3SLGA

Crystal structure of pbgp3 protein from burkholderia pseudomallei
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
347
structure length
334
Chain Sequence
KAKKVLILGVNGFIGHHLSKRILETTDWEVFGMDMQTDRLGDLVKHERMHFFEGDITINKEWVEYHVKKCDVILPLVAIATPATYVKQPLRVFELDFEANLPIVRSAVKYGKHLVFPSTSEVYGMCADEQFDPDASALTYGPINKPRWIYACSKQLMDRVIWGYGMEGLNFTLFRPFNWIGPGLDSIYTPKEGSSRVVTQFLGHIVRGENISLVDGGSQKRAFTYVDDGISALMKIIENSNGVATGKIYNIGNPNNNFSVRELANKMLELAAEFPEYADSAKRVKLVETQNRVPKIENTMQELGWAPQFTFDDALRQIFEAYRGHVADARALVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PbgP3 protein
publication title Crystal structure of PbgP3 protein from Burkholderia pseudomallei
rcsb
source organism Burkholderia pseudomallei
total genus 127
structure length 334
sequence length 347
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3slgA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 3slgA02
4J0EA 3UCFA 1DLJA 3D3WB 1G0OA 7MDHA 1D4FA 1YL5A 3H9QA 5BSHA 4R1NA 1LSSA 3V5NA 4H16A 5I9LA 1XDWA 2X58A 3JQAD 2PGDA 3WNVA 3RFTA 3WGYA 5COBA 2GLXA 2VHYA 5FF9A 4TZKA 1I3MA 3RIHA 3BHJA 2O50A 4BMVA 1E1NA 2CVOA 2NACA 3TFQA 4YXFA 1QR6A 3QIVA 1XU7A 1EQUA 3JYNA 5B4TA 4DREA 2HAEA 4BO6A 4B7UA 1RM4A 4UUOA 4YRAA 2W2LA 4YDRA 1B0AA 3JQGA 4IJWA 1C1DA 1WDMA 3KO8A 1I24A 4E31A 3KTDA 3ZHXA 4P22A 1PJLA 1GV1A 1A7AA 5FI3A 5THKA 1DHRA 4TKLA 4R1UA 1IZ0A 4EGFA 3HDJA 1A5ZA 3H5RA 1ISIA 2QZZA 1I01A 1LDEA 1C1XA 3UFXA 1V3VA 3N74A 1ADBA 3ENKA 2NU8A 2VUSA 4FDAA 2BI7A 3BHMA 1H6CA 5EERA 2UDPA 5B37A 1QYVA 3U9LA 2G17A 1IUKA 3QY9A 3AOGA 1EZ4A 1XSEA 2R00A 2DLDA 2Q50A 3O8QB 3P2OA 4AJ2A 4M86A 2YJZA 3IOYA 4NFYA 5K6AC 4IQ8A 1D8AA 3VKVA 1YOVA 1KY5A 3UF0A 1R0LA 4OXNA 2H63A 1XR3A 4RVFA 3BMCA 1X1TA 3EVTA 1E1KA 4NHEA 4WK6A 1H9AA 3C24A 3CH6A 3QHAA 4N5LA 4R41A 3ZU3A 1DIGA 1OC2A 3ONEA 2ZTMA 5KVQA 5A5EA 1JVSA 2X0RA 3PLNA 4GGPA 4Q3CA 3D4NA 2P5UA 5BNTA 1AN9A 5AVOA 5TJ9A 1D7OA 3WGIA 2A94A 1C0PA 1YL6A 4BO0A 4P38A 3ZWCA 3KOUA 3DAPA 3NTOA 4FPXA 4XKJA 4RDIA 1BXKA 2VOJA 1WMAA 3O9ZA 4PGFA 5CFZA 4E5PA 5A9SB 4BV8A 4RF3A 4Q3NA 3O03A 2HDHA 1M75A 1YDWA 4GWKA 4AJKA 3S1LA 2Z5LA 2NUAA 4UREA 4WASA 2B5VA 4OM8A 2IYPA 4PCVA 3V1TC 3QWHA 1LLCA 2UV8A 4E21A 3Q9NA 2ZB7A 4WUVA 2JAPA 4L8VA 1RYDA 1YONA 4CM6A 1GR0A 2AW5A 3UGKA 2P2SA 2GR9A 4BNZA 2EP5A 1Q7BA 3MWDB 4JP2A 3WGHA 4WCDA 4YAJA 4CM7A 3DZFA 3F9IA 4XB1A 5G0TA 4XRRA 5COQA 4RVSA 5JPIA 2CNBA 3ST7A 4YRBA 1I33A 4JROA 4IGEA 4GMGA 2RCYA 4Z3KA 9LDBA 4G2NA 1DOHA 1WXDA 1YJ8A 4DQVA 1Y8RA 5I8ZA 4D3FA 1P1RA 1PJ3A 2B4RO 3LT0A 1VJ0A 4W4TA 5L9AA 2UUOA 3IQDB 2X7HA 1HSOA 1QSGA 2C5AA 4EDFA 3PYMA 1GL3A 4YYZA 4YAIA 2FR0A 3RUAA 3FR7A 3BXXA 4AJJA 2EKPA 4HBGA 2Y1FA 4P8RA 3RROA 2DAPA 2X9VA 2D5AA 1R4MA 1FK8A 5F5NA 4DC0A 1JQBA 3D1LA 5AXBA 3B1JA 1BVRA 3PHIA 5JY1A 4F45A 2AMFA 1XLTA 2VCYA 4MPDA 3BYZA 5DCWA 4E5YA 1IYZA 3E5MA 4N7RA 3MTGA 1XKQA 1PJ4A 1Y5MA 1HT0A 1E6EA 4BNUA 1ID1A 5B1YA 4MIEA 5KVVA 4RDHA 3KLMX 3U0BA 5CEJA 1ULUA 5I7SA 4XGKA 1CDOA 4CV2A 1NYTA 1A4UA 2BI8A 2CF5A 4NU5A 4UVHA 3PJFA 4R16A 1T2AA 3ADPA 4GAEA 4YR9A 3GVCA 1LDYA 1Z75A 2POQX 1GPJA 2B37A 4DYDA 4XJSA 4BNIA 2D1YA 5GY7A 5FYDA 1VE9A 2BGLA 3QWIA 4IJKA 3VH3A 1E7WA 1I2ZA 2I5PO 2GASA 4ND1A 3UW3A 3H9GA 2O3JA 3V8BA 3RUDA 3PJDA 1KYQA 3IIEA 3E1KA 2EKLA 3PEFA 2WD7A 1KEVA 2Y1OA 4R51A 4B3JA 5HTOA 1NTOA 2FZEA 4A7PA 1V3TA 4O59O 1CQIA 1J5PA 1K6IA 3NT4A 4MINA 3ZHBA 3DQPA 1GQYA 2QW8A 3MWEB 4TVOA 1Y81A 4IDCA 3DC2A 3JQBC 3KETA 2A92A 1XQ1A 2P5YA 2YHIB 3M1AA 4WEQA 4CL8A 1N92A 1FDTA 1RYEA 4K28A 4Y9DA 4LW8A 1UAYA 2HQ1A 2AQHA 5BSEA 3ITDA 3KYDA 1U9JA 3K30A 3AU9A 4FC6A 4ZJUA 5K6AA 1C0KA 2C29D 1A9ZA 1E1MA 4N5NA 1W4ZA 4BNXA 3VC7A 3TDKA 4KQWA 1UXHA 2B83A 4DTIA 1OOEA 2YQ4A 1XEAA 4A27A 1LRKA 4JLWA 3M2TA 5TT0A 4BV9A 2PFGA 1JKFA 4GX0A 4OKIA 3Q9UA 4HV4A 1O6ZA 5HBRA 2V6FA 1EUZA 4TROA 1U8XX 1T26A 1VL0A 4ZQFA 5AYVA 3WBBA 1DHTA 1XGKA 2BELA 4F46A 2G5CA 1DC4A 3PFWO 5DT9A 1MB4A 1E5QA 3K6JA 5ILOA 3WYCA 2GN6A 2H1SA 3CPSA 2BLLA 1CIVA 3DR3A 3S2IA 2FSSA 2EKQA 4J4HA 1ZCJA 4WEOA 2AEFA 1TT7A 1PJSA 4XA8A 3RC7A 1F06A 5IFLA 4TRJA 2Q1UA 1U4SA 5KTKA 3AUTA 4OGWA 2O3UA 3WBFA 1RM3A 3VH1A 3RKUA 1Q7CA 3KYCA 5IZ4A 4CQLB 2NTJA 4JCOA 1KC1A 2H6EA 3OFSA 1V3UA 2A9FA 5A9TA 1UDBA 2O2SA 4DIBA 3R6DA 1W0CA 2O3TA 2Q49A 3E9QA 4IJVA 3PPIA 2XXBA 4XX0A 4OAQA 1F17A 3ZV4A 5A3JA 1QG6A 1SOWA 3WLFA 1WNTA 2GCGA 3CUKA 3NEPX 4TKMA 1U3WA 1WP4A 5L51A 5JSFA 1YWGO 2RIRA 3UKOA 4R54A 4J9VA 2GERA 1KVSA 1CEQA 4XZ3A 4ALMA 3WMWA 3C3XA 2AG8A 3ZNNA 3VPFA 3UICA 1IHYA 3GEDA 2AE2A 3ZWPA 4ZGWA 3ZU4A 3KZVA 5CG2A 2F00A 5LDGA 3E5RA 4YBZA 3RASA 4IM7A 3JQFC 3LC1O 3FPCA 4HP8A 4E4YA 4FFRA 5KJ1A 2HU2A 3T7EA 1AXEA 4CM3A 2P9CA 5A4DA 1KETA 5GZ6A 1KOLA 3NTRA 1I3NA 4DQXA 2XAAA 2NLOA 4FD3A 3H9UA 4BNFA 1UXIA 5COAA 1PWXA 5JAQA 1QLHA 3AY7A 3QWFA 4LRTB 4MKZA 3OIFA 2OOSA 3IMFA 5F3RA 3AM5A 1OBFO 4FN4A 1LC0A 4ZD6A 2Q2WA 2NVUB 3ENNA 4GX1A 2PD4A 3BTVA 3ZW8A 2VZ8A 3VH2A 3WIEA 5C7LO 2YYYA 1X0XA 3ICPA 3EHEA 3I3OA 1LLDA 4WLNA 2EIHA 3JD2A 4KOAA 4AJIA 5CAEA 1LUAA 2VYNA 4Q3EA 4TWRA 2RBEA 4OIMA 2DTXA 3EGOA 3WSVA 5DBFA 4PZCA 1X14A 1HDOA 3FNHA 3QP9A 5JCJA 5G4LA 1H6DA 3BHIA 1UJMA 4BKOA 3JYOA 2X5OA 1CJCA 4W82A 1NX6A 1P1IA 1XHLA 4RF5A 3MJEA 1EMDA 4BMSA 1SAYA 3AOEC 3W6ZA 1LA2A 3ZWYA 4IY1A 4QUKA 1D1SA 1HRDA 1MA0A 3WXBA 2RHRA 2DBVO 1PU2A 3RFXA 5L7YA 4OQZA 5F1PA 3RJ5A 1VC2A 3OQBA 3LF2A 1GV0A 3O4RA 1PIWA 3ZWBA 3UAGA 1LXCA 2W90A 4NIMA 1P44A 2P9GA 2WYWA 4NK5A 4ALNA 4GWGA 2X4GA 3L9WA 1PJCA 3OJLA 3NTQA 4RF4A 2IODA 3SEFA 2B36A 3UN1A 4XRGA 2NQ8A 1YBAA 3SLGA 5JCJD 1O89A 2TMGA 1QYXA 3GDFA 2B4QA 3V2GA 1ZEJA 5JY6A 1UAGA 4XYLA 2VWGA 4ESOA 4N5MA 3G17A 3H8VA 1R37A 5KOIA 4MP6A 3OM9A 4OSPA 1QMGA 3E9NA 2Y99A 3GDGA 3HG7A 3ONFA 4CR7A 4BO5A 1N1GA 4RORA 1XQ6A 4KDFA 4A26A 2C54A 5HS4A 1I2CA 3D5QA 5KIAA 3IKVA 2GUGA 4BGEA 4J1QA 1U8FO 5IXSA 4M8SA 3U5TA 4HKTA 3E9MA 3G1UA 3ETGA 3HDQA 4MVJA 1JWAB 1SMKA 3CEAA 1OI7A 4YB8A 4MVJH 1N9GB 3FBGA 2BGMA 3DWFA 1EFKA 1N7GA 3GMSA 4FC7A 3GVXA 3PHHA 3KSZO 3X2EA 2IRWA 2C20A 3ZNOA 2V65A 3KXDA 1T1SA 3RJ9A 1LLUA 2JL1A 2PKRA 3JQ6A 3HQ4O 5H83A 1A72A 3DAGA 4KUHA 3TOZA 3CIFA 4NFSA 1KERA 3I9NA 4LRSB 3WOHA 2HO5A 4CLRB 2LDBA 2FPGA 3F4LA 3R3JA 2X0NA 4F6CA 3MTJA 4IJUA 4L74A 1XU9A 5JAIA 3WQRA 3FR8A 1U28A 3M1LA 4CM8A 3HN7A 3VZSA 5EQFA 2OUIA 2FMUA 1WWKA 3MCVA 3R3SA 4NFHA 4EJ6A 1HSZA 3BMQA 4WE3A 5B12A 2C82A 2AA3A 1BW9B 4WPGA 1AHHA 3OA0A 3F1LA 3G0OA 3OICA 2LDXA 3CKYA 4CQMA 3LYLA 2YY7A 2HRZA 2FOIA 4DLLA 1RM0A 4D43A 4RVDA 4ND4A 4K6FA 2R6JA 1V9LA 2JCYA 1ONOA 1QRRA 4MOWA 3LDHA 4DMMA 3D7LA 3PLRA 1QYDA 2IEDA 4RLHA 4U6SA 2CFCA 4WCFB 4XYEA 3NUGA 3JYQA 1ONNA 5I7FA 1QV7A 1BWSA 2WJPA 1P45A 3N58A 4RZHA 1UZMA 1GQQA 2HK9A 2CVZA 2W2KA 3ZU2A 4FFOA 1M76A 3GZ4A 3W8FA 1UXGA 3K92A 4EJMA 1FDVA 4LN1A 2D8AA 4KTVE 4OKNA 4S3MA 3A28A 3IUPA 4RVGA 3LK7A 4BO9A 5TGDA 3VHRA 5JC1A 3OEYA 1QKIA 3GNQA 2Y05A 1PGNA 2Y66A 1NPTO 2DBQA 3A14A 4K9DA 4II2A 5ENDA 5FWNA 1FDWA 2HSDA 2JKVA 4CQMD 1NFQA 2Y1GA 1SB9A 1LSOA 2XPCA 3OQ1A 4I9HA 2EW2A 3Q3CA 4IGFA 2DQ4A 4QTZA 1E7SA 2WEKA 1KVRA 2HK8A 3JQ9A 3SC4A 3VZRA 2DKNA 4ND2A 3PZBA 2NSDA 1K5HA 5JAMA 4G65A 2BKAA 1DRUA 8LDHA 3GN2A 1B8UA 4J2OA 1YS4A 1T4BA 1PGPA 3FHLA 5DNAA 4EI2A 5G0VA 3KRTA 1BHSA 4PG7A 4RPGA 4CLXA 2EJVA 1ZUD1 2HCTA 1YB1A 2ZCUA 4J3FA 4PLVA 4Z9YA 1SEPA 2UVDA 2DBRA 5H81A 1U5CA 4J43A 3F4BA 3WQSB 3IS3A 1TT5A 1Y9EA 3E18A 3GN1A 1GYRA 3O26A 1HYEA 1M6HA 2GGSA 4CLOB 4DVJA 2UYYA 4PLFA 2NADA 2BFPA 3UOGA 1GUYA 4JQCA 4CM4A 3ZNPA 2EWMA 1R0SA 2Y1CA 4QEDA 3ZU5A 2ZIZA 5BNFA 3GUYA 1MLDA 3CZRA 4RCVA 3UCXA 1BRMA 3OBBA 5ICSA 1DFIA 3RAJA 3I52A 4QO7A 1JN0A 4YJFB 3GEGA 1DRVA 1O95A 4DIFA 1LX6A 3H3JA 3GGOA 3ZV6A 1E7MA 1WVGA 1EE9A 2NV6A 4B3HA 5C3MA 4X54A 1IZ9A 1KY4A 4GH5A 1LLQA 4ITUA 4MP8A 1ZK3A 4BNWA 3DHNA 3H2ZA 4R3WA 1R66A 4YPOA 3KUXA 1PEDA 2P91A 4MVJG 1ORRA 3BMNB 3TPCA 1DFGA 1NAIA 3O38A 5JXWA 4K6CA 3NJ4A 3S55A 5LDHA 2Z1MA 4CUZA 5IN4A 1LDMA 3DONA 4OOFA 4UAGA 1BG6A 1F8GA 4ZA2A 4AICA 4K26A 1ZXLA 3E48A 2VRBA 4IS2A 1GYPA 1NVGA 4NDNE 4M89A 4XYGA 1ZKMA 2O3SA 4YT4A 4J90A 2IZZA 4IMRA 3RFVA 1YL7A 3PJEA 1KC3A 3ZWNA 1Q0HA 1IPEA 1MXHA 2ZB8A 3WG9A 4NK4A 2QZ9A 1DRWA 2CMDA 4J49A 1B8VA 3WGZA 3SBOA 3WWZA 3SX2A 3PXXA 4Y6PA 3GVHA 2PZLA 3C7DB 3ANLA 3PYXA 5TF4A 5EINA 4CMIA 2PD3A 1R12A 3GGGA 3C1TA 1I5RA 5JO9A 5TQVA 1ML3A 3MJSA 2WSBA 3M2PA 1LSJA 3PIIA 3NJ8A 3S2EA 2RAFA 3GG2A 3DZHA 4M1QA 2PH5A 1CRWG 3CZMA 3GRKA 1QV6A 4U8GA 1AXGA 2ILTA 1VSVA 3DTYA 2PKQP 1TI7A 2W98A 4Q39A 3UVEA 2JFHA 4INAA 2E48A 4EEZA 2PLAA 3GVIA 3I5MA 4AJHA 4ALKA 5JYDA 3CMMA 1PZGA 5K0ZA 4J7CA 4OO3A 5A04A 5KVSA 2HJRA 4DA9A 4FJ1A 4U0JA 1M6WA 2OMEA 5JO0A 1TA4A 2QYSA 4WJZA 3BMOA 4D41A 3H7AA 1WZEA 1KVTA 2VUTA 3UCEA 1HWYA 3HB4X 1ENYA 3FWZA 3RBZA 1KVUA 2C7VA 3DOJA 1GEGA 4NQZA 5I9NA 4IMPA 4GSLA 5BNIA 3JV7A 4PG8A 2TMDA 3NDJA 3PDUA 3I6IA 4P4NA 4BO8A 2BFAA 1M66A 1EBUA 4NJMB 4CLDA 2E49A 2SCUA 4AJEA 3GZNA 3AUAA 4NZ9A 3JQ7A 1E77A 4GX2A 2OHXA 1A9YA 1T24A 3LF1A 4O0LA 3ZW9A 3W4KA 3FF4A 1J0XO 3JQ8A 3F6YA 1R16A 3L4SO 4G81A 3ZWVA 3INGA 3EAGA 4CMCA 4FGSA 4A03A 4XJTA 3ZHZA 4NJOA 1BXZA 1WW8A 4ZQEA 2WE7A 2X86A 1EVIA 3GPDG 4HFJA 4PG6A 4JIGA 1NVMB 1QXSA 4RL6A 1OZAA 4DPKA 1X13A 4H7PA 1T2CA 2C5EA 5ITVA 1ISFA 4IXWA 4KMSA 1PQUA 3OA2A 2OXIA 5JMWA 1U2GA 3MJ4A 1UP7A 4UVDA 3ZH2A 1MUUA 1NVTA 1FDUA 3B70A 3DMTA 1DSSG 4KWHA 3LT4A 3D4OA 4DLBA 3V2UA 4CM5A 3QVOA 2JD1A 4UEOA 3LT2A 3I4FA 4J1TA 2RH8A 2GPTA 3NT2A 2I67A 1K3TA 4XQ9A 3DBHA 5IJZA 2IZ0A 4D79A 4PLWA 2VUUA 5DP2A 4DIOA 2Q1WA 3LSYA 4MDHA 1YXMA 1ADFA 2I3GA 3D64A 4L73A 4B8ZA 2PZKA 1ZW1A 4XIJA 5JMPA 2CD9A 4MKRA 5G0SA 1B16A 4K1LA 3WTCA 2X9GA 2IZ1A 3PWSA 5ER9A 1UXKA 3OF2A 4CV1A 4HUJA 4OH1A 4YJHA 3VTFA 3QSGA 4IQGA 4XGIA 5JCXA 1GADO 4BUCA 4HNGA 4E2ZA 2WE8A 5U9CA 4TMFA 3DBRB 3FNFA 2WWRA 3D3EA 3MOGA 4RQTA 3DBLB 3PQFA 1IOLA 4Z3DA 4FS3A 1ARZA 2J3JA 5T8KC 5JE8A 4QXMA 3L77A 2ZJ1A 2QX7A 4BGUA 5IXYA 2IXBA 1YH3A 1HYHA 3TNLA 3QV1A 2PV7A 1ULSA 2OFPA 1Z82A 3DEYX 4R5HA 4BS9A 2WYUA 5TIIA 1G1AA 4YWJA 1Y6JA 4BO3A 1Q0LA 1BXGB 3G1TA 2OGUA 4YRDA 3JQEA 3LLSA 4B4WA 1SNYA 4FFNA 1P1KA 2D3TA 3GHHA 4PZEA 3I9KA 1MC5A 1TB4A 1NP3A 1A71A 1EBFA 2ZB3A 3WGTA 4U6QA 2FPIA 1NFRA 1PS0A 3Q6IA 4EUHA 5ICMA 3BTUA 2ZTUA 3AFNA 4CV0A 1LSUA 2GDZA 1YDEA 2VHZA 1Z45A 1D1TA 3B20A 4W99A 4XDYA 1PGQA 3BA1A 1X1EA 1ISGA 1T2DA 1UR5A 3EZLA 4FFMA 3RUCA 4RO0A 5C5IA 1H6BA 3RU7A 3D5TA 3TRIA 4W6ZA 1KEWA 1NWHA 2AQIA 1GZ6A 3WSWA 1E3WA 3IC5A 5CDTA 1PSDA 5A05A 1P1JA 4U0KA 5KKCA 4M87A 4PRKA 2Y1EA 2VOEA 1J6UA 4Z0PA 1FDSA 4J2HA 5EIOA 3JQAB 1B7GO 4LCJA 3ZWXA 5IDQA 1DB3A 3PHLA 3K2EA 2X0JA 1NQ5A 2DFDA 2NTNA 1H94A 3ETEA 3RI3A 3VAZA 1WPQA 3NT5A 2BFMA 3QVWA 1IHXA 4DPLA 4O6VA 1UZLA 5ITWA 1DPGA 4URFA 3KSDO 1JAYA 5TS3A 5CP8A 2OBNA 3DZJA 3K9QO 4DMLA 3Q1LA 2ZATA 3NGLA 1DIRA 4J1SA 5CEFA 4CL3A 1H2BA 3WICA 5G4KA 4NH4A 1R4NA 2JD2A 3GRPA 4CMKA 2ZYDA 5TNXA 1HLDA 5G0WA 4CLEA 3TL2A 2I99A 2J8ZA 2DUWA 5IF3A 1SEVA 1KS9A 3HE3A 3STHA 4YCAA 1P9LA 1Q7GA 3C8MA 4DBZA 1XIVA 3QQPA 4WLUA 4CUJA 5KJ6A 1GY8A 1L7EA 3P5SA 4E3ZA 3GK3A 1SBYA 1X7GA 3VDRA 3W6UA 3U3XA 3ICCA 5BR7A 5TLSA 1YQDA 4BHTA 1KBZA 3QVTA 3WR5A 5IN5A 1U3TA 4Q9NA 4BKRA 5CHEA 1UH5A 2XOXA 2AEMA 1ZK1A 1B15A 2PZJA 3G3EA 1SB8A 3LZ6A 2I76A 3DXFA 5T57A 4EEXA 5I7VA 3HN2A 1Y8QA 1C1DB 2E37A 3CE6A 3JQGB 1QORA 3RC9A 3VPGA 4CMBA 1CQJA 2DM6A 1L1FA 1ZSYA 4J1NA 4PG4A 1S6YA 2G82A 2QHXA 1I8TA 5HWSA 4XD2A 2OP1A 1C1XB 3KBOA 3W4IA 1EUCA 4CUKA 1LJ8A 3C1AA 1H93A 5ILGA 3FWNA 3VZQA 2AXQA 1HDGO 1P31A 1UXJA 4RGBA 5JS6A 1MX3A 1HL3A 4DBVO 1DJQA 2Q46A 3RUIA 3PHJA 2BD0A 1F0YA 4J4BA 5JC8A 4MVJI 1GZ3A 3HUDA 1ZZEA 1YOVB 1G6KA 2Y1DA 2EF1A 1E1LA 4HNHA 2PH3A 5DBGA 1VJ1A 3BMCB 4AVYA 1A7KA 3DAFA 1GTMA 3W8DA 3PP8A 4E32A 1EVZA 3PWKA 1EE2A 5T8KA 2HLPA 4BNHA 4BQPA 1PX0A 3JQDA 2AEJA 2GZ3A 2V6GA 1VM6A 4I9NA 4CMHA 4CMJA 4IDFA 2J5QA 4ZQGA 4QSMA 3L6OO 3SLKA 5I9MA 2CY0A 5T6BA 3VZPA 1N2SA 5ER6A 3RBXA 4XR4A 3WQQA 7ADHA 2DTEA 4TQGA 2VWPA 4L76A 4BNNA 3JQ9C 1MG0A 4B79A 1YB4A 2VWHA 2FPPA 5JDCC 5KWEA 6ADHA 3QWBA 4BNTA 4H3VA 4C4OA 4ND3A 1T1RA 2EW8A 3DO5A 2FZWA 3H65A 4Y98A 3NKLA 4B8WA 3AY6A 4GVLA 4QT0A 4E6PA 4ALLA 1IULA 1I30A 2YUTA 3GMDA 4QECA 5L45A 1N7HA 3FNGA 2O7SA 2Q3EA 4IXTA 5U1PA 5DULA 3I6QA 4R1SA 5F5LA 2GD1O 4F3YA 5BSFA 3VVCA 1D3AA 1JAXA 5A9RA 1PJ2A 3ZV5A 1B2LA 3SXPA 1KVQA 4J16A 3OJEA 1E3JA 1JA9A 1Q0QA 2GN9A 2HMTA 3H6KA 1JWBB 4XR9A 4RJTA 3LVFO 2PKQO 2EGGA 1X7HA 4KTTE 1VKOA 1ADGA 1LDGA 1C3VA 3MJCA 4PRLA 1ZK4A 4MVJF 5L4NA 5KJFA 1Y8RB 1ISJA 4QFDA 4DXHA 3OIDA 3GFGA 2PZMA 3IJRA 3ETDA 3T7CA 1HLPA 3K5PA 3O8QA 4ZVVA 4BVAA 3IL2A 3OSUA 2WTBA 3GUCA 5KNLA 1ZSVA 4O1MA 1Z7BA 3GDOA 3GY0A 3ITKA 4GVXA 4EITA 5JDIC 3I23A 2FP4A 1IPFA 4S1VA 4KUGA 4W7HA 2WDZA 1JDJA 1ZMTA 2ET6A 2ZYAA 4KZPA 1EQ2A 2X9NA 1DC3A 3EZYA 4YEDA 1C0IA 4NBRA 4Z6KA 4IDEA 1VLLA 5JAZA 1R4MB 4UUPA 4MIOA 5BT9A 3TZCA 4YT2A 1O94A 1GPDG 3PIDA 1PJTA 4R69A 1L7DA 3OP4A 1MFZA 2VNSA 3UUWA 2JJYA 4LMRA 4RF2A 3DHYA 3ZWMA 2OZPA 2EJWA 2CDBA 3B6ZA 1E6UA 2XXJA 4NPCA 4LGVA 1HDZA 4DGSA 4W9NA 5K9ZA 3X2FA 1V35A 3H9EO 5TX7A 1ZEMA 1HE5A 4YT8A 1EVYA 3EYWA 3L4BA 1T25A 5AXAA 4CMEA 5IDWA 5A9SA 4B4UA 1O0SA 4Q3BA 1E6WA 1HDRA 1WLYA 3AI1A 3E8XA 3L07A 4PLCA 5AOVA 2JFFA 1LDBA 1YQGA 3DOOA 3JYLA 2GN4A 3AM4A 2JFGA 4HWKA 3U4CA 4BOYA 1DBVO 1PS8A 1NQTA 3GAZA 1ADCA 2DU8A 5DCUA 3AK4A 5CDUA 3GPIA 3QJ5A 4OQYA 2EGHA 1N8KA 2PTGA 4B7CA 1PQPA 2ZB4A 3N7UA 5DZSA 4NMHA 5CPFA 2WD7B 1U3VA 4IQ0A 4ROSA 1LTHR 5I8WA 2VN8A 1PS9A 5F21A 4P4GA 4DUPA 1GCUA 5L7TA 1M67A 1AGNA 3UH1A 4I1IA 2PK3A 3I83A 2UUPA 3GH3A 4EYEA 3ZNQA 2O3QA 1CETA 2RHCA 1YVEI 4R68A 1SCUA 4TRRA 2X5KO 1F14A 4IDDA 4N54A 1LBEA 5F1KA 5HM8A 2GZ1A 4YVFA 1N5DA 3KYDB 4OYRA 4C7JA 5F1OA 3RCBA 4YJGA 1OAAA 1DDOA 3VH4A 2I3AA 3PJGA 2D59A 3ZN2A 2GRAA 5KJCA 1IE3A 1E7QA 1E0DA 3LC7O 1EEHA 1NHGA 3OECA 2G1UA 4KP7A 4R5MA 4E13A 4KWIA 5IDXA 4IDGA 4Q3DA 4AJ4A 4H15A 4JP3A 4FJ2A 5B4UA 3PZRA 3RUHA 1R6DA 1NPYA 1IL0A 3GQVA 5ADHA 3GOHA 3GGPA 1PGOA 4RPLA 5A3VA 3E82A 5CDGA 2JHGA 2JD0A 1H2HA 4R01A 4LMPA 4I08A 1I32A 1NWCA 3NV9A 5I7EA 2C2XA 2Q99A 2FR1A 4I5GA 5G4KB 3WMXA 1EVJA 3RC1A 3DFZA 5TC4A 2O3RA 5KKAA 1GFSA 3KV3O 3W4JA 3IAHA 3MZ0A 3C85A 2H9IA 4WKGA 3FBTA 1TVEA 4HFMA 4RPHA 2ZJ0A 2QIOA 3RBVA 5JDCA 1ONPA 4R3NA 2IDZA 1YRLA 2DPGA 3KB6A 2HUNA 2J3HA 1AHIA 3KHUA 5T5QA 4DC1A 2H5LA 3PTZA 2CZCA 2ZKLA 3KYCB 4JBGA 3WWYA 4AFNA 3TJRA 1GDHA 2YV3A 1GZ4A 4IDBA 4EBFA 4Z0HO 3HFSA 1Y9AA 3DMTC 2B4TO 1JKJA 2QYTA 4IZHA 4E2WA 2YDYA 3JYPA 2C07A 3WTBA 3TZ6A 4C7KA 5DOVA 1KEPA 1CF2O 3AW9A 2B0JA 1PWZA 3B1KA 3D0OA 3DZIA 1YBMA 1U4OA 4AG3A 3E6AA 2YHIA 2ZQZA 3EK2A 3VOSA 1EK5A 3F5SA 1P3DA 1ZFNA 1UUFA 2EHDA 1BMDA 3FNEA 3U4IA 5IDYA 4DPMA 3U4HA 2Y0CA 2VRCD 3QLJA 4WLFA 9LDTA 2R2GA 4BNYA 1HZJA 5GMOA 4ID9A 5JDIA 1NFFA 1E3LA 5DP1A 1DAOA 2DC1A 3IJPA 4NG5A 2NM0A 4AJPA 4M54A 4BKQA 4XQEA 2YDXA 3A06A 3JD3A 4BO4A 1UDAA 4I8XA 4R4JA 2VZ0A 3QW2A 4NI5A 3ROMA 2C0CA 5FI5A 5EN4A 3PYLA 1HZZA 3HZZA 1WMBA 4D3DA 5BSGA 1ENOA 1NASA 2BH9A 1HXHA 1X7DA 4AJOA 2A35A 2VNAA 3GNTA 1K6XA 2AE1A 3SJUA 2YW9A 5EQDA 5CDSA 3Q2KA 3ZDFA 3PWZA 3EDMA 4GKBA 4B7XA 2QRKA 4LSMA 4AJ1A 4II3A 1JVBA 4O63O 4E12A 1ZNQO 2YZ7A 4FB5A 1HEUA 3OJFA 3AI2A 2NU7A 2PGLA 1IB6A 1NQOA 1HE3A 1DXYA 2I65A 2VTDA 3KVOA 4IZIA 4WLVA 4UEJA 4KDEA 4D0RA 1F8FA 4CQLA 4PLTA 3CSDA 3ROPA 2Q1SA 2B5WA 1R15A 1UZNA 3DZKA 4FFLA 1DEHA 1GUZA 3TZKA 4Y67A 2JAHA 5IG2A 4E5NA 4BO2A 2FY8A 3R0IA 4PVDA 3QVXA 1FXSA 3ROQA 1Y5RA 2OP0A 2ZK7A 1I0ZA 2D4AA 1P1HA 4BB5A 4A0SA 3DHEA 1ZK2A 2JCXA 2NVBA 3PGXA 4BQRA 3PQEA 5JFOA 4U7WA 3FSRA 4NBUA 4YTEA 4RQUA 2EG9A 1FMCA 2IYOA 2YQ5A 3BIOA 3U49A 3HSKA 2HRBA 3NRCA 1SO8A 4D46A 3ZWWA 2GYYA 1U5AA 3A1NA 3ZI0A 3VDQA 2XF8A 2WMDA 1I3KA 1DIHA 2V7PA 4IIVA 3ULKA 4CM9A 2BRUA 4L75A 4GBJA 2QRJA 5L4SA 2IE0A 1WAMA 4XEHA 2WM3A 3DTTA 4GKVA 2W2LD 2DVMA 2J3IA 4WCFC 5A02A 5A1TA 4IUYA 3OMLA 1EK6A 3F3SA 3BTOA 3I9JA 3ASUA 4GMFA 3EC7A 3EW7A 3LQFA 3FRJA 2J5RA 5A06A 4J9UE 4RZIA 2NVUA 1GUFA 4UUMA 1Z73A 2J3KA 4N18A 2EEZA 1KEUA 4LVCA 1B14A 1P33A 2FWMX 1H9BA 1EUDA 2Q4EA 3DZBA 3NDIA 4Z9FA 3CTMA 1NAHA 4JN6B 2CSUA 3HWRA 3HFGA 5TJHA 1O9BA 4JJIA 3RSHA 1QLJA 2NVWA 2EP7A 5ES3A 3C7CB 4J7UA 4RV9A 4BO7A 5L3ZA 2YHUA 3S8MA 2Z1NA 4EZBA 3FN4A 3HADA 4CM9D 5AXDA 1DO8A 3FI9A 2QRLA 2BGKA 1B8PA 2I9PA 4I9UA 3VTZA 1X0VA 2CDCA 3GEMA 4MO2A 1FJHA 3AUUA 4BKUA 4ZRNA 2HK7A 2Q4BA 2CUKA 3MJTA 1YQXA 4GL4A 4PN3A 4BIIA 3DB2A 3LLVA 5L4LA 3QVSA 1TLTA 4JJGA 5U4QA 5J23A 4CLHA 4CM8B 3S2FA 2E6UX 4E2XA 3WJ7A 2P4HX 3DOCA 3RU9A 3WIDA 3H5NA 1ISMA 2B35A 2J6IA 3BMQB 3RUFA 4E33A 3BAZA 1K2WA 3VPHA 2AHRA 2PD6A 2FN7A 2X8LA 3AI3A 3WB9A 2DBZA 1YGYA 4MVJP 4B4OA 5MGBA 4CQMB 1YKFA 4MKXA 4XDZA 1DJNA 4ZRMA 3I9OA 3HJAA 4HFRA 4OL9A 1MGOA 2CF6A 3L6EA 3CXRA 4TRNA 4YAGA 3RKRA 2VTEA 5GZ1A 2ZCVA 4YJGB 2NWQA 3ON5A 1IY8A 3OJOA 1S7CA 4FW8A 5L7WA 2E4AA 5B4VA 5IAAA 4I5EA 1B3RA 4YAEA 4E5KA 4BNVA 1YO6A 4J6FA 3NDRA 5C7OO 1DFHA 3K73O 1NXQA 1UDCA 1V0JA 2W2KB 3CMCO 1E3EA 4IDAA 1PJBA 5AXCA 1PZFA 4L9RA 4YQZA 4ZU3A 1CWUA 4YACA 5CG1A 2YV2A 3I1JA 4CM1A 2G0TA 3WFJA 1JTVA 1VRWA 5EPOA 3L6DA 2OORA 2VT2A 2NTVA 3E03A 1K6JA 3TN7A 3PFFA 3TL3A 1PQWA 3K8ZA 4EUEA 3GLQA 4BL5A 3LC2O 2DFVA 2O23A 5FFFA 4FJ0A 4UVIA 1N9GA 1PGJA 4YT5A 3HB5X 3ZV3A 1QYWA 2J5KA 4CJXA 5L53A 1V6AA 1R0KA 3H3FA 2O4CA 1GCOA 1I2BA 4JNKA 2PA3A 2C2YA 1DAPA 5DDIP 2X5JO 3HDHA 4RPKA 1U7TA 2YFHA 3D4PA 4UVEA 4D42A 1GQ2A 4CLRA 4XYMA 2V6BA 1PL7A 1GYQA 3GG9A 4OMUA 3FD8A 2HJSA 4BB6A 4IBOA 3WX0A 1TT5B 2Q45A 4NBTA 4BNLA 1MXFA 3BZUA 4BNGA 3F1KA 4IIUA 4DRYA 1E7RA 2E82A 2NU6A 2X1HA 3SC6A 4HX5A 4UUNA 4E5MA 4CM4B 1H5QA 3L9XA 1BW9A 3U4DA 4R9RA 4D7AA 1MC4A 4J7XA 1C14A 1P0FA 1VL6A 4KQXA 1LRJA 2PGJA 4Y6SA 3T4XA 3EVNA 4HFNA 5EMHA 3WGOA 3FTNA 5IZCC 3ABIA 5KCZA 3RVDA 2OBYA 4YQYA 4A73A 2VHVA 4HXYA 4JK3A 4GLLA 4JGBA 4WCFA 4D3SA 1SC6A 2A4KA 4YAKA 1HETA 5JNLA 1B26A 1ZK0A 1NPDA 3I9LA 2VYVA 3TOXA 2GO1A 3ADOA 4DLAA 3KLPX 3DFUA 4W9NC 4UULA 3UXYA 5A5FA 3K96A 3BTSA 3CINA 4YJDA 4D45A 3MJVA 2NNLD 3F46A 1BGVA 1KIFA 3L4BC 4LK3A 2PNFA 1Y7TA 5EL0A 4CMEC 3H5AA 5A03A 4Z9XA 2GZ2A 3AJRA 2QQ5A 1AUPA 3IDSA 4P4LA 2EERA 4FOSA 4EUFA 1M2WA 1SOVA 1SZJG 4WOKA 3QA9A 3ROKA 4FQ8A 1HE4A 4QO8A 4TSKA 4FGWA 3GF4A 4OJNA 4U5QA 1PR9A 2B69A 2Q1TA 4L4RA 4OXYA 1B3BA 1CERA 1GAEO 4CMIB 4EJ0A 3DZGA 1VKNA 3RQSA 1RPNA 4PLGA 1NBOA 1E7YA 2Q2QA 4GI2A 4DWVA 1NM5A 3WJAA 2O48X 1ZO8A 2W4QA 1AE1A 5JLAA 3V2HA 3SVTA 2DUUA 2VYVD 5TT1A 2VHXA 2BMAA 3OHSX 4BO1A 1I3LA 1HDYA 4XQGA 4ZQHA 4LCEA 3OQ6A 4ILKA 2JCVA 5TRTA 1VJTA 3K2BA 4CLOA 4MIYA 4A10A 4L4XA 4CV3A 2VWQA 5G2OA 3WYEA 3GAFA 6LDHA 2AQ8A 3BMOB 4MP3A 1ZIDA 4E0BA 2IXAA 4YJFA 2P9EA 2WD8A 1K89A 1PZEA 3A9WA 3GA0A 3QE3A 3COSA 4FSHA 4R9SA 2RH4A 4CMGA 4ZICA 3C1OA 4XWYA 2HMVA 4MJLA 1T2EA 4WNCA 3ZWAA 4AL4A 1HF3A 3GHYA 1FF9A 4J91A 1TXGA 3BMNA 3JTMA 4XCVA 3D3WA 4GLOA 3Q11A 4M55A 3HNPA 5H82A 3KEOA 5KJEA 2D2IA 3GZNB 3JQ7B 3AM3A 3ORFA 3UHAA 1JLLA 2GF2A 1RM5A 3JQ8B 4MVJM 4QQRA 4XB2A 3W8EA 4DQUA 3QRWA 3V1YA 4ONEA 1ZH8A 4JBIA 1I36A 2DT5A 4GGOA 1MFPA 2W8ZA 3NX4A 4LVUA 1U2DA 1VI2A 1Z7EA 4ZN6A 1BSVA 3JD1A 1PJQA 2V6MA 1NNUA 3DBVO 2QG4A 5THQA 1XA0A 1TEHA 3RUEA 1K0UA 2Y68A 3PQDA 5GZ3A 4J4TA 1PR3A 3AUSA 3VKUA 2PY6A 4OOEA 2HMWA 4FCCA 5JW6A 2G76A 1U1IA 1LC3A 3GVPA 5FEUA 4B3IA 3EY4A 1NR7A 1WZIA 3OEWA 3HHPA 4G5HA 2NU9A 1PTJA 3QWAA 4ND5A 1E5LA 3ZWOA 1QYCA 4ZHSA 3EUWA 3GC6A 4RVHA 1CYDA 2OO5A 1W6UA 2WYVA 2Y93A 4YA6A 4F6LA 4Y8VA 3MOIA 1JW9B 1W8DA 1DIBA 4GPD1 3TQHA 1LQTA 3WYBA 1GEEA 3DBHB 3JQBA 5JYEA 3WGGA 1ZXBA 2IEBA 2AQKA 2OL4A 8ADHA 5G0UA 1H6AA 1XCBA 3S2GA 5BQFA 4WOJA 4WECA 5IZCA 2VQ3A 3IP1A 3GT0A 2I66A 2PWZA 2Y0DA 4D0SA 1LNQA 3TZHA 1W73A 3AU8A 3FCOA 3H4VA 3W1VA 2P68A 1OMOA 2GSDA 4RPJA 4YJHB 4AJLA 5AQ1A 2VYND 2Y67A 1RJWA 1BTOA 3P7MA 3RWBA 4BNKA 3G49A 4E2YA 5DCYA 5LC1A 2JHFA 2CDAA 1LDNA 3OJ0A 4FR5A 4KUEA 4UEKA 2Q2VA 3PI7A 1E3IA 2DTDA 1U3UA 4XGNA 4NJMA 4JJFA 5ENVA 4LSWA 1PZHA 5TSDA 5CPBA 4BNMA 4TRMA 3NAQA 4ZQBA 1A27A 3WDSA 4QX6A 3I9MA 3R1IA 3U09A 3EMKA 3H9JA 4I5FA 4IPTA 1JKIA 4R1TA 4WLEA 1BDMA 4QFCA 3TSCA 5EJ2A 4CODB 1GU7A 2UAGA 2HMSA 4NNJA 1ZMOA 3KM0A 3M6IA 4HADA 5JBIA 1P0CA 5LCXA 1WDLA 1LQUA 4W7IA 4FOOA 1LI4A 4Q3AA 4PFJA 1HYGA 1LU9A 2CVQA 3LT1A 3P19A 3RC2A 4XQCA 4FBGA 1VPDA 3JD0A 1DC6A 4RVUA 3KSUA 4UVGA 3Q2IA 1BDBA 2X0IA 5DF1A 1C0LA 1LEHA 3ASVA 1HE2A 2NQTA 3ONDA 3PRJA 1P77A 4NBWA 2BHLA 5C37A 2Z95A 4PZDA 1QP8A 3WFIA 4JXKA 2FSVA 2FRDA 2DPHA 4PLPA 3PVZA 1PL8A 4NU6A 3JCZA 4WLOA 4DL9A 1Y1PA 5HRUA 2P4QA 1EDZA 1ZJZA 1U7HA 3B1FA 3I4CA 3FPLA 4PLHA 4B4VA 4D44A 4TVBA 4IINA 3AWDA 3PHGA 3LU1A 2D5CA 3SJ7A 2I6TA 3AFMA 1E3WB 3OIGA 1JU9A 2PR2A 4WGGA 4Z0TA 1DC5A 3VPXA 1Q1NA 3VVBA 5MDHA 1XELA 4TZTA 3L0DA 4L4SA 4A2CA 4LISA 3U62A 3HDYA 4M49A 3MEQA 1HDXA 1HTBA 2FR8A 2YV1A 3AY3A 3K31A 4BNJA 1XG5A 3NYWA 2O4UX 3RD5A 2R00C 2EV9A 4MVJD 3WLEA 2C7GA 3H2SA 1XYGA 3IP3A 3JSAA 3Q0EA 1VL8A 1J4AA 1ZSNA 2O2YA 3PGJA 3WS7A 3JQFA 4PLZA 5T67A 3ZGYA 1RWBA 3DL2A 1GD1O 3KEQA 3INRA 1PL6A 1EDOA 4PIVA 1XWFA 1YBVA 1E92A 1YB5A 2ZTLA 3DBRA 1OFGA 3PDJA 1LRLA 3NGXA 3DBLA 1MP0A 2AG5A 5L95A 1R4NB 1A4IA 1V8BA 2FHSA 4ALIA 3INTA 1F12A 2D0IA 3ZHYA 1P1FA 2VRCA 1T4DA 2BF7A 4PVCA 5KVCA 3PK0A 1ISHA 2GN8A 2X6TA 1HDCA 4PLYA 1DIAA 1ENZA 3KYBA 2C59A 4JX8A 5CEEA 3GNSA 1OC4A 2ZQYA 1BXGA 4J0FA 3ZZNA 2VZ9A 5DOZA 2X22A 4WNIA 3IUSA 1RKXA 4GQAA 1WDKA 3A4VA 1O8CA 3TFOA 4RLSA 1G0NA 2YFQA 3IKTA 3WGQA 3WNQA 5HA5A 3DMYA 1Y8QB 1Z74A 1ZJYA 2O7QA 4OHUA 1UP4A 4EW6A 1P74A 4OSOA 1ZVMA 3OETA 3ZCXA 2VHWA 4PG5A 1J49A 4A5OA 1EFLA 3F5QA 3ANMA 3AOEA 1VSUA 1T2FA 4CMAA 4CR6A 2F1KA 2X23A 4E30A 3OH8A 1Q2XA 4AJNA 4BGVA 4FFPA 3TZQA 4IS3A 1MV8A 5DBIA 4XYBA 1O5IA 3JQCA 4BGIA 1ZBQA 2BFOA 5EESA 3TF5A 3ANNA 4MVJE 4Y6RA 2Y0EA 1YE3A 4ALJA 3JQAA 3T4EA 2ZYGA 4CR8A 1NR1A 1YJQA 3C7AA 4JBHA 1X15A 5L40A 5T64A 1SPXA 4CPDA 3VPSA 2GNAA 1BVUA 4NR0A 1NQAO 5DN9A 3GFBA 3GR6A 5CDYA 4BMNA 4GSKA 1E3SA 3DDNA 1ENPA 4GX5A 4O5OA 4HY3A 2ZTVA 4OXKA 1HKUA 4FIZA 2EXXA 2HKIA 4L0QA 4DYVA 3P2YA 4I5DA 1I10A 3FTPA 1H0KA 4XIYA 1MG5A 4NBVA 5C7IO 4BKPA 3F47A 1N1EA 1UP6A 3TWOA 2HMUA 1Z6ZA 1NHWA 3JD4A 3V1UA 5HS6A 3G79A 1DLIA 2VT3A
chains in the Genus database with same CATH superfamily
2BCGY 4J0EA 2W6PA 3UCFA 1IG0A 2A5DA 3CZQA 2AOWA 3A31A 4YCCA 5BSHA 4AY4A 4J0CA 4H16A 3EPLA 4CQNA 4RTJA 3OHPA 1NUUA 1XDWA 4O02B 2IW3A 4ZZ1A 2PGDA 4R6WA 4AO8A 3T9FA 3MTDA 4M8IA 4IOJA 3WNVA 3M9WA 3WAKA 2UYGA 3BD7A 4MRVA 3EXHC 3NFRA 4AZ0B 5J47A 4C78A 1X86B 3TFQA 4YXFA 3QIVA 3BBPA 3E3OA 4YV1A 1VHJA 4AJ9A 1SBIA 4PQEA 2BMJA 4YIKA 1HEIA 1K4YA 4UUOA 3UMVA 3UXHA 2WG0A 3G2KA 4YDRA 2ONKA 4BVJA 1VLVA 4C0AC 1WDMA 3ZUGA 3VNSA 4TYPA 4D98A 4BLUA 4EYKA 3KTDA 3R9XA 2H2AA 3ZHXA 1PJLA 2ZAGA 1GV1A 2EKZA 4H77A 2BHTA 2QT0A 3KJGA 4JV5B 2REOA 3I8OA 3I39X 3MMSA 3JZMA 1ORHA 2WAMA 1G17A 1E79A 5TY0A 5KU7A 4XOIA 1IZ0A 3IEIA 2D06A 2F3TA 4U9HS 4EGFA 3H5RA 3AXTA 4ENQA 1OWLA 4CKWA 1ZDMA 2X7XA 4KXMA 3VR2D 4EG4A 2VIIA 2XLBA 1DCTA 4A36A 4A6EA 4IHAA 3A1DA 3IMKA 1MO5A 4RSHA 4F6RA 3KQLA 3FZNA 3ZG6A 1A82A 1ACLA 5G1NA 5B37A 3U9LA 1UC4B 2W6OA 1XSEA 2R00A 5SZHB 5J5VA 1WL8A 2FPXA 2JLXA 2EBHX 3H5TA 5I5GA 1SG6A 3ND9A 4R2WA 2BM9A 3UF0A 1T9GR 3FCAA 1FFGA 1SQGA 5K0NA 4YMGA 4C6TB 1ZRNA 3BMCA 1Y8AA 4FCWA 4NCNA 4OAOA 1E1KA 1H9AA 3QHAA 1XCMA 1Z0ZA 2F6RA 1SHLA 4MARA 4R41A 5B57C 2ZRJA 3QBDA 3TQQA 5JSQA 1B1CA 1DIGA 3IPRA 1XEXB 1BH6A 2QU8A 4O5AA 3C3KA 1JVSA 2DYKA 1PW7A 1UFRA 2X0RA 3Q5GA 3WLPA 5JCOC 4GGPA 3HSSA 3D4NA 2P5UA 4KGVA 1TJ3A 3Q98A 2ZP1A 2PUFA 4GM4A 1OLXB 4RJJA 4MGYR 5E7MA 1TM2A 5AVOA 2O2ZA 2F1IA 5DM2A 3TM5A 1WQ4A 1YL6A 1N2ZA 3ZWCA 3KOUA 3CTPA 2B8JA 3NTOA 4X66B 4XKJA 2QQFA 1GGFA 3PG5A 1BXKA 2XZPA 3KX2A 1VI5A 3O9ZA 3QE4A 1N5JA 1DINA 4PGFA 1KZ9A 4BVGA 3UJNA 1N0UA 3D2LA 3NBXX 3PKIA 2JGDB 5CFZA 3NBKA 3RVBA 1DX9A 1PR5A 4RF3A 1QHGA 5AQEA 1Z9BA 3B52X 1YHZA 1YS2X 3IKJA 2XITA 3IQZA 3OZCA 1XU4A 4GWKA 3PE4A 1KKLA 3RSOA 1G42A 2BYTA 4O4HF 4RFLA 3B1YA 2I2XB 3QW4B 4PCVA 3OLCX 3ANXA 3V1TC 5GTDA 5KYGA 1Y6GA 3CEPB 5AKLA 2DB3A 2UV8A 4E21A 2WJYA 5FKJA 1Q1AA 4WERA 2XNJA 4KQ9A 4L8VA 1NM5C 4L8GA 1EX6A 4HB3A 4BRSA 1N3BA 1CR1A 1GR0A 4WBSA 2Q7DA 2YINC 2ZWVA 4QQFA 3VTKA 5BMVF 3PNLA 5LLDA 4K86A 2IHJA 4L4YA 4UHDA 1CZLA 4OQQA 2REQB 3T1TA 1TEZA 2BEJA 2VLIA 3FVTA 2DECA 1JAZA 3QNWA 4WCDA 1EFUA 1V16B 2AUNA 4YAJA 1NU8A 3DZFA 5ELLA 5JAHA 2HA4A 1T1EA 4PWZA 5G0TA 2GM3A 1COWA 4RVSA 5IAEA 2ADOA 1QWOA 4DUGA 1L7RA 3W5HA 3HCNA 3WYNA 4JROA 4IGEA 4XDHA 2YNMA 4GMGA 4Z3KA 5IM4A 1IJBA 1DUVG 1W4CA 1XNHA 4HH0A 1DOHA 5HXAA 3VYWA 1RAEA 4MVWA 1SCUB 3HBMA 4Q19A 5CYFA 4RD4A 1Z62A 4D3FA 4HDOB 2B4RO 1PJ3A 2Y4NA 3DL0A 1DBWA 2ZI5A 2ZS8A 4WACA 5HW0A 1ZN2A 2HYDA 5EWJA 2ESRA 3TGWA 3SWWA 1GPKA 1FFWA 1JTFA 1CVLA 1XBTA 1W4RA 4FLMA 5KAPA 2OFWA 1N78A 1LVHA 1RQXA 3TXYA 4DLZA 2FR0A 5FBHA 1KJWA 1XHFA 2JBAA 2DUMA 3H0CA 1Y89A 3AEZA 2JI8A 2R79A 1C50A 1OR8A 3FR7A 3L6CA 4I19A 3U7FB 3G88A 4AJJA 4ZMSA 4ARIA 1O3YA 2XKJE 3RROA 3SYTA 2D5AA 4G07A 4RNCA 5K3FA 1R4MA 4EY7A 5FLEX 3PXEA 1LZLA 5F5NA 1JQDA 4LOIA 5AXBA 2ZDGA 4F45A 4RD0A 5EJMA 1UKBA 1XKLA 2VCYA 3Q6NA 1CDEA 3G0IA 5BN3B 2JLYA 4NCBA 1IYZA 1DVRA 3F9CA 3NBQA 2I1WA 1OFIA 3A9RA 1XROA 2C88A 2VEDA 3MTGA 4MRMA 3WIUA 1NG9A 4P9NA 2WWTA 1TE2A 1Y5MA 2J45A 4KVFA 1MOQA 1U31A 2MSWA 3OWXA 3SBEA 1XQWA 2ZVPX 1PV1A 2FSPA 3PUKA 4LQDA 2IDKA 4MIEA 4QYTA 2AMJA 3PWTA 1HNWB 4E1VA 4XGKA 1CDOA 1H2YA 3CLRC 3KSMA 4AS2A 3ZE8A 4CV2A 1NYTA 2QTNA 2OAP1 4M0MA 1XTBA 4LC0A 4O1IA 3RSLA 4DKJA 1T2AA 2X3YA 4GAEA 5AO9A 5B1IA 1LDYA 1LI7A 1NOJA 1WXEA 1XVLA 2B37A 3UA3A 4DYDA 3HXOA 2WA1A 5JXGA 4OF4A 3W9SA 1KBOA 3HVHA 4TKUA 3W2GA 5F3WB 2NO4A 1VE9A 2ATCA 2XF2A 3I6BA 4RPIA 1OKKD 2I5PO 2IZOA 2J3LA 4UBMA 2IYFA 2WP0A 2O3JA 3H9GA 3V8BA 4HQ0A 4IIJF 4BX3A 5CB6A 1JHOA 2WBLC 3PHCA 2Y6UA 1SXHA 2EYQA 1TGYA 3PJDA 4QRHA 4UPVA 3VJKA 2B1RA 3IIEA 3VR6A 3V4ZA 2XUIA 4DIEA 5FLKA 5KYYB 3EVGA 3O4FA 2M6RA 4DR7B 1M1YA 2WD7A 1N0HA 4R51A 1US8B 4MUHA 5LB2A 3UY4A 5HTOA 2OQRA 5A3RA 2OO5C 4PC3A 4TVKA 1K7CA 1UPCA 5FJJA 4A7PA 2OY0A 1V3TA 2UZ0A 4M4SA 1J5PA 4TTJA 3SHVA 4KIJA 5KOHB 4MINA 3CGGA 3DQPA 3MWEB 1L7OA 4TVOA 5FWAA 3BH0A 3SC2A 4IDCA 5YASA 2W43A 1AKMA 3NCTA 3TTXA 2EARA 4D99A 3KETA 2OCYC 2B82A 3M1AA 4CT5A 4F7DA 4CL8A 1KWKA 4UU7A 2WHPB 4NOJA 4GT1A 1XRMA 3QKTA 4JCCA 2JH8A 4CETA 3TSWA 5BT8A 4CHGA 1ZJ6A 1GJRA 5DGXA 3WY9A 3ETHA 2R8BA 2A7XA 4ZCMA 4I4CA 5LWHA 3K30A 5K6AA 4NZOA 4EI7A 4OHVA 1II0A 2QD5A 2RC6A 3AEKA 1KMQA 1W0JA 4J7AA 5TGZA 3V7YA 4BNXA 5LM3A 1DUSA 1U6JA 3VC7A 5M7EA 3TDKA 1Q14A 1UXHA 4DTIA 4ZJZA 3IUBA 1AQNA 4HAVA 1BZYA 1XEAA 3CURA 1MIOA 1T6ZA 4DJEC 1M7GA 1WKCA 1QYRA 3M2TA 4AQDA 2I9KA 3BKXA 5D84A 3SHWA 4C5AA 2J0SA 4EGQA 1KH3A 1XTRA 3Q9UA 4DF3A 1CZNA 4HTAA 1O6ZA 2WM9B 3HU2A 2ZW9A 3K72B 4JT2A 1G8GA 1EUZA 4KNVA 1KMCA 2J33A 4K2HA 1VL0A 4PICA 2PFKA 5AYVA 3WB2A 4A8JA 3NYQA 5AW7A 3ZDAA 1UC9A 4MH0R 1I9CA 3T0FA 2I2WA 3M6FA 3V42A 2ZKIA 4UTZA 4XWAA 1XZGA 3OLVA 3PGA1 1RI2A 3EG9A 4UQOA 3WYFA 3WNZA 1QRTA 5DT9A 1CRPA 5BXYA 4AB1A 1MB4A 2QXYA 2IWRA 1E5QA 1AGXA 1OFUA 5ERXA 5NLLA 4BMCA 2CXXA 2ODWA 3LXMA 4EJSA 4W8OA 4D4IA 3H5WA 1G9SA 1YA6A 2CKMA 3AF0A 1I9GA 1Q1QA 2G08A 2AEFA 5SV2A 2OILA 4DG8A 2ZAYA 2B0CA 3LL7A 1F06A 3PT5A 3NH9A 3L8CA 2UVQA 1QVWA 1NU6A 3E61A 5KTKA 1P5JA 3DR5A 4RULA 3KKOA 2QV0A 2O3UA 2QN1A 2XGGA 1RM3A 1LVGA 1XAJA 4LNHA 4B48A 4QOIA 4S0ZA 2Z8XA 5KNCH 4B6FA 1OH8A 1CZOA 1Y48E 3CW2A 1BFUA 1YCHA 4CQLB 3T52A 1T5IA 2NTJA 3OFSA 5ICFA 3AR8A 4H6XA 3TR5A 1QIDA 1IDN1 3FB4A 4TVSA 3U7GA 2D00A 2WINI 1QKKA 3N8IA 4YP1A 4Q4JB 5J5CA 5FPSA 3E9QA 1P75A 2HU7A 4LE2A 3MYYA 2XXBA 1VZ2A 3RIYA 1G59A 2W6CX 1T9HA 2ZUTA 2XCUA 4RANA 1QG6A 3CUUA 3E81A 1FQOA 5EYPA 3IV6A 1WNTA 1XF9A 4BFUA 5I3CA 1U3WA 1Z4NA 3B60A 1YWGO 1Z47A 1IUOA 1C3EA 3UKOA 4RSMA 1UPAA 2HD4A 4B45A 4V24A 3TOVA 3KL2A 1IAQA 5EKUA 1Y6ZA 1O4VA 3RRJA 1ZINA 3E4CA 4U5XA 5EI5A 2I6GA 1ZMBA 3ZWPA 1RJFA 1OI2A 2BY4A 3PTZA 4LJSA 4OATA 3F3KA 1BD4A 5DGIA 2F00A 1SVWA 1X7WA 2JGRA 1WG8A 3NAZA 1IHPA 3I2IA 4YBZA 5ALQA 1PI3A 2BEUB 1Z17A 2IHKA 4DV6B 2UVPB 4RA6A 3I45A 2O8FA 3MWYW 2HL6A 4LHWA 2HADA 4PYOA 1H8ED 2CLSA 2FKAA 1AXEA 5IT0A 2DR2A 3KQPA 5A4KA 5GZ6A 3VJMA 2OLKA 3RVJA 1CD5A 4RHCA 4RA9A 2DHDA 1KE2A 4AXBA 2IPOA 1I3NA 4PO9A 1J8VA 2NLOA 5ALDA 5LD2C 5COAA 3DDUA 2H4YA 3TX6A 1PWXA 3CS3A 2A3RA 4I1OA 4NCJA 3ENVA 4IDXA 3I1YA 1GKLA 1CLUA 1FP1D 3QWFA 4KN5A 5AW2A 5K1ZA 1H5NA 1QQBA 4XQ0A 1ISPA 1QZTA 1IONA 1JMYA 3AM5A 4ZD6A 1EEXB 2JI6A 3RPEA 4DRZA 1GUAA 2O2IA 3MUOA 1RI4A 2O0JA 5ALOA 4PANA 3GYGA 3RK4A 2PD4A 4JT4A 3VUFA 3BTVA 2CHGA 3ZW8A 3KD3A 1XKTA 2OM2A 2QI9F 4KIGA 3V4OA 1MJGM 4ZYVA 1GPNA 2IOHA 1ODFA 2OV4A 3DJYA 1SU6A 5C7LO 5IWCA 3ICPA 4M1EA 3EHEA 4G0MA 3BA6A 2BW0A 1V7QA 3PFGA 4YRJA 4DIKA 5JXHA 3W5SA 4EY5A 5HIJA 3FLEA 4KOAA 2GJKA 1LWNA 2XMZA 5BSRA 1NJ5A 3C2QA 3ONNA 3V8NA 4AJIA 5CAEA 1L5HA 5J4HA 1WX1A 2EYUA 2ZYVX 3ECSA 3KOYA 3OOEA 4PBTA 3EGOA 2FRVA 5B1HA 1FFDA 1H5UA 3MT0A 1HDOA 5DLPA 2DFTA 3QP9A 1NN1A 5G4LA 2Q7OE 1XZDA 3L8HA 1UJMA 6GPBA 3LYHA 4ITRC 4D56A 1GZVA 1IQRA 3HFRA 2X42A 4JBLA 1CJCA 4PPFA 4U4AA 4BEJA 1EINA 3OUTA 4C4PA 5ALLA 5KOYA 2JJ1A 5DBEX 5AR1A 1PE0A 2QY6A 2WJIA 3B1XA 4IY1A 1A5TA 2AJLI 1YQQA 5FULA 3TLCA 3WXBA 2W2QA 1XZPA 4N3AA 4F84A 5BWOA 1E2JA 4JXJA 2LCQA 5DCLA 1MU0A 3WGUA 3RFXA 5L7YA 1Y6RA 4H6VA 4UDOA 5F1PA 1Z8NA 1W581 2FFRA 3PQ5A 1O97C 3FFWA 3LF2A 5JNTA 3LTNC 2BSQA 2J41A 2VK4A 1QPGA 3ZWBA 3MT8A 5HF6A 3IH5A 5LR6A 2ZITA 4FFVA 3B7GA 4NK5A 3JVUA 5LOVB 3AF6A 1OI4A 3Q87B 5DWQA 1PJCA 2W58A 2D13A 2R8ZA 3FJOA 3NTQA 3ZDRA 2IODA 3VR4H 3TDNA 1ODSA 3SEFA 4XPIB 2B36A 3FH0A 4UTOA 4HNRA 4TLLB 5DNEA 1DKOA 3THYB 2AN1A 2VK2A 5JCJD 1O89A 4AMZA 4ZVNA 1JEOA 3GDFA 3HLYA 3P0RA 2IKQA 3B1VA 1UAGA 1E9SA 1PK7A 4XYLA 1DQYA 4F11A 5A4JA 5FA5A 2PZBA 3G17A 4RESA 3H8VA 3HPRA 3W2HA 2UYCA 3BN3A 5KOIA 2JJ2D 4OSPA 3IPAA 4QT4A 1IXYA 2Y99A 3GDGA 2J09A 1C9YA 3BCRA 1CY8A 4RORA 1XQ6A 1NURA 2BFNA 2XTJA 1CFJA 2C54A 3JY6A 3QEMA 4A8TA 5DNCA 2FLWA 2QTVA 1OPXA 2XADA 1M2HA 4Z4GA 2MIIA 4E11A 1GR1A 2BSAA 3A4TA 1U8FO 5IXSA 4KQ6A 3U5TA 3K6RA 3G1UA 4MVJA 3HYLA 1XEFA 3CEAA 4YB8A 1WVMA 1JBQA 4X7MA 3VR4D 1RRFA 4CFSA 2J48A 1TYAE 4I3HA 5AM2A 3ISJA 1EFKA 4KWTA 3PHHA 4Q9IA 5C1OA 3ZNOA 4DLYA 2V65A 3WQBA 2WPDD 2O06A 3A1VA 3CX8A 3BIWA 3QVLA 4QUEA 3ESBA 1V1JA 1PK9A 1U0TA 2PX2A 4N5HX 4RETA 2JL1A 1LFDB 3JQ6A 4N7JA 1VLHA 2BC9A 4PCUA 2JGAA 3G9UA 3SC3A 1RBQA 1P2SA 2BGGA 5BQPA 1XRNA 1E2FA 4M7WA 2ILVA 4M0DA 3WOHA 3GH1A 2FX3A 2GN1A 2BHSA 2E0IA 2HO5A 2IX9A 4QTUB 1VPLA 1X6VA 3IPYA 3OM0A 5FWXA 1P5RA 2QUIA 2X0NA 3MTJA 4IJUA 4L74A 4LHXA 5FWYB 3WQRA 1KZ1A 3FR8A 4B9AA 1Z12A 3MJFA 2HQOA 3NVAA 4ODIA 4PNHA 1BJKA 4EKEA 1E6CA 3VZSA 2OUIA 1T9AA 2DQKA 1WWKA 1DEAA 1TVKA 2FPMA 3MCVA 4TMYA 2C4MA 4DCOA 5IEJA 2O7VA 3KALA 4NPAA 2ISCA 5SZKB 2AA3A 5B12A 4HNTA 1WBDA 4O3MA 1F2UA 1AHHA 3G0OA 3OICA 4B3SB 4IDOA 3CKYA 4BVHA 4OB7A 1P9RA 2PEYA 2VJCA 2ZXEA 3LYLA 2YY7A 1M7HA 1UMCA 1OGJA 2FOIA 3ZDEA 1V6SA 3LZDA 1DARA 4YRCA 3HKCA 1ZWKA 3C43A 1J2RA 2HQBA 5TV2A 3SOZA 3VU3A 3K9CA 3HVIA 4RVDA 2YVQA 1NF3A 2ZJ5A 4K6FA 4D9CA 8OHMA 2R6JA 2FPOA 2JCYA 2YN0A 5TPZA 1NW6A 1QIJA 2XOKA 3TAXA 4DMMA 1OYOA 4MV5A 2WIGA 3CE9A 3PLRA 4R9NA 5ILQA 4TWIA 1II8B 4RLHA 3Q5DA 4U6SA 1M6EX 1NVVR 2JNWA 4WCFB 4YCBA 4B80A 4XM2A 2VDVE 3NUGA 3JYQA 1PNVA 1MVNA 1ONNA 5I7FA 3NAMA 4MRSA 4RZHA 3KQSA 2TMYA 3EIEA 3ZEIA 2W2KA 1CR0A 1GLGA 2YWRA 3NXSA 1W87A 3OF5A 3GFFA 3Q7SA 3F5MA 4WXYB 4BKUA 5ICEA 1F4LA 1Y3HA 4QUIA 4AMVA 2FPUA 2WJZB 4S3MA 1NG1A 4KTVE 2G9NA 3B89A 3A28A 2J4DA 3UHPA 5CCXA 3IUPA 4HNSA 1P7PA 4G5GA 3LK7A 2XQKA 5TGDA 1NW4A 3OEYA 5BRJA 4DCSA 2BZSA 3O6VA 2BH2A 4K9DA 1NW9B 4AD8A 4NOLA 2QJWA 3GBSA 3KLOA 1RACA 1AS2A 1HQYE 2H9YA 4V2UA 2XPCA 4MUEA 2CUTA 5K0LA 3Q3CA 3SI7A 4BY9E 2D1RA 4FEGA 3OO0A 2DQ4A 1JI3A 1E7SA 1KVRA 1FRNA 1MNQA 1W46A 2CYCA 4LQCA 3SC4A 2IYVA 3DMDA 4RHYA 3E2MA 4I1PA 3PZBA 4WOCA 2NSDA 3F74A 1K5HA 4L6AA 5AKXA 2J59A 4AZ3A 4G65A 1YCGA 2BKAA 2VAVA 2WT8A 5C8YA 4UM5A 1JDZA 4YCLA 3AY0A 2J85A 4DQLA 1YF3A 1T4BA 3FHLA 5DNAA 2RARA 1VJ5A 2YWHA 4N8DA 5G0VA 1BHSA 1TU3A 1CS0A 2CJPA 2HREA 3LOQA 5FL7D 4DZRA 2EJVA 4PLVA 1MD9A 1ESDA 4Q1FA 3H84A 3LBFA 5C34B 4TV8B 3MT9A 2UVDA 4QM6A 3V3KA 3ER9A 1FSZA 5HKAA 3H5IA 3WQSB 3GN1A 4OV6B 4H1UA 2VXOA 5B1DA 1HUQA 1YR2A 4B6OA 6NULA 4Q93A 3DKPA 1PZXA 2ZAMA 3ROEA 3BXFA 1FP4B 3CCFA 3T1NA 2CV1A 2UYYA 2FCRA 2GNOA 3OX1A 3BEDA 2VDRB 4NL4H 1GUYA 4JQCA 5CCEA 3ZNPA 8ABPA 1V4BA 5DPMA 5EMMA 2Y1CA 2MTBA 4EMUA 1NE7A 1NGSA 1P0IA 1V45E 2O1SA 4HYTA 3Q3IA 4QPCA 5BNFA 5HZHA 1EKXA 2ODQA 4JC5A 4ZAZA 3W04A 3CZRA 2J87A 1G3UA 3S1AA 1BRMA 3NV7A 1DFIA 1DL5A 1EFVA 5D3MA 3I52A 1JN0A 3H6GA 4HAWA 1UODA 3OE7A 1O95A 4NFLA 4J0HA 1LX6A 5BOVA 4C4YA 4ZDKA 3H3JA 3GGOA 3ZV6A 1E7MA 2PRJA 1WZUA 1IZZA 1KHHA 2NV6A 3JR3A 1NE2A 2QPAA 4B3HA 3VYVA 3RYHA 3DO8A 3HXLA 1IMOA 2DWOA 3CLUC 3DHNA 3H2ZA 5JZBA 1R66A 3IRUA 3N7TA 5I7RA 2WWYA 1EZ1A 3FNRA 3A1TA 2P91A 2FEXA 3V6LA 1DFGA 1W36C 3MMXA 1W75A 3FMIA 1WUHS 5JXWA 5LYJB 3INNA 3LA6A 3NTUA 3LNTA 4Q9HA 3W2EA 4LF4B 1P4GA 1N36B 2Z1MA 1W35A 5IN4A 2DR3A 1LDMA 3CEHA 2GNPA 2R97A 4UAGA 1F8GA 2HCBA 1JNYA 4OHCA 4OXXA 4BX2A 2PQ2A 4K2AA 4IS2A 2ZUFA 1GYPA 1FRZA 1NVGA 2W11A 3E9CA 1ZKMA 2FW7A 3I0ZA 3O92A 1TMOA 4J90A 3OWHA 2AG0A 2AKEA 4S2EA 5E4YA 4COOA 2I55A 4Q4HB 3VDNB 3ZWNA 1IPEA 2Q6OA 2SECE 2ASEA 2ZB8A 2EU8A 1UBNA 3EGVA 1DRWA 3BSYA 1XPOA 1TCVA 5FTWA 1K06A 3WGZA 5DSTA 4PSAA 1XT6A 2I1QA 3V32A 1BIFA 3GVHA 4O29A 2CWDA 1SXJD 1OLUB 4XW2A 4PFQA 5IVHA 4REQB 1R12A 4RYDA 1HI9A 1K6EA 5IAKA 1UBMS 2CXHA 5E4JA 3QI7A 2AT1A 1UK9A 3M2PA 4X3PA 5IXJA 4TYQA 2A9PA 3AMVA 1JBKA 2NU9B 3P9YA 4IR7A 2H1LA 2RAFA 3S2EA 3GG2A 4TKVA 3N2GA 4C4ZA 1P2UA 2ZJ3A 4NS4A 1CRWG 1ZLYA 3CZMA 2KW5A 3GD5A 3GRKA 2OB2A 4YP5A 1QV6A 5HK8A 2WWFA 1FTGA 5KWVA 3ISVA 1CUJA 5L3SB 3OQIB 4J3JA 3RRMA 1LPAB 2JJ8A 4M88A 13PKA 1XQ9A 4GXTA 3CNOA 3ZD6A 2IIVA 2PMFA 3CMMA 4YMIA 1PZGA 2I71A 4G9EA 5K0ZA 4J7CA 4RGVA 3ZBPA 5A04A 3A2KA 1EWQA 1WPRA 3W6UA 5JO0A 1TA4A 1CV2A 3UCEA 2IY7A 1XTJA 5JG7A 3AEUA 2R6ZA 3RBZA 1C3OA 3RSQA 5I9NA 4F4HA 5BNIA 4K46A 5E1BA 2H8KA 2XAUA 3CVJA 3PDUA 5HRAA 2BEWA 5GONF 4ENRA 4BO8A 3UJHA 4EUKA 3THXB 1EBUA 1Z25A 2DFLA 1L5VA 3EZ6A 3JQQA 5BRAA 5KX5B 5DSZA 5I6DA 1FFYA 2I4MA 1J39A 4GRDA 1ZCBA 4DJFC 4JP1A 2W2VA 4NZMA 3ICVA 3GZNA 3KU1A 3D3NA 4KKXB 5JS2A 3I05A 5IUKC 3WGOA 3ZW9A 1J0XO 1FQKA 1ZC4A 5C1DA 4WN9B 3DTVD 3F7MA 5CB4F 5JSYA 2E4ZA 2GWRA 5EIHA 3GUVA 3ZWVA 2H11A 4H7IA 5HMMA 3AIMA 3INGA 3T5GA 3I8SA 4URWR 1GNSA 2AK2A 2I2FA 3L5KA 4FGSA 2SKEA 3TJMA 4A03A 4CMCA 3Q9SA 4BECA 4HSEA 3FPHA 1N33B 2QPLA 3K9GA 1EVIA 1JHVA 1N75A 2P4EA 3EF0A 2W6NA 2RHJA 3D54D 3GPDG 3H2YA 2FVYA 3OZXA 4HMOA 4JIGA 4F1WA 4OB6A 4RL6A 4DPKA 4H7PA 2AYZA 2Q8QA 5ITVA 1RWQA 2OK7A 1ISFA 4BQOA 1NMEA 2A5JA 2ZJ6A 1PQUA 2FG7C 3OA2A 1LBQA 4RCYA 2XBMA 1TQ4A 1TVCA 3ZH2A 4NCKA 1Y1KE 1Q7EA 4GLJA 1GKYA 1NVTA 3PUYA 1NJSA 1UPUA 1FU7A 2YBEA 4MMXB 3UATA 1QRDA 1DI0A 1V39A 2GX6A 4MR7A 1CUXA 4L78A 3S2ZA 5G41A 2XT0A 4N8EA 1BMQA 5CLHA 3E53A 4CM5A 4AT1A 2JD1A 4UEOA 5EKSA 3NHLA 1E63A 2DSNA 2WQ7A 4PC7A 3ZCQA 4J1TA 4R8RA 1ODCA 1ES9A 3FUUA 4Q6BA 5U4XA 3MCWA 3X1XA 1EJ0A 2I67A 2WKQA 4XD7A 5CJ2A 4X1YA 3QPDA 4XQ9A 1Y5NA 1T1GA 1TMYA 2XMQA 1LCIA 1VI6A 4PFSA 1O08A 4PHFA 3LYAA 4PR0A 2NPIA 5I9SA 5KCMA 4F91B 1I4EB 5T41A 4MDHA 3AEQA 5CA1A 3D64A 1E8MA 3FROA 3GP3A 2OGTA 1XFDA 3SN6A 1F4VA 1ZD2P 5JMPA 5CB8A 2HDOA 4TKZA 4OKSA 4BUJA 3F6EX 4K1LA 3QY0A 2M2IA 1RZUA 2IZ1A 3N8DA 3MTAA 3L49A 3PWSA 1UXKA 5ER9A 3T7DA 5KQLA 1EAMA 4R2XA 2XTNA 3HBLA 1SA0A 2A0KA 2QTRA 3G8BA 5FUVA 4YV2A 5FBWB 5LZ9A 3HO6A 4XGIA 5JCXA 3LO8A 3LYUA 4BUCA 1SHKA 3N3BC 2Z1DA 3PNQA 2JLZA 1GVNB 4TMFA 2I3DA 2WWRA 3D3EA 5D8DA 3RS0A 2V4ZA 1LBSA 1YB6A 3DBLB 4FYJA 1MJNA 4M0UA 4HDKB 5TVKA 1CY0A 4DR1B 2A2ZA 1ZD8A 2WF9A 5IVDA 1ARZA 1VIDA 5GJBA 2W2OA 4HAIA 4RIFA 1M2GA 5JE8A 5T8KC 3U3OA 1JDTA 2D7CA 2QX7A 1I7PA 4L8YA 2PZGA 1A7JA 3KK0A 2PQ6A 2IXBA 1YH3A 3NFYA 1L1QA 5CVUA 3ZY4A 2WUFA 2FHPA 2PV7A 3QLUA 4LQ4A 3HK2A 2VL7A 3EMBA 2WYUA 4UU1A 3W06A 5TIIA 1A2QA 4YV0A 1Y3CE 3TIFA 2JFNA 1L8QA 3AR6A 3O94A 1C3LA 2C94A 1A5AB 1PT7A 2YIDA 3JQEA 4JLDA 4QJ5A 4HT3B 2PBZA 1EXMA 1SNYA 2JGFA 4IHJB 5DNDA 4AWXA 1MC5A 2PH7A 4TT8A 1FC0A 2D7DA 3ZJTA 3A6LA 1NP3A 5EUQB 1EBFA 3UNXA 5KUTA 2J1LA 2E5LB 3NG1A 4H3SA 3WGYA 3OM1A 1QP4A 5BV1A 4QBKA 1FMLA 4CDRA 3RH0A 1LSUA 3DW1X 3AI7A 3IPCA 1KYVA 2VHZA 3IV9A 1AUOA 4M53A 4EW3A 1X1EA 3VJLA 1T2DA 2GXSA 2QSZA 2VAXA 2HLHA 3D6HA 3EQ6A 1RPAA 5AVWA 1JECA 1G63A 1XZIA 3DSRA 3NYIA 1L8LA 3RU7A 2CGEA 2Q28A 3IUYA 4RV5A 3UMFA 1CNEA 1NWHA 4MKHA 1GZ6A 1E3WA 3CX7A 3VISA 1GAWA 1YZQA 4RK6A 3AO0B 3JARA 4M87A 3N2KA 4PRKA 3ZLVA 5AFSA 1SR8A 1FDSA 2Q0QA 2YHBA 2GDJA 5EIBD 5BQOA 4YUVA 4LCJA 1SVSA 2FF5A 2C77A 2JRLA 4I1SA 4S35A 1CT9A 2BHNA 3LUHA 4OJKA 1CUDA 2QRVB 3LS2A 4G56A 2X0JA 1NQ5A 1VPEA 3ADDA 2NTNA 1ID8A 3NT5A 5IARA 2BFMA 3QVWA 3EQZA 2EEPA 4BBPA 2X3FA 2GTPA 3Q41A 5C32A 4O6VA 1UZLA 3EMVA 5ITWA 4KACA 1DPGA 3KPYA 2J08A 2D2FA 4I3FA 1JAYA 4EFMA 3KYJB 1BXRA 5TS3A 3TLKA 2OBNA 1W1UA 2ID8A 3EVDA 4QXPA 3V6MA 4DMLA 3OTIA 2QR2A 2ZATA 1R6UA 3VDMA 5I7OA 4J1SA 3STUA 4CL3A 3PKZA 3Q5EA 1FPQA 4ZO6A 1W6RA 1KMHA 1R4NA 3GRPA 2ZYDA 2VFAA 5TNXA 2VP0A 5G0WA 1XCOA 4ZREA 3S4YA 1RJ9A 3ZGNA 1HLGA 2C95A 1KS9A 4G36A 1IWOA 3BUSA 4L85A 4YCAA 4Q15A 4ER5A 4DUZB 4GVPA 1QHIA 1OXSC 1UKYA 2VP5A 1JGTA 3PA6A 4QDUA 3QBEA 1I80A 1A97A 1LY1A 1PX2A 1LGYA 1SM4A 1SBYA 2YKGA 2ZANA 3IX7A 1QFZA 1X1BA 2MINA 4Q7KA 5AW5A 5TEWA 1D0SA 4BJ1A 3SFZA 3T9AA 3SG0A 1CB0A 1G2QA 2AN9A 2IHVA 1I6MA 2PVSA 2PPVA 2VK8A 2W48A 1M83A 4Q02A 5EHQA 5BN5A 2WUWE 1AO0A 4RKYA 1EFHA 1QJ4A 1VG0B 4KK4A 1YRAA 3M9LA 3PU6A 5JD6A 1DQNA 2C8JA 3GLTA 4MUGA 2R4QA 3VI4B 3P0JA 5C35A 3O8RA 1CUVA 1ZN9A 1AKQA 5T57A 3DXFA 3SMVA 4EEXA 4KYIB 2DG2A 1C1DB 4P5EA 3BS4A 4CMBA 4W1PA 1CQJA 4Q9LA 1K9SA 5IT9A 1GXSA 1RJDA 2A67A 2FQWA 3OJXA 4RZXA 2RJOA 2I29A 3KLNA 4J1NA 4CIAA 4PG4A 4IX1A 4TYYA 2BHRA 3P26A 1SZPA 1ZAKA 2FZKA 2DCUA 2BJWA 4WI1A 1FPMA 1V8OA 1S6YA 2BFCB 3EZNA 4G4GA 3T4UA 4BE7B 5J63A 1V47A 2ZS9A 3V8MA 4XWGA 3EFHA 1BH2A 1JHQA 4A6PA 2NU8B 1CU1A 1U8UA 2F8MA 1Z6XA 3EWIA 4CUKA 1R8XA 2VUIB 1W2WB 1DWPA 4ZI7F 4G9GA 3DT9A 3VV2A 2A8YA 3MCUA 3DC7A 2AXQA 4HO1X 4RGBA 5JS6A 1MX3A 4QL3A 1HL3A 3IBFA 4FHDA 2JFXA 1DJQA 1M2OA 2NAPA 4Z9BA 4DBVO 4QDTA 4ZT4A 4C0QC 2I91A 2O07A 1OLOA 3HABA 2B4KA 1P7VA 2AJTA 4KRFA 4NENA 2PGXA 3HUDA 2LRHA 1V2HE 3BFJA 5FORA 4CIVA 1TO1E 2D3WA 2EF1A 2HBRA 3BJMA 5IAGA 2X6RA 1W2HA 2GVNA 2PH3A 4HAZA 4TLAA 3SSOA 5C5DA 1UC5B 4TL9A 2WJ6A 1KSJA 4G5FA 3VPAA 1W4AA 2WHQA 4DTCA 3ORQA 2UYOA 3A1WA 4PYLA 1SHTX 1EVZA 5F7ZA 2VTVA 3A26A 5K8CA 2AEJA 1R1DA 1VMAA 2GZ3A 2B78A 2V6GA 4YP0A 2FUNB 2Y8EA 3P0HA 4CMJA 1AS3A 3EZFA 3N2LA 4ABYA 4WY5A 3R8CA 2QEQA 1EB9A 4HH3C 5CFLA 3AFGA 4QVGA 4A2QA 1Q0ZA 4KPGA 2M98A 5A7FA 3R09A 1N2SA 3OT1B 5ER6A 4XR4A 4YI5A 1XPUA 2XYVA 3GJ0A 3LD9A 2VYCA 1YNSA 3EQ9A 2QIPA 3HCBA 3MTQA 4BNNA 1CRLA 5EHNA 4E88A 4L7QA 1P39A 3FW1A 4DIUA 1WETA 4RC9A 4RMGA 4JBWA 3CN9A 3CUEF 5JDCC 2Q9AA 2NUAB 4AZ0A 3OJWA 1E4EB 3I28A 4C4OA 5AKZA 4MCJA 1ODIA 4NESA 1EFTA 4ND3A 1T1RA 5DGTA 2EW8A 1YOBA 5KSPA 1L7MA 1UXOA 3NKLA 3VKWA 3AIIA 2OKCA 4FWIB 4N0QA 5CLIA 4UTPA 4E6PA 4ALLA 1ZRMA 4P82A 2YUTA 4EZEA 3FOZA 1Y1SA 2V55B 2P3QA 5L45A 3MG9A 3H2IA 4BWYA 3GFTA 1WBBA 5F5LA 1GN9A 5WRFA 1H05A 5BSFA 1MQSA 1D3AA 1K97A 1JAXA 5A9RA 3RSSA 1IIRA 1P9OA 1ZR4A 3SXPA 4J16A 3H13A 2GN9A 4RJTA 3LVFO 4PYMA 1IY9A 3SJZA 1RWXA 2E1RA 3R6LA 4WXEA 4ENVA 2ORIA 1LDGA 1GZ5A 3HCFA 1KOGA 4ZQIA 4WXMA 4PRLA 4ICIA 2PXXA 3H1EA 4MVJF 4BU0A 1A9PA 4WOPA 1Y8RB 4HYYA 5KHOC 1VPWA 4QFDA 2G4LA 3DNPA 2Y1KA 3DWGA 3IO5A 3GFGA 2VJBA 3IJRA 4YC7A 3T7CA 3WL5A 1E4OA 3HU3A 4ZVVA 4BVAA 1OBCA 4BBZA 3E1GA 3GUCA 4JKOA 4RIEA 4UAUA 4LTNA 1ZSVA 2WDPA 4O1MA 4U2EA 5JDIC 4QC2A 3LXXA 4EITA 3I23A 4KDRA 4S1VA 1IPFA 1D2CA 4MQEB 1GDTA 5JMTA 2D1SA 2QUKA 4C6TA 4H7EA 1ZMTA 1V3QE 2ZYAA 3P9XA 3C14C 4OQXA 5J2TA 4MKFA 2I3BA 4Z6KA 5JAZA 1VLLA 1XEXA 2J0VA 1F1BA 4MIOA 7AT1A 2QLLA 5BT9A 2ZYIA 1JQKA 2QB5A 4HVTA 3M8KA 4KAJA 3PIDA 1C9MA 1PJTA 1R9NA 1TM4E 1ZISA 2EWVA 4R69A 1KK2A 1NOIA 3COYA 1QH0A 4ZVRA 2OMKA 3EEFA 2VNSA 3UUWA 1OLXA 2JJYA 3U1VA 5JQGB 2OZPA 4RIHA 2EJWA 4D97A 1YZVA 3FUVA 3NUZA 4LGVA 3IJEB 3SDBA 5EVCA 4DGSA 1W5SA 3LQ4A 1T2NA 1V35A 1ZEMA 4XSVA 4YT8A 1DXQA 1YS9A 3L4BA 3EEBA 2H65A 3VU9B 4CMEA 2BMVA 1K2VN 1O0SA 4URYR 2BE7A 2LIVA 3KVYA 4K6MA 1Z5OA 3E8XA 2RMKA 3D0QA 3GXOA 4OXIA 4XI9A 4FMCF 1MAVA 3U3MA 1E61A 3DOOA 3JYLA 4LDPA 1OFVA 2JFGA 3I92A 1I14A 1EIZA 1HOXA 1KAHA 1PS8A 2GHQA 1ADCA 3QJ5A 2EGHA 4P54A 2JA1A 2Q5HA 2ZAIA 4RZSA 2PUDA 1UBTS 1F38A 4YMSA 3WKAA 1Z26A 5K8VA 1T0BA 2HM7A 2GK4A 5CPFA 4OTZA 4MHSA 3V9PA 4ROSA 1NL3A 2XGSA 3CWQA 5I8WA 3GIDA 3I2GA 2REQA 2A1UB 4P4GA 5F7JA 4WGFA 3BK2A 4DUPA 2ZBQA 3JWHA 1V16A 2QX9A 1AGNA 4DR2B 3AHHA 2JAXA 4I1IA 4C89A 2CNKA 2UUPA 4DMRA 1J99A 2J7PA 3ZNQA 4EYEA 5TEVA 2BDUA 1P8AA 1F6BA 5FBQB 4JI8B 4YI3A 3F3MA 3Q12A 5JBNA 3HJBA 4KRXA 4BAUA 3TXXA 3M4ZA 2OXFA 1D1PA 1SCUA 2KJQA 5IANA 3S70A 4N54A 5AM1A 5F1KA 2GYWA 1ESCA 2HWKA 1MTZA 3KCNA 4MWSA 4OYRA 4X3CA 1NBHA 4NH0A 3VNRA 4R1LA 4C7JA 3RCBA 3HCWA 4YJGA 1OAAA 1WOYA 1VDMA 1DDOA 1BYUA 2BGIA 4K9NA 5A4AA 5EJ9A 2D59A 5HNKA 1IE3A 1QK5A 4G86A 4LJ9A 1J2UA 4MGIR 3OECA 2G1UA 4XFDA 5HDBB 1SCBA 4HQNA 4KWIA 2IF0A 1F2VA 2G72A 4IDGA 2GM5A 1T6NA 3PUXA 2PH1A 2EL7A 3A6KA 4H15A 4FJ2A 5DHTA 5CW2A 3RUHA 3RTDA 3RU2A 1NPYA 3GQVA 1JSCA 3R7AA 3UWPA 4C1BA 5ADHA 3GOHA 1E99A 1JPNA 3E82A 4PX2A 2JHGA 2JD0A 3CVWA 1N2EA 4R01A 4C7OB 2HA3A 3NV9A 5I7EA 5BN3A 4F04A 3QE9Y 2PL1A 1N6IA 3EAFA 4UBLA 4JBXA 3EWSA 1EVJA 4N03A 5G4KB 2DERA 1JXMA 1YAJA 1SQ0A 2PL3A 4J2TA 5IC6A 3RW9A 3UMJA 1KDVA 2RONA 3UENA 5BSKA 2PYIA 3KV3O 2G07A 4DIDA 3H0EA 1PVOA 2H9IA 3KAQA 2GI4A 2OQ2A 3O1IC 3SIXA 3ESYA 3IP6A 2EFHB 3FX2A <