3SLGA

Crystal structure of pbgp3 protein from burkholderia pseudomallei
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
347
structure length
334
Chain Sequence
KAKKVLILGVNGFIGHHLSKRILETTDWEVFGMDMQTDRLGDLVKHERMHFFEGDITINKEWVEYHVKKCDVILPLVAIATPATYVKQPLRVFELDFEANLPIVRSAVKYGKHLVFPSTSEVYGMCADEQFDPDASALTYGPINKPRWIYACSKQLMDRVIWGYGMEGLNFTLFRPFNWIGPGLDSIYTPKEGSSRVVTQFLGHIVRGENISLVDGGSQKRAFTYVDDGISALMKIIENSNGVATGKIYNIGNPNNNFSVRELANKMLELAAEFPEYADSAKRVKLVETQNRVPKIENTMQELGWAPQFTFDDALRQIFEAYRGHVADARALVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PbgP3 protein
publication title Crystal structure of PbgP3 protein from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 127
structure length 334
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3slgA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3slgA02
1GQQA 1XGKA 2YDXA 4MP8A 3VKUA 1Q1NA 1T24A 3AI1A 4J0EA 4TRNA 1EQ2A 2P9CA 4XGNA 4BKUA 4CM9A 1LX6A 5KKCA 1FDTA 4M55A 3ZWAA 3C7CB 3QLJA 4AJ2A 4AJ1A 4JP2A 2VUSA 1ZEJA 2GYYA 4FIZA 4GPD1 2YHUA 1AE1A 4BOYA 4B8WA 3ICCA 1E3JA 2QRJA 1CERA 1DRUA 3SLGA 1V3VA 2ZK7A 5JDIA 2AE2A 4CV2A 2OGUA 4RF4A 3CE6A 3JQ9C 3AI2A 2W2KB 1HT0A 4O1MA 4WECA 3ORFA 4XYEA 2Y05A 3MOGA 1EE2A 5L4SA 4YAGA 2R00A 5COAA 4IDEA 4J7CA 5DBGA 4WCFB 1SCUA 4MP6A 3BTVA 3JQ6A 4Q3BA 5CEFA 4YDRA 4IDBA 3K2EA 3KHUA 5CG2A 4JJGA 3F4BA 3FR8A 2W2LA 2GD1O 4CV1A 4ND3A 1ZSYA 2GN9A 4WPGA 5EMHA 3V2HA 2BFPA 1GUZA 1JKJA 4GSKA 2GN6A 2ZB8A 3U9LA 2ZATA 2ZB3A 2PY6A 1HEUA 3PIIA 3FBGA 1H94A 1ZMTA 3HB5X 4RQTA 3SJ7A 3GPIA 1BDBA 2VNSA 4LGVA 5JAZA 4Z9XA 2YYYA 3D4OA 1SEVA 1ONOA 4FDAA 2PKQP 4MVJF 3OICA 4M89A 2Y1OA 2YV1A 1IOLA 4NBRA 4I1IA 5A9TA 1KY5A 1VC2A 1U5CA 1Y5MA 1O95A 2Y0EA 1BMDA 2LDBA 2VHZA 3B1JA 5KJ6A 2EKPA 1DJNA 2HUNA 3ENKA 5IZCC 2Q4BA 2V6FA 2X7HA 4M54A 4WNCA 1Y7TA 4O5OA 3FNGA 2DC1A 3OM9A 3KSZO 5FYDA 1IULA 4R4JA 5JDCA 4WLFA 3ZU4A 3I83A 3S1LA 4BB5A 1K2WA 3BMNB 1C1XB 3WWZA 3F1KA 3W8FA 4CLRB 3ZHZA 2O3SA 2D2IA 1PJBA 2X22A 3WXBA 4JLWA 3CH6A 4PGFA 4YRAA 2G76A 3ZV6A 1X7GA 3FTNA 1H2HA 4W7IA 4LRTB 2J5RA 4L4RA 3ETDA 4YAJA 4ZA2A 3WMXA 4YJGA 5T6BA 1UR5A 3PJGA 1B8PA 1ISJA 4D3FA 1F8FA 4RPJA 4Y6PA 1N92A 1DRWA 3NGXA 2B69A 5TC4A 4ZHSA 4XB1A 1WVGA 1HL3A 4WJZA 4D79A 1J4AA 1OC4A 3VHRA 4BNHA 4GWGA 4HWKA 1BG6A 3LC7O 4EEZA 1CYDA 3I9KA 4UVIA 4D45A 3JQ8B 4DXHA 1KC1A 4AJLA 3GA0A 2ZJ1A 3Q9NA 4MOWA 1K6XA 2C2YA 4B4OA 4DBZA 1G6KA 5JC1A 5EQFA 1ISGA 2Y66A 4LSMA 3WWYA 2O3RA 3IAHA 5AQ1A 1BW9B 1YBMA 2VYVD 4Y6SA 1UP4A 3DBVO 3TFQA 3JYLA 2V6BA 4G65A 1LC0A 3HNPA 1YJQA 3D0OA 1QLJA 2OL4A 4IIVA 4MVJP 3UW3A 2JHFA 4H7PA 4CMGA 4BNLA 4NBUA 5L7YA 5LC1A 3RUAA 1DDOA 5F5LA 2Y1DA 3EUWA 2Q50A 3DBLB 2AQKA 1PZFA 1TA4A 4MKRA 1IY8A 5EIOA 2VCYA 3VDQA 4BNMA 3KV3O 2ZYGA 3GGGA 3HJAA 1RM5A 4XA8A 2P68A 4W4TA 4QXMA 1DFHA 3HE3A 4X54A 3VOSA 1YB4A 1DJQA 3KO8A 2WD8A 3HN2A 4J91A 2YV3A 4B7XA 3GZ4A 4BQPA 4J1TA 4BGVA 3BMCB 2OFPA 4ND5A 4LVUA 4Y98A 4ALJA 3E1KA 4FFNA 1ML3A 3RFVA 3W1VA 4D3SA 5JSFA 5IDXA 2GRAA 1DAOA 1V3TA 3CTMA 2PH5A 3WG9A 1KEVA 1I8TA 1JWAB 3FN4A 2WMDA 4BNZA 4D7AA 1QMGA 2EP7A 2JD2A 4R1NA 1DC5A 2BMAA 3JD4A 4OXYA 4XR4A 4DPMA 3KXDA 1WMAA 4UVHA 1BVRA 1B26A 3DOJA 3BTSA 2UVDA 4ZRNA 1VM6A 1X1TA 2UUOA 4H15A 4CMKA 5AXCA 4HV4A 2WDZA 3MEQA 4NR0A 1E3WB 4XEHA 4NU6A 2B36A 4OSOA 1LU9A 3P2YA 5B1YA 2ZJ0A 3DO5A 1X13A 3RU7A 2BH9A 3JQDA 1GQYA 4M1QA 3ST7A 4CLEA 2FY8A 4PLYA 1KOLA 3AK4A 4QEDA 1NNUA 3ZI0A 3JD3A 1MGOA 2HKIA 2EJWA 4J9VA 5GZ1A 4QO7A 4CM9D 1NPTO 5KCZA 3BA1A 3GH3A 3F5SA 3GAZA 3DTTA 4RZHA 3RC2A 1ZBQA 3MTGA 3LDHA 1WDKA 4S3MA 1PZGA 4U6SA 1SOVA 3AOEA 1A27A 3TOXA 3DMTC 1ZXBA 1LDYA 2W90A 3GEGA 4J49A 1A7AA 1D1TA 2JL1A 4D0RA 5AXBA 3FTPA 2PV7A 4GX2A 3IUSA 3ZHBA 4E13A 1C0LA 1JWBB 4NJMB 2EWMA 4MINA 4YQYA 5JLAA 1Y81A 2H1SA 3BHMA 3LLVA 4CLHA 4CR8A 4IMRA 2O4UX 3D4PA 1CQJA 1A72A 3BIOA 4J2HA 3DAFA 4RPGA 4TVOA 5TGDA 1QG6A 2X0RA 2GGSA 3L77A 2Y93A 2CZCA 1A4UA 2W2LD 3GDOA 3GVPA 1YQGA 1BRMA 3KBOA 1SPXA 1NHGA 4BKPA 4KDFA 3BHIA 2HCTA 4XIYA 2B83A 4HY3A 5JAMA 1GUYA 4UUMA 1Y5RA 3ZHYA 3OEYA 2P4QA 3WYBA 1NASA 5ES3A 3ANNA 1KEPA 5DCYA 4IDGA 2WSBA 2YQ4A 4PIVA 2DT5A 2GZ2A 3BMNA 3VDRA 3BHJA 3OJFA 2EV9A 2OUIA 3HUDA 4GWKA 4J43A 2E49A 2ET6A 4A5OA 4QSMA 1BXGB 1CJCA 1NR7A 1T4BA 3ADPA 1CRWG 3DQPA 4XQGA 5K6AC 5DCUA 1LSOA 3QE3A 4MPDA 4PG5A 3R3SA 3WLEA 5U9CA 3L6DA 1LNQA 1QKIA 4CJXA 3WOHA 3Q3CA 1EUZA 3TPCA 3X2EA 3NT5A 2I9PA 4BVAA 2EXXA 5U4QA 3DL2A 3ZU5A 2PKQO 3PQEA 3JD0A 4PG7A 3ZN2A 3DBHA 3AM5A 3AY3A 3L4BC 2C7GA 2WJPA 1ENOA 1WNTA 4W9NC 1X7HA 1BDMA 1GFSA 3FWZA 4NI5A 3FRJA 2PA3A 3NTQA 3UKOA 1NVGA 2QIOA 3K96A 3Q2IA 3Q2KA 3KUXA 3IP3A 1NVMB 3IKVA 4TRJA 3GHYA 4J1QA 1SEPA 1A5ZA 3ASVA 1WZEA 3WMWA 4N5MA 2J3JA 5L45A 1U7TA 4QECA 3WBBA 1XR3A 4GAEA 3JV7A 5G0UA 2CF6A 2EP5A 4FW8A 3G0OA 3JQFA 2OHXA 1E7SA 1H6BA 3HQ4O 2A94A 2F1KA 4MDHA 1DC3A 2Q2VA 2H9IA 3PYXA 2OBYA 1NTOA 1PJTA 1LQUA 2CNBA 4JBHA 2WYVA 2Q46A 1LSJA 4L9RA 6ADHA 1T2FA 2BGMA 3SEFA 4IS3A 3RJ9A 3PJEA 5IG2A 3OF2A 4CM4A 4CLOB 3SVTA 4UVEA 2WE7A 4RVDA 4WLUA 1ZK3A 5C7IO 2DVMA 4PVCA 3STHA 2X9NA 4EDFA 3WX0A 3O8QA 1P45A 1M75A 3DOOA 3LYLA 4GLLA 2FR0A 5TSDA 1NQ5A 3X2FA 1PJ3A 3HDYA 1PS8A 2UV8A 4OOFA 4R54A 1CF2O 1YQXA 3IIEA 1GTMA 2NU9A 1LLCA 4PZDA 4BO7A 1QRRA 2NU7A 1R37A 5JO0A 1EFLA 4FGSA 4IJUA 5H82A 4BV9A 4HKTA 4K6FA 5L53A 3BMOA 4LK3A 3GUYA 4NHEA 4NG5A 4EJ6A 3RU9A 3WTBA 1KIFA 3H9QA 4M8SA 3I3OA 1T1SA 2ZTUA 1W6UA 1YXMA 4E2XA 1EDZA 3KB6A 4I9UA 3GVCA 4CM8A 1XCBA 4WNIA 3EHEA 2X58A 1E1KA 3DFUA 5TIIA 3QWBA 4EUEA 4QX6A 3U4IA 3JQ7A 4XYLA 2DUWA 3GFGA 2ZQYA 4U5QA 3SX2A 1YBAA 3KETA 1IUKA 4B7CA 1WZIA 5CDGA 4J4BA 2HMVA 3O38A 3HSKA 3AI3A 3AU8A 1PL8A 1XIVA 3Q11A 1F12A 4IZHA 1UZNA 1JN0A 4RQUA 2A4KA 1X1EA 3PLNA 3V2UA 4CQMA 3DHYA 2J8ZA 1PGNA 2Q1TA 3E9QA 4J2OA 4CMIB 1ADBA 5A02A 4CMHA 1GU7A 1QYCA 1WXDA 1DIAA 4IDAA 1E7MA 3A4VA 3DWFA 3KOUA 3Q9UA 1ULUA 5B37A 1ZK1A 2HMWA 3K5PA 3T7CA 1U8FO 4MIOA 3QWAA 4JCOA 4BO6A 1MLDA 1SB8A 1CEQA 4PLPA 5IAAA 1KBZA 3IDSA 1NFRA 1PQPA 2AMFA 5DT9A 2O3UA 1MB4A 3IMFA 1LDGA 1O89A 2WE8A 3TZCA 3TFOA 1K0UA 1PJSA 3KLPX 3OBBA 3JYOA 3PWZA 1Q0QA 4D3DA 3ANLA 4D42A 4Q3AA 4YACA 3HN7A 3M1AA 1PGPA 5K9ZA 3RUHA 5A9SB 2PZLA 2I76A 2JD0A 2O2SA 4NPCA 4YRBA 2HAEA 4N54A 1VSUA 2FPIA 4PLHA 2BI7A 3KYDA 2FOIA 2VYNA 4BNVA 1U2GA 2BFAA 4EUHA 3H65A 3HADA 2O2YA 3IS3A 3JQAB 3FPLA 2QG4A 3WGZA 3LSYA 3AY6A 1MUUA 4ALLA 4E30A 1W4ZA 4XR9A 4IY1A 2VTDA 4RF5A 4A7PA 4FFOA 2C0CA 5KIAA 3N7UA 3O03A 2EG9A 2PK3A 3PEFA 5DDIP 2AQ8A 1DIHA 1DHTA 2XPCA 2OZPA 2V7PA 2DFVA 5TS3A 3EDMA 5T57A 2QZZA 1TI7A 4BMNA 3TZHA 2GPTA 3AUAA 4RLHA 4QTZA 1NFQA 1VRWA 5GZ6A 1MG0A 2QHXA 3NT4A 4PLFA 1YRLA 4J7XA 1ULSA 4TKLA 4NK5A 4FOOA 2DLDA 4UEKA 1U3TA 3U5TA 1IL0A 4PG8A 3RCBA 1GEGA 1KYQA 4BO4A 4R5MA 4PZCA 1HDOA 4E5KA 3H8VA 1FMCA 4BO3A 1I32A 4RCVA 3WSVA 2E82A 4CMAA 1Y8RA 3MWEB 1P0CA 3GGOA 4UUNA 1U5AA 3V2GA 2E6UX 1WDMA 1R4NA 5L40A 4AJHA 3PYLA 1ISFA 2CDBA 1K6JA 4D41A 5JNLA 1ZMOA 4DMLA 1ZO8A 1VKNA 4O63O 4KTVE 1EEHA 3IJRA 5I9LA 1OOEA 4RDIA 2D59A 1HSZA 1R0SA 1F06A 2JFFA 4BHTA 4JBGA 4UULA 3ZCXA 1DEHA 4JQCA 2VQ3A 1AGNA 1R15A 2V6GA 3DAPA 4HBGA 5JCJA 3OA2A 1Y9EA 4LSWA 3TZ6A 5TX7A 2NV6A 3DZBA 2DTXA 1IE3A 1VJTA 1HWYA 3NKLA 5A9RA 2GSDA 3B70A 1B2LA 2Y68A 3PPIA 2YW9A 1QYDA 3C1AA 2I67A 1YVEI 4IJVA 1D8AA 3L9XA 3MTJA 1Z7BA 3PQFA 1NWCA 3GN1A 1KVUA 5C7OO 2J5QA 3ZGYA 1DO8A 1E3IA 3UOGA 2WEKA 2IDZA 3RI3A 3WTCA 3DHEA 4XQ9A 1Z82A 3H9JA 3BAZA 3HG7A 1XQ1A 1ZNQO 4AVYA 3I1JA 4NFHA 3WGYA 2EKQA 1HLPA 4NK4A 4RF3A 5IN4A 4WASA 4PG6A 3PGJA 1JKFA 3U62A 3GFBA 4B3JA 1GCOA 4ZQFA 1ENPA 4BNWA 1BXKA 3VPXA 4YQZA 3L9WA 1FJHA 1GAEO 1ENZA 3BYZA 5G2OA 5KVQA 3F3SA 1T2DA 1CWUA 3E6AA 3IL2A 3GNSA 3ZU2A 4BNYA 1RYEA 1ENYA 2EIHA 4MIYA 3UHAA 4OL9A 1LSSA 3PYMA 4YXFA 4RJTA 1IZ0A 2QQ5A 3WGTA 4QFDA 4LN1A 5F3RA 1X0XA 1ZW1A 2CFCA 3WYEA 3JQGB 1UDBA 4B3IA 1SZJG 8ADHA 3UF0A 1YQDA 5GZ3A 3QVXA 3KSUA 1UDCA 1EK6A 4IQGA 3KYCA 3V1UA 1H6CA 3DOCA 2WM3A 2AXQA 2GR9A 1P1RA 1NX6A 1PSDA 5I9NA 3DEYX 1X15A 4RVUA 4QT0A 1M66A 5AVOA 4B8ZA 4TMFA 3UVEA 5G4KB 3BMQB 3W6UA 2ZTVA 1BTOA 3QJ5A 1BHSA 4EBFA 1ZK4A 2DPHA 2Y1FA 4YCAA 3MJCA 1TT5B 2VZ9A 4AJOA 3IQDB 4W99A 4NQZA 2FSSA 1KVTA 2X6TA 3OHSX 1LRJA 1JAXA 1VKOA 4EYEA 3WGIA 5JY6A 3K6JA 5JDIC 3RSHA 5HA5A 5ER9A 3CMCO 4CQMD 5I7VA 1PZEA 3HHPA 4OKIA 1HRDA 2FSVA 4BS9A 1UZLA 1HE5A 1O6ZA 1T26A 3UXYA 1NP3A 3QWFA 2R00C 5K6AA 1GZ3A 3EW7A 1ZSVA 4MVJH 4YT4A 2E37A 3INRA 1T25A 1TVEA 3WSWA 4BNUA 1J6UA 2Q2WA 4K1LA 3LU1A 3E9NA 5G0SA 1PEDA 5K0ZA 2OP1A 4O59O 5THKA 3JQAA 1QORA 2C82A 1N8KA 1O9BA 1Q7BA 3D1LA 4PLGA 4W82A 4DYVA 4EJ0A 3O26A 3TZKA 4P8RA 3NRCA 1RM0A 4ND4A 3W8DA 3FPCA 4LRSB 3VVBA 2GLXA 3N58A 4ZVVA 1A7KA 4F3YA 4FN4A 5U1PA 4YAKA 1KVSA 1GCUA 3E82A 3VTFA 1YE3A 4Q3EA 1NQAO 2BHLA 4B4WA 4IS2A 4HNHA 3KM0A 5IJZA 1LUAA 2DBVO 4CM7A 3LC1O 3FI9A 1PL7A 1UH5A 4DPLA 1PU2A 3QVWA 2VYND 1VI2A 4LISA 2Q1SA 1GQ2A 1JLLA 3LT1A 2H6EA 5IXSA 3OJ0A 1LQTA 1R12A 4GVXA 1LLQA 4IINA 2CVQA 1ZCJA 4CR7A 9LDTA 2Z1NA 4D44A 1NFFA 2HDHA 3RKRA 3CUKA 1B3BA 3ONDA 2BF7A 3V1YA 1D3AA 2NVUB 1HDYA 3WYCA 4IGFA 4R01A 4AL4A 3FCOA 5JDCC 3GN2A 3OQ1A 2X23A 3AW9A 5DN9A 5G0TA 2UAGA 4Z3DA 4GMGA 5KKAA 4TRRA 2POQX 1HYEA 3RVDA 4DLBA 3ZV4A 2P4HX 4CPDA 2X5KO 4YR9A 4CUZA 1GYPA 1R66A 1Y8QA 4K9DA 3TJRA 3D4NA 4NFYA 3PVZA 1EE9A 2D3TA 3ZNNA 2PGLA 1MC4A 4AJIA 5ILOA 1Q0LA 3ZNPA 3HFGA 1HTBA 4WLVA 1HKUA 1A9ZA 3RC7A 2V6MA 2VRBA 4IUYA 2BFMA 2RAFA 1B8UA 4PLTA 1R4MA 2HU2A 2QYSA 4CQLA 3RD5A 1PZHA 2EF1A 2GUGA 3AWDA 5I7SA 3NTOA 3QVOA 1SAYA 3DZGA 2VHVA 1VSVA 5IDQA 3G1TA 4AICA 2YFHA 4FFPA 2EEZA 2YV2A 5ITVA 1J0XO 2BD0A 3ABIA 4ESOA 4JJFA 5TJHA 5JCJD 1KVQA 4RPKA 5CDYA 4R3WA 2VHYA 4ZD6A 2PD6A 4NBWA 3H2SA 2GN8A 4HADA 4CV3A 4DIBA 1OMOA 1EUDA 1P31A 3DZHA 5L51A 1FDVA 4MKZA 2ILTA 3WGHA 4RORA 2IRWA 2H5LA 1DC4A 2DU8A 1DIRA 2JHGA 4I5FA 1MC5A 3D5QA 3K31A 2IZ1A 1EVYA 4RL6A 1IZ9A 1QV6A 3GVHA 2NTNA 3EY4A 1YJ8A 3SLKA 1ZUD1 2BELA 1OFGA 1YS4A 4LMRA 3ZW8A 2O3TA 4FSHA 1U9JA 4YT5A 4BKRA 1DIBA 2JCXA 1LRLA 1Q7CA 1TEHA 3DDNA 4R5HA 3JQGA 5L95A 4NH4A 3C7AA 1DXYA 1YOVB 2AG8A 3EK2A 3GF4A 3ITKA 4CUJA 2Q49A 1GADO 3FNFA 2AEJA 3GAFA 1DHRA 3JSAA 1WDLA 2BFOA 1XU9A 1M2WA 2W2KA 5CP8A 4PZEA 4A26A 3ITDA 3CXRA 2IXAA 4UUOA 4BQRA 4KZPA 4F46A 3U4DA 3VH2A 3GDGA 2IYOA 3K8ZA 2EKLA 3ZWMA 1GR0A 5KVCA 4NBVA 3KVOA 4WCFA 3ON5A 1S7CA 2B4TO 4J7UA 5DBIA 5COQA 2X9VA 5KTKA 3PQDA 4KWHA 5AYVA 4ZQEA 1CETA 1PJ4A 3ENNA 3OEWA 4P4NA 4CM6A 4B79A 4XCVA 3ZWNA 4B4VA 5HRUA 3DTYA 3WFIA 2R6JA 1GL3A 4C4OA 5TT0A 3GPDG 2FZWA 2C54A 2JKVA 3UFXA 4YJDA 2BRUA 5A04A 1U4OA 1V35A 4PLCA 2PZKA 1LDBA 3I23A 1NR1A 4GBJA 4OKNA 4OHUA 2AW5A 5BR7A 3TF5A 4XB2A 5C5IA 2AG5A 4IJKA 3TWOA 3ZWWA 1KS9A 1OC2A 2EGGA 4TRMA 5ICMA 3A14A 3R1IA 1QV7A 1EZ4A 2B0JA 4WGGA 5ICSA 1KVRA 3TSCA 4IXWA 3AU9A 1YKFA 1M6HA 2HSDA 3PDUA 2A92A 3V1TC 4EJMA 5A3JA 1FDUA 4U7WA 5T64A 2PLAA 3INGA 3AOEC 2UYYA 3U49A 1AHIA 4NDNE 2EJVA 4CMEA 1YDWA 4GQAA 1P1HA 3HZZA 4GKVA 1A71A 1SC6A 5JAIA 1E7YA 5JO9A 3MOIA 1WW8A 4YVFA 3I6IA 3K2BA 3OECA 4W6ZA 1D7OA 4FFLA 3VAZA 1C1XA 3DAGA 1QSGA 4CLRA 1I33A 3JQAD 3GLQA 5L3ZA 3OETA 1P1JA 2WTBA 4DBVO 3WBFA 4BNFA 5KVSA 4MVJG 1DBVO 1O94A 2P5UA 3H7AA 4JNKA 1PWZA 1HE4A 4K6CA 5IN5A 1VL6A 2GF2A 3OP4A 1KETA 4FQ8A 3AY7A 1GD1O 4MJLA 5F1KA 2Z1MA 4NBTA 1K3TA 3JCZA 1HXHA 3QA9A 1UZMA 5B4VA 2GNAA 4R9RA 1I0ZA 1W73A 4J90A 3WGQA 3JYPA 4XRRA 4Z0PA 1ID1A 5ADHA 4YTEA 3PFWO 3OJEA 4TVBA 3U4HA 1PX0A 5A1TA 5KNLA 1HE3A 2ZIZA 3NYWA 1LXCA 3ZHXA 7ADHA 2VWPA 2V65A 3JQ8A 3QV1A 2ZYAA 5JBIA 2P91A 4NIMA 3GHHA 5FFFA 3L0DA 3F4LA 3OH8A 3G49A 1P1IA 3PHGA 3C24A 3ZWYA 1G1AA 1UUFA 4GSLA 1BW9A 3ZV5A 4BNXA 4IJWA 4YPOA 4EEXA 2PNFA 3D3WB 5BNTA 4I5GA 3QP9A 1BSVA 4FFMA 2GASA 2OMEA 1N7GA 4CODB 2Q1UA 1PTJA 1R0LA 2I66A 3WJ7A 3MJ4A 1LBEA 3H5AA 4IDFA 3DBLA 1LDNA 5IZ4A 1DLJA 1JTVA 4NFSA 4II3A 3GVIA 5DBFA 4LMPA 5F21A 3QIVA 1SMKA 3W4JA 4F6CA 1I3NA 2FRDA 1UXJA 3NTRA 4R69A 1HDRA 3JQFC 2EGHA 3I9OA 1B15A 3ZNQA 3GG9A 3ZWBA 4KOAA 3JYQA 2NLOA 3R6DA 3WFJA 3BMCA 5FEUA 3NJ8A 2JFHA 2RH8A 3ROMA 2Y99A 3L4SO 3MJSA 1E1MA 1XEAA 1E3SA 2NVWA 3QSGA 5TQVA 3PZBA 1ONNA 1NXQA 2HRBA 2G1UA 3PHJA 3F6YA 4E2YA 3NV9A 3H4VA 4U0KA 4XQEA 3ZW9A 4U6QA 4ZGWA 2GN4A 1Q0HA 4L4XA 3HFSA 4P22A 4ZU3A 5KWEA 1ARZA 1YB5A 3ZWCA 4L75A 5B4TA 1I2CA 3LVFO 1U4SA 2X8LA 3WIEA 1I3MA 1H6DA 3GK3A 3TNLA 4E5NA 9LDBA 1DAPA 1OI7A 3EGOA 1DIGA 3WDSA 4XWYA 5C3MA 1T1RA 4JROA 3COSA 1E3WA 3KSDO 1JKIA 1LSUA 3WR5A 3WNVA 3DZIA 3RFXA 3U4CA 5EERA 2PZMA 3E03A 2E48A 5MGBA 4K26A 2RHRA 1MX3A 5T8KA 1P77A 3P7MA 2VT2A 1E7RA 2NACA 3A1NA 2NTVA 4JXKA 1SB9A 5TF4A 3LQFA 1WPQA 4BGUA 2VHXA 5KVVA 5MDHA 4YJFB 1ZZEA 1E77A 2Y0CA 5L4LA 2CD9A 1L1FA 2B5WA 4KQWA 4L8VA 5DOVA 3RC1A 3PGXA 4BB6A 1DFGA 4YT8A 3VZPA 3Q6IA 1ZJYA 2PWZA 2AQIA 3GOHA 4BNGA 5JYEA 3GT0A 1QP8A 4OMUA 2PH3A 2X86A 2YQ5A 5TT1A 4WOJA 3VH3A 2HJRA 1LC3A 5B12A 1V9LA 3VZSA 4FD3A 4JX8A 3BTUA 1J49A 3ZU3A 4NJMA 3ZWXA 5AXAA 3CEAA 5HBRA 2YFQA 1RWBA 4BKQA 3A9WA 3U09A 1AXGA 1J5PA 2WWRA 3S2FA 2VRCA 3VPHA 4XDYA 1R6DA 4OO3A 4DUPA 5BNFA 4BO5A 2EHDA 4DIFA 3AUSA 4GMFA 4BUCA 4YRDA 2F00A 3HDJA 3GMDA 3IP1A 3LZ6A 5L4NA 1GYQA 4OAQA 1T2EA 4BO0A 3GZNB 1LI4A 2EW8A 2ZYDA 4WCDA 2BI8A 1FF9A 3DFZA 4AJ4A 1XKQA 1OAAA 2OP0A 1C1DB 2X9GA 4J1SA 4WOKA 2VWGA 1XDWA 2CDAA 4YWJA 4L4SA 1WLYA 3Q1LA 2NU8A 1RPNA 1YL5A 3GY0A 3O9ZA 4MVJM 3SC4A 1FK8A 2VTEA 1TT7A 4CMBA 2FPPA 2AA3A 1F8GA 1PJ2A 1A4IA 2CVZA 1BXGA 4KP7A 2AEMA 3QVTA 4DVJA 3F46A 3F5QA 2UUPA 4KUEA 1FXSA 2BGKA 3SXPA 1I5RA 4CLXA 2TMDA 5BT9A 2C07A 2I5PO 3C85A 4FPXA 4BNKA 1U28A 3NJ4A 1DLIA 2QYTA 3I4CA 5CEEA 4YB8A 3UH1A 2FP4A 3MJEA 4FC6A 3HDQA 4LW8A 4GX5A 4J1NA 4R3NA 4RV9A 3RUEA 4IM7A 3DZKA 1YBVA 5KJEA 4H3VA 3DR3A 3GR6A 4Q9NA 2DBQA 3MZ0A 4UEJA 2WD7B 3WJAA 1EQUA 1VJ1A 4XZ3A 1MG5A 5A4DA 4HXYA 1EDOA 4HFRA 3LT0A 1O0SA 3B6ZA 1P44A 4BL5A 4GVLA 4Z3KA 2RCYA 2WYUA 2A35A 1EK5A 3PZRA 3FR7A 3GNQA 4L74A 1ZH8A 4ZJUA 5THQA 5JYDA 5L9AA 4TWRA 1Z45A 3NEPX 4WEOA 3JQBA 5EPOA 3IKTA 3AOGA 3B1KA 4N18A 1P1FA 3UCFA 5CDUA 1PJLA 3IUPA 1KY4A 5H81A 3SJUA 1E0DA 2GO1A 4YT2A 4ITUA 1VE9A 3ASUA 4GGOA 3QWIA 1XLTA 5JW6A 3UCEA 4FC7A 4RGBA 3NGLA 4M87A 4TKMA 4Y8VA 1YH3A 4MVJA 4ROSA 4HP8A 5JMWA 1JQBA 4CLOA 4YJGB 4BO9A 5IDWA 2Q4EA 3U0BA 3KEQA 3S2IA 4BIIA 3I9LA 4DPKA 4DYDA 1ZVMA 4RPHA 4CUKA 3JQBC 3TDKA 4XYBA 1H9AA 2IYPA 2I6TA 2PR2A 3S2EA 3ZWVA 1RM3A 2XXBA 4R51A 4ZQHA 3ZH2A 2QZ9A 1HZZA 4R9SA 4XYMA 3L07A 1JAYA 4I08A 2D0IA 1F14A 4A27A 4DREA 3D3EA 1MFZA 4EUFA 2VHWA 2X5OA 5A5EA 4RDHA 1H6AA 1QXSA 1NYTA 1M67A 3DMYA 2Z95A 3ZV3A 4DQVA 1VPDA 2HK9A 4CMJA 3IJPA 1W0CA 1ZFNA 1HYHA 1B16A 2VUTA 2XXJA 3DXFA 3QRWA 4PVDA 1PGQA 1PQUA 5AXDA 2GCGA 1A9YA 1XA0A 1P1KA 2ZQZA 5JAQA 1D4FA 4BO1A 1X14A 1ISIA 5EESA 4MIEA 5JC8A 3R0IA 4JP3A 4PLZA 4H16A 1BXZA 4HX5A 5JFOA 1I3LA 1GZ4A 1O8CA 2C2XA 3D7LA 5G0VA 3PFFA 4M49A 1E7WA 2YHIB 3W4IA 2JJYA 4IZIA 3OFSA 4XIJA 4OXKA 4YBZA 1RKXA 2VT3A 4YJFA 4DQUA 2XF8A 3WICA 1U2DA 4CMIA 3T4XA 1UXGA 3EYWA 1GEEA 1MP0A 3WQQA 4E6PA 2C59A 4E5PA 3HWRA 4WE3A 2QW8A 4O6VA 2Q1WA 4B7UA 3JQ9A 4FS3A 4ID9A 3NDJA 1PL6A 4EZBA 3E8XA 4TQGA 5DF1A 1H9BA 4J0FA 5KOIA 2O7SA 5C7LO 2P9GA 2G17A 4BGIA 1GPDG 2CF5A 3PJFA 3QHAA 1ISHA 1I2ZA 4BMSA 1ZEMA 4FGWA 1E1NA 4PFJA 4XQCA 4UUPA 1XELA 3A06A 4J6FA 3UUWA 1UP6A 3DBRB 3LC2O 4A2CA 2DTEA 3GZNA 1BVUA 1L7DA 5IF3A 1N2SA 4Q3NA 3RAJA 2Q3EA 4F6LA 4B4UA 4AJKA 5A9SA 3PHIA 5I7FA 4E21A 3NT2A 2X1HA 1C1DA 4DC0A 5LDHA 5AOVA 1HE2A 3Q0EA 1LA2A 1PJCA 2X0JA 5ENVA 2O50A 3WGGA 1I10A 3H3FA 4XD2A 5CPFA 3ZNOA 3HB4X 3PXXA 2CVOA 2VRCD 3T4EA 1IPFA 3UGKA 2ZCUA 1NHWA 3H9GA 1DC6A 2DFDA 5HS4A 3QQPA 5IZCA 3FWNA 3P19A 2GDZA 2W4QA 3PWKA 3QVSA 2I3GA 1AHHA 4E5MA 2G5CA 1EVZA 3EC7A 3PWSA 1PR9A 4CM5A 5T5QA 4HFMA 1SO8A 4NU5A 4ALIA 4BKOA 3VVCA 3H5NA 4EITA 1SOWA 2W8ZA 3M6IA 4BNJA 1U3VA 1ZK2A 1NQOA 3B20A 4YAIA 1ADCA 3I4FA 1N1EA 2C20A 2HMSA 2HRZA 3OQBA 2VN8A 4RZIA 1KC3A 3PHLA 4N5LA 4RVFA 4E12A 2LDXA 2DAPA 3WNQA 2JD1A 2WD7A 5HS6A 2RHCA 3C8MA 4J16A 3F9IA 3EVNA 2X0NA 4TZKA 3KYBA 4OM8A 1OZAA 1PIWA 1ZSNA 4Q3DA 2ZB4A 1QR6A 1IHXA 1M76A 1NBOA 4RLSA 3VPFA 1YL7A 1GYRA 2DTDA 4P4LA 3UICA 4PCVA 4L0QA 2UDPA 4A10A 2ZCVA 2DBZA 4KMSA 4AJEA 1HDCA 1CDOA 2XOXA 4PRKA 2HQ1A 1XG5A 3AFMA 3G3EA 4KTTE 2NVBA 4YJHB 4AJJA 3OSUA 3PHHA 3PK0A 4OQYA 4OYRA 3GDFA 1C0PA 1U7HA 1UXIA 5FI3A 4OH1A 3H9EO 2Y1CA 2DBRA 5CG1A 4D0SA 2DPGA 4WLOA 4YEDA 2JFGA 3RUCA 4ZRMA 3DBHB 4FCCA 4TSKA 4II2A 4XJSA 3K30A 1I01A 5CPBA 4QUKA 3G17A 2EW2A 3GUCA 1LDEA 3OA0A 2BGLA 3C1OA 4GGPA 3OIFA 1VL0A 1H0KA 3BZUA 1QYXA 4FR5A 1VL8A 3JQCA 1T2AA 3M2PA 1Y1PA 2O48X 2AHRA 4E33A 3TL3A 3OIGA 2B5VA 3MCVA 4INAA 4G81A 1GY8A 1EBFA 1U1IA 4MVJD 5DP1A 3RFTA 4EI2A 1GPJA 2X5JO 1EVIA 1ORRA 3PJDA 5KJCA 1V8BA 4C7JA 5COBA 1E5QA 4JK3A 4A73A 5BNIA 1MV8A 1R16A 2Q2QA 1VLLA 1CQIA 3S55A 3R3JA 3RJ5A 1C3VA 4YAEA 3RASA 5BSEA 4EW6A 4ZQBA 3M2TA 4AFNA 1FDWA 2ZTMA 7MDHA 3AJRA 3JQEA 1I3KA 2RBEA 1IB6A 3MJVA 4CM4B 3A28A 5DCWA 3VH4A 4XGIA 4KQXA 2YHIA 4ND2A 2B4QA 1E1LA 1B14A 1PR3A 3GVXA 3K9QO 5F1PA 3C1TA 1LEHA 1E3EA 3CIFA 4AG3A 3H2ZA 3O8QB 1Z74A 3FF4A 3QWHA 4BGEA 1P33A 4CR6A 3LT2A 5FI5A 1I30A 1N9GB 3ZZNA 4GKBA 1EFKA 4E5YA 3WIDA 4HNGA 2HJSA 1P74A 1GV0A 3KTDA 4J9UE 1UAYA 3JTMA 5G4KA 3BMQA 4I8XA 2PGJA 1ISMA 1E5LA 5GY7A 2VUUA 1DRVA 1TT5A 4RVGA 4N5NA 5I9MA 3RUIA 4WEQA 3BMOB 3GEMA 3I6QA 3GMSA 4WLEA 1E6WA 3RBZA 3W4KA 5A06A 5KJFA 2G0TA 2HO5A 4DQXA 2NQTA 3DBRA 4LVCA 2WYWA 4GL4A 2C7VA 2D4AA 4R1UA 1NPDA 4MKXA 4RVHA 1IPEA 1KEUA 4CM8B 1WP4A 3DMTA 4IMPA 4BV8A 5A5FA 3CSDA 1K6IA 4FFRA 1UDAA 4E2ZA 4WCFC 3JQ7B 3C3XA 2D5AA 1HYGA 1HDXA 2NSDA 2VNAA 4IBOA 4LCEA 2HK7A 4BNNA 3LF1A 1F0YA 2JAHA 5CDTA 5DNAA 1T2CA 3P5SA 4CV0A 1ZKMA 3MJTA 3ONEA 4J4TA 4CQMB 2C5EA 4WKGA 1VJ0A 5BQFA 3I52A 1B3RA 2VZ8A 2P9EA 4E32A 1XU7A 3D64A 2J6IA 4O0LA 3SBOA 3PLRA 4I5EA 2IEDA 5IFLA 1E7QA 3FBTA 2R2GA 3JD2A 2AQHA 3PDJA 4MO2A 3H5RA 4S1VA 4DA9A 3GRPA 3T7EA 4A03A 5LCXA 4FBGA 2O7QA 4ZN6A 1DOHA 1HLDA 1Z7EA 1HDZA 2OXIA 4R1SA 3V8BA 5J23A 4DLAA 3KZVA 3OJOA 1PJQA 2Y0DA 3I5MA 1U8XX 3WS7A 4UEOA 4DL9A 4R68A 5G4LA 2QRKA 4L76A 5DP2A 4BO2A 4IPTA 5I7EA 5BSGA 1YONA 4CMEC 2EERA 4HUJA 4D43A 3E9MA 1Y6JA 2DKNA 1L7EA 4DC1A 2BLLA 5EL0A 1NWHA 3VPGA 2NVUA 3LF2A 2HMUA 1NAIA 1QYWA 2CY0A 4IGEA 2CUKA 1TLTA 3KYDB 4UAGA 5FWNA 4R41A 2YDYA 3L6OO 4OSPA 1H5QA 1XWFA 1I2BA 1ZK0A 5LDGA 4BNTA 1HSOA 5F1OA 3VH1A 3D5TA 3EVTA 4WUVA 5EINA 4IIUA 2NU6A 3FHLA 1X7DA 3L4BA 4MVJE 4Z0HO 1LDMA 3KLMX 5ENDA 5G0WA 3H6KA 3UAGA 4ONEA 2FR8A 4PLWA 5JPIA 2IE0A 4W9NA 5EJ2A 3VZRA 5C37A 3K92A 3PTZA 3NDRA 1UP7A 4FJ1A 1ADGA 4YJHA 1SBYA 1Q7GA 1WMBA 5DOZA 1FDSA 1XHLA 2W98A 1E92A 4HFJA 3PP8A 4UVGA 1Q2XA 2IODA 2VWHA 3DB2A 4GI2A 4I9HA 2Y1EA 1LRKA 5IDYA 5ITWA 3S8MA 2NM0A 1W8DA 4QQRA 5TJ9A 4KUGA 2QX7A 4NMHA 3E5RA 2RH4A 2PTGA 3WB9A 1Y8RB 1HDGO 3LT4A 1LTHR 5F5NA 5KJ1A 3ICPA 1R4NB 1V3UA 1TB4A 5EQDA 4OGWA 3GNTA 1C14A 2XAAA 4WLNA 5A03A 1RM4A 4RVSA 1HZJA 4A0SA 4JBIA 1XSEA 4OQZA 6LDHA 1XYGA 2D8AA 3JYNA 3ROKA 1NAHA 1GUFA 4IDCA 2O4CA 1BWSA 2OOSA 3I9NA 1ADFA 3OMLA 4BO8A 3DHNA 4EGFA 1C0KA 2X4GA 4GX1A 3DZJA 1PWXA 3IOYA 3OJLA 2FWMX 4QO8A 2AEFA 4NNJA 5EN4A 4DTIA 4P4GA 2RIRA 1V0JA 1QLHA 2FN7A 2DQ4A 2Q99A 1RJWA 3TRIA 2Z5LA 3VZQA 2OO5A 4ILKA 2VOJA 2NTJA 1UXKA 4PLVA 3AUTA 3LK7A 1KERA 3NX4A 4I9NA 4CL3A 4FB5A 1UJMA 1G0OA 3AM4A 4Q3CA 1JVSA 2D5CA 2FHSA 3PRJA 1JW9B 2O3QA 5FF9A 1EBUA 4I5DA 4Z9FA 4CM3A 5H83A 4D46A 1YOVA 1Y9AA 1ZXLA 2YZ7A 3CKYA 3E48A 1N9GA 1P3DA 1YO6A 1Z6ZA 3FD8A 4R16A 3H9UA 4OOEA 3DZFA 1U3UA 5L7TA 4U8GA 1NVTA 4YA6A 4G2NA 2I99A 2ZTLA 1I36A 4KWIA 2B37A 2Y1GA 2IZ0A 3WGOA 3M1LA 2BKAA 1GV1A 2D1YA 3KRTA 3RQSA 4L73A 1P9LA 2J3IA 4M86A 4CL8A 1RYDA 4OIMA 1S6YA 1DSSG 3ZWOA 1SNYA 1TXGA 2PD4A 1P0FA 2NADA 2A9FA 4XDZA 3OQ6A 4N7RA 2JCVA 3ROQA 3RUFA 2PGDA 3VKVA 5JCXA 4G5HA 5HM8A 1LLDA 1WWKA 2CMDA 5T8KC 4C7KA 5TNXA 3CZRA 4DGSA 4ALNA 4DIOA 2SCUA 3B1FA 3WLFA 4XKJA 3WQRA 1D1SA 1DPGA 2IEBA 3RKUA 4CMCA 1T4DA 4NZ9A 4RO0A 2DM6A 2AE1A 1MXHA 3BTOA 1EVJA 3PIDA 4FOSA 3RBXA 3LLSA 1DFIA 2PFGA 2NNLD 4Y67A 4JIGA 3KYCB 1KEWA 4NJOA 4PG4A 1WAMA 4ALKA 1HETA 1K89A 3GGPA 3NAQA 3TOZA 3DC2A 3CINA 3ETEA 3RUDA 4Y9DA 4ND1A 2ZB7A 3FSRA 2C29D 3VC7A 1OBFO 3HDHA 4RF2A 5ILGA 1NQTA 3QY9A 2P2SA 3TL2A 4JJIA 5HWSA 4ZQGA 2CDCA 2O23A 2PZJA 2YJZA 5T67A 4JN6B 4BNIA 3ROPA 3GG2A 5DZSA 4U0JA 3ULKA 5JY1A 3CZMA 3L6EA 2J5KA 3WQSB 3PI7A 1LLUA 4PRLA 1UAGA 3E18A 1JDJA 4LCJA 1DB3A 8LDHA 3AUUA 3NUGA 5TLSA 4HFNA 4IQ0A 2B4RO 5I8WA 3ETGA 4K28A 1B8VA 3G79A 1NPYA 3I9MA 4E3ZA 1PS9A 1EUCA 4AJPA 3E5MA 4GLOA 1PGJA 2GZ1A 4XGKA 3FNHA 4URFA 4W7HA 5TRTA 2VOEA 3GRKA 3RROA 1X0VA 1Z73A 1V6AA 4PN3A 1YWGO 2DUUA 3G1UA 1LJ8A 3P2OA 4JGBA 4TZTA 2PKRA 2GERA 2VWQA 1UXHA 1ZIDA 5CDSA 2PD3A 4GH5A 4KDEA 3RBVA 2Q45A 1F17A 5BSFA 4UVDA 4DWVA 5CEJA 3V5NA 1EMDA 3S2GA 2YUTA 3JD1A 2GZ3A 2I3AA 5JE8A 5B4UA 4E4YA 3IC5A 4F45A 1IHYA 1NM5A 1PS0A 1Z75A 1ZJZA 2HK8A 4R1TA 4DRYA 3BXXA 4J4HA 1YDEA 1MFPA 2FMUA 1JA9A 2HMTA 5CHEA 3TQHA 4AJNA 1PGOA 1QYVA 3FNEA 3D3WA 2I65A 2J3HA 2JCYA 3NDIA 4XRGA 3EZLA 2JAPA 2FZEA 4IQ8A 4CM1A 2E4AA 5CFZA 2IXBA 3QW2A 4YYZA 3MWDB 1N5DA 3GQVA 2IZZA 3ONFA 4ALMA 3GC6A 4DMMA 4KUHA 1G0NA 2YY7A 4Z6KA 3EMKA 1K5HA 2VYVA 4FJ2A 3H3JA 2NWQA 3VTZA 5BSHA 4OXNA 2CSUA 4Z0TA 1JU9A 3O4RA 2NQ8A 2P5YA 1AUPA 3W8EA 1E6UA 1Y8QB 1E6EA 1H93A 5A05A 1ONPA 2QRLA 4MVJI 3DONA 4GX0A 4IXTA 5JS6A 4XX0A 4RPLA 3ANMA 4XYGA 4QFCA 4XJTA 4UREA 3AM3A 1YL6A 5I8ZA 3C7DB 1YB1A 3RWBA 5IXYA 1AN9A 1B7GO 1R4MB 3OIDA 4E31A 1BGVA 4FJ0A 4CQLB 1H2BA 3UCXA 3UN1A 3TN7A 2VZ0A 3TZQA 3ADOA 2Y67A 1IYZA 4BMVA 1XQ6A 5DULA 1AXEA 1JVBA 2TMGA 2HLPA 2NUAA 4Y6RA 3GEDA 4E2WA 2C5AA 3F1LA 5GMOA 4B3HA 4OJNA 1N1GA 1PQWA 2X0IA 2H63A 3SC6A 1O5IA 5JXWA 3K73O 4MP3A 2OBNA 1U3WA 5JMPA 5ER6A 3N74A 2OORA 2O3JA 4Z9YA 5L7WA 2B35A 3RIHA 2G82A 5CAEA 1N7HA 2FR1A 4WK6A 5A3VA 4CLDA 1MA0A 1M6WA 3EAGA 4P38A 4ZICA 1I24A 1HF3A 2FPGA 1MXFA 4IDDA 1R0KA 3U3XA 3ZDFA 4E0BA 3F47A 3VPSA 1CIVA 2ZKLA 4Q39A 3AFNA 1E3LA 3KEOA 1B0AA 3W6ZA 3CPSA 1GZ6A 3EZYA 4TROA 3ZWPA 4J3FA 5HTOA 1GDHA 3INTA 3I9JA 1YGYA 3RC9A 4DLLA 3CMMA 1C0IA 2J3KA
chains in the Genus database with same CATH superfamily
1QIGA 2IOFK 4MP8A 3VKUA 1PYDA 2WOOA 5DI9A 2X4LA 1CQXA 3INYA 4NV1A 4BKUA 1LX6A 2IOFA 4A6XA 1H4TA 1Y7IA 1FNDA 2OHFA 5LZ4A 2G7ZA 3HN6A 1XAJA 4B1FA 3AR9A 1BC5A 1TFRA 1U2DC 1ZEJA 2GYYA 2AXNA 2K5UA 2QGFA 2XYGA 4JP2A 4B9AA 3O1JC 5JI3E 4P53A 1Z9BA 4N12A 4R1LA 1CERA 2JA2A 1DRUA 1ZNWA 3K0SA 5HGXA 4D82A 4RF4A 5J4HA 3DT8A 5DNEA 1I5OA 4K3UA 4EHHA 1H22A 3VR5D 3N8KA 1RWKA 2Y05A 2PMCA 4DSTA 1HNNA 4HQLA 1GT6A 2ATVA 3BXFA 4MP6A 4JOCA 5CEFA 3CRMA 4WN9A 4IDBA 2QSYA 3KHUA 1YASA 4NG4A 3AJDA 3F4BA 3AR4A 3V32A 1TEZA 4TTSA 3TIVA 4ND3A 1DAEA 1XZGA 1U5BA 2JATA 3QFCA 1DP4A 1ZRMA 1PHRA 3SC2B 1JFLA 3V2HA 4ARZA 1GUZA 1HV8A 3KD3A 3OU2A 2GN6A 4GSKA 3RM3A 3KJFA 1Z28A 1ZUNA 4P58A 4DCPA 5I8PA 3VVMA 3HJTA 3WMGA 4RTMA 3OOJA 2R65A 5DBEX 1U2SA 2WMNB 1YIAA 3MCUA 4CHTA 2ZUBA 3M3PA 1H94A 1ZMTA 3HB5X 3KB8A 4P9NA 1VHJA 1BDBA 4KI0A 1X7XB 4RQTA 4AP9A 5KWJA 1OB5A 5JAZA 3T41A 1RXCA 5FL7A 3KV1A 1AKUA 1E8NA 3QU2A 4FDAA 4U6NA 5C4MA 4ZZ0A 5KTPA 1MAHA 2MDTA 2JGEA 2O8NA 4M89A 2YV1A 3GLKA 3JRWA 4NBRA 2C77A 1KY5A 3KEFA 3MBIA 4CCAA 1DDIA 1U5CA 1O95A 4X3OA 3K2QA 3B1JA 1VE6A 4QTTB 1CR6A 2Y2UA 3G68A 1UFRA 2EKPA 1DJNA 2HUNA 3OCCA 4O2AF 4YXWD 5KQRA 3KPYA 3L2OB 3H99A 3L02A 1USUA 3A6EA 3IQFA 4M54A 3T7AA 3SXUA 5F5XA 5HQJA 4EENA 1RZVA 3TZEA 1JQAA 2OQ2A 3VSEA 3B5IA 3U81A 4LOIA 1KE1A 3CKMA 3RSCA 3THXA 1J25A 1D0VA 3O4JA 1X7YA 3ZU4A 3DNFA 3S1LA 2R2AA 1C1XB 2AG0A 1XVVA 2I78A 1JZTA 2QPAA 1NVDA 4ZVTA 3ZHZA 2R60A 1U7ZA 4UASA 1BN6A 4PS1A 4X6YA 4JSTA 3WXBA 4F84A 4N01A 3BULA 5CJJA 5CMLA 1NJ1A 3KOYA 4KWTA 4CKYA 4YRAA 1VOTA 3RTBA 1DAKA 4PCUA 1NW3A 3IAFA 1UBSB 3II6X 4CDRA 4GICA 2OILA 1B6GA 3FTNA 5AM0A 2NOAA 2ILVA 1M1YB 1BS9A 1GPLA 3BUSA 1LD3A 3ETDA 5EOVA 1JWLA 2J87A 1XWWA 3WMXA 2EOAA 1KTIA 4KXQA 4NFLA 4XWGA 5FL3A 4CEIA 1UR5A 3DFIA 3AERA 2HJ9A 4D3FA 4A2WA 1QH8B 2RSLA 1F8FA 4IUCS 1V8FA 1B8OA 1OE0A 1YK0A 1XRNA 4RPJA 1QTNA 4Y6PA 1DRWA 3OY2A 2HFJA 4DZTA 3RRYA 2HLDA 1WVGA 1HL3A 4D79A 1MJGM 3H9CA 3VHRA 4BXOA 2O7NA 1ULHA 4A36A 4MX8A 1BG6A 2FOLA 4TLEA 1Q20A 4MZXA 1UPTA 1UWLA 1FU8A 3JQ8B 3OPYA 3WL8A 2WT8A 3Q9NA 3O5AA 3QBTA 3DE0X 5AVYA 4PZ9A 4Q21A 3MS4A 1L4GA 2CLEB 1ES9A 1XO1A 1OILA 1QYRA 3IIIA 1ISGA 2D5BA 3ADKA 5BT8A 1J8FA 4FSXA 3VSBA 5E6UB 1SKYB 2F1RA 3WWYA 1JRLA 2P0AA 2QSJA 5AQ1A 4X20A 2VYVD 4A6DA 1UP4A 5AM1A 4DANA 4LBVA 3M4JA 2RHMA 2PGNA 1TX4B 4YC7A 3UW3A 4TSRA 1THGA 1PKXA 1CS0A 1GPBA 2AFIE 5LC1A 3RUAA 4AKHA 2WIJA 2ZGVA 3HKBB 1CUWA 3K9WA 3LIIA 2Y1DA 5F5LA 5JNUA 2OB1A 2IS6A 3JW8A 2L69A 4HWTA 5ERGB 5KNLA 2J07A 4RXTA 3LPNA 2L2QA 5EWMB 5FBQB 3AHJA 3KQKA 2Z8XA 4LF4B 3NO4A 1BE8A 1GT91 4QXMA 4KQIA 2UZ1B 2HLNA 4X54A 3I37X 1PK7A 3VNRA 5KHLB 3ONVA 5EA2A 1D2RA 2YV3A 1PW5A 4Z51A 1Z68A 3GZ4A 8ABPA 1F2VA 1I6KA 2WVJA 4DLPA 3KJZA 3KQOA 3DDUA 4BGVA 3AHIA 3KLBA 3L84A 1RCTE 4ND5A 5H70A 2ZJ3A 5KOHB 1N7JA 2VBIA 5DHSA 1GRNA 2PUJA 4LJAA 2QN8A 4D3SA 2D1TA 4TM7A 5IDXA 4RSGA 2GRAA 3LCUA 1V3TA 1AQYA 1AQLA 1H05A 1MQ8B 1T5LA 2H5IA 4XSGA 3X0DA 4EJSC 3TUZC 2XDQA 5AHOA 1OLXB 1RXEA 3B1YA 2BGUA 3KPJA 3VR3D 2G9QA 1RKUA 4WKOA 3FN4A 4YGYA 3RVLA 4D7AA 3OLCX 1QMGA 4DLKA 4CEHA 3M6UA 1K7YA 3OOSA 3ELDA 4MW0A 3BRQA 2WNSA 1BVHA 4UVHA 2CN1A 1WU7A 4BLOA 3QU5A 1MJGA 1P8AA 5IEJA 1B26A 2CHEA 4OYHA 1NXXA 3EZGA 3ENVA 3K70B 1LTQA 4CMKA 4DUGD 2ZR7A 4A91A 4HRVA 3QU9A 1E3WB 4HDKB 4F12A 2W2QA 2R1ZA 4NTZA 4BQOA 1PT8A 3O75A 1BHO1 4OSOA 4UM5A 3Q41A 2IYUA 1RI1A 4G89A 3E4CA 1ZUWA 3MWFA 3H2IA 3CGGA 3OKPA 3E9RA 1Z0UA 4F86A 4CF3A 2G5TA 2PX4A 2FDRA 4AWAA 3SR3A 3F0TA 2RK3A 4RVNA 5C1PA 5I6DA 3GLGE 3ZGNA 5HF6A 4TV9F 2XZLA 4C4YA 3EIHA 4J9VA 5KOJB 5MN5A 3NFRA 1IOVA 3BA1A 5CBPA 4N3GA 3NHFA 4RZHA 1U0EA 1N3YA 2HSEA 3FW1A 1ZBQA 3MTGA 4LX0A 3VZDA 5LQNA 1PZNA 2X8BA 2D06A 4RACA 2B9EA 1OXUA 1PZGA 3PA8A 4U6SA 5TQJA 3X44A 1V2GA 1C9DB 1EVQA 2GK6A 2E5FA 3DMTC 1LS1A 4RKQA 1ZXBA 3EEQA 4L7QA 5J59A 2R1UA 3CEHA 1D1TA 1Z3IX 2JL1A 3LWDA 4QPDA 4D0RA 3O74A 4YBRA 4RZQA 3CKLA 5AI8A 3RTCA 1NBWB 4M1OA 1WD7A 3IEKA 1T0BA 3FMGA 4S0ZA 5JLAA 3R7WB 5ENZA 1G18A 2A1UA 1SUBA 4JENA 1Z07A 2O4UX 1QFJA 3OCVA 2CYCA 1JKXA 2CZCA 2NO9A 5LWHA 2XQKA 1J00A 3HBAA 5GOZA 4YMVA 3G88A 4QGAA 1BH6A 3L79A 3SNKA 2IITA 1P3Y1 1N6RA 1NQWA 1Z8FA 2B83A 4HY3A 3CGWA 1JHMA 4YGXB 1WV0A 1AZTA 1T9AA 4QVIA 4UUMA 4B73A 1Y5RA 3ZVNA 1V7PC 3LK6A 1NASA 5IH3A 3QM1A 4IAOA 1OREA 3TJMA 1F4VA 1HK7A 4JXZA 2WSBA 3D6JA 1ZIOA 4PIVA 1S3FA 3GLFA 2BGJA 2ZJ8A 3V42A 2DT5A 3JU3A 4DXAA 1UC4B 3BHJA 3OJFA 4WK4B 3R74A 5SZJA 3HUDA 1GL7A 1YNOA 4J75A 2HK6A 3LUKA 1V7ZA 4GOMD 3ZG6A 2V0NA 3OQHA 3N86A 1OYWA 2D1FA 1BXGB 1A4XA 5FUYA 4G5XA 1NR7A 2Q28A 5CTJA 1CRWG 5AK3A 5FOWA 4W5WA 5DCUA 3VSCA 2KWIA 4LNHA 2AFHE 4DV7B 3E4DA 5JU6A 2SKCA 2GARA 1XMVA 2B30A 2RHOA 5GJCA 3WLEA 3L6DA 4BMDA 3WGNA 2H00A 4EZIA 1LNQA 5U9CA 1Q57A 3K1AB 1VLHA 1EUZA 4FHGA 4P3OA 2VJPA 4HLUC 4HQ6A 3TTYA 3KZCA 1VHQA 1R88A 3R3ZA 4X0EA 3FKSD 3UKDA 1GCIA 3LXRA 4EK9A 3R8FA 2EXXA 2JCSA 3ZU5A 4C0KA 1G16A 3G2JA 5F2EA 3JSXA 3UWSA 3PQEA 4BLVA 4DV4B 3NHKA 3R3VA 3F78A 3ZDAA 3AY3A 3RYHB 1RI4A 1JLRA 3EFOA 2WWTA 5CW1A 4W1RA 3EX7C 2Q4OA 5C1DA 1Q19A 1H3EA 1WNTA 3RSLA 1XKXA 4W9NC 1IZZA 3AO0B 3FWZA 4OYYA 3THYA 2Z9DA 3FRJA 3EXEB 3Q15C 4PRYA 1I4WA 1JHQA 2O0MA 3V4OA 1P60A 3F6PA 4ZDWA 3FHTA 3GHYA 3AIIA 3C3KA 1RYYA 3IT1A 3NHUA 1M2VB 4GM1A 4QQNA 2P2GA 3B7GA 2FZCA 2J7KA 2RHWA 2XIQA 2VP2A 3BM5A 4B46A 4AYWA 4EPTA 5CD1A 2F8SA 1XR3A 2JPDA 4GOOD 2K7ZA 3V7FA 1T3HA 1HBJA 3MTDA 5DGTA 3G0OA 4LC9A 1QO0A 4LE1A 3JQFA 2OHXA 4B85A 4N9QA 1O97C 2JARA 1D5CA 1DC3A 1JEAA 7ADHA 1W34A 2H9IA 1DWUA 4EIWA 2K4MA 5KPJA 1PR1A 3RSQA 1NTOA 4LOHA 1NKSA 1QIJA 2WYVA 4HPWA 5FKJA 1KZ9A 3T5AA 2X77A 3OBIA 1XXHE 3SYKA 4D57A 5EP3A 2FWBA 1IONA 3T38A 2OV2A 2AYXA 4LZJA 4BTVA 4IVNA 3I0ZA 1E5TA 4H7KA 3DMGA 4BFTA 1OBOA 1X3LA 2JEZA 3GT3A 4AAYA 3SVTA 2HPZA 2FE1A 4UE2A 1DC7A 1N2CE 4WFJA 2YN2A 1RMTA 4K5QA 1LF0A 4UXHA 1YRYE 2I54A 3QKWA 3VR1A 1G3IA 1VKZA 2QI9F 4P4SB 3RSGA 2QROA 2AG6A 3DOOA 3OT4A 4GLLA 2P6NA 3M49A 3X2FA 2AOVA 3T9FA 3EBPA 4GO1A 1PS8A 4OOFA 4R54A 2NYUA 2YWCA 2L42A 2RHDA 5GPBA 2HDWA 4KYTA 2XMRA 3IIEA 5DWVA 3KR2A 5JISA 1LLCA 1SUCA 5J1SB 1EVKA 4JR1A 2C5SA 3P27A 1L5NA 2FNAA 4UHHA 1U94A 3RADC 5JADA 4KGZA 2Q62A 1AU9A 1JB1A 2V7TA 1BNCA 3KZKA 2UYCA 3O6VA 1CK4A 1P7ZA 1BO6A 2AOTB 1REQA 4MS1B 2XUPA 1OI3A 3MPOA 2GYUA 4C89A 1Q14A 2I8CA 3I76A 2J0VA 4M9QA 1ZCFA 1JTFA 3M5CA 4KR3A 3SKYA 1P3JA 3QLUC 1OWMA 4ZO8A 3T8YA 2X5XA 4PONA 1N2JA 1X86B 1W6UA 2ZTUA 5TQ0A 5A7HA 1WCIA 1XALA 2Q5IA 4NU8X 2FSGA 3ENZA 5EUQB 1U0BB 2PA0A 2C5BA 3GRYA 1Z2PX 1XCBA 1OA1A 4WNIA 3KOZA 5BQPA 1XEXA 1KOGA 2VPYA 2CLLB 2X58A 4UBIA 5TIIA 1E3QA 3HUEA 5C53B 5K8LA 4EUEA 4QX6A 1KK2A 3CUSA 2ZQYA 3GFGA 3JZDA 1YBAA 5E1OA 3SX2A 4MYRA 5JECA 4Q9AA 3OVMA 4PX9A 4JL8A 2R7AA 1B41A 3NUQA 3C3WA 4PV7A 2ATXA 4NSNA 2ZJYA 1TTTA 2F59A 3ZK8A 1XIVA 3Q11A 2QBYB 1F12A 2B6NA 2J6HA 1JN0A 2X7JA 3GJXC 5BN5B 3V2UA 3PLNA 4JC0A 2IYRA 5FUMA 1WM1A 3LHFA 4MLPA 4BLTA 2V4UA 1ZGAA 4LJSA 2H7CA 2W2MA 3NBKA 4N3AA 3ZDBA 3P5BA 3PD0A 4BPRA 3KU4A 1WSAA 2B8EA 1SIUA 4DABA 1Z2OX 3LKDA 1NNSA 2RAPA 5AW8A 1YDFA 3UFBA 5B37A 1ZK1A 3G7SA 3T7CA 4RJLA 3LUCA 1N8SA 5LP6A 4IDNA 3TRDA 3OLYA 5DYNA 1DKMA 2X19A 3FMIA 1D1PA 1HQDA 4ZAZA 2C4NA 1JXAA 1ECLA 2AMFA 2O3UA 3IMFA 3EZXA 3KUDA 4CG3A 5BNZA 3DF7A 3KLPX 2B3DA 4GLFA 2CVHA 1H2AS 2V5AA 3GU3A 1H8ED 1M73E 3VJLA 3ANLA 3DH0A 4C3OB 4D42A 4UHBA 1JQDA 4ZMSA 4BGPA 1L4LA 3HN7A 2JGKA 1PGPA 5K9ZA 3G13A 5KNCD 3I2FA 1XTPA 1Q6ZA 2PPLA 2OBXA 3W5BA 4KYUA 4Q4CA 2I76A 1VFNA 5FAXA 3U1TA 1M0WA 4E46A 2CUTA 2R8RA 3PFCA 4YRBA 2Q5QA 1VSUA 3URKA 1WTAA 4IJSA 1C9KA 3U4AA 5LU9A 4HMPA 2Z6AA 2PKWA 1BFDA 1Y7PA 4JT4A 3VYSB 1XJQA 1U2GA 2VYQA 2A67A 1QR2A 4CCYA 3ER9A 2PUFA 2PE5A 3NBFA 1NLZA 4DIUA 3HDGA 3FPLA 4OU5A 3VUEA 4F4FA 2WPDA 3AY6A 1MUUA 4QWWA 5L8VA 4E30A 3FHCB 4RTJA 3IQWA 4W8OA 3M6AA 1GTJ1 2ZIVB 4DBLC 5FEUA 2H92A 3OO0A 5KIAA 3L8DA 3OE7A 4Y9UA 4ZARA 3FAKA 1B1AA 3ND8A 3NVMB 1RAFA 3PEFA 2JW5A 3QYPA 2BGGA 5G53C 1SC1A 2P5TB 1KSHA 4XARA 2OZPA 4B43A 3PQ5A 3R9WA 1RQRA 2L82A 3WNBA 2QMZA 1JHPA 1GILA 3FPKA 2O2ZA 3MUEA 1PEAA 1T4CB 2DH5A 2QHXA 5H7XA 4UEKA 3P9PA 3NBMA 1F2DA 4NK5A 2XXAA 1W36B 1U3TA 4ZZ3A 1NURA 5JOQA 1BCSA 4MAFA 1GEGA 1W85A 3COPA 5E95A 4BO4A 2P3OA 3TXAA 3CWQA 4IDPA 4BO3A 4B6QA 4HGOA 3WSVA 1GRCA 2B1GA 4BMXA 2X8WA 3R77A 3HXLA 3EEIA 5ICFA 5IUNC 1MDFA 2VPWA 4HAWA 3VV2A 2TMYA 1H0HA 2I7VA 3GGOA 1N6OA 1U5AA 1TK9A 1WXXA 3AH8A 5GJWC 3AKCA 3DDOA 3VXKA 1ACMA 5KYNA 3H1BA 2XVZA 1ISFA 2V3WA 3DMPA 3IP9A 1NRWA 3JARA 2ONJA 4K2AA 3AG5A 2WJGA 3HDVA 2PXAA 1KK0A 5IKEA 4GE0A 4FCWA 5T41A 3Q12A 1G2OA 4C5CA 4MHTA 4RDIA 2HDOA 5CDFA 3ZEAA 2J4CA 2A5FA 4RXMA 4JKIA 1GPAA 1R0SA 1MPXA 1NXPA 1MIHA 3A1FA 4A16A 1G2PA 2JFFA 4WK0B 4BDTA 5M34A 5DFAA 5MHTA 1ZRSA 3ZHSA 1A9QA 4GLJA 4XVUA 1P2BA 2BKLA 3ZW7A 3MMXA 4HS4A 2ZUUA 4JQCA 5H9WA 5LXTB 2VQ3A 2V6GA 4PO1A 1GPMA 3EGCA 3AFGA 1TO2E 5LMZA 4Q1CA 5C3MA 1RAEA 2HOQA 4HXGA 2PZAA 4P54A 4BCDA 3OQMA 4B2LA 3DZBA 1X8JA 3T5DA 4DLUA 4EHNA 2FDXA 2XGSA 1VJTA 4X5OA 4ZYTA 3R5XA 2PANA 3KE9A 1OX4A 4RDCA 2V9ZA 1B2LA 1E6LA 3D43A 1BN7A 3PPIA 1RJEA 3C6XA 4O1HA 1KYTA 1N2XA 1S1MA 1T8UA 3TTUA 4F91B 1HRKA 5FA5A 2QR5A 1EQAA 3L9XA 1JA0A 3EXIA 3PQFA 3PL5A 3LA8A 3RS2A 3T1YB 1VB3A 5LXTF 1Z18A 1RSZA 3IQEA 3ZGYA 1UQUA 2GHTA 2V54A 1R4AA 1JDSA 5GV8A 4KKXB 1PF7E 1UBRS 3AESA 3A4TA 4MB2A 2IZ5A 3DHEA 3ZQJA 4C14A 1HE1C 4V38A 3H83A 3O1HB 2B1JA 5KS2A 3HVRA 2VSQA 2O1XA 1E4VA 2JJ2A 4NFHA 2HRRA 1ZINA 1QB8A 4UZFA 3IMKA 5IN4A 1RJ9B 4DJJA 4R6WA 3CF2A 3KKKA 1JKFA 3U62A 3GFBA 5A3SA 2R0QC 721PA 1GCOA 4YPOA 4WHMA 3AW8A 3NNSA 2GJAA 3USES 1PLKA 2ZWIA 3B12A 1IUNA 1DBWA 4EKDA 1QANA 3BYZA 5KVQA 1T2DA 1CWUA 3E6AA 5EIBD 1YVPA 2GRJA 4RKYA 2YJ6A 3PA6A 4YCNA 4O2BB 1IVNA 5DSTA 2WMOB 2JLXA 4Q05A 1OIXA 4K05A 3R41A 5IM4F 1LSSA 3PFNA 4YXFA 2C2ZA 3R7LA 3DM9B 3OLQA 2ACVA 4BATA 2NSJA 2D74A 2WZCA 4C4AA 1IZ0A 1XPRA 2HH9A 4R71A 4NECA 1Z5GA 4IWXA 2CFCA 4MEJA 3WYEA 5JQWA 1SZJG 4JJ4A 3NP7A 1Z5OA 2O5RA 3ICQB 3DO6A 5F4ZA 4FHZA 3UF0A 3W6NA 3G5UA 3ILHA 2AOUB 4E4RA 1Z22A 3V1MA 2G7MC 3KYCA 1XPUA 2FZGA 3DOCA 2J9YB 2GJ9A 2WM3A 4E94A 2HCBA 1NX6A 2E4YA 1P6XA 2BCEA 1M66A 1KTVA 2PEZA 5AVOA 2FWPA 2I3BA 4B8ZA 1USGA 4TMFA 3UVEA 1P91A 1Y48E 3A37A 3BMQB 2QB5A 5JNWA 2X41A 2VT7A 3JAWB 5EI5A 3AP3A 3QJ5A 3OZBA 4ZTUB 2EDAA 3PSHA 4G8BA 4EBFA 4ZVKA 2Y1FA 1U7PA 3GI1A 1TQ2A 1AZWA 4G5RA 5JPCA 2MYTA 4AJOA 2PSSA 2AFVA 1CYEA 2X6TA 4NOJA 4GKKB 3WGIA 4DIKA 3RODA 2Q8PA 3U1BA 1X6VA 2Y1KA 1TM3E 2Q41A 3FPSA 3UENA 3ZOKA 2C92A 4ZQIA 2JLAA 2I1QA 3G85A 3HHPA 3P2JA 1J97A 1EHCA 4O08A 2IP2A 4ZVOA 4RHEA 3KQUA 3G5TA 1FE8A 3UXYA 4P93A 2NPIA 3H19A 3QWFA 2EBFX 1GZ3A 1L4KA 1A2QA 2BFEA 1ZSVA 3OKAA 3P0EA 3B6EA 3INRA 4HBZA 3WSWA 5EY5B 1M2OA 2BDEA 2ONYA 3HYLA 2Q2WA 1XZHA 1GG5A 3TMKA 3V4RA 3E9NA 3PLAE 2JS7A 3OZAA 3TRJA 1MVNA 2DQZA 5K0ZA 1J5EB 1VSBA 4LYAA 4QEKA 1QORA 5THKA 1TYEB 2XUJA 3QBDA 3D1LA 3DJYA 1JNYA 1G9XA 3NHSA 3OSZA 4K88A 2GBLA 2J4FA 3S44A 1C4XA 4EJ0A 3AINA 4X90A 1I5EA 2FEPA 2TYSB 5FP0A 1K06A 4A1FA 4OFBA 3PG5A 1NXSA 3EJWA 4JJ8A 1PN3A 3SBDA 2H48A 2WAOA 3VVBA 1WVIA 2YIJA 3N58A 4UM7A 1OZ0A 1A7KA 2FSFA 1GL9B 1EX9A 3AEKA 4FN4A 1U8YA 4N5IX 4XD7A 4YS6A 4KSYA 4FYPA 5LLTA 3E82A 4H0CA 1WY5A 2EIXA 4CI0B 1L4EA 2XTNA 4X95A 4Y30A 3C87A 1YULA 4ZOLB 1NN1A 1TU4A 4HNHA 5DKFA 5IJZA 1LUAA 2FG5A 4CM7A 4UBMA 5CRIA 5EJIA 4DG5A 1PL7A 5FUBA 5B58C 2H2IA 2GPWA 1W0KD 2C0PA 3DL7A 2VDVE 2MSLA 3W5CA 4HD8A 4JBLA 1RBMA 3D4BA 3LT1A 1A8IA 3OJ0A 1P62B 3LLUA 4P4TA 3MT0A 1LLQA 1N8NA 2CVQA 4GMXA 3VR4H 4DMGA 1E98A 3ER8A 2CLMB 1ZCJA 2PG3A 2UZIR 2Z1NA 4QLAA 4XPIA 1EWQA 1LK7A 1X70A 2VP3A 3VRHA 3TG8A 2R48A 3WO0A 4N82A 3KUKA 5JZ9A 4O3MA 1W5EA 4BJHB 1B1CA 3PD7A 5AM3A 2C03A 1FP4B 1HYBA 2PX0A 1CR4A 2BUBA 4IGFA 1THTA 4ACAA 1IY2A 5JDCC 3PENA 3IV6A 4ZHQB 1Y5NA 4YDQA 4INJA 1NU8A 2NP7A 4EHLA 2NUPA 2D7JA 5G0TA 3Q8LA 2UAGA 4Q82A 4TRRA 2POQX 1HYEA 1TK3A 3V8QA 1SCIA 7YASA 3BWVA 4I55A 5K09A 4YUVA 3RVDA 3IILA 4AO7A 2JLVA 4H9GA 4LXXA 2NU6B 3KAJA 4JBNA 1Q0UA 2F9LA 3EXG1 3QJGA 4YHHB 1CB0A 2RGEA 2XMSA 1G60A 3SX0A 4NFYA 4BQIA 2PO7A 3JR3A 1EE9A 1UDXA 2HA3A 4QYSA 3ZNNA 4G9BA 4MULA 3PPWA 1LLFA 1T9HA 1RW4A 4DA7A 4ENPA 1HTBA 3PX7A 1HKUA 1A9ZA 2YJ3A 2ZZMA 2G4VA 3AKEA 1Q1ZA 2V6MA 3EJ6A 4LECA 4WGFA 4J29A 2BFMA 2RAFA 1T3GA 3EQZA 5AJYA 5CVJA 2QYSA 3LRXA 4UDOA 2ZUEA 4FN5A 5I7SA 2GZSA 3QVOA 4MA5A 3D8RA 3WYDA 2VHVA 2LRHA 3AYZB 4ZI7A 5IDQA 2YFYA 1US8B 2VAMA 2VI5A 3V33A 2J9RA 3R5HA 4DHEA 3G8YA 2OQVA 4GP7A 2YFHA 1ZU5A 2EEZA 1M1NA 3E3LA 3RKSA 3RW9A 5KQMA 4LRYA 2MINA 4IOMA 4LXYA 3ABIA 4FONA 2QMUA 5T3YA 2FPWA 3KJGA 3MCWA 4K87A 1SURA 3Q7IA 2A1TS 4JJ6A 5ALWA 1AHPA 3A6PC 5FOTA 2AXEA 4RIFA 2PD6A 2QTGA 3C8DA 1Q2UA 2GN8A 1PUXA 2G40A 4DEXA 1JALA 4QNNA 1CP2A 1SVKA 2PCJA 3EUAA 4JI4B 3DZHA 2WJJA 5EKUA 1DQPA 4MKZA 1EUYA 3EIFA 2COEA 2IRWA 2QPLA 2ZITA 2H5LA 2E1PA 2WUWE 4DNFA 2P9TA 1Z47A 4XTCS 1DIRA 3BGDA 4KNYA 1MC5A 1WY7A 4EL0A 4H17A 1IZ9A 4JB0A 3GVHA 4AYTA 1YJ8A 4EX7A 4XJXA 2GXUA 1Q77A 5LZ2A 4JLOA 1R6AA 1XMOB 3L06A 3CE9A 3EIOA 3I34X 5AKLA 5ARCA 4ND6A 1G66A 4XWOA 2LZ0A 3X1MA 2C2KA 1U9JA 1JG1A 1T9DA 4YT5A 2CL5A 4I8IA 4MRPA 1YMQA 5AHRA 4B4KA 1Q7CA 1UKAA 4PICA 4R5HA 3X1WA 5K4HA 1NMQA 3C7AA 4UCQA 2AMVA 3QPCA 4J1TC 1FLVA 3HCCA 1KJWA 3S27A 5EE5B 3SYNA 4CUJA 2Q49A 1GADO 2ZAIA 2B20A 1R6UA 3FNFA 2FJUA 2HIAA 3GAFA 2HCFA 1Y4UA 2XQGA 4QREA 121PA 3CSSA 1YQTA 2BFOA 2CYAA 3FA2A 3WWPA 1NJSA 3KPVA 1YFKA 3F6EX 2ACEA 1DCMA 1L8AA 2ZRAA 4B84A 4UUOA 4BQRA 4KZPA 3OTWA 3DL4A 1OLUA 3NVDA 3VH2A 2GZMA 3H1TA 1FRFS 1K7FB 4P34A 3ZJ5A 3ZVRA 4Y6GB 2GTPA 1ZKDA 5C52B 1O54A 2XCRB 1XEWY 4WCFA 1RTTA 2R44A 1GZDA 2B4TO 5DBIA 3OLVA 4CFYA 4ZFNA 4IOKA 2X9VA 3D7SA 1VECA 5KTKA 1E58A 3PQDA 1Q1QA 2WIFA 4JHXA 4JI6B 3TE6A 4ZQEA 1FA9A 2D1RA 4R2HA 1NIPA 2XE4A 1Y0BA 3VR6H 1QLWA 2F8LA 4CM6A 2Z5VA 3GRRA 5HRUA 4BFLA 2RDMA 1QKKA 1EJ6A 1IHPA 1Z36A 2L18A 1W87A 3QNWA 3RYTC 2MMGA 1AQ6A 1AUQA 2BKVA 3ELYA 4PLCA 1O77A 3QTTA 3W04A 4OKNA 2V7WA 2Y4NA 3A1UA 2XUZA 5BR7A 2V4ZA 1U02A 3LYHA 2AG5A 3OMXA 5C5IA 2B99A 2FSPA 2ZR9A 4MQEB 4V0ME 1FFDA 2X2FA 3VPCA 4TRMA 3B1XA 4X92A 1H69A 3A14A 1EZ4A 4WGGA 4JL5A 1SKAA 1KVRA 4RABA 4UDNA 2WICA 3TSCA 1QM5A 3ZUPA 3UT5A 3Q0TA 3RC8A 2E4VA 3NAGA 9ABPA 1JXMA 4U7GA 2FCRA 2BSAA 3V1TC 1MW9X 2VDLB 3HVHA 4MB0A 1IBKB 2PLAA 2OBLA 3AOEC 1NF3A 2UYYA 3HY4A 3U49A 1NTRA 1AHIA 3AYXB 4RCZA 2QNIA 2WHRA 3NPMA 4ZCLA 2WUVA 2EJVA 1QK5A 3BSYA 4ZOEA 3SIPA 5EP1A 5I3ZA 3EAQA 3HZZA 4GKVA 1V43A 2X14A 1A71A 2RHTA 2QKYA 2F4NA 3IELA 5JAIA 3FB4A 3A6KA 1Y80A 4E5DA 4HOYA 3TQTA 4ER3A 5KSWB 3SM9A 1MC1A 4A9AA 4YVFA 3BS4A 1RXWA 1EHYA 3EPHA 5HMMA 4EYSA 1GZ7A 5C34B 1A76A 3DAGA 3LLMA 5AVTA 1SVWA 4E7OA 3DT9A 1UBEA 2CEKA 1H9CA 1MRZA 3R6WA 3GLQA 4F93B 5JD3A 3EOAI 4BBZA 4PTYA 4LNUA 1CULC 2Q9CA 3HA5A 2VSFA 1K7XB 2OCAA 3LP6A 1V5FA 2WY2D 3WBFA 3UMGA 5KVSA 1ZDMA 2H08A 2ZR0A 3JPWA 5J2UF 3TW8A 1H2WA 5FWXB 2G28A 2J9XB 2WHPB 5AJVB 1HLFA 2GF2A 3DVLA 3OIYA 1KETA 4JMLA 3AY7A 4LZPA 4MJLA 2R6R1 5F1KA 5C2JB 2NX2A 2KJQA 2A5JA 4LBYA 3KKPA 4NBTA 1KZ1A 3QA9A 5HKKD 4ETIA 2NZVG 1W73A 2C3UA 4Q0MA 1E4YA 4E70A 3AEZA 2D0OB 1YI8A 1Z33A 1JI0A 2QTAA 3WGQA 4Z0PA 1ID1A 1U80A 1FS6A 3QHQA 5ADHA 2RGYA 3R5FA 1R5BA 4RY8A 3L7NA 2IF0A 1RIFA 4S35A 3HCDA 1YR3A 3LJKA 2YRFA 2HQSA 4MDFA 1TTHA 4O4HA 4CG2A 3AL3A 3FUTA 5KCMA 3QUTA 4DDHA 1JL3A 4R9NA 2HEGA 2ZIZA 3IRVA 1LXCA 2D7CA 2XA2A 2JHCA 4NC9A 2V65A 3E05A 1QH1A 4DIDA 4WRRA 2C4KA 2DWUA 3FMVA 4IXDA 2ZE7A 2P91A 4NIMA 1WHSB 2Z6UA 3CC8A 3AVOA 5I5GA 2DXIA 5LIRA 4OUDB 3LVBA 3CLUD 3FLMA 5JARA 4LZNA 1TMOA 3VTAA 4EY4A 3IXQA 4OI4A 2ZXEA 1DJMA 3AKZA 2OD9A 2Q3MA 3QMVA 1BW9A 1ZMBA 5EWLB 1YBHA 1GPUA 4M1KA 4L6CA 2FEAA 3K0AA 3V4ZA 3A58B 1QE5A 4XWAA 4BNXA 3E22A 1FLDA 1OHHA 3OFND 1Q12A 5BNTA 4H3KB 1SXJE 4I5GA 5JD4A 2Q6LA 2X1LA 2WAXA 2P41A 2GASA 1KY2A 4YRCA 5B58T 1XK7A 5DPMA 4NDZA 2A30A 3H5VA 4NPAA 3B38A 2G0AA 3MJ4A 4QUJA 1KO7A 2D2XA 2GZRA 3O8OA 4D9GA 3HTXA 2WG2A 1DLJA 2FE4A 3GA7A 3W0LB 3EIQA 1RLUA 1Z34A 2BFFA 3AHEA 4II3A 3GVIA 3L6RA 4YJ2B 5FRDA 1JMVA 2IBSA 1K68A 3IR5A 5F21A 1MAAA 1RLMA 4M9UA 1YKGA 3E3AA 3HWSA 1EGVB 2FRDA 3OU7A 3M9WA 1UXJA 2QD5A 3NTRA 5ALEA 1MD9A 1TVMA 4R69A 3UWPA 4IRUB 1G55A 5JLJA 2EGHA 3GEHA 1B15A 1T43A 1C3OB 5BUSA 2NLOA 4M9XA 4OEHA 1GP2A 3BMCA 4BHHB 4MI3A 1KKLA 1YVRA 5EVCA 2QLNA 5JH7B 1SBNE 1Z0AA 3L4SO 3QSGA 4P82A 5TQVA 2NVWA 1A9PA 3A1EA 3PZBA 2GZAA 2R6ZA 4MYHA 4CU5A 3PHJA 4E2YA 2G1UA 4UARA 4XQEA 5DX8A 3WV4A 3CN7A 2GN4A 1Q0HA 4L4XA 4P22A 4Y2PA 1VMEA 1PD1A 3OZEA 3UO8B 4QHTA 3ZWCA 1DKPA 4YCJA 5DASA 5DI3B 2PXXA 5DM4A 3TTVA 1DUSA 3LVFO 1U4SA 2WHYA 4HXEB 4AN0A 2CLCX 2C8JA 3B1VA 1FUKA 4E5NA 1KI6A 3A3YA 2WF8A 3IJ5A 1KYVA 1OT5A 1RHKA 4YRQA 3WDSA 1UKCA 2ZYRA 3KHSA 1I6WA 1OZGA 1XZBA 1T1RA 1ZD9A 2IY9A 2CC2A 2PWYA 1VJRA 3RRXA 1JKIA 3WR5A 3GT4A 3DZIA 3VSAA 4KPUB 4Q6WA 2E1RA 3BZWA 3IB3A 4J76A 1NG9A 1O5TA 1SWVA 2E48A 4H3HB 5I7HA 3MTEA 2FZ4A 4UEWA 4K26A 3B9QA 3UAWA 2PUBA 1MX3A 4DCSA 3IAM6 4E5SA 1XQWA 2I2FA 3CUVA 1P77A 1FMFA 1FDRA 1ZGZA 1GFZA 4FKBA 4KGVA 2NZXA 3PXCX 4JXKA 4MV7A 4W5JA 1BS2A 2BF4A 2WJWA 2LBPA 3LQFA 1CHNA 1D2GA 4TQAA 1L7OA 1RADA 4ZAVA 1JSXA 2VH2A 4WA8A 4AMZA 4J0HA 5MDHA 4RANA 4G25A 1X80A 4AG6A 2YXBA 1GGNA 4ZCPA 3QX8A 4BB6A 4EF6A 4YQFA 3VZPA 1R1DA 1ZM4A 1ATIA 3A9UA 3AFOA 2DULA 3P9QA 5CGQB 1XP5A 2PWZA 1GZ5A 2AQIA 4BNGA 3GT0A 1QP8A 5E2AA 5JALA 3ZY6A 4L51A 2PH3A 2X86A 2YQ5A 4HXFB 1NF8A 2BMDA 3VH3A 3CR8A 2I9KA 1NF9A 1ISPA 2V58A 1VIMA 3LQQA 1V9LA 3QFSA 1CUYA 4FD3A 4FHCA 3STVA 1J49A 1YVUA 3PT5A 3KWJA 4EVQA 4D26A 3CLRD 4TKUA 4NJMA 3ZWXA 5FJIA 2O0KA 3CEAA 5HBRA 2YFQA 4ZRDA 3DFFA 1RWBA 5K8JB 3TD2A 3A9WA 5A4KA 4D98A 3FCXA 2WWRA 4S2EA 2BMFA 2VRCA 3VPHA 1RWOA 4OO3A 2IU0A 4NENB 2FLKA 3FGOA 3HDJA 5E9JA 3GMDA 1L7XA 2FFBA 3I0MA 1GGFA 1MR3F 2QZSA 2IHNA 1T2EA 2OFOA 1DOZA 1UEIA 2BI8A 2NIPA 4G3XA 3OKCA 5FORA 4HUQB 1ZH4A 5E4TA 2IEAA 5AH0A 4YX9A 2QUZA 2EVWX 1KDVA 2X9GA 5K0CA 2V7XA 4DLYA 4HT3B 4WOKA 3ZZ0A 5KYYB 5CLFA 5HOQA 2ZBQA 4YWJA 2QE7D 3VU8A 3Q1LA 4C7XA 4CKEA 1P2DA 4BDSA 4IXMA 1GKYA 1G4UR 1QOPB 1WMDA 1L1RA 3RS8A 1YHNA 3QU4A 4Z3OA 4CMBA 1CUJA 2VBGA 2FZKA 1FRQA 1VDZA 3D0RA 4LRUA 4KQFA 4MA0A 2JEOA 2QLBA 1E2PA 1U8CB 1DX4A 1M2FA 2CVZA 3EGXA 1MH1A 3LKVA 3PQ8A 4MVYA 4QODA 4UD6A 3ZBUA 1WB6A 2YMMA 3GGDA 3UPUA 4LC0A 1WBBA 2DETA 1AGPA 5BVGA 3DV2A 2GF9A 3RVOA 1L6RA 421PA 2KLBA 2CT8A 3I04M 1PW7A 1EK0A 2C9YA 3FOAA 1WPRA 3DP9A 3ET4A 1ZLXA 1AT1A 2WAAA 3AGPA 3O1IC 3OJXA 4YRNA 4XOUA 2WFZA 5BT9A 3C85A 2BZ0A 2Q8NA 3CISA 1JR6A 1R5JA 2ODNA 4HDCA 4BNKA 4BP3A 4RKWA 1Z6TA 1V5EA 2FP4A 3QPWA 3R40A 4JFRA 4L3WA 4TVSA 2G4LA 1G8FA 4LKRA 1WXEA 5AUOB 4TZ0A 1O58A 3DE5X 1SU8A 4IM7A 5KJEA 3DYVA 3IAUA 3V6MA 5JATA 1T0PA 2XJ4A 2Q6VA 1QC5A 3LNTA 3N8DA 4IIHA 2G4CA 4DLTA 5B7GA 1VJ1A 3PFKA 4PYRA 4XZ3A 1EDOA 4QYWA 4UDXX 1JAZA 1ZMXA 1XZEA 1U65A 1O0SA 3A31A 3B6ZA 4FYKA 2ONKA 4HFRA 1ZLYA 5L3RA 4QOEA 4Z3KA 4PPGA 3A70A 2OLKA 3PZRA 1EK5A 4L74A 1RAIA 2X5NA 3D6MA 5JYDA 5L9AA 2GXSA 1JIVA 1T9KA 1QZ3A 1D6SA 1ZX1A 2KX7A 2P4SA 4IH4A 4LI0A 4WZBE 4N18A 1P1FA 2OV4A 4JXJA 5CDUA 1PJLA 1QH9A 3PPXA 5B1DA 2FFRA 4EFLA 1GVNB 3DOIA 3L6CA 5E0KB 2QX9A 4YT2A 4ITUA 4A2QA 3QWIA 3OAAA 4WT7A 3UCEA 5EJ9A 1GOTA 4RGBA 4UHKA 3UJBA 1W4LA 1T9ZA 1UJNA 5K8TA 4D8XA 2ZSJA 4U2BA 3V1LA 4NV3A 4DMUB 4CLOA 4WA7A 1MX9A 4K6GA 3KQPA 1VHTA 3S2IA 1N6HA 4S24A 4DPKA 1ZVMA 4RPHA 4HDMB 3M1YA 3ETNA 4DA4A 2X1VA 1FRZA 1G21A 1DKQA 3Q3JB 4U7JA 3QK7A 1H9AA 4O2AA 3H6HA 2I6TA 3Q98A 2PR2A 5LJIA 1J42A 5D1NA 4MLCA 2BMEA 1Q15A 3UG7A 1H4QA 1KZ6A 1MC8A 2CUZA 3H0EA 3M4YA 2QMHA 3ISTA 3W9UA 3FVVA 1JBEA 1P0IA 3I04A 4XW2A