4GICA

Crystal structure of a putative histidinol dehydrogenase (target psi-014034) from methylococcus capsulatus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
401
structure length
382
Chain Sequence
SMTEVKIKRLYTGDADFASQLDRLLAWSDTDIHQRVTEIIGCIRRDGDAALVELTARFDHFVVDTAAALELPRDVLEAAWQALPAEQAKALREAAERIRAYAERQKLDSWDYREADGTLLGQKITPLDRVGLYVPGGKAAYPSSVLMNAVPAKVAGVPELIMAVPAPRGELNALVLAAAYISGVDRVFRIGGAQAVAALAYGTETVPRVDKIVGPGNIYVATAKKLVFGQVGIDMVAGPSEILVISDGRTDPDWIAMDLFSQAEHDEDAQAILISPDAAHLEAVQASIERLLPGMERAEVIRTSLERRGGMILVDDLEQAAAVANRIAPEHLELSVESPEVLVESIRNAGAIFMGVLPTSGTARFSSPLGVYDFQKRSSLIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidinol dehydrogenase
publication title Crystal structure of a putative Histidinol dehydrogenase from Methylococcus capsulatus
rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase
total genus 120
structure length 382
sequence length 401
chains with identical sequence B
ec nomenclature ec 1.1.1.23: Histidinol dehydrogenase.
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4gicA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4gicA02
3NU1A 4G09A 4M7OA 5BVHA 3HJTA 3AERA 1G20A 2O1EA 3AEQA 3MWGA 2AFIA 1QH1A 1H1LB 4NNOA 4TKUA 4PM4A 3MINB 4XPIB 3PDIB 1PSZA 1N4DA 5KOJB 4N01A 1KAHA 4K3VA 3AEKA 4WZAB 1QGUA 2AFIB 3CX3A 3ZK8A 1M34A 1KARA 2RG7A 4WZBA 4WESA 4UDNA 5BVGA 1ESZA 2Q8PA 4FNAA 5KOHB 1K0FA 3R5TA 4HMQA 2PS3A 1QH8B 4B8YA 3TLKA 1M1NB 4WN9B 1H1LA 2R79A 3LHSA 4HMOA 2YNMC 1EFDN 3AESB 3MINA 5BVGB 4XPIA 3PDIA 4H59A 5KOJA 4TKVB 4CL2A 4WZAA 4INOA 5KHLB 3U7QB 2ETVA 2WHYA 4LS3A 3G9QA 2R7AA 4IRMA 4OVKA 4OXRA 5CX1B 2M6KA 5KOHA 3EIWA 1PQ4A 1QH8A 1N2ZA 1M1NA 4WN9A 3TNYA 4MLZA 4UTPA 3HH8A 3AESA 2PRSA 3GI1A 3R5SA 2OSVA 5GGYA 1TOAA 4FKMA 1M1YA 2XDQB 4TKVA 2AFHB 5M29A 5M34A 2YNMD 3U7QA 4FILA 4WNAA 3ZK7A 2OV3A 4MX8A 1M1YB 2XQVA 1MIOB 5CX1A 4DBLE 4ND8B 4MDYA 3MFQA 4PAGA 3ZKAA 1G21B 3MD9A 4HMPA 4WNAB 2Q8QA 2XH8A 3AETB 3LI2A 3UJPA 1K75A 4UDOA 4MO9A 5M3BA 2XDQA 2AFHA 2M6LA 3BE6A 1L5HB 4GICA 5M2QA 2XV1A 5GGXA 2XUZA 3BE5A 2PS9A 3K1AB 1K7SN 5JOQA 3HXPA 1MIOA 3ZTTA 4G07A 4ND8A 2MINB 5AFSA 1N2CB 1G21A 4UTOA 2PS0A 2OV1A 2XY4A 1FP4B 3AETA 5HDQA 4FI3F 3TEFA 4OXQA 3EIXA 4INPA 4NNPA 5B58T 5BVHB 2OGWA 3AERB 1G20B 1N4AA 3ZK9A 3AEQB 1L5HA 1KAEA 1QH1B 3AEUA 3PSHA 5CR9A 4LJSA 4TKUB 3K1AA 2X4LA 4WESB 5FLYA 4H0FA 2QI9F 2PHZA 4BBPA 1XVLA 2WI8A 2MINA 3AEKB 1N2CA 4HN9A 3PSAA 5JG7A 5I4KA 5JJ5A 1QGUB 3AEUB 5JPDA 1M34B 3MWFA 4WZBB 1FP4A 1K2VN 5HX7A
chains in the Genus database with same CATH superfamily
4O2RA 1H0HA 2H8KA 4XQ9A 3HGMA 1RXVA 2HMYB 1RI1A 3UYLA 2FCRA 4DZRA 3WJ1A 4M1EA 1KE1A 3ON5A 5HRUA 2VBIA 3ZWAA 1RWBA 1EHCA 1ONOA 4BC0A 2INGX 5KYWA 5ERYA 1SCNE 2LVBA 1QAQA 2PSFA 5IH7A 4RF3A 3EZYA 1MMFB 2SKCA 3BH7A 3G2OA 3HZHA 5ITZA 1DCFA 1GNTA 4NARA 4UDNA 2O2HA 5CAEB 2E2WA 2QE6A 1FDUA 3L7AA 5FR2A 1HZZA 1Z29A 3P2JA 4JUFA 5BV0A 2QX4A 4B7UA 2G71A 5CG2A 3KVNA 3UKDA 4YJ2A 3ILVA 1L5QA 3BSWA 3OJCA 2YMPA 1T10A 2HADA 2VQ3A 1H1LA 2BFEA 4JC4A 4NFLA 1SU7A 4PV7A 4UU0A 4KBYA 4W4TA 3GA7A 3C98A 3HLYA 5A5GA 1CR1A 3SZMA 3D6AA 1B0UA 2PV7A 4ZC1A 5LQSA 3RUDA 4BNUA 1L0BA 3FFWA 2HJHA 1JT2A 5G4KA 2BHSA 5H81A 3WRYA 1DKNA 5HYVA 4PBSA 2Y1OA 3K0AA 2C7QA 1P2SA 3BXEA 3EG9A 3QVGB 4BMZA 5EJGA 5CA1F 2UUCB 1E1QD 1YB5A 2HA3A 2O4UX 2VTEA 2BBTA 2NZ8A 1LVGA 1M9NA 3JQGA 3OTIA 1YF3A 3DUWA 4R54A 2CVZA 2VEOA 2ONZA 1VJRA 4FN5A 3EGXB 3ROGA 3BWCA 2BOVA 1C1YA 3O4IA 1EVQA 2ZREA 3TKYA 4BNLA 1Z4IA 2B4RO 1P4SA 4A27A 1YFLA 3LZ6A 1GL7A 1JECA 1R12A 2IEAA 3JVVA 4IIBA 2OFFA 4CDNA 2JFBA 3LCMA 3T12A 1QFZA 4CDRA 1I32A 4IIFA 5F5XA 2C3MA 4HEQA 4ZD6A 3SGLA 4BU0A 5B2EA 5KJFA 4HWPA 1ZN8A 1X13A 2HSGA 3WBJA 3QE9Y 1OI3A 1NW5A 3AIMA 3ZKAA 4MCHA 2RGEA 1L8AA 4HRVA 3W5JA 2IP1A 3W3AA 4J91A 3BQ9A 3JARB 5CRIA 5CHEA 3ZDAA 4G4SO 3HBAA 1YZUA 2EL7A 4IUBS 5LZ5A 2B1GA 3RWOA 1DCTA 2FMTA 2ECFA 2IIQA 3FNEA 1SD2A 2Q28A 4JB3A 4X44A 2A0WA 3TW8A 3FOCA 3VV3A 4C0BA 4E07A 4EJ0A 5J4HA 1W8DA 4ZO7A 4LFBB 1E79D 3ETHA 2J6IA 3JWGA 5DWQA 5FBWB 3O4GA 3B85A 4AMGA 5F12A 4CMEA 3FVWA 2Z6QA 4DFDA 1VL1A 4BDTA 5F9HA 1ZSYA 5FBRB 1FSGA 1TUBA 5KTOA 5CCBA 1HETA 4HK4A 3EDCA 4KNVA 1NVWQ 1ML4A 3DLPX 4ABYA 2O2XA 5ITWA 2AG6A 1DTWB 1LTHR 1E9VA 2ZUBA 2BFWA 4TTSA 4B6GA 1S7GA 2YVKA 3K05A 4ACBA 3ZCSA 1QZUA 2JLRA 5IKMA 1RC0A 2II6A 4YHBA 1REQB 1VBNA 2UYHA 3P9QA 1WQ4A 4GWKA 3NIGB 3IGFA 4P7KA 5IAKA 1DAHA 1MP0A 3MXTA 3VR3A 1JFTA 3VU9A 1EVIA 1QFSA 2HC9A 3AQIA 3NP7A 1RBMA 3QPBA 3L6CA 5L6LB 1LPOA 2NZUG 3Q2IA 2XUIA 3D6MA 4GFDA 4I4NA 1J1IA 3W5CA 1EGAA 1CIVA 1NYTA 2FPOA 4FJ0A 2FTKE 5DHTA 3WDKA 3DM9B 4YTEA 4CHTA 3VNUA 1BAPA 4BQNA 1EZZA 3FCUB 1DLJA 4IKPA 4X20A 4BCDA 3B1FA 3T94A 1K8QA 2HPAA 3OIUA 1ZCJA 4JSTA 4HD8A 1P19A 3OZXA 5T6BA 5FI0B 2F4NA 5T4HA 1R27A 4XASA 1OQAA 4MQFB 5AJZA 1XCBA 1OFUA 2ATEA 1MZPA 2YVUA 1UKAA 3L4SO 1VBFA 3L0ZA 3D3WA 3PDHA 3RYHA 1VKRA 5LA6B 5HOEA 4NV1A 4HAUA 3ZXXA 4JP8A 5FT9A 1JFSA 4E1AA 4XDHA 2JIRA 3OFSA 2VXCA 5EG5A 3OPYB 3Q72A 5JSQA 1QE5A 2JCGA 2FPXA 2JC3A 1TADA 2L18A 3P4YA 2O8VA 3RVOA 2NO5A 2ZRHA 3SBOA 3VR1A 4H0CA 5JC1A 4HGPA 4XSHA 1BO6A 1XZBA 5LFAA 3RIEA 2RGXA 2ZT8A 2IIPA 2X13A 4RELA 1YSCA 1EFLA 2BEKA 3ECSA 3M89A 2AK3A 4GX5A 3R7LA 3VXKA 4BNTA 4BP3A 3TRKA 1I3CA 2G28A 2GVNA 3M82A 3UMCA 4Q7QA 5L8VA 1IY0A 3JASB 3PNKA 2HF8A 4HPJB 5GPBA 3VDNB 4RCYA 4YQYA 3K9GA 1KXZA 1KSJA 1U3DA 4GRAA 4MVJF 2F17A 2WABA 2VYVD 3BERA 3B82A 3EFOA 4GVPA 5AKKA 4CIXA 3OD1A 1CNFA 3FYUB 2CCKA 4C7XA 1N2CE 1R5OA 1XAGA 3K30A 4YACA 5IDQA 3V2GA 2RCNA 2NU8A 3REQB 5IPFA 3DO8A 5SYAA 5JCJA 5C34B 1KS9A 3INYA 3NHBA 2ATCA 2B4TO 2A9FA 2R6R1 3RVMA 1AQNA 3VZCA 2CDBA 3MHPA 2HJVA 2OO5A 1H5NA 3OLCX 1Q0LA 4YJHB 1T4MA 3F6CA 1R18A 4PTLA 5DHPA 1E4VA 2NUAA 4KX5A 3O8QB 2N75A 3JAKB 1ZG3A 4DPMA 1ISJA 3ONVA 1AC5A 1CZHA 4X62B 1NW6A 1O95D 1WKBA 2HU2A 3GLIA 4M3NA 2BMDA 2VPPA 4WRRA 1YASA 4G0YA 5CXSA 4KXQA 3MQFA 3O03A 3RSGA 3O93A 3PFWO 3B70A 2SICE 4EFDA 1X9HA 2NWQA 3EXFA 1R8SA 3OFVA 4ENRA 1J0BA 4BKOA 4CETA 2ODTX 4UHJA 4F11A 4B3JA 4JYCA 4BAGA 3PK0A 3RGGA 2D5AA 5BYKA 4U6NA 1DO8A 2AW5A 1CY7A 2I7DA 3GNQA 4BFTA 2F8MA 4QREA 1GU1A 2HA0A 3QM1A 3N58A 1J5EB 4JBHA 3B6IA 1RWWA 1VSVA 2Y0DA 1C30B 4FDLA 4HXEB 3ZE7A 4DHWA 2XCUA 3MWJA 5EJ4A 1DJQA 4PZ9A 5KJ1A 5KAPA 5CFZA 4UHHA 4M1KA 1J6UA 5EINA 2IPMA 1MAVA 1NDQA 3KAQA 4RD1A 3R74A 2XHEA 1E3WA 3CGGA 4G5QA 1OXUA 4CPDA 5MN4A 4ZDWA 2YVQA 1CP2A 3AR9A 1QX3A 3DZCA 4K6HA 4WY8A 1JX6A 2V6BA 3Q3JB 4HH4A 1X77A 4JR0A 4MQ6A 3B7GA 4BKQA 2W6CX 2CJXA 1IZ7A 1Z17A 3LBYA 2JD0A 4MWOA 2ANCA 4QIHA 4UHKA 3DBLA 3SNKA 3K9LA 3WMGA 2ZPTX 3ZDEA 4ZYUA 4QOHA 3SC6A 2DF8A 5J47A 2VUIB 3VR4H 1U28C 2JGNA 4OOFA 2EBFX 2Q49A 4C05A 2FE1A 1JE0A 2R9VA 2GLTA 3KQHA 2C3PA 2E5WA 3L01A 3M49A 5MHTA 3IUPA 1QQTA 4W5HA 1AM4D 1OXSC 1V43A 5C3UA 4KXVA 1O8CA 2DLNA 1B1CA 4P7FA 2NU9B 1KJNA 3E3MA 4TMKA 3PZBA 4XYEA 2C7VA 1ZCBA 1QKJA 2JB9A 2APJA 3BXGA 3ZDCA 3IX7A 1QLWA 3KZVA 4Z1MA 4CG3A 4FFVA 1I6KA 3LT4A 3RU7A 4QJBA 3MT9A 3PXDA 2J32A 3A9WA 3EB9A 2KS6A 5DJ5A 5ERXA 1PBNA 4I36A 2FETA 3JS5A 3LW8A 1CY8A 1S8AA 2ORED 4MZDA 2JLSA 4C03A 5AW8A 1X7YB 3DOFA 3T3OA 1Z73A 2E1RA 4TV9A 2IUSA 5JY6A 2DR0A 3QEMA 1G66A 1ICIA 4D8VA 3Q9UA 2BCGY 1N2JA 1EXMA 3DHNA 4JB0A 3SVLA 3CH4B 3KZOA 5A0VA 2JVIA 1N9KA 2D0OB 2VDOB 1HDOA 4JJ8A 3RS2A 2J41A 4RD4A 5FWYA 4F60A 1CRWG 1ABBA 3CR8A 1QYWA 2YX1A 1JR3A 3DEKA 3W4IA 4C4SA 5DNCA 1FJXA 5F98A 5IWAB 3MC1A 5BSRA 3BXPA 2Z58A 3OF3A 1XNGA 1I5OA 2H54A 5IJAA 1PZEA 1YDEA 1P0FA 3DEAA 3LCRA 4AUMA 2R6HA 3RC8A 3BBPA 4H08A 2MSEB 4DJEC 3K1ZA 3B12A 4WNAB 2W2LD 4JI0B 4GKKB 2Z2KA 3HUEA 1YHNA 3BT7A 3EZ6A 5TT1A 3UT5A 2GM3A 3WGKA 4IAOA 3GJYA 5DMXA 3U5TA 2FQQA 2G17A 3WADA 3PJFA 1UADA 1BWSA 3SPXA 3PNBA 3SQWA 1CDEA 1B41A 4PC6A 5DGIA 1JQBA 5GIPE 5IZCA 3N07A 5GM2A 4BFLA 2I4OA 3ND8A 5JOQA 4FLEA 2DYKA 1WCXA 4RX1A 5JQGB 3ZD9A 1D8AA 3S8YA 1A2KC 3M1YA 4GLBA 1YZKA 1QP0A 5ARCA 1NR5A 2ODNA 4E5MA 4LQCA 4Y2XA 2WDZA 3LHKA 5FBQB 2ZYRA 4BFXA 3L8YA 1RZ3A 2O8EB 4QPPA 2G63A 3SXJA 1A1VA 2J6HA 4C1BA 1U8FO 3GFGA 3S2GA 1WZEA 3TQFA 4BVEA 1WXEA 1C3OA 1D2NA 4TRNA 1TK3A 3KP1A 2Y05A 3QHAA 4ROSA 4YRSA 3O7MA 4RMIA 2GNOA 3HO6A 2BZSA 4UAJA 1ZH0A 5E1DA 3AFNA 4F45A 2QMYA 3QFTA 3KU4A 2AN9A 3HWRA 4Y9SA 1J24A 3M6FA 3R6TA 1SCQA 2XECA 1EFPA 3E0QA 2J85A 5FA6A 2SECE 2P35A 3CG0A 4FNMA 5FUBA 2I6GA 5LDGA 4Q12A 2A30A 1CVRA 2C7GA 3FOAA 3QBEA 3OT1A 1LY1A 1C14A 3TVYA 1K3UB 1R0BA 2NVUA 3DXZA 4OFXA 1PWZA 5DX8A 4E2YA 1S89A 2EIXA 4OGGA 3JZAA 3K73O 3PCXA 2W6OA 4LFCB 4IOJA 4HAVA 3I9LA 2UZ0A 2XTNA 3CPJB 5WRFA 3FTNA 4MHTA 2BUBA 2QTFA 3UUGA 3M6MD 3KUXA 1AT1A 1MJ5A 3MERA 4QXMA 4UREA 4NZMA 1Q7CA 4BV3A 1H6AA 5EP4A 3LQ2A 4EHDA 4CLRA 4AVYA 3GQVA 1HX7A 3DVRX 1WABA 3ILHA 3MELA 1H9BA 5BUCA 4KXLA 3PA6A 5B3JC 3A32A 3H5VA 3RYIA 1SC3A 3NUQA 4PO3X 1NFQA 4AICA 4UDYX 1DWPA 3E48A 4LWPA 4UUQA 4PO1A 3IAS6 3OZAA 4YRAA 1CUDA 2FFHA 3DWIA 4UPVA 2M1XA 2C3OA 2R60A 5BN5B 4ERXA 5BMOA 1PJRA 1IQUA 2BM1A 2WC1A 2OO3A 2QM0A 2GSDA 3K16A 4DNPA 3H5TA 1OZGA 1XCPA 5U1PA 2YYSA 3QPCA 2I6FA 3K1YA 2D4HA 3KSMA 1NN1A 2I4TA 1QH8A 1VKHA 1OLOA 2XDAA 4D4MA 1M1NA 2P1DA 4DRZA 4UTPA 1OXVA 1U90A 2AN3A 2ACEA 5D01A 1I7SB 2JLVA 4Y9UA 3S7TA 1XDSA 2O0JA 3DFZA 3WKAA 1F38A 4Z4FA 4B9AA 4WCVA 2LWIA 4FS8A 5CLFA 2GBFA 2HDHA 4L0CA 3SHTA 4I9UA 3GD5A 4PXYA 4DQKA 1KYQA 1O9BA 2WVGA 3JQFC 4BN5A 2PT5A 1CFZA 1FYWA 1N5IA 4KHZA 1C1HA 4COOA 5ALZA 2AI3A 1JU3A 3K9FC 3K4QA 1QAOA 5HIKA 2EHDA 3TZBA 1X7DA 2Z08A 2ON6A 5KDOA 1T2DA 3KPUA 2YWGA 1TPZA 3WO1A 1PS0A 1UBTS 1FSPA 5CT4A 1WDMA 3FMIA 1Y5NA 2FW1A 2G4VA 3ESZA 3BGDA 5FWXA 1G8SA 2H48A 1B8OA 4Z0NA 5IVPA 5C9ZA 1Q0PA 3KQPA 3JSXA 3NAGA 3PEEA 3WP0A 4OB6A 4Y1EA 4ND6A 2JFGA 1GCOA 3AR2A 3L7JA 4HC4A 5BMVF 4XW2A 2PKQP 2VJCA 1LBTA 3OSZA 4FT2A 3P9PA 3C6ZA 4B43A 3RDPA 2GXSA 3HXTA 3IAUA 5IDVA 3NVDA 2IDKA 5GZ1A 2YN2A 3IBSA 5IZ4A 3L8HA 4ZO8A 3SQOA 2OCDA 4M8KA 2ZQYA 3DFFA 2PH3A 2R2AA 3KQQA 5INTA 1U63A 3WK9A 1T3GA 2OFXA 3E0XA 5BV7A 5CBPB 3NVMB 1IJKA 4C0SA 5H70A 2ZT7A 3OQIA 1XXHA 2QQEA 1SY7A 4QBKA 4LJKA 1G9TA 1TTTA 3FYSA 1QG4A 5F76A 3TN7A 5BRAA 4Z7NB 3D8TA 1K98A 1TA9A 1ZA2A 3QLUC 4GWGA 2PM8A 2ZRCA 3QJ5A 3RV4A 4NOLA 2Z2YA 3MQ4A 1IK6A 3GWZA 3MIZA 1P5JA 2WPDA 4QBFA 1FFHA 1DX9A 1ZJ6A 3LVBA 2H2AA 3AF1A 5IJXA 3W3ZB 4P1ZA 2J67A 1ZL2A 1BH2A 2ZE8A 2ANBA 1QQ6A 1I4DD 1O95A 3R3HA 5AXBA 1Z45A 1E92A 2X58A 4JI6B 1LC0A 1RFLA 2YV3A 2Q4RA 1KFJB 2WLSA 4RE5A 1XX6A 2PSDA 1EUDB 2FZLA 3AIIA 4MEJA 4X6XA 1MXHA 4O25A 4C76A 2Z6AA 4YS6A 1M2GA 4RIIA 4PX2A 1YH3A 2RH4A 2BFNA 1DIGA 1I4OA 4MW5A 3S27A 2PT9A 3Q3CA 3ETLA 4G25A 4OMFG 2DUWA 4RA6B 1DAOA 5JCOA 5HCNA 4PVDA 2WAYA 5DM1A 5C8XA 3E1GA 4PPYA 4ZPXA 5FA8A 3BIFA 1GLGA 3P0HA 3U9SA 3TLZA 3HB5X 1Q6ZA 4Q37A 1BS2A 2OORA 1N78A 1QORA 1GCUA 4B82A 4YMGA 2XWQA 3WNQA 2PG3A 3ZY2A 2W22A 1SCUB 5FPQA 4UEWA 3PDJA 1FFGA 3UK1A 1KVQA 5LU9A 5D5PA 1DDGA 2LDBA 5CITA 3OJFA 4QXPA 3H17A 1ZVJA 4OJNA 3T1NA 5KQMA 2QW0X 2FWNA 3NYIA 1EXNA 1GO2A 4NH0A 4B4WA 4UE3S 5E6SB 4CKZA 1Y34E 4IEIA 4MP3A 3UCXA 1OXBB 4DVGA 5JJIA 2I2XB 5I5GA 5EZYF 4AO6A 1H2AS 1W44A 1AA6A 1F2TA 1HDIA 2QXTA 2A4KA 4A10A 1NBME 4BAZA 1P91A 3RS4A 1RT9A 3OMWA 4IXWA 5GMOA 4AM8A 3TJRA 5CA1B 3HM9A 4DGQA 1BHQ1 2Z9CA 3IP9A 3UEOA 1C3VA 2TMKA 3D8HA 1SHLA 3N39C 3AP3A 4X45A 5B4TA 3EGDA 1JIIA 4W1SA 3ONFA 4NBWA 5J2UA 2ZJ2A 1MQSA 3P9SA 3FN4A 4RESA 1PCXA 3ET5A 4QU5A 3SDSA 3WFJA 3MMZA 5DXFA 2Y4NA 3AVTA 1R0LA 1NUPA 1X19A 4CT4B 4XQEA 3CUEF 4XWYA 1JA9A 4ZI7B 1A8SA 5A1TA 1WBDA 4PPFA 2HLNA 2W2QA 3AHHA 1B74A 3ABRB 3K09C 3TIFA 1XZIA 4I5EA 4KAFA 3V8NA 4AULA 4OM8A 1EQAA 2VJDA 3LLUA 5TARA 3S0JA 1NUQA 1E1CB 2PO5A 1CUBA 1A9XB 1ELOA 2HIAA 3T52A 4EABA 5ALJA 5B58T 4PGMA 3C3BA 1T9AA 4UD2A 5KNLA 4J07A 5CB0A 2HU5A 3I5MA 5T64A 4L2IA 5HGJA 1DJPA 1UK8A 1GJRA 3TI7A 2IKSA 3OPYI 3U60B 1FC0A 4NENB 3SSOA 2PGNA 1CYEA 1V9CA 2D1TA 3QOFA 4K9SA 3A70A 5AVZA 1A8UA 3EGVA 3LNTA 4WY2A 2A9RA 3V48A 4X8HA 4M9RA 2CK3D 4L8LA 4RF4A 1GRQA 3B53X 4TTPA 4HYEA 2A9QA 2WAMA 3KJQA 1OPXA 2P3SA 5IJWA 5JNWA 2F67A 1U6IA 2W2LA 4IIDA 4RQBA 1LF0A 1F2UA 4AT1A 3PIIA 3VOBA 3RJMA 2RK3A 4UU7A 5JRDS 4KMMA 2W70A 1Z2EA 5ED4A 3GZ4A 1QYXA 1G59A 1XO1A 4QU9A 3TRDA 4CMKA 1COZA 1IUOA 2C78A 2EAUA 4II3A 2DY1A 1SUWA 1YL6A 2EW2A 4QPZA 4YRDA 1G8JA 1YIOA 4MPRA 4WZBA 9LDTA 1Z0AA 3GZNA 2QZJA 4KWIA 5I9MA 5G0TA 4M1OA 4EPRA 5E95A 1OBVA 5ILQA 1U8YA 2KX7A 2Q5JA 3HN6A 3N0VA 1JJBA 1U3VA 1LLDA 4MJXA 1LS1A 4HRAA 3VYVA 4WHMA 3RS9A 1E2JA 4WCFC 1JEEA 1F0NA 1PK8A 3U4GA 3WA7A 1RJEA 3HMKA 4CTMA 2BI4A 1XMQB 1KDVA 4Z9XA 2P62A 1SD1A 1YOVA 1BX3A 2ZDGA 3HNPA 4P92A 4C7OB 1J0DA 3U26A 1JBEA 3GYGA 1M2FA 3WWPA 4DKXA 4YT8A 4H1WA 4D6YA 5B3JA 4H4CA 2P5SA 3M6WA 3P2MA 4ZA2A 3IULA 4GI3A 2G80A 2V5UA 4IUDS 2YQ5A 5KYYA 2VN8A 3QRWA 2NSLA 2AZDA 3VJKA 1UK7A 1XRNA 2GF0A 3A6JA 3C6BA 2RGWA 3CMCO 3H84A 3IQWA 3WGGA 4A8TA 5K0SA 1Z4NA 1Y3FE 3G79A 1SOAA 4B71A 4C3OB 1LI5A 1ENOA 3ZYZA 4YRTA 4Q48A 3RVSA 2FR8C 1KMMA 4XLZA 5U9CA 2DXIA 2YJTD 1VP9A 1T0JB 2W2MA 4GH5A 1JG3A 2DCMA 4IIJF 4M0MA 4LGCA 3M6LA 4WINA 3RIXA 4EKNB 3NIDB 5A3RA 4DWOA 1QFMA 1XL1A 4ALLA 1ZISA 2VH2A 3COJA 3W8EA 1GYQA 3A7EA 3EZGA 3RRNA 3H87A 3S2YA 4WASA 1TVKA 3C3PA 1T9BA 4TT8A 3UG6A 3H11B 2Q3FA 1K7FB 3DOEA 4PC1A 5BSUA 4DJTA 3G2QA 1DMRA 5IJ9A 3DG9A 2QVCA 1EPUA 4JB8A 1EM6A 4KQJA 2GQ0A 4DR3B 1MN6A 4U63A 1A96A 4LJLA 2ODWA 4KO8A 2B3TA 3VU3A 4EGQA 1YMUA 2LDXA 3U4QB 1DXYA 2A1TS 1PG2A 3TNDA 4ND8A 2PGLA 2KLBA 3ZHVA 2HPVA 2X2PA 3CT6A 4LF4B 1T29A 2H0RA 3NATA 5KC9A 1GGFA 3IQZA 1M8KA 3KYBA 4TROA 3LBIA 1KC1A 2VA8A 4IIGA 1HFJA 4KV7A 4YAJA 1XN4A 2B82A 2I3DA 2AR7A 3FGZA 1HE2A 3O6VA 2H6EA 4H7PA 3T5BA 1FJ2A 4EQ6A 2B5OA 3LUCA 4R31A 4R5HA 4XX1A 3HWSA 2V7GA 3GIWA 2DETA 4JL8A 1XCOA 1ZM4A 4FQ5A 4Z9FA 2GMWA 2WHPA 2L0XA 3V7FA 5D7BA 1NW8A 5KKCA 1YJ5A 2EFGA 5B1SA 3LAWA 5I9LA 2WJGA 3D2CA 1QONA 1HNWB 1ES9A 2Z8XA 2VBGA 5GIOE 4FFRA 3EOZA 3M6XA 4RKEA 4F2PA 5DFAA 1FP4A 2DKNA 1ATIA 1IOWA 3EIOA 1OGYA 3IFSA 2PBFA 1J1ZA 4EA7A 4QKQA 5A2QA 5F1KA 2XE7A 4GQAA 3C3EA 3T9EA 2XZPA 3ENVA 1VHWA 2Q0QA 4WKCA 3UO8B 3ROZA 2HQSA 4EGJA 3TI9A 3U09A 3CLRC 4RM3A 4D0LB 3DWFA 4GI7A 2ZIEA 4NFHA 3VR6D 1E89A 4FXOA 2DKOA 1MDFA 2X0KA 4LXIA 2CKMA 3H1PA 3ZXIA 1UOEA 3ZWXA 3NALA 3H75A 3HZRA 2UU9B 5C5DA 4CLEA 4L08A 4PLPA 1Q95A 3TVTA 4DMRA 1GTG1 4YH1A 1TE2A 1FTSA 4AXBA 3Q8MA 2BTEA 2LNDA 3ROPA 1UKZA 2FHSA 4MI1A 2DBZA 1AG9A 1QQAA 4Q82A 5CVVA 4JLUA 3H65A 3OZDA 1W47A 4D1YA 5C4IA 3C8MA 3E2PA 1F9EA 3I5AA 5IANA 4K0RA 3HKEB 3LDHA 5AIAA 3EVDA 3HVHA 3TH5A 3WLTA 2RI6A 4B3DA 3GZJA 2Y93A 5EHQA 4Q1BA 5JT1A 3O47A 1TU0A 2OXCA 3U3KA 4RTKA 1TQHA 3GZTB 5H83A 1NYLA 1SWWA 2V4ZA 5ALGA 5TV2A 2ZJ8A 4D80A 4JJKA 5BWBA 3UWMA 4WN9A 3S44A 4RTQA 3C6XA 4E5DA 3N8KA 1WP9A 2OHJA 1LEHA 4FYHA 1RHJA 2G9VA 2IEBA 2QTNA 3FR8A 3TZLA 3TLBA 1D5WA 3RNOA 4H6XA 1GRRA 4B3BA 4ER3A 3MWYW 1BGXT 2OV3A 4QM6A 4QVKA 5JC8A 4OHUA 2F1HA 5DI9A 3T7EA 4PNEA 3R7FA 2ZYHA 2VXBA 2WILA 3KZ1E 4JELA 5CNJA 1X7WA 1MH9A 2JGRA 1ODIA 2HWWA 5AM5A 4KQGA 3WJAA 2IBTA 1DQNA 5BO5A 1PR6A 3Q6IA 3R7AA 1E61A 2BUAA 4YCNA 1U5BA 1BVHA 3N2GA 4ICIA 2DHRA 2YHUA 3FJ1A 1QIKA 4LX8A 2ZAOA 4FYMA 3LRPA 4KIJA 4QU8A 3SE0A 4AJEA 1XAIA 1XYGA 2EGUA 3A1DA 5IF3A 1H4SA 3RROA 4MS3A 1T3SA 1W9HA 3LYAA 3NHAA 3T9DA 4RTRA 2R6AA 1KSFX 3O8OA 1DIHA 4H7JA 4YWJA 2J5BA 5DTIA 3AETA 2PLRA 1SU4A 2H00A 2NP6A 3H1GA 4IBOA 4ENVA 3M1AA 4PLTA 5FWNA 4ZVTA 4GZLA 3V2UA 5IBPA 1UBJS 2QGFA 1IPEA 2RBGA 4L57A 3QYFA 1Z5ZA 4A1FA 4QFMA 5CDGA 3D6HA 2HLDA 2NPIA 3CXUA 3HGTA 4YO8A 1QWSA 3TB4A 3PHIA 3DBOB 3JVDA 5JS6A 2Q6TA 3JQQA 1MAUA 2Q5EA 3OZUA 1AK1A 2R4UA 2BD0A 1TKCA 1P2VA 2HRQA 1YKSA 4FDUA 3A6GA 4Y7DA 16PKA 3IOMA 4LZJA 5DGTA 2Y9PB 3JYPA 4Z7JA 1MVLA 2WAXA 1BDIA 1YGPA 3ORQA 2GN2A 3NC4A 1H05A 4MS1A 1QXSA 2A9KA 2AFIA 2D8MA 2XAAA 3QE2A 1GOTA 2EBWA 4PAOA 4W9NA 1T0HB 1E1RD 1MLDA 3B1KA 5CM2Z 5KVAA 2GKOA 1HYEA 2PXXA 4FN4A 3V8VA 3U4HA 4ZAXA 1KR5A 3UWKA 2QG9A 1JSXA 2QN6A 3R3SA 4WZAB 2P40A 5JDCC 4XE5A 2I8LA 5G0UA 3DOJA 3DVLA 5JJBA 1BW9A 4RK0A 4AIRA 2AJBA 4GLFA 3RH0A 4KR6A 3EXEB 1VJCA 2H4XA 1WUTA 2C4TA 2CLLB 2EJTA 1PJ4A 2VF4X 4CM4B 3SQXA 5DGHA 4PX5A 1PL6A 1ZNWA 1EZ4A 1IBSA 1NVAA 1JALA 4IEFB 5CFNA 4KR3A 1ZWKA 2RHGB 4GYYA 4LBZA 3B2NA 2WU3A 2ZIAA 4IVQA 1L5KA 5J4LA 4DSZA 4LJ4A 2B20A 2HGZA 5F7XA 1L5VA 2WG2A 2C42A 1MC5A 2ERCA 3HBFA 5IAGA 2X9GA 5AR1A 1MRZA 1ZRSA 5BYJA 4B6JA 5BOVA 1OC2A 4HYTA 3LG2A 1L7RA 1AZTA 1PDVA 5H1YA 5BNWA 1HFKA 1DOAA 2HEGA 3OUUA 1QZXA 3B1VA 2CK3A 4M0UA 5DLDA 5IM4F 1WPXA 3OEED 4PG6A 1JFLA 1S7CA 3A1WA 3AP1A 4TV8B 5AJXA 1P4JA 4F04A 1WOMA 3F9CA 3N3AC 4Z4CA 1NP3A 1HWYA 1DUIA 2DWPA 2ODAA 4I4TA 1TUGA 3MB8A 4W6ZA 2ZWPA 1ORRA 1P9NA 1RM5A 1OAAA 5EJMA 4RK5A 1JMYA 2PLAA 2ZDHA 2HX1A 3D4IA 5HM8A 1H4QA 3FY4A 5DX0A 1E5VA 5CP8A 2J33A 3W6NA 1DBWA 1FP7A 2IIBA 2JCSA 4J7AA 1X7ZA 3EH1A 4MV7A 5EQTA 4WPGA 3D6TB 4A73A 4CMCA 4FBMA 4BNKA 5LD2B 5KTKA 4LRWA 5CX4A 5F3RA 2GR9A 1FDVA 1NASA 4OU4A 1NW7A 3D6VA 4DW8A 5IU6A 5K2OA 4X84A 1Y5RA 3K31A 2CZCA 3A9UA 3AOEC 5A3QA 4J43A 2C61A 1M6NA 1RHUA 1DBPA 4NOMA 1RABA 5JIBA 1RACA 4H3VA 4FYWA 3HXPA 4G8JA 4BX0A 1VMEA 2IJGX 4H16A 5TPZD 3JYHA 3OQ6A 3REFA 5KYKA 1M54A 4EX6A 1LC3A 1A95A 1DADA 3D81A 1B0PA 1EHYA 5KYGA 2LBPA 4YJ2F 3O0TA 5J2TB 1JLLB 1ZDMA 2JANA 2NO7A 4U5QA 1KERA 2WWWA 3T5MA 4AQYB 1J99A 1G16A 4NYIR 1J22A 4I1RA 5FOQA 1UJCA 3GQBB 4LTMA 5GOZA 1QP4A 4KUGA 3A9TA 4LDQA 3ZBUA 3LSTA 4HQ0A 3TZEA 5CA0B 1GPMA 4IVNA 3IVGA 2F8LA 2V8OA 3OZGA 4FE4A 2RK6A 4PPGA 5FLYA 1QX4A 2IQ5A 2B61A 4N7RA 1MB0A 2C5GA 3HCPA 3KXPA 2J5RA 2PGIA 2A7QA 2QBYB 1CETA 1JQ3A 4I6EA 1ULTA 1Q1BA 5BMVB 3A1FA 5D6NA 4DSNA 5F5NA 4X64B 1XZLA 2CEAA 2H2IA 1BQ3A 3E4DA 1UPFA 2UZ1B 4RDHA 3BFJA 3VU0A 3UC9A 5K3CA 2Z56A 1I7NA 2IXEA 4XIYA 2OQIA 1CXZA 1JDBB 3OA2A 3RAPR 5KSPA 3IOYA 2HHAA 2WZBA 4G0MA 2QJRA 2JLAA 4Q4HA 3QOYA 4Q4LA 5EKUA 1IJEA 1J0XO 4TS9A 5EXXA 3UJ9A 4CN9A 1JKFA 1VLLA 3E3AA 2R25B 3DWGA 1HSZA 3EEBA 1RM4A 3KELA 3UK7A 2JI8A 4QBTA 1XZGA 4MMZB 1ZMXA 2BDEA 2RKOA 5LNK1 1KSHA 2E85A 1FTQA 1ENPA 1QZZA 3CF4A 3DE4X 4TYPA 4GL2A 3RRXA 3INNA 4QGAA 1NJGA 5DLPA 4LVCA 5KOJA 4JITA 4NE2A 3M4ZA 4HNRA 4QO7A 2L69A 1N9ZA 2PTHA 1RAGA 3BJEA 2JLCA 4GPEA 1W9MA 2A5DA 1YZFA 1CJCA 1LTQA 5HKAA 3OJLA 2ET6A 2PS1A 3X2FA 5JH7A 3KJZA 1PX0A 1NOJA 1UT6A 3IMGA 4GECA 3ZU6A 4M0CA 5JYEA 3BH6A 3TRFA 3BRSA 2A9OA 3Q3HA 5K8CA 1DEKA 4JQZA 3RJZA 3VKFA 1AKEA 1YUBA 1JJ7A 1RRKA 1V3TA 1K6IA 2MYUA 1MV8A 1YRBA 4EVIA 1L1FA 4TKVA 1Y3IA 5C5IA 5CAEA 3PQ3A 4PHFA 3U3DA 2QQGA 3HCWA 3WHIA 1PL8A 3ZE9A 2IYEA 1WZNA 4XWAA 4XVCA 2AC7A 2BFCA 4LISA 4TUYA 3VR6A 4L3WA 1FNDA 1LNQA 2P2NA 3OOWA 2W2OA 4B47A 1X87A 2W5UA 1DKRA 1I6WA 3C5VA 1GTSA 4QATA 2IYOA 3UAYA 2GYWA 3G8AA 4GXTA 3AFMA 2PUHA 2P7IA 1NNSA 4BHTA 3M4NA 4DSUA 3ABSB 3QNWA 4B44A 3CISA 5EXTA 4QEKA 1W8IA 3L46A 4AYTA 2FK7A 5I7VA 2GYUA 3LLVA 4CM8A 1OZFA 3NWEA 2GEKA 4Q1FA 3UANA 4RTMA 1GKYA 5DN9A 3LXUX 2ACVA 4E46A 4US1R 4ZIRA 1FRVA 3LL4A 1RJGA 4DV5B 1FP1D 4ZCRA 1IBLB 2FNAA 3BK1A 3FMVA 4Q3KA 3EX7C 4J0GA 4TZTA 4MWTA 1TW3A 1OXMA 2PX8A 2Q29A 3C74A 3QVSA 5EZYB 1JYEA 4BO6A 4TMVA 4MQEB 1JEOA 5HIAA 3W5SA 3W8NA 1JSLA 4R1NA 5HPYB 3NWBA 5CMLA 4Z0TA 1GUDA 2EGGA 2Y0CA 4ZVSA 2Q5QA 1GTMA 4PG7A 4FFMA 4CLDA 1Z68A 1Q1QA 4F38A 4AUEA 2ZRJA 4CIVA 5IHXA 3BFKA 1IWBB 4ZJZA 3X43A 2B4KA 3LUGA 2JFPA 5LMZA 3NRCA 3UH0A 4WAUA 5KVVA 3DZJA 4HB0A 2GAOA 3W6ZA 2GZ1A 2WB4A 5H7XA 1OI2A 5JAUA 2ZSJA 3RSSA 2WIJA 4KZKA 4YXFA 2HQRA 1T8PA 1L7VC 1XTVA 2JHAA 5G1PA 2W2TA 1NX6A 1UF9A 1MU0A 2IYFA 4PFSA 5FBHA 1CQJB 2O5RA 3BIXA 2V5AA 1K5DA 3N05A 1VLHA 3WLLA 2YH2A 3WFIA 1K7CA 4U7FA 2AVNA 4Y2TA 4HCJA 1XUOA 4PRZA 2WG0A 3N7TA 4NYJQ 4EY8A 4C0QC 1K7XB 3A6ZA 1PJQA 1GFZA 2FX2A 2Z9DA 1I2BA 4Q5IA 4MIOA 4P33A 2XTJA 2ALJA 1S8NA 3FVRA 4MZXA 4OP1A 4DCJA 4BRUA 4G24A 2FUCA 1DBVO 3A9SA 4ZEXA 4B6SA 2ODPA 3ER9A 1KARA 1T2UA 2FPPB 4R2IA 4CEHA 3LQ4A 1T2VA 2WJIA 3O83A 4P9NA 4RK7A 4UZSA 3DZHA 1ORWA 5EXPA 4IVRA 1QVVA 1CIPA 4OQDA 4PZYA 1CJSA 1H2RS 2QPLA 3AHGA 2E7ZA 3BE8A 4UTZA 4BRZA 1WU8A 3RKSA 4YYEA 1QC5B 4WDQA 3O92A 4KPFC 1P73A 5IEBA 5ICEA 5JDCA 5E6UB 3SWWA 5BSKA 3ZEAA 4LRUA 4Z8XA 5U4XA 2VCEA 4LRXA 3TXXA 4E1BA 4MPTA 2QRPA 5JALA 3LWZA 5MDHA 3W05A 1GQYA 1WLYA 1DAIA 4MR7B 3T06B 3CV3A 1EVYA 3JATA 4IVPA 4MVJI 3TSOA 2X5JO 4AZ0B 2H1WA 5LQJA 3DMPA 2VQFB 1XZPA 4OKNA 4C6SA 2IV7A 4UE2A 2QD5A 3DPUA 4FE7A 4DC9A 4TTAA 5AQ1A 1WEKA 3UAXA 3WV4A 4RYLA 5AVJA 1H8HD 1CIJA 2DBVO 3PPWA 5A9TA 1SUDA 1CHNA 2P67A 1KEZA 2I33A 3AJ9A 3B6EA 4ZTUB 4EUNA 1D6JA 4BO5A 1D1TA 4NIMA 4NZYA 4AJHA 4A6XA 3P9YA 2HZ7A 5AVOA 1ABFA 2VVTA 5EWJA 3ZOKA 3WRXA 3TGLA 1X70A 4FHCA 3BICA 4X0EA 3X44A 3JAMA 1FS6A 5FEUA 3HS3A 1AY0A 5CB4A 5LMNB 2EVWX 3FBTA 3P2KA 3WB2A 2H18A 3MFQA 2D5LA 4OHBA 5JSFA 2ZOSA 3G5UA 1EFKA 1I5EA 3WICA 4MDEA 2C98A 2CFSA 3ISTA 5FTLA 3DO5A 3WOVA 3RWMB 3IPAA 1V2HE 3FNGA 4MIYA 4Q18A 3RIHA 4JLBA 3D8SA 5ICMA 2R87A 2VJMA 1P9WA 5GJCA 4ECAA 5ABPA 2G04A 2C97A 1RBQA 1M33A 1EH5A 3HB1A 4JQSA 3FPBA 1YXMA 2EYUA 3G2KA 1Q14A 2HY7A 2UKDA 1P5HA 5AK3A 2ILVA 4GU5A 2CNBA 3LPCA 4LNUB 4QGGA 3TIIA 4UBIA 3R0JA 3ZCQA 5A3SA 3D5TA 1QO0D 3X0DA 5K0GA 4Q34A 5EWLB 4YV2A 4BEBA 1IN4A 1NMXA 1NSFA 1TVEA 2YJ5A 3Q0EA 4I55A 2J0EA 1WB5A 2ZUWA 4NNPA 1NI5A 5IWCA 3QKIA 1FF9A 3A36A 2ZM5A 2JRLA 4AU1A 2YWCA 2AE1A 1PHPA 1NMYA 2ZSAA 3EZNA 1TJ3A 2KWIA 3K96A 4MPPA 4E5VA 1RYHA 4HV4A 5JVDF 3NW9A 3Q98A 2B34A 1W5SA 1Z82A 5IW8A 3RS3A 3JQBA 3LBAA 4BUZA 3T99A 1P6XA 3EXHB 3OG9A 4YCJA 4A26A 3QELA 5FDFA 2CBXA 1MUUA 1SCAA 2RHDA 2XEXA 2XT6A 1V8FA 4QU0A 3RNLA 3W2FA 4EY4A 3A4TA 4X8MA 4TV9F 4ZYWA 4XWWA 3MWFA 2XVAA 3TAHA 1RD4A 3WGYA 3HKCB 1TA4A 4JUIA 1E6CA 5FFNA 1P2DA 5FB3A 3QPWA 3T7IA 2G9QA 2COKA 5DHAA 3U0VA 4I4CA 2OT3B 2AJDA 5LB4A 1G6KA 3A4NA 3E82A 1LZKA 1TVCA 5LP6A 4Y7CA 3UHPA 5F4ZA 4NNOA 1WHTA 2R65A 3THXA 4ZVOA 4ER7A 4X6UA 2Y76A 2CDCA 1VLJA 4ITUA 4B3TB 3TXAA 4H1VA 3LPLA 2V3CC 4KFTA 3RAFC 3P5SA 4U6QA 2UVPA 1Q17A 1KO5A 2WSLA 4LJ6A 3OAAA 3THYA 1ESNA 1TM5E 4GT1A 3I53A 3P7MA 5TPZA 1P29A 4CDGA 4EENA 3B2QA 3GEIA 1PL7A 4HX2A 2WIGA 1SMKA 1TCBA 3PHLA 1ZJ4A 4B8YA 2RMKA 1UFKA 1O6ZA 1VG0B 4HB2A 2YNMC 1Z6ZA 3NUZA 3PFIA 1E3MA 4MI6A 4RPGA 3P1JA 3ZWKA 1JG2A 2Q2QA 2XXAB 1K6EA 4HN2A 4NXMB 1XL0A 1CEEA 5K3SA 1G5TA 2J7PD 3SF8A 2CYCA 4C0HA 1JL3A 1BE1A 2P2YA 2Y1KA 2ZRKA 4H4EA 1OUMA 2BE7A 2JPDA 4MYDA 5AKZA 4ZAVA 2H2FA 1KVTA 4EBBA 1N0WA 1RYEA 3NB0A 4B4VA 2PAFA 4A23A 5TVGA 1RYZA 2AD5A 3KV3O 2VHJA 3H2ZA 2J1LA 5DVZA 2BFDB 4JVNA 4EG3A 4KO4S 4J1TA 3RVKA 3A1VA 3GI1A 3G2NA 1KZ7B 4F56A 6PFKA 5DSZA 1V16A 1EGMB 3DE5X 3IMCA 3NHKA 3U7RA 1KA9H 3EA5A 1UJMA 2E4UA 3JQCA 3S29A 3VMMA 3UJ8A 1NA5A 1RFGE 1S8OA 2G77B 2R8YA 3EVFA 2Y99A 4PYMA 3RIMA 3W7VA 3WLSA 1G5IA 1XNHA 3GNSA 3ICQB 2HK9A 2AMJA 1M0SA 2B7LA 3G23A 1WSBA 4L73A 3EDQA 4FGUA 4UMVA 4YVFA 4YA6A 3KKPA 3PKIA 1JEJA 4A8JC 4KAAA 1FYFA 1NX9A 3ZOZA 4C07A 5B58C 2FEAA 4JYMA 1U0JA 1U0HC 3U7FB 3QU4A 4A03A 3EIQA 4YAIA 2QE7A 1PDWA 3R5JA 3FUWA 3ROFA 4BQEA 2H4ZA 3GJ0A 1E8MA 2BCEA 5LJIA 4KE9A 2O20A 1DEHA 3HXMA 3EFHA 3ND5A 1QYCA 2ZAYA 1RRPA 4M98A 4GPZA 1ZJWA 5T3UA 3LQQA 4L15A 4RDCA 3TRJA 2J8ZA 1BXRA 4MK4A 5AHRA 4E31A 2O8CA 3AEZA 3DD5A 2ZUEA 1ZHFA 4I1OA 4LMAA 4LYGA 4UZEA 4JGGA 4RAOA 4C0LA 3WG9A 3K5WA 1Y6ZA 2ZAMA 1Z12A 4EK9A 1GKUB 4OQQA 1KO1A 1FL9A 3QX3A 3ZV7A 3QNMA 1W0JA 1PVDA 4R1PA 3K6RA 5HF9A 4B5LA 4AO8A 1DX6A 3OHPA 4P0PB 4LY9A 4INPA 5FI3A 3ROEA 2O5EA 4K05A 2QY9A 5LXTF 5C51B 1F2DA 2JVKA 3HXLA 3VAYA 1SXPA 4BEWA 2FRDA 2HA5A 4N9QA 3CJTA 2ZANA 4PLHA 3QEOA 1K2WA 3HYRA 3Q40A 4ZVMA 1VGRA 3U2QA 3KZCA 2R8PA 4ARBA 2A86A 3C7AA 3AERA 3RCBA 2ZQZA 4LIPD 3V33A 4G4SP 1M1YE 3C14C 3QVXA 2BEJA 4ARZA 4GL4A 4K28A 4UHEA 4H7HA 5BR7A 4F2WA 4UUAA 5AUPB 1N4DA 1T8UA 1OOEA 3V1KA 4LKRA 4RZSA 5C8ZA 2XUAA 1FU4A 3TE7A 2A0KA 1MO2A 4TQGA 4OHZA 3RC3A 4MEAA 3GFFA 3IA2A 1HFWA 3VHXA 4DUZB 1BE0A 1S2IA 2GZ3A 4OAQA 1R0WA 2NOAA 4AIIA 3LC7O 4FW9A 1XEXA 1Z8FA 3TCXB 1NMSA 2XYVA 1R8QA 4UDXX 2DX7A 1Q57A 5JZOA 2BR3A 1UKBA 3HXQA 1DU4A 4WACA 5G2OA 1E2BA 4RMJA 3H19A 1LSJA 5FP0A 2XVZA 4M0EA 2O8NA 2V97A 7REQA 5KB3A 1U2GA 2P8SA 1KEEB 3NT2A 4HGZA 3ADPA 3WQBA 4R2KA 2XA9A 1O4VA 3R5HA 3U81A 1IEXA 4GUDA 3B52X 1AXEA 1TKRA 2A35A 3DLCA 1ZIPA 2AEEA 4HGOA 4RJLA 5D51S 1YD7A 2O3SA 1Y3AA 4LC9A 5BQPA 2IPXA 1Z34A 2OXIA 4C7MA 4LJ9A 4YCCA 4DR6B 3RBVA 4PSDA 3ZJ5A 3SSMA 1E2PA 1JZTA 1Q16A 4PC3A 1ILEA 1VA4A 2FE4A 5IYZA 1ZUIA 1NW3A 5JXJA 2V7XA 3MRSA 4O1HA 3SJBA 3G2LA 2B5VA 2J7KA 3P5BA 3JQ9C 1V1MB 4DRYA 4BO7A 2ROQA 2WM2A 3NBZC 5FOWA 4JOQA 1Q0RA 4ECEA 3DE3X 1DBQA 4XRRA 1RP1A 3I9V1 3RJ5A 5JXHA 1CRLA 1SPBS 1EX1A 1OROA 2RGGA 1J21A 4HPWA 2ATVA 3VZSA 3DBRB 2O8DB 2WHEA 1J8MF 2VSNA 2DQYA 1EP1B 3HJFA 1U8ZA 3I52A 4B3HA 1UPUA 3CYFA 3MG9A 4H1TA 4QUGA 2DQSA 4BNVA 1OVGA 2CXNA 3WV5A 4CKEB 2C88A 3IP7A 4EB6A 4S2UA 4AMYA 3DP9A 4TMXA 3JZDA 2VJOA 3HVKA 3SZRA 2YOGA 3QKUA 1VL6A 1Z0SA 3FI9A 3MK31 4Q21A 4BX9A 1K27A 5F21A 5AHKA 3UT6A 1G3MA 1NI4A 4C30A 3VNQA 3K94A 1TLFA 2B36A 2ZUUA 4U9HS 2I4IA 1NN3A 3NJ8A 1RKQA 5HUHA 4PWZA 1OHHD 1U2DC 1VDZA 2Q6VA 3FSJX 3R41A 3TCNA 3S81A 4Y8VA 3KDPA 2XMGA 3FDZB 3LKDA 5L3QA 2Z1NA 4D9NA 3ZK9A 5CU7A 3W5BA 5DYNA 1JFRA 1XF9A 2JIZA 4P93A 3UBMA 3G17A 3FZYA 4L3VA 2WNSA 3JYQA 3AJEA 4OHVA 1YU6A 3HDJA 2IOHA 1SULA 3L9XA 1EWYA 5KYWB 3IHTA 4HWGA 1DWUA 4CL8A 3G13A 1RMYA 3GVPA 1E2DA 1XJQA 5ITZB 1N2SA 4AXXA 1XTPA 3PUHA 1GV0A 1HE4A 1UIRA 4H1UA 4M7OA 3A0UA 3IUJA 4WOJA 2PNJA 3WSVA 1XP5A 2PYIA 2ATXA 3SAJA 1OX5A 4LYAA 1O0BA 1L1QA 5JXWA 2XB9A 1VLZA 1YTUA 4YJ2B 3S40A 4ZQFA 4RTNA 4QZVA 5BUZA 3A31A 1QM5A 2QTWB 1D1PA 1H1LB 2BFEB 3WGOA 4FB4A 5TY0A 3KSAC 1C0PA 1NVBA 2I80A 2J0UA 2XODA 3HUFA 2QT9A 1R0CA 2BFBA 2ZSDA 3UMSA 3F5FA 4F84A 4KMSA 2AI2A 4NCKA 5G4KB 1YFZA 3RHFA 1II0A 1Z6XA 1HTWA 1QCZA 1SXHA 4TM8A 3K0AB 3QKSB 2P4EA 1OIWA 1PLJA 3D6JA 3AUAA 3EG9B 4YRMA 4RTLA 3T1QA 4DA7A 2IZ7A 5I01A 1Z0FA 1TQ6A 4D41A 3WGZA 3MEQA 1UXHA 2IYWA 1XRPA 3IJ5A 3HA3A 1MW9X 2JFXA 3JQGB 4Q4AA 3GELA 4WMLA 4B40A 5J2UF 1THGA 3V4LA 3RFCA 4MR9A 3DEJA 3MINA 4C7BA 5BVGB 4E33A 4O29A 4BLVA 2VZLA 4HB3A 4UHDA 3W8DA 1I6MA 2N47A 1QP7A 1RAAA 2QIOA 3F78A 5MF6A 2MU1A 1MO4A 3F7OA 3EW9A 3KE8A 4KXMA 5K20A 1E0DA 1KHHA 3GJ3A 2X9QA 1M72A 1ZP6A 2AR0A 1ZUNA 4W5NA 3CCFA 3UHFA 2N1MA 4I5DA 3REGA 3IUYA 1JPJA 2REXB 4ZVLA 4A8PA 1E4EA 1N8TA 3QYPA 1GXSA 1ZRNA 4PG4A 4BQPA 3T1OA 3FTQA 5JTTA 5ALDA 2GK7A 3ONEA 4QYIB 2V6GA 1E18A 1IRIA 4XUCA 3BG5A 1RYNA 3FSGD 4C2TA 4MRVA 1KEUA 3TW8B 4IV0A 4L5AA 1JWLA 3EZFA 2C03A 2BGRA 1M83A 1RI5A 1RYBA 1WAMA 2EZTA 2OZPA 1LSSA 2XJ9A 3HL0A 1HSOA 3QW2A 4Z9AA 1LX6A 2GZRA 4N5DA 2D2FA 4RYDA 3JZMA 3QOXA 1XDBA 2QY6A 1LDGA 1WNTA 4L4RA 3I05A 4EDFA 1DVRA 4EATA 1A9SA 3CNNA 1TUBB 1U2SA 2IZOA 2NACA 4QUEA 5IJ0A 5HP4A 1BGVA 1MA0A 1DC4A 2VF2A 2FSIA 4IDHA 4ZYTA 1SOVA 3DUFA 3KTOA 5DM60 1S2LA 5D3ZA 1AIPA 1P1KA 2XUZA 4MYRA 4QICA 4NEHB 3RUIA 2CXUA 4Q1CA 4F3TA 3TZ6A 3GWGA 4PRYA 2PQ2A 2VC2B 2C94A 1A0OA 1JPUA 2YCBA 4DDVA 2WB2A 5JU6A 2FMFA 4CMAA 4O2BA 1Z6QA 4JBXA 2J7PA 3U1VA 4UOEA 1W4AA 2HJSA 2Z57A 2ZT6A 3BL6A 4AMBA 2D0DA 3VU9B 1ORTA 1EFUA 1S2MA 1NV8A 2P9ZA 4UATA 4EP1A 4ZI3A 2IXGA 4ND5A 5FLEX 3RRJA 2I67A 2PLWA 1GPUA 3HB7A 3Q2KA 3GUHA 2ZRQA 3AX6A 4EO9A 3A04A 5B55A 1X3SA 1B1AA 1I5RA 1QLJA 4JFRA 4X20B 3SFVA 4MGYR 4A0SA 5DHRA 2FN3A 1JIUA 3B20A 1ECJA 3I72A 4QUJA 1MOPA 2HUPA 4MMYB 4EHFA 2EKPA 5KHLB 3HPRA 2PKRA 3R0XA 5DM0A 2CL6X 4XVHA 2VOJA 5FRDA 2WVJA 3D3WB 3ZV3A 1UCFA 2OK8A 3A14A 4ZCQA 2CCJA 1UBFA 5C8VA 4YRFA 3JRNA 4MMXB 1AS0A 3CSDA 4RKYA 3STHA 2FR0A 3SYMA 3OIYA 2QG6A 3GFBA 3ZD8A 5J1SB 3HRKA 1VHJA 5HZMA 1ZR4A 2EERA 2QA5A 1CV2A 1NSTA 3OOSA 3L7OA 1YJBA 2I0FA 5EFZA 1E6EA 3F9IA 3PD1A 1R0XA 3ZCVA 4F86A 3B8HA 1GCIA 3EF0A 1Q12A 4J0IA 4JLOA 5K8JB 3ADDA 2UZIR 2WZQA 4XD7D 2IBSA 4BKMA 2HBQA 2R00C 1EBUA 3GA0A 4RL6A 1P3DA 4WTOA 2GSWA 3MVEA 3SZOA 4DEXA 4HMOA 1W48A 5CFQA 4J8PA 2PEYA 1JKJA 3ITKA 3VO8A 1X2EA 2GESA 2BE9A 2DSNA 2VDJA 3EFOB 1ZQ9A 4CUZA 1IOZA 2QRLA 2F3RA 2XCTB 4EJMA 5CK4A 1K08A 4TVKA 5JSUA 2WHQA 2NU8B 4PAQA 5T67A 1LJLA 3DCYA 3SCZA 1DIAA 3VBEA 5AOVA 1E7YA 4PLVA 4YBZA 5L45A 2C7OA 4DJ5X 4OREX 3STXA 1PGPA 4FINA 4I50A 2P2GA 3HGQA 3FKJA 4EUHA 4KGZA 4O02B 1JS1X 3EC7A 5E9JA 4GBED 2ZYTX 4HH0A 4MOWA 1ZIXA 3EBLA 3IQDB 3RSHA 4DKJA 1JHVA 4YR9A 1WL8A 1UFRA 2VP3A 3IV6A 3JXEA 3WB0A 3EA4A 2R7KA 3A27A 4H6WA 5DF1A 3EUEA 2I7TA 3X2SA 3GLIB 1VHTA 5IUKC 1Y33E 5D1NA 1W581 3VRHA 5E3JA 3PXUA 1KORA 5L3RA 1P1CA 1Z0ZA 5LLSA 3C3AA 3EXFB 1GPNA 1YR6A 3DYVA 1DAPA 4TLAA 3U48A 5A4IS 4M37A 2FF7A 4YNBA 4J0KA 2ORYA 4HVLA 1G8AA 1FQWA 1PF7E 1FVXA 1E3IA 1NIPA 2ZI3A 4HQNA 4IR7A 1TC2A 4GE3A 1NXTA 1VDMA 1NV9A 3T0FA 3WIDA 4B80A 3FOEC 2WF9A 5JBIA 1LW7A 2ZE7A 2IV2X 4HWSA 3IHWA 1O89A 2NZYA 4FFBA 4A7PA 4BNMA 4D3YA 3U7HB 1CWUA 4JP2A 4MV6A 1NQAO 1SB8A 2HA4A 1RC8A 1I30A 5DDIP 3UJHA 3V3TA 3VBCA 1QIEA 4UHCA 5IC6A 4DLBA 3SC2A 5EOVA 3WAKA 3DP7A 4LRSB 4R9UC 3G7UA 1D2EA 4IJKA 1FBTA 2QMHA 1E3WB 3VPBA 5EXSA 2XUHA 3ANNA 2JEZA 3D3QA 4TM7A 1XU4A 1Y1SA 1GV1A 4HFRA 2N42A 1XD2A 2P2LA 3ORRA 4ZEMA 5HZHA 3UMRA 5DSTA 5JNUA 4IMRA 2VHTA 4MITA 1IZYA 3DBLB 4B3GA 4R8VA 4DIUA 3R7BA 3G5TA 4IY1A 4YALA 3ZZMA 3AF5A 3KR9A 4R41A 3PD7A 5KKNB 2H2HA 1K8ZB 3D02A 2IC5A 1A8QA 4F4DA 3N7UA 1UPTA 4OHXA 1IC6A 1R9JA 3KK0A 4JYZA 2DHQA 1Y82A 3DLTA 3T5CA 1XCJA 2JLBA 4DNQA 1N7JA 2VDWA 4YAUA 3L07A 5EJ6A 3PTLA 2FZCA 4ZT2A 3CNLA 3II6X 3MWGA 3WJ7A 4QD3A 5KQSA 4B4DA 2IXBA 5FLXA 3FD8A 2OGTA 3ENQA 5ARDA 5FWDA 1KEKA 3LTEA 2P3OA 3NC1C 2JCXA 1Y9JA 5KU7A 2OA0A 4FM9A 3JQPA 3K35A 4DNXA 2QM8A 2VJBA 4UC0A 4AZ3A 2JJ1D 4TQAA 3NTRA 2H06A 4EJ6A 4J03A 1QIGA 1MAWA 2POCA 5ISMA 2ST1A 3NNNA 2JIMA 5J5AA 1ZA1A 2YBEA 3NWOA 2CHQA 1ISPA 4YJKA 2IDZA 4RZIA 3IT3A 4TV9B 4D98A 2X22A 5IULC 1OHHA 3QEMB 4UAUA 3W6OA 1FS4A 3WHKA 4DMMA 1Z5PA 4Y6LA 3IL2A 2O8BA 4L5BA 3TNFA 4AP5A 1C0EA 2VFAA 1JQEA 3FYUC 4I9NA 4L5CA 2QLBA 3AY6A 5FWYB 1LPBB 5I7FA 4GOND 3EPJA 3ZVNA 3NDBB 3R3YA 4ER5A 3V7WA 3GPBA 3VFDA 4FCWA 4EYQA 2GI4A 1Z5NA 1LXCA 4RW0A 1ZI8A 1GHTA 1C29B 5FTMA 2BV3A 3BTVA 2XYRA 5F3WB 3HBJA 3S2IA 1SCJA 3M70A 4WBNA 3F8WA 4L9WA 2G88A 1WY5A 2JH8A 5BSVA 5JNLA 1KBZA 1SKUA 1UZLA 4BLUA 4ESEA 3UT5B 3KZXA 2L2QA 2WU8A 2QAGA 3FZEA 1D4FA 2WMYA 1U99A 3PV0A 4OUKX 2O3JA 5M34A 2HMAA 1KPIA 1ND5A 2DPHA 2WNHA 4MR8A 3EYWA 1DEAA 3O2QB 3TNLA 3NYQA 4G6ZA 3K4PA 1AGXA 2GYVA 4GPIB 4F4HA 2VNAA 4UBMA 2P1ZA 4P3PA 2P5TB 4M49A 2JD2A 1AHHA 4N40A 3AWDA 6Q21A 3C5EA 2UXCB 1LK5A 2WLTA 4P84A 2XTMA 3GAZA 2BELA 2W4IA 3GPCA 1DJOA 1Z06A 2J59A 2Q8QA 3K8QA 3O3NB 3GRVA 4Y0AA 2G1PA 4DJFC 1FZQA 5CGZA 3WTBA 2PKWA 1BVUA 4KN5A 1OTXA 3UJCA 3P0EA 2C9DA 4KVGA 2A9JA 2ASVA 2QMOA 3ETDA 1AKVA 1C3OB 1EWTA 2FZ5A 4MQBA 4G0VA 1I7PA 4D2IA 5I4BA 5AW5A 3NXKA 3OLXA 4YRIA 2DFPA 3QG1A 4BOYA 1QRDA 1NRIA 1KR2A 1X9IA 2Y8EA 3MOSA 4N6GA 4RH3A 1TMGE 4RMHA 2OFOA 3C70A 3UK0A 5CNKA 1OYVA 4EUEA 3TOXA 4R3WA 5LNK6 2ODEA 1C9MA 2G5TA 4N18A 3L0CA 1QOZA 1KY3A 2VWGA 3HB4X 3T0IA 2V7PA 4Q01A 1NE2A 2V7BA 3H86A 1QGYA 3HZOA 3TW4A 2X4LA 3WQSB 3J81A 1A7UA 1BWQA 3ITNA 1XVLA 3DFUA 4UJ5A 3PYXA 4BMSA 1TRKA 1GG9A 2OAQ1 3AQ4A 5AKGA 3E9EA 4GDFA 1W5EA 3PT9A 1XKXA 1PU2A 2C31A 3D54D 3DBIA 3QMWA 4MKXA 3S2ZA 3DTNA 4TN1A 4P83A 4IZHA 3P9RA 1W7AA 3WYBA 5CBKA 2EFDB 3BD9A 6ABPA 1QG2A 5ALFA 4URVR 2W48A 4GPAA 4I4TF 4XWOA 4QQKA 2PJDA 3RYIB 3OLZA 3EZ9A 3H18A 4JT9A 3C6KA 1EVJA 3MJEA 3R0VA 1YS7A 2NP7A 2ZS7A 2JI4A 2QIPA 5FL7D 4JI3B 2ID7A 2X6RA 1BU8A 1UBNA 3RSOA 4E5PA 4NG4A 2Q1WA 3PPVA 4G2NA 1SCKA 3M0EA 3I45A 4PR0A 5J40A 2WJVA 3OKAA 5AM0A 2IHZA 3DPIA 1SXJD 3OLQA 1NC1A 1J2YA 4QWWA 1I24A 3JW8A 3DMTA 1QH8B 3PNYA 4ZEVA 1WNFA 1M1NB 1I1QB 2R79A 3W7AA 2BDTA 1XKTA 4RTSA 1EFDN 4NE7A 4IO0A 4KEAA 1M2NA 3ND6A 3QFCA 3RI3A 1I6LA 1DC7A 2CFRA 1QVAA 1U7PA 2RC5A 1MNAA 4P81A 4WT7A 4TZ0A 3AI3A 2BGNA 1RPJA 3DONA 4B35A 1DHTA 4R9NA 2ZATA 2I3AA 4MP8A 5D8DA 2QXYA 2XQFA 3R3WA 4ITVA 3SIRA 2FG5A 1L5YA 3A4LA 2WINI 3ZY5A 2JFWA 2R00A 3ENKA 2CMFA 3NOVA 4CKYA 3TQOA 2C4UA 1YRWA 1USIA 1T4DA 1SAYA 4R69A 4D96A 2Y2UA 1JG4A 1QO7A 2A33A 3KOUA 1LPAB 1PQ4A 3FKSD 4Y2UA 5DIZA 3BZUA 1XZFA 3WOHA 2I2CA 4G0QA 4RMGA 2G0NA 3PUIA 1ND6A 1EJBA 5CB6A 1DKQA 3GPDG 4TT3A 4FVTA 1AS2A 1F12A 2AG5A 4P7GA 1LSUA 3VH3A 3ANYB 1Q2UA 1GN8A 3SIWA 3U7QA 1JIXA 1SKYB 4GZMA 4ZAYA 4CFZA 4W5OA 2OD2A 1KI4A 2V0NA 1U8CB 3PG5A 3URKA 4CF6A 3UJBA 4EPVA 4XYBA 5ANRB 2WYWA 4HQ6A 2ZTLA 3ZXUB 2VJAA 1ZEJA 3PUZA 2XI4A 2I5PO 2QZ4A 3EF3A 4D99A 1JWAB 3BGOS 1IUKA 1DL5A 1JDNA 2XH8A 4YMWA 5HIJA 2YY5A 4EGSA 2FG7C 5EIOA 5TQ0B 5FTWA 2FN4A 4BGIA 2C1XA 2XA2A 1UJ2A 3FFXA 2GK6A 1CR0A 3C6QA 3IQXA 4GLOA 5FYQA 3SQLA 4YPOA 3BRWA 5FAKA 1NLFA 4NSNA 2PS9A 1IHXA 1TYBE 1Y5IA 2RH5A 4PZZA 1SBYA 5C7LO 1ZM7A 2BF4A 1YVEI 4W7IA 1KYYA 4QLOA 3OQIB 4QRIA 1XXHB 1YS2X 2V55B 4IS3A 1G4AE 5K3BA 4JI2B 4O5AA 2QAJA 4NPAA 1JG1A 1V1RA 1E2LA 4KRYA 1H1DA 2QX6A 2J9RA 5DTEA 1SUFA 1CZLA 1YB7A 2PBRA 3PE3A 1JG7A 3U56A 1KMIY 2Y92A 4AS1A 1V3VA 3PHCA 3SQMA 4ZCMA 2AOXA 1FTYA 2AJCA 2O7QA 3H8VA 2D5BA 3GEHA 2VPXA 2P6UA 1NDUA 2Q9AA 3ETEA 4M9UA 4H15A 2DEUA 1Z16A 1IBCA 4DA8A 3P2EA 4C2AA 1B14A 1GRCA 1OREA 3GLHE 5BPFA 2J87A 2XRMA 2NU7A 1RS0A 3D59A 4ASUD 2X9VA 3RC1A 1I14A 1IMOA 1YZQA 1RTKA 4GBGA 4ZCTA 1RWVA 3KE9A 1TYZA 4YPFA 1YQXA 4QTZA 2W90A 3ZJ4A 4CV1A 1D7OA 2BHLA 1NVUQ 2WOJA 2OHVA 1AMOA 3G7SA 1FUYB 1O3YA 4QUAA 5C7YA 1JMVA 1L5LA 4RS3A 4TUYF 5AKIA 3H1EA 4MB6A 1S9DA 2GBLA 5AKEA 2A88A 2BSAA 1U3FA 4R0VA 2OZVA 3UVEA 3AH8A 1FDTA 3FZQA 3P71T 4C01A 2P78A 1Z4OA 4E94A 1H2HA 5JYCA 5IN5A 1JTVA 3L41A 4FMPA 3L5KA 4I8XA 4ARAA 3CLSD 3KKMA 4YRJA 3E05A 4MGIR 2COUA 4RETA 1UC5B 3ZPXA 3PQ8A 4RTJA 1Y6GA 1C7ZA 5BY2A 1JDJA 2F90A 4FNOA 4HNHA 2VYQA 3OHMA 4OAOA 5EJIA 4EEZA 1BHO1 4OI2A 2VT6A 3B1JA 1U3TA 4OY3A 2NSDA 3JASA 3JR3A 1YDHA 2BVNA 2Q8NA 1L6IA 4WLFA 4YECA 1J8QA 2EG9A 4O4HA 3GUVA 2NVBA 4MIEA 4CL3A 2JA1A 1F2TB 2AQIA 5CURA 4JMPA 2Z2XA 4CR7A 3GJ6A 2F3PA 2P4UA 2Z1MA 2L42A 2BGIA 5IMBA 3W5IA 3CX6A 3OLWA 1AMUA 5IT9A 3REQA 4B45A 1GAXA 1BOFA 1KJ9A 5H02A 3OLYA 1E3EA 4ZO6A 3EGDB 5J2UB 4D9CA 2VK1A 1U6JA 1ZL0A 4C2UA 4YRRA 1A4XA 1P7PA 2DUMA 4JUDX 4IJQA 5ED0A 1ZAYA 1LPMA 1GITA 3AUFA 4JX8A 4BB9A 5ALRA 4IFIA 4L8YA 4H9GA 3BMOA 1NJSA 4F2GA 2XQVA 4LOAA 4FTWA 4HDOB 4UCWA 4US2R 1FQOA 3EZXA 4RHYA 3B8EA 3BXZA 3ISJA 5C18A 1X8KA 2JHFA 3OF5A 3EBPA 4PHCA 4JOSA 3IVMA 2CV1A 1VHLA 2CLCX 4GX0A 1DKOA 3CRRA 4HZUA 2D2EA 4DABA 4DYDA 3CRQA 4Q9NA 3RKUA 4YLYA 2JFFA 1R2QA 1F60A 2LZ0A 5DYIA 4YCSA 1MPTA 1U9JA 2HCBA 2VDLB 4L2IB 1NAIA 3TD9A 4B6FA 1TJ5A 3EPRA 1CRQA 3AVOA 3E9ZA 1EB8A 5CXXA 5ECYA 4ZYXA 3H9QA 3P0RA 4QNMA 3S2FA 1MJGM 2YHIB 1QUEA 1KBOA 3CPEA 2K7ZA 3FFBA 1KMQA 3AZQA 3PEUA 1DOHA 3QOWA 3ME5A 4JS0A 2CUKA 2E1PA 3AV3A 4US0R 4XXHA 2D0IA 1C30A 4Q3EA 4JI1B 5K45A 5IRCD 4M87A 2I22A 2WD9A 5H16A 1UWCA 4ZXPA 1F4PA 1J39A 5B2FA 1F2UB 1L4MA 4CL0A 2EYQA 1Y6FA 4ZV4A 4QNNA 1SZJG 3RABA 3UAVA 4ZTBA 3ZHSA 3WISA 3DHWC 1AVTA 1UXIA 1R64A 2GPTA 2HQOA 2Q2OA 3JQAD 9ATCA 4URYR 3WGTA 5CB8A 3HCRA 4RGBA 2YJ3A 2J07A 1CJVC 4WZBB 4ZV7A 4O8CA 3TS1A 4DANA 4DM3A 3MS4A 1JHRA 4PQFA 1ECCA 1JQDA 2FW0A 3BFXA 1NNEA 1X9GA 3USES 2ZIFA 1QQBA 2YW9A 5DK4A 2FPIA 4Q00A 1HT3A 1Y0BA 2PUWA 3KR0A 4RLHA 3RE1A 3SHOA 4Q24A 3OEYA 3HCFA 3BC1A 4RVUA 3TF5A 4OX9Y 3EBOA 4QDZA 2O3QA 1V5IA 2J6CA 2TYSB 3B78A 4HX5A 1ISFA 1DAMA 3DQZA 3MCUA 4MGHA 3IEIA 5L3SA 1P81A 2GZAA 1M2EA 2JKYA 2X1LA 3P9KA 2VK8A 4DC1A 4TWBA 3G7NA 1PJSA 5G3YA 1LBIA 1QGUA 5JD4A 5K03A 2GETA 1KI9A 1YOVB 5KNBA 5DM70 1OIXA 1YJCA 3G9TA 4DWJA 4AMVA 2Z5VA 3GP8A 2PSJA 1Y9EA 1SO8A 2K5UA 4W5RA 1KDRA 3DOCA 4JLKA 3MF4A 4JLSA 3TQIA 3UHAA 3L8CA 3MJFA 1G2IA 2QV0A 5KYYB 4W6QA 3STTA 1A9TA 1T4BA 1JWBB 4N5MA 4CTNA 5JZVA 1NDHA 1PTJC 4J7CA 1ZC4A 1RE0A 1U3GA 1X7YA 3LLSA 4E2ZA 1WVGA 2QG4A 1TTPB 2QN7A 4PBRA 5A5DA 4Q39A 1VPLA 1VKNA 1UWLA 2VDNB 2YWEA 1JDPA 4CM9A 5KMGA 2G4CA 5IEJA 4DF3A 5KYXA 1H2WA 1PGNA 2OZEA 3PQFA 3SZUA 1A5BB 5C32A 3ZLJA 2VSQA 4AKIA 4WNIA 3SLRA 1P62B 3IOEA 2PUCA 4I55F 2AHOA 3OZFA 1X3LA 1NOKA 1YZHA 3FF4A 4JXKA 3GRCA 4JU9A 1TVKB 5FUMA 1OBOA 2D0PB 5LBTA 1C8BA 1WJGA 2WP0A 4IHJB 5B3LA 3GDGA 2V3VA 1O94D 3R2JA 4P0QB 5IJ9B 4RIEA 4DLZA 5JSZA 1M6HA 2Q3LA 3RJ9A 1NF9A 3FLBA 3BJMA 4KQIA 4WNAA 4J16C 3U39A 1R16A 4MB2A 4XWGA 1RYMA 3WLHA 2CHUA 1KH3A 3E5HA 3O21A 4HBZA 2VTBA 3DW3X 3LX8A 3P9IA 5GJWC 4ND8B 1VJ0A 4EY6A 3IXLA 2XIJA 2FSUA 1TZ2A 3OFNA 3TSYA 3T7JA 4MUNA 1Z35A 5ITVA 3Q8WA 2Q5CA 2FUKA 4OQPA 5LP6F 1SXJA 4KI7A 3I73A 5AI9A 1USGA 4EQ6B 1WUIS 2AFHA 5JQGA 3M3PA 2G25A 2ACKA 5KNCD 1A8IA 2PAAA 1CUWA 2OE2A 3E61A 3NBAA 5T8KA 3A25A 4MV9A 4E14A 2WHPB 3EPLA 4G1EB 4OF4A 1BKSB 3LWNA 1JIKA 1IJFA 2OV4A 1WU7A 3ED1A 2VYND 4R68A 1SBHA 4QASA 1XZQA 3E22B 4MUEA 3E7PA 5A7FA 2BHTA 2G36A 2HWKA 1MC4A 2NAFA 1Z83A 2R4QA 3AHDA 1CE8A 2REQA 3NUGA 4U1RA 1FP4B 4L6CA 1RC1A 1W6RA 4H77A 4CR8A 4CV2A 1NNLA 1VB5A 3O4FA 5HDQA 4ZVVA 3TXYA 4U4AA 2YJZA 1GTVA 2IHBA 4CEJA 3FKSA 2VWQA 1L5GB 2H31A 3KQSA 3PDCA 2RJOA 4AY2A 4FOLA 5C3MA 1TCUA 1HFEL 1PRYA 5CR9A 2C5SA 3PQ6A 3ANLA 3BL8A 4FHFA 1DG1G 3S1LA 1WTCA 3AI2A 1W76A 1OBHA 2ASEA 3C8UA 3QPAA 4LSGA 4TSKA 5K0CA 4AJLA 4TLLB 2R6GA 3A6LA 2PUFA 5C80A 1IN1A 3NHPA 2AFRA 2RGNA 2GCIA 4Q9IA 1JFVA 4JJZA 1YZ3A 2FWIA 3TLGA 3H9CA 1HY3A 2EU8A 1UAAA 2DT5A 2QX9A 1YOBA 3SU8A 2P75A 3RTBA 3T5GA 4K9QA 1ESMA 1A7JA 1FRFS 3HP1A 3IMKA 1WV0A 2FGKA 4XCVA 4AFNA 4DMFA 1FW8A 5IX8A 2ZB8A 1J0CA 5T3YA 1WA5A 3UOWA 2LTAA 1T5OA 3DFIA 5LDDC 1P1IA 3RAGA 1H6CA 4PTZA 5LM3A 2BJWA 4G5HA 4IO1A 2ZJ7A 3Q9NA 3ZDDA 2D8AA 4WKOA 2QD4A 3QVTA 4IF4A 1H94A 3WL6A 1UC4B 3GRAA 1FRNA 5BN5A 2NSYA 4I1YA 2OD7A 3K0CA 3WK5A 2XGJA 4YP5A 4WN9B 1ONBA 1TYCA 1S6YA 2OCGA 4DREA 4P54A 3QQ5A 5FD8A 4N3NA 5TNXA 3RG8A 4DIDA 4FS3A 3DEFA 1G6OA 2PK3A 4MI9A 2FRVA 3IKJA 5BQOA 1O6FA 1TMYA 2F3TA 3CJQA 5KBYA 1E9AA 4ZWNA 5L6MB 3NHMA 4ZU3A 2I91A 3FG9A 2FR1A 2FDCA 4IXTA 2IYZA 1A82A 1NZDA 3QSGA 1YDMA 4MW1A 4BS9A 1U9IA 3PRHA 1B6GA 1VCHA 1GQSA 1YQEA 1X7WB 2E49A 2VZ0A 4G1UC 4LSZA 4Y1RA 1PT7A 1TGYA 3UC5A 1YJAA 4ASUA 3QA9A 2QLFA 1U5BB 1LFAA 1O58A 1KWGA 3N2GB 3UWOA 2LCIA 4R1QA 4FLFA 2LIVA 4JKOA 3IPLA 3Q5GA 4YP9A 1U7TA 4FWTA 1NRXA 1UP7A 3I58A 1TM3E 1OWPA 1HE5A 2Z5GA 5FOUA 4PIVA 4N1AA 1SVUA 4DIFA 4DLWA 1SUIA 4MS3B 1JLMA 1CZUA 5AVTA 4BCBA 3ZI7A 4UNNA 2IU4A 1GDHA 1SBNE 3NANA 5DNDA 3MD9A 3O8OB 1K63A 4IDAA 1PZMA 1U04A 2HNAA 1CHDA 1GA1A 2GRJA 2NAPA 3ONNA 3AETB 3LI2A 4HLUA 4D8UA 1PNRA 2IS4A 3JZFA 4F85A 1T1IA 3H1FA 2J0VA 3FYHA 3IOBA 2I03A 2X0RA 1J25A 5HHTA 5LZ9A 4B3MB 4IQ4A 4RKWA 3E84A 5EE1A 1U7HA 1S01A 4MVJP 1PS8A 1RPNA 1SXGA 3T4XA 5LOVA 4FBGA 3NI2A 1GNLA 2J3HA 1EDEA 1N6PA 4QRHA 3TZKA 4DRXA 4F6RA 3E35A 3FUCA 4HNTA 3IUNA 3KETA 5BWOA 5KINB 2FU5C 2A7XA 2IOFK 3FAZA 4Q19A 1T25A 1WPRA 1D8TA 1NHWA 1S2OA 1CJBA 4LRTB 8GPBA 2HSJA 4OI0A 4RQAA 4J3FA 4DN6A 1Y63A 4Y6OA 1WXQA 1KGSA 2UYYA 3CLUD 5ALMA 1QIHA 2XNDD 1W1WA 3IERA 1SIBE 4GF5A 3MQ2A 3HB0A 3L8ZA 1FSSA 4MS1B 4TS1A 2IVFA 3WWEA 1AGPA 3EARA 4MI3A 2DWUA 2JI6A 2O7SA 3QBTA 2BTOA 2ZJ1A 1JLSA 5EP1A 3FPKA 1XR3A 2ZUSA 2NYVA 5H82A 4BTVA 3MCZA 1OC4A 2WSYB 1BW9B 2D7CA 2HYIC 4G97A 5EZQA 5KPDA 2WWHA 5IYZF 4A2QA 3S8EA 4JVSB 4Y2SA 3BXFA 1E7MA 4C2BA 1CRPA 2EJCA 4CKBA 2ISCA 3D4PA 3BK7A 5KO2A 4CFYA 2M2IA 1PZNA 3BMCB 4QFCA 3IP8A 3TLCA 1OIVA 1XQ6A 3GVCA 3OJEA 4YRLA 4X7PA 3UBTA 5F3DA 4N0EA 1X15A 5K8IA 4GMHA 2QN8A 4HWTA 2X8WA 4DZTA 4CBVA 3OQHA 5TX7A 3T9FA 1M2VB 4MWZA 3ZEIA 4S1NA 4ZODA 2Q5OA 5HR5A 4X8OA 3N0TA 5CFPA 3KQWA 2PZEA 4JJIA 1QTRA 2BGLA 3OURA 1IQ0A 3LPDA 4LECA 3CE6A 1STOA 4K5QA 5KWIA 4XGKA 1F3LA 4BZZA 3EMKA 4C6TA 2ZUTA 3OE7D 2JG3A 4KITB 1U4OA 3H7IA 3TL3A 4AKEA 1ZEMA 4CL2A 1CJKC 3CZ9A 4I4TB 3UWDA 5EIBC 3ADOA 1GSHA 3R20A 4RIFA 3TLXA 1WV1A 3ZZTA 3GHYA 3SHVA 3ZGLA 2NVOA 1U1CA 1Z5GA 1I2AA 3OY7A 4UM7A 2OWEA 3AIKA 3WL3A 3BAZA 1GP2A 3JQAA 1NBHA 4EKGA 3DAOA 1QNFA 2D1SA 2ONKA 5EJ2A 1JP7A 1RCTE 5BSWA 1X7ZB 1CC1S 2Z95A 1MDBA 2B94A 2NM0A 1P0IA 1PTJA 1YVRA 2PH1A 3CTMA 1XQWA 3DGFC 3I01M 3PVSA 2YY7A 2AN4A 2H1OA 3ZW8A 2BRUC 3LJKA 1XF1A 2AH5A 1VIYA 1U2EA 4RZ3A 1DO0A 4GXRA 2BGWA 4OJQA 2RHLA 3K3PA 4I0WB 1W29A 1GFSA 4LSWA 3GFTA 4FILA 1EXWA 1NNUA 4KQMA 1MHTA 2BI7A 4NC9A 4Q7JB 5H59A 2AFVA 3BWEA 2ZYIA 3C41J 3H5IA 2F9LA 4KQEA 3VYTB 3K2IA 1U2TA 2OHXA 1KI1A 1GZSA 1LI4A 1I4LD 2Z8YM 4IIXA 1K5GA 1T0PA 3BEOA 3ICPA 3K6KA 3FA2A 4NWIA 2O52A 2DUUA 2DPYA 2NQ2C 4RSHA 5J4VA 3OQJA 3MYRA 4J16A 2YWFA 3LT1A 1GL3A 2Y6VA 4LE2A 1KQ3A 1YR8A 3AUKA 1C9NA 2ZYAA 3KJXA 3L0BA 3L92A 4HPXB 4RK6A 4FWBA 5A0FA 4Z4GA 3M33A 3QKTA 1WY7A 4JLJA 3JD2A 4GC5A 5EIEA 3C16C 2RI1A 1G21A 3U9LA 3ZN2A 3IJPA 10MHA 1IY2A 1S5PA 2YJ6A 3IXMA 1L1RA 3ZIAD 3C8DA 2NIPA 2PV0A 5DN6D 5FJJA 1OPRA 2AA3A 1MBZA 1VL5A 3D8RA 3GN1A 4QODA 4I4LA 2NVWA 5EYPA 4DBLC 4EDHA 2A2ZA 1L7EA 2V0GA 2V1XA 5AWFC 4AG3A 4LMPA 3IRVA 1RQGA 3BB4A 4IXDA 2V58A 1O94A 1UBEA 2YZNA 3K1AA 3KOXA 4P3OA 4UBNA 3PHGA 1WUYA 3H5AA 4IGEA 4M8IA 4ALNA 4KPEC 4S24A 3E1SA 2OXRA 1GNRA 1XI2A 1ZONA 3C5WP 4Q4HB 7ABPA 5K8LA 1T8YA 4WA7A 1EAMA 2ZSUA 1Y3BE 3ZBQA 4EFKA 5AW4A 3IQHX 1SD5A 2ENWA 4MDYA 3T7RA 1N75A 5FBKA 2R84A 2WUGA 4UVIA 1K89A 4LQ4A 2FW6A 1CERA 5B53A 5TF4A 5I3ZA 1X8LA 1U1DA 3EC2A 1QTNA 1Z0IA 4GPTA 1BMQA 1X0VA 1WXIA 3NFYA 5EAIA 2X4GA 3ZG6A 4KPUB 2W2KB 2HZBA 4FR2A 3KT6A 2DT8A 2OB2A 3CUYA 1PI3A 2JI7A 5KOJB 2A5LA 5KNCA 2EV9A 2BEVA 3EVBA 3AEKA 3L4JA 1U11A 5KAMA 4CT5A 1S2NA 3H4IA 2PKQO 4IDQA 4TVSA 2GPWA 3ZIUA 1QE0A 1XROA 2NU6B 1MENA 2BH2A 1Z4KA 4XIJA 2IYSA 2VYNA 3I04M 3QF4A 4NJOA 4O2LA 1FZTA 1GPWB 5SY4A 3KXDA 5JH7B 5HTOA 3ZYCA 5CDUA 4OSOA 1ZKMA 1CUXA 4CM1A 4M1MA 3AFHA 2IUYA 3D7LA 3GEMA 5JSYA 3R3ZA 3HEBA 3S99A 3ZJTA 4NU6A 5DO9A 5CXQA 2VWHA 4IQGA 5B7GA 1JB9A 5FYDA 1OBFO 1P6UA 2E0IA 3IC5A 4JK3A 4K87A 1FXWA 3HYSA 4TKVB 1X80A 2IELA 2PA3A 1N2EA 3IQFA 3W1EA 3WLOA 1XLVA 1G3QA 3JWPA 2BFCB 4TUYB 1CS4C 2H16A 3ENNA 3CE9A 4E70A 3CX7A 1HKHA 5CW2A 2X0EA 3QSYA 2XMCA 2OBXA 2VUTA 2QMUA 2NZXA 1NVVQ 3DBVO 3HMQA 2JF0A 4GS5A 1PSDA 4BWVA 3AESA 5K6AA 5CGQB 2E4AA 4OQFA 5F2OA 1JU9A 4AJ2A 1IHDA 2Q9BA 2VLIA 2YNMD 3FFTA 1SQ5A 4R2MA 4CM8B 1GUAA 3F5MA 3V8QA 4ZIRB 1EP3B 1OAOC 3AOGA 5ESRA 4MKFA 3PQ4A 2Z1DA 4CF4A 5EPEA 3UATA 5F4BA 4GOXA 2IS1A 2C0QA 2B37A 3OH8A 4JROA 3DQQA 3RARA 1WVMA