4GICA

Crystal structure of a putative histidinol dehydrogenase (target psi-014034) from methylococcus capsulatus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
401
structure length
382
Chain Sequence
b'SMTEVKIKRLYTGDADFASQLDRLLAWSDTDIHQRVTEIIGCIRRDGDAALVELTARFDHFVVDTAAALELPRDVLEAAWQALPAEQAKALREAAERIRAYAERQKLDSWDYREADGTLLGQKITPLDRVGLYVPGGKAAYPSSVLMNAVPAKVAGVPELIMAVPAPRGELNALVLAAAYISGVDRVFRIGGAQAVAALAYGTETVPRVDKIVGPGNIYVATAKKLVFGQVGIDMVAGPSEILVISDGRTDPDWIAMDLFSQAEHDEDAQAILISPDAAHLEAVQASIERLLPGMERAEVIRTSLERRGGMILVDDLEQAAAVANRIAPEHLELSVESPEVLVESIRNAGAIFMGVLPTSGTARFSSPLGVYDFQKRSSLIY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histidinol dehydrogenase
publication title Crystal structure of a putative Histidinol dehydrogenase from Methylococcus capsulatus
rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase
total genus 120
structure length 382
sequence length 401
chains with identical sequence B
ec nomenclature ec 1.1.1.23: Histidinol dehydrogenase.
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4gicA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4gicA02
2M6KA 5I4KA 3HXPA 4FKMA 5CR9A 1N2CB 4OXQA 4FNAA 1KARA 4NNPA 5KOHB 3CX3A 1EFDN 1MIOB 3AERB 3NU1A 5B58T 3AETA 3UJPA 4LS3A 1TOAA 1FP4B 4INPA 3PSAA 4UDOA 3ZK9A 4M7OA 2AFIA 2PRSA 2OSVA 1MIOA 3G9QA 2ETVA 3R5TA 4LJSA 2Q8PA 1QH8B 3TEFA 1K7SN 2OV3A 3MFQA 5JJ5A 5M29A 5AFSA 2RG7A 3TNYA 1N4AA 3AETB 3MWFA 2XH8A 4WESA 5HX7A 1N2ZA 2R79A 2Q8QA 4HMOA 2PHZA 1QH8A 4BBPA 1N4DA 2AFIB 4H0FA 1KAEA 2PS3A 4WN9B 4NNOA 3MD9A 3GI1A 2YNMD 4N01A 4HMPA 2XQVA 4FI3F 5BVHA 4DBLE 5KHLB 5M34A 4WESB 5KOJA 1H1LA 4WZBB 4OVKA 3PDIA 4H59A 4WN9A 3ZTTA 3ZK7A 4HMQA 4MX8A 1K2VN 2MINB 2O1EA 3BE6A 5BVGA 4WNAA 3K1AA 4WZBA 4MLZA 1QH1A 2YNMC 2R7AA 4TKVA 3AEQB 4TKUA 3LI2A 4G07A 4XPIA 5BVHB 5M2QA 5KOJB 2AFHA 1H1LB 1L5HA 4MDYA 2MINA 3PDIB 3EIWA 2PS0A 3EIXA 4UDNA 4WZAA 5JOQA 4B8YA 1M1NA 3BE5A 4PAGA 3MWGA 4HN9A 5CX1A 1G20B 3AEQA 3TLKA 5BVGB 5FLYA 3LHSA 3K1AB 4WNAB 5GGXA 4MO9A 1QH1B 1G21B 4TKVB 3AESA 4TKUB 1XVLA 4XPIB 2QI9F 3AEUA 4FILA 2AFHB 1L5HB 1M1YB 2XUZA 1G20A 4OXRA 3HJTA 1QGUA 1PQ4A 3PSHA 4G09A 4WZAB 4GICA 1M1NB 1M34A 3U7QB 5CX1B 2PS9A 1G21A 5M3BA 4UTPA 3R5SA 2XDQB 2OGWA 5HDQA 5JPDA 1K75A 1K0FA 4ND8A 1M1YA 5JG7A 2X4LA 4PM4A 1N2CA 3AESB 2M6LA 4CL2A 4IRMA 5KOHA 3AEKB 3AEUB 3U7QA 3MINB 3ZK8A 3HH8A 1ESZA 1QGUB 2XDQA 3AERA 4K3VA 4UTOA 2OV1A 4INOA 1M34B 1FP4A 2WHYA 1KAHA 2WI8A 3ZKAA 2XV1A 5GGYA 2XY4A 3AEKA 1PSZA 3MINA 4ND8B
chains in the Genus database with same CATH superfamily
2O48X 4JEHA 3H3XA 3ULKA 4UPDA 1P2FA 1J8MF 1RQ7A 5HNKA 3MMZA 3EY9A 3IUBA 1K9SA 3H05A 3IKLA 1QGED 1OTXA 2EP7A 2GKOA 3O8LA 4H60A 4L9WA 4UNNA 3I61A 4LK3A 4IIBA 1XZAA 2FW1A 4P4GA 3DHWC 4BMDA 1XWIA 1Y4DE 4LDPA 1CFJA 4YQEA 1QGDA 4FE3A 3R3HA 4I9NA 3HUEA 3SBDA 2CJPA 3VVMA 3HDGA 4KRXA 3NRBA 4HDKB 5KTTA 2FZLA 4DWVA 4P1ZA 1JLHA 2PXHA 4XB6B 4F84A 1J07A 1D6JA 2OP1A 4M55A 4RJ2A 4X61A 3I1YA 4UBJA 5AW8A 1ZMBA 3UUEA 2NO6A 2ZT5A 3TMYA 1BG6A 5ERYA 3U26A 4MQFA 4O4IB 1T4MA 3TAXA 5LD2B 5BSRA 1US8B 4BLTA 3PEVA 4W1QA 4DNOA 2ZRCA 4OJQA 3UC5A 1MG0A 1TLFA 4E1BA 1T9AA 3CJTA 4QUHA 3ZU6A 3LOPA 2F55A 2XCRB 2GVDC 1ONOA 4RPKA 4XFJA 1XU4A 3QIAA 2AXNA 2HJVA 3E53A 4Q02A 4OHPA 4JI1B 4D4MA 1SD1A 2BGTA 4P5PA 4FS8A 1OJ7A 1W1IA 3H6KA 3QLEA 3UMCA 5HJ5A 1QKKA 2MINB 1ZUNA 3BMQA 4YYEA 1FYXA 1IY1A 1WB9A 1UC9A 2BHNA 3K2IA 4XEUA 1T9DA 1CQJA 5DIZA 3S8EA 1IBMB 1JFLA 3IUMA 4INZA 1YF3A 1JA0A 1FZTA 2G5GX 3GUUA 1FYDA 3G5TA 3KOXA 1HDYA 3B85A 3HUUA 3M0EA 2QTBA 2CNNA 5AKJA 1AE1A 3BZBA 2X8LA 4BQQA 1RNLA 2OC4A 2V6JA 4P3YA 1EP3B 1GQFA 2KJQA 1V1JA 5DKFA 1M34E 2JFXA 1W87A 4ZT5A 2VRBA 5BR8B 4KQJA 1XBTA 3ESCA 4HY3A 2B8EA 4K6KA 3UWPA 2V0CA 4LYYA 3QXSA 5KVVA 1DIRA 4HEHA 4IZIA 1O97C 4PGMA 3DMGA 4RE5A 4TKVB 4M88A 1K2WA 2A6PA 3OE5A 2V55B 2YXEA 4DQUA 3MCTA 4FFRA 4Q3BA 2NXCA 2RH5A 3F0TA 1JE0A 2P30A 4IUDS 2YXLA 4GUAA 3BORA 3DZBA 3KJNA 4DC9A 5DGXA 4ADSG 1C1DB 2BDUA 1ZEJA 2OO5A 2HTFA 4D79A 4F85A 2X4IA 1GTG1 1AZSC 2VDRB 3M89A 4Q1CA 1M3SA 1BJKA 1VP9A 2O06A 1XTKA 4JENA 4MEAA 3LC0A 3IUEA 2BMEA 1QZ3A 4O5AA 3P0JA 1Z6GA 3NGXA 1GEEA 4IFEA 3WIDA 4GP9A 1NXWA 4R2WA 4UASA 4IDCA 3BHMA 5CXUA 3EDRA 1XRMA 1QTQA 1R0RE 3BPSA 4O4HA 2A3RA 3NUQA 5HFJA 2G7ZA 3PC7A 4BMCA 3SM3A 4I4TB 3BJRA 4AG3A 4PANA 1Y6FA 1QQ6A 1V25A 2NACA 3DE1X 5G0UA 4QDZA 1JG4A 1PZGA 3JQ8A 1KU0A 4PAWA 3I2IA 5SY9A 1YJ8A 3OJ0A 1SVLA 2D1SA 4UCFA 4M2LA 4PX3A 1U0JA 2WZCA 5HBGA 3BMOA 6AT1A 3K6JA 5I4CA 3DFMA 3CLTD 1Y4SA 3DL7A 4FFWA 4RUKA 1UBHS 2NU8A 3GZTB 4P7FA 4JYPA 1SWVA 5F52A 2IOQA 5FL7D 2P2ZA 2J5KA 1G5PA 2RHMA 2P9CA 1BDHA 4A8TA 1BMFA 4Y7CA 4BBAA 4CMKA 4ZYWA 3G9QA 3OQVA 4I1YA 4NTZA 4KRGA 4X1YB 1I80A 3MBIA 4X20B 4Y2HA 3REQA 2HQOA 4LF9B 1M72A 1VTKA 5F9MA 5FTJA 2ZB7A 3AB8A 4DCVA 1HORA 3QPAA 3ANTA 4CTNA 3F2VA 3ZXSA 2ZTSA 1TW2A 3JZDA 3V6LA 2DHCA 1UPFA 3K1ZA 3QVTA 3KDAA 3PQ5A 3IFSA 4D9KA 4I1PA 1Z6PA 2OHVA 3AFNA 4AZTA 1FCJA 3X1ZA 4ASUD 5BQXA 4MHOA 1CUUA 4KODA 5A6VA 3BB1A 3E3NA 3ISTA 4YJGA 1DT5A 3GJRA 4Q3DA 3RSLA 3LHFA 5PGMA 1OWMA 4DBLE 3HSKA 3GNTA 3NH9A 4L3VA 4TZ6A 2XGGA 3RT1A 5J5VA 1I36A 3DXZA 4WNYA 5DFAA 2NPIA 2G06A 2X3FA 4KIWA 3BGWA 2OCXA 1NF8A 3TLGA 1X7ZA 3MWEB 3A4VA 3KQQA 3UTDA 1ZONA 1K2VN 2F9FA 2J4CA 4NESA 4XQEA 2DTXA 4C0WA 1E32A 3KLMX 2QLLA 4GWGA 5K51A 1ISHA 1L3CA 2P90A 5KSWB 2ODBA 4NFYA 1Z4JA 1E20A 4EFLA 4H7KA 1R88A 4US2R 4LZPA 1XMVA 2G1JA 4MMXB 2OO3A 4YRBA 5JHHB 4MDYA 3KZOA 3M2PA 5CK5A 2WBLC 1G20E 4TV9F 5LU9A 1WDLA 2B6HA 2F3RA 4ROTA 1QRAA 4RLFA 4BMPB 4QKQA 1CYDA 1MO6A 2YR0A 1IMJA 3IPRA 4RA9B 3R75A 3WB2A 4DDUA 4JV5B 1EAYA 2YUIA 2BMAA 3F6RA 2NTNA 4DRYA 3AX6A 1ODTC 2BKXA 2V58A 4R54A 4RFVA 2R751 3I5YA 3OZGA 2RAUA 3LLMA 1L4UA 3MMXA 3MT8A 1RAEA 2VTVA 1Z82A 4WLVA 2GBFA 4EA8A 5F23A 4NBWA 2WSIA 1KP3A 2ZSAA 3FCCA 3CXRA 2E89A 5IJAA 4Z5XA 3OURA 4QBHA 2JJMA 4KLNA 3P9RA 5B1EA 2WWFA 5KSPA 1YBMA 2Q7XA 4GSKA 2QRVB 3VZCA 3LPCA 4PLFA 2QTVB 1ND5A 2QRUA 1KO1A 4QTYA 1WW2A 3EC2A 3PDUA 1R37A 2W6ZA 1JIXA 1MO5A 1SCKA 1N3YA 4CUJA 2G3YA 4NE7A 5HTOA 1U11A 1RBZA 2AC2A 5BV1A 4RGYA 5A4FS 1ZOIA 3HEBA 3LLUA 1WXGA 2DP4E 3SYMA 2CMFA 1YQDA 3H87A 1GUZA 3T06B 1VP3A 3O7MA 2J1LA 2XRYA 4FEYA 1VJ0A 3ZEAA 4BGUA 4S05A 3MBKA 3NBXX 4F4JA 1C1HA 2FXIA 4YUVA 3B38A 4QQNA 3D8BA 3QZUA 5KYVA 3QRWA 4M60A 2BFFA 3LY9A 5DOZA 3W04A 2KS6A 5AJXA 1ZSVA 1DARA 3I1IA 3Q9LA 4C6TA 3F1LA 4BNDA 4JVLA 1U2PA 3CW8X 3JS5A 1TKAA 4XIIA 4AQDA 2XRZA 2FTKE 2XVYA 3MGKA 2RKWA 2FPWA 1E6CA 2O57A 4WXMA 3R74A 3W7VA 2RH4A 1IH8A 1PVVA 1PZXA 1JGTA 3ZTYA 1HOXA 3PQ6A 2O52A 1IAQA 1OPXA 2P2LA 2WWVD 4X44A 4RKWA 4BPBA 4KXYA 4ONEA 3R09A 4XEHA 3LX6A 4IZHA 1BJRE 2GT1A 4WK2B 2FQQA 2HFJA 2FUEA 2P2DA 4GOOD 3TLEA 4B3SB 3STTA 5DHPA 1UM9B 3OLXA 3LX4A 1ZCBA 1JW9B 3HJAA 4GUDA 2B20A 4RABA 1ZN8A 2JFFA 5EWLB 1X86B 3ZV6A 3G89A 2D4AA 4HGZA 1K7FB 1QB7A 5DP2A 2Q6TA 1J0DA 3W8EA 4ARAA 1WZNA 2AKEA 2X9GA 2QD4A 5EIOA 2QYHA 3MELA 4RV4A 1NR7A 1J1ZA 1RQXA 4PG5A 1BS9A 1ZP6A 5E4FA 1DTEA 5GY7A 3NVDA 2O2HA 4V2IA 5HF8A 9ABPA 4AKTA 4P5EA 4V39A 5D3ZA 4C4SA 1U2ZA 2ZKIA 3L0PA 4GZ6A 1OXXK 2JEOA 1YACA 3WRXC 1HPLA 4RJKA 2BY4A 3BREA 1GIAA 1W5SA 4QTUB 5TJHA 2WTEA 3ANYB 3D6MA 5GONA 3REFA 3CKLA 4PLCA 5ALQA 1UXOA 4O3FA 1CUIA 5AUPB 3KKQA 4J6FA 4QT0A 4BQEA 4B3XA 1ZGCA 4UMFA 3PFNA 3RR2A 3W6NA 5EESA 4QQKA 4OQYA 1TMYA 2AFHA 4TTRA 1QVWA 4BNUA 2RGCA 4H27A 1MHTA 4Y9RA 2QX6A 3OX1A 3ZWKA 4HAVA 1ZA2A 1DPFA 4YJDA 5H82A 3BA6A 1FYVA 1M1XB 3LO8A 1J23A 1QNFA 1SXJD 4RPIA 3O1JC 4NJOA 4ZICA 2AV6A 3K1JA 3AO0B 5TSDA 3CGGA 3G8CA 4LZOA 4PCLA 1QDLB 2NMVA 1IBCA 3A28A 3V4PB 2ECOA 1FXUA 3FFXA 13PKA 1K8YB 2DJ5A 1XEWY 3CUEF 1ULBA 4L8FA 1WX1A 1KI2A 2H7CA 3AG6A 3DDCA 1NWHA 3F6BX 3U4CA 1NNEA 4CPDA 1R0BA 3IE2A 1P0CA 4FCCA 4LHEA 1RWBA 4RK1A 3LZDA 4OMDA 2VEDA 3ZJUA 1TQHA 2ZWMA 2APJA 4TUYF 1ONBA 2KMLA 1DRWA 4ARVA 4UHFA 1ZX1A 1Q22A 2OLEA 3E5HA 4EG5A 1V1RA 1T6YA 2EKPA 3E1KA 4GR5A 4QDJA 4U2DA 4OHYA 5TXGA 3U7QA 2XUGA 1NDHA 1X9IA 2HC9A 4D9HA 3PRJA 3DNPA 4EG8A 2D59A 1O7JA 2ASVA 2QI9C 1N3BA 5CAEB 4CF6A 3CKKA 2C78A 2M9MA 3EEIA 3M9XA 1CB0A 2H1VA 4QEDA 4TMVA 1USWA 4UHDA 3KSUA 5ECYA 4N9QA 4ND8B 3VISA 2WWXA 4KGZA 3S28A 3LQ2A 1HF3A 4ODIA 2BUAA 5HIKA 3S2YA 1E2GA 1FS6A 2ZIZA 2JGJA 2O8CB 2B99A 3OICA 5CUQA 3T4EA 1XTTA 1VL1A 3ODPA 1EINA 3WMXA 2I2CA 3OFSA 3P0RA 4FU0A 5SICE 4M99A 2WSLA 5HS4A 1PLLA 2BZGA 2Q6KA 2UVDA 4CDNA 1F48A 5J4LA 3M1IA 3KX2A 2VP6A 1R6AA 2FSVC 3H7AA 1XMPA 4MK4A 1CXZA 2B5VA 1X74A 2REBA 4HDNB 1ZHOA 1O6GA 2ZTLA 3IVRA 2WT8A 2PAFA 1F0PA 5BP7A 5I48A 2XHZA 3M6MD 3HG7A 3L92A 4M36A 4GL2A 2ZJFA 2CLCX 3VPFA 1B43A 1WUTA 4HXEB 4JYZA 4V1CI 3AW8A 1T1RA 1NM5A 2YJZA 1O0SA 4AG5A 4O2RA 1CRZA 2NTYC 2YV2A 2PSEA 2CV1A 3EW9A 4X54A 4P7JA 2X42A 2RGBA 4HBZA 3UAXA 1XZKA 3OD5A 1T8WA 2VYVD 4I5EA 1U2EA 4E2YA 1HDZA 1QVRA 3EEBA 3UC9A 3IA7A 2Y1OA 3B6MA 5HYVA 3IIEA 5JEEA 2C7OA 1ZKMA 4J2HA 4O02B 2GCGA 3A25A 1ZJ5A 5B1YA 1RLIA 3G2LA 5A3QA 5EIBD 4X64B 3IAFA 4EG4A 5JD3A 4ALMA 3JASB 2XWBF 2JIDA 4ZD6A 4AURA 5IDXA 3JX9A 2FPGA 2QMOA 4HWGA 2IYQA 4ALLA 3IEKA 4P22A 1ABEA 2VRCA 4KIGA 1MFPA 3F3KA 1PYDA 1HEYA 4ZVQA 3UMRA 4CKBA 2H18A 3GLGA 1K06A 2I2XB 2MSKA 3D4IA 4FFDA 4TTQA 1OFGA 4E4YA 5E4TA 1HNNA 1MG5A 2IUEA 1EHCA 1F2UB 4H7JA 1H3FA 3Q5GA 1ESMA 4EECA 5LKAA 5M04A 1YDHA 2H5JA 1RMQA 3UMGA 4LRQA 1YO6A 2HJWA 1D1SA 2R47A 3T3EA 3NH6A 5FBRB 2JCSA 2P11A 5F2NA 5K9ZA 1OD6A 2B3TA 1QMPA 3ACCA 1Y9JA 2YW9A 4LQLA 4ZI7F 4BVGA 3NONA 3SZUA 3D4LA 3A3YA 2CMDA 4Q4HB 5DNEA 3LUJA 2VZ9A 1MB2A 3D8TA 3EWNA 4BXOA 4C78A 2I62A 3TL6A 4X1OA 3ZGZA 1G59A 1UH5A 1LF0A 2EKDA 4IV0A 4R1OA 2FWIA 3M3HA 4L0DA 4X7PA 3RRYA 1WMFA 3QKRB 1Y8CA 1RJFA 4IMPA 2QX8A 4O2AA 2P9FA 2WKQA 2FW7A 1EUDB 1I7PA 4W9NC 3TX6A 1RZVA 3F4BA 1DEKA 3IRVA 1MAVA 1AQ6A 1BXKA 4L50A 5ELLA 2QX7A 3BJIC 3N0RA 1QFJA 3NUZA 1UMBB 2C83A 5IUKC 5JV5A 4YRGA 4M1ZA 3NEJA 5TMPA 3WGJA 3SM9A 2EIHA 5H8WA 5C0OE 4I0WB 3K0FB 1KC1A 1L5VA 3FB1A 3MWJA 5GMOA 4C4AA 5KSYA 5IT4A 4NU8X 2X0JA 2O2EA 4KGVA 4HLUA 4JQOA 4J49A 3EPLA 2OESA 4JLJA 3FDJA 3DVQX 1VE5A 1PNTA 3HVUA 4HNRA 5JOQA 3IEXA 1NLYA 4TV8F 4U9UA 3W3AH 4B6EA 3I92A 4RSGA 1CUBA 1V11B 2Y2VA 2H52A 4EWLA 4E7OA 1F1JA 2FFHA 4C6SA 5L3QB 2NU6B 4K7JA 1USVA 3ETJA 2FZEA 2BONA 3F5QA 4YROA 1LPNA 4UDOA 2REQA 1HDXA 2AD5A 2PYIA 3K8OE 4FQ5A 4Z6KA 4HJRA 3ETNA 2NU7A 5BR4A 1BDBA 5I9NA 4FONA 3M4ZA 1U7DA 1EA5A 2XI4A 3T35A 4CTMA 4HGQA 4KQ9A 4F38A 4BFVA 3GNLA 3WB1A 2BF7A 5LSAA 1JB9A 4ZMBA 3K2QA 4ZVOA 3NWEA 1PJ8A 3H4MA 4P0PB 5D5HA 3PYXA 2O4UX 4JQSA 5IHPA 3ENNA 2XQFA 2C4NA 1Y8QA 2P3SA 3Q72A 5CFRA 3G8DA 1N78A 4XWYA 1TAGA 2YVKA 1N2OA 4PRYA 4ZOLF 1H5UA 3FVQA 1TU0A 4OMCA 1FY2A 3C1AA 3WLLA 3KZMA 3SEQA 4WBXC 1LPAB 3D7LA 4XSVA 2C31A 3VKFA 2V5AA 3QELB 4HB2A 4OX9B 3EASA 1U63A 2ZIFA 1TPZA 2W43A 2QL9A 4D74A 1CRWG 3IJRA 2EJCA 2QA5A 3LECA 1D8AA 3HDQA 1LDEA 3P9IA 1GNTA 1J5XA 1HGXA 4RENA 2GJ8A 2I55A 2WV7A 3WA7A 1M2HA 1ADFA 1VHJA 1JPNA 1GLNA 3HBMA 2HA0A 2NV6A 3IVCA 3DE0X 5DK4A 3FF1A 2OYCA 1N3IA 2DM6A 2VXYA 3CLSD 3TSAA 5I7HA 3O4JA 2JI9A 1KHTA 3CLVA 2H2IA 3HWX1 2G1PA 1RC1A 2FWJA 1YFJA 1ISFA 1B14A 3N9IA 4R7ZA 1J39A 1NW5A 3CZ5A 2XB6A 3HO6A 3UAVA 1P18A 2ZXFA 4OJKA 1X6VA 2XNJA 4IIYA 4B6OA 4F5WA 3CPJB 4KWCA 2ERCA 1E2BA 2W2KA 4IOMA 2G72A 1UZMA 2OO5C 2JRLA 3KQPA 1ZZGA 1VSBA 1KDYA 5BYKA 1M1YE 1GZUA 4D42A 3WWDA 1BX1A 4C7VA 3AHDA 4C87A 1KI9A 2AMVA 3IQHX 3KLOA 3N8NA 2W8BB 5F51A 2WFMA 4R1SA 1ZGJA 2QNBA 3QWHA 4JB8A 4LVOA 1M2KA 1CJUC 4EYOA 5KTYA 3JWJA 4C08A 3JAKA 3LW8A 1QKJA 4JDUA 3ESBA 2PKEA 4KCGA 2YJ5A 4DYDA 5JI2E 1GFIA 1QU3A 4TMWA 1L4BA 2JFUA 3DR5A 1T6BY 3CX4A 3VNSA 4YV2A 1RHJA 1HT1E 3PUIA 5AVWA 1B15A 4BTLA 2CUKA 2Q6VA 3SIRA 1EJ2A 4OOEA 1ZMTA 1X7XA 1Q21A 2NPOA 2OWEA 2XEDA 3R3XA 4HF7A 5BXYA 2A9KA 4H7FA 5F3WB 4H1TA 3A4MA 1AC5A 5LPNA 5GAJA 3UAGA 2RGWA 4UARA 4PQYA 4R6WA 1ST2A 4UQPA 4KVGA 4YJ3A 4AP5A 3I04A 3D59A 3I9V1 2JGNA 5MN5A 2P1RA 4G2NA 3LBYA 1LS6A 4FBGA 4EHFA 2C2BA 2G5PA 2PL5A 4F96A 1SRRA 1MZVA 4JCCA 2VDUE 1C9JA 1NUHA 1ZD8A 3OCZA 1KEZA 2YHAA 1SU8A 2V03A 3TOZA 4ALKA 3IBGA 1II0A 3PJRA 2VQ3A 3QE4A 4AFNA 3FUUA 4O0LA 5EXTA 1AKWA 1KJIA 4BRUA 4GI5A 5BURA 2BCGY 1Q11A 2VOEA 3C4QA 3KZCA 5CVVA 3VXKA 4CODB 3COJA 5L3SA 1HQKA 5FNZA 3W8NA 2NUPA 2DERA 2I8LA 4NG4A 3OZXA 4PWZA 3X3HA 2WJ6A 1JA1A 4HS9A 1FXSA 2PJDA 2X9LA 4CLHA 2Q41A 4EBBA 1YZKA 2NQ8A 2E5FA 3L02A 5K6AA 1JSZA 2X1VA 4FFPA 2BV3A 1Q7EA 2BF4A 3AB3A 1P2UA 3I6IA 4QIHA 3S2FA 2JGLA 3H11B 1EFHA 1SHKA 2ZJ1A 4IUBS 4YO8A 2PUCA 1ODSA 2P35A 2CCKA 1BHQ1 2L69A 3OETA 3GJ3A 1B26A 4AP6A 1S3FA 2YL2A 5B4UA 3SYKA 3TBFA 1Z0IA 2CMKA 5K0BA 4DV6B 4MS1A 1AS0A 4Q9LA 221PA 4IQ8A 4GOLD 3MD9A 3U44A 2AOVA 1KI7A 3DBLB 4J9VA 3RK1A 1ZL2A 4DQLA 4EMTA 3KUXA 3A6PC 5D2CA 1R1DA 1JNXX 5IDVA 5AP9A 3QBDA 4UM5A 4C01A 2BI4A 2CMGA 2AOTA 1N25A 3GJ5A 5D84A 3BXZA 5BNFA 3UJ7A 1UANA 3OT5A 3OQHA 1Y4UA 4JB3A 2CVZA 1GG8A 1PYGA 2F8MA 3G5LA 4I3GA 1IXZA 2Q9AA 1OTHA 2PZ8A 4AN4A 5CIWA 1GA1A 4EG0A 1Q1GA 3RYHB 1CVIA 1PS0A 2QW1A 4X94A 2CZGA 2JANA 1C30A 1CY1A 1DQRA 2PD4A 3WRWA 1WRBA 2VK2A 1YRQA 3HR8A 3ZW9A 5JSKA 5A4AA 1UKEA 2GARA 3OJLA 2G07A 4BFWA 1I2AA 2Y1KA 1KDZA 1GCOA 4BJ5A 3VKHA 1Z0JA 3BGSA 4YAOA 1PDVA 5KEIA 1HR0B 1GNLA 3C3JA 4MR7B 4N4AA 4RW0A 5ALRA 1QF6A 1JAIA 2R1VA 4L15A 3ZNOA 1X14A 4E1VA 3VR0A 3OM9A 5KTMA 2XXAB 4B8WA 1AG9A 3UJAA 1PQ4A 1Y82A 4TMXA 2F1HA 5EQFA 1W4AA 1SXIA 2FVYA 4PYLA 1J5PA 5T3YA 3TWOA 2E6UX 2ZU6A 2RAPA 4JUIA 3FLEA 4CLRA 3HHEA 1PYOA 4PRZA 1DCKA 3AVOA 1NVVR 4Q01A 3W34A 1VFPA 1QAMA 2YHIA 3MHTA 2BFMA 2B7CA 5JG7A 1NMQA 1TXGA 2CXUA 2DTDA 3UJNA 2OQ2A 3ICEA 4D4LA 1F8GA 5K6TA 1TYAE 3F74A 1S89A 2R11A 3E22A 2ZSIA 4TQGA 4RDHA 4C7OA 4WTOA 1KIMA 4TMTA 1Z68A 3D8UA 3MCAA 2QRGA 4FS3A 3Q9NA 5ECWA 2P8SA 1QFYA 3PWSA 3WWOA 5F35A 5IK2D 1W1UA 4EI7A 3JQCA 2GB4A 2FSUA 3BWMA 4TKZA 3RS7A 1TYBE 3LUPA 4LQCA 4W8GA 2VI5A 5TE9A 3D4OA 4UM8B 2WNSA 1OX4B 4OXQA 4WNIA 3VRHA 3ETLA 2JD2A 4NNPA 2MCFA 5F7XA 1AMUA 1E3JA 5LNK6 2C4HA 1R27A 1MIOB 2HPAA 4FXPA 1PR4A 4J03A 3R7BA 5CLHA 3R76A 3ZWNA 3LQFA 1O5TA 3O8OB 4BRZA 4TV9B 1LWNA 3EQ7A 4LYFA 3LA8A 1R0KA 4KTVE 3FHTA 1T0BA 3DL4A 5AHRA 2CXQA 2M6RA 3N2KB 5H9VA 1CLUA 1C3JA 1JMKC 2GN0A 3ZOZA 2YICA 4F11A 1VSUA 2A0KA 2H5EA 2OV3A 3TDKA 4BO1A 2ACVA 3DBHB 4KPEC 3JCZA 1E79A 4FMPA 4MPPA 4DLBA 6GPBA 3QITA 3LPNA 5F7OA 2F1KA 3OSUA 6ABPA 1IOWA 1UIMA 2C5EA 4GXRA 1KTVA 3ZWAA 4P2GA 3K70D 3I12A 4PN3A 4YRMA 1V8FA 4XVUA 2AFIB 2SKDA 4GD3Q 3VPCA 2UVPB 4GPIB 4AQYB 3UXHA 1QIFA 1X39A 2PX2A 3H04A 4YRDA 1YRWA 4UC0A 4WUTA 1HA3A 1ODIA 3ASUA 3KKEA 4KYVA 4LJAA 5AJYA 4TLAA 4L5CA 5DT9A 3RSCA 3V32A 4JT2A 4BFLA 4E5NA 4W5OA 3N7UA 3HXOA 2IW3A 1NBMA 1MTZA 4U0JA 5DWQA 1EG7A 5FFMA 1L5KA 2VYCA 3EHEA 1WSWA 4R2KA 3IV7A 3UHAA 1T5OA 1YHYA 3HSSA 3W7BA 1R4MB 1UPTA 2JGEA 3NRCA 4N7MA 4TN5A 4YB8A 4R1QA 4E07A 1OVGA 2WSSA 5I7AA 3FDIA 5ADVA 4JLBA 1NP3A 3U7EB 1N8TA 3AM5A 1NIPA 1UDBA 3RJMA 2ROQA 3VHLB 4RH3A 4C76A 3Q2OA 2JLRA 1C9MA 1QSGA 2XGMA 4E6PA 4K3UA 2NNWB 2G9NA 1DELA 3KPYA 4HQRA 3K16A 3O4GA 3OUTA 4EB6B 2O8VA 2WUDA 2AZXA 2V7BA 5DHAA 1VLVA 3ZHRA 4HAIA 5ESRA 1LW6E 5CT6A 2O8FA 1EFPB 2IY9A 3NVMB 3OECA 4KFTA 4RPJA 2A9VA 1XTZA 1N2EA 3IDFA 4E31A 2FSFA 3P9XA 2MYTA 4HHEA 1JFFA 1RAGA 4MYDA 2IZ7A 1P8JA 5AOCA 4DSAA 3HA3A 4I14A 2B3DA 2DR2A 1THMA 4D44A 1LLQA 2WU0A 2BCEA 1RLOA 5FR2A 1R64A 2X19A 3FTQA 2ES4A 5L7TA 3N8KA 1BE6A 3Q15C 5M7EA 3TBHA 2V4ZA 1QP8A 4RF2A 3HPRA 4OYHA 4TYWA 1R0XA 4A6XA 1AMNA 3KQTA 5IAOA 5CX4A 1AO0A 4Q9KA 3ONFA 5CEJA 3K9LA 3KWLA 4BMZA 2DJIA 1YI1A 4RS3A 3V46A 1XD2B 2ZTUA 3SKXA 2F3PA 2ORWA 4DJFC 4CM9D 5ILOA 4POOA 1D2RA 3KPJA 4AW9A 2OB2A 2MYNA 2C5BA 1ZGHA 3KHUA 5G41A 3R0XA 2XNDA 4B4KA 1FTWA 5T64A 4LJKA 3ROMA 4MQEA 4MVJH 1G41A 3MINA 3L0OA 1DRUA 2WFLA 5AVTA 4ZOCA 2EJVA 2BC9A 1SG6A 3CR8A 4HX2A 1N2CB 2IZ0A 5JD5A 1H85A 1O6BA 3PS9A 2OKGA 3SE7A 2ZYTX 4UE6A 1LS1A 1CJMA 1ZK4A 4FDMA 4Q1AA 4Q66C 4LI3X 1Z0KA 2DKOA 3Q11A 3L4EA 5HKBA 1GFSA 3W5BA 2R60A 3P2JA 1RHMA 2VDLB 2BKLA 5K99A 3CQ9A 4NIMA 2NP6A 2JEZA 1Q7BA 2AGVA 2PKWA 3H2KA 3PD7A 3W06A 1TFRA 1C3LA 5B2FA 3IHLA 1ZI8A 3N2LA 4J7AA 1T34A 4JS0A 1NM5C 3AU8A 1U4SA 4WKCA 2DEUA 4QOJA 1E1NA 3ZU4A 3OESA 2OSBA 4YC7A 3RVJA 1H8HD 3WHKA 4E2XA 2POQX 4S12A 3OJCA 4V0KA 5CA0A 4G36A 4LQ4A 3E05A 4Q05A 1JZSA 2AD1A 1FRZA 3RIYA 4RA6A 3C6YA 1N5IA 1PT6A 2NYUA 2I2FA 3H99A 4O2BA 3DMTC 4C1NA 2GM4A 4QDXA 3KWMA 1BKSB 4OAPA 3HCNA 2QT1A 4K03A 4RHTA 5EE3A 1GARA 2BMDA 1NOIA 3BD7A 5EWMB 5JS6A 2NUTB 1I32A 4TUYB 1KEWA 1MAHA 1WCIB 1Z6ZA 2PZLA 3NB0A 3QJGA 4O1HA 1O9HA 5FBHA 3SD7A 3DDNA 4KQWA 4AG6A 2XYHA 1KQNA 1WLYA 3DF7A 3FPEA 3L1VA 1Z9BA 4IDAA 4WESB 4Y30A 3VH3A 2I3GA 3G85A 2QKYA 2XKJE 4XARA 4B32A 1UKAA 2JAXA 2A59A 5KWVA 4ESHA 1WCWA 3L6EA 5KX5B 2ADFA 2ZULA 2J5RA 2OB1A 2KB0A 4MX8A 1SPXA 3KAKA 3O8QB 4F04A 5FEMA 3LJKA 2IW1A 4GPTA 3RSZA 2VQ6A 2XNSA 4CQMD 4HNGA 3TG2A 1MQAA 3LL4A 4UU0A 1MOSA 3O1LA 3PCXA 1IFXA 1TX4B 2J08A 2R7AA 3ADBA 3Q88A 4B84A 4Q24A 1YVPA 2Z5LA 4W8OA 1CUWA 3BK7A 4Q4JB 1VMKA 3M6UA 4E4TA 4IVNA 3UGTA 2OBBA 2WIGA 2EJUA 4JNCA 3TTSA 4KXVA 2VJAA 1NATA 1NQOA 3I45A 3I8OA 3AEQA 2ZR8A 3SLRA 3U4HA 4B3JA 4P0QB 4U63A 4JR2A 1TECE 1H5QA 4RNDB 1I4OA 1PR1A 3GJ0A 1K98A 3JYPA 3C5CA 4R0VA 5DXAA 3RBVA 5JQGB 4KR2A 2RHTA 2E4YA 2O4CA 3QOFA 2JFHA 2CJXA 3AEUA 3AVYA 1KETA 1W5BA 3RRJA 2ZWVA 1YA4A 4YUWA 4K6GA 4Q9NA 2CVHA 1MKYA 1QDUA 3U0BA 2HWKA 4OBXA 4REQB 4IXMA 4KE9A 5EOVA 3WB0A 2B61A 4A2QA 4BNIA 3IE1A 2C4MA 4XYBA 2FFBA 2WM3A 3OLWA 3PHBE 1JHOA 4I8IA 4KSYA 4PXYA 4ZIRB 2O9JA 3EXIA 1GDHA 4N3GA 3S40A 2WJ4A 3SSOA 2AN9A 3HA2A 3GRUA 5J4HA 5ALXA 4MV6A 4X93A 5DTQA 5LLDA 1YFLA 3AVPA 2G71A 3QKUA 4HLUC 4QUAA 4YQYA 5I9MA 2WR8A 5C5IA 1Z74A 3ZQ4A 3MLAA 2EG9A 2GRUA 4EA9A 2JLQA 1YB4A 4K9OA 1J1IA 2H1OA 1NP7A 4N39A 1M34B 3DUFB 3JYHA 2VYVA 3FJ1A 5KWSA 4NMHA 3R7LA 3G6KA 3VSCA 3IP9A 4DR1B 1OYYA 3ZLJA 4BQSA 4IHJA 1ZCJA 1P4GA 5G3ZA 1EFVA 5FUMA 3JAMA 3RC8A 1SG9A 3HM2A 3ABSB 3K9BA 4PO8A 5G0SA 4N6GA 1P29A 5H1YA 3T7TA 3IILA 4XM2A 3LT2A 3R6DA 4PO9A 5FTKA 4D8YA 4B3DA 3FKSA 4TTSA 3WQBA 4BY9E 5AM4A 2C03A 4BFXA 5B30A 2Y8EA 2JBAA 3AP1A 4CKZA 4ON9A 3C8ZA 3TCXB 3NWPA 4GKVA 1OGJA 2R2AA 3TUJC 4UATA 3FG9A 3ONDA 4DGSA 4D4KA 1CDDA 2IEBA 2HZBA 2FDCA 1L6IA 3C41J 4MWBA 4QOGA 3E84A 3KP1A 5AKHA 5BNIA 3EQ2A 4UHEA 2FG6C 1OV6A 2M98A 4JJFA 3SZMA 3VR6D 2A1UB 3I1JA 4Z0PA 4QFDA 1AKYA 4HQFA 4EHKA 1PFGA 3M6IA 1EX6A 3BFPA 4R31A 3VNUA 2H2AA 3NOQA 2CNWA 3V4OA 4H3KB 1OF1A 4RTOA 4MI9A 3LOUA 1MN6A 1CJVC 4RM3A 4LNUB 2GCEA 5EP1A 1C0LA 3L9XA 3WLJA 2DQZA 3W2IA 1WA5A 2C9BA 2PMDA 1J56A 3HRHA 2QTAA 3H5IA 5EG5A 2CK3A 3VDRA 4YWJA 3S2SA 4EQZA 5HK9A 3P4UA 1GSAA 2OZLA 4IICA 2J8ZA 1WB4A 1PW5A 3QMPA 4S1TA 3ABZA 4A5OA 1RWMA 2OK8A 1M8KA 3CLHA 1UR5A 4C3UA 4D02A 1Z38A 1CR6A 4R41A 3RSFA 3HV2A 1A8SA 2WUEA 1I3CA 1OAKA 2OKCA 2W2LD 3NOXA 3PC8A 3UKOA 2E2WA 2E9SA 3FROA 3A6HA 4FVTA 1C1XA 1KPHA 3HJGA 4U6QA 3DEZA 3CM0A 2PX5A 3RS4A 5KNBD 2FY8A 1SUWA 2EFCB 2UYOA 2YMPA 2Z83A 3GJ4A 2AK2A 2QIPA 1I2MA 2E7ZA 3I9JA 4QYIA 4AL4A 3THYA 2BJWA 3BWCA 3KEQA 2RHGB 1ZIOA 3PFKA 3UMJA 3WQSB 4YDQA 2W4MA 3PKIA 2NTVA 5UKDA 2IQ5A 1SUAA 3EY4A 4E94A 3TLKA 4BMSA 5BPHA 1W6RA 3ILYA 3K9HA 3TK1A 1E1CA 2Q5HA 4X1KB 2H1RA 1WOMA 5IM4A 2EKBA 3GEBA 4M8SA 2V7EA 2R68A 3WMRA 2DETA 2JHPA 1JVBA 2IELA 3O2QB 3W1VA 1W76A 3OAAD 1ZRMA 3JYNA 1HFWA 3OPYB 4PYJA 5EIWA 1DKPA 1TK9A 1FIUA 4I55A 3HGTA 3UHFA 4ZVUA 5EJ6A 1SXPA 1K6XA 1S4QA 3JZMA 3NAGA 2ZQYA 3A2MA 1JZTA 3DZIA 1YVEI 4Q4AB 4RELA 4TYQA 3WLMA 1G3QA 1P4HA 3LDGA 5DT2A 4YP1A 2M6LA 4DIMA 4ZOLB 3TGPA 4Q1FA 5IBQA 5K8JB 2ODTX 4WKBA 5HIJA 2YOHA 3DO6A 3GPIA 3O92A 4QU5A 4DMFA 5KVCA 2VG8A 2PWYA 1NMYA 3VAAA 1FNCA 2XOKA 2VWGA 2Y67A 4YRQA 2EGGA 2R44A 2WJYA 1VCOA 2IC5A 2GXSA 3LVFO 3T15A 1IATA 3GP3A 3LCVB 1BXZA 1VOTA 3L41A 3L6CA 1C8LA 3DLBA 3DGEC 1DIHA 1QO0D 2WMDA 1IHDA 5L4SA 3C3DA 5AI6A 2OLJA 4R9RA 2BR4A 5DNWA 1JEYA 4X92A 1UJBA 3RDPA 3UVEA 4C0BA 3Q0IA 3RKRA 4YMHA 1U81A 3EVCA 5HSGA 1HX7A 5MGNA 5FNVF 3LBAA 4KEAA 2DC1A 2IXEA 2C1ZA 4P58A 1DWPA 2R84A 3BT7A 2QUJA 3L7AA 3SN6A 1XZLA 2PCLA 1GPH1 2EZ4A 2ST1A 2GHTA 3GLHB 1MH9A 3NM4A 4O4JB 2E55A 3R5TA 5AI5A 1MAWA 3FTEA 4LDJA 3EVDA 1X8LA 3SOPA 3FTNA 2JGDA 2A0YA 2O14A 1M0SA 3QFSA 4R0MA 1HQDA 3AETB 3W2HA 1AKEA 1XZMA 3D3NA 3EUEA 4JBGA 5EMKA 4YJ2A 4LYJA 2O2GA 4XA8A 4J2TA 3CF2A 4ZP1A 5AIAA 3TW8B 2AG6A 3QYAA 5ITZB 4CM3A 2A86A 2VPPA 2ZPAA 1LQTA 2H00A 2PS3A 4CM8B 3CKMA 2XQIA 4I8XA 3B20A 4M1WA 2YW2A 3W5SA 3RSGA 3SZGA 3WDKA 1NE2A 4FFSA 4YTEA 1PUXA 2RI0A 3I37X 2CF6A 3IO5A 4FOOA 4LXGA 1NF2A 3ZIAA 4KBYA 4QU0A 4WDRA 1MEEA 1MAUA 1Y4ZA 2HX1A 2ON6A 2WAYA 3MNFA 1ZEMA 4NR0A 4PNHA 4W6QA 5DW3A 4LBVA 2EKQA 2Q4RA 3ZTTA 1QYXA 2B30A 1YT5A 4J4BA 1PJZA 2HMSA 3EWIA 3NUGA 5L6MB 3R3UA 3TIIA 3KVOA 1Q50A 2GJ4A 4OK3A 4R2XA 2J09A 4R8MA 1M8PA 1RRVA 4B85A 1GUDA 1SVWA 4E70A 4XD7D 1L4NA 1WVGA 1J4AA 2X0IA 1ORIA 3DTTA 2C3YA 3QEAZ 1IM5A 3DO8A 2AR0A 1LVUA 3U80A 3ZGVA 1AK2A 1VYUA 1QQ5A 4YUZA 2J3LA 4ZWNA 1H66A 4WASA 4X3OA 1X3LA 4Z0HO 4R01A 3MG9A 4OH7A 1R12A 1LX7A 4PAGA 4I1SA 3NHMA 2A5FA 1P62B 2CF5A 4C0JA 4D9MA 5CEEA 5I8PA 1A9QA 4L9SA 5F1KA 1DB3A 4OU4A 2F1IA 8ABPA 3Q7TA 1KZYC 2LW7A 3EWAA 2PKYX 4G41A 2VTKA 5CDFA 3MJCA 1ZJZA 2VCHA 3P94A 3GCGA 4W99A 1XVLA 3HDTA 3PUVA 4A0HA 1EZ1A 1P9WA 1NQAO 2DRIA 1NE7A 2AFVA 2QZ4A 5B3JC 2IBTA 4XYGA 1DX4A 1P61B 2CE7A 3K0AB 5DX8A 1UBTS 2NSJA 1VYTA 4OSOA 4YAGA 2C2WA 4PQEA 3A9RA 1MJFA 3R77A 2H1IA 4LC9A 2JHGA 3ANLA 3UH0A 1I51A 3RC7A 2WF8A 1Y5NA 1G2IA 1B1AA 1ZZEA 1KMIY 3WICA 3JATB 4AF7A 3OHMA 4EZEA 2RGYA 4D8VA 1NFQA 4OUDB 2VS1A 1XVVA 4C22A 3V1UA 4E51A 4QQFA 4ZAGA 2FNAA 1YU9A 2ZCVA 3RM3A 4ZDJA 3TZ6A 3UXEA 1PQPA 1MMFB 3ZLBA 2FP4B 2WMYA 2B1IA 2HI0A 2D2FA 3HDVA 4EI9A 1OREA 1VXOA 1Z0SA 3PWKA 3R5KA 2HWUA 4QPJC 1CS0B 4PZAA 1TUIA 3UMFA 4BO6A 1T13A 2DKNA 1JH8A 1HTBA 1Q5PA 1KXJA 2XMBA 3HJCA 3F5SA 1ZH0A 4MV9A 2SHKA 3M5CA 4JJ6A 4QBKA 4ZQEA 4UTNA 3LAWA 1CB7A 1FYEA 4L4YA 3S99A 4HH1A 1E5XA 1IHOA 1UZAA 2PA0A 1Q0UA 3FY4A 2PQ0A 1DAFA 2FUG1 3QEMB 3SHFA 4B45A 1XDSA 1BSVA 2Y0CA 2CVFA 2AI2A 4QM6A 3OFJA 1VLZA 2QG4A 5EE9A 2GNAA 4M9SA 5BN5B 2I87A 2Q4DA 1W5TA 4HBGA 1XPOA 4MUYA 3QXCA 1E6KA 3M6VA 1QIHA 4FSHA 2X2PA 3KL4A 3KV1A 3F3SA 2COEA 5DE3A 5CG1A 1UPXA 2VP2A 4LAFA 3T1NA 1A7UA 3WZMA 1UXHA 4B3HA 5JMWA 2JD1A 5JVDF 4EPRA 4ZAZA 4WGFA 2GBLC 3KUUA 1Q83A 3FLMA 4NNOA 2LXNA 5FBQB 5LJLA 4EFNA 1TA4A 2W7TA 4OHMA 1ZAKA 3JQBA 3PQCA 2G76A 5TJ9A 3GGDA 2Q9BA 5D1NA 4K2AA 3NNSA 2AZ4A 1JYSA 5E1OA 5DZSA 1BXGA 3EXG1 1T8RA 5I9LA 2JH8A 2QXYA 2FMIA 3HYRA 3S7ZA 3A0RB 3VGPA 2N75A 4B0OA 4BO8A 3Q0EA 4OFZA 1NF3A 3ZQKA 2NV2B 4BX9A 1FX1A 3RRZA 3VO9A 4RD3A 2QORA 3LNTA 3PP8A 4A26A 1RYEA 4HPJB 3NNDA 2ECKA 4ZODA 3O90A 1ISSA 5AW5A 2UXBB 2KM1A 4LWQA 4UNIA 1EJBA 4IS2A 3EGDA 1F20A 1QHHB 2XAUA 4Q7JB 4BQPA 1SQ6A 2G1AA 1LI7A 5AHOA 1PJ3A 4HZIA 4MO2A 4B48A 3D3WB 1P17A 1NW6A 2CB9A 5EKXA 2X5KO 4D96A 1PKEA 2N42A 3L0SA 4TRJA 1ZL0A 5AHKA 3B5IA 3EQZA 1REQB 4MCAA 3RIHA 4FFBB 5E6SB 2XTMA 3A3OA 2NN3C 3JRNA 5K8UA 1J7KA 1TMOA 3NTOA 1F8XA 3W79A 2JFPA 5LP6A 2WV9A 3A1EA 2IOFK 1AGNA 1H2WA 3TOXA 3BXXA 1S8FA 3UCFA 1YB2A 1U2SA 2H3HA 1JLLA 3B6IA 1KJWA 1UBLS 3FYUB 1G21A 1RCTE 1O58A 2NZJA 1PT9A 3A1FA 3T5TA 1YIOA 1RDFA 4W6ZA 3E3LA 3GBPA 2OZKA 4V3BA 4F4UA 2YYZA 2DH5A 4AKEA 1A76A 1M1ZA 1SBHA 2JKYA 3ORHA 2R1ZA 4DMMA 4C0SA 4XWGA 1Y8RB 3ZCTA 3BJZA 3QU4A 2GQ0A 3AM3A 4GBMA 2IS2A 2C20A 1QE0A 3CWCA 1DC4A 4PCAA 4DT1B 3I32A 5B6IA 4XCVA 1MO2A 4QU8A 4BGIA 2JLVA 3OLYA 4W1PA 4DLAA 3TECE 1IE3A 2GRAA 5B7NA 4DMRA 1Q3TA 2Y93A 4OO3A 4P98A 1SVNA 3SR3A 4GVXA 2A5GA 2NNLD 1LK5A 1UOEA 2YZ2A 3FMVA 4HRXA 3UK1A 1OA0A 2ZREA 2WD9A 4YRSA 4HNQA 1MJGM 3FLAA 3AXSA 4HTFB 4MCHA 3EXHB 1HG1A 3SHQA 2VOJA 4D8UA 3QE9Y 5ADWA 1FNDA 4YRZA 4AS1A 2Z2KA 1ECFA 3SOZA 1GZ6A 1LSJA 2ZANA 2I0FA 1J8FA 1E6MA 5MFPA 1QZZA 4M22A 1LLFA 3O7WA 5FAXA 3QPCA 4X7RA 3OE7D 2AG5A 4ALJA 3G8BA 3DZHA 3CYFA 1EE9A 3KAPA 3TRFA 1VIDA 5K20A 1YJ5A 3QG1A 3G23A 1LI5A 2I2BA 3UO8B 2IU6A 3S27A 1ZICA 2FPIB 1T8UA 1Z6YA 3BWDD 4PCUA 3WYAA 1J8VA 1OYVA 5SY6A 1B8OA 2GWHA 4EMBA 1CE8B 2BSQA 3DEAA 3GRFA 2YCLA 4GMKA 4RD4A 3UYKA 1TC1A 4L5AA 4LRWA 1Q15A 2PG3A 5BYBA 2ZI9A 3IPCA 4QPCA 1E9AA 3QVGB 3T34A 5KB3A 5JUWA 1MJHA 1AQJA 4X24A 2AYXA 3ENKA 4I5IA 4C5CA 4Y2RA 3WB9A 4U02A 4HMPA 1TMGE 2EXXA 1TM2A 2HOQA 1QP7A 1P0IA 1YR8A 4PTYA 4B6JA 5D51S 1T8TA 3HY3A 2GVZC 2WVHA 1UJ6A 1F0YA 4N5LA 4CM9A 1OR8A 3IKVA 2I4TA 3TFWA 3WS7A 1TJYA 4E2FA 3DOOA 2ZE8A 3TM5A 3HXMA 1XZGA 3CFYA 5CVUA 3ZCRA 1G60A 2JDIA 4MS4B 4BNJA 2SCUA 1MPTA 4Z9AA 3CG4A 3AI3A 5CLGA 1GL9B 1KQ3A 1TZ2A 4ITVA 2G7MC 2VTEA 5KNDH 5I6DA 2WU3A 1UKVY 4H7HA 3ZBTA 1D1PA 2CUTA 2I3BA 2PVSA 3H5VA 5CIQA 4EJSA 4CCSA 1HDCA 5ENDA 3OKPA 5FPSA 3K6RA 4LOHA 4BNXA 4RY0A 4L2IA 5J43A 1U28A 1ZR2A 3SQNA 4GE3A 4UU8A 1IG3A 2BPOA 3NP9A 5KC8A 4GX0A 4KDFA 3ZKWB 1YC2A 3GPBA 3CLRC 3VOAA 3GP5A 4QUJA 2UUBB 2O3QA 4G1EB 4TMZA 3L0ZA 2BEUB 2A0XA 4IMJB 4D6YA 3QWBA 2DB3A 5JBQA 1OAAA 2XE8A 3AU9A 4KWTA 1Z83A 4U7GA 4Y6OA 1EX7A 3P2IA 5DEIA 2GXAA 4AJ2A 1UT6A 5CDHA 4EW3A 1L1RA 1RLTA 1M1NB 1H8HA 1ENOA 5DSTA 1GTVA 2PLFA 3NLLA 4GM4A 5G40A 5HKAA 3FSRA 4WVLA 3WIVA 3H9UA 3SBEA 1I4WA 2O3UA 4FQ7A 3USZA 3Q4GA 2X0FA 4CFZA 4CKXA 4MVXA 3IIJA 1JIKA 5JD6A 4PF1A 2FV8A 1SELA 1COZA 4PHGA 3I28A 4MLCA 1AKTA 4PM4A 4RANA 3NHRA 3F49S 2XA9A 4F3NA 2BR5A 1TQDA 3VTKA 3IAS1 2P9GA 4FWBA 2WWRA 3K35A 4EF6A 3R7SA 4KQIA 1MX5A 2JHAA 3A6DA 1RVDA 3CLUD 3VJLA 4BQRA 1RZRA 1ZXBA 5C7YA 2O07A 1FMLA 1S3IA 1QAOA 3VZQA 1BU5A 2XMCA 2H11A 1MOPA 2CJFA 3X1YA 3O8BA 4RH1A 1ADGA 2GO7A 5EE0A 1GM5A 1LTQA 1NC1A 3PQEA 2XB8A 5JMOA 1P4RA 1QIEA 3D9QX 1NBOA 3MQ4A 4HDKA 1U94A 3U3OA 3CUVA 3DLPX 2OVBA 2CJWB 2F59A 2RGAA 5MHTA 5KOIA 3PYMA 3HN7A 1X8KA 4YCLA 2JH3A 4M1MA 3OKFA 4D9GA 5TVGA 3MJHA 3EDOA 1M73E 3LRTA 1EDDA 2FJUA 1ONPA 2XJ4A 4I6JA 1JAHA 1Y8ZA 3LY7A 4HP8A 3WGYA 4URHA 4MVJE 2ZPTX 3I4LA 1N7JA 3RF7A 3SXPA 1B8PA 1JEDA 3G82C 2ZSHA 3AR8A 3ETDA 1EVYA 1YR1A 2Q0XA 3B8HA 5JJ5A 1GEGA 4HLNA 4AT1A 2Q4OA 2WTXA 3EGIA 1P1FA 1VKHA 2R6FA 4H4EA 4RORA 3ONEA 1QKIA 3A31A 3NT2A 1E5LA 1PZFA 1W88B 4MKFA 1Z3IX 3A7DA 3TNFA 5ALSA 3SQOA 2X2EA 3QGMA 4FMDF 3R3ZA 4NE2A 1KAEA 2H54A 3MJEA 4B75A 2Y1LA 4E4RA 2Q4BA 4A8JA 1VKNA 2FQYA 3GCZA 3JD1A 4JGGA 3PC8C 1UMDB 2XWJI 4XOIA 2I29A 3LCJA 1FVXA 3QEOA 1NXVA 2VDMB 2XQVA 1OLOA 3U6KA 3ASYA 3KYDA 3OZVA 2PMEA 5BQ3A 3PQ4A 4OBBA 3RTCA 1AM4D 1FFEA 4IX1A 1Y42X 3LSTA 4M1QA 5K8IA 2C5GA 2REOA 4UHKA 3TOSA 1YJAA 3TMAA 2CBXA 3GLFE 4MZXA 2Q9UA 3A4LA 4AMVA 1K08A 2DLNA 3AJ9A 4EG7A 3AT1A 3DKKA 3SCZA 3DD1A 1P1KA 1SUDA 2QTCA 4UXJA 2Z4TA 3QKWA 3DCJA 4HEA1 4LVNA 4TKVA 1N2JA 4LF7B 5DB4A 3FI9A 4JP5A 2O7NA 4YCNA 5ICCA 1UXGA 1XPUA 2I9PA 2GPAA 3NXSA 5AYVA 3VBCA 3EIXA 1A5TA 3UUGA 3ZE1B 2I7XA 3CR7A 4I5FA 3FHCB 4OG2A 1QIKA 4DTCA 3MJFA 2OV8A 4FM9A 1KK3A 2O5VA 4WW0A 5FDFA 1C1DA 5DLDA 4RD1A 1G8SA 5IJ9B 4AZ0A 1SOUA 3C87A 4HUQB 4OJNA 5BWBA 3IEVA 1R9NA 3BSSA 5A06A 4FR2A 3K0SA 1EHIA 3KKMA 2GF9A 4KX5A 3UYLA 3TZCA 1UWLA 1E1RD 2X0KA 3AI7A 3R7DA 4OXRA 5IJZA 4TL6A 4CUZA 4ZI3A 1SB9A 1UFRA 1G0OA 1KZ9A 2BTQB 2Y92A 4FEGA 4X45A 1LV8A 1NW3A 2BMWA 3EGVA 4C30A 3BJMA 1NRJB 2YWCA 1SXGA 4I4TA 4TXHA 4E12A 3C85A 3L0DA 4Z86A 3LE8A 4NMWA 4PLGA 4UHBA 3TCKA 5CYPA 4R1NA 3E5RA 2CL7X 1KJZA 4GX5A 4MVYA 4R9UC 5AQEA 5EPUA 2WJWA 4G1CA 2P77A 1YR3A 1SVUA 4RLQA 3H7IA 5J9FA 2SNIE 4CG0A 5JCPA 3ETCA 3OFVA 3TOVA 3WNDA 1U0TA 4LMBA 1UBFA 2ACKA 5CLJA 1SHJA 3NTRA 2FFQA 2J9GA 2PPVA 2I4IA 3HXTA 3ZJ4A 1C0IA 3A2KA 2FMFA 2C2YA 1FFDA 2LDBA 5HCIA 4HWSA 2SECE 1Z17A 1OQAA 4BEBA 4GRDA 3FGZA 1NGSA 1WVIA 3GEIA 1XKTA 4NY1A 1N3LA 4X1YA 4X20A 2N9UA 3AIIA 5HFNA 4AMBA 3FMGA 3T5PA 1DJNA 1K7XB 4R1PA 4U3JA 4R5MA 3RWMB 3ZGNA 5AESA 1O4WA 2GN8A 6ADHA 4QJ3A 1E7MA 1ZMOA 1ITZA 1JLSA 5D85A 3HDHA 4AAYA 2OOSA 3GGGA 3UWOA 3EG9B 4HLDA 2FPOA 4IIXA 4LFCB 2VSXA 3OQOA 4GGOA 1FFYA 1KFEB 1USIA 1GGEA 1WKCA 2Q2OA 2YV5A 2DUJA 3PJEA 1T2DA 4C0AC 2Q8PA 1QH8B 1IPFA 1ZJJA 5LC1A 2GUGA 4GU5A 4D0RA 2AVNA 5IN4A 3IAHA 2XCTB 5K4HA 1L4HA 4XSGA 5JCOA 4L57A 3HCDA 1ORDA 1Z5OA 3SNHA 3TW0A 2CFSA 8ADHA 2V97A 2JAOA 5DNDA 3OQIB 1RKBA 2ZVPX 3HYCA 3DAFA 4Q3NA 3UFXB 4DWJA 5B4VA 3WISA 1Q7CA 3K2BA 1HQCA 1NKTA 1WXQA 3GI1A 4BUJA 2I7CA 1IONA 1PFVA 4UM7A 4Y0VA 2UZ0A 3N7AA 2OTCA 3AUAA 3S1AA 2ODEA 5HR5A 2VPZA 3I5XA 1MH1A 2RHHA 1UC4B 3PYLA 4UEQA 3RYFB 4QGGA 4I50F 3F96A 2ZYGA 3LP8A 4O0MA 1DBWA 1G8HA 3D7NA 2AR9A 4FIZA 4RA9A 5D86A 5FWXB 1GQRA 2ATIA 2CXOA 2ZKLA 2G6BA 2Z56A 4G5FA 3HCRA 4P32A 2VYND 1C7ZA 4GZ3A 4OHVA 1E4EB 2WYUA 4G4SP 1ZH6A 1BQEA 4HQLA 2VEOA 4BB0A 3U3JA 3V8PA 5K01A 2HW8A 3MTAA 2EERA 2EYUA 3RHFA 4FD2A 5KOJB 3N39C 3PNSA 4Q47A 4QVIA 3HLTA 2DCMA 4ZCPA 1SAYA 1KEPA 3OQJA 2QTHA 1JWAB 4BP3A 4JB2A 3LHDA 4YX9A 2M1ZA 4RHXA 3ZV4A 3OTHA 3ZBPA 3TZQA 1BN7A 4RZ3A 2QRVA 5CH8A 3NANA 1TL7C 2XD4A 2XE4A 5LM3A 2R7LA 3FUCA 5IANA 4Q1EA 4AY2A 2UUPA 3FVWA 1SU7A 3IAUA 5C5CA 2CE2X 5J2TF 2GUWA 4MWEA 2E4WA 1CUSA 4BOYA 1O57A 3I2FA 1ISRA 3LRXA 3Q3HA 4XPIB 3DPUA 1SRQA 3DLCA 2VQSA 1MVLA 2I6SA 3B53X 4UOEA 2IX9A 5EZSA 1GZDA 2QTLA 2LZ0A 2QMZA 5JAHA 1DAIA 5AJUA 1ECLA 1Z33A 2P8JA 2TMKA 4WEQA 4YBRA 1I14A 3A9TA 3HA7A 3C43A 3WLSA 5HOEA 2GCOB 2I34A 4LCBA 3VZPA 3UBMA 2WIDA 1E3TA 3GRKA 2OBMA 3N75A 1I1NA 1YK0A 2O3TA 4WECA 1H2HA 1D2HA 1V5WA 3EVBA 3LLCA 4A8PA 4MP6A 1ESZA 3JQ7B 2PBZA 3QVOA 4G65A 4H7PA 2LCQA 5AW0A 2XDAA 3C2QA 4G89A 4UEJA 3V80A 3AMVA 2V0GA 2F43A 3IT3A 2IU0A 3VGJA 4YPVA 1G7CA 4PPQA 2EL7A 1EWVA 5BUZA 1RWQA 3W2TA 5CTAA 2VN8A 1Y6GA 2JI4A 4IWNA 2JK1A 3GNSA 1CZNA 2TMYA 4V0RA 2GKGA 2PCJA 1IY0A 3RQSA 1Q77A 3OCWA 1JN0A 2R86A 3K9WA 2GAFA 4B83A 4GMDA 4XJTA 3KKLA 1G5RA 3VYRB 1ZINA 3EXG2 3QFRA 2WHRA 2IHBA 5H80A 1L4KA 2OHOA 5EWLA 4D99A 4H1HA 5ICMA 1L5RA 2IZ1A 2JKVA 3ZZUA 2JPDA 2ZYSA 1U8TA 1P1IA 4D3DA 1PNOA 3ZE7A 2B2NA 5J59A 1R6DA 1U0OC 3CRW1 1UP7A 1Z5NA 5DF1A 3WYGA 5SZIA 1IY2A 4GVPA 4KL8S 1V71A 3WNBA 3PNOA 1QF9A 3O0TA 2Y9MB 4AYWA 5CA1A 5CCDA 1RHUA 3A9VA 4HNAB 2CLKB 4BN4A 1H05A 3F9RA 3W5VA 1XZJA 2Q3LA 4J0GA 5A0FA 1G7TA 4LHYA 4DKXA 1P0QA 1YV9A 4EIWA 4F2HA 5I9IA 5K0EA 2XITA 1RYHA 1Q2UA 4K5QA 3WOHA 4DUGD 2XPCA 3N76A 2QZSA 1Z4KA 1S2DA 4G5QA 5EYPA 4NH4A 1H3EA 1NIJA 1A5SB 3HDJA 4BV9A 3KC2A 4H59A 3LGSA 4TSKA 1GZHB 1EUQA 1ND6A 5K2OA 4MHTA 4XJXA 3TNDA 2OVFA 1U8UA 5GJCA 1GR0A 4AJOA 5DWDA 1MX9A 3AF3A 4Q19A 5AMXA 5JZ9A 4HMQA 1N9GB 5EQJB 4YP6A 5BN4B 4QASA 3LM8A 4OHZA 1NV9A 3H2GA 1LTHR 5A3VA 1H9BA 4F3CA 5BV8A 3OJXA 2VSNA 5KNCD 2C1XA 1TEXA 3ZOKA 2W0SA 1OGYA 4GR9A 1M7BA 2H2FA 1VHTA 2WYWA 3QBVA 3MT7A 3CH7A 2D5AA 4EW2A 3FNFA 4V1CA 4LA4A 4OYLA 4UMEA 4C7XA 5BQFA 3VHXB 1B8UA 2WFZA 3GELA 2A5YB 3OFNA 2FI1A 4KXWA 3ND9A 2WJVA 4HAUA 1RQPA 2GDJA 1JRLA 3KQSA 4MYRA 3DLTA 1WZIA 4JLUA 4WV3A 1AX9A 4MYCA 2HO4A 2JIOA 4TLCA 2O8BB 3AV0B 3L04A 4IDDA 4M54A 4ZVMA 4G0WA 3R8CA 2A0UA 1T1SA 4DZRA 621PA 3DL2A 3MT0A 1ECJA 4MWDA 1HYHA 4PX5A 4FB5A 1ADBA 3KR1A 5CAEA 5EKDA 1M2OB 1KKMA 2KHZA 4YRAA 3HABA 2OECA 3GNQA 4K9MA 3M6LA 3QOYA 4QYXA 2WVJA 1PX0A 1YZNA 2HUPA 1FVHA 1QH9A 1I3NA 3G1TA 4ND8A 4N3BA 5JVDB 1JBEA 3FN4A 2DGDA 4YCAA 2KQUA 1FLVA 1R8SA 2ZVQX 3C3CA 3E5NA 1KO5A 1VL8A 2Z6QA 3X2EA 2O2IA 1D9ZA 2O8CA 1Z2AA 2R8OA 1QHGA 4NLLA 2I6FA 3Q5DA 2XXBA 4BWFB 3W6OA 4AM8A 1DZIA 3MIZA 2QRJA 4MVJF 5IWCA 4BZWA 5IXYA 3EFBA 5CT8A 3T1QA 2V9CA 3GT4A 3GMDA 3O3MB 2RHOA 5BXQC 1XJ0A 1SBCA 2HGSA 2WLTA 4ZVKA 1VMAA 4P5DA 3TQFA 2G36A 3PUXA 1GITA 4IMIB 1FFAA 1N9ZA 3TG8A 4BO2A 2NYVA 2FPKA 3BM5A 1ZGBA 3DCYA 1T2FA 4HDNA 4ZVNA 2VNJA 3GJSA 2JJYA 3IKMB 4ENSA 4QUDA 3KPVA 4F6LA 3V1TC 4BMYA 5BSEA 1IJBA 2J07A 1EFKA 2D5BA 4ZO4A 3KPWA 4IIDA 4MQFB 1Z37A 4JP8A 1JR3A 1M54A 4UULA 3I09A 3V9AA 2XWQA 4CFYA 4P33A 1XEWX 1ATIA 3MSCA 5IT9A 3VYWA 1E4YA 1E94E 4S0XA 4AWXA 2WIKA 3EPPA 3KTDA 4I4IA 1W5AA 2V5VA 2FMXA 2F4NA 3IMCA 1GZSA 3EZNA 4TXNA 3Q3IA 1KY4A 3WC4A 2O0JA 2CWDA 3F4KA 5FT9A 2WF6A 3D2CA 2DPHA 1QRUA 2ZBGA 1GA6A 2P2GA 1VA4A 2ZBUA 3LDAA 4FQ8A 5D3MA 5LB2A 1ZUNB 3BMQB 5A5GA 1JDBB 3KL2A 4Q3CA 5U1PA 3K73O 5EXPA 2WSBA 1L7DA 3L1JA 4IDHA 1UP4A 5K3OA 3JQ9C 2AQKA 3U6BA 3H0KA 4BIMA 1ZR4A 2LWIA 1F2UA 1QOZA 4MGZR 1U4NA 3IJPA 5HCNA 4EJSC 2ZM6B 2C5HA 3RUAA 2JIZA 3VX3A 1U28C 4PYQA 4QYTA 2O2DA 3OEWA 4UD2A 4B3TB 1U5AA 3D6FA 1U99A 4A6EA 1I3LA 4KU4A 1GNVA 5JZOA 5EIAA 2P0YA 2YWEA 3BH6A 4ZV9A 1NYRA 1JVNA 4OIFA 4KVZA 5TEVA 1FFSA 3CVUA 4Q4HA 4Z9BA 3EZLA 3KQHA 3AIMA 1W36C 4HUTA 8MHTA 3HNOA 1V3TA 4ZC1A 1OC4A 1HKHA 3QKRA 3U0VA 4W5RA 2VP0A 4QD3A 1YDWA 1YZGA 2R7MA 2BSXA 1E3DA 1EUDA 1NDQA 1VSQA 2QXUA 4UDXX 5EZYF 5GGXA 3WFIA 1P72A 5SZHB 5KINB 4V3CA 5EAIA 5ENVA 4ZGWA 3WAGA 3EMBA 1DTWB 3K1YA 3NAMA 4EHJA 1D0VA 3VJMA 2EFJA 1NTRA 1NRIA 3ZWOA 3OE7A 4W82A 4L5IA 3K0FA 3RG8A 3VAYA 3NALA 1PR2A 1N8KA 2JCGA 4GGPA 5G4LA 3ZPXA 1V3QE 1T4BA 2QPTA 1XALA 4AICA 5IAKA 5H9WA 2OBXA 1W4CA 3V7UA 2ZI4A 2O23A 4NCKA 4OQNA 5K1ZA 3IDSA 3VZRA 3JQ8B 2D7DA 1N32B 2HNBA 2ZBFA 4R2LA 1V11A 1KOJA 3AF5A 3GGOA 4PAQA 1TO6A 3FCAA 4Z2AA 1I9CA 5L3QA 1KVQA 2NU6A 2QF7A 3FZQA 2MU1A 4J0JA 1Q91A 5T3UA 4MEJA 1A98A 3BRCA 3I2YX 3R7AA 4BVHA 1P80A 5LD2C 3R5XA 4YP7A 1UKCA 1ZVJA 1E0AA 4CW7A 4LRUA 2ZE5A 2HA7A 1GGJA 2B83A 3FTCA 2H7VA 1I2DA 2F67A 5L9AA 4MYHA 4BWGA 2EBHX 3FCUB 4Y2VA 4HDMB 4PC1A 3U4QB 3BEDA 2QG9A 5CXXA 1GQOA 4FEAA 4JOSA 3OJFA 1W59A 1UBKS 3SEFA 3W7AA 3UY4A 3RVLA 3G2MA 4WZZA 3BRQA 1WAMA 4NBUA 2PH3A 3QBEA 5FOWA 4CIDA 2CL0X 2Z4RA 4RZQA 3FJYA 4OUKX 4B4WA 3H9QA 3HRKA 4B09A 1RM5A 1OROA 4I3HA 3LYHA 4P86A 2UXDB 2GYWA 2L18A 2E87A 3I6QA 1QB8A 4IBOA 1DXOA 4A8JC 1CRPA 1L8XA 3DKVA 4DE5A 4Q3OA 3GFVA 4FJ0A 1SKBA 2ZBRA 1TRKA 3QELA 4RZHA 1JALA 4RXTA 3W5DA 1ZHFA 3VKUA 3JV7A 3DWEX 3KBOA 4LX8A 3HHPA 1L5QA 2DUUA 1O95D 1RE1A 5D87A 5AUOB 4C04A 4U8HA 4R6XA 5FJIA 1F2TA 4R16A 3TLGB 5EUCA 1QLHA 1YHNA 3N87A 1E9SA 4RKRA 3CH6A 5HDBB 1WE2A 3GLQA 1K9VF 1RD4A 2WUGA 4FGKA 1NUQA 3LIIA 4QXAA 1BA3A 5AIBA 1XN1A 4U7FA 5CYFA 2YZKA 2XBUA 1H8ED 2V9PA 5J23A 1OT3A 2VF7A 4B9AA 5IDQA 2VNIA 4B80A 4NZ9A 2P68A 1QWOA 4TPKA 3ZVRA 5KI6A 4F60A 1AD2A 4FMCF 3TAUA 5JSQA 1X1RA 4QX6A 1C3EA 1ZN2A 2G77B 3M1YA 3TS1A 3GRPA 4D8WA 1B73A 4O8ZA 3FUXA 4QFCA 5FI5A 1YJCA 4JXJA 2W8BA 4OK5A 3G13A 2AE2A 4PHCA 1RQNA 3SJAA 2C42A 1YHZA 1PV2A 1TD9A 3NIBA 1NX6A 1NU6A 3O9VA 4FR5A 4NJEB 4XOUA 3H8WA 5IJXA 4OGFA 4YLYA 5INTA 2UUCB 4G5RA 4LMRA 1N5KA 3W77A 3KQUA 3OP1A 1U1IA 3EFHA 1TZJA 1ZESA 1G291 1PS8A 1U9CA 4KXUA 3SP1A 2H4WA 2OILA 4Q16A 121PA 3K3PA 3CY6A 4IWYA 3V4SA 1KTIA 4EJ6A 5CGZA 1Y80A 1JQLB 1BX0A 1JX6A 2EKZA 2IEIA 3WLHA 5KYYB 1XZNA 3A10A 1YU6A 2XMDA 1FSSA 3EC1A 2ZIAA 4U2EA 1P4JA 2H4JA 2DQKA 4IKPA 1FX0B 5A4JA 5FTMA 2IZ5A 2JS7A 1WW8A 4FMDB 5CPFA 3EIEA 5DN6D 1NKSA 4BAZA 2N1MA 4JJKA 2AKYA 1E8NA 3D7RA 4GLOA 4EYGA 1Z0UA 1E3MA 1E7SA 1KSJA 5E9QA 2O0MA 2YXBA 2DCUA 5JFGA 2MSLA 4I9HA 2O1WA 1HV8A 2AJLI 2PH7A 3IBCA 4JJ7A 4YCCA 5K45A 4GNKA 5ITSA 2BFFB 3FZEA 3E9RA 1J09A 1MBZA 1Y1PA 2EF0A 4IR7A 4C6TB 5HIMA 2IP2A 2E1PA 2BDEA 3GAAA 4K6OA 3FF4A 4LY0A 4URWR 2DFLA 2IOFA 5EXSA 3ZKAA 4DQVA 4CEJB 4GMFA 2P9EA 1XPJA 1U8ZA 3NTQA 4OI4A 1E3LA 3DSRA 4Y3UA 5E7MA 3ROPA 5KBYA 1T4CA 4JH0A 4DCGA 1FK8A 3SY8A 3M49A 1KH3A 3FSGD 4NATA 4BO3A 1GU7A 4C6HA 1ULZA 5JDCA 3BH7A 1KZGB 1Q14A 5BWOA 3V3TA 3IDZA 2XVAA 3H11A 2EJTA 5JCOC 4RE6A 1GT91 1R15A 3FAZA 4JYAB 3UNXA 1CD5A 2QB5A 1E2UA 1RPJA 3HC7A 4NEGA 1M2FA 3SYNA 2I80A 4BC1A 5IKEA 2QOEA 4MTLA 1NMZA 1CFZA 1HDEA 3PTLA 1GDDA 1HTWA 1RCUA 1ZG3A 2GBGA 5AH0A 4P4UA 3AB7A 3Q3GE 3ROZA 3UMYA 1S2IA 2J6IA 3SEZA 4BQFA 3OTIA 4LHVA 4NENB 4BNFA 3AVTA 4NPCA 4BGVA 1COWD 4ZAYA 3ETEA 3EDMA 3BS4A 2AWNA 3NDRA 4CI0B 1UQRA 2EWMA 3T0IA 2GEBA 1H3NA 3K5HA 3UQYS 3DYIA 3P4XA 4TGLA 1FA9A 3NBAA 1UBCA 3D0KA 1NSYA 3C6ZA 3ICOA 3PE6A 1Y1KE 4FI3C 4CXMA 2ATXA 2Q2WA 1WM1A 4YR9A 1D6MA 3TXXA 5ALVA 4D26A 4ISCA 3DCNA 3MMNA 4GDMA 1LDMA 1R4AA 3GRAA 4ZAXA 5GONB 4DNQA 3RYHA 4OA5A 4B47A 2DBVO 2HSDA 1CIVA 4JUCA 2G9VA 3VC2A 4D9CA 5JATA 4ZEWA 1V7PC 2HKIA 1VB5A 1VI6A 1T10A 1YCDA 4CLEA 5FRDA 4XTRA 3BGDA 1TA9A 1Z36A 5CLQA 4YAIA 3ER8A 1KO4A 3VOBA 3TW6A 5A4KA 1ZVVA 1NJ5A 4L95C 3KYCB 2MDTA 3B9QA 3GUCA 3C3KA 4RWZA 2IEGA 1I1HA 2QTZA 2NSHA 4A0FA 5KHOC 3T1OA 5DASA 4L28A 2J9FB 3I9NA 4LN1A 2XXAA 2NPFA 2J30A 5K8TA 4ARBA 4LSMA 4OHOA 1TZKA 1I4LD 2PGDA 4J0DA 4Y6QA 3LQYA 2H8GA 2BBOA 1AV7A 2GAAA 2XDYA 3AONB 3RUFA 4DIKA 4ZJUA 5T7BA 2C5FA 3OP4A 4KDEA 4MV3A 3H3FA 4W7IA 1OWNA 1DFIA 4XX0A 2AN3A 4GS5A 1W36D 3LPAA 1PNQA 3FPSA 5COQA 1YMUA 3GHYA 3S8MA 1LVGA 1P5FA 4QVGA 3JQEA 4FBMA 2ID4A 3A2LA 2D1FA 3IBTA 2W58A 2N0SA 3DE5X 1T2UA 4FNGA 4DMCA 1Z8NA 3COSA 1JMVA 3BX1A 1V1RB 1VJRA 2C29D 2J0QA 4F1KA 3U7QB 1Y1SA 1BCRB 2WU1A 4PX9A 2G08A 3KHSA 4AC9A 2PJZA 1XE3A 3C4VA 3LBFA 3FDFA 3OPNA 2FWRA 4Y6RA 1HDRA 3AJDA 2OAQ1 1OX4A 1DKOA 3ZBUA 1YASA 4LKRA 3EA0A 1QHYA 3H9BA 3C8DA 2D0OB 3F7TA 4YACA 2GZ3A 2XDQA 5FA6A 5I7FA 3UT5B 4G0OA 2ZAGA 3IIKA 4LXXA 3W5IA 3C3MA 3O8OA 4TV9A 3T3OA 4I50B 1YZ3A 2G8LA 4EYKA 1GZ4A 1UBSB 3E23A 4A03A 1WTAA 4R3WA 3QJ5A 5F21A 3GLIE 4OQFA 2J3QA 5JSHA 4N8EA 2VH1A 5FV7A 3N2KA 1Y0BA 2B9EA 2C8JA 4H4CA 1GSOA 2VHCA 2XTJA 5K0NA 3UXMA 3BHJA 4RVGA 2OCGA 3ME5A 3PIIA 3DBHA 2PX4A 2QJOA 1U2GA 1XZIA 4PAOA 1AHPA 2VYNA 4OQ4A 4D3YA 3K5IA 1USGA 4OBEA 3IR6A 5HM6A 4IKOA 3CCCA 4P08A 3DFKA 4OAQA 1VBNA 1CY0A 2IYSA 2PZMA 3BAFA 5SYNA 3P5BA 3VI3B 3RTAA 4AX4A 3G3EA 2AFIA 4RADA 1ZJ6A 4AJLA 2UVPA 1NUAA 1QCYA 1ECPA 2CYBA 2Q1YA 2HU5A 1XTQA 2QN2A 3PDHA 1WULS 5AVQA 1SCNE 4LJSA 2QNRA 4EKDA 4RVHA 4ESEA 1QHSA 1WY7A 4JD5A 4PIVA 5J2TB 4GE0A 1MLDA 2I6XA 1U4OA 2D1QA 2RHWA 3U3XA 4G0QA 5B1DA 1OTYA 1TVMA 3PEFA 1ZS9A 4PG4A 2F1RA 3OZBA 3NC4A 3SNKA 4C0KA 4TRRA 2LVBA 4NFSA 3ZDBA 5FL3A 3HU5A 3AJRA 3MS4A 2IEDA 3B1KA 2Z5FA 3D8NA 3KQOA 4X90A 5TX7A 4YO7A 1L8LA 2FW0A 5JS8A 3ZWYA 2C59A 1LPSA 3EIQA 5JXGA 5CGQB 2O1XA 1HG0A 1UEIA 4HB4A 2IV3A 3RIGA 4DCUA 5HRCA 1Z2EA 3OEYA 5JH7F 4FZ5A 2D54A 2VUSA 4J16A 1E3EA 1XMQB 3ZGXA 5C1OA 1ELOA 2FCAA 4PEVA 5FBZA 3T95A 4EB6A 1VLQA 4BE4A 1IEXA 3AG5A 1KFJB 3AILA 3D3EA 1G18A 1LNZA 1VBKA 2AKAB 3EMVA 1T1JA 1EFPA 2P9TA 2RDMA 1VRWA 4FCTA 1JHMA 4RVUA 3TIGA 4J6EA 3D8HA 1UUFA 3RSQA 2QUIA 4CEHB 1V43A 1VI5A 2R65A 3N8HA 4WLOA 3UPUA 2IYAA 1V5IA 2YNMC 2ZR9A 3GXBA 3QHQA 1VHQA 1P6UA 2HBRA 3OX2A 1T9CA 3T9EA 1ZITA 2FHPA 2Y1XA 3V7NA 4Y0NA 4DY6A 3VO1A 1UBMS 3GRVA 1SULA 2VDOB 2X9QA 3LDFA 3OMWA 3EJWA 1ZCAA 4WI1A 3QK7A 1Z7GA 4I9UA 1XDGA 4JHXA 2B5WA 1XNQB 4UHJA 3PWZA 4MUGA 4BATA 4R9SA 2H5IA 1T9ZA 1X38A 4JK3A 4YY3B 2C7RA 1TVCA 5TPZD 1LPBB 4OQQA 2IX3A 2MWMA 1EGVB 4QTZA 5E8JA 1TDJA 1GTL1 1XD2A 1XNJA 1JIUA 5IARA 2XT9A 2XGSA 1IXYA 2Q62A 1E63A 4FILA 3UJBA 5IT0A 2PANA 4QPZA 2VUHB 1QTIA 1ADCA 1SKQA 3GEGA 3LWDA 1YFKA 1I4EB 1M8GA 1LZLA 3OC0A 2K2WA 2OOKA 3OSZA 1F2DA 1DOAA 4R1TA 4RD0A 1E2PA 3P8ZA 3QH4A 4RIHA 5GZ6A 2H65A 4JP3A 1J2RA 2A88A 3CNNA 3ZD9A 3QUBA 3FYDA 4QELA 4R05A 2VZEA 1KC3A 1N2CA 2WD8A 3UQZA 2ID7A 3CUTA 5JT1A 4E3ZA 4I6EA 3I01M 1K27A 1HDOA 5BMVF 3SKYA 4ZZIA 4QDUA 4D45A 5LQUA 2ZBPA 4ZANA 1C9KA 2PWPA 4V0QA 5JZSA 4JI8B 3HV0A 4L9RA 1QU2A 2YIJA 3OCYA 4F06A 3GH3A 1AU9A 2G9ZA 1OFTA 1TUEA 2NLOA 4UJ3A 4OD0A 3USES 3PTAA 4S1NA 4TTPA 2XADA 1EXNA 1XRNA 1Y1QA 2HF9A 2XT0A 4G1VA 1MX3A 1RFGE 4NBKA 4BX3A 4ZDIA 3TTVA 2O2CA 4BWVA 1Z3CA 4OMFG 2IHVA 2XYQA 3C70A 3TTUA 1WV0A 2AA3A 4CDGA 2OM2A 4IF6A 4MKXA 3PXCX 1Q2XA 1M74A 2ZE6A 1TZMA 1XYYA 3F6PA 1SUIA 1ZMXA 4LHZA 5A7GA 1S6YA 2P9QA 5KJCA 2PY6A 4BO9A 2WYOA 2CCJA 1C4KA 4KQGA 1H65A 5DSZA 3GWZA 3ZHBA 5EWMA 2DUMA 3A9SA 2NUTA 4N0PA 4TUYA 1OYWA 4MIYA 3RUHA 4U7WA 1Y8QB 3KKKA 1P7VA 4Q03A 1A4UA 3ZY3A 1AURA 3L6BA 4WESA 2C94A 4M0FA 1K8XB 2Z6AA 4ZTZB 4XWTA 1I8TA 2JASA 5FLEX 3KLBA 1HYBA 4KNVA 3R3VA 1VHWA 2VSYA 1EQUA 5KX5A 2R5FA 2GFQA 2IUUA 3O8QA 2ZPUA 4KR3A 1FL9A 1MABA 5IHXA 1YGYA 2D2EA 1HO3A 4IQGA 3H5NA 5HQTA 2OP0A 2CLEB 1MJGA 2X8AA 4IIJF 2VJBA 4EJFA 4CIBA 4YR7A 4Q4JA 4KLZA 2AEFA 1KOFA 4ZJZA 2DXIA 1TZCA 4JI5B 4JBWA 2OK7A 2O8DA 4DCPA 3F6SA 3LGAA 2EW2A 3CV3A 1B23P 4BDSA 4FW8A 4QHTA 4FDUA 2C8LA 2GR9A 1DAGA 1KYQA 4FYIA 4FZ3A 5AKXA 1G1AA 3EYWA 1G38A 4JKIA 4X8HA 3WTBA 3V2UA 4EG1A 5L95A 5K09A 1IPHA 1GPKA 4Y6LA 5JQGA 2Z6UA 1E0SA 4D46A 3NHPA 2W2KB 1G8JA 2O3JA 4C07A 3EIWA 4P80A 1T4GA 2Z57A 1KF0A 2KBFA 3PWTA 4OL9A 2WF5A 4REQA 4X95A 5IC5A 1WKVA 3A6LA 3MWGA 4BVAA 2O59A 1XWFA 3OLCX 3NJ8A 4YQZA 3VYVA 1O87A 3UV3A 2Q5QA 3JAKB 1ZVQA 4QWWA 3D0RA 5DV9A 1ZW1A 2C04A 1DAPA 2Y1GA 1JA9A 5HJ2A 4B73A 3UG6A 4KREA 1JKXA 2IUFA 2D1TA 4S35A 2CT8A 1I0IA 3FPGA 3NATA 1YL6A 2PSJA 1HZZC 2WIJA 3RWOA 1Q12A 1ZY2A 3P9ZA 3HB9A 4RL6A 3V42A 2W42A 1M34A 3DUFA 1OFUX 3OLZA 1J2YA 3IVXA 4DLLA 3R2JA 3JY6A 3MQ2A 4KE7A 5EJFA 4HDAA 4ESOA 4GZMA 1J8DA 2VF5X 1HT3A 3L77A 2C9ZA 1BXRB 3KUKA 4BQIA 1E7QA 3RO7A 3VU9B 1PL6A 1H22A 4Q7EA 2ZUFA 3HH8A 4L4XA 4LBZA 5ED4A 4QM7A 5GIOE 1MRNA 4TWBA 1L6RA 4NK4A 3OVMA 8ATCA 2XIJA 3E2IA 3CEJA 4KB5A 1YRHA 4KR9A 1XN4A 3DGFC 3WKAA 1DQZA 4FYHA 3U9SA 4ZALA 3P26A 1HLFA 3PT9A 1EP2B 4DFDA 4DJAA 3G5MA 4B81A 1WB5A 4MVJI 2Z98A 3GK3A 4N3AA 4YAFA 4LWPA 4GEGA 1DL5A 1DX9A 4OMUA 1WS6A 3M4NA 5DX1A 5NULA 3W0LB 2ORVA 4EELA 4E5SA 5HVNA 3OOHA 4FYKA 5FOSA 1EXMA 1MVNA 3HADA 2Z4SA 4FR0A 4ZI7A 1EIWA 4X8MA 1F9EA 4LOKA 1LFAA 5ETJA 2P67A 4H08A 1HYQA 4EMUA 1E1YA 5IX8A 2JJ1A 5DIFA 1DDGA 2FOXA 2RB4A 5C8YF 1H6CA 2WILA 3E35A 3SFTA 1ZIYA 4PLTA 4YGXB 5DYYA 5LZ7A 1OZFA 4BEVA 5EJEA 2Q46A 5EUBA 4BNNA 1DAMA 1DKMA 4GECA 5ALZA 3AR5A 3TLMA 4LHXA 3AVQA 1XCBA 2V9ZA 4JBLA 4LNUA 2GESA 2K7ZA 2XUFA 3KJEA 7ADHA 3BTOA 3DUWA 1ODFA 4AZSA 3HXQA 5EZYB 5A62A 4XLLA 3KFXA 5GV7A 1ZNZA 1QP4A 1XELA 5LQSA 4NV3A 2PUFA 5TRTA 3QX3A 1Y8AA 3OTGA 4PC7A 2NO5A 3W6PA 3B12A 1OXSC 2RBEA 1V5EA 4DRZA 1SWWA 4JFRA 1NVMB 5H16A 3WDMA 3ZDEA 4OM8A 2AJTA 1HLPA 5HFAA 4ZU6X 5LN1A 1MV8A 5EHIA 3LOQA 4NAHA 4AUKA 4DHEA 5B64A 4MA0A 4DA9A 1KHHA 2NVWA 4BLSA 2X0DA 4LYAA 5AXCA 1G16A 2XLBA 2ZJYA 3N2GB 2DLCX 3RVDA 2Q5IA 3BQMB 1JR6A 1QC5B 2JF0A 3HWRA 1EVIA 4QHSA 4TV8A 4A7PA 4RULA 4JIGA 4AVYA 3FFBA 5C52B 2OV6A 4BNHA 1VJTA 5AVXA 5KQLA 3QX7A 4K9RA 2IPOA 1YB6A 3SC3A 1QHFA 1Z5PA 4UKDA 1LCIA 3FE2A 4OQZA 1L5GB 2FR1A 2W37A 3UJ3X 4NQRA 1EXDA 3TJRA 3HL4A 5EXXA 1Y89A 3DTVD 5GZ3A 4NCIA 1I30A 1OXMA 3VV2A 1V4VA 2W9XA 2C9MA