3SLGA

Crystal structure of pbgp3 protein from burkholderia pseudomallei
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
347
structure length
334
Chain Sequence
b'KAKKVLILGVNGFIGHHLSKRILETTDWEVFGMDMQTDRLGDLVKHERMHFFEGDITINKEWVEYHVKKCDVILPLVAIATPATYVKQPLRVFELDFEANLPIVRSAVKYGKHLVFPSTSEVYGMCADEQFDPDASALTYGPINKPRWIYACSKQLMDRVIWGYGMEGLNFTLFRPFNWIGPGLDSIYTPKEGSSRVVTQFLGHIVRGENISLVDGGSQKRAFTYVDDGISALMKIIENSNGVATGKIYNIGNPNNNFSVRELANKMLELAAEFPEYADSAKRVKLVETQNRVPKIENTMQELGWAPQFTFDDALRQIFEAYRGHVADARALVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PbgP3 protein
publication title Crystal structure of PbgP3 protein from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 127
structure length 334
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3slgA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3slgA02
3BTUA 1GCOA 2AEJA 4R3WA 1IY8A 4EJ6A 3PGJA 3WNQA 2BHLA 4RZIA 2V6GA 1JLLA 4GSLA 1WAMA 3LVFO 5JSFA 3SLKA 1E3SA 4XKJA 1WZEA 2ZJ0A 3AU8A 3I9OA 5T8KC 2HLPA 5JFOA 2OXIA 3K96A 3JYPA 3HN2A 4YRAA 2FY8A 4AJEA 4CQMD 4E2WA 1NWHA 1BDMA 3FI9A 1H6DA 2E37A 2PKQO 2YW9A 3AUAA 4Y98A 4J90A 4TRNA 3NAQA 4KQWA 3GHHA 1HLDA 4RF2A 1GY8A 4Q3AA 1AHHA 4FN4A 2BGMA 3ROMA 2GN6A 3BYZA 4N5NA 4C4OA 2OBYA 4UUOA 2HRBA 4E6PA 2AE2A 3JD2A 4ONEA 3ZHYA 3JQBC 2JHFA 2UUPA 3GK3A 3G49A 2C2XA 4GWGA 3GRKA 4UAGA 1YL7A 5A1TA 3ZNPA 4LK3A 4R1NA 4OSPA 3PDJA 4XIJA 4MIYA 4FPXA 1EDOA 4MVJG 3ROQA 3U09A 4AG3A 1PEDA 4GX1A 1GEEA 4BO3A 1HEUA 1YQXA 3M2PA 3QJ5A 4L76A 2EW2A 1H0KA 2DTXA 3RAJA 3TFQA 4EYEA 1HDRA 3NKLA 1NP3A 2CVZA 1XR3A 4WJZA 3B1FA 2Q1WA 4HBGA 3S2IA 5FYDA 3ADPA 4HNGA 4FFPA 3SX2A 1TVEA 4D41A 1W0CA 3A4VA 4OM8A 4JGBA 2G17A 2NU9A 2VNSA 1O95A 1GYPA 5KCZA 3OIFA 1HETA 4WEQA 1KY5A 4Z3DA 3TZHA 4N7RA 2ZQYA 2WJPA 4DA9A 1SEVA 3D5QA 3NTQA 1U3WA 2OMEA 4S3MA 3W6ZA 5JDIA 2HJRA 1CQIA 3DC2A 4KTVE 4BNMA 3EZLA 2D5AA 2PH3A 3AUTA 1H94A 4WUVA 3HJAA 1ZK4A 1Q1NA 4II2A 1YXMA 3RC7A 4QT0A 4XGIA 3WX0A 2BGKA 2VTDA 2AEMA 2I9PA 3KEQA 3HB5X 3PEFA 4NH4A 2AHRA 3D0OA 4BB5A 3FSRA 1XQ6A 3GMDA 5J23A 1ISHA 4XJTA 4XR4A 1F8GA 4PLHA 4CUKA 2DC1A 3ZNQA 5JO0A 4XB1A 1GV1A 4JJGA 2SCUA 4YACA 4GKBA 2J5RA 4W99A 5LCXA 3ABIA 3KOUA 1PQWA 1B15A 1XYGA 1E5QA 2PK3A 3GNTA 2Q2WA 5L7YA 3F4LA 1XELA 1K2WA 3BXXA 1PGQA 1WWKA 4INAA 2B69A 2RBEA 5A05A 5LC1A 3UCXA 3KB6A 3OETA 5BNFA 4FGSA 3IP3A 1V8BA 2PZKA 3ULKA 1KVQA 1Z7EA 5JS6A 4L74A 3UFXA 1M75A 1QYDA 3BTSA 1JTVA 1NFQA 2PR2A 3ETEA 1BDBA 4Q9NA 1YQDA 3OM9A 5F3RA 2QZZA 3VDRA 4PCVA 5IDQA 2ZTVA 2IYPA 4JP3A 5G0SA 1VL8A 2O50A 4M87A 5DP2A 1SAYA 4WCFB 2JFFA 3C1AA 7ADHA 1ONPA 4WCFA 2XXBA 1OZAA 4J43A 4CMGA 1JW9B 1ZUD1 2LDXA 5EIOA 1K6XA 2P2SA 3ZU3A 2O2SA 3DBHB 4B79A 4BO2A 1DAPA 1DC3A 3RQSA 4IGFA 4Z0HO 3FWZA 3DZFA 3OJOA 5T6BA 1Y6JA 3EY4A 3RD5A 4HFMA 3I52A 4K28A 2IEDA 2NU7A 4LVCA 4R16A 1D4FA 4XA8A 1D1TA 3Q2IA 1X7HA 1NNUA 3ZWOA 3DBRB 4B4WA 3DBRA 3PWZA 1MX3A 1C0LA 2PGDA 5DDIP 1PQPA 3GEDA 4NK4A 5KJ6A 1KETA 4ROSA 4Z9XA 2O3JA 2WYUA 2NWQA 4AJ4A 2ZKLA 3ADOA 4YQZA 1YOVB 2DM6A 1Y9EA 1O0SA 3WTBA 4DUPA 4D7AA 1YBMA 3JQAB 4QO8A 4BNTA 4PRLA 3CZMA 3W8FA 3GVIA 4LSWA 1TI7A 4BQPA 3DFZA 1P44A 2HK9A 1ZBQA 3K6JA 4U0KA 1QKIA 5HA5A 4FJ0A 4BL5A 1DRUA 3IC5A 4PFJA 3HNPA 2BGLA 4RVDA 4L4RA 2VTEA 4YJFB 4EBFA 3U49A 1CJCA 2RH8A 2J3KA 4R01A 3WYBA 1XQ1A 4J16A 2HRZA 4JP2A 4PLWA 2EXXA 1AN9A 2W2LD 3GVCA 3TRIA 4DMMA 5JYEA 4UULA 4WASA 1BXGA 4EEXA 1PL6A 1O94A 3KBOA 1LA2A 1P1HA 1J5PA 4D45A 4BOYA 4KTTE 1X13A 3FN4A 4CM4B 3H2SA 4CM4A 4BGEA 1CDOA 3DWFA 4DIOA 1R4NB 2C0CA 4CM8B 4JIGA 3SVTA 4CM8A 2PKQP 3WFJA 5GZ1A 3G1TA 3WIEA 1DRWA 1ULUA 4OOFA 3AI2A 2GZ3A 2Q1TA 2Q2QA 2B83A 1BRMA 2HJSA 3DL2A 3S2EA 2P5YA 4BNJA 1HE2A 4K26A 4YJDA 4YYZA 4XYLA 3MTGA 3JQCA 4W7IA 3RCBA 3R1IA 4EUEA 3KEOA 5B1YA 1D3AA 3GC6A 1OAAA 3ZWNA 4J49A 4IXTA 4M8SA 4RQUA 4BO9A 4JJIA 1EQ2A 5AYVA 1P3DA 2EKLA 3M1AA 1HE4A 5FI5A 3L6EA 3HE3A 3LT4A 3OF2A 4I5DA 4ZVVA 1P1IA 4DPKA 5L9AA 3M2TA 1UDCA 1V6AA 3OJ0A 4F6CA 4R54A 2RCYA 2X86A 3E9MA 5IDXA 5ER6A 1VL6A 3ST7A 1AE1A 1FF9A 3R6DA 3H2ZA 4XQEA 3WWYA 2FZEA 3VKVA 1OMOA 1SPXA 2FSVA 2PZLA 5HWSA 1RYEA 5FI3A 4DLAA 3AU9A 5TJ9A 4HUJA 2J5KA 3KYCB 3UCEA 4BIIA 2VT3A 3KYCA 3QHAA 3C24A 4IDGA 4PZDA 1A7AA 3O8QB 5TLSA 3O8QA 1PZHA 3MOGA 7MDHA 5AXDA 3A9WA 4FJ1A 1AUPA 4KDEA 3ZNNA 1SO8A 2PWZA 5BR7A 3TJRA 4MVJD 3ASVA 1YWGO 2ZCVA 1KVRA 4U8GA 1FDTA 4CMHA 4CM9D 4JLWA 1A71A 5HTOA 1NPTO 2EW8A 4U0JA 1TLTA 4MKZA 4ALLA 5TSDA 2AQ8A 3RU7A 3HN7A 3HQ4O 4DXHA 4RVFA 2ZQZA 3GT0A 1N9GA 4QQRA 1FDWA 2Q3EA 1X0VA 5TF4A 1LDGA 3CE6A 4GVLA 2QG4A 1HE3A 1Y7TA 3F5SA 4J91A 4UVDA 3S8MA 3ZU2A 3JD3A 4MP6A 3DMYA 3P19A 1O8CA 5IG2A 5G0VA 4NJMB 1PX0A 3AOGA 1E7YA 4IIVA 4NJMA 4WLNA 5TC4A 3ZWMA 2YV1A 4LCJA 3ZHZA 4Z3KA 4AJ2A 1NWCA 3H5RA 4K6CA 2B5VA 4OL9A 3D4NA 3A14A 5CEFA 3W6UA 4P4NA 1IE3A 1DIAA 2HMWA 3UAGA 4JBHA 5FF9A 5LDHA 1L7DA 2DTEA 1Q7CA 3DO5A 3HADA 5ENDA 2PLAA 1EQUA 3SC6A 3WLFA 1BMDA 4RPKA 4EUFA 1EVIA 3I9NA 1N92A 4PN3A 3HG7A 2VRBA 4IS2A 2NM0A 3PHIA 3CUKA 2Z1MA 1E6EA 1K6JA 1VSUA 2J3JA 1VM6A 4RF4A 4AJPA 3WGTA 4E32A 1BTOA 1SC6A 2F1KA 1U9JA 3RUIA 3E8XA 4Y6SA 2CVQA 1IL0A 3ASUA 5G0UA 3H9EO 4FGWA 1ML3A 3L9XA 4ND2A 5DBFA 1AGNA 1E3EA 1O6ZA 4RO0A 4Z9YA 2PGJA 2E4AA 1VKOA 1HYGA 4GKVA 1LQTA 4FOSA 5JCJD 1I2ZA 1PIWA 1V0JA 3KRTA 2H63A 1DIRA 5GY7A 1N8KA 5ES3A 1PJBA 1IPEA 1U3TA 3ICPA 3X2EA 4EJMA 3LDHA 2GCGA 2GPTA 3RVDA 3VC7A 2PTGA 3H7AA 5IJZA 4OOEA 4U7WA 1DC6A 1BW9B 5EQDA 2C2YA 4N5MA 1BW9A 3RC2A 2CF6A 4DC0A 4DLLA 3VOSA 3ETDA 3UOGA 1P77A 4OMUA 4Q3EA 3V1YA 2JFHA 3OFSA 3ZW9A 1UXIA 3BHJA 4BNVA 5G2OA 1RM5A 5F21A 2AG5A 5H82A 2EHDA 4MVJE 3I9JA 4CLXA 1OC2A 5THQA 3GNSA 3DOOA 3WICA 4BHTA 4AJIA 2VT2A 1N5DA 4L4SA 1X1TA 4GX5A 5GMOA 4RVHA 3RJ9A 4R51A 1OI7A 3Q6IA 1GZ4A 1YH3A 3ZV6A 4FS3A 4PZEA 4WCDA 3U4DA 5T67A 3DTYA 1P45A 1HSZA 3ANMA 1NTOA 4ALIA 2DFVA 4B8WA 4GLLA 5L4NA 2PA3A 1E3IA 4BO0A 1E7MA 3JQ7B 3FWNA 2NV6A 6LDHA 3JQ7A 4YAIA 3VZSA 1P0CA 1WZIA 1BHSA 1T2DA 4XRRA 1ZW1A 1FXSA 3K30A 4J9VA 5IXSA 4P22A 1ZK3A 3ZWWA 4CV3A 1GL3A 3WS7A 4C7JA 4R5MA 5CDYA 3QVWA 1E5LA 4JBIA 4M89A 3N58A 2QRJA 4UREA 4LMRA 2P4QA 2Q1SA 3PDUA 2HUNA 4E33A 5ITWA 5BSHA 1LI4A 1NVMB 4FC6A 2QX7A 3QSGA 3GA0A 3JQAD 5JAZA 2X23A 1T26A 2CMDA 3EYWA 1JDJA 1LJ8A 3DBLB 1ZEMA 3DBLA 4GI2A 4KUGA 4TRRA 2GN9A 1ZJYA 4WPGA 2GO1A 4PLFA 2V65A 2P5UA 3VHRA 5BT9A 1WW8A 3I6IA 1DDOA 2AQHA 2X7HA 3VVCA 3INGA 2EKPA 1Y5RA 3R3SA 2DBRA 5DULA 4CM1A 4QSMA 3ANLA 3CIFA 1ISFA 1YBVA 2C29D 2YYYA 3C7DB 4MOWA 1TXGA 3PK0A 5JDIC 2VOEA 2YUTA 5B37A 5ICMA 3RKUA 4FFRA 3JQFC 3WJ7A 3WB9A 1R0KA 1Y8RB 4ZU3A 3ROPA 3OP4A 3IAHA 2WTBA 2VYVA 4WNIA 2EJVA 3H5NA 2B4QA 3GAFA 3RROA 5L7WA 1XU9A 4IQ0A 2IXAA 1PS8A 3H4VA 1XEAA 1NQTA 4ALJA 2O4UX 1PJQA 1QLJA 4CUZA 5AXAA 1JAYA 4CM3A 1RPNA 1Q0LA 2GD1O 3HUDA 3AM5A 4FC7A 3RIHA 2O3QA 1C0IA 5DCWA 1WVGA 4UEOA 1NFRA 5CPFA 4BNFA 3B70A 3L6DA 3P7MA 3AK4A 4KWIA 3V2GA 4E5YA 4BGUA 3RC1A 1ZK2A 3DQPA 2BD0A 1ZCJA 3AUSA 5AOVA 3H9GA 2XAAA 1SMKA 2X4GA 2BFMA 1SOVA 4MDHA 3O9ZA 1P31A 4GGOA 4BO7A 4UUNA 2VZ0A 5FFFA 4BVAA 2E6UX 5U9CA 1W4ZA 3AY6A 4AJOA 3B6ZA 2OO5A 3JYQA 1VPDA 4CLOB 3HDQA 4ESOA 3OIDA 4CLOA 1JU9A 3GDOA 3LZ6A 5KOIA 3TFOA 3MWDB 4RORA 2JD0A 4BNWA 1HKUA 2JD1A 5L40A 2FP4A 3L07A 5TS3A 1BVUA 2AQIA 4HFJA 1NPYA 4BO6A 3QLJA 4D3FA 4JN6B 5EL0A 1T2EA 4TZTA 2WE7A 2VHYA 4UVEA 4B3IA 3ONEA 3UHAA 3DHYA 3G3EA 1K89A 3PIDA 2PV7A 4RL6A 4OQZA 2DAPA 2NVUA 2PY6A 3UW3A 4PLZA 4RPGA 3F3SA 1ZVMA 4A2CA 4E5PA 1PSDA 1I5RA 2PZJA 2V6MA 2WEKA 2FR1A 1NVTA 3P2OA 3H65A 5JMPA 5A9SB 3C85A 3L6OO 5A9SA 5FEUA 3KSZO 1B8PA 2Q46A 3IUPA 2BFPA 3DEYX 2GN4A 3UVEA 4OXNA 4UVIA 4NR0A 4R9RA 3U4IA 3LC7O 3FTPA 3H6KA 3DB2A 2P68A 3QE3A 5BNIA 2O3SA 5C7IO 3WGIA 2DBQA 3L4SO 4I9UA 3MJEA 3ZWBA 3E5MA 3ZN2A 1SOWA 2DQ4A 4OKIA 4J6FA 3V1UA 1NVGA 2AW5A 3WGGA 3KV3O 3GRPA 2I5PO 3KTDA 1WLYA 4E2YA 3P2YA 2GDZA 3GGGA 2X9VA 4XQGA 1ZXLA 3KM0A 2VN8A 1ISJA 3PFWO 1NXQA 2XF8A 1YRLA 3QWHA 1L7EA 4D3SA 2OFPA 4X54A 2GR9A 2YJZA 1K3TA 4XYGA 2X8LA 5IN4A 3JQDA 3NTRA 3TPCA 5G4KA 4D42A 3TOXA 2ZTMA 2V7PA 4GGPA 4IMRA 1ID1A 4AICA 2DU8A 4GVXA 1YONA 1N7HA 2POQX 4DQXA 5CP8A 3JQ9A 2EJWA 5T64A 1IULA 2WYWA 3NUGA 2HSDA 5EINA 2EWMA 3PLNA 1YBAA 1ZK1A 2Q45A 2ZIZA 4CR7A 4RDHA 4MP3A 1DEHA 3DAPA 4ZRNA 1HT0A 3LQFA 1NHWA 3T4EA 2BFAA 3BHIA 1KEPA 3QV1A 4G5HA 1U28A 3EVTA 3GFBA 5AXCA 1E92A 3OJFA 4ND4A 4AJHA 2AA3A 2DUWA 3WOHA 4BGIA 2G76A 1LDMA 4M86A 3NDIA 3PJDA 4NFYA 1WPQA 3D4OA 5EN4A 4DGSA 4JJFA 4NI5A 3B1KA 3IDSA 1X0XA 3TWOA 3AI1A 3BAZA 3I4FA 2W8ZA 5A03A 2Y1DA 3AFNA 5DT9A 2HCTA 5GZ3A 5IFLA 4FDAA 1UP7A 1O9BA 2D4AA 3GMSA 3Q1LA 1T25A 4JK3A 1H5QA 2O3RA 5F1OA 3FBGA 2O7SA 4H15A 1BXZA 3BMQA 4J7XA 2OP0A 2OOSA 1CERA 3CZRA 3VAZA 2JAHA 4MO2A 5I8WA 4OO3A 4OXYA 1ZMTA 4WLFA 4B3HA 5IZCA 2IXBA 3S55A 3W4IA 5U1PA 2WD7A 2BLLA 4P4GA 4HY3A 3RUAA 3A1NA 4KMSA 1QSGA 3JQFA 4K6FA 3ZNOA 3I83A 2QRLA 2BRUA 3LYLA 3FHLA 3OHSX 4MIEA 2B0JA 1SNYA 4J9UE 4RJTA 3E5RA 1U8FO 3E18A 2Z5LA 5C7OO 4BNLA 1S6YA 3Q9NA 1E1KA 2VWGA 4CR8A 2JCXA 3DXFA 4KOAA 5JNLA 3UH1A 1WMAA 3GGOA 4A26A 1QYVA 4NHEA 1T4BA 4HX5A 2HAEA 3ZU5A 3CXRA 3TZQA 4TRJA 2FHSA 4Z9FA 5I7FA 2X0NA 1PGJA 2Y1GA 1B26A 1V3VA 3DOJA 2JL1A 5MDHA 2AMFA 3RUDA 2X6TA 1JWAB 2YDXA 1K0UA 3K9QO 3MOIA 2Q99A 1PL8A 2RHRA 1YE3A 2VYVD 3EK2A 5T57A 4ALNA 5KVSA 1DHRA 5COAA 4NBTA 2FZWA 3W8EA 1I3NA 3JQ8B 3PVZA 2CDAA 3JQ8A 3WMXA 4DPLA 3OQ6A 4DBZA 1HWYA 2BFOA 3PQDA 1XA0A 4IM7A 4J4TA 1UR5A 3WGHA 1U8XX 4CJXA 9LDTA 1AHIA 4Z6KA 2DPHA 1LSJA 4W4TA 5I7VA 4NFSA 4YPOA 3GN2A 1IHXA 2P4HX 1DRVA 1YL5A 4K1LA 4A7PA 3V5NA 2PNFA 3ZV4A 1E3WB 1GFSA 1R6DA 2X22A 3E48A 1E3WA 4G81A 1ZXBA 4W7HA 1YDEA 1EMDA 2NVBA 4IJVA 2VHVA 4YBZA 4L0QA 5BQFA 1J4AA 1ONNA 1U5AA 2IODA 3V2UA 5L51A 2GYYA 1LXCA 4J0FA 1I01A 1NM5A 4E30A 5DOZA 3UUWA 3TF5A 1NQ5A 3DMTA 1VLLA 1KVTA 4XCVA 3O4RA 4F45A 1DLIA 1TB4A 1ZNQO 4E2XA 5CAEA 3P5SA 4GX0A 3HWRA 5TRTA 4NDNE 3PQFA 4B8ZA 5TX7A 3CH6A 3VPHA 1IOLA 3ZHXA 3WQRA 3WGZA 5L53A 4YT8A 3DR3A 1I3MA 2O2YA 4CMIA 4OH1A 1GZ3A 2CZCA 2UAGA 2QZ9A 3I1JA 4FFNA 3UGKA 3Q11A 2JJYA 5KVQA 3RUFA 4YQYA 1OOEA 2NUAA 3JD0A 1PGNA 1X15A 2GF2A 2HMTA 4MKRA 2VRCD 3GPDG 1R16A 1ZO8A 2RAFA 2BKAA 2Q49A 2UV8A 4YVFA 3WSVA 4Z0PA 2NTNA 3W8DA 3ROKA 3KLPX 3MEQA 3AFMA 1E1LA 2F00A 1LLCA 1VC2A 3HDHA 4IIUA 3LT1A 4ZRMA 4BO4A 2VWHA 3KVOA 3NDJA 5JAIA 3U62A 4BGVA 4DQUA 1X7GA 1SZJG 1I24A 3GFGA 3PZBA 4ZQBA 2NTVA 1BXGB 1IYZA 2NNLD 4FFLA 4NBVA 3QA9A 5COQA 1TT5A 3C8MA 2B35A 3VZRA 3E9QA 2EKQA 4WLOA 4LISA 3ITKA 4ND1A 1R0LA 3GDFA 3JYOA 3OSUA 3DHEA 3ITDA 3RFTA 1RWBA 4Q39A 4J1SA 4IGEA 4RVUA 4ZD6A 3RC9A 4D3DA 2YV3A 1SEPA 4NIMA 4J0EA 3DZIA 1A72A 3DAGA 1E77A 4FR5A 4G2NA 3LC1O 3GVHA 1ZFNA 5TJHA 3FR8A 5THKA 2TMDA 1PL7A 1LDEA 2Y0EA 3D3EA 3F46A 3G1UA 2G5CA 5CFZA 1UDAA 2X0IA 1B8VA 5ITVA 4Q3NA 2D59A 4L73A 4AJKA 5K0ZA 5JXWA 4JQCA 5A9TA 3CKYA 4BUCA 4IJKA 4QXMA 2GN8A 3K2BA 3NV9A 1UP4A 3V1TC 1MUUA 1DFIA 4RVGA 4MIOA 4CMKA 1GPJA 2A94A 4RVSA 4I8XA 3IJRA 1NHGA 3VH2A 2YZ7A 1U2DA 1NX6A 1SB9A 3AW9A 1DXYA 2VZ9A 1I30A 1EK5A 2YV2A 4IBOA 2JAPA 4XIYA 4BB6A 5FWNA 2VOJA 4J2OA 1UUFA 5JCXA 2GUGA 4HNHA 1BSVA 1GDHA 4BO5A 3H9QA 3JQGB 3VPSA 3JQGA 2P91A 4BO1A 1E7RA 4QFCA 4DRYA 2JD2A 3IJPA 3DHNA 2NU6A 1O5IA 4F3YA 5IF3A 1Y81A 2OORA 1U7HA 4J2HA 1AXEA 3PJGA 3WYCA 5A9RA 4DVJA 1N9GB 5AQ1A 3GUYA 4YJGB 2O48X 2QYSA 3O26A 1HYEA 4YJGA 5G0TA 1VJTA 1GUFA 2A92A 1LNQA 3EZYA 4TVOA 3ZU4A 3VVBA 3DOCA 3E1KA 2FR0A 3EVNA 1EUDA 4NBUA 5EJ2A 1F12A 4U6QA 2Y0DA 5KIAA 1Y1PA 4WLUA 4Y6PA 3G79A 4PLCA 5A5EA 4B4UA 1WDLA 2BH9A 1NYTA 3OECA 3BMCB 3FD8A 3K8ZA 1YJ8A 3BMCA 3H8VA 4BMVA 3ZWVA 5A06A 2D3TA 3QWFA 3B1JA 4I08A 4YJHB 4E31A 1UAYA 4YJHA 1LRKA 2YHIB 2P9CA 2YHIA 3WFIA 3QP9A 4CM7A 4MVJF 3DZGA 4YA6A 9LDBA 2Y99A 2CUKA 1I3LA 4FFOA 4IS3A 5TT0A 1GQQA 2OZPA 3JYNA 2DTDA 1MFPA 3ZGYA 2B37A 5HM8A 4D46A 2VYNA 1EVJA 1ENPA 3EDMA 1YB1A 3KYDB 2CD9A 3KYDA 3GNQA 5I9MA 2IZ1A 5F5NA 5F1PA 2IE0A 2W2KB 2W2KA 3RUEA 2B4TO 1R4MA 3E82A 4O6VA 4YB8A 5B12A 5I7EA 3A28A 5TQVA 1QMGA 3AOEA 4KWHA 2JHGA 2DUUA 3FRJA 2OP1A 3RASA 3WSWA 4OGWA 1NBOA 4HP8A 3WLEA 3Q2KA 8ADHA 1Z74A 3RJ5A 2J3HA 2ZYAA 4RGBA 3FNEA 3G0OA 1JKIA 3UF0A 1BG6A 5A3VA 1P1KA 1GAEO 2A35A 4RLHA 4LGVA 1KEWA 2ZYDA 4NK5A 4NU6A 4DTIA 1L1FA 1EUCA 4CQMA 4Y9DA 3GEMA 1NFFA 4LN1A 3MZ0A 3I4CA 1Q0QA 3QVSA 3FBTA 1H6AA 4L8VA 1V35A 1LDNA 4R1SA 3JQ9C 3X2FA 4A0SA 4XRGA 3QWIA 1HDOA 1BGVA 2ZB8A 4RPLA 4CMCA 1R66A 1WDMA 4D79A 3R3JA 4KQXA 4TWRA 5HS4A 4DPMA 2WE8A 4RQTA 1H9BA 4EI2A 1Y8QA 4IQGA 4CLDA 2EF1A 1LSSA 4ITUA 1B2LA 3ZCXA 1LLUA 3E6AA 3GZ4A 4BQRA 4E4YA 4E12A 2X58A 1PJTA 2HMVA 3L4BC 1HZJA 2W98A 1X1EA 1NASA 2HO5A 4CMBA 2Q1UA 5JE8A 1CQJA 4DQVA 5KJFA 1DFGA 2EIHA 1I8TA 4YCAA 4J7CA 3ZWXA 5HRUA 4MP8A 2DPGA 4ILKA 1E7SA 4YT4A 1ULSA 3COSA 1ZIDA 2LDBA 3TN7A 4YAJA 5CDTA 5KJCA 3F4BA 2QW8A 3K92A 3D3WB 3D3WA 4LSMA 4NFHA 2HQ1A 1H2BA 3CPSA 2X9GA 1UZMA 4PG4A 2C59A 4BKQA 1MP0A 1HXHA 1UXKA 2JFGA 1PTJA 5JBIA 1JN0A 1EVYA 3OIGA 5L95A 3MJTA 1MXHA 4MKXA 3OBBA 4IDFA 4FJ2A 4QTZA 4D43A 3IMFA 1LSOA 3TSCA 3LLSA 1PGOA 1E7WA 2Y1CA 3GEGA 3QVXA 4ALMA 1PGPA 4A10A 1SCUA 2YFHA 4MVJH 4XYEA 1VJ1A 3WBBA 3WGYA 4XGKA 4URFA 5IZCC 3FNFA 5CEJA 5ADHA 2NADA 4W9NA 5IZ4A 1N1GA 1C14A 3KO8A 1VE9A 1F14A 1ENZA 3CINA 3IP1A 1PWXA 3JTMA 2ZB4A 4PVDA 5IN5A 2Q50A 4WECA 4E13A 3GPIA 5ILOA 2PKRA 1LLQA 3IQDB 3W4KA 4R68A 5L3ZA 1Q0HA 1QXSA 2A4KA 1J0XO 3ZI0A 2Z95A 1T2CA 1K5HA 3MJ4A 3OQ1A 3OJLA 1ISIA 4XB2A 1C3VA 4CL8A 4GWKA 3TQHA 1CEQA 4FBGA 4A5OA 4D44A 3VZPA 1ADGA 1LX6A 3O03A 1CIVA 1T24A 1A9ZA 2CY0A 3JD4A 4M55A 1PJLA 4CR6A 4BNYA 1FJHA 2FPIA 4XQCA 5BSFA 2D5CA 1XIVA 5JMWA 3ZV5A 3EMKA 5KJ1A 4UEKA 4YR9A 3PP8A 4Y8VA 4B7UA 2BI8A 1DHTA 3ZH2A 1HRDA 2FRDA 4E0BA 1KBZA 1LEHA 2AXQA 2PD3A 1GQYA 1VJ0A 1IHYA 3K73O 4XWYA 2H9IA 3K2EA 2VUUA 3DFUA 2BI7A 1HDYA 4QECA 3ORFA 1LRLA 3WMWA 1YQGA 3M6IA 3HDYA 5CG1A 3C7CB 3D64A 4UEJA 4DL9A 3I5MA 3WNVA 2YDYA 4CLHA 3W4JA 1KEVA 1P1JA 2HU2A 3H3FA 3WWZA 4AJ1A 4JBGA 1T2AA 3GOHA 3VDQA 4E5MA 3U0BA 2D0IA 4CODB 4LW8A 3B20A 3QRWA 3DONA 1PS0A 2NVUB 3N7UA 3SJUA 4AFNA 1XHLA 1XG5A 2FR8A 2CSUA 1U4OA 4JCOA 5DNAA 2C5AA 3QY9A 2NU8A 4BNUA 4CPDA 1EE9A 3GH3A 1A4UA 4PG5A 3F5QA 2FN7A 3DMTC 3PYLA 4A73A 4F6LA 4UUPA 1RM0A 4BKUA 5EESA 1C0PA 4R1TA 1IZ0A 3JSAA 3GG2A 3KSUA 4E5KA 1FDVA 1C0KA 3GHYA 4F46A 2OHXA 4H16A 4PG7A 1EBUA 2YQ4A 2A9FA 3PFFA 1YJQA 1D1SA 2DLDA 3SC4A 1LUAA 3RFXA 1MC5A 3DBVO 1FDUA 4HFNA 1ZSYA 4QFDA 1P9LA 4LMPA 3UICA 1CRWG 4RPJA 4CV0A 1PJ2A 4OJNA 3ZZNA 3LT2A 2VUTA 1VRWA 1RM4A 4E5NA 2HK8A 4RF5A 2WYVA 3TZ6A 2DBZA 5JDCC 3WIDA 5DCYA 1PJ3A 5EMHA 1I3KA 4D0SA 2HDHA 3CEAA 1JWBB 5EERA 1Q7GA 2Y67A 3NGLA 4I5EA 4L4XA 4XYMA 1PJSA 1X7DA 1YGYA 2DBVO 2EP5A 3Q9UA 3RI3A 4MJLA 5TT1A 3GN1A 4TKLA 4MVJP 5G4KB 1XGKA 4IXWA 3PQEA 2VYND 1LQUA 3D4PA 1EZ4A 1PZEA 5CHEA 5ENVA 5HBRA 2HKIA 4O63O 1UDBA 4J4HA 1LDYA 2X5OA 3JCZA 3FNHA 1GYRA 3VPGA 3DAFA 3O38A 4E21A 2I3AA 3IKTA 4YRBA 1UXJA 1F06A 3HZZA 1EK6A 3AM4A 1LTHR 3AY3A 3ZV3A 5L45A 3RBVA 3PGXA 1M6WA 3DZKA 1U5CA 4HWKA 4XJSA 4IDAA 3WGQA 1E6UA 1T4DA 1ZMOA 1ENOA 5A02A 2X1HA 4B3JA 3PLRA 4PZCA 3QW2A 3K5PA 2VCYA 3I6QA 1W73A 3L4BA 3KXDA 4IMPA 5C37A 1GCUA 4OXKA 4JNKA 4FB5A 3F47A 3TNLA 1Z7BA 3WXBA 4AVYA 2E48A 1DLJA 1IZ9A 4WLVA 3RBXA 5JYDA 4KDFA 4O0LA 2VWQA 1WDKA 4GQAA 3PWSA 4FQ8A 4LRSB 3R0IA 4N5LA 1HF3A 4NJOA 1MG5A 1EUZA 1B7GO 4NBWA 2I67A 4EGFA 2C54A 4BNHA 2WD8A 2UDPA 5GZ6A 4ND5A 4RZHA 1G0OA 3EUWA 1N2SA 2FMUA 2D1YA 2YFQA 3L77A 2G82A 2UUOA 2I66A 2VHXA 2C82A 4H7PA 5ICSA 5KKCA 5C7LO 3GY0A 4NMHA 4GMGA 5K6AA 3KETA 1B8UA 5C5IA 3BMQB 2PGLA 2QQ5A 3L0DA 2P9GA 1NAIA 1YS4A 1JKJA 1M66A 1P74A 2ILTA 2FOIA 3LK7A 3QWAA 1C1XB 4MVJA 1EDZA 1C1XA 4I5GA 1OC4A 2R00A 4BKRA 2ZK7A 2Y66A 4CM9A 2EP7A 3WQQA 1MFZA 1T1SA 3DZBA 1G1AA 3IUSA 3JV7A 1QV7A 2CVOA 3PYXA 4FD3A 1ADCA 1JVBA 2Q2VA 2WD7B 2J5QA 4WKGA 1ISMA 1I2CA 2C7VA 4YEDA 1DSSG 2NTJA 5JPIA 1JQBA 4O5OA 1GR0A 2WDZA 3GVPA 1UZLA 3D1LA 3GDGA 4L9RA 2V6BA 3F1KA 2QRKA 3TL2A 5JO9A 1HE5A 4ZQEA 5A3JA 4CMEA 1KS9A 4I9NA 4R1UA 4NG5A 5I7SA 4LRTB 3AUUA 3PHLA 2I3GA 5BSEA 1RJWA 2Y05A 2X9NA 5B4UA 3RBZA 3W1VA 4J1TA 5CPBA 1UXGA 3QVOA 4GBJA 2NVWA 3PWKA 2RIRA 1PZFA 1T2FA 2FPGA 5B4VA 4YAEA 4S1VA 4AL4A 4E3ZA 1HDXA 2HK7A 3LT0A 1XDWA 4WK6A 2H1SA 1TEHA 1GTMA 1SB8A 4XX0A 1E3JA 1U3UA 2I99A 4FSHA 2C07A 1OFGA 5I9NA 5H83A 4R41A 6ADHA 2GNAA 4Y67A 4NPCA 1M6HA 3FF4A 2WSBA 2V6FA 1H6CA 4KUEA 3U3XA 3UXYA 1B14A 4PG6A 5DBGA 1WP4A 4OHUA 3BZUA 1HZZA 3BA1A 4IJWA 3BMNB 4CQLB 4CV1A 3BMNA 4CQLA 1ENYA 2AQKA 4FIZA 4RV9A 3ICCA 4ZQHA 5JCJA 5DN9A 4OSOA 5BNTA 1W8DA 5IXYA 4XDYA 3WGOA 5COBA 2XOXA 2DT5A 1P0FA 1ZJZA 3LU1A 5I9LA 1U3VA 1H93A 3SLGA 3RSHA 1IB6A 2AEFA 1RYDA 4IQ8A 3EHEA 1QP8A 3PJFA 3T7EA 3GZNB 3AOEC 3GZNA 3PZRA 4TZKA 5KTKA 4UVGA 3PI7A 3GUCA 3OMLA 3UKOA 4BS9A 2NACA 2VUSA 2X0JA 4BNZA 1QG6A 3JQ6A 1QR6A 4TRMA 4TKMA 4WOKA 3WQSB 2CF5A 1RKXA 2OBNA 3KSDO 4XGNA 1EFKA 3I9MA 4QX6A 1B3BA 4ZQGA 5KJEA 1LC3A 4PVCA 1GEGA 3ZW8A 4DMLA 3IOYA 4BNNA 4IZIA 4FW8A 1DBVO 4PLGA 1M67A 3ZWAA 4ZN6A 4LVUA 1DC5A 2Y1OA 1NAHA 3NGXA 4QUKA 4UVHA 3I9LA 1LRJA 3EAGA 3OA0A 4QEDA 1R12A 2FPPA 4P38A 2D8AA 4CMIB 4TVBA 3H9UA 3QQPA 3DBHA 2VHZA 4YAKA 1MA0A 4AJLA 4HADA 2Y93A 5L7TA 4HKTA 4YT5A 1UXHA 2H5LA 4FOOA 2ZCUA 2O23A 4GX2A 4Z0TA 5JDCA 3V2HA 4ZICA 1ORRA 2XPCA 4BNGA 4EITA 1MGOA 1VL0A 4RCVA 4Q3DA 2C7GA 5ER9A 3QVTA 2RHCA 3PIIA 2NQ8A 1B16A 1EEHA 4IDBA 1XKQA 4W6ZA 1KC3A 1KY4A 3RUCA 1MB4A 2WMDA 2G0TA 2X5KO 3BHMA 5TIIA 1UJMA 1YB4A 1YOVA 4NQZA 2DVMA 3LSYA 2AE1A 3JQAA 2GRAA 3FPCA 3FR7A 4Y6RA 3LC2O 2QYTA 3VZQA 1TT5B 3CMMA 4BKPA 3AI3A 2JCYA 2O7QA 4PLYA 4ZQFA 3DTTA 2HMUA 1QLHA 3QIVA 4CLRB 1GQ2A 4DYVA 4CLRA 1MC4A 2WM3A 1GUZA 1UZNA 1F8FA 2HMSA 4WOJA 2GZ1A 4J1QA 1A7KA 1TT7A 5DCUA 3NJ4A 4N54A 4TQGA 4YJFA 3BIOA 3AM3A 3V8BA 1ISGA 2Q4EA 1Z6ZA 5T8KA 4UUMA 1V3TA 4JROA 1HDCA 4YDRA 3ENNA 2CDCA 2OGUA 1Q7BA 1UP6A 4I9HA 1GV0A 5AVOA 3G17A 3U4HA 4W9NC 1GUYA 1WMBA 3MTJA 5EPOA 5H81A 1UAGA 2Y1EA 4OKNA 4DWVA 5CDGA 4LCEA 3NDRA 1M2WA 1DAOA 3U9LA 1QYWA 2PH5A 4DIBA 5JAQA 1R4NA 1I36A 5JW6A 1I0ZA 4EDFA 5JLAA 3HHPA 4BMNA 4BNXA 4DC1A 3TOZA 3F9IA 4XEHA 4CM6A 3JQBA 4DYDA 2BELA 3CMCO 3OICA 3S2FA 5IDYA 4A27A 4AJNA 5DF1A 2YQ5A 4NZ9A 2I6TA 2R2GA 3ZDFA 3EGOA 1VSVA 1IPFA 4DREA 1F17A 2XXJA 2EG9A 2BMAA 3EC7A 3EW7A 2GERA 4IZHA 3ZWCA 1H9AA 1BWSA 4YRDA 1YB5A 2D2IA 1XWFA 3PXXA 4PLTA 4AJJA 1EFLA 4PRKA 1LBEA 4PLVA 4U6SA 1Z45A 4QO7A 1PZGA 2IZZA 3PHJA 5L4SA 5U4QA 5KNLA 2ZJ1A 2IEBA 4EZBA 4ALKA 2FSSA 2ET6A 2OUIA 4B7CA 3NJ8A 4BO8A 1A9YA 4KUHA 1ADFA 1DB3A 2J8ZA 5L4LA 5MGBA 1NQAO 2CDBA 4XR9A 4BNKA 1CYDA 4ZA2A 4R3NA 4IY1A 2B4RO 1ZH8A 1XLTA 2Z1NA 3OH8A 5ILGA 3S2GA 3SJ7A 3VH1A 3Q3CA 3RUHA 1GPDG 2C20A 3SXPA 4ZGWA 3IL2A 4EEZA 2OL4A 3NT2A 4Q3CA 1KOLA 1B0AA 1BXKA 4P4LA 5DP1A 5CDUA 3DZHA 1Q2XA 1PU2A 3TZKA 4BV9A 1X14A 1N7GA 4J4BA 2ZB3A 1DIHA 3MWEB 4CM5A 1HDGO 2W90A 1ZSVA 5A5FA 3FPLA 5T5QA 3HFGA 1Y9AA 4B7XA 4MPDA 4I1IA 1G0NA 4WGGA 1WXDA 3C1OA 4YAGA 4MVJI 4R5HA 3F6YA 4J7UA 1A4IA 3MJVA 3JD1A 3GR6A 3VTZA 3T4XA 1HL3A 1KIFA 3KYBA 5K9ZA 1MXFA 3OEWA 3H9JA 5JY1A 1ZSNA 3SEFA 2EGGA 2EEZA 3NEPX 3WYEA 5F1KA 5JC8A 3STHA 1NR1A 1PS9A 1LDBA 4GLOA 3ANNA 3KUXA 4E2ZA 3K31A 3IKVA 1KYQA 5CDSA 3Q0EA 3T7CA 3LF2A 4GMFA 1U4SA 3U5TA 8LDHA 1R4MB 3LLVA 4O1MA 3GQVA 2PD4A 3WDSA 3NT5A 4HV4A 1GADO 4ID9A 4J3FA 4NBRA 1U2GA 1VI2A 4FFMA 4WE3A 3ZWYA 3DDNA 3GAZA 4JXKA 4P8RA 2FWMX 3NX4A 2H6EA 3AY7A 4PG8A 1D8AA 3PRJA 3OJEA 3SBOA 1HLPA 2C5EA 1I32A 2PFGA 4EUHA 3GF4A 3I3OA 3NT4A 3JYLA 1YKFA 4G65A 5EQFA 1Z73A 1ZZEA 4CQMB 2ZYGA 2B36A 3VPFA 2CFCA 2Y68A 3GLQA 4IINA 2VNAA 5G0WA 1CETA 2J6IA 4RPHA 3PHHA 1KVUA 1V9LA 1B3RA 1R0SA 3PJEA 5CG2A 4HFRA 1NPDA 3WR5A 1KVSA 4BV8A 2IDZA 5IAAA 4FCCA 2VWPA 4CLEA 2X5JO 1QV6A 1FMCA 1Y8QB 4R69A 3TZCA 2DKNA 3KZVA 5CEEA 2EERA 4U5QA 1RM3A 5G4LA 3OA2A 3C1TA 1ZK0A 2I76A 1DIBA 4CMJA 4OYRA 3ETGA 4M54A 1W6UA 3TL3A 1P1RA 4II3A 4YTEA 3CSDA 1PQUA 1ZKMA 3E03A 4NU5A 3VPXA 1FDSA 5TNXA 3FNGA 4PLPA 1DIGA 4EJ0A 2O3TA 1I2BA 2AG8A 4IDCA 3VH3A 2NQTA 3PPIA 4TROA 4CUJA 3TDKA 1J49A 1E0DA 1U1IA 4PIVA 1ONOA 1J6UA 4XYBA 2R6JA 1DO8A 4JX8A 3ONFA 1P1FA 3GG9A 1JA9A 2BF7A 4TMFA 4XDZA 4YXFA 2IRWA 3WBFA 1P33A 3AWDA 1FK8A 1ARZA 1CF2O 3FCOA 2GLXA 2O4CA 1A5ZA 4H3VA 3QWBA 1R37A 1Y5MA 1GZ6A 3HSKA 4BKOA 3WG9A 2QHXA 3C3XA 5K6AC 1LLDA 4MVJM 1PR9A 2E82A 3N74A 1DFHA 2Y1FA 3U4CA 5JY6A 2UVDA 4XZ3A 1BVRA 3HDJA 2WWRA 3NTOA 4R9SA 3BTOA 1MLDA 4CMAA 2ZB7A 1LSUA 3INTA 4HXYA 4MINA 4CL3A 5I8ZA 1K6IA 4RF3A 3LF1A 4ZHSA 4CV2A 3JQEA 4RLSA 1DJNA 3MJSA 3MJCA 5KVCA 5A4DA 2R00C 1Z82A 4B4OA 4DLBA 2VZ8A 3RKRA 3PTZA 3D7LA 1YVEI 3OQBA 2GZ2A 4WLEA 1YO6A 1KERA 3PHGA 3E9NA 2EV9A 1F0YA 4GSKA 2TMGA 1GD1O 5KWEA 1C1DB 1C1DA 2Q4BA 4ZJUA 4O59O 1NQOA 1PR3A 2IZ0A 1PWZA 1S7CA 2G1UA 3M1LA 3CTMA 1G6KA 4OIMA 3KLMX 3VTFA 3ENKA 1PJCA 3HB4X 4CMEC 4IJUA 5A04A 5IDWA 3FTNA 3H5AA 3NYWA 1JKFA 1D7OA 1NR7A 1TA4A 3BTVA 4GAEA 3VKUA 4R4JA 4OAQA 4L75A 1QYXA 5LDGA 4WEOA 2B5WA 1V3UA 3NRCA 1ZEJA 1Y8RA 2ZTUA 4J1NA 4M1QA 1M76A 3GGPA 1DC4A 1KC1A 5HS6A 1XCBA 3DZJA 2JKVA 2E49A 4I5FA 2IYOA 1GU7A 1EVZA 4M49A 1LC0A 2J3IA 4XQ9A 4Q3BA 5KVVA 5C3MA 3C7AA 1CWUA 3INRA 5JC1A 3BMOB 3ONDA 1A27A 4K9DA 3BMOA 3WJAA 4RDIA 3RFVA 1EBFA 4PGFA 1LU9A 1H6BA 1HTBA 4W82A 4IDDA 4GL4A 4KP7A 2JCVA 3IS3A 4A03A 5DOVA 1YL6A 1QYCA 1H2HA 5KKAA 3ZHBA 4GH5A 2VQ3A 1I10A 1IUKA 3AJRA 5DBIA 1MG0A 1MV8A 3PYMA 4EW6A 4BMSA 1N1EA 3ON5A 1XSEA 2W4QA 2Y0CA 4IDEA 3GVXA 1QRRA 4XD2A 2GSDA 1DPGA 4B4VA 2ZATA 4YT2A 3VH4A 2YHUA 3MCVA 2CNBA 1E7QA 1E1NA 5JAMA 1DOHA 1EE2A 2GGSA 1I33A 1HSOA 2P9EA 4N18A 1WNTA 3KHUA 1VKNA 2NLOA 3IIEA 2YY7A 3H3JA 3L9WA 4GPD1 1XU7A 4TSKA 1PJ4A 3I9KA 4WCFC 3ZWPA 5BSGA 1GYQA 1Z75A 4YWJA 1E1MA 1QORA 3RWBA 1SBYA 2GASA 4WNCA 4D0RA 2I65A 3A06A 3S1LA 1AXGA 1JVSA 2VRCA 5DZSA 1HYHA 2NSDA 3UN1A 2QIOA 2X0RA 1JAXA 3D5TA 4IPTA 1KEUA 1HDZA 5AXBA 4BNIA 2EGHA 1E6WA 2VHWA 4OQYA 2DFDA 3UCFA 3OEYA 1E3LA 2O3UA 1T1RA 4DBVO 2UYYA 5B4TA 3I23A 5F5LA 2RH4A 2W2LA 1U7TA 5TGDA 4NNJA 4C7KA 1ADBA 2PD6A 4KZPA 2PZMA 3WTCA 3RU9A 4ND3A 1R15A 2ZTLA 1OBFO 1O89A 1YDWA 3F1LA 3HFSA 4DIFA 1DJQA 4IUYA 1UH5A
chains in the Genus database with same CATH superfamily
3M33A 2A57A 4OB6A 3GPBA 2AEJA 2RC5A 1XMIA 3MHPA 3TTSA 4R8VA 3VAZA 5AW7A 3A1FA 5D3ZA 1TC2A 4CKEA 4B33A 2I2CA 4RGQA 4UM8B 3B9QA 1ZS9A 4C4YA 3OE1A 3QEBZ 4M0UA 1KJWA 3OUUA 4XKJA 2ZJ0A 3E2PA 1UXOA 5FLKA 1E94E 4UM5A 1AUVA 2QE6A 5JFOA 1NJ8A 3TJMA 4EHKA 3F67A 1YZLA 2ZIUB 2FPOA 1V45E 2HLDA 4X20A 1PHPA 5JANA 3AFHA 4AJEA 3EHDA 3TW8B 1CRPA 2GJSA 1NNLA 4DILA 1O94C 1A96A 4KBYA 3QNUA 4OGGA 5BN4B 4J90A 1BFUA 3NAQA 3GHHA 1E3DA 2KBFA 4IXDA 4RF2A 2JLAA 1AHHA 1XP8A 2VT7A 2IP1A 4F8EA 1NBME 1VXRA 4KXWA 4WXYB 4BX9A 3SJBA 2VSQA 2GN6A 2QTNA 4C4OA 1AOXA 2HRBA 2XMGA 2AGVA 4PO3X 3OOWA 4BY9E 4ONEA 1M7BA 2XMQA 2LWIA 1D4ZA 1YZKA 1E1RD 1EJBA 1S3SA 4LVNA 4F5DA 5A1TA 4DCOA 5AUNB 3PQ2A 1CS0B 1GNRA 5DYGA 2P3SA 1RPAA 4MVJG 3ROQA 3U09A 2WZCA 3PJRA 1FRQA 4W8HA 2OV6A 3WRYC 1GEEA 2JBAA 3L82B 1FP1D 3EVDA 1N5IA 2EW2A 3TXXA 2VBIA 2M9MA 4A1OA 4HK4A 4YBRA 2X7XA 4QJ3A 3NBKA 3I58A 1U0FA 1YZ3A 2Q5FA 4G1VA 2Q7OE 1QB8A 5KJEA 1NP3A 2CVZA 1XR3A 3S2IA 1G3QA 4B7AA 1EFPA 1BD3A 3MT7A 1Z0ZA 1IEVA 4RXTA 5ESDA 2EFEB 3SX2A 4D41A 2ODPA 1W0CA 3LJKA 4PTYA 2PAFA 1OA1A 3A4VA 4DMHA 5H5JA 5CXQA 1XDBA 2VPPA 2NZUG 2EZUA 2I7TA 1D03A 2GI4A 5E6RB 1BX0A 1K63A 2OD7A 1XLTC 3OUTA 1GKIA 2BP7B 2IYRA 3CB2A 3COZA 2P2ZA 3OIFA 1HETA 5BVHA 1GN8A 3WWDA 1KPGA 1KY5A 3OPYA 2X1MA 3B82A 3WISA 2ZQYA 2C8KA 2FCAA 2WJPA 3CF0A 4EB6B 1YV9A 5H02A 1J20A 2GF0A 2DY0A 4I50A 1K7EB 3DEFA 4ZWNA 3GUUA 1JGTA 1Y48E 4S3MA 4R2JA 4U4AA 3VPDA 4F5WA 4INPA 2GBIA 1CQIA 2I34A 2M1XA 3DC2A 5GQSA 3IQHX 4EG0A 4DY6A 4KXUA 2OLJA 1NJGA 5BPHA 4P4SB 2I62A 2RI1A 4QASA 4ZTUB 3HJAA 1ZK4A 2I1QA 4DLVA 2R6R1 1UADA 1Y42X 4S2UA 1IG3A 3FE2A 1J2EA 1X3LA 2YVQA 4ZOLB 3ZU6A 2BTEA 2WHQA 3EEOA 1RVV1 4K7JA 5DX1A 4CTKA 2EC5A 5K01A 4XWWA 1A98A 1I14A 1BE8A 1ZITA 4HDQB 4B44A 3HB5X 4QUAA 5F7OA 4C3VA 4KK3A 4PPNA 4YPOA 1AA9A 4NH4A 1AKTA 1XTTA 3KZOA 3T15A 1I94B 4MJ3A 4H0NA 1U0BB 3HJFA 2WIJA 3M9XA 2D2EA 4EHNA 2EF0A 3KG2A 4I1SA 3GJ3A 2G0NA 4XJTA 3QNWA 2AUTA 1H2EA 5CNKA 2QBYA 1KMQA 2FFAA 1BMTA 4ZANA 2GA9A 3PT5A 4LXYA 4F71A 5BOSA 4CETA 3VMFA 2VDLB 4NZZA 4P9NA 5LU9A 5JXGA 4K9KA 1MNAA 3UATA 3HUTA 1PQWA 1B15A 2COUA 2UU9B 2PK3A 2HTFA 2PVSA 3D3QA 3HEBA 3LPDA 3SDSA 2FUCA 1XZCA 4W5NA 1XELA 3RC3A 4CLDA 2ANCA 3DFIA 4LDPA 4HLCA 5SZIA 3F4KA 3GFSA 2NYVA 3OETA 3IDQA 5DTRA 2QTVA 2WABA 3CCFA 4FGSA 4G9BA 3IP3A 5CLHA 3VNSA 5TPZA 1Z7EA 4J7AA 4MV3A 5F2EA 3EGEA 3UFXA 1L5FA 5KDDA 4WH0A 1M74A 4TWJA 4FEYA 2YHSA 1UPTA 3ZOKA 2HU7A 1VYTA 4HAWA 1E58A 4ZZ2A 2P6UA 2AN1A 3OM9A 4L7VA 5F3RA 4QGBA 4RDXA 5KC9A 3DKIA 3CRQA 1M1YB 4EY8A 1BH6A 1R0CA 4QUDA 2ZTVA 2IYPA 3H4MA 5G0SA 2Y4OA 3LPCA 3C3CA 1XLUA 3IALA 1A1VA 4WCFB 2LR0A 2NO1A 1ONPA 1VA5A 3C1AA 4JOQA 5FPSA 5ALUA 2JEZA 3D8NA 4TWBA 4CMGA 1ZUD1 2LDXA 1LBQA 3DZDA 4NFLA 4Q3KA 3ZU3A 2O2SA 1QCZA 2WF6A 2C7PA 2R3SA 1E98A 3EARA 2DHCA 3FI0A 3OZAA 3PGVA 2ZETA 2HHLA 1Y6JA 2A1TS 3IUMA 1WXQA 5ICFA 5A4FS 3MW8A 2D7DA 1WB5A 3I52A 3NOVA 2IEDA 4K28A 4RHTA 4U39A 4ZYUA 4XA8A 3Q2IA 3RSCA 2UYHA 4PAWA 4PV7A 3V97A 1W5FA 3IHLA 4OHRA 2QW1A 3JS5A 4X62B 5MHTA 3HNRA 4OAOA 1C0LA 1EFVA 2PGDA 3GEDA 5KYVA 4C89A 3CJRA 4V0ME 2O8EA 1VCNA 4OI4A 1G8SA 1V7PC 2O3JA 4HDCA 3TZLA 2J7PA 1E5XA 2BFCB 4AJ4A 4XPIA 3ADOA 3BERA 1YOVB 4YQZA 5LNK1 1H1DA 2DM6A 3R44A 5DWQA 4NRDA 2OXTA 4ASUA 3PPWA 3X1DA 4QO8A 4WESB 1KQ3A 1X94A 2QNIA 3FHOA 2QVYX 4MWEA 4WY5A 3QOXA 3FMVA 4IUBS 1ZMXA 1JR3A 2JBHA 3DE0X 1TI7A 3Q0TA 4LECA 1TJNA 4N3CA 4FX2A 1ZBQA 1IHDA 4UW9A 3LC0A 4H35A 2R65A 5FNZA 5IK2A 3QV2A 3VFDA 4BL5A 4FYPA 2OCLA 1IONA 3IC5A 2HWYA 4J0KA 3SJAA 2BGLA 5AI9A 3B6JA 4KIWA 4RVDA 2CSXA 4L4RA 4FE4A 4R98A 3NO4A 2VTEA 3PNYA 3WY9A 1UDWA 1X92A 3U49A 1J0AA 3DFMA 5JXIA 2ECPA 4GG1A 3W5HA 4Z4IA 4R01A 4TVKA 3E4DA 4PZ0A 3VYSB 2NT3A 1JQDA 2X5XA 1AZWA 5AO9A 3HNOA 3GVCA 4BDTA 4ZAWA 4B48A 2J59A 5D5QA 3FUVA 2X77A 4DMMA 3Q88A 3OX1A 4X7RA 2VJBA 5JYEA 5K03A 3PPVA 1IBSA 1LKZA 2CJFA 1P1HA 2BUCA 2VF7A 3NMUF 1SCJA 1JHVA 2JAOA 1OT5A 1R6BX 5ERXA 4H6XA 1JR2A 1GPUA 3SYNA 2VJMB 5CRIA 1SD1A 3H2SA 4CM4B 3D7NA 1OE0A 3QMWA 1U0TA 3I9V1 2FUG1 3R9XA 4EYQA 2G7ZA 2FH5B 4LJ6A 5AIAA 4CM8A 4R2MA 3WIEA 1H0HA 1ULUA 3HA3A 3NYQA 1RE0A 2B6HA 2WUGA 4MULA 1JEQB 2GZ3A 2XAUA 4LQDA 5SV2A 2Q2QA 1E5DA 2P5YA 4BNJA 4ML3A 5HE8A 3NOOA 1HE2A 4B85A 4YYZA 1D2MA 2J30A 3HU2A 4I55B 5IAKA 5B7GA 3GLIA 1NG9A 1Z2NX 5AQEA 3EZFA 1FMTA 1YAHA 1L4KA 3SSNA 2BEWB 5B1YA 4K6MA 1NUPA 3ZWNA 2NQ2C 1OXSC 3A25A 3RTCA 4P7FA 3ECAA 4TS4A 3LL4A 1P3DA 1ZNZA 5I7RA 3QK7A 1HE4A 3CR8A 4LC1A 5FUYA 3WAGA 3L6EA 3KVRA 4AW9A 3LW8A 4DMUB 2HFJA 1D6JA 1FQWA 1I7NA 2F64A 4UCXA 4FCWA 1FPMA 2P1ZA 3SBXA 3MWFA 2IXEA 1SCQA 3HKEA 2WU0A 3CC8A 3CG0A 3K20A 3SFTA 3E9MA 5J58A 2HLNA 4J75A 3H2ZA 4YP6A 3S5UA 4LUCA 3MD9A 3RT9A 1RYEA 5FI3A 4DLAA 3AU9A 5FKJA 5FA8A 4HUJA 2GWRA 2IX9A 4LJ7A 4YPVA 1OZHA 3KYCB 1DAIA 2YC2C 3UCEA 1G3UA 1YR7A 2JIZA 3DXYA 2XCRB 1MO4A 2WOJA 3C0KA 4W8GA 4O4IA 3RRXA 6CHYA 3BB1A 7MDHA 2ZRIA 4P4TA 2W6JD 2RGAA 3I2HA 4KDEA 1AUPA 3QE2A 4PHGA 5AXDA 1KJZA 4MHTA 5HZGA 4MUMA 1AGRA 3C8DA 3D8UA 5BR7A 1GGHA 3ASVA 2K5UA 1YWGO 3MUNA 4HSGA 3WLHA 3AEUA 4Y0AA 4S1OA 1E61A 4CMHA 1SXIA 2Z8ZA 4CL2A 3LWZA 1A71A 4JLWA 1NPTO 2EW8A 1OXKB 2IDKA 4EVIA 4OVKA 1TLTA 3LOPA 1UJ6A 2ZJOA 5TSDA 2PNJA 4BP8A 4ZCQA 2XSZA 3G5UA 3IXQA 1CZOA 2K6GA 2CLLB 4NX2A 4BIMA 4QOIA 3G9QA 1LDGA 1Z8FA 2GD2A 3VXKA 1YRAA 2I2FA 1CVRA 4ICIA 4J91A 4UVDA 5DT2A 4DGQA 5LQDA 1OUMA 4JI0B 3ZU2A 2XYPA 2BAGA 4I1RA 2X40A 4U63A 4N48A 1NW3A 1WXGA 1ZM4A 3P19A 5TS2A 1F1JA 3BULA 2O9JA 4JR2A 5H68A 1C41A 4NJMB 3AOGA 2IS1A 3R7WB 2HV9A 4GPBA 4MV4A 5TC4A 2Y9PB 2YV1A 2R4TA 4LCJA 5I9IA 1MVLA 4YJ3F 2W2VA 1NONA 1F4PA 3G9TA 3N2KA 3R20A 4FSDA 4OL9A 5CM2Z 5KKNB 5EWJB 2QLLA 4HYTA 5KYWA 3UAGA 3W7AA 2ISQA 1AUQA 1L7DA 2BM0A 1J9GA 1Q7CA 1ZKDA 3MBOA 3DEJA 3T5AA 4DV5B 2C61A 2PLAA 4X9XA 3OD1A 4H27A 5YASA 4DMGA 1BMDA 1S3GA 4TXHA 4OI0A 1EVIA 1NW9B 3I9NA 1D5CA 1N92A 4PN3A 4IS2A 2YS7A 3ZE8A 5KOYA 1E6EA 3PR3A 3SY8A 2J3JA 3TSOA 4AJPA 2J32A 1BTOA 2F1KA 1R9MA 1DPFA 3E8XA 3ZLJA 1NLYA 2CVQA 2FQ1A 4LYEA 4ARVA 5E2IA 2CB0A 3S99A 3L9XA 2CHVA 4L4UA 3SZLA 2AC4A 5DBFA 4Q18A 5FB3A 1E3EA 1HO3A 2RGGA 1O6ZA 1Y89A 3KEGA 3RFCA 5DM0A 3QA3E 4IIXA 3WK8A 3WXMA 3HVIA 3ZWDA 5CNJA 1YC5A 1S02A 2PGJA 2QRGA 2Y71A 3RE1A 3RVQA 3V7UA 2ZSEA 1YFKA 4FOSA 3ECSA 1GGVA 1I2ZA 1PIWA 3PRYA 2H63A 4DXAA 5F3WB 3RFUA 3DE3X 1QP4A 5KYGA 3FOFC 4WSOA 5HMMA 1U3TA 3ZXUB 4NNPA 3B9BA 1KMCA 2GPTA 3EVAA 1CCWA 4Q16A 2VATA 2ZZKA 3GJ8A 3CH5A 3GRFA 5LYYA 3VC7A 4K6OA 1N6OA 2A5DA 1USGA 4Z4HA 5K3EA 5CVJA 2R0QC 1QHXA 1ZOOA 4U7WA 1A95A 2IQ5A 1BW9B 4DIDA 1E0SA 5J5VA 2QV7A 5IVPA 4WBNA 1W36D 4BFWA 1MQ9A 5HTKA 3CJQA 1P77A 2RSLA 1GPH1 4OMUA 2JGIA 5LQMA 1UXIA 3BHJA 3IUYA 4BNVA 5G2OA 3U61B 3IA2A 4D4IA 2AG5A 2EHDA 4UPEA 1DS6A 4BB0A 2Q41A 3FCCA 4CLXA 1V71A 5THQA 4BHTA 3T3OA 2IYSA 1KE2A 5HZMA 2VT2A 4LPKA 4GX5A 1KJIA 3KPJA 4MYUA 4RVHA 4UD2A 4ZOBA 4Z4FA 1SRQA 4KG7A 5J63A 5FTWA 1FXWF 3H3XA 3OJXA 1B41A 1QTNA 3HP1A 3STUA 4LF9B 1K7YA 3QKSA 5ECYA 1L7QA 3MQ2A 2BZ0A 4FEAA 1CU1A 1JPNA 3U4DA 4N8EA 3DTYA 1P45A 4W1PA 5T67A 4B6GA 4R84A 2I3DA 5CFRA 1YZGA 1JG7A 2P9ZA 1A2KC 1YKSA 4QYMA 4YP5A 5LLSA 2PA3A 3QU9A 4CKWA 4TN5A 1D6MA 2BKVA 4URHA 4YAIA 2CXHA 1BHSA 3LHDA 4I7EA 1T2DA 5FWXA 3PGMA 3R7LA 5JNSA 2VSXA 1S8NA 3WLQA 2VTKA 1G8FA 4P22A 4N0DA 2GDJA 4NCJA 1YOBA 1YE8A 3HYSA 4O4LA 1XNGA 4QICA 5H0IA 4CV3A 5DNWA 3WS7A 4P7BA 5CDYA 1PFQA 2ZT7A 1IG0A 3LD9A 4JBIA 5TEWA 5FX2A 5FOXA 3N58A 2QRJA 1KEKA 3QFSA 1FYWA 1MIHA 1JPJA 1N9KA 1L7PA 5ITWA 5BSHA 2ZJYA 3FGNA 3I6MA 4MRMB 4YN3A 1C1YA 4BLVA 3TRDA 4H3KB 3QIAA 3QSGA 4BZPA 3JQAD 5JAZA 1L5NA 3SIXA 1T26A 4JHLA 3M4YA 5ALLA 3MINB 3HKDA 5I6DA 2EATA 4FWBA 4F7WA 1QV9A 1ZEMA 4N12A 4GI2A 4Y9RA 2AXEA 1CJUC 3D1JA 3RVLA 2GEJA 1XTZA 2GO1A 3L7LA 1VG1A 3NS7A 1NF9A 4MQLA 3VHRA 3I2YX 1OT3A 1WW8A 1E4YA 3DXXA 4REQA 1W4RA 1BWQA 1GTL1 2AQHA 3K0BA 4RE6A 2VP0A 3AESB 3INGA 4AMYA 2EKPA 3R3SA 1NI3A 4HVAA 3ECCA 5TDHA 5JTUA 3TQCA 2SKDA 2ZG6A 4CM1A 3TINA 1AV7A 1RJDA 1VCHA 2EG5A 4OIFA 4QSMA 4Q1EA 4X8MA 4A6PA 4ZGGA 2ZBVA 1YBVA 3ANSA 2C29D 3CIFA 4M9SA 4RY2A 4FNOA 3UC9A 4HQ6A 2D62A 3WJ2A 4FGLA 1TXGA 5KX5F 5ICMA 2ZBEA 4FFRA 3WJ7A 2AFIA 2BFEA 4TM8A 3WB9A 1R0KA 4D3YA 3ROPA 3A2KA 1OYWA 4G0OA 3OZIA 4L5CA 5IP5A 3OP4A 4LY9A 4EJSB 3I5YA 1XROA 3IAHA 4I4NA 3DCIA 4WNIA 4FDTA 4M0FA 3H5NA 1XA4A 2OCPA 4BN4A 1H42A 1QCYA 2GD0A 3RROA 1YNOA 3RVKA 4TV9A 2O6LA 3AH8A 4C4XA 1X1CA 2HHJA 2NPIA 1EH5A 4WFIA 1RYNA 4A15A 1WO8A 3V3KA 1NQTA 1FE8A 3E1SA 2NYUA 4L22A 1T4CA 3ZC3A 2V55B 2BMWA 1QLJA 4PPYA 5AXAA 4CUZA 1E1QA 2R85A 3CWQA 2GD1O 1Q0LA 3RIHA 3VR3D 2K2WA 3CX7A 1WIWA 2WICA 4BNFA 1P18A 1G98A 1XDSA 3V2GA 1APBA 3AUXA 1R18A 4X6LA 1A9QA 2PIDA 1NMQA 2FSPA 3RC1A 3U9SA 3DQPA 6REQA 4L9WA 5LUBA 4KN6A 4RMGA 5AOVA 3C6BA 2UKDA 2VT6A 2DQSA 1SMKA 2O8DA 1PDWA 3L4EA 3LKDA 3UC5A 1JALA 2YYSA 3DA8A 1A7JA 5SYNA 3TKAA 4C7OA 4H77A 1CB7A 4MDHA 1X77A 3BSSA 3UV3A 4I2NA 1P31A 5C8VA 2P0AA 2A30A 3ZIAA 5BN1A 5HQ3B 2WG2A 3LGAA 2E6UX 4X41A 1TIBA 1Q7EA 1MA3A 1TQ4A 3R0XA 2XA1A 1N8TA 4LJSA 1KRWA 1Q14A 5SY4A 2QORA 1DV1A 1T5HX 3GFRA 3HDQA 4CLOB 2WWGA 3NC0C 4WIAA 2O8FA 5DBOA 2W22A 5J59A 3GDOA 3LZ6A 4B5KA 5KOIA 1VKRA 1QVVA 4GPAA 2HJHA 4RTNA 3TFOA 4RORA 2JD0A 1O57A 2XHEA 2XKAA 3TPFA 5L40A 4YCJA 1QRTA 4FYHA 4Q48A 1OSNA 1NPYA 4QTUB 1WTAA 3DE2X 3AQ4A 2FK8A 1Z2DA 4MW9A 3DD1A 4HDMB 4JN6B 4PFKA 3BS4A 3CY6A 5EL0A 1NVAA 5ALDA 4OLBA 4RHUA 4UNRA 4ZT3A 4MPPA 4UVEA 5KMGB 3ONEA 3KWMA 1Q11A 3DHYA 3G3EA 2PV7A 4A8JB 1GRVA 4G4SO 4C0AC 5JUWA 3T5MA 4RL6A 2AR7A 1NBWB 4OQZA 1CY6A 1TF5A 1VKJA 2PY6A 3MUFA 4I3GA 3IDAA 3RBAA 3FDFA 4A2CA 2GJKA 2N3ZA 4JUDX 2AZXA 3WZLA 2PZJA 1R4AA 2GFQA 5JMPA 4CIXA 3L6OO 3T35A 3QFFA 3KSZO 4MQFB 2QLFA 4FDMA 3F6EX 3IUPA 2BFPA 4QOJA 4CCYA 3SSMA 3RYHA 7YASA 1CUYA 4PQRA 4OXNA 1AD2A 4B8YA 1OXMA 1V8DA 5HCNA 3D6MA 4DLWA 1AZTA 3PQ4A 2RK3A 3UAWA 1JYFA 2WLSA 1QOPB 3FTPA 3N0RA 3AF5A 2MOKA 3H6KA 3U80A 5C1PA 2CFIA 1H8ED 5FEMA 4OCZA 4EPXA 4C43A 1R1DA 3CZ9A 4P80A 2BFFA 5E2AA 4OKIA 2XMZA 4J6FA 4ER3A 2VQEB 3G7UA 4QDTA 5LDDC 5FPHA 3WGGA 3KTDA 2RGCA 1WLYA 3TD2A 2JCBA 3LYAA 4E2YA 1VGRA 2Y1XA 3CUEF 4ZCLA 1M0SA 2GDZA 3W5SA 1D2NA 2FW1A 3GGGA 5B7PA 3UJNA 1W75A 2X9VA 3GT3A 1NSFA 1B6TA 2IF2A 5AKZA 3SHWA 4XVUA 6NULA 2GWHA 1SD2A 5SZKB 2XF8A 3LVQE 3X1KA 4BRSA 2WUDA 1L7EA 2Z56A 1NXTA 1NLFA 3D2AA 4Q4JA 3SZRA 4BV2A 4D3SA 3FVQA 3EUFA 4KJXA 3EX7C 2PRKA 2WWIA 2CUZA 4OA5A 2X8LA 1CZRA 1KYVA 1WS6A 2WPNA 3EEQA 4K3UA 4L8LA 4LHWA 2F3QA 1Z35A 2AT1A 2V7PA 1ID1A 2DU8A 1YONA 4MGYR 4WK0B 2A5LA 3NETA 1T2VA 1WLSA 2FV8A 3AETB 4FHDA 4OXQA 1PAUA 2ES4A 2GSWA 4Q37A 1K66A 4DDMA 3P9ZA 4BMCA 3JQ9A 5DN6D 1NW5A 3TSYA 3TGWA 2FWJA 2RI6A 1OB2A 5DYIA 1DX4A 5EINA 2EWMA 3G5MA 1OU4A 4CCWA 1ZK1A 3T38A 1MAAA 1I7LA 2IA5A 4TUYB 2RG1A 5FBKA 2WM9B 3H9CA 4YC7A 4F86A 4MP3A 1DEHA 1HT0A 1Z15A 1Q84A 5MN5A 3M34A 3NQ41 1IBMB 5B1EA 1AB6A 1JA1A 3K4HA 4OHXA 5GVSA 2CFOA 3EVTA 1HYQA 1ZLXA 3FH0A 1D5WA 3VNRA 3VBCA 1A82A 1PEKE 2GD6A 4AD8A 2DUWA 5CH8A 5D7NA 2W4IA 4JVSB 4TS3A 4C87A 3ZD9A 3GT7A 2XMCA 4M9CA 1KYYA 1E2EA 1G63A 4M86A 4AUKA 2Z6QA 2NZ8A 5INTA 2XDQA 3DTNA 5CX1B 4Q9DA 5DWVA 3SC2B 3UAYA 4YMUA 1Z33A 4XUDA 4ZT7A 3FJ1A 5IF9A 1RRKA 5DU2A 3CF4G 3B1KA 4NI5A 5LMUB 3V4RA 3OE7A 3ZTYA 2ATEA 4RIEA 4X64B 3TLEA 2AI2A 5DYWA 1RPJA 3KKKA 4FZRA 4HOYA 4FDAA 2FSVC 4R3UC 2F17A 1ATIA 2R8YA 4G63A 1O97D 1WQ4A 2DJ5A 3Q87B 4FMCB 5F1OA 1Y37A 1BXZA 1USUA 4BE4A 3PXBA 4X1KA 5EJ8A 1CERA 3DTVD 3FUXA 3K0CC 1Z2EA 3M6UA 1G2QA 2P62A 3PEUA 1EFTA 2IY7A 2JAHA 1ZESA 2B34A 2P69A 3QXJA 4IZ6A 4B09A 1UBLS 2PQ0A 2D1SA 2Q5LA 4OHBA 4Q4HB 4E5SA 4JUAA 1NBEA 1ZMTA 4OXYA 1A04A 1NNEA 3DWIA 1XZHA 2BBSA 4LV6A 4LDZA 1DQNA 3NHWA 4M6WB 5IZCA 1QIMA 1RI5A 2A5YB 1NW4A 4AWXA 3ZE1B 2OPBA 5TV2A 1C8BA 3VAAA 2QTRA 4HY3A 4YDQA 3N7AA 3GRZA 3N53A 3AVWA 1I7DA 2AOTA 3WHKA 5BNIA 3C7KA 3EF0A 1TK9A 3TLBA 3WDKA 1KI2A 4K6FA 1NVFA 3ZNOA 2BRUA 3B3AA 4MO9A 1U8FO 2J6BA 2ODBA 3E18A 4KRGA 5C7OO 1W9HA 3HJRA 2QD1A 2X8JB 1E9VA 3CEHA 3DXFA 3L18A 4KOAA 4PC2A 1SKYB 2PM8A 1WEKA 4UE2A 1Z2PX 2VZLA 4HX5A 5JG7A 2ZLBA 2CNKA 2EYUA 2FDRA 3HUUA 4GPTA 3TZQA 2YH2A 4KQJA 5I7FA 3RT7A 1H0RA 2FQXA 2UYOA 4WXRA 1B26A 2Q3DA 3DOJA 2JFXA 2JL1A 2XWSA 4PGGA 5MDHA 4RKEA 2DULA 3RUDA 4M46A 2RGBA 1QAOA 4O4JB 2ODAA 4PPFA 1UFKA 2ZBUA 4D02A 3R3YA 1QIEA 2Q99A 2GZMA 1RACA 1R10A 1PL8A 2QSZA 5NLLA 1LI7A 2PGIA 3PTAA 4ZI7A 1Q95A 4CFZA 3NIBA 3DHWC 1S9DA 3K0FB 1D2RA 5IT9A 5ELXA 3JQ8A 2BSXA 1WF3A 2LTAA 3EXHC 5DHAA 4DPLA 1NSTA 3WWOA 4RJ2A 4UASA 3IIIA 5BN5A 1G55A 2X4IA 1Z4KA 4KFCA 1HWYA 2Q6KA 1DWUA 2BFOA 4U3JB 2I4MA 1Z5PA 2QSUA 2IYQA 5CVUA 1UR5A 2M6RA 1QVRA 3WGHA 3TG8A 1TMYA 4JFRA 4NEGA 9LDTA 3ADBA 4OUDB 2Q21A 2BZ1A 4X97A 1QQAA 3OTQA 1X3SA 2WPDA 3AIKA 3H84A 1XAGA 4NYJQ 3EWIA 5I8PA 2GZHA 5L8VA 4NBNA 4GP7A 4NFSA 4FFSA 4A16A 3V00A 2H3HA 1UC5B 3GN2A 1BGXT 3L1IA 4BN0A 5ABPA 3ZH9B 3GO4A 2RAUA 4K9OA 1R6DA 1E3WA 2VDQB 3KU4A 4G81A 2P8JA 4W7HA 3KXPA 4QUIA 1YDEA 2C97A 4WY2A 4D74A 1J4AA 4HPWA 4L95C 2QLTA 3R4CA 4EY6A 2N1MA 1Z4QA 2GYYA 3LVRE 4G1MB 4KLAA 5AKIA 4C88A 5CTAA 1C80A 3AKZA 1NM5A 4KKXB 3C3WA 4QARA 2CXOA 5HKLA 3QF4A 3UUWA 3TF5A 1G60A 1GGNA 2GYUA 4ZEWA 2UYCA 4F45A 5A6SA 5CAEB 1T6BY 1DLIA 2QE7D 1ZNQO 4BP9A 5TXGA 4Z9BA 3UENA 3LHKA 1XMOB 3CNOA 4NOLA 4U9UA 4NDNE 4K0KB 3PQFA 1XXHB 2IDMA 2QM8A 3WC4A 1EK1A 5HE9A 1VI6A 1BJTA 5C1IA 4QHSA 2CFSA 3KKPA 1T0JB 1MO6A 1IOLA 2RJNA 3RADC 4M1YA 1M2OB 3WHIA 4QU9A 3G68A 3BE8A 2GNOA 3OBIA 2QUBA 3DR3A 2O2YA 2ZDQA 4NOJA 3MUEA 2YN4A 3EWAA 4FFNA 4DSNA 1JB9A 3GLKA 3KUUA 1BMFD 3CZPA 5DW3A 3AVYA 1OWMA 4EUKA 1JHQA 2JJYA 4YQYA 3I62A 1PK7A 2HY7A 1X15A 2GF2A 3PC3A 3SMVA 3D6UA 4D4KA 2IJGX 3QU7A 1JYSA 4RVOA 2AFHA 2IV2X 1SVIA 3AVVA 1L5SA 1DAKA 3C6QA 3KB8A 3PA8A 3R3VA 3WSVA 2GRUA 4DR4B 3FBWA 3QW4B 1PT8A 3EIWA 5FJJA 1MHTA 5JO0A 3QLUA 1E1LA 2F00A 3KKNA 3EYAA 3KELA 1Y6FA 3ZJVA 3ADDA 3KOXA 5BMOA 5BORA 1SIOA 2QI9C 3A6KA 4HB4A 5KHOC 3LT1A 3NWJA 4ZRMA 3DCJA 3NXSA 1PVOA 2I1LA 1T15A 3CW8X 4BGVA 2A86A 1ZM9A 1LFAA 1PSZA 3JAKA 2E1PA 4CN9A 4HRAA 2NTVA 3R5TA 2NNLD 2NXWA 3QA9A 4X1KB 2CXPA 5TMBA 3C8MA 3WKBA 4K05A 3WLIA 3R7SA 5LZ2A 4G5RA 3E9QA 4LXTA 3IDZA 1JHZA 1I51A 4LISA 2VA8A 2V7GA 3PFCA 3QVGA 3GDFA 3JYOA 5KNDD 3OSUA 4C5AA 3DHEA 3V4SA 5KYUB 2AF3C 3ITDA 1RWBA 2H7CA 3P0RA 4Q39A 3ZBUA 1ESZA 3HO6A 5E7QA 1XDUA 4JC8A 4W1SA 3UUFA 2AFVA 4PYLA 4YI3A 4M9ZA 3UMVA 4DEYA 3OLWA 5DTJA 2BJWA 2HF9A 3HMQA 5EE5B 1UWLA 3I32A 2Q9AA 5MFZA 2QL6A 1VE1A 2AN4A 4AURA 3KAKA 2HLDD 3OKCA 1LDEA 3AJAA 2HCBA 2A5JA 1HNXB 5EJ5A 2HQOA 2QTZA 5FQNA 1ZPDA 4Q00A 1SC4A 3B6KA 2BE9A 1FXUA 3A2LA 3OZRA 5ITVA 2IGTA 4Z1MA 4L73A 4N01A 1CIPA 4EJSC 4F2PA 2PJRA 3Q5DA 2V5UA 2ZJBA 4AJKA 3G0HA 3DL4A 1SU6A 3H05A 1MW8X 3H1EA 3PDIB 1KQFA 3SZGA 1XPUA 4HT3B 4ZHQB 3SM3A 1NUHA 3CKYA 2JF0A 4EDHA 1X86B 4QXMA 1KPIA 1VBKA 3GX1A 2W70A 3MD0A 4QHTA 1YR1A 3VR6A 1H2AS 1MEEA 5CB8A 2C7OA 1E5VA 3MWLA 4AZ3A 4I8XA 2HU8A 2JAUA 1M8FA 1NHGA 3JZFA 2BBOA 2YZ7A 4CG3A 4MWTA 5A3SA 4LV8B 4UJ3A 3DPIA 4JJAA 2ETXA 4EH1A 1CUVA 3JPYA 1IQUA 2VZ9A 4TMKA 2OCDA 2YV2A 5DCLA 5B64A 1ZU4A 4C9BA 5FWNA 1BVYF 2OQ2A 4J2OA 3ACCA 2GUGA 4HNHA 4PPQA 2QMZA 2R6DA 1GDHA 4BO5A 4LQ4A 3WYGA 1H3EA 2EOAA 1GZDA 3DPSA 4HMQA 4EHAA 2EX0A 5CA1B 1E0AA 2YY6A 2KLHA 4DRYA 2NU6B 5IVHA 3DHNA 3EG9A 3K1ZA 4PCUA 1N2EA 4KWTA 5IF3A 4O4HF 4PRYA 1NUUA 1QJCA 2OORA 1U7HA 4X71A 1O7JA 1MBZA 3PJGA 5U4XA 3FDZB 4YJGB 1L8LA 1XP5A 2O48X 4JWKA 1C81A 3U7QA 1UC4B 2A92A 1WRBA 1SHTX 3S8YA 4MR7B 4UXIA 1KNQA 4YRIA 2Z09A 3VVBA 4GQBA 1SU7A 4GXNA 3E1KA 1JSZA 3VYVA 1X1SA 1EUDA 4JYMA 4NBUA 1M5UA 1WCYA 2Q8NA 1JMKC 3QVUA 1UJ2A 1WTCA 4IOLA 1C3EA 2JFUA 3DF7A 4N3AA 1K2VN 2GJ4A 2DRIA 5DK4A 4L8FA 2Y0PA 1E79A 3OZTA 1Y1PA 1DAMA 5ELMA 1H2FA 5I5GA 3UHPA 1U63A 3WAJA 3G79A 5ANRB 2I3BA 2R5NA 4PINA 3OECA 4P2BA 4L0CA 3SNHA 4D4MA 1YJ8A 4XTCS 1A50B 2QYHA 2G9QA 3RIMA 3ZDEA 5JISA 4F91B 4EGJA 1Y4UA 1KO8A 3ZK7A 1YVUA 3RM3A 1ESCA 1P2DA 3QWFA 1R00A 4E31A 3QELA 4ECAA 1UAYA 4YJHA 2P9FA 1LRKA 2IYWA 5J4KA 2YHIA 1C4OA 3MMNA 3A1CA 3WGJA 3DZGA 4YA6A 2C9MA 1L3CA 2B8WA 4OSEA 1TZMA 3VYTB 4E6EA 1H4TA 1I3LA 1L5KA 1BFKA 1DEOA 3ZUGA 4G0VA 5TT0A 1H1TA 4HX9A 5F9MA 1N0HA 2PKYX 3CRVA 4X8HA 3DMGA 3OEHA 1ABFA 3ZD7A 5DSTA 3OHPA 2HFKA 1EVJA 4BWYA 1OY1A 4H9GA 1CQZA 4HDKA 4ZI5A 2QY9A 4RA9A 5FNVA 4DG5A 1O96A 4KSBA 3QBVA 2HB6A 4LC0A 2IZ1A 5I9MA 4ZCIA 2LVBA 2ZJ8A 1NR5A 1OTHA 1QAQA 2CXNA 1IJBA 1BN7A 2HRCA 3SHVA 4B82A 1DC7A 3COJA 2ZUEA 3S4YA 2XKKA 3A28A 1P5ZB 1DKRA 1E2IA 3PQ5A 3RU2A 2ZI7A 1CG6A 4P81A 4TYNA 2JHGA 3WSWA 3A9TA 4LA4A 4GYYA 2NMVA 5KREA 5EMKA 1NBOA 1RQ2A 3K9GA 3WLEA 3Q2KA 3LPLA 1CUFA 2OBBA 2PGNA 2B7CA 1LQ2A 4J0CA 1S8FA 4RGBA 5D2CA 3X1WA 3T7AA 3LTEA 3JARB 1JLHA 3M4ZA 1J7JA 1GAEO 2A35A 4LGVA 1SGWA 5TPZD 3T4UA 2OKGA 3F90A 1CHNA 4LN1A 4E4TA 5F23A 1EHCA 1VE7A 3QVSA 4L8VA 1H6AA 1LH0A 3M8KA 4IFEA 1K86A 1QOZA 1GNLA 1W76A 3IVXA 2I78A 1XD9A 4F0JA 3HHEA 5DH9A 2DP4E 3QWIA 4RPLA 4ZOAA 3WL5A 3WLNA 3DOIA 3ZDRA 4DCCA 2WG0A 5E95A 1PR1A 4G9GA 4P7GA 5L6LB 1M5RA 5FUBA 2ZBDA 3QF7A 1UKBA 2EJTA 2FW9A 3HSSA 3ESBA 3M83A 4LGYA 4L6AA 4B4KA 4YMVA 1TCBA 4A2QA 4KWCA 3C15C 3IJEB 1A4XA 1IVSA 2HMVA 1XZEA 1AA6A 1HZJA 4U6NA 1X1EA 1NASA 3HR8A 4CMBA 5JE8A 5HVNA 1PEYA 1IY2A 2CDRA 3BRCA 2IXFA 2VDPB 1IMJA 5TARA 3SZUA 3TPZA 5CURA 5JR3A 1JLKA 2HGSA 2V6IA 4YCAA 2H5IA 1NURA 2LBPA 3EUEA 3LY7A 1E7SA 2F43A 2QDKA 3ENQA 1WUKS 1ULSA 2G9ZA 5FL7D 4KNVA 4GZMA 4HJRA 2QD2A 4TKZA 1GFZA 1UAAA 3A7DA 4CW7A 5DIZA 2C3YA 2LDBA 1JI3A 1DBIA 1J8QA 3THYB 4POOA 1L7VC 2OTCA 4Q3OA 1OAOC 1BD4A 4LSMA 5JCOA 1EXVA 4NFHA 4Z4QA 4F5YA 5HSGA 4LNUB 2HQ1A 2J7PD 4KO4S 2YJ3A 4NNOA 1XCOA 1EZ1A 4Z8XA 4C20A 4WFJA 1YFZA 3M82A 4P1ZA 4TGLA 4V24A 3FKSD 3ZD8A 4WOCA 4ZO6A 5T4BA 4ASUD 4Y1RB 1HXHA 1F3LA 1K8QA 1LV7A 2XMPA 1PTJA 4QSHA 5JWRA 1EVYA 5HGJA 5CW1A 1JR3D 2WHXA 4QBFA 1C4WA 2C96A 4M8LA 5IK2D 3A1TA 4MKXA 4Q1CA 2HW8A 1E3QA 2C8LA 4FJ2A 4AN4A 3IMFA 1CFJA 3NEAA 3FHCB 1PGOA 3AO0B 5ALHA 3TSCA 2A67A 1AUXA 2L2QA 2JBWA 2QT0A 3ML1A 2Y1CA 3OQPA 2Y1WA 3GZTB 3I4LA 3KDAA 3QVXA 4KAXA 4ALMA 4HB0A 1CUHA 4Y6GB 4D57A 5EUMA 1KU0A 1X7ZB 4XGKA 2IHJA 4URFA 1DXOA 1KI6A 4O1HA 2WWYA 1V9SA 5ADHA 2NADA 2A9VA 1C9JA 4RM2A 3EDYA 3MTDA 3PUJA 1DBRA 1YTUA 1QZZA 2YJTD 3DVSX 2JRCA 1NJFA 1KS2A 1FYEA 2YJGA 1QS0A 1PWXA 4W5TA 1QPBA 4R81A 4TT3A 4KXQA 4PVDA 2ZSKA 4PQEA 4ER0A 4V1CA 4WECA 1MJFA 1OF1A 4E13A 4GP6A 4MA0A 1TTTA 3ZTTA 2WSMA 3PL1A 3W4KA 2NUPA 4R68A 1JIJA 1CJKC 1E60A 1QXSA 5I9SA 2Q6OA 1OW3B 5DGHA 2NNWB 1T2CA 3IKLA 1NBHA 3K5IA 4RMIA 2QP9X 2RGUA 1M1NB 3KJXA 2DPMA 1U8AA 1BS2A 2JFYA 3MJ4A 3OQ1A 4N8SA 4XB2A 2H1CA 2XUIA 3TQHA 1QG2A 4BAUA 4FBGA 3T9AA 3UQZA 2JZCA 2H2GA 3C4QA 3VZPA 1UBUS 1ADGA 1UM9B 1LX6A 2LRHA 1CIVA 3O03A 2FEOA 5EP4A 3VU9A 3AXSA 4UBNA 1DARA 1PJLA 3SS9X 4O8CA 2IH2A 1V25A 2FPIA 2X1VA 4XQCA 3V6MA 2XNCA 2FX5A 3BREA 2D5CA 3HLKA 3ZJ4A 4BCDA 1XIVA 1T1JA 1UQRA 2XE4A 3DP7A 4HX2A 4NCXA 3EMKA 3ZV5A 1R8YA 5AUPB 5KJ1A 1GPYA 1P19A 1VIDA 2FI1A 3UXMA 1DTEA 3K8OE 4UBOA 5FAKA 3HFRA 4RVNA 1DCKA 4FR2A 1YQQA 4E0BA 1KBZA 2EVWX 2P7IA 2AXQA 4IH9A 3UGQA 1FBTA 1TKCA 4IVNA 1GQYA 2REQB 3ZZMA 1OH6A 1NL3A 1XOIA 2CLCX 4QYIA 4JQSA 3D7KA 4WV3A 2JH8A 4BFUA 2H9IA 5C8YB 1T10A 4MGEA 4FYVA 1N36B 2DPLA 1C29B 3N2ZB 2XI4A 3ORFA 1LRLA 3I0NA 1JDTA 3IAAA 1YQGA 3P0JA 1QGED 3ZYCA 1B42A 2G06A 1U9IC 2IY8A 4I6GA 5JVDB 1DMRA 3JRNA 3I5MA 4BATA 2J31A 4X3PA 1KF0A 1LX7A 2BTQB 3LO5A 1V41E 4BLTA 4CG2A 1NE7A 1N6LA 1PP4A 1ZG3A 1WPRA 3CRNA 3H3FA 3WWZA 1UQUA 4GHWA 1E9DA 3ELDA 5T3UA 1QWOA 5M3BA 4BVFA 4E5MA 5ES4B 4HR7A 2BWJA 3U0BA 3T3EA 5EXSA 5KSYA 1WW3A 1MH9A 2WHRA 3KFVA 4EG3A 3WIVA