 3M70A 4AMYA 2IUTA 1QMPA 3DBVO 5AI5A 4QPZA 4F71A 5CTJA 5C1IA 4I36A 4PO9A 1DBSA 4BVFA 1O08A 5FOSA 2XDYA 2QL9A 4NZZA 1KBQA 1K86A 4O63O 5HRUA 2C5SA 2KJQA 2PGAA 2BHTA 4IP0A 3GT0A 3DVSX 4R68A 2P9CA 3IP8A 4HYQA 5BNIA 3ZDCA 3RT1A 5IAAA 1Z47A 3F3SA 5C8XA 4TV9A 1I2ZA 2GNAA 4AU1A 2B7LA 2QLJA 1M76A 2Y1CA 2BMFA 1C7EA 4I9HA 3BK1A 4YJ3A 3RYIA 2R7NA 4IIDA 5BSFA 4CU2A 2PYDA 3BXXA 4JSYA 1SU6A 1P91A 4XWKA 2UZ0A 4QDKA 4AC9A 1ZL0A 4KTVE 4W63A 2NAPA 4DSUA 4JROA 4XQ0A 5KINB 4Y2JA 3UOWA 4G1VA 1Z4QA 4JYPA 4YRRA 1USVA 3K35A 4KX3A 4LDPA 3V9PA 2WG2A 3IAUA 4L0QA 4WY5A 2FF7A 1S1CA 4CDMA 1FSFA 3WB1A 2PKQP 1K92A 2H52A 2ZT7A 3MMPA 3T06B 4Z54A 4R81A 3AO0B 3IPCA 3CURA 3N8KA 8LDHA 3W5IA 3HKCA 3D2CA 3V7YA 4D3FA 3AIKA 3PITA 3WSVA 2E1RA 2FSVC 1YXMA 2I8AA 4EBBA 2BFAA 3K7EA 4TT3D 2BGKA 1J2UA 3ESCA 4EH1A 3AHDA 5CDFE 1M1YA 3CF2A 1RYFA 3KKQA 2DPGA 2XGMA 3BB4A 3HB4X 1OZHA 3OU2A 2FOIA 2IS2A 2G9NA 3S55A 2XVAA 4OI4A 5AHRA 4DNPA 4CL8A 4D02A 5DH9A 1FLAA 4O2AA 4WVFA 3DAPA 2O9JA 4DIEA 1LFDB 3AW8A 2QYHA 3PWSA 3KT3A 4OSEA 3GL9A 1L6IA 2NSYA 2ZUEA 5JDIC 4B6OA 1ZJWA 1WW2A 2Y0EA 4JP5A 4FBLA 4PYRA 5AKZA 3AONB 3G8CA 3OMXA 4AWBA 1S8AA 1MO2A 3H87A 2WFMA 1H22A 3VO8A 1Z33A 1KI6B 3VPSA 3AJRA 1U7XA 4X85A 4BZZA 1E2BA 2QN1A 1B2LA 1T4DA 2LIVA 1H6DA 4OFBA 3CPJB 2BH9A 2HHAA 3G8BA 4JQOA 5ALPA 5EUCA 5H7XA 1JJ7A 4EECA 4J4BA 2O6LA 4NL4H 1V1MB 5J47A 1DV1A 2YS7A 3L07A 3UF0A 3KTFA 3ROPA 4PZ0A 3WP0A 2G9QA 3KG2A 1A5ZA 4NAUA 4Z2YA 4FEEA 2W00A 4QG7A 3SY8A 3T3PB 1NY6A 1ZGHA 2HBRA 2R1TB 3NTXA 3RGWS 4WFKA 1E1QA 5AOCA 3WLOA 1T9ZA 2MWMA 1MFPA 2BGMA 4BNMA 3LIPA 1HK7A 2XSZA 5CJJA 3V34A 4ZT2A 3VU9B 3WZMA 1A9XA 2EDAA 1CBUA 1M2EA 3NNSA 4CKCA 3H1AA 3EFEA 5DHPA 1FXWF 2VZLA 3HMKA 3ODPA 5ITSA 3PR3A 2YJ6A 1GQ2A 1ABBA 2CB0A 3QLEA 4C08A 2FEOA 4Q0MA 3O1LA 3W9YA 4E09A 1ZH4A 2ZS8A 3ESRA 1U8AA 4UU8A 2EBUA 3AR9A 4Z4CA 1LZKA 5JCJA 2JI6A 2QN8A 2YDYA 2CLEB 4NMHA 4B3RB 3OX3A 2OHVA 1C3OB 3F78A 1UPAA 5FF9A 2QJFA 2ZRDA 3IOMA 3QFRA 4ZQEA 1RVV1 4PZYA 1ZK3A 4BC0A 1IFXA 1BGXT 1RAGA 4RADA 2IV7A 2PU7A 3KR2A 4B3JA 4E22A 4Y6OA 3RYCA 2VTDA 1FU4A 2B8EA 2O20A 1I5EA 3IUMA 4ZQHA 2Y27A 3UJ7A 3ZWPA 5HIKA 1VFNA 4R2IA 3EEBA 3ETDA 2DPXA 3TQTA 3UOGA 4LOAA 4F4HA 1CIJA 1ECCA 1U4NA 2Z2KA 2Q3JA 4V0LA 2HC9A 5KSZA 3L0CA 1RABA 4DWJA 3I09A 2A3NA 5DNAA 3DTYA 1PNQA 4EG6A 4PXAA 3PDWA 2O59A 1P8JA 2BBOA 4KREA 1NQXA 1DOAA 5HFAA 2G5GX 3RFVA 3SLGA 1YKSA 2JD2A 3D8HA 1ZM2A 2BKAA 2P2CA 1C7RA 2D3TA 1QP7A 2IP2A 4RSRA 4NU6A 3PIIA 2JGIA 4PONA 5KC8A 5LMZA 2P0AA 4TT3A 4WK6A 2EU8A 4H31A 2NM0A 5GMOA 3K70C 1MG0A 3GPCA 1MB2A 2EIHA 4JYBA 1ZGGA 3MIIA 1X8LA 4YLEA 3W8NA 4M49A 1W36B 4CKEB 2WYUA 4Y2VA 1UC8A 4ZN6A 3G2IA 3I04A 4RELA 5B3KA 1C0IA 3K0AB 1NT2A 2HIGA 4KN8A 4LI3X 4RM2A 5K4AA 4QHSA 2R3SA 1H65A 1XQVA 4DMGA 2YRXA 1PJCA 1QG0A 2Q1SA 2IRWA 1ABFA 2ZCVA 5K8IA 3T7CA 2LV8A 5B1DA 1Z63A 1UWKA 2EBWA 3VJKA 3C3XA 3JU3A 3G7SA 2B1GA 1B93A 2WMNB 3TLZA 2BHNA 1GRRA 3P0HA 4OHPA 2Q7OE 5MHTA 1D0IA 1ZK0A 2G9UA 1YE3A 1YQUA 5G1NA 1KMHB 4R4JA 2NSDA 2JDID 1NF8A 4PCUA 1F2TA 2I1LA 4HQKA 4MZXA 1M5RA 4Y1FA 3A27A 3DOFA 5F9FA 3S2ZA 4CLDA 4D8XA 1FFXB 4TMTA 7ADHA 1G8FA 1YZGA 1SIOA 3EIUA 3YASA 4IINA 4YI5A 4M6WB 3MT9A 3GYGA 4NCIA 3ZV7A 2Y3IA 2DEUA 4KYIB 3CRNA 4MQFB 1PRYA 2BVNA 1Z39A 5FL3A 1PYOA 2G8LA 2C5HA 5DLYA 4BJ6A 1JSLA 2B83A 4YX9A 4MRRA 1X2EA 5BQ3A 3DEHA 3V1LA 3L9XA 3PF9A 3WGNA 4CR6A 2CLKB 4O3MA 1E96A 5KTPA 2JFWA 1O94C 2QAGA 1XZEA 2QYSA 2PE5A 1YUMA 2J46A 5EE1A 1U8XX 3ER9A 1JWLA 2BM0A 2WT9A 2HHCA 4IH4A 3WMXA 3MS7A 3FW1A 3M4YA 4J6EA 4R1NA 4CKXA 1VPLA 1TJNA 4KQHA 1YDMA 3FNRA 1KZ7B 4EHHA 3ZZ0A 1Z5ZA 1RYNA 2RGUA 4KQGA 5E6SB 1C1HA 2WA2A 2VJAA 4BNGA 5IJXA 1K7FB 4U2KA 2UXBB 4FYMA 5DDIP 1TJ5A 3LYHA 4D9IA 2J9GA 1E99A 3I2FA 1D1TA 5SY6A 1EWYA 2AF3C 5F33A 1DAMA 4Z4IA 1OFHA 1WUJS 6ADHA 1O94A 2Q21A 1VSTA 2J3IA 4EYSA 2FZWA 1GY8A 4GSLA 2XA1A 3QFHA 1O57A 1T4GA 5LXTB 1JKXA 1FMCA 3LT1A 3KTAA 3UFXA 2IPNA 1ZUNA 3AUJB 3LDUA 4Q1FA 2BY4A 3SQMA 3EXEB 4YRTA 4OL9A 1UBLS 4UBLA 2WJ4A 4XM2A 4WJKB 4X60A 1PF7E 5CYOA 1JLKA 5BN4B 3V7FA 3VC3A 1DG3A 2UVPA 4RKRA 4YMWA 2P6UA 4J03A 5D84A 3VKUA 3PD7A 5KJEA 2PRJA 3ESYA 4E3WA 1Y37A 5JPDA 4U2GA 3UUFA 3H97A 3WQBA 5A3SA 1BVRA 2FMIA 3IUPA 2K5UA 4R2MA 3TTVA 4XTCS 1V4VA 4B3HA 5HBGA 1KI3A 2VJMB 4XWGA 2OBBA 2NQ2C 4N76A 3L0DA 5C1PA 1ZD2P 4PPYA 4F45A 1AVTA 3DL2A 1PFKA 3V4OA 3EMDA 4PVCA 4DHWA 4C88A 4KQ9A 3PHLA 3IMGA 1JE0A 3BIWA 1YULA 4JU9A 1E6MA 3HCBA 4HQLA 2HR1A 4ZQBA 5AW6A 2HO4A 3WK9A 4JP1A 1A95A 1U3WA 3M3DA 2YFQA 4FDUA 3ZQ6A 2GRAA 1TGYA 2MSLA 2QXTA 2R7KA 2ZE7A 1EQUA 4MRAA 4CF3A 1X14A 3H65A 4K3VA 4F86A 1JEQB 5ALOA 2WM9B 3TE7A 2NT4A 4A6DA 1XQXA 2C5BA 3HCPA 1EVKA 1CUUA 1K5PA 3IX7A 1VM6A 1OYOA 1Q7BA 2YDXA 4WNCA 1W0KD 4XOUA 4WFQA 1SOAA 3FKSD 1L7EA 2B0CA 1C9EA 3BXZA 5DX8A 3WL5A 1Z4IA 3OZTA 2XOKD 4EW2A 4GVLA 5K01A 4KO1S 4MQFA 5I8WA 5KNCD 4KPGA 4N6GA 2XUPA 3RG2A 4W8GA 2J1LA 1LSOA 2B8TA 3EAGA 2QN7A 2A5FA 2J33A 3ZCRA 4C6HA 2UXCB 3NDIA 3G5MA 4MIOA 4J3NA 3ZXUB 5E2BA 5LP6B 1L3CA 3QHAA 1XD2B 2D1RA 2TMDA 2VA8A 1KEZA 4HYTA 1MPXA 2PKQO 2ES4A 3ZK7A 1YA6A 2BGUA 1BXGA 1ZRMA 2F3SA 1EAYA 3OZRA 4BGVA 1QPBA 1V5FA 3KQWA 4ZCTA 2CBXA 1QG6A 1PLJA 3RS2A 4BWGA 4J43A 4XYBA 3WLRA 3EZFA 4RK1A 1IQUA 3ZHBA 1F7UA 5JCPA 1K5HA 2VWHA 1U4SA 2BP7A 2WJ3A 5B3LA 1XHLA 1C1XA 1T3HA 2W6ID 1JHZA 1VJGA 3P4UA 5BR7A 1QGDA 3MBKA 4I2VA 5FUYA 2MIIA 3K5IA 1GUZA 2IOHA 2R8YA 1CEYA 1QPGA 4EVRA 2P67A 2ZPAA 1GVNB 4IBOA 5G40A 3NDBB 3U9LA 2ZM6B 4L4SA 2WOOA 1NVDA 1B43A 2XCLA 4IJWA 3UA3A 4E14A 3DBLA 3DONA 3SFZA 4C2UA 1FP2A 3IBSA 1UBRS 3IBCA 3SKYA 4LJSA 3P2EA 8ABPA 2NXJA 4J16C 2ODAA 4AUKA 3Q2OA 3D3WA 4UBMA 4QEDA 4YJDA 2FY8A 1Y9JA 2AN3A 2FN3A 3JR7A 1M54A 3KOMA 1TVCA 2QPLA 4MRSA 5EZYA 2H6EA 1TA9A 2HWUA 3PL1A 1SCDA 4JT2A 3DC7A 2NOAA 3TTTA 1M1ZA 1KORA 1LNQA 3ZE8A 5C35A 2LBPA 3COWA 1HQKA 2PLWA 3U9SA 2PU5A 1TQ8A 4QL3A 1SELA 2O8DA 2WJYA 1JSXA 2Q4RA 2R68A 4IUYA 4UHJA 4PC3A 4HEJA 3I58A 2WVGA 1RCTE 2G09A 3PT9A 2CNNA 4WKPA 1GPYA 4PSCA 4D8TA 3GCZA 5EHIA 4D4GA 2M6SA 3NXKA 4HJXA 4UBIA 5D01A 4NFHA 1JEEA 1YK1A 3WRWA 4MS3A 5JXHA 1ML3A 1MB9A 5AOVA 1X7DA 1KWGA 4NU5A 4WCFC 5K8CA 4KRFA 2DH5A 5BRAA 1KO4A 3ABZA 3HCAA 2GN1A 2GI4A 3LSYA 3FA2A 2LTAA 1P1CA 3MJ4A 5JYBA 2CN1A 5FLEX 4EDHA 1ZJ4A 1NFFA 1V47A 3UHPA 3MWLA 1BD3A 4IHJA 3A1CA 5K0CA 2NU6B 4PS1A 3A8TA 5ALKA 1XA0A 4MGEA 5FWDA 3UAWA 2F90A 4AZ3B 2DKOA 3M9WA 1GV0A 3ZWQA 2PG3A 4EB3A 4GPIB 3AG6A 3KT8A 2W2PA 4XIFA 2DX7A 1LNZA 1W8DA 2OZLA 3K73O 4FR2A 5HGJA 2IZ7A 3VR3A 2C9DA 3FWKA 2VBCA 4KFUA 1FYXA 2WIKA 1BU5A 2AEEA 4RIHA 1DC4A 5ALFA 4D1YA 2J0UB 2FMHA 3IHTA 1O9HA 5FFMA 5BW6B 3PXBA 2GCNA 2Z2XA 4RFSA 5K0TA 3E2IA 2VHCA 3VR0A 2IV3A 3ZXSA 4QFCA 3DF9A 3BQ9A 3H19A 3M8KA 3OHMA 3L6OO 1ZQ1A 4MWEA 3ZS9A 3IVXA 2O7VA 4BWYA 3W6OA 4GI5A 2VSNA 1BJKA 3GFBA 3C3CA 3FWNA 3P2JA 2IHNA 1RYYA 3B3AA 3R6WA 3RJTA 2ZRHA 1BW9B 3B48A 2GEVA 1WVGA 4YAIA 2D1FA 5JCOC 1ZDMA 1QE0A 1VGVA 3ZGNA 4R31A 3ZUPA 4HYYA 4G65A 1KVQA 1UFOA 1E20A 1EESA 5HGXA 1KK3A 1HFWA 2SHKA 4NZYA 4O3FA 5JFGA 2Q5IA 1IAVA 4CF6A 4ZI3A 1M34E 10MHA 4PN7A 1Q84A 4BAZA 3ADPA 2A9PA 3D4LA 3GRPA 2BUCA 1O6ZA 1PHRA 2K7ZA 4MO9A 4UTOA 2V5AA 3F98A 2OHHA 3STXA 2Q62A 2XVZA 4LK3A 5JUWA 1WB9A 2OGUA 3OQ1A 3WZ2A 3OZSA 4UKDA 2W2VA 4Y2QA 5CIQA 2FPGB 5I5GA 5TPWB 1L5KA 3LE8A 2P27A 3G2OA 5IN5A 4GP7A 2ACWA 4R6XA 2R4TA 1GR0A 2XUZA 4PG7A 4LY3A 3GJ8A 3DW3X 621PA 3EK2A 3GXBA 3F5QA 3IKJA 4DR6B 4IVRA 4GQAA 2E55A 3W90A 5KMGB 5ITZA 4CNBA 2AF4C 3BGSA 4RZ3A 4ZO4A 1XJCA 4BFYA 2CKMA 3OQVA 1CJTC 2H0AA 1IM2A 4RVDA 4OY3A 4WN9A 5MF6A 2POQX 3JY6A 2X3YA 2RAPA 3SSOA 3GLFA 3QF4B 3BX1A 1YCHA 4MRVA 3GUVA 1GU1A 3FLBA 5AI0A 5DIFA 3RVRA 1ODFA 3UMSA 4I66A 3A06A 1NMYA 4KIUA 1YU9A 4NJMB 2QPTA 3RYIB 2YUIA 1TIBA 3EW9A 3H5LA 3HB0A 1NVXQ 1DQNA 3M4JA 1E3IA 3NBQA 1ZD1A 2A7QA 5LOVB 4LV5B 2J6HA 4UCWA 1NXOA 1QFSA 4G81A 4P4NA 5DTJA 4RLFA 5EE5B 2C96A 1AKQA 4LJYA 4HAVA 5BWBA 3MM4A 3ROGA 5T6BA 5KX5F 3LYAA 3ED5A 5HQ3A 1E4EB 1SC1A 4J0HA 3UJHA 1XVIA 2DLDA 1YAHA 4ALIA 3HA2A 2JGLA 2MSWA 2Y99A 1DVRA 3U0BA 1ADJA 3V48A 2G7ZA 4OHXA 4PRKA 4OP3A 1EUCB 3ESXA 2HA0A 3EFBA 3FCSB 3L7KA 3UICA 4M98A 4AJIA 4RWZA 1QGOA 4C3UA 4LGVA 1RI3A 2HJRA 5EWLB 5TR9A 3E8MA 3TCKA 5JU6A 1JHYA 2YFYA 5F64A 1S2DA 3VTZA 4DZTA 1BMFA 3PGVA 5B6JA 2BM1A 2QAIA 1QXSA 1SBTA 4P9NA 2A94A 1VG9B 3A1WA 3C4QA 3HI4A 3KDAA 4BGUA 5LZ8A 2YYAA 3DEYX 1DGQA 1OILA 1UJ5A 4HPJB 4IHJF 3MWEA 2GHRA 2HLDD 3DPUA 5TVKA 3PNKA 1IWPB 2XOEA 4ECEA 1GNQA 1WMDA 1LLFA 1B14A 4U0KA 3RO7A 2OHOA 2XVYA 2QVCA 1WV0A 1LI5A 5AICA 1XEFA 3RRMA 3AGPA 4TWZA 1O54A 3OWXA 3OI7A 1AUQA 1G7SA 2E1PA 4XDYA 4JI1B 3NU1A 4A8PA 4XVUA 5JLJA 4LXGA 1VTKA 2BBTA 2W6NA 4MWTA 2G1AA 1EBUA 4PSUA 2IGTA 5AW5A 1BG6A 2YNMA 5JYDA 3AESB 4LJ6A 4YT4A 3OPQA 4FWBA 4KP7A 2JHCA 4BMZA 5CM9C 4D81A 4DMFA 4QFDA 2BFDA 5K45A 4U1RA 4L5YA 4AFNA 2W83A 1RXWA 1GHTA 2QP9X 3N2GB 4LXXA 4X8LA 5IARA 4C22A 3PEYA 2HH9A 5F2EA 1QH1A 3AHCA 1AMUA 3VA7A 3C7DB 3DO5A 3PDCA 4EGAA 1HMYA 5D6OA 1PN3A 2P3LA 5LLSA 2ZI6A 4CV0A 1WS6A 1XRPA 3AVOA 1C0EA 3HDYA 4LJ5A 1A8QA 3A4LA 4YWJA 3WL3A 3IT0A 2QBYB 3VZRA 2VSOA 2F9MA 2VXYA 3JWHA 5ICFA 4YUWA 3Q9SA 4L85A 1XQ6A 2FZLA 3C48A 3H5OA 4R0MA 4HJRA 2E4AA 1OH7A 2Q0QA 5EMKA 4RTRA 4LUCA 2YV4A 4JLKA 3OEHA 1NUHA 2YQ4A 3AR3A 3H8JA 2AV6A 4ND8B 3V3TA 4D98A 1KRHA 1DLIA 1BRMA 2QLLA 3OCYA 2PSFA 3EVCA 2GRJA 1N25A 2AG8A 1O96A 1Q2XA 4UU1A 4K9PA 4FHCA 4MOWA 4R1SA 3TD9A 2WMDA 5CVUA 1UMBB 3T6KA 3R9IA 1UJCA 3O94A 2PD6A 3A0RB 4DIFA 3MBOA 4FILA 1P33A 4F06A 1DJLA 5IANA 3COZA 1TYAE 1HV8A 2JAPA 3ECCA 1ZISA 3DE4X 3A2LA 4POAA 2X0EA 4ES6A 3WGMA 4HFMA 5J2TF 3WHPA 4OLJA 3FYUB 1RIFA 3SGLA 4Q1AA 2VO1A 2WSSD 3LHDA 1OT5A 4RIFA 4UDXX 2YCLA 2Q5JA 3CTPA 2GPSA 2JAXA 2R7AA 2WHRA 1GRNA 4TVSA 2YL2A 4O2BB 2IU0A 2Z04A 1JQBA 1AM4D 1ML4A 1XTUA 2Q5QA 3E81A 1CUWA 4GDMA 4LJKA 2ZZKA 2UZIR 5C5IA 4W4TA 1DWUA 3JQDA 1ZIDA 2OBMA 3BAZA 4B44A 1JDTA 1DKRA 2NVWA 2QRKA 4E6EA 1NNUA 1KKLA 4JL6A 4WACA 1LRLA 1SB8A 1UDWA 1EVIA 4ML3A 3R5TA 3F6PA 4XFKA 3CNHA 3DWEX 3ENKA 4AYXA 3HVRA 1BDIA 2FR0A 2FSGA 2X2PA 3JQEA 4LMAA 3U3JA 4CTMA 1T25A 2YWRA 4HNAA 5JVDB 4HNUA 1A9PA 2A84A 2GJKA 4DMRA 3UGKA 5BR1A 1JZSA 4LZZA 3VNSA 1TAHA 3L49A 5TC4A 1ZGCA 4F91B 4UHHA 4DT1A 4L6CA 6Q21A 3EXHB 3N70A 4EFKA 1I24A 3IQIX 2ZG6A 1P1FA 4EFNA 1FUEA 2QY9A 1FJHA 1IN5A 1BVUA 1XZJA 1RP7A 2XMZA 4EJ6A 5KTMA 5KO2A 1E0AA 3E82A 1KNXA 2DPHA 4M0CA 3TX2A 2CNKA 2IYQA 4LZNA 2ZJ8A 5E0KB 4Z8YA 1QBKC 3EDCA 1EE1A 1EHYA 3H2GA 3DLCA 3DL4A 5EMMA 5B36A 2NU9B 3GLGA 2LCQA 1SCKA 1YQQA 3DMFA 4ZEVA 1RLIA 2CKDA 3TF5A 3JRNA 4Y7DA 4YPFA 1VIDA 1J21A 5BN3A 4G84A 4JP8A 3ZDQA 2X9VA 2QE6A 1JLRA 2WTAA 1U7DA 1DXQA 2Z58A 5GZ3A 2GO7A 3D43A 1ZLYA 1Z0FA 5KTNA 3CJTA 3DBHB 4YJ3B 4DCNA 5IUJC 5I8PA 3ZLUA 2HJ9A 1CUXA 1ZVQA 2ZJ5A 3PC8A 3PNOA 2HI0A 4M1MA 1MAUA 3CZCA 5EP2A 5E7IA 4LVUA 4YP6A 5KC9A 2NU8B 1FNBA 2F2TA 2Q5LA 2C82A 2PQMA 1E2MA 2Q1TA 5JRJA 3U3XA 3EXAA 2P9ZA 1P0MA 3KK0A 4C06A 3OJEA 4JGGA 1FCJA 3ILVA 2WHPB 4QOFA 4KRGA 4AK9A 4CQLB 2L18A 1P60A 2QSUA 4DZZA 5KYKA 3PYXA 2GAJA 2O8NA 1P80A 2VF2A 4UJ5A 3HG7A 4XDHA 4X63A 1N2CB 3OD1A 3O8LA 3PX2A 4YFVA 4MVJH 3UK6A 4CMEC 1AQJA 1D6MA 2ZJBA 1Z5VA 4CM9A 4KO8A 3DZBA 4FMCB 3UCEA 1JDBB 2B78A 1D1PA 4QSHA 5FBHA 1QR6A 5PNTA 3U13A 2JLWA 2EFGA 2HGZA 5A1TA 3O8OB 2W0SA 5ICMA 2OKGA 3G49A 1XVTA 1DMSA 4PSVA 2PH1A 3WK7A 4GG1A 1LLUA 2G5PA 2QUZA 4JBLA 1WQ4A 2SCUB 2EVWX 1YGYA 3S68A 4A91A 2HQSA 3O8QB 2PSSA 1G42A 1CF9A 1C29B 2X6TA 1OBHA 4GYWA 4DABA 3QXHA 1XHEA 2CJPA 3RHFA 4QELA 4PYMA 4I55B 4Y2HA 5LB4A 1FNMA 3WYCA 4DLVA 1I2CA 4R9SA 1MGOA 2CBZA 2YBDA 4TKMA 1UPFA 2GKOA 3B3JA 4RLQA 3A6DA 5ALIA 2BGRA 4TZKA 2Q5FA 4YXFA 2AHRA 1AK1A 2HCRA 1NZDA 5C81A 4PWYA 2OCXA 5F2NA 4W5NA 5J2TA 2Q9BA 1EUDB 2DQZA 2IVZA 4IIGA 5KTRA 2OXFA 3ILYA 1BE8A 2GN2A 2SBTA 3RTEA 2P75A 1I30A 3L43A 2O2SA 3FUVA 4CLEA 4QFMA 4B3GA 1J00A 1DC6A 1TQHA 3CEPB 4XKJA 5I5EA 1B1CA 4QDJA 1DOZA 1BJRE 1WXGA 2JZOA 3EOAI 3IFSA 1ZJ6A 4WNAB 1D4OA 2PX2A 3BD9A 3F7OA 3ZE9A 1JA1A 1SZJG 1X15A 2X14A 4AROA 3USZA 5MN4A 4FFVA 2QTVB 1NFRA 1NPYA 1B74A 1ADGA 1XDDA 4E4TA 9GPBA 3G02A 1Q6YA 4HAWA 4QQ8A 1PQPA 3QVTA 4ZVTA 5GV8A 2P4QA 3IUYA 3K5HA 3STVA 5JS2A 1U2DA 4UJ3A 1H9CA 5IJ9A 1XJ0A 2D0DA 1WY7A 3GJSA 1BKDR 4N0PA 4P0PB 1T0UA 1ST3A 3EG9A 2XTZA 5DISB 3VU3A 3DFKA 4XX0A 3TVTA 1IXYA 3BMQB 5ITWA 4XUDA 4C7OB 2Q29A 2IYRA 3OJLA 4K6HA 2WLTA 1LTKA 1FFHA