3SLGA

Crystal structure of pbgp3 protein from burkholderia pseudomallei
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
347
structure length
334
Chain Sequence
b'KAKKVLILGVNGFIGHHLSKRILETTDWEVFGMDMQTDRLGDLVKHERMHFFEGDITINKEWVEYHVKKCDVILPLVAIATPATYVKQPLRVFELDFEANLPIVRSAVKYGKHLVFPSTSEVYGMCADEQFDPDASALTYGPINKPRWIYACSKQLMDRVIWGYGMEGLNFTLFRPFNWIGPGLDSIYTPKEGSSRVVTQFLGHIVRGENISLVDGGSQKRAFTYVDDGISALMKIIENSNGVATGKIYNIGNPNNNFSVRELANKMLELAAEFPEYADSAKRVKLVETQNRVPKIENTMQELGWAPQFTFDDALRQIFEAYRGHVADARALVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PbgP3 protein
publication title Crystal structure of PbgP3 protein from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 127
structure length 334
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3slgA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3slgA02
3I9OA 3MOIA 2VHXA 3H9EO 1DB3A 3V8BA 3ASVA 3OIFA 3BMCA 4D0SA 5ITWA 1Y9EA 2A9FA 5JDCC 2GUGA 3JQ6A 3JQAB 3ZV4A 4Z9XA 4N5MA 4AFNA 2O2SA 3PEFA 2A35A 4YB8A 2PLAA 5HWSA 3E82A 2JJYA 4M8SA 2EEZA 1ZJZA 3DTTA 2R2GA 4F46A 5JLAA 5HBRA 3GF4A 4URFA 2GYYA 3OJOA 4FS3A 2X0NA 4DGSA 3JQBC 4D79A 3FWNA 4JP3A 1AGNA 1NR7A 4YJGB 3RQSA 1RM0A 3NEPX 3G1TA 4BNZA 3PP8A 2O48X 2JD1A 3ITDA 1FDVA 3OJFA 1C1DB 2ZCUA 2HMSA 3ZNQA 4W9NC 3I9JA 1CF2O 3FTNA 1RM5A 5KJFA 5L4LA 4XGNA 2NVWA 3ROQA 2YY7A 1TLTA 1V0JA 1NNUA 3RUDA 5I7EA 1PL6A 4L74A 1PJBA 1DRUA 5AOVA 4Z0TA 1DOHA 2AE2A 5DP1A 1YJQA 3ZWBA 1FXSA 4O59O 3QQPA 4HFJA 1GU7A 1G0OA 4CM8B 3P2OA 4M54A 4DBZA 3B1KA 4CR6A 3UKOA 1VRWA 2B5WA 1U3UA 3G79A 1XQ6A 4FFNA 2VTEA 4OIMA 1U8FO 4AJHA 4GKVA 5B4VA 3DFZA 4J4TA 3SEFA 3HFGA 1YH3A 1HKUA 3GLQA 1EUZA 5ER9A 1UP6A 4BMVA 5EQDA 1GY8A 4IZHA 3ZWCA 2AHRA 2CNBA 3ZWVA 2NADA 2UUPA 1EDOA 3GFGA 4J1QA 4RVDA 4ZN6A 1N7GA 3RC2A 3MJEA 2P4QA 2G82A 3ZCXA 1LDNA 2IE0A 4WUVA 2Y0EA 1JKJA 3ZDFA 2GGSA 5TIIA 3OF2A 1QLHA 1UDCA 4GLLA 4TVOA 5A9SA 1KVRA 4DUPA 4L75A 2VYVD 3A9WA 1A27A 3EAGA 3FR8A 3NDIA 3QSGA 5ILGA 3WGQA 3CTMA 2I3GA 4MDHA 4P4GA 1BGVA 1Y5MA 2FN7A 2IEBA 3DZFA 4UVHA 4IS2A 3ETDA 4XB1A 4R1NA 1UP4A 5G0SA 4ZGWA 1SZJG 3B6ZA 3LC7O 4QTZA 3JYPA 3ZGYA 1KVUA 2PGLA 3RU9A 1ZCJA 3I6QA 5JBIA 3JQ9C 4L73A 1MC4A 1EVJA 1WNTA 4DQVA 2AQHA 1I0ZA 3H6KA 5HRUA 1ISIA 1NAIA 2DLDA 3D0OA 4IIUA 1QV7A 2Y1OA 2ZTLA 4OQYA 2X4GA 4ALJA 1KVSA 2B36A 5AYVA 3PWKA 4I5FA 5TJ9A 3TWOA 5CDGA 3I9MA 4ID9A 3RASA 4IINA 2NU9A 1TT5B 2E49A 4XZ3A 5B37A 3QWAA 4YT4A 5BSFA 4Z9YA 4OMUA 3RAJA 2VHWA 4GX0A 1FK8A 1VJTA 3HN7A 5F21A 3WQQA 1PR3A 2OMEA 2C29D 4QEDA 5IXYA 1XEAA 2O4UX 4J7CA 5HM8A 3AM5A 2ZK7A 2GPTA 1ENPA 2WWRA 3JD1A 1HDYA 4QFDA 2Y67A 4K6FA 4BNFA 5ES3A 4Q3AA 2B4QA 1U7TA 3ZHXA 1E5LA 1NXQA 4PCVA 5JPIA 4RVUA 4RF2A 1FDSA 5C7LO 3OSUA 1U2DA 4LVUA 5HS4A 5BSEA 3RUEA 1R4NB 4JIGA 4XJSA 4DMMA 2JAHA 2HAEA 3D64A 1MFZA 3W4JA 3FBGA 1Q0QA 4IXTA 4W6ZA 5JS6A 7MDHA 3GHHA 1YL5A 2Y1DA 5DOVA 4JCOA 4UVDA 3BMQA 1XU9A 1XA0A 2IRWA 3VH2A 1KS9A 4IDBA 4B3IA 3PFFA 2C54A 1HE2A 2NUAA 3OJ0A 1IPFA 2CSUA 3D4OA 3GNQA 3GHYA 3DR3A 4D7AA 5JCJD 4RO0A 4GMFA 2JAPA 5KVCA 1YKFA 3OA2A 1HYEA 5K9ZA 3C7AA 3S55A 4XYLA 3GR6A 2J5QA 2P9CA 1R4MA 1UR5A 2Q46A 4YVFA 4Q9NA 5GY7A 1T25A 1MB4A 1EK6A 3V1UA 1KERA 4CR7A 1IULA 3WX0A 2FZEA 1MXHA 1U3TA 1Y8QA 1VC2A 1QV6A 4XDYA 3GDOA 5ENVA 3CPSA 2Q2QA 3ABIA 3KLPX 4XX0A 2WTBA 5U4QA 1ZK0A 4FC6A 3VPFA 3FPLA 1SEPA 1LQUA 2W98A 1KY5A 2D8AA 4WCFA 4WLFA 1YS4A 3D3WB 3GZNB 1DBVO 3I1JA 4K9DA 5F5LA 4E13A 4UVGA 4ND1A 1C0KA 1N9GB 2WYUA 3WIDA 2NTVA 1E5QA 4TRNA 2C07A 3VPHA 4II2A 5G0WA 4D45A 1DFHA 3LYLA 4NK5A 5FI5A 3UCEA 3JD2A 5I9NA 4RLHA 1P77A 2YW9A 3QW2A 1NAHA 4ILKA 1GEGA 3GVHA 4OXYA 3Q6IA 2QQ5A 3GRKA 4JJIA 4CMCA 2YV3A 3WSWA 1L7DA 4FB5A 3PWSA 4XQCA 1Y81A 4RZIA 2QRKA 5JDIA 3K92A 1XKQA 2H1SA 1R16A 1LDEA 1EVZA 5EMHA 3DAFA 2DT5A 1E1MA 1K6IA 1HSZA 3OIGA 3JQDA 3GPDG 3I9KA 4PVCA 3W8DA 3NDJA 2OP0A 2J6IA 4QQRA 1HDCA 1BVRA 3COSA 3BMCB 5HS6A 2UYYA 4BMNA 4FBGA 1JAXA 3FBTA 2P9GA 3KBOA 2O2YA 2R6JA 4PZEA 3E5MA 1R0KA 2PGJA 1BW9A 5BR7A 1IPEA 3L0DA 1AXEA 3ONFA 1YBAA 4XGIA 4BO8A 2CY0A 2EJWA 2FSSA 4KP7A 3KETA 4JROA 1EE2A 1GQYA 4ALKA 1UH5A 3IP1A 1DRWA 2GZ2A 1XG5A 3KSUA 1U1IA 3ZWNA 4WLUA 4I08A 3ZWYA 3H7AA 5LDHA 4E5KA 3GAFA 3ADOA 1TA4A 4EUEA 4MKXA 2UVDA 1YVEI 3ZV6A 5KKAA 1PJ4A 4FSHA 5COAA 4CV3A 1UAGA 4NHEA 3BMNA 5IF3A 5CDTA 4BNWA 5L4SA 3VVCA 3QVWA 1LNQA 2HO5A 3JD0A 3WGHA 4AJEA 4QSMA 4D0RA 5CG2A 3ZH2A 3HB5X 2CDBA 1VL8A 1HTBA 1VI2A 4IQ8A 4OAQA 4OOFA 1BDBA 4EEXA 4QO7A 1T2DA 1PWZA 3ZU5A 5JY1A 2CD9A 1O8CA 1H2BA 4RV9A 3R1IA 2WD8A 3ENNA 4O0LA 2G76A 5KVVA 1B14A 1HE5A 3SLKA 3WYEA 3VZPA 4UUMA 2DBRA 2E48A 3S1LA 4AG3A 3ZU4A 5CDUA 3ZWXA 1Q2XA 2ZB4A 1UZLA 4R3WA 2VYVA 2C82A 2ZCVA 1I10A 2O50A 2NM0A 1LDGA 3SC4A 3R3SA 1LEHA 1QYXA 5A9SB 4Z9FA 1NX6A 2HMTA 3BTVA 4JJGA 3F1KA 1YB1A 1F06A 3I9NA 4UVEA 5IN4A 3TZHA 1UP7A 1ZK3A 3NDRA 3PHHA 3PQDA 3BYZA 4LW8A 1EK5A 3KO8A 3Q9UA 3GZ4A 3G49A 1P33A 1KETA 1ZJYA 3GMDA 2C59A 5TLSA 4RQUA 1G6KA 4WCFC 1I3NA 1LX6A 3RI3A 1Z73A 5DN9A 3TSCA 6ADHA 4OO3A 4C7JA 1X15A 1E6WA 4BVAA 2HKIA 1SCUA 1R15A 3E9NA 3WGZA 2BRUA 1W73A 2DFVA 1E7YA 1YO6A 1PX0A 1P44A 1V9LA 1H2HA 3M6IA 1P1FA 2Q45A 4CLXA 4P38A 4DL9A 1I33A 2DPGA 2HK8A 2W90A 3JQFA 4NFHA 3F1LA 3DEYX 8ADHA 4CMIB 4GQAA 4WNIA 2JFHA 2DVMA 2XPCA 3WWYA 4FGSA 5C5IA 3T7EA 1E7SA 3OJEA 1LSUA 2QW8A 2YYYA 1LSJA 1MLDA 1U3VA 2FMUA 3JQGA 4Y98A 1EBUA 5JDIC 4E2YA 5COQA 4NNJA 2NSDA 2HRBA 2BKAA 4XKJA 4R1SA 4OGWA 1PTJA 2PA3A 1YQDA 3WICA 4X54A 4JNKA 1GAEO 5IG2A 4ZQHA 1E3EA 2LDXA 1JLLA 4XWYA 4E5MA 1MG5A 4IGFA 1D1SA 3PHJA 1Q1NA 4ZQFA 2SCUA 3PQEA 1E7MA 1WMAA 1IE3A 2B35A 4G81A 3CEAA 1P3DA 3KLMX 2G5CA 4I5EA 3U62A 3P5SA 4QO8A 4J6FA 1EUDA 3MJCA 4HY3A 3TL2A 4DWVA 2IZ1A 2Q2VA 3OBBA 1AXGA 1E3IA 4CR8A 4CMHA 4P4NA 3WG9A 3KEOA 1DLJA 1X1TA 4IZIA 3VOSA 1HSOA 3WR5A 5A5EA 2W8ZA 5T6BA 3AUAA 1GPDG 1OC4A 1ADBA 3OM9A 3H4VA 3V1TC 4II3A 2H9IA 4PLYA 5EL0A 4ZRMA 1UZMA 3MEQA 2GN9A 1SBYA 2PGDA 2OOSA 2W2LD 5A3VA 3MZ0A 3VKUA 5AXDA 3U4DA 1Y7TA 2OBNA 1Y8QB 2DQ4A 4PG5A 4M87A 4Z0HO 5T57A 3JYOA 4E5NA 4MKZA 1EFLA 1N7HA 1WDMA 4WCFB 4L8VA 1PQPA 4NFSA 1VL6A 4J16A 3RROA 3BHJA 3GEMA 1E7RA 5GMOA 5G4LA 1RYDA 3JV7A 2J5RA 3QWBA 2CFCA 3JQBA 3FWZA 4UUNA 2ILTA 2NACA 1AN9A 1OI7A 3SX2A 1PJCA 1H9AA 3JYQA 1NPDA 5AXCA 1I2CA 1ZIDA 3WBBA 2VYNA 1E7WA 4MP3A 3HDHA 1NR1A 1T2CA 4TKLA 1A7KA 5FFFA 4YWJA 3V2UA 3WTBA 3OEWA 1PGOA 4BNLA 3S2IA 3RIHA 3PPIA 4KDEA 5AQ1A 4O6VA 1ZFNA 3K8ZA 1DSSG 4XRGA 2DKNA 1T26A 3WGYA 4YRAA 1GUZA 3IAHA 5DZSA 2BGMA 3MTJA 2RHRA 3V2HA 1DC3A 3L9WA 1BDMA 4B7CA 1R4NA 1P1RA 3KRTA 1WAMA 1DAOA 3SC6A 4R16A 4AJIA 2FPGA 2PH3A 5KJEA 1QKIA 1JW9B 4ZA2A 1P1IA 3OIDA 1HE4A 4GWKA 4N5LA 3PYXA 4H3VA 1ONNA 4BQRA 2O3JA 1LXCA 4YJFB 1WW8A 3RVDA 1PR9A 2GDZA 2GCGA 3GG2A 4XQEA 4IQGA 3CKYA 5COBA 1SOVA 5DBIA 1PZHA 1F12A 2PWZA 3BTUA 2HRZA 3CZMA 3L07A 3U49A 2GASA 4Y6SA 4XDZA 4ITUA 1LC0A 2VHVA 3C7CB 4EJ0A 4EYEA 2EKPA 1DIRA 1EVIA 3TNLA 4QXMA 3VTZA 1NFRA 1IYZA 3MJVA 3ITKA 4O63O 1GADO 1DAPA 1T24A 4BGUA 3IJPA 1DIHA 3I9LA 4M86A 2HK9A 1HWYA 5L4NA 2O3RA 4L4RA 1VJ0A 1YBVA 4NH4A 4TRJA 3DOCA 3IS3A 2NLOA 1PJLA 4CMGA 1M6HA 2B69A 3DHEA 3K2EA 3BMNB 5U1PA 4BV9A 3UOGA 3JQ9A 3DHYA 2BFAA 1NTOA 3D3WA 4R5HA 3GZNA 1QP8A 1NPYA 1GR0A 5BT9A 5DF1A 3RCBA 3WQRA 2UUOA 4PG8A 4HUJA 3E6AA 4CUKA 3AY6A 2NU8A 3VPSA 2BFPA 4CLEA 1N9GA 2DU8A 2IZZA 1HZZA 3IIEA 4N18A 4NDNE 4AJ4A 4DC1A 5C3MA 1A5ZA 4NJOA 1R0LA 3CZRA 4B3JA 4UREA 2CF6A 3PRJA 1CDOA 4BGIA 4PLTA 1LU9A 3O03A 5IZ4A 1B16A 1EQUA 1PJ2A 1DFIA 4B4OA 9LDBA 1GV1A 3F3SA 2Y68A 5BNIA 1HF3A 3G1UA 2Q4BA 3QWIA 3PK0A 4LRTB 4TZKA 2NQ8A 4BNVA 2Z1MA 3DBHA 4PLPA 1IOLA 2A4KA 4Q3BA 4QT0A 2C5EA 2IZ0A 4FCCA 2ZKLA 3QHAA 4CMAA 4J1SA 1DC4A 3PGJA 4J1NA 4ZRNA 1XR3A 2ZTUA 3W6UA 5I7FA 3PLNA 5JY6A 3RJ5A 1U5AA 1Z82A 1ZK2A 4RVSA 4GGPA 3ZW9A 4GVLA 3EDMA 4IPTA 2G0TA 5I7SA 1N5DA 2BGLA 4CV1A 1HDRA 1AE1A 2B83A 3IKVA 2VOEA 4J2HA 2PNFA 3U0BA 1ZZEA 3KB6A 4NQZA 5FWNA 2AG5A 2VUSA 3A4VA 4OOEA 1IUKA 2ZIZA 1HLPA 1YRLA 4C7KA 4IXWA 1PIWA 4IUYA 1BXKA 3NT5A 3ROKA 3TOXA 3WBFA 4DLLA 1Y5RA 2PK3A 3UFXA 2AQKA 1D1TA 3D5TA 3C3XA 4G5HA 5JXWA 4CV2A 2IXBA 1YDEA 1JWBB 4GAEA 4PZDA 1N2SA 4PZCA 1U28A 3RKUA 3WB9A 4FFMA 1SNYA 3CE6A 2Y1CA 3JQCA 4LMPA 4XD2A 2PKQP 5TT0A 5TX7A 1PZFA 4CM9D 1H9BA 3DZIA 4R54A 3VPGA 2DBQA 1GFSA 5GZ3A 4IS3A 1LLCA 1GZ3A 2V6FA 3S2GA 5KJCA 4Q39A 4CM7A 1E0DA 3JQGB 3FNFA 4TSKA 1V6AA 3KXDA 2AQIA 1CWUA 3UN1A 1W4ZA 4H7PA 5JC8A 1DC5A 1LSSA 3QVXA 2JHGA 1BTOA 1GCOA 3RC1A 1DJNA 4MVJM 3WFIA 3E1KA 2PKQO 1T1SA 1W6UA 4BO6A 4GBJA 3QRWA 4JGBA 1HXHA 3ZNOA 4BNKA 4DIOA 1HYHA 4YQYA 2JCYA 2QYTA 1S6YA 1B3RA 3QVTA 5JE8A 1UXKA 4UULA 1FDUA 1GL3A 3PVZA 5J23A 4CMKA 3PZBA 3ANLA 3FR7A 1WXDA 2D1YA 3LF1A 3H2SA 5JAZA 1L1FA 5IDWA 5TC4A 4KTVE 2H5LA 2EP7A 1NHWA 2DTEA 1BWSA 2O3TA 3DHNA 5DULA 4A03A 1BRMA 4TWRA 5I9MA 3IDSA 1UXIA 4PLFA 1C14A 3PTZA 3O26A 3SVTA 4MO2A 3DC2A 4OH1A 5L9AA 2I3AA 4LSWA 3PGXA 3L6EA 1PGPA 1X7DA 1I8TA 2RAFA 1BHSA 2XXJA 1LI4A 2PZLA 4EI2A 1NVMB 1CQJA 1CJCA 1OFGA 3TZKA 1LRKA 3HADA 2NWQA 3ASUA 2RHCA 2P2SA 4MVJE 4QECA 3S2FA 3VTFA 1F0YA 5I9LA 1U4OA 3JQAD 4CMIA 5C7OO 3T7CA 2FPIA 2BFOA 4CLOA 4J9VA 3U4IA 1DJQA 4EGFA 2V6BA 2GZ3A 2C2XA 4CQMA 1QYDA 3V5NA 2ZB7A 2IODA 4ZVVA 4RDHA 1PZEA 1VM6A 1C3VA 1X0XA 4JBGA 1N1EA 1TXGA 1ORRA 3GUCA 3NKLA 3NUGA 8LDHA 1LJ8A 2CVZA 4GPD1 1NFQA 4CQLA 4ALNA 4N5NA 3RBZA 4I9NA 1P31A 2GERA 1NVGA 1NHGA 1M67A 3DBRB 4YPOA 4CM1A 1ULSA 4YJHA 4OXKA 1E77A 2OO5A 5T5QA 4DIFA 5JYEA 3L4BA 1D8AA 2BD0A 3Q2IA 3WJ7A 4YRDA 1U8XX 2Q1SA 2X0IA 4TZTA 1UUFA 4OSPA 3P2YA 4EDFA 1I3MA 3H3JA 3G17A 4JXKA 1H5QA 3DWFA 2FR0A 4BOYA 2P68A 2WD7B 2WMDA 1B8VA 2Z5LA 3B20A 5DCWA 4J7UA 4BV8A 2NTNA 4XQ9A 4YR9A 5CFZA 3SJ7A 4KQXA 3AJRA 4Y9DA 2OHXA 4YT8A 3QA9A 4WLOA 1VSVA 2B4RO 4XYEA 5I8ZA 5MDHA 1A72A 4JP2A 2ZQZA 1E3LA 3LF2A 3V2GA 3ONEA 5C7IO 3IP3A 2C20A 2JFGA 3BA1A 2PD6A 3CMMA 1Z74A 4YJDA 4B3HA 1GZ6A 2YUTA 3MJSA 1VLLA 1O6ZA 3HUDA 5ER6A 4BNGA 4O5OA 1O0SA 2FZWA 4MVJP 3CSDA 4RL6A 3NV9A 2EG9A 3DAGA 3GUYA 2Q49A 2TMDA 2W4QA 3DQPA 1JVSA 4RF5A 2QRLA 2XOXA 2E82A 1XU7A 3HG7A 5EINA 1J5PA 1NP3A 3LT1A 3RBXA 4FJ1A 1PSDA 2DTDA 5TGDA 5AXBA 4BGEA 4ZU3A 1DFGA 3H5AA 2JL1A 4ALLA 3FPCA 5A1TA 1OOEA 3IUSA 4K26A 2Q1WA 3WSVA 4PN3A 2D0IA 1GYRA 1PS9A 4AJJA 2EF1A 3BHIA 2VRCD 3N7UA 3IC5A 4R68A 3TOZA 3VDRA 4CMEA 1HE3A 1XHLA 1YDWA 4Y6RA 1GDHA 4YTEA 4PIVA 5JC1A 1ZNQO 1I2BA 4RF4A 2YDXA 4UUPA 1X0VA 4B7UA 1LRLA 4A5OA 3PYLA 3DBHB 4EBFA 1SC6A 2J5KA 2Y1GA 2CVOA 3VC7A 5G0VA 1E1KA 4MVJA 2YQ5A 1ENYA 2HJRA 5IDQA 2Y93A 1QYCA 3KYDA 2JHFA 2VZ9A 3ZI0A 1KYQA 4BS9A 2LDBA 3HQ4O 3R6DA 2EKQA 1QMGA 5L95A 4J2OA 3RSHA 2BI7A 1U5CA 2DBVO 3DZJA 3L4SO 4YJFA 1RWBA 2C7GA 3NAQA 4MVJH 4MVJI 2X86A 1JA9A 3ETGA 4MVJG 5IXSA 3DB2A 1ZO8A 2X0JA 1ZSVA 4PVDA 4J43A 5BSGA 4XR9A 5L3ZA 5ITVA 3I4CA 4YBZA 2YHIA 1QSGA 4NBWA 4PRKA 3F4LA 2GO1A 2X22A 1LSOA 5B12A 3ST7A 2OBYA 1G0NA 3HJAA 3N74A 2Q2WA 4IJVA 1RKXA 3TN7A 1DRVA 4CLDA 2VNAA 4DYVA 3W1VA 2OGUA 1GTMA 1WLYA 3PDJA 4GL4A 4J1TA 4U5QA 4XQGA 3AK4A 2X23A 3C1OA 2O7SA 4HBGA 1NM5A 2EW8A 1YBMA 2QHXA 2ZJ0A 4TQGA 3M1AA 4AICA 1X7GA 2C2YA 3GVIA 3OA0A 2P91A 4W82A 3RUFA 5CDYA 3LU1A 1QRRA 4GVXA 2Z1NA 1C0IA 4LVCA 4XYGA 2Y1FA 4Z3KA 4R5MA 2F1KA 4E5PA 3S8MA 3CINA 4RVGA 2WSBA 4UVIA 3GGGA 2PH5A 3FCOA 3ZV3A 5EQFA 1UDAA 3L4BC 2D4AA 3A14A 4NU6A 4XYMA 5BNTA 2Q99A 2BMAA 3VHRA 2NTJA 2GR9A 3ZHYA 4BO7A 4YACA 1I5RA 1IZ0A 3K9QO 3QLJA 4MIOA 2Q1TA 5JO9A 2VUUA 4RPHA 4XR4A 3TF5A 2POQX 2Y0CA 3PJEA 1XIVA 2CUKA 1ZXLA 1IHYA 3EZYA 3LVFO 3PHGA 4MVJF 3GVCA 4RQTA 4DRYA 2I65A 1X1EA 3K6JA 3VPXA 5K6AC 1U9JA 3WNQA 3QWHA 5THQA 2GZ1A 1U3WA 1V3UA 4L4XA 4WLNA 3RWBA 4BNHA 2HMWA 1ISHA 1E3JA 4NFYA 4Q3NA 4ESOA 4A73A 1CERA 3DL2A 3KZVA 1ZVMA 3HFSA 4YCAA 4J0FA 4GWGA 3W4KA 1HRDA 1NBOA 1FDWA 3OFSA 3EHEA 4B79A 1YXMA 4YT2A 1Y6JA 2E37A 1YL7A 1Z7BA 3UICA 1HZJA 1EFKA 1F14A 5TT1A 1W8DA 3PQFA 3IOYA 3WIEA 2V6GA 1GV0A 4BO5A 3GNTA 1H6BA 4YXFA 5A4DA 2AXQA 4CUZA 4AJOA 3F9IA 2I99A 2IXAA 1ZEMA 2ZTMA 4TKMA 2AQ8A 1P1HA 1GEEA 1R37A 1SPXA 2EWMA 2HQ1A 4F45A 5JAIA 4GX2A 3Q11A 1OZAA 3ORFA 2Y0DA 4CMEC 5F3RA 4BNXA 3H5NA 3KV3O 4E30A 1ADCA 4LSMA 5AXAA 3HWRA 4Z0PA 2VNSA 4CLOB 1ZBQA 2P5YA 4Q3DA 3RC7A 3FI9A 1VPDA 3GOHA 1HDOA 3PXXA 1NFFA 4ND5A 4CQMB 5IAAA 3H9UA 1I30A 4AVYA 2X58A 5ICMA 5L7WA 4TVBA 4FFPA 3ROPA 4DBVO 1H0KA 3NGLA 3F46A 4L0QA 4RPKA 4CQLB 1AHIA 2NU6A 3KHUA 4NBUA 3TRIA 4BL5A 3GVXA 1PQWA 4ND2A 4DLBA 2H63A 1I2ZA 4C4OA 2FHSA 3AUUA 2ZYDA 3HDYA 3IQDB 4I5DA 4RPGA 5EJ2A 3RU7A 4YJHB 2P9EA 3W6ZA 7ADHA 3DXFA 3UW3A 3UVEA 1CEQA 3ON5A 5LCXA 4BO2A 4OM8A 5K0ZA 4BKUA 2FOIA 3FD8A 3LQFA 3NT4A 3WGIA 4S3MA 1J6UA 2VWGA 5F1PA 4NJMA 5FEUA 1OC2A 3GQVA 5H82A 5JCJA 2VN8A 4DQXA 5L7TA 1MFPA 3GEDA 3W4IA 1P9LA 3JQ7A 3WGGA 5A06A 1YOVA 5BQFA 1Y9AA 2IYPA 5JO0A 1H6DA 2AEFA 3IKTA 3G0OA 2QYSA 4YAIA 1XWFA 4MJLA 4BNJA 1H6AA 3EVNA 4L76A 3E48A 2ZB3A 4KUGA 5KJ1A 2DM6A 3OETA 1K6JA 1XDWA 4A26A 4RDIA 3WMXA 3JTMA 4BNIA 1T2FA 3DDNA 3DZGA 1WZIA 3KOUA 5DBGA 1K89A 3B70A 4ALMA 1ML3A 1NYTA 2HU2A 3B1FA 3E03A 4K6CA 1LTHR 2B4TO 1K5HA 3I52A 1F8GA 1LA2A 2V6MA 1EDZA 2BI8A 3U5TA 2G17A 4F6CA 2C0CA 4Z3DA 3VZSA 3VZRA 1DEHA 4FPXA 3OICA 4HNGA 5FYDA 4I9UA 3E5RA 1YB4A 3EW7A 4RORA 3KYCB 3OHSX 3WYCA 1PGQA 4BB5A 2JCVA 4I8XA 1X7HA 3F5SA 4KUEA 1E7QA 2O4CA 3DAPA 1IHXA 1DC6A 1SO8A 1T4DA 1WPQA 2YV2A 4OHUA 5CEFA 2PY6A 3PFWO 5DDIP 4PGFA 1KIFA 1B2LA 1KVTA 3GG9A 2PTGA 3AUSA 1SB8A 1RM4A 1R12A 3AFMA 3UCFA 2YHUA 3BXXA 1DXYA 3HNPA 2HJSA 3BIOA 3U3XA 2X5JO 4DXHA 3AY3A 1TVEA 2FP4A 5EPOA 1M75A 1NQAO 4Q3EA 3ZHBA 5I7VA 2I5PO 3PWZA 5DP2A 5L51A 3L9XA 3DBRA 3KYDB 1ADGA 4BNYA 2X1HA 2XXBA 3C85A 4YAJA 5DT9A 1DIGA 2DPHA 4FOSA 2DBZA 3KSDO 4R69A 5F1OA 3LC2O 4FGWA 1K0UA 2WD7A 4JLWA 4UEJA 3QY9A 3T4EA 3VH1A 3NTQA 1Q0HA 1DHTA 4HP8A 3DOJA 1HEUA 3JYNA 2YHIB 2ET6A 4YRBA 5MGBA 4FOOA 4B4WA 3PIDA 2GF2A 5CPBA 1JWAB 1GUFA 3PLRA 4U7WA 1A9YA 1LQTA 5KVSA 1C0LA 2QZZA 3QJ5A 4DIBA 4E3ZA 2DAPA 2ZATA 3P7MA 4MINA 1R0SA 2EKLA 1NQOA 2WE8A 1H94A 2PFGA 3AI2A 2EXXA 2ZQYA 3BTOA 5EIOA 4LCEA 2Q1UA 2HSDA 3K5PA 3TFQA 3UF0A 4W7IA 4BO1A 2XAAA 3WWZA 3ZNPA 1RM3A 3RFTA 1WDLA 1FMCA 3RUIA 4KMSA 1G1AA 4D42A 3VH3A 2O3SA 4TROA 3DBLA 3WFJA 2AE1A 1QYWA 4H16A 4CMBA 2BHLA 3CUKA 3DOOA 1JDJA 1ISMA 4NU5A 5IDXA 4D3DA 4PLGA 1T1RA 4CPDA 2HK7A 4ONEA 4CLHA 1T2EA 4B4UA 1BXGA 1H93A 1ONOA 5T8KC 3ZWWA 3CMCO 2DTXA 4XGKA 4PG7A 3OEYA 1YJ8A 3KTDA 4P22A 3SLGA 4IMRA 1A4UA 4NBTA 5AVOA 5G2OA 1EZ4A 1UJMA 4MIYA 4BKRA 3LT4A 4A7PA 1EUCA 4S1VA 4M1QA 1QR6A 1B26A 1J49A 2JFFA 2Z95A 3OECA 3PDUA 1PJSA 4YA6A 4ZQEA 5T64A 1T2AA 4M49A 3INTA 4QFCA 1K6XA 1M6WA 1SMKA 3Q2KA 4R9SA 1UDBA 4J4BA 5TSDA 2I67A 5KJ6A 2TMGA 1PL7A 3O8QB 2GN8A 3OQ6A 4W4TA 3GY0A 4CODB 2EJVA 5KIAA 3FRJA 3BZUA 1TT7A 4F3YA 4GKBA 4NBVA 2BLLA 3AOGA 1ZSNA 2VHYA 3DFUA 1XELA 1PGJA 1V8BA 3NT2A 4PLZA 4XJTA 3AUTA 3GDGA 1PEDA 1HDXA 2OL4A 3Q0EA 3ZWMA 3DMTA 2BH9A 3HDJA 5G4KA 4BO3A 3SBOA 1ZSYA 2IDZA 4IDDA 4U8GA 2YQ4A 3GT0A 4ALIA 3C1TA 1WWKA 4IDGA 3DONA 3JQ8A 1ZK1A 1N92A 6LDHA 4ND4A 5DCUA 3ETEA 1E92A 4DVJA 1EVYA 4EUFA 5CAEA 3PZRA 3MTGA 2PKRA 1XCBA 1XYGA 1M76A 3GMSA 4IJWA 4D46A 3RUCA 5IJZA 4WLEA 2I6TA 5U9CA 4DPKA 3EYWA 3WXBA 5C37A 1GZ4A 3GDFA 5A02A 5DCYA 3EY4A 4AL4A 3A1NA 4DLAA 3F6YA 1PS0A 1I3KA 5BSHA 3TJRA 4CM5A 4WCDA 3AY7A 4U6SA 4WEQA 4DPLA 5KCZA 3GNSA 4GI2A 4FIZA 3HE3A 1X13A 4N54A 2GNAA 3AWDA 3FNEA 3H65A 3ANNA 4HFRA 4RPJA 3PIIA 4J9UE 3K96A 2JCXA 4BKPA 2EW2A 3MWEB 4BO0A 2OP1A 5IZCA 2EIHA 1UXJA 3ZWOA 3WJAA 3FNGA 2R00A 3AI1A 4IIVA 1I24A 1JVBA 1VKOA 4KDFA 1DDOA 1U4SA 3OQ1A 1NWHA 1KY4A 4FDAA 2D3TA 3WYBA 3RUHA 3NJ8A 1ARZA 4HKTA 4XIYA 1YB5A 4HX5A 4JN6B 1ZMOA 2YZ7A 1PS8A 2RCYA 2WE7A 2FWMX 3EK2A 2J3HA 4NJMB 4WLVA 4BO4A 5CDSA 4RZHA 5JYDA 2RBEA 3UH1A 1QYVA 2B5VA 3K31A 4ND3A 4UAGA 2UV8A 3ADPA 2BGKA 3AU8A 3ULKA 5JSFA 2NNLD 2Y05A 3JQ7B 1JN0A 1YOVB 3HSKA 2Q50A 3DZKA 1KEVA 4LK3A 3H9JA 2GSDA 4NK4A 3ZN2A 3PJDA 2GN4A 4OXNA 4FC7A 4PLCA 3B1JA 3ZV5A 3WTCA 2W2LA 9LDTA 3I5MA 2DUWA 3NYWA 1Z45A 3INGA 2HDHA 4GMGA 4XRRA 4BNNA 1E1LA 4QX6A 3GN1A 3GGOA 1U2GA 3Q9NA 5TRTA 1Q0LA 2CMDA 1V3VA 3WNVA 5G0UA 1GQQA 3PHLA 4PRLA 2WYVA 4A0SA 3MCVA 4P4LA 1GCUA 2CF5A 4I5GA 1S7CA 1VL0A 3LC1O 2X9VA 3AM4A 1V3TA 3X2FA 3TZ6A 3IL2A 3I3OA 5A03A 3TPCA 4CMJA 1MG0A 4WKGA 3BAZA 3SJUA 1I01A 1NVTA 4E5YA 4GSKA 4E31A 2AMFA 5A04A 3JD3A 4FQ8A 3L6DA 4IDAA 2P5UA 4U0JA 2QZ9A 3H2ZA 1JAYA 4W7HA 5TNXA 5L7YA 1ID1A 3WLFA 4E2WA 5ICSA 3LDHA 1Y8RA 5L40A 4OL9A 5G0TA 3MJ4A 5CG1A 3VAZA 1UAYA 3C8MA 3TL3A 2Q3EA 4H15A 1IZ9A 4R3NA 1DHRA 4K28A 3HZZA 3K30A 4MP8A 1D3AA 2IYOA 4LRSB 3I4FA 3M2TA 4XYBA 1A71A 4EITA 1VSUA 1YGYA 3AI3A 4CM4A 4CM3A 4F6LA 2JKVA 2QRJA 3MOGA 3W8FA 1SAYA 5KWEA 2FRDA 1ZH8A 1BSVA 4MIEA 2ZYGA 4BUCA 1F17A 4J49A 1ISFA 4IDFA 4WECA 2NV6A 3PHIA 4HV4A 3H8VA 3UXYA 3X2EA 3DMTC 3M1LA 3WGTA 2D2IA 2HUNA 4WGGA 1MX3A 3BMOA 1A7AA 2NVBA 4J7XA 4B8WA 4RVFA 5K6AA 5L53A 2Q4EA 2VWPA 3AW9A 4IJKA 3HN2A 1Z75A 4LGVA 2PZKA 2YFHA 3DMYA 1Q7BA 3O4RA 4R4JA 5H83A 4GX1A 4K1LA 4ROSA 5JAQA 5JNLA 1T4BA 3LT0A 3WGOA 1UXHA 4FFLA 1MV8A 3QIVA 1YQXA 4NR0A 1VKNA 2E4AA 3O9ZA 2QIOA 1E6UA 4IY1A 4UEOA 2I76A 3GVPA 1MUUA 2I9PA 3FF4A 4O1MA 5JW6A 3AOEA 4WK6A 5TS3A 1E3WA 2ZTVA 4E2XA 2XF8A 1CQIA 1U7HA 2DC1A 4MPDA 4JK3A 4IQ0A 1KBZA 4PLVA 3TZQA 3DBLB 5IZCC 3QE3A 3H3FA 2D5AA 2W2KA 1YE3A 2R00C 3AM3A 5A3JA 3GFBA 5JCXA 5H81A 1N1GA 1Z6ZA 2V65A 3HB4X 3D5QA 3KYCA 5KVQA 4G2NA 5FF9A 1TB4A 1ZW1A 1EQ2A 2BFMA 3GH3A 4TRRA 4BB6A 3FSRA 1XGKA 1GUYA 1P0CA 1FF9A 1YL6A 1BXGB 2NQTA 3P19A 4FW8A 3RD5A 4E33A 5DNAA 2YJZA 4HXYA 2PD3A 4BKOA 3MWDB 2NVUB 1J4AA 4BQPA 3DTYA 1SOWA 2H6EA 1QLJA 2QG4A 3OJLA 3EC7A 3F47A 4R41A 3KUXA 4CLRA 3TFOA 3FHLA 3LT2A 4I9HA 4ZJUA 4A2CA 4PLHA 1D4FA 2UAGA 1B3BA 2WJPA 3A28A 3F5QA 4LMRA 3GAZA 2ZYAA 4WASA 3PJFA 4J90A 1F8FA 3TQHA 5JMWA 2B0JA 4RCVA 1QG6A 3T4XA 2FR8A 4DC0A 1HT0A 2VZ0A 2AG8A 1RPNA 1IB6A 1LLQA 3KYBA 3R0IA 5F1KA 2VYND 3QVSA 1XSEA 4KOAA 4EUHA 3KEQA 2X5OA 5EN4A 2Y1EA 3E9QA 1NASA 1ISJA 5KKCA 2C7VA 4BNUA 4INAA 4CL3A 4IDEA 3ZHZA 2PV7A 3UAGA 5ENDA 2PD4A 1YWGO 5G4KB 5THKA 2CZCA 3U9LA 1P0FA 2C5AA 2VTDA 5CP8A 1HDZA 3Q1LA 2VUTA 1AHHA 3DBVO 5A5FA 4WNCA 4P8RA 3JQ8B 4CM9A 2OXIA 1TEHA 2RIRA 3GA0A 2AA3A 4WPGA 4TRMA 2CVQA 3UGKA 3RUAA 4AJPA 2RH8A 4L4SA 4FD3A 4IDCA 1M66A 1LLDA 1AUPA 5LDGA 4M55A 4OJNA 1WP4A 5B4TA 1ONPA 3WOHA 2O23A 1HLDA 5IFLA 1A4IA 3F4BA 4Y6PA 4GLOA 4ZD6A 3V1YA 4RGBA 3RC9A 4W99A 1RYEA 1JKFA 1KEPA 2J3KA 5I8WA 2I66A 1BXZA 4FN4A 3D4NA 2CDAA 1KEWA 2WDZA 3H9GA 4J91A 3ENKA 2VZ8A 4B4VA 1DIBA 5CEEA 4WOJA 3E8XA 2VCYA 1R66A 1NQ5A 3FN4A 2EHDA 5LC1A 2VT3A 2EGGA 1WDKA 4XEHA 4Y8VA 5B1YA 4GH5A 1ULUA 2V7PA 3UUWA 4Y67A 2EERA 5TF4A 3ROMA 3EGOA 5KTKA 4LN1A 3OMLA 4A27A 2WM3A 2FSVA 4FJ0A 4R01A 3ZW8A 2F00A 2VQ3A 5HA5A 4Z6KA 5EESA 1HYGA 1EEHA 4KWIA 4BO9A 3W8EA 4U0KA 1ENZA 1LDMA 4HADA 2AEJA 1A9ZA 2HLPA 1GYQA 3S2EA 4BGVA 1KVQA 1IL0A 3O8QA 5EERA 2X8LA 3QWFA 3ZNNA 4TMFA 1YQGA 1C1XA 1WZEA 3L6OO 3PJGA 4E6PA 2HMUA 1KEUA 1HETA 1LRJA 2VWHA 4JX8A 3CIFA 3AOEC 4OYRA 4YYZA 2GLXA 1UZNA 3NTRA 1E6EA 1D7OA 4IM7A 4NI5A 1B8PA 4CJXA 3ZU2A 2HMVA 5JMPA 1I36A 2D59A 1JQBA 4RLSA 2B37A 1PWXA 3K2BA 3NRCA 4ZQGA 4IGEA 4AJ1A 2FR1A 4NPCA 4J3FA 3A06A 3JQAA 2OZPA 1WMBA 4OSOA 1HL3A 2G1UA 1DO8A 4MOWA 1OMOA 1V35A 4R1TA 2EGHA 1ISGA 3JSAA 3UCXA 4UUOA 3TDKA 2EV9A 2VWQA 4YT5A 5DBFA 1GQ2A 1MGOA 4EZBA 1B8UA 1CYDA 4R1UA 5KOIA 2J8ZA 2WYWA 3RFVA 3JYLA 4LISA 4D3FA 2IEDA 1Y8RB 4YJGA 1HDGO 2OFPA 3NJ4A 2FY8A 4JBHA 3U4CA 3C24A 4JJFA 4KWHA 4B8ZA 1NQTA 4BHTA 4NIMA 1C1DA 4FFOA 5TJHA 2A94A 2O3UA 3LK7A 1BG6A 4R51A 4UEKA 1P45A 3AU9A 1EMDA 3E18A 4CM4B 4ZICA 5T67A 1I3LA 1DIAA 3KSZO 1MC5A 1Y1PA 1QORA 4YAEA 3QV1A 3WS7A 5ADHA 4GX5A 3UHAA 4YEDA 1FDTA 5T8KA 4CM8A 4D41A 3PYMA 1DLIA 3CH6A 4NBRA 4L9RA 4YQZA 1N8KA 4IBOA 1E1NA 4XCVA 3D3EA 5TQVA 2D5CA 3U09A 4BKQA 2X5KO 3M2PA 1ZEJA 1PL8A 3GN2A 3BMOB 3DO5A 1VE9A 3RBVA 3RKRA 3OQBA 4MP6A 3VZQA 4EW6A 3NTOA 3QVOA 2GRAA 4AJNA 4E2ZA 1NWCA 1W0CA 3ONDA 3WQSB 4FFRA 2X0RA 4RPLA 4DQUA 4E32A 4WEOA 4R9RA 3BMQB 3INRA 1B7GO 3LZ6A 3IJRA 5CHEA 4NMHA 4KQWA 3MJTA 1K2WA 4HFMA 4BMSA 4NZ9A 5GZ1A 3EMKA 3VKVA 5A05A 4BIIA 1B0AA 1E3WB 1EE9A 1ZMTA 3N58A 1OBFO 5BNFA 3L77A 3R3JA 3GGPA 1IY8A 4B7XA 4CUJA 1LDYA 4MKRA 4E12A 2AW5A 1EBFA 1NPTO 2CDCA 1R4MB 2GD1O 4JBIA 4DYDA 2W2KB 5ILOA 3SXPA 3I83A 2VRCA 2HCTA 2VRBA 1P1KA 4IJUA 4OQZA 4YAGA 1SEVA 3FTPA 3TZCA 4ZHSA 4KTTE 2VOJA 1P74A 1B15A 1LUAA 3CXRA 4LCJA 5JDCA 4EJ6A 4EJMA 1WVGA 4D44A 1SB9A 4D43A 4HNHA 5JFOA 2J3JA 4KZPA 4CL8A 2EP5A 3GRPA 1J0XO 2DFDA 4PG6A 4PFJA 3ZWPA 3EVTA 1CETA 4DTIA 1TI7A 1TT5A 1JTVA 2PZMA 4CLRB 1RJWA 4XB2A 4DPMA 3HHPA 2J3IA 1KC1A 1YONA 2VT2A 4CM6A 1LC3A 3JD4A 2ZJ1A 4U6QA 1LLUA 4PG4A 4FR5A 2ZB8A 2OUIA 1Z7EA 1ADFA 1O89A 1E3SA 2JD0A 2Y66A 3ANMA 4M89A 5A9TA 3H9QA 4W9NA 3Q3CA 3D1LA 4RVHA 4NG5A 4E4YA 1PU2A 2AEMA 1GPJA 3KVOA 3ZZNA 3ICPA 3LLSA 2A92A 2UDPA 3ZWAA 4CQMD 1XLTA 4OKIA 4XIJA 4PLWA 3STHA 4AJKA 1H6CA 3C1AA 3G3EA 4RJTA 2FPPA 3EUWA 5JAMA 4DREA 1MP0A 3OH8A 4G65A 1M2WA 1UXGA 3K73O 3NGXA 3JQEA 4BNMA 3O38A 4GGOA 1C0PA 5KNLA 1LDBA 3QP9A 4N7RA 2JD2A 1FJHA 1O5IA 4RF3A 5CEJA 3GK3A 3NX4A 4HFNA 5CPFA 4I1IA 3IUPA 2X6TA 1JU9A 3FNHA 3E9MA 1MXFA 2NU7A 3LSYA 2PZJA 2P4HX 3WDSA 4WOKA 4AJLA 1XQ1A 4BNTA 1GD1O 4AJ2A 1BW9B 1MA0A 2X9GA 2Y99A 3ICCA 2PR2A 4OKNA 3DZHA 3BHMA 3HDQA 4HWKA 2BF7A 4J4HA 4CV0A 1X14A 4XA8A 3IMFA 3H5RA 3LLVA 1I32A 3C7DB 3DZBA 1KOLA 4EEZA 1Q7GA 4E0BA 4GSLA 1PZGA 1QXSA 3JQFC 1PJ3A 4IMPA 4YAKA 1ENOA 5A9RA 2O3QA 5DOZA 5IDYA 3RFXA 2YFQA 1L7EA 3I23A 3VDQA 1PJTA 3BTSA 1LBEA 2YV1A 2GN6A 4J0EA 2BELA 3VVBA 4WJZA 4Q3CA 1O94A 3RJ9A 3KM0A 2YDYA 5B4UA 1OAAA 1ZUD1 4ZQBA 2VHZA 2NVUA 1GYPA 2X7HA 3D4PA 5FI3A 2DUUA 1P1JA 1CIVA 1Q7CA 3U4HA 2WEKA 2E6UX 4FJ2A 4WE3A 2X9NA 1DPGA 4A10A 1JKIA 1PJQA 3GC6A 1VJ1A 3GEGA 3OP4A 4YDRA 2O7QA 1ZKMA 5L45A 3PI7A 1KC3A 1ZXBA 1CRWG 4KUHA 3I6IA 1K3TA 1O9BA 1O95A 1PQUA 3GPIA 4D3SA 1PGNA 3VH4A 1BMDA 5IN5A 2OORA 4JQCA 3WMWA 3EZLA 5GZ6A 1C1XB 1ZK4A 2QX7A 5HTOA 3WLEA 3JCZA 2RH4A 1R6DA 3AFNA 3D7LA 4QUKA 5F5NA 4DA9A 3ZU3A 4DMLA 1BVUA 4MVJD 4E21A
chains in the Genus database with same CATH superfamily
2DFKB 4I55B 4IGAA 4EHNA 4DV6B 2NZ2A 2VHXA 2DR2A 3OIFA 3T3HA 4PX5A 3SXUA 6PFKA 4F4CA 3BMCA 2H85A 5DYIA 4EB8A 3WOVA 1JT9A 4MQ6A 5IJWA 5EHQA 5K3EA 3C3BA 5HBGA 4HLNA 4OX9Y 1IBSA 2VVTA 3JQ6A 3IEMA 1FFGA 4K86A 1FQJA 2O2SA 3BM5A 2A35A 3CKKA 4YB8A 1RQNA 1Y3FE 4X3OA 1OI4A 2GF9A 1QG4A 3E82A 1R00A 1RAFA 2JJYA 4GO1A 1VLHA 3F9RA 5EJ9A 1L5RA 5H8WA 1X7ZB 2CJFA 4KN9S 4TMXA 3GT3A 2IWRA 2R2GA 5CA1A 4F9GA 1LPMA 5B1EA 1V2GA 2DFLA 3PKJA 3SNHA 3GF4A 3CVXA 3ZXSA 3HFJA 5DYTA 4D79A 4KV9A 4JP3A 5J43A 3RQSA 3IAFA 1RM0A 5TF0A 3CQ9A 1J97A 3I01M 4ZTZB 5A4MS 2ZW9A 3VJLA 2Q5OA 2EQ5A 2XUOA 2K6GA 5SICE 4BQFA 4DJDC 5K20A 2GA8A 2O48X 2QMOA 2JD1A 3LBIA 2ZJ3A 3EEYA 3ZNQA 3HACA 3I9JA 1CF2O 2P6MA 1MH1A 1QMPA 1RM5A 1Y42X 2J3MA 2JK1A 3CE9A 3C87A 3LKVA 4R2HA 5DWDA 4JSTA 3T5CA 2EJTA 2YY7A 5D5HA 3RUDA 1MEJA 3PC8C 4ZVLA 4TYWA 5KQSA 4JB2A 5ED0A 2X4LA 4IMJB 2CXQA 1DOHA 1FSGA 3CPJB 3ZWBA 4HLUC 1FXSA 1QIGA 2HA7A 1T6ZA 3GJQA 3BX1A 1D6MA 3LFHA 4W63A 3FI0A 4CM8B 1BDJA 2VAPA 3B1KA 2IUEA 2ORIA 3LQYA 4GI5A 3A4IA 4KI0A 3VBEA 4BCBA 3LCUA 1U8FO 1UEXC 5CFQA 1ULHA 4AJHA 3IVGA 3W34A 1NURA 2IH2A 3ZE7A 3RS5A 3SGLA 4YPVA 2JGLA 1YH3A 2VUIB 1HKUA 2WF7A 3GLQA 3RFCA 1HFWA 5ER9A 4FWTA 2BCEA 4P83A 5EQDA 2ORED 1WD7A 2PZEA 3IALA 5JATA 1PG0A 3ZWVA 1PWHA 2C9BA 2NADA 2UUPA 1YC2A 2B21A 1GQOA 3GFGA 4TS3A 4ZN6A 2C7BA 1YA8A 1C5KA 1VIYA 3MJEA 4MR9B 1OH6A 3X1JA 1G4UR 2FGKA 2GXSA 2L69A 3D0QA 3L7JA 4N0DA 1T9ZA 1PO7A 3EFOB 4KIFA 4B32A 2RHMA 4AZSA 1PFWA 4OQXA 5TIIA 1CIPA 2IZ6A 4GLLA 2PKWA 2I7VA 3AF1A 4NENB 4L75A 2VYVD 2VTVA 1A27A 3A9WA 2J59A 2NXWA 4MX8A 1QB8A 4C08A 5DGTA 3G9ZA 2RGXA 4HQ0A 3E0XA 1XL0A 3B3QA 4BMCA 5AKLA 5AI8A 1D03A 2FSPA 1QS0A 4MW2A 3IT3A 1Y5MA 3KT6A 2IEBA 3QU5A 4R0NA 1GFZA 4XDGA 3ETDA 1ZBDA 1DU4A 4J0JA 3WHLA 4U5XA 4ZGWA 4MW9A 2VIIA 3ZI7A 1A9XB 4P3PA 3HJRA 2N42A 1KVUA 3UV6A 1ZHOA 4YK7A 1K5PA 4CW7A 3CRQA 5AQEA 4FT4A 1U31A 4MA0A 1S2MA 2WU0A 3SN6A 4DQVA 3AFIA 2W11A 2X0KA 3MPUA 1CUXA 1E69A 3FJOA 5DXAA 3GD5A 5EMLA 2G5TA 1D9ZA 1GNSA 4UUQA 3R9WA 2W4IA 1CY8A 5IM4F 3FDXA 4OGKA 3ER9A 1TFUA 2Y1OA 2X4GA 3BD6A 3ZHUA 2I6GA 2QM8A 1XCJA 2B36A 2HTFA 1YZHA 5JRZA 2DWUA 3DQQA 1RZRD 4I5FA 4RKFA 5AJXA 3BBLA 3OEED 3TWOA 3Q8KA 4HWOA 4IINA 3I05A 4FBLA 4YT4A 4DMCA 4YJ3A 3KQMA 3S2SA 2PKCA 4FOTA 2EGUA 4I1OA 4OMUA 4Z9YA 3RAJA 1O95C 1JA1A 2VHWA 1FK8A 1YB6A 1RHJA 2BZ1A 1L7MA 1ZQ9A 5F21A 4AUKA 1PR3A 3ZCPA 3A4LA 3OQNA 3PTLA 2C29D 1MQAA 2OORC 1PZMA 5IXYA 3K6SB 3AM5A 1CFZA 1V25A 2KPOA 1UKZA 2AJDA 3EIOA 4QFDA 4YAUA 2C3UA 2Y67A 4WSOA 3CURA 4Q3AA 3SU8A 1RKBA 1O57A 1U7TA 4UOQA 4MQUA 2ODTX 4LWPA 1BC5A 3U3RA 2FETA 1NXQA 2CMFA 2IXEA 1HK7A 1BHQ1 1MNAA 3GEPA 3ZDQA 3G0DA 3MCAA 1P4JA 5ERXA 4DWWA 5EJ5A 1KYTA 1XNQB 1VRCA 3IIJA 4RF2A 1FDSA 2I6XA 5ALIA 3ZV3A 3R0XA 4DLTA 1U2DA 1YK1A 1GTZA 1C9KA 3VZCA 5BSEA 1ZN8A 3QYFA 2R8EA 2EZ8A 2H7YA 2QZSA 1DG1G 1JJFA 4F4UA 3FBGA 4DAEA 1S4MA 1ZU4A 1Q0QA 3MJDA 4JT2A 3RSCA 1U81A 1T3GA 4X7MA 4YJ2F 4ODIA 4DNFA 2VQFB 2HJGA 1GTL1 2EHJA 4IOMA 2QL9A 3GHHA 1LW6E 4RULA 1L4MA 3I28A 3VV3A 3OJCA 4JCOA 3W2HA 1JHXA 2Y2VA 1QHFA 4GQBA 4UVDA 5F23A 3L7KA 3K0FA 1YZLA 1KS9A 3EEFA 4QZVA 3QG5A 4P36A 1G8AA 4IDBA 5EKUA 4A8PA 3E0QA 2HEGA 2FF7A 1SBNE 2GK6A 2NUAA 3G2NA 2CSUA 3AUJB 3D4OA 5E4JA 3GHYA 3ZOZA 3I5XA 5JCJD 1L9XA 4RO0A 5A6SA 4GMFA 2CD7A 5DNDA 4R71A 2JAPA 3MELA 2I4RA 1U7PA 2Z4TA 3FZYA 1XMIA 5KVCA 4JWTA 3T5PA 5IVDA 3EZ7A 3O8DA 5E7MA 3RO7A 3A1CA 3UA3A 3F8WA 1Z4JA 5K9ZA 4LHEA 2IUTA 2ZYWX 4EF6A 2J5QA 2HWWA 1SXJB 4K3VA 1GITA 3OIWA 2P75A 3Q15C 5GY7A 1YNSA 3GJZA 5JMOA 3QXCA 1T25A 4GLJA 5C46F 2DB3A 3IX7A 1NC3A 3COPA 3GLGA 2HUPA 2PCJA 3G8YA 1QV6A 2ZKIA 1M7BA 2PUFA 4CEIB 1CX9B 3BCRA 2VNHA 1MPTA 3AL3A 3LD9A 4GC9A 3ABIA 5BQOA 1YR7A 3WRWA 2BAGA 4FC6A 4AZ0A 1WS6A 3H17A 3VPFA 1CP3A 3OT1A 1LQUA 4PRZA 1KEEB 2HEIA 2G8NA 3KPUA 4KXMA 2AI2A 4K8RB 4WLFA 3G2HA 5BVGA 4ZOLF 5C51B 5IBRA 1OXSC 3QFSA 1V71A 2PT6A 3I1JA 3U6KA 1V8ZA 2OFWA 4E13A 4N6NA 4P4SB 1BJTA 2AL7A 2JFOA 2YXNA 4MAMA 5DHQA 4TLMB 4UTRA 4MUHA 1OX4B 2VSNA 5IT0A 3VPHA 5G0WA 4GBED 1QP0A 3NHUA 1TYEB 3W5BA 2V3VA 1WLSA 2MR5A 2WPDD 1RYNA 2X4IA 3JD2A 3ETCA 1JG4A 4PHHA 5SZJA 3SDZA 1SKMA 2PLWA 4RLHA 5CLQA 3CF2A 1P77A 3RR2A 3MQ2A 3CW2A 3R7WB 5JWRA 3B2NA 3GVHA 1CR1A 4ZO9A 4UMEA 2WY2D 2QQ5A 1Z5VA 3P4XA 4Q9AA 1SOMA 1WTCA 3OI7A 2O8FB 4EKGA 4MYDA 4CMCA 3WSWA 3IAXA 5BURA 2HNAA 3SPXA 3TBFA 2P67A 1I4OA 2DLCX 1Y3IA 1Y81A 2AN1A 2QRKA 5FBLB 5JDIA 3K92A 2G9RA 5DM1A 2DPXA 4GGMX 1LDEA 1GZSA 1DEXA 3T5DA 4LVNA 2EFHB 3DAFA 3W9SA 3G5MA 2GPYA 3OIGA 1CY6A 1E2EA 3JQDA 3I9KA 3LX8A 4I1YA 4MYHA 2XD4A 4PVCA 1EFPA 5EXEA 3W8DA 2JLZA 5IBCA 3H5LA 1QKJA 2GZAA 3H5VA 3VA7A 3SXUB 3BMCB 4EPYA 1DGQA 2UYYA 2MIIA 2O2YA 3ROFA 1NT4A 5F51A 4BE9A 1JJVA 1GG5A 1E3DA 2ZI5A 2I3ZA 1Y0BA 3FUUA 5FO0A 3NDBB 3QVMA 5GGYA 1BW9A 1P75A 4UATA 4HB3A 4YLEA 1KRHA 4PTYA 4AMZA 3V34A 4AJNA 3L1HA 5CA1B 2FSSA 4KP7A 5K01A 1JQ3A 2C8JA 1GN8A 3SIXA 1P1BA 1RI3A 1T9HA 1CQPA 3GFRA 3ZWNA 1PVVA 4QVKA 1CUZA 1IN4A 1H1LA 3G8CA 3MGKA 4JBNA 4KW7A 3RGGA 3RRYA 3LRXA 4G24A 2FPWA 4KN5A 4D9JA 4E5KA 4EUEA 5K8JB 3ZL9A 1DQZA 1NU8A 2X0FA 1CJKC 2QRVA 4PM4A 1PNOA 1QIIA 5HDQA 5FULA 4LOJA 4CV3A 5A0VA 2JPDA 1UAGA 2JAUA 1KJZA 4MUAA 3U4QA 5IF3A 4H0NA 3TR6A 2XOKD 4GICA 5IMBA 2DQSA 3KP1A 3OLCX 3TNDA 4NHOA 3VVCA 4PGMA 4AMUA 3EXG2 3EF1A 3JD0A 1H0RA 1GPBA 3H3XA 4D0RA 3DXYA 4BRUA 3AWIA 5AK6A 1BJKA 3FXAA 4I5IA 3LV8A 4FLFA 4IQ8A 4WT7A 2X0DA 1MPXA 1ZAYA 4EEXA 4ERNA 5HUHA 2M6KA 1H4QA 1IEXA 3OPQA 4YCBA 2H65A 1FFAA 1DUVG 3TPFA 2J6CA 1H2BA 2R85A 3RSLA 4PF1A 2PSDA 4L8FA 1MF7A 2G76A 3WYFA 1O08A 2XE4A 5LPNA 3HN6A 5BY2A 2CV2A 1W59A 1BDIA 3KKPA 2DBRA 1II8A 3R4CA 3T3OA 2ZIVB 1O5OA 3V7NA 4EO9A 4RFSA 3ZU4A 5KPJA 4B80A 3V2IA 4C03A 1OKKD 3UKJA 2X0EA 3NWJA 4EHIA 5LNK1 2DWCA 5K0NA 5PNTA 1RWOA 2VYVA 1X86B 3HSYA 4JI6B 1F4LA 1Z26A 3P9RA 4ESEA 1LEHA 1EUQA 2LTAA 1OGIA 1FUKA 3R7FA 1YFKA 4B3XA 1XN1A 4PC2A 221PA 2HMTA 2R2AA 1YR6A 4YCSA 3KZKA 5E3JA 3F6SA 3K2QA 3BTVA 5EE9A 3KJXA 1BE6A 3JVEA 5K3SA 1A8HA 4CGYA 1PFYA 1YB1A 4OLFA 1QS0B 4W5HA 1F06A 3AVXA 2R6CA 1P2UA 3FZQA 4D9CA 1QHHA 5AM1A 3NDRA 2FPUA 5AM4A 4XQ0A 4M7PA 5IT9A 1SVIA 3IELA 2XIQA 3KO8A 1GNQA 4B0OA 3G49A 3QOFA 1P33A 4V0QA 5GPBA 1ZITA 2APJA 3QHQA 1W52X 1B76A 3D7KA 3P0RA 3TI7A 3V4SA 5ISMA 4HEA1 3A4TA 3RI3A 4RHFA 4Z7QB 4IDXA 1UQTA 1Y7PA 3WLSA 1TGYA 3TSCA 5AVQA 1Z6GA 6ADHA 3CZ9A 1AJEA 3PCTA 2HKIA 1SCUA 3L46A 2CLKB 3WGZA 2DRIA 2Q5CA 2DFVA 4RA9A 1E7YA 2RFLA 5IS2A 1NVEA 1BEZA 1PX0A 1QQAA 3UJNA 4Y2QA 1V9LA 5LIPA 1M1NA 4DL9A 1QR2A 4G3XA 4ARCA 1YOBA 3UY4A 4L4YA 4UW9A 4FGZA 5IXJA 3DEYX 4RTOA 4G8JA 4TN5A 4IF4A 4CMIB 3RIEA 4DA8A 2DMRA 2DVMA 2JFHA 2JI8A 2XPCA 5GM2A 2J46A 1OWLA 1G8FA 2RHJA 5AVVA 2LCIA 4WBNA 3FYUC 2XUFA 3GLHA 1J25A 2V97A 3GYGA 3MYRA 5CMLA 2IS1A 1RWQA 2YYYA 2PCLA 1LSJA 2FMUA 3CGWA 3I45A 3OEHD 1RIIA 3PVSA 4Y98A 6AT1A 2QLBA 5COQA 2ZSFA 3QBDA 5SY9A 4HYQA 1J8VA 1Q95A 4B84A 3EIQA 4CHGA 2BM0A 4OAOA 4PPFA 4OHOA 3MWLA 4DG9A 1PTJA 2PA3A 2A2ZA 5EUMA 2A33A 2YY5A 5EKTA 4EA8A 4JNKA 3CWCA 1LB1B 1XKLA 4ZQHA 5CFRA 2HPVA 5ELXA 1L5YA 1VXOA 4H4CA 3A4MA 4LDRA 4CEHB 3C7KA 1F3LA 4XWYA 2JLXA 3L8HA 4IGFA 2Q6LA 1XA4A 2E4VA 2R5NA 4D9GA 4HCJA 2ZRAA 3CEAA 1P3DA 2Q62A 1TMOA 3KLMX 1Z6YA 4IDHA 4K46A 1FOEB 1I2MA 2IHNA 4MQLA 4OXIA 2QPTA 1BMTA 5HYVA 5K6TA 1Y8ZA 2UYGA 1ZLYA 1TQ4A 3MJCA 3K0FB 4HY3A 4WX2B 4NMWA 1EH5A 3FOAA 4YASA 1AXGA 1T3LA 4B35A 2YWGA 2H7XA 2NUAB 2H59A 4CR8A 4P4NA 3WG9A 3K09A 2HU8A 1X1TA 3VOSA 4AUMA 1QM5A 5A6SB 2WVGA 4HS9A 3I2FA 3WR5A 5A5EA 2W8ZA 4XOUA 1T9BA 2PRYA 2ABWA 3NG1A 1ADBA 5JBQA 1E61A 3FOWA 3H4VA 3FNBA 2Z1DA 4NZZA 1RWMA 3FDZA 4YV2A 2FQYA 2IHZA 2MMGA 5AVWA 2WVHA 3E58A 5A7GA 1NR5A 3TLZA 5DBOA 1A96A 3LO5A 3MEQA 5INTA 2GBIA 2EBHX 4MVXA 1FP2A 2XT0A 1SBYA 2IYLD 2PGDA 2OOSA 3DJFA 4HQNA 4IUDS 4Y1GA 3GLGB 4DG8A 5AXDA 3U4DA 1Y7TA 4UHDA 5DM2A 2OBNA 3WIOA 4PG5A 5FWYB 4ZYTA 4JNGA 4RM2A 1FS5A 2G80A 1PNVA 4QOHA 1R0BA 5DBHX 2P4UA 4G1BA 2A67A 2BFEA 5CB8A 4DARA 5IBPA 1PQPA 5BVGB 1VL6A 3RROA 2Q29A 1E7RA 3IP6A 1ETHA 4OK5A 4DBLE 3CH5A 3LOUA 2RGUA 1JI0A 1YS7A 4RLQA 4AS3A 4AS2A 1U98A 4U9UA 4UUNA 2ZDGA 1CR2A 3COYA 2X13A 2P1DA 4DHWA 1W5EA 4RTPA 3LXRA 3NHMA 3CF4A 3PNQA 3IP5A 1I2CA 1TTQB 2Z0MA 3CRNA 3FMOB 1E7WA 4OB8A 4KPGA 1R3DA 4QEKA 2VNIA 2MOKA 5DM70 5E4TA 1O0BA 1A7KA 1T43A 2ACKA 4D80A 1M3SA 4EEKA 2ZIUB 3OEWA 4ON9A 2B7CA 1NKTA 2GYWA 4CTMA 5AQ1A 4Q7MB 2GX6A 3K8ZA 5AKKA 3LHSA 4YWHA 2REOA 1LCIA 4XARA 1T26A 3WGYA 2WM8A 3BULA 3IAHA 6REQA 4KQEA 4U7JA 2PU7A 4ZFNA 2E21A 1Z6QA 2XNKA 3DOFA 3CF4G 1I3OA 4RH0A 1SIBE 4JUAA 3MC1A 4GMKA 4ADSG 5ADUS 2K7ZA 3D1JA 4KRXA 5JSQA 4ARBA 3OCJA 1FNSA 5JD6A 2BV3A 2C88A 4WMLA 3M3PA 4ECEA 6GPBA 3WL8A 3KHTA 4NKRA 4WINA 1JW9B 1QJCA 2P79A 2XRYA 4M9ZA 4ZA2A 3TTXA 3K0SA 4LV6A 1EFPB 4RD3A 4R7ZA 4CT5A 2R8RA 1WW8A 2D7CA 2ONCA 1TIPA 3RVDA 3I04A 1SCNE 5E1DA 5AVJA 4QGAA 3EAQA 1J09A 2DJIA 5J4VA 3CKYA 3EXFB 3RSQA 5DBIA 5AOCA 1K3UB 4KL8S 3BTUA 2BEKA 2HRZA 2O20A 2PH7A 3C4VA 4Y6SA 4RHCA 2HDOA 3NFRA 3SK0A 3G6KA 3VPDA 2BDUA 1KBQA 1J90A 2W83A 4IDPA 4EJ0A 2X77A 4EYEA 5FUXA 1A88A 1KH2A 4FR2A 4M8KA 4WVFA 3FPSA 1AUVA 3VTZA 4TV8B 1SBCA 2WHPB 5AESA 3ECCA 4YROA 1DDGA 5CJPA 1T24A 2WNSA 4YALA 1UK6A 1DIHA 1H1LB 4KLCA 4GZLA 4C88A 4NH4A 3C6YA 3IEIA 2BI4A 1ZINA 1UOOA 2QRVB 3R2JA 5FTNA 1W4CA 3FE2A 3EMBA 4F5WA 2RDMA 3NHZA 4CMGA 3NHJA 4HGYA 1PKXA 2M6SA 2ZETA 4BV9A 5J2TF 3JQ9A 3I0MA 3DHYA 1RS0A 1NTOA 2GCIA 3I1YA 1SCAA 3S3TA 3NW9A 4M1TA 621PA 2XY4A 1QQ5A 2M32A 1K98A 2UUOA 1J22A 3OPVA 4F4HA 4CUKA 4ZI7A 3AY6A 5EGNA 4CBVA 1S9HA 3BMXA 1N9GA 5GOZA 5C7YA 5CFNA 4OLAA 4ZXPA 4DC1A 4EHJA 5A4JA 3ORHA 5C8VA 1FTNA 4FCVA 3JXEA 2OHFA 5FEMA 3PRJA 1CDOA 1M2EA 1U8TA 1Y5LA 4AKEA 3WAJA 2XCTB 1TZMA 3D2CA 5K7SA 1E9AA 3O03A 3RV4A 1B16A 5BORA 4F92B 3H16A 2FHPA 1PJ2A 4NBSA 3L84A 1B00A 2OBBA 3F3SA 2Y68A 1HF3A 1J2TA 2D7JA 2CCGA 2P90A 3M6LA 1KZGB 2YWEA 5CX4A 3GLRA 1X70A 3PK0A 4HDOB 1II8B 3M70A 4NEQA 4XXHA 5AKYA 4NBKA 5BO5A 3ZDZB 2J9FA 4RFSB 1AF7A 3NLLA 3DBHA 1UPUA 2XDWA 2ZSHA 3A26A 2XCOA 5IUNC 4ZALA 4DRXA 1CV2A 2BP7A 4J1SA 1DC4A 2BGNA 1KMIY 2R6AA 1H69A 5HPYB 5I7FA 2FPLA 3PQ7A 5IRCD 1ZK2A 3ZW9A 1XMVA 5I7SA 2BGLA 3ROTA 1AE1A 5F9HA 2P3QA 4YUZA 1WZUA 2PNFA 1I6LA 1ZZEA 1PBNA 2VPYA 4NQZA 4BMYA 5BWOA 5J5CA 1QHHB 1IUKA 4G0WA 1HLPA 1OGYA 1YRLA 2YWDA 4OHZA 2J9ZB 1UKEA 3KKZA 3UBMA 3W8NA 2IIBA 3DGFC 3KSBC 3PQ2A 1BXKA 3NHSA 3ROKA 1N3YA 2IZ5A 3JPWA 4G0YA 1KAQA 4HEHA 3EG5A 4Q4HA 4DLLA 4EABA 2IT1A 4Z4EA 3INNA 2ZJ4A 3DW1X 4O4HA 1JYEA 5EP2A 2PUAA 2C4TA 3CCBA 4K6GA 1KAEA 2HLDD 2I1LA 4TT3D 1Z13A 5P21A 5JXWA 3G7SA 4CV2A 2IXBA 1YDEA 1RXWA 5HMMA 1QVWA 2K4MA 4OQLA 1GTVA 2O0HA 3MHPA 3L05A 1RLIA 4DMKA 4A9AA 1SCUB 1XZ8A 3DLIA 1G21E 2XCQA 1U8UA 1DQPA 2WG2A 3EQ6A 3BIJA 2WJYA 4RA9B 5HZGA 1OH5A 2LPMA 1N2HA 1KDTA 3EYAA 4G5RA 5TT0A 1B6TA 4BE7B 1BEEA 5B3LA 2GPSA 1U0GA 3CW8X 4TXLA 1PZFA 1RCTE 3OHMA 1M1NB 4X00A 1H9BA 1Z63A 4XWAA 1YJAA 4GS5A 1ATIA 1HKHA 3WQBA 5EJMA 5LWQA 3GLTA 3L8CA 1JDUA 3ANTA 4AT1A 3KOMA 4P7KA 4I19A 4TL9A 4QT4A 3IVRA 2WJAA 1BH2A 1D0IA 1LLCA 1GZ3A 3S2GA 3THRA 4P0PB 5GM1A 5FD8A 4JFAA 3EQ9A 3HLTA 1XEFA 4WBNB 3SS9X 1M0WA 1E0DA 4G41A 4GSYA 5DISB 3SJCA 1GPH1 4BLQA 2AKAB 3QFHA 2AR0A 3FKSA 3NIGB 5JXJA 4RJLA 3PHBE 4JLUA 5DTJA 5C8YA 3GMIA 3L8FA 5MN5A 3QVXA 3E7WA 5HJ5A 1GCOA 4KLNA 721PA 3FSJX 4XIFA 4QOIA 4KIGA 3IDQA 4FYXA 3WFIA 5BMVB 2IYZA 3IJ5A 2PKQO 5E7IA 4EZEA 1ELOA 2EEPA 1D1QA 3H18A 4G86A 1FLAA 4JI1B 1J2EA 3TIGA 4POOA 1Y6GA 3CLKA 2QUKA 1FTGA 3ZLJA 3TXXA 1FYWA 3QRWA 2JAWA 3RF6A 3F8SA 1FTYA 2AG6A 2FWJA 3EQ7A 4FZVA 4KLRA 4AP9A 2QYTA 1S6YA 1W5TA 2RHDA 4O4IA 2M2IA 1V9SA 1Q7RA 2Q0QA 2QMZA 3W2GA 4JJKA 4UULA 3VAYA 3B1WA 3AB7A 1GL3A 1ZX1A 3PNKA 3PVZA 3RRNA 1QF9A 3UGQA 1L7NA 3B6JA 1EVKA 3LWDA 4HGOA 2OG2A 5TE9A 3LF1A 2CWWA 2F1RA 3H2SA 4U2KA 3SQLA 5JAZA 2ZZNA 4RIGA 1XCGB 3QEKA 4RYLA 4MICA 4RHUA 4AJ9A 4CFZA 1LPBB 4M22A 4DNXA 3UJBA 5DULA 4BZPA 3FDZB 1KORA 1QONA 1U0TA 2GEJA 1OW3B 2GPWA 2C2HA 1VSTA 5FPHA 3AKEA 3EWNA 5D6OA 2XUHA 1L7PA 3IDSA 1LBQA 2ZPTX 3AFHA 4MO2A 3M6VA 1L4LA 3QLVA 1MOPA 5EJAA 5L9AA 1RWVA 2Q5LA 2AZDA 2XB6A 4LWZA 1IM5A 2G36A 1AQJA 2RAFA 1UBMS 1DOAA 1M2VA 3SS7X 1QZUA 2FEMA 2BFEB 1CP2A 1W44A 3OT5A 4EECA 3RHSA 1CQJA 1MDFA 1OFGA 3BWMA 2YYAA 2KMLA 1FFWA 2NWQA 3LECA 1JG7A 2WWTA 1F51E 1GG8A 4QECA 3TD2A 2VRWA 5I9LA 2IZOA 3GROA 3K9WA 2OZLA 1TZJA 4KE9A 1PHPA 5LB4A 2DLNA 2XI4A 2R84A 4BAUA 2FPIA 3A6HA 4P58A 1R27A 2X9LA 2CUZA 4TV9F 3UUEA 5KX5B 4IEEA 4UNQA 4DKXA 4RKQA 5CH5A 5HKKD 1DBWA 1O03A 5CK4A 4EGFA 2V6BA 1GTRA 4WXYB 3HLKA 2DG2A 5TGZA 4DBLC 3ENWA 3L8EA 2PVSA 1KNXA 4PE5B 4LHVA 4ZVVA 3F74A 1SGWA 2QYHA 3GUCA 3W77A 4LZNA 4QUDA 1JG3A 2J4CA 2RGAA 3NKLA 5B30A 3DEKA 1LJ8A 4CQLA 4K5QA 6REQB 1OJ7A 2W37A 4OF4A 2R86A 1KZ7B 3NAZA 4ZYXA 3OCUA 3ENQA 1NVGA 1GLGA 3DBRB 1PG2A 3QFFA 1ULSA 2WJHA 4YJHA 3S44A 3L4BA 4YI5A 2I91A 3HB0A 3Q2IA 1DDIA 3WJ7A 2X0IA 1S2IA 4G26A 1UUFA 5A5VA 3F6EX 1I3MA 1YC5A 3WLAA 4LY0A 4CTNA 1H5QA 3SSAA 3P2MA 1OY1A 1LF5A 4NYJQ 2AD5A 4Q1VA 1JAHA 1B8VA 2BBWA 3PL5A 1XN4A 3BGDA 3UB4A 1G3MA 3C0KA 1SUBA 1W85A 4NE7A 5F9MA 4B45A 4BV8A 4DQDA 5CFZA 2V5AA 1LK5A 1EXVA 1OIVA 4LXGA 2BDTA 2XYRA 2BEVA 2OM2A 2ZR0A 2OHXA 1VG9B 2W6JA 1G4AE 2X3YA 4BVAA 4YRZA 2ZITA 5HQTA 3QA9A 4WLOA 3FA2A 1I7SB 1W1UA 5CM2Z 3RTGA 2QU7A 3LF2A 1VLVA 4ZJYA 3IP3A 4GBMA 4R7GA 4W5TA 3BA1A 4IZ6A 4ACBA 1W5SA 1TUEA 3CMMA 2PMDA 2XYPA 4FQ5A 5FBWB 4F3KA 3V9PA 3KTOA 2XVMA 5G1NA 2GA9A 1O6ZA 2AF4C 2PQMA 2I1VB 4A6XA 4DEVA 2H51A 1O0SA 1SU8A 3TE6A 2X1MA 3EY9A 2VRNA 3OTIA 3RTDA 1SD1A 3D1VA 4QDKA 2DHRA 3DQPA 2A5JA 3NWBA 3O90A 4HMPA 1ABFA 4RF5A 2C4VA 1Q0UA 2QRLA 2QN8A 3G8DA 2D00A 2FEOA 1XU7A 2R8OA 3HXTA 3VGJA 1NP3A 2RBKA 2OV8A 4TTPA 3RBXA 4Q1BA 3ZVMA 4M53A 1OVMA 2ZROA 3LW7A 2DTDA 2V7QD 5AXBA 4BGEA 1L7AA 2MT9A 3H5AA 2Y6VA 4ZI7B 1QPBA 1HG0A 2CXSA 4K26A 1RKUA 1SG0A 1SBZA 2AFVA 3DAHA 1PS9A 2VRCD 1XZLA 2WUEA 1FFCA 2ZUDA 3IC5A 3QUBA 4QDOA 1X39A 1UQUA 4ETMA 3Q3GE 4BPBA 3HPQA 1YDWA 5DYNA 2FK8A 4D9NA 1Z4PX 4PIVA 5C81A 3J81A 3G2OA 3WA6A 1Q7TA 3OCYA 4UUPA 3T95A 4B7UA 2J9FB 1LRLA 1M74A 1FVHA 3AY0A 4X62B 2XQFA 3DBHB 3I1IA 4EBFA 3C5HA 4YI3A 3NTLA 2J5KA 2WV7A 2VDLB 4DNQA 4DRXB 1E1KA 1T8UA 1JEYA 3HY4A 2QXTA 2YQ5A 1E2DA 1J5XA 2BP7B 4LXUA 1ESMA 2V5UA 1TA0A 2Y93A 4QQ8A 1KWKA 1U63A 2D54A 2PGOA 2XNJA 3GUUA 3TBKA 2X2OA 1C9DB 5J47A 2LDBA 3CNQS 3C3JA 4L9SA 4BQSA 4RCYA 3U80A 1KAGA 3G13A 3JTEA 4J2OA 1U5CA 2DBVO 3K71B 1RWBA 4FP9A 4C6SA 1JHUA 2IW1A 2WMOB 3CO0S 3ZLUA 2QIPA 1TTPB 2ZYIA 2WF8A 3A1DA 3ETGA 3F78A 4LY3A 4MWCA 1Z83A 1V11A 4IG9A 1N5LA 1R0YA 4ZARA 1ZSVA 3KPVA 1RWKA 5HIAA 4J43A 1LBIA 4C22A 5BSGA 4CETA 4LXXA 2Q3CA 3V1NA 4JR0A 1Y4DE 2FZCA 2J85A 4Q4HB 2YHIA 2HYIC 3PA6A 4O4HB 5ADVA 1XL1A 2AJBA 1S3GA 3D2LA 1LSOA 4FOLA 3HJAA 3N74A 3RS2A 3AETA 3K0AA 5B3JA 3WKDA 1A7UA 1P3JA 1TEXA 5AMXA 3OIUA 4I46A 5C4GB 1WLYA 3W1VA 3LHFA 4J1TA 1KZHA 4XQGA 4G0OA 4R31A 1E5TA 2VJDA 1S8AA 2Q1YA 4M0MA 4ZEOA 1C9NA 3H2IA 1OZFA 4G1VA 1BS9A 3OQMA 4DV4B 1J5EB 3P0HA 2O7SA 4N49A 1FBTA 2PYIA 3KU1A 5KSPA 4O0MA 4FMDF 4HPXB 4EOGA 2PX6A 3GVIA 2DY1A 5G02A 2OWEA 4W82A 4OKSA 3U31A 2N9UA 3LU1A 1QUFA 1FDRA 1GQSA 4JGGA 5CLIA 1C50A 5DXFA 3ZBTA 3OX3A 1UINA 4LVCA 4Q4CA 1GGFA 1K0FA 2EATA 2P5SA 4XIIA 4C20A 5EIAA 1JXOA 3CINA 3H42B 2WSBA 5CITA 3GGGA 4KQGA 3WZ2A 2AZ4A 5C8YB 3PDCA 3CVUA 3NIBA 3LTEA 5EQFA 1LNZA 1JFVA 1WXQA 3KAPA 1ZG3A 2D4AA 4NU6A 5KI6A 4FN5A 4ESHA 2JGEA 2Q99A 3CKMA 1JPNA 4Q4LA 5KS2A 2GR9A 4TL7A 3ZHYA 3HO1A 3OF3A 1C8KA 2HLHA 3GU3A 2XE7A 3IAUA 3W6PA 3D0KA 1IZ0A 3K9QO 3O2QB 3OCWA 4K9PA 4MB6A 1NJGA 2Q1TA 4G25A 5JVDB 2D1FA 3QE4A 4RPHA 5CCEA 2HBRA 2Y0CA 4F56A 1SXQA 1CDEA 3CVWA 2CUKA 4CEJA 4KHPB 2BVNA 3L7MA 1JLKA 3EZYA 4GRAA 3ETJA 4RQTA 4HRAA 1TQ6A 2A9VA 5K0TA 3WIVA 2I65A 1X1EA 2X2EA 3KLOA 3B6KA 1TPYA 2DE0X 3N59A 3KXLA 3RC8A 2H2WA 3VPXA 3SE7A 3EZ9A 2QK4A 4GPBA 2V4ZA 1R0RE 2QGZA 4I4IA 4WFIA 5THQA 5L3RA 3REQA 1U3WA 2R96A 4FS8A 2QLMA 1U1GA 1Y3HA 1XP5A 3UJPA 4L07A 1ST3A 4O3FA 2QJOA 3V3KA 2ZJ8A 4I50F 2HHHB 2XA2A 1E3JA 4X8MA 5F4BA 5ARBA 3A6GA 3PNVA 1CERA 2P3SA 2BTEA 3UHPA 3DL2A 1KIAA 1XDGA 1AZTA 1CUUA 4YCAA 4M21A 4OK6A 1L8XA 1JJAA 1UXOA 1ODFA 2E4YA 1HRDA 4LHYA 3LVQE 4WBXC 2I0FA 1RJEA 2C83A 1E62A 2Q1XA 3H1EA 3L4JA 4B79A 4KU4A 4C0WA 4ENWA 1HMPA 4CKBA 4YT2A 1CPYA 4HH3C 4JP1A 2E7ZA 1HZJA 3NVMB 3QENA 2WUFA 4UC0A 2W00A 1NUTA 3W5VA 3GNTA 2FUCA 2P9FA 2PX8A 3CX4A 1H6BA 3OFND 4NCIA 4IDOA 5A4DA 4AJOA 3F9IA 1IBCA 4QE3A 4POAA 4C87A 2IIQA 3ENZA 4NDZA 1M2VB 1Q3HA 2ZBEA 4FYJA 4JQYA 5LUBA 1QH8A 1R37A 5F33A 5AUNB 3IO3A 4G1FA 1CQJB 1G6OA 2QRGA 2IC5A 4Y2SA 5DGDA 5HVNA 4ER5A 1YRYE 3Q11A 5CR9A 4HEJA 3LPNA 4CMEC 4Y1RA 3CVYA 3PSHA 1QDLB 2OZLB 3BRQA 3RJTA 4N6OA 1JDPA 3BE6A 4BN5A 4JEHA 2B25A 4LSMA 2AN3A 3PPVA 4QDJA 4HGZA 3RYFB 3PR1A 1DZIA 2AK2A 3VVLA 5JT1A 1I30A 2PTHA 3L6BA 1ZJWA 3CJRA 2QM7A 1EX1A 4HAUA 3K05A 5BR4A 3ORRA 3ROEA 2V7GA 1IN7A 3PE6A 4FFPA 4Q3OA 4LDNA 3F46A 2CYBA 4JVSB 4RPKA 3AONB 1WMFA 2QUBA 1Q7EA 2H4HA 2XBLA 3P1JA 3ZDYB 4CQLB 4PX3A 1WCIA 5HEKA 2NU6A 3KHUA 2SBTA 4BL5A 4F1WA 3GVXA 3SYTA 1DZ3A 3QFTA 1M5RA 1PE0A 4ND2A 1GIAA 1PUJA 2EBFX 2FHSA 4RPGA 4XB6B 1P8JA 5EJ2A 1OXMA 3DL7A 3RU7A 4YJHB 4ER6A 1CZLA 3KCNA 4G8BA 3UVEA 1R4ZA 3TTYA 1BXRA 1G2PA 3I64A 5JEDA 1TZBA 3WNCA 2FOIA 2BWJA 3FD8A 3NT4A 4D4LA 1GKYA 3K4PA 3P9ZA 2QGNA 3FZEA 5F1PA 1KRWA 2PUHA 5CT9A 4C3ZA 3DA8A 3P27A 1VLZA 3PUYA 1SD5A 2VN8A 3BDIA 4PEVA 4BYMA 4JU8A 2E18A 1RYBA 4KVFA 1W85B 4KYIB 4GUDA 2H4JA 2PMEA 5LYJF 1GSHA 2QVGA 2F4VB 5C5DA 4G0VA 3M5WA 1Y9AA 2BEVB 4Y2YA 3V7YA 2A9QA 1QFJA 1XVAA 4JB0A 2FW0A 4BX8A 2R44A 1QYRA 4MJLA 5CDHA 1HNZB 4WZBA 2HDWA 3BF7A 2YMQA 1CBUA 4DV5B 3K1TA 4OBWA 1AQIA 2XYQA 3V42A 5JAPA 4KMMA 4MW7A 3JTMA 1ZNYA 2R68A 3DZGA 4XW2A 1DXHA 2IX9A 2P6OA 5A4AA 3NATA 2FZVA 3KOUA 4O2BB 5DTMA 1KKLA 1RWWA 3B70A 4FKMA 5AT1A 1EEXB 3WBJA 1ML3A 3WLTA 4ALMA 1ULZA 2F90A 4C5BA 4F11A 3H05A 3OU6A 2QUHA 1K5HA 1DEKA 2F67A 4RTNA 2QJRA 1YJXA 2FW7A 3FPBA 2XKAA 5IJ9B 3DH0A 1NOJA 5F1YA 1SCBA 2FCRA 1KHTA 4Z3DA 4AP5A 4HJXA 4LZZA 1Z33A 1XAJA 4I9UA 1YB4A 1HNXB 2MWMA 3OHSX 3WYCA 1X1RA 1DMRA 1ZA2A 3E1GA 2OV1A 4KUEA 4MUBA 4L5IA 3TLBA 2O4CA 2NO6A 3IUBA 1P5HA 1B0ZA 5B7QA 5DSZA 2MSNA 5ECGC 2XODA 2PY6A 5IC5A 5CUQA 1R18A 5MN4A 3B8EA 4A0GA 1KIFA 4O4JA 2DY0A 4LRQA 1KVTA 1IRIA 3AUSA 2LKDA 3BD7A 4FHZA 3UCFA 3OY7A 2UZ1B 2YHUA 2YCBA 2SNIE 3HNPA 2D7DA 4HQFA 1SK8A 1TO1E 1SCJA 1TVEA 4GR9A 4EAAA 2M1XA 5EPOA 1M75A 1CE8A 4RKRA 3A9UA 5L51A 2Y76A 4D4GA 2CVHA 2ZI9A 5BYBA 4HD8A 3B12A 3U60B 4O08A 1PR6A 3GFOA 1VJCA 3C85A 3EQ8A 4MEBA 5JCOA 4JELA 4ZCSA 2J7KA 2WG0A 3IIMA 4WZAE 5FWAA 1EA5A 2J4FA 2WU1A 3KSDO 1TM2A 1KR5A 1ZW6A 4AKHA 4UUAA 2FOXA 5HTKA 4FGWA 4TSRA 4HYEA 3MWFA 2WD7A 3N0WA 5LZ8A 5HP4A 2JJ1D 3B3GA 4UEJA 1AXRA 2EQBA 3KNZA 3QE2A 4D82A 1V11B 2IUFA 3T4EA 3VH1A 2EFJA 1W49A 3NTQA 5BNWA 1X80A 3B3AA 1RZ3A 3B8HA 3DOJA 3K5HA 1HEUA 1CD5A 1RJGA 3IQXA 3H0EA 4V2IA 5H3LA 3UXEA 2VSFA 5DSXA 4LXQA 4OIFA 5FLEX 2YHIB 4BTEA 1A7JA 1WVMA 1YS6A 1FNNA 4B4WA 3PIDA 5CPBA 3ED1A 1C7IA 4U7WA 2D13A 4K9RA 5F7XA 1VKZA 4M0PA 3ZR4B 1IXKA 1KZYC 3CEJA 3GGSA 4DIBA 3THWA 1RCUA 2GD0A 2WA2A 2ZATA 3AETB 3ASYA 3H13A 3K0AB 3MWGA 4BDTA 4F2GA 3EGXA 1R0SA 2EKLA 2JJ8A 4L9WA 4KXUA 3FDFA 4WXMA 2WE8A 4Q9JA 1I1QB 1OA0A 4BU1A 1H94A 1RKVA 3K6KA 3CCFA 4B09A 2PFGA 3AI2A 821PA 4PWZA 4EVSA 5LJLA 4YFYA 2Q1UA 3UF0A 3TFQA 2O8EA 3HVRA 2AI1A 3KXPA 1N2CA 2XAAA 4K87A 4BO1A 2BCJQ 2VS1A 2GYUA 4HC4A 4HQ6A 1MX5A 4X65B 1G1AA 4CCWA 3VH3A 4TROA 3M89A 1H5NA 2X5NA 4H16A 1R0WA 2A58A 4G97A 3AR4A 3WP0A 3IURA 5EXTA 2IWHA 2WILA 13PKA 2A3RA