4GICA

Crystal structure of a putative histidinol dehydrogenase (target psi-014034) from methylococcus capsulatus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
401
structure length
382
Chain Sequence
SMTEVKIKRLYTGDADFASQLDRLLAWSDTDIHQRVTEIIGCIRRDGDAALVELTARFDHFVVDTAAALELPRDVLEAAWQALPAEQAKALREAAERIRAYAERQKLDSWDYREADGTLLGQKITPLDRVGLYVPGGKAAYPSSVLMNAVPAKVAGVPELIMAVPAPRGELNALVLAAAYISGVDRVFRIGGAQAVAALAYGTETVPRVDKIVGPGNIYVATAKKLVFGQVGIDMVAGPSEILVISDGRTDPDWIAMDLFSQAEHDEDAQAILISPDAAHLEAVQASIERLLPGMERAEVIRTSLERRGGMILVDDLEQAAAVANRIAPEHLELSVESPEVLVESIRNAGAIFMGVLPTSGTARFSSPLGVYDFQKRSSLIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Histidinol dehydrogenase
publication title Crystal structure of a putative Histidinol dehydrogenase from Methylococcus capsulatus
rcsb
source organism Methylococcus capsulatus
total genus 120
structure length 382
sequence length 401
chains with identical sequence B
ec nomenclature ec 1.1.1.23: Histidinol dehydrogenase.
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4gicA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4gicA02
3AEUB 4M7OA 2AFHA 4OXRA 4FNAA 5KOJA 3AERA 4LJSA 4XPIB 4MX8A 3HJTA 1QH8A 4UTOA 5JOQA 2OV1A 1M1NB 4G09A 5BVGA 3AESA 3U7QA 3HXPA 1K7SN 5I4KA 3CX3A 4OVKA 4TKVB 1KAEA 1G20B 3AEKA 1MIOA 1N2ZA 5KOHA 5AFSA 5B58T 2M6LA 4WNAA 1L5HA 3BE5A 2OV3A 3PSAA 2OGWA 4WN9A 3PDIB 4G07A 5BVGB 4NNPA 1EFDN 4WESA 1M34A 3BE6A 4HN9A 2XQVA 2YNMD 2R79A 4MLZA 4ND8A 2RG7A 3R5TA 4WZAA 2PRSA 2PS9A 5GGYA 1L5HB 2XV1A 4WNAB 3MD9A 2R7AA 4WZBB 5JJ5A 1KARA 3MINA 5BVHB 1H1LB 1KAHA 3K1AB 2QI9F 2M6KA 1M1YA 1N2CB 3AEQA 1M34B 5CX1B 1QGUB 3AEKB 3TLKA 2XUZA 4H59A 4ND8B 4TKUA 2MINA 4PAGA 3HH8A 4HMPA 2YNMC 2AFIA 2AFHB 2ETVA 5GGXA 3AETA 5KOJB 3AERB 1FP4A 3EIXA 4PM4A 1QH8B 2PS0A 4MDYA 5FLYA 3UJPA 4MO9A 3ZK8A 1PSZA 3AESB 3U7QB 3TEFA 2XDQA 2XY4A 3ZK7A 4B8YA 3MWFA 5M3BA 1MIOB 2WI8A 3EIWA 4UDNA 1G21A 5KOHB 3G9QA 1ESZA 4HMOA 1PQ4A 2Q8QA 1QH1A 4N01A 3ZTTA 3GI1A 3AEUA 4INPA 4WN9B 5HDQA 4K3VA 4OXQA 4WESB 4XPIA 1TOAA 4DBLE 1M1NA 4H0FA 3LHSA 3LI2A 2WHYA 4TKVA 3NU1A 4WZAB 4HMQA 1XVLA 4FKMA 3MINB 2O1EA 2PS3A 2XH8A 1K2VN 4LS3A 1M1YB 3AEQB 5HX7A 3TNYA 5KHLB 2OSVA 3R5SA 3PDIA 4TKUB 2MINB 4GICA 5CR9A 2AFIB 4UDOA 5M2QA 2X4LA 3AETB 4UTPA 3MWGA 4CL2A 5M29A 5M34A 1FP4B 2Q8PA 1K75A 3ZKAA 4NNOA 1K0FA 4IRMA 2PHZA 3MFQA 2XDQB 4WZBA 5JG7A 4FILA 3PSHA 5BVHA 1N4DA 1H1LA 3ZK9A 1N4AA 1G21B 3K1AA 4BBPA 5JPDA 4FI3F 1G20A 1N2CA 5CX1A 1QGUA 1QH1B 4INOA
chains in the Genus database with same CATH superfamily
2RH5A 1ISPA 4JOQA 2F1OA 3TVDA 1NFRA 2B6NA 4QFMA 4DGQA 1JN0A 1UM9B 2R4UA 5F9FA 5KQSA 4JUCA 4ISCA 1GTMA 4Q1AA 1Q1GA 1AMOA 5ALQA 2DWPA 2EAUA 2OBFA 5HJ5A 3ZN2A 2UZ3A 1UDAA 1E7WA 2FAXA 2HBYA 1ZVKA 4FDLA 1AKUA 2J0UA 2RI6A 3EW9A 3SHOA 4CW7A 2F48A 3OCYA 4RNDB 2ATCA 1NT4A 2P9GA 5I7SA 1VJGA 1GU0A 2ZIFA 4IH1A 2X3FA 1VP3A 4UNSA 4WNAA 3U1VA 1AA6A 3D6UA 1A8HA 2VPXA 3M6UA 3OKCA 3WX0A 2F43A 4CU2A 3KXKA 1CUWA 2WWXA 1INLA 3H5IA 2P9FA 4EOGA 3CLRD 4V0OA 2P9EA 1TJ5A 4MLZA 3I6IA 4IV5A 2JKZA 3PCXA 3UN1A 1MENA 2XCUA 5BRAA 2VK8A 1B8UA 1Z2NX 3OIWA 2H16A 4B9AA 1WZ2A 3DSRA 4DIBA 1GSHA 1Y8RA 3BSSA 1KKUA 1XZMA 3WQBA 1W1WA 4MUAA 1BROA 3QVSA 1RWMA 2IHUA 3ZGNA 1C3JA 1ZVQA 2OVFA 4LJ7A 4N5IX 3T1OA 3WBKA 2B21A 2H1SA 1I36A 3T4EA 3ZLBA 5KB3A 5ESWA 1PF7E 2WJ3A 3A6PC 2YXLA 1IHDA 4FEYA 1N1DA 4PF1A 5EQDA 5LNK1 1X19A 4CUKA 3FSEA 4IX1A 4KXQA 3D6TB 4TWZA 2HRQA 2OENG 2DRIA 4IGFA 4WECA 2C7OA 3EXAA 1IVNA 3SU8A 4EJSC 3GHHA 4UDNA 5JJBA 3TPCA 4DV5B 1ZD4A 1PDOA 4M99A 1K0UA 1Q0ZA 3NX4A 2QRJA 3ND8A 2PUJA 2Q99A 3QVGB 4PG4A 1T0UA 4Q9JA 4GWGA 5NLLA 4EKGA 2ZJAA 2NU8B 5EHXA 2HRZA 3OE7D 4IDGA 3LQFA 3C85A 1U1FA 2AE2A 4DQVA 1BFUA 4O2AB 1NJ2A 1XU9A 1NBAA 4ZHSA 2MYTA 4Q7EA 1G59A 1ZMBA 1W52X 3WYGA 2VHJA 4DV2B 4FKMA 3TCKA 1Z4PX 5F7JA 2ODQA 3K3PA 2UYQA 1TGYA 1QKIA 4CMAA 4QJ5A 3R3JA 1ZIOA 4U6SA 4JP2A 4NAUA 2NU7A 1EQAA 1YQDA 3EF0A 4P33A 3KAJA 3P9QA 4D82A 1E3WA 4ZN6A 3EB9A 4MTLA 1FNSA 2AG6A 1I32A 1DFHA 2IVFA 1K75A 3OG9A 1PZEA 2AI2A 3WB2A 2ZSDA 4ES6A 4RM2A 3VZPA 4KYUA 2CFTA 4G24A 5AI6A 1HXHA 1YI8A 2R6JA 3DQPA 4H17A 2E5WA 3S7ZA 1K63A 3ADDA 3OKPA 4O4IF 1LVGA 2L82A 2XMQA 1JT9A 2P65A 2QPLA 3AW9A 3EVTA 4M9XA 4NTZA 5H1YA 4MVJI 1YO6A 1JRLA 2P3SA 4JBHA 3GLIB 5D7NA 5E0OA 5AW3A 4YRTA 3TCXB 4BU0A 2VNKA 3ZXSA 4ZI3A 1UPBA 3IUMA 4L02A 2DWOA 1DC4A 4HSGA 4P80A 3A58B 1YMQA 4JSTA 4RFSB 4EUSA 5IFKA 2JBAB 3I2IA 3SIPA 1Z17A 3A1WA 3K0BA 1KO5A 4J94A 4GKBA 3UPDA 1JUDA 2CV2A 5DNYB 4FEGA 5L3SB 5ED0A 1PX0A 2XCQA 1SK8A 4OQEA 1OI7A 1FQWA 2UUPA 3GG2A 3H86A 3EPKA 1P7ZA 2Y0PA 1FFXA 1QG2A 1BWSA 1RRMA 1PEKE 3PSAA 3CR3C 3R4CA 3Q9UA 5E2AA 4ZXPA 4ECEA 1C8BA 4KLAA 4YJ3F 2OXTA 1YOBA 2OHHA 2YMPA 4CCAA 5EFOA 2LWIA 4PQEA 2H7YA 1YZNA 3TFQA 3IT1A 2BTQA 3HC7A 5AP9A 4CDNA 2BUCA 3U4DA 3NAZA 2HA7A 2V0NA 4WLUA 1RKUA 4AYXA 1FFGA 4G4SP 4ZVLA 2OYRA 3ZKWA 3KSZO 4M1SA 1XDUA 3C74A 4WZBB 5E9AA 2FQXA 2QW0X 1MO6A 2YW9A 4U5QA 1VHWA 5DV9A 4UFNA 5KU1A 4MCJA 3FLAA 4Q16A 4J0IA 4WK2B 1OOEA 4QTYA 1SG0A 1V1JA 2O8BA 5B5SA 2XCLA 1FSZA 3KKOA 1EK1A 3F71A 1IBKB 3MTDA 1II8A 5A0FA 2KM1A 1L3CA 1ZS9A 3LUKA 1W59A 4U9UA 5E4FA 3MHPA 4CR8A 1W4AA 2XTMA 3RIGA 3UPTA 1MX3A 1JEDA 2Q46A 2DPXA 4OQNA 3OP1A 1LV8A 1E6MA 1P2GA 1ZK1A 2QZ9A 2Q0QA 3I73A 1M6NA 3O8OA 5JXJA 2KX7A 2YH2A 4OYLA 4YPOA 1ZC4A 2VSYA 4QLOA 4EPRA 4POOA 4F72A 1W96A 2ZUUA 3OPNA 3K15A 1KJZA 1I0IA 1ZSYA 1YCFA 3FSJX 3JQGA 1ODSA 1AB6A 1LBSA 2HIHA 2QAGC 4YCMA 4KMSA 3K1JA 4BZPA 4U2DA 1TM4E 1HNNA 3UOAB 5K6AC 1XJCA 2WUFA 1MJHA 5I6DA 2PH5A 2J09A 4WKNA 4BJ6A 1YIDA 1NNI1 1F17A 2WHPB 2X8WA 3EOAI 3C2QA 1NZDA 3MZ0A 1D2GA 3PQ2A 5KYYB 3FTNA 4N12A 1ZD5A 3KVRA 3O7WA 5FTJA 1U4NA 2PEYA 1RQXA 3NBZC 1KVUA 4YC7A 3PNMA 5HA5A 3QUCA 3WB1A 3G79A 2TMGA 3N9IA 2IU0A 2V4MA 3LJKA 1GAWA 2BFMA 2QR3A 3P2KA 4IDDA 1EEXB 3GW8A 3NVKI 1W6UA 2WV7A 3W9UA 2C3UA 4JJ6A 1WV1A 2QP9X 4ARVA 3GJ5A 2ZRHA 3Q0TA 1JDUA 1G2OA 1KQOA 1PNTA 4PLHA 4ZYZA 5F5XA 2RGNA 4IIDA 4MB2A 3IJEB 5EN4A 4C9BA 4IUCS 4RGBA 2I3DA 4R05A 4WNCA 1G38A 2YUIA 1XLUA 2AOXA 5I7FA 4H4DA 1NNEA 5DGIA 1X39A 2VH5R 3NC0C 2O2GA 4F60A 2FZVA 3K05A 4TRNA 2F9MA 1EM8A 4KK4A 4TZ0A 3LPLA 2WJVA 4I4LA 4Q9KA 2NVUB 4QT4A 5CX1A 4XWGA 3OZFA 4DRZA 2WM9B 3VJRA 3AUUA 4F2WA 3A37A 1WPGA 2XJ9A 3TQRA 5FWYB 3MNFA 5LXTA 2E87A 2VYFA 5CCXA 3A9VA 1M54A 1YB5A 4PLYA 1DCMA 2E4ZA 2H1HA 1XEXB 2Z43A 2I9PA 4QHYA 4JAVC 3CYFA 2C94A 4KH1A 5TMDA 2PFKA 1M72A 3WA7A 2VJOA 5E9JA 1Y3AA 1CVRA 2GA8A 4J1SA 4OQPA 2W4QA 5ER6A 1KGSA 1Q16A 3G6KA 3HACA 2PUEA 1ULSA 2QYOA 1D03A 4XGKA 2VSXA 2YDYA 4K9RA 2ZRKA 3NZEA 4AG6A 3BX1A 3OEYA 1ZCZA 5CM2Z 1LA2A 2K6GA 4Q4JA 1H4VB 1TJNA 1QHSA 1VJ1A 2CB0A 3MD0A 4QULA 3ZV6A 4YY3B 3WBBA 1Z7WA 3L6EA 4BECA 3NNDA 4ZO7A 1A2OA 2PMBA 3K8OE 4UPDA 4B1FA 4BNJA 1C4WA 2VLIA 2ZRMA 1FDSA 1P5ZB 3DS8A 1HOXA 5BYAA 4KHPB 2FG5A 1UXKA 3AW8A 4WNAB 1PT5A 3RUAA 1E1RD 1GPMA 4KLCA 5JXIA 3KAKA 2F43B 4TUYB 4XZ3A 4BHTA 1LDNA 7YASA 2PM8A 5DI9A 5DHTA 3W5BA 2GXUA 4GI5A 5JPCA 1CZKA 1C7RA 1U3VA 1OBCA 2V7VA 3H87A 4YCBA 5AVZA 1UPTA 4BMOB 1U3UA 3R7LA 9GPBA 1QVAA 2FFQA 1EUCA 2YV4A 1P2VA 3CLKA 3U3ZA 3DUFA 5ECWA 2LCQA 4OYHA 1BOFA 3BCSA 4FM9A 4B2YA 3QSYA 5C7LO 1U6KA 2ZK7A 4NG5A 1KSJA 4QPZA 1CBUA 1Y8RB 3IKMB 3ESYA 3MJTA 3ZZ1A 4N6NA 1G8PA 2OXEA 3GGCA 4N3CA 5M3BA 1F6DA 3FOFC 4Z3OA 1CY2A 3IQFA 5HRUA 3BT7A 4KRFA 3DONA 1F8UA 4Q01A 3I9FA 1J70A 2W2OA 1JR3E 2O4UX 3OMWA 2GKSA 3NMUF 4CZ2A 2WW8A 1RRVA 3N7AA 3PR1A 1YB1A 2ZSJA 2HU2A 3IIIA 2CN1A 5JYDA 2FPLA 1LUAA 4J0KA 4DXHA 2HD4A 3IVMA 1Q1QA 2JJ2A 4YP7A 2IS4A 1Q0PA 3AGQA 3CVXA 3G7UA 1EE1A 2B1GA 4OK6A 5ALZA 1XVVA 3E5RA 1VA4A 3K5WA 2E2WA 4EA8A 3AUFA 5AW0A 4D56A 5C51B 1YB4A 3ABSB 3P26A 5AW9A 9ABPA 4CCYB 2GXAA 4D4HA 1FFAA 3W78A 4W7IA 1JQBA 2FW0A 2WILA 4Z4GA 1QUEA 7GPBA 2M2IA 2DY1A 3IUEA 1OFHA 1Z62A 2BW0A 2P67A 2NXEA 1V9SA 2XUGA 5KU7A 4X62B 1QV9A 1SWVA 4YCJA 4C07A 3HCAA 4GOKA 2W48A 4LI0A 1E18A 2BEJA 2H1CA 4NMWA 1OIVA 1FLVA 2V7PA 2RD2A 1TCCA 3H65A 1YL6A 2V03A 3BWDD 2FMUA 3WC4A 3CCFA 4KQHA 4NL4H 1FRQA 1VBNA 1TF2A 1HEIA 5EMLA 3EAQA 4EAQA 2OV4A 4U9IS 1NA5A 2H2FA 3GT0A 1FQOA 4F8JA 3K7EA 1CKEA 2VHQA 3H1TA 4H1UA 1QFYA 1C9DB 1NY6A 2QTVB 3QX3A 4JYCA 2O3SA 4MAFA 3S2EA 1ADFA 5HJ7A 1XRMA 1T35A 3DZFA 1LSJA 2PGIA 4MICA 4Y2TA 2X77A 1QHYA 4LJ6A 4OP2A 3Q8LA 4O6VA 1CCWA 2GJ8A 2B34A 4FCVA 4EX6A 1Q83A 2JARA 3I9MA 2X3UA 4M9ZA 1DAMA 1SBZA 4OSEA 2WUVA 4FNAA 1TYEB 2AW5A 2GN4A 3D1VA 5GONF 3F9IA 1N2OA 4OHBA 2KBFA 5G3ZA 3OLYA 1Z5NA 1YFKA 1TGVA 3WLNA 1GNLA 1IEWA 5F3WB 5IAKA 4GPZA 2WABA 3PC4A 4CQMA 1NVTA 1TIPA 3MGBA 5CDFA 3SFTA 5DZSA 5KDOA 1BXZA 3M81A 3OTOB 4QUAA 1H0HA 1Y5MA 5T6MA 2X7JA 1PEDA 1AC5A 3H2GA 4MMXB 2XZLA 3DA8A 1XZIA 3MAJA 4CLDA 1A5SB 3RS3A 2GHRA 3L4KA 2NPOA 2MYNA 2UKDA 4QO7A 4BRWA 4GQBA 1M2EA 3PHIA 1Y8CA 1X7ZA 1ZY2A 2ZRJA 2AE1A 1WXHA 2QGZA 3JQBA 3LKVA 4MJXA 4BWYA 3S55A 3RTAA 3DHYA 3Q5GA 5JPIA 3ZVNA 2QMZA 3JTMA 3JVIA 1BHO1 1EJ0A 2XNJA 4NCKA 1ES9A 4EARA 4EW6A 3WY9A 5BVHB 2YV3A 3O26A 3OU6A 4BO3A 1YDMA 5KHOC 5JS8A 5AT1A 1VHLA 2D5AA 1GN8A 3DM9B 3PDHA 3EDCA 4UHBA 5FXMA 4BEVA 3D4OA 1OZAA 2NVBA 1Z4JA 4AD8A 5AW4A 2BTQB 1C7JA 1VA5A 3EPPA 3SJ7A 5K0TA 3K9FC 3OCJA 3HBFA 1RJ9A 2XUKA 4RVOA 3STVA 4C4PA 4BVKA 4DBZA 4DVJA 4MI6A 3S2ZA 4EKEA 3TUIC 3L7NA 1TQ2A 1M67A 4BVJA 4D25A 1H0SA 3KV1A 3EPRA 3FLMA 5JBQA 2Y1LA 2GPSA 3GJ3A 4WEOA 1RXSA 1IOVA 1XMSA 1FEZA 2NZJA 1ST3A 1C9YA 1YMVA 4LJ8A 2C8VA 4CMGA 2QQEA 1VHQA 1PL8A 4GYYA 4LMRA 3TTXA 1E4EA 1RI4A 1CEYA 3KPVA 3IXQA 3Q72A 5A5FA 4ZHQB 4GBED 1N5IA 2IU6A 1K08A 1TW2A 2XA1A 3FVVA 1CWUA 3VU9B 3WKEA 3AR9A 3TNDA 4BB5A 1OVGA 3OLZA 5DHFA 3S6JA 1GR0A 3LGXA 2I3ZA 3CLVA 1P1KA 4EFLA 1WSDA 1V2GA 1ZD1A 3A10A 3MYRA 3OU7A 4RHCA 3F3SA 1RJDA 3GV0A 2HCFA 4R2XA 2QTNA 2Z5VA 4AZ3B 1OYVA 5LB2A 2IYPA 4GM0A 3DKRA 5KIAA 4LS3A 1HNZB 5IAAA 2IYNA 1A4IA 2F17A 3X1WA 4EPTA 2ZB7A 1C1HA 4EUNA 5IF9A 1Z0KA 2VT6A 4FOPA 4TMXA 3OX3A 4GDMA 4S0ZA 3M0EA 3BXHA 4ER7A 2BJHA 1BE8A 1RE0A 2ODTX 3HFRA 4P38A 2DQSA 3QXSA 4RE5A 5KYKA 1ISFA 1I51A 1OU0A 4UAVA 2BKXA 2Y6VA 2BGKA 4TTJA 4YAJA 3UO8B 1DC5A 4TN1A 1NU6A 1O08A 2WD8A 1XXHA 3KP1A 1ZYUA 4KWTA 4NOLA 5J9FA 1JPUA 2BM0A 4K6OA 1GD1O 3JZDA 4G0PA 4UBKA 2EBUA 4INOA 2AOWA 1YS6A 2B78A 2GB4A 1S3FA 3Q9NA 3STHA 4HUTA 3ND7A 5HGXA 1ODCA 4J0EA 2OGUA 3PVCA 3W9YA 2G71A 4E08A 2FPXA 4PLVA 3WK6A 4N7JA 1WSBA 2BGGA 1M1NB 1NW5A 3IP1A 4Y7DA 2ZUSA 3RYFB 4MRMB 1AD2A 4C4SA 1A9XA 1E3LA 1X1DA 4IYRA 1W34A 3L4SO 4GGOA 2GRUA 3T54A 4FMBB 4R01A 3HWX1 4M8KA 3MMNA 4NBTA 4EGAA 5JZOA 1ZRSA 2P78A 1YVRA 2O8NA 4P81A 2QBYB 2BZ1A 2ZCVA 2JGMA 3T7CA 2P1ZA 4HEJA 2Y4OA 4DJAA 3TW0A 3L6OO 3S2FA 2LD4A 5DX8A 5GOZA 1W7AA 1N36B 1PTKA 1Z7EA 2HB6A 4HX2A 4I50B 4LW8A 4CCSA 3DE2X 1KU0A 2AR9A 3QPVA 3A27A 3TGLA 5HEKA 2Q07A 4RPIA 1I4DD 2G0NA 2JFOA 3FDXA 4XIIA 3EWNA 4JMPA 3ZBQA 4AYTA 5KOIA 3MD9A 1Y5RA 5B53A 4ZCTA 4G0OA 1C2TA 3MJDA 4E2WA 3IDAA 2JHCA 3ZWCA 2VF5X 4BPRA 4ND3A 3OT1A 2SCUB 1W4LA 2GD6A 3JAKB 4NBKA 3ZW7A 2WUGA 1X0XA 1E5XA 1KMHB 3V80A 2RJ3A 3ORSA 4JENA 3N2EA 1DIBA 5K3CA 5HIIA 4GG1A 2C4NA 1K8YB 3AERB 1GPJA 3CLTC 4BEBA 2X8LA 1DO0A 3TIFA 2GCIA 4BIMA 1OI3A 3RANA 2ODPA 1VXOA 3T52A 1E6CA 2GM5A 1Y3CE 3EUWA 1W49A 1UMDB 1Z6QA 2BJVA 4OOEA 3VR4H 1VRVA 4TM7A 1G64A 3BZBA 1TIKA 2GCPA 5JALA 4UE3S 1W5AA 4YK7A 1W85A 5LOVA 3N75A 1K5GA 4WBNA 3BHMA 4JLUA 1YRQA 4YB8A 1KYZA 3TB4A 3G2QA 4DA8A 2REQB 3BCUA 2NAPA 4N5NA 1JEYA 4BC0A 2PGJA 3L1UA 1O95C 3GD7A 1P3Y1 3A3NA 4WFIA 4MHSA 3KD2A 2VCYA 1CR6A 1RFLA 1YJ8A 3C14C 3D8TA 2EF1A 5J59A 1VLHA 1WDWB 2CLOB 5AUPB 3EWIA 5K4AA 3KUCA 2IHNA 1DI0A 1MKYA 4HMQA 5EHZA 4CFZA 4P84A 3ZQKA 1B2LA 4G25A 3NUQA 4I4IA 3PVSA 4QJBA 4DUGA 3TX6A 2ZP1A 5HMLA 2EJWA 3UXEA 3ITKA 4UQPA 5EESA 5IX8A 2ZJ3A 1OBHA 3FKSA 1OH8A 1JXAA 4NBNA 1W1UA 2ETXA 3FN4A 1P4RA 4UHFA 4Y6SA 3GEDA 4MGYR 4EZBA 4EELA 1CDEA 2QT0A 5IMBA 4MQ4A 4UBNA 1EESA 1EDZA 3DB2A 2D2FA 4ZZ1A 1UMCA 3L1VA 1IXSB 2VHTA 3BBLA 1GSIA 3HY4A 1K8QA 1W2HA 1X1BA 1D1QA 2FW9A 2QRVA 2GGSA 4HNAA 1JR6A 3RTEA 4XSHA 4E11A 3BWYA 1XNQB 3CC8A 1KSGA 1M8JA 1SD5A 1JPJA 1ZCBA 2POQX 3O8LA 4RZQA 1IB0A 1U0EA 3IP9A 5J58A 1I33A 2WA2A 1AUQA 3EHDA 1J20A 4L4UA 2IYAA 1WB9A 1EFAA 4X1KB 3T5DA 2KPOA 4W9NC 1NJ6A 3BAFA 3BXZA 2PUAA 3OTQA 2ZPAA 5AI5A 1EFVA 2EARA 2J8ZA 5E4TA 3SC4A 3VM6A 2IE0A 2P91A 1JEQA 5FBKA 3E2PA 4A6XA 3LUPA 1UJ6A 2VAWA 2H8KA 3FLEA 5DI3A 2QZ4A 3OZGA 2H11A 4R4JA 5JCOC 2C0QA 3KYJB 3KTDA 2CYBA 1MVNA 4CM8A 2ZYRA 1NG9A 3ZEIA 2IWRA 3N5KA 5EP3A 3TCNA 4TLLB 3L0ZA 5AXDA 2NXNA 3O75A 4IDOA 2NUAB 3WXBA 1E2KA 2V54A 4WKBA 1E2NA 2GFIA 2XZPA 3W2HA 3FZGA 3WKBA 4LQDA 3OI7A 2YQ5A 1IJBA 4YUWA 3RBAA 4ZD6A 3V4FA 1JAYA 4F71A 4URHA 4B3RB 3L1KA 2HCBA 1V1RA 1KAMA 2EG9A 4LJ9A 4EB6B 5CFNA 1FXUA 1X7ZB 1T9DA 2Q4DA 2E4YA 3UA4A 2A9QA 5LQDA 4PC6A 1D4ZA 2DP4E 3JWPA 3ZE8A 3U60B 4ZCSA 1KOGA 4JJ4A 4JT2A 4TQ9A 1E5TA 4CKWA 4D3YA 3KQMA 2PH7A 2VQDA 4AZTA 2ASEA 3AY0A 3OIVA 4JLOA 1V0JA 1GPUA 1MOZA 3MWKA 4QQNA 1GNQA 4HJXA 2ES4A 1WDMA 2PVPA 1QGAA 2ZYDA 1Y63A 4HLQB 4I9NA 1NQOA 3JYQA 4UHJA 2DR2A 1T8TA 3QEMB 1UJBA 1F8GA 3BFKA 2Z2IA 1UWLA 2I7XA 3IAUA 1DLIA 3FF4A 3LIIA 4HWRA 1TE2A 5GAJA 4IHKA 3AUSA 1QHGA 4KGVA 1SKYB 3AP2A 5ALKA 3UFBA 3HCPA 3ZCQA 2DFLA 2BFEA 2VJLA 2ZIGA 2Z5FA 3R6GA 5C18A 1P44A 2GNOA 2BPOA 2ZBDA 4BE4A 2X4IA 2CXRA 3D64A 3P5BA 3PGLA 4Z4HA 4BEWA 1IN6A 4JK3A 1SOAA 2EW1A 1BDBA 4CVNA 1DTWB 3KUXA 5B3JA 4ALLA 2W37A 3KHTA 1C0LA 2OO7A 4P4SA 3QHQA 3QIVA 3K0EA 5FI1B 3R5XA 2WDPA 2C3OA 3BJEA 1OX5A 2ID8A 3OPYB 1T9GS 1GG9A 1ZGZA 1VCHA 5AHKA 1FP2A 1UKBA 3EXEA 1X38A 2H2DA 1N2GA 1COWA 3KQPA 5EE3A 3ECAA 4MKIA 3ZX5A 4G0YA 5M29A 3T9FA 1TKBA 3S8EA 2YJZA 4DWWA 1NN5A 1Y98A 2HF9A 1X7YB 2ZRDA 1M7GA 2AF4C 4JBGA 4A15A 4ZOLA 4BMCA 2NGRA 2B1JA 3VXKA 1QOQB 2V7WA 4PC1A 3A28A 2XDAA 1S8NA 1JJBA 1IZ8A 3SVLA 1YVPA 2JJQA 1RLTA 1VJ5A 4EMBA 3DV2A 3QF7A 3M4XA 3QYAA 4FDTA 3AEKA 4YRAA 1FFHA 2YY6A 4C0WA 1MQ8B 3EF1A 2W70A 4E4TA 2FSFA 3IO3A 4K03A 1SC6A 4OXRA 4RL6A 3MRXA 5DNUA 5JZMA 3Q8WA 1WIWA 5LM3A 4CQNA 4PXYA 1PRYA 3KZXA 5A3VA 4PG6A 3WYFA 3V9PA 1H6BA 2ZIVB 3DEYX 4KI0A 1QP0A 3P2MA 3IOEA 1XXHB 3GAMA 3WGTA 1CY0A 3L41A 2FUKA 3HSYA 2PZKA 3LHDA 4PZEA 3RR2A 1C50A 3HKCA 1Y4UA 2VBFA 2JI6A 1LW7A 1PGJA 1UKAA 2F6RA 4YLGA 4JJAA 1USVA 1AF4A 2X2OA 2FDCA 2P2GA 4K9DA 4LZAA 1L7BA 2HJ9A 1KEUA 3L8YA 4Y18A 1TVKA 2MWMA 4HN9A 4MWDA 3GUUA 3BHIA 3CF0A 1MABB 2H07A 3NHPA 2JS7A 4UOZA 4QIHA 1FP1D 3QF4B 4RPCA 3EMVA 1LSOA 3RT9A 1NLUA 5K3FA 4AKGA 3N58A 3UANA 1B74A 1IY2A 4YALA 3SYRA 4OI0A 2DQ4A 3EVCA 1IUPA 3BBPA 2IUSA 4MK4A 3AFMA 1QP7A 3C1UA 1I3LA 5BNIA 1UPXA 1X7DA 4D4KA 2C57A 3BF8A 5C5DA 2D06A 5IP5A 3CX6A 3VGPA 4BWFB 4KXLA 1IU9A 4WKCA 1X1AA 2FE1A 4ZZ0A 3DO8A 1F48A 2GBLC 1THTA 1D04A 2WNSA 3DBLB 4JUDX 1E8MA 1NN1A 4O0MA 5HKAA 3KQWA 2FG7C 3QKRB 2QEQA 4FLFA 3CLSC 2VDWB 4X63A 4EUFA 1SKUA 2FW8A 1ABEA 5DBEX 1DOHA 4GUAA 3L8CA 4N01A 2QD1A 4U1RA 4UKDA 2GLXA 3RRYA 5IKPA 3N2IA 1GZDA 2VDVE 1TB4A 1Z18A 2O3QA 4UNNA 4RXMA 4YXWA 4R9UC 3ZIDA 1PJRA 4YI5A 5E9QA 1GA1A 1N5JA 1V41E 1Y1TA 4LJ5A 2JAHA 3RYHA 3LY9A 4G0QA 2X0FA 2FGJA 1Z0UA 2YXEA 3AC0A 4WXMA 4L0CA 3WGVA 1R16A 1VL6A 2RB4A 1A9RA 5G1PA 3ROMA 5JSHA 2XQKA 3UXHA 3PCRB 4EENA 3KB2A 4YS6A 4M98A 4QTTB 5SV2A 3FJYA 3W2TA 4X8HA 3X43A 2O6LA 3SC2B 3WMRA 3WQRA 3BMQB 4BZZA 2WG2A 3USZA 3TK1A 3X3HA 4BMYA 1YR7A 4CUJA 4EGSA 4B6FA 3EBOA 1M0TA 1G7SA 1KKMA 2WMYA 3HEMA 3UGKA 1PZGA 3GJXC 4EM6A 4FCTA 3DFMA 5CT9A 1JPVA 3W3AA 3SX4A 4G1EB 1J8YF 2NPFA 4X66B 3RLIA 3OZUA 2MIIA 4AICA 2O0HA 2RHWA 3HXTA 4QOGA 4S1OA 1DO2A 3WIUA 4F84A 1XTTA 1OY1A 2PBZA 1CIPA 4GMKA 4MVJH 2EKLA 5TMBA 2ZBFA 1JP7A 3ONNA 3ZCVA 1FTWA 2OZKA 2KE5A 2QR5A 3OQ1A 2WAAA 4PYLA 5J5VA 1ULTA 3C41J 3WO1A 2HDOA 3KKZA 1P5HA 1Q6ZA 1QE3A 4LX0A 3JAMA 3N87A 4MV6A 2WINI 4ZEXA 1OZFA 5ADVA 1ZN7A 3DZ8A 4YUVA 4U7JA 1ZKDA 1BE0A 1XB2A 3CT4A 3O38A 1U9IA 1N0UA 1C1YA 1O9HA 3O2JA 4F1JA 1V4BA 1E64A 3TD6A 1F3LA 4P86A 3D6JA 5FPPA 4QO8A 4D1YA 5KTOA 2LW7A 3F6BX 1FJXA 1EFVB 1CZLA 4Q7MB 4QDJA 3KU1A 3CA8A 2Q49A 5EXSA 4QAJA 3LV8A 1EX1A 1OAKA 1JEQB 5L95A 3OTGA 3D02A 2VSQA 1XDDA 3P0FA 3DPUA 3R5TA 4Q4HB 1BD4A 1WULS 4X1IB 2XGGA 5JJ5A 1B43A 1H2RS 3IEIA 4FCCA 5GADl 1ECBA 3F4LA 4B47A 1Y3IA 4CNQA 2AC4A 1T36B 1R6AA 3I9NA 4QBFA 4R5HA 1JG7A 4KVAA 1AUVA 3EBPA 1EFRA 2UZ1A 2XMDA 3JQ9A 3OFND 4U2KA 4LF8B 5JAQA 2R86A 3VR6D 4WWHA 2C31A 1IIRA 3A3KA 1IM2A 1U8XX 3HGTA 5A0TA 4G1BA 4RKEA 4OCZA 2WF9A 2YZ7A 4HPXB 4OLHA 4A2PA 2VUIB 3NV9A 1K4KA 2FKAA 4G63A 4OYYA 3K96A 2XD9A 4LE0A 4Y9DA 1VFNA 2PCLA 2KB0A 3AJ9A 3ENNA 2PMEA 3RS5A 3OURA 3UZUA 4DNQA 2QLLA 3H5NA 2ALJA 2XCIA 3NBFA 4J9UE 4PCUA 2Y2VA 5GV7A 3KSBC 3M5DA 2E89A 2VQ3A 2HL6A 3KPJA 5HE8A 4EHFA 4J7AA 3AB8A 3UENA 2P75A 5AXCA 2CSXA 3OHSX 1J22A 4NJEA 3S2IA 3GFPA 4HYEA 5EYPB 2QZZA 4HDRA 3GMDA 3NIFB 2QUJA 1UXGA 3QFRA 2VP2A 4KJZA 3DLCA 3LI2A 3VYUB 2BHSA 3MJSA 1GZHB 2XE8A 1OXUA 3H8WA 3OZRA 2VJBA 3OZ7A 3RTCA 2HRDA 3MUOA 1RAGA 4JVSB 5G0WA 1NE7A 2DXIA 1PL6A 3H0EA 1UM8A 2ZCUA 1LNZA 1Z6PA 4Q3AA 2JHGA 1SHTX 2WTNA 3OLXA 4A4DA 5HQJA 3QPWA 1XZCA 2IY8A 3B6JA 3RAGA 2B4KA 4QQFA 3B7PA 4MUNA 3V8NA 5F7XA 1VFPA 3ZDCA 3PKIA 3MJRA 4HDNB 4XVQA 1Z0IA 4XYEA 2H63A 4O4LA 4I4TF 4X60A 1BRMA 3DL2A 4CYMA 2PRJA 5BN5A 1MA0A 5AVRA 2IS6A 1N32B 1TO2E 3R6DA 3LUBA 2D7JA 2YWJA 4RZHA 3WOHA 4JFAA 4MQUA 2JLQA 5FUWA 1E0SA 1F0KA 3EXEB 2B5VA 2X1VA 3M70A 1UFOA 5K0BA 3HM9A 4RELA 3KQLA 3M3PA 3K71B 1XXLA 3QEAZ 5CVTA 4S12A 4HAXA 5EKXA 1X1TA 1JBEA 4E2XA 2W6PA 3ONDA 4NSNA 3SXPA 3WKDA 4CDGA 4ON9A 1CYEA 1OXTA 1UQTA 3QNMA 4BMPB 1DRJA 3S81A 4HLDA 4UHEA 5EXDA 2IEAA 5K8LA 4MYUA 3IKVA 4QHSA 1NPYA 4PZ9A 4B3HA 4CLRA 1RZRD 3WYNA 4RZUA 4V1CI 3HKBB 1C7IA 4L5AA 4R7ZA 3ET5A 4M8IA 4NKRA 3GGSA 1XDBA 2ZJ5A 3PD1A 4IPTA 3K09C 2ZKLA 2FK7A 3E3LA 4Y1FA 3NDRA 3GELA 1CY6A 1WW8A 3Q5EA 1SVKA 4W5WA 4NATA 1PYDA 4DS3A 3SC6A 3QW2A 1J5PA 4Q1EA 4P36A 3LYLA 3PUJA 1NYLA 4YRIA 1WHSB 3N2ZB 4YV7A 3IAFA 3EIHA 5AIBA 1D2MA 1IBRA 2ACKA 2OCKA 3VNSA 1ZJ4A 4DSZA 1UFRA 2PO7A 5FNVA 3VHQA 5JHGB 2P7IA 5L51A 1PO7A 1WXWA 4MJ3A 5LR6A 3HB0A 5B6PA 1AKQA 3FDZB 2PD3A 3MIZA 5IRCD 2CLIB 4K6KA 1OBFO 2QE6A 3H11A 3BJMA 3NHZA 5FWXA 2DERA 3NS7A 3ZGZA 2GKGA 1JLLA 2QV7A 2VP0A 3O9VA 1CUXA 4QDZA 3GT3A 4PFSA 1P61B 3KWFA 4XUDA 5P8WA 1RBQA 5AVYA 3B1FA 4POAA 4V0QA 3VKFA 1ECLA 3C3BA 3OHMA 4PM4A 1OSNA 3FFTA 3GBSA 3WLJA 1NIPA 5K3FB 1IY9A 4PSVA 3NVDA 4FYIA 3F98A 4O08A 4FHDA 1BFKA 1U2ZA 4WBNB 3FPKA 2JIQA 4AP5A 1PYOA 4C7OA 4B80A 1XEFA 4NYIR 4QYIB 3R3UA 2B35A 5DNAA 1UDBA 5JANA 4M1TA 4HQ0A 1F14A 1P7PA 4L28A 4Z4FA 3FWPA 1VG9B 1IRIA 1UFKA 2C4UA 3PS9A 1Z06A 1T1IA 3EC1A 3CNLA 4TRRA 4U6QA 1CUZA 1NKSA 1ADJA 3F9RA 2QD2A 5LYJB 5BSRA 1GPWB 1WEHA 1M1XB 1ISGA 3U3KA 3GFFA 5K99A 3OUUA 1SXJE 3DTVD 2WPDA 1AQUA 3R9KA 1E5LA 4MV1A 1K92A 3FJ1A 2E1PA 1VE6A 2ZSIA 3ZTYA 3OQ6A 2QMOA 4FYHA 3BDVA 1NKTA 3HDYA 4JLMA 1II9A 2OV8A 3NHYA 3MF4A 4LMAA 5FPYA 4ITRC 1QTIA 1IULA 4J0DA 4MWOA 1IJFA 3TDNA 3W7BA 3WE7A 4J76A 2J30A 3HCEA 3K1TA 3WIBA 1SCUA 2WMOB 2QDKA 4NK5A 3EZXA 4NIMA 2J3LA 3A4YA 4U0JA 5KNDD 3IIJA 2NZWA 1XJ5A 4FE7A 2B1RA 1CY4A 3ROKA 2F55A 3AYZB 4YRBA 4YAGA 3AVXA 1NHGA 2QRMA 5JD3A 3W6NA 3DFKA 2W11A 1RI3A 3VYVA 2OBYA 4D92A 4HDCA 4CQJA 3HI6A 2J6BA 2I8LA 1E8NA 3TLYA 3SQXA 1I2AA 1WG8A 1KI2A 2Q3HA 4HCJA 2X9VA 1VSVA 4L4ZA 2D2XA 2RMKA 4NC9A 1G8YA 2AMFA 1GILA 1RM4A 3NVAA 4IHJA 4CJXA 3IQXA 1ZM9A 1RHRA 2YCBA 1PLLA 2JFPA 1FBNA 3EA5A 2G1AA 1C81A 2DTXA 2WWHA 3HGMA 3OSUA 1JR3A 4ESOA 1OJ7A 2AN5A 2HR1A 4RKRA 1Y4AE 4DE5A 2WV9A 3RUCA 1G19A 1TM2A 3ZIUA 1I10A 3C3YA 5KSWB 2A9VA 3FWKA 1N2ZA 3SQDA 3K6RA 2IY9A 1ZMRA 4ARZB 5TPZD 3HVIA 3IALA 2XRFA 2PKYX 1YGYA 4NESA 4JC8A 1BDHA 3SSNA 5H0IA 4KPFC 1EK0A 3VNQA 3E2IA 4L16A 2XNCA 3RTGA 1C30B 4A2CA 1Z15A 3N2NA 3PA6A 4BDSA 1Z0DA 1JWAB 1ORTA 3BE6A 3KOYA 4TVKA 3TTUA 4XWAA 2C5FA 1TUBB 2FRDC 5C8YF 4ARCA 2FPGA 2RGBA 2ZGVA 1KP2A 2IT1A 2ILTA 1G4AE 1JG2A 1RI1A 1RQGA 2I4IA 3BQNB 4H60A 4PICA 3M83A 1FYDA 3DNFA 2A86A 3V1TC 3M1LA 3N0VA 2XMZA 5EMHA 2Q7DA 2EGHA 3NXSA 4NXMB 2SBTA 3C3CA 3PR3A 3D8BA 3GGOA 1OI4A 4H15A 3PFFA 1R6VA 4QTXA 4Q4CA 1T4DA 1V8DA 2VP6A 2WSBA 2X19A 3O0DA 3A9CA 4NBLA 4ECAA 3LT2A 5HXAA 1UJ2A 2JZOA 4RSGA 5ICSA 1M2OA 2DBQA 4ZQEA 1ACLA 3GNSA 2I0FA 3HXOA 4IEFB 3OT4A 2F1IA 3UV3A 1Z4IA 2IBTA 3DDNA 2YC4C 2F3RA 3VZCA 5JVDB 3TVTA 1FMCA 4UU7A 3EDMA 1DC3A 1IXRC 3ETJA 3QEKA 3B9PA 3K4PA 3HN6A 3Q2IA 4EPVA 2O20A 1GG5A 4Z0HO 1BVUA 1AGYA 4HWSA 1CUIA 1P0CA 2PSHA 2GAIA 3QXHA 2EIXA 4YAFA 5DCYA 5KYGA 2BRUC 3LWDA 2FPSA 2FQWA 5F3RA 3QUSA 1QGED 3I76A 1QB7A 2O1WA 4TTAA 5KQLA 3REQB 5JXGA 3V2HA 3QTTA 5CFOA 2IPLA 1X7XA 1EIZA 3EUEA 5CDGA 4EFDA 1T0BA 4DVGA 4CKZA 3QY9A 2B8TA 5KKCA 3GGDA 1RJGA 1FNNA 1R9NA 4YI3A 3T35A 4LSMA 3VFDA 1M75A 3I9KA 3FMGA 5BPHA 3C5WP 2QYHA 2CNLA 1OWOA 3AHEA 3D4NA 3AY6A 4OUDA 1CRQA 4X7MA 5CXQA 9LDTA 2DHEA 5HX7A 2QTBA 4XQ9A 3CE6A 5JCXA 1ZR2A 1KGDA 2SICE 4OHVA 3DQQA 1EP1B 4GICA 4HDRB 1LCIA 2GM4A 5CITA 5K3OA 1JAHA 2JF0A 3HKEA 3L49A 5IK2A 2VTBB 1K3TA 4W6QA 1K8ZB 1SVMA 3PJGA 1NBMD 1G3MA 2HUNA 3WADA 4AQYB 1EFPB 3AHJA 1L5VA 4WVLA 3H4IA 2WTMA 1SCAA 4RK7A 5TT1A 4DW8A 4RZSA 1SC9A 5EZSA 1GGHA 1EA7A 3MJEA 2ZT7A 3CZQA 2W2TA 4X5OA 4AMBA 2AJ8A 4TMZA 3FNHA 1JHVA 3WLOA 5C46F 5K0JA 4IUYA 3F6EX 1JKFA 1E4OA 4Z0NA 3X1KA 5KJFA 3F7TA 1RAIA 3VDXA 1QG0A 5CBPA 4WKOA 4XGRA 5FPQA 1XPRA 4XR4A 3ASYA 1UDWA 4I36A 4MP3A 4R1QA 3ZZMA 4CIVA 4O4LB 1O4VA 1PJTA 1NWHA 4FYXA 2YY5A 4RKFA 1Z34A 4HD8A 3PNVA 3KQKA 16PKA 2C07A 2JAXA 1J39A 8OHMA 4YAEA 4ALIA 3PPWA 1WF3A 4L7QA 5ABPA 4CIYA 1QRUA 3AHDA 4G09A 3GPIA 1Z5WA 4GH5A 4O2BA 4PAQA 4BKPA 1NF9A 2HV8A 1RKBA 4E88A 2QMEA 3EQ6A 2V7UA 4JJGA 4WXYB 5AVKA 1HDOA 4EI9A 1MR3F 2Q3CA 1GARA 2F4NA 4UDXX 1WQ4A 1J06A 3L4BC 1D5WA 3JWIA 3O8BA 3WMFA 4BFLA 3V1YA 2Q6VA 2RGDA 5JZ9A 3ZS9A 5IYZA 1IIBA 4XLZA 2Q5JA 1BJRE 1ZBDA 2J3KA 2Z9DA 3EDYA 1MJ5A 2FPPA 2H5IA 4F45A 3AXTA 3UWDA 2JIMA 4KFCA 4GRIA 5E2IA 5A4AA 3AM4A 2Y76A 3BWEA 4FMDB 5ILOA 3Q3GE 2N42A 8ATCA 3MFYA 2V3VA 4CLRB 4TYMA 7REQB 1N2XA 5D00A 1XCGB 2QN1A 3OCCA 3ENKA 3GWGA 1QQBA 4LF9B 4TTSA 5HTKA 2R7MA 5AKKA 3LP5A 3UY4A 4Q1DA 1QIKA 4JT8A 4PYJA 1QAQA 4YRNA 1USGA 2R7AA 1DUSA 2Z4TA 1ODKA 3KDPA 4GL2A 4RDXA 2HYDA 2CLFB 2CMHA 2Z95A 5DYNA 1K2WA 2BFCA 3HGQA 3V8EA 4LHEA 5KVSA 3KZCA 3ZHBA 1AXGA 3BULA 4NQZA 1EQ2A 3LUFA 4DYDA 5BV8A 4HL6A 1OHHD 3G02A 4BKQA 2G9RA 2AG1A 2IVZA 3C3XA 3G2LA 3KJZA 1DJNA 4ZI2A 1X2EA 5I8PA 4BRZA 5K0ZA 3IOMA 2R8ZA 4DDTA 3HP7A 5JASA 2NWQA 1W8IA 3KVNA 3I3SR 3UWOA 3TBKA 4LRWA 3L9XA 1XMJA 1E3JA 4RIFA 1EB9A 3ZS8A 1CR2A 4ALJA 5KWEA 5GIOE 1YC5A 4CTKA 2FEMA 4O2AF 1J0CA 1I30A 2B7CA 4N4AA 4WL0A 2O7NA 3JSAA 1GGKA 3GL9A 4X7PA 1HT1E 2OFFA 2VTDA 2OXRA 2NSJA 5KTYA 3D59A 4CKBB 3IP8A 4L4SA 5JNUA 4AMYA 1F51E 1I3KA 1EVJA 1KAGA 5LLSA 2G76A 2VVTA 2DBZA 1IAQA 2QE7A 3KK0A 3L0YA 3UT5B 1NJ8A 1Z6YA 1FX1A 3HCCA 3ZWDA 3Q7PA 5E6UA 1E20A 4IP0A 1BMTA 4NH0A 4DM4A 4CIWA 4RTOA 2V74B 4FFWA 4DN6A 4QATA 3FYHA 3K6SB 4QFDA 1C9KA 1FRNA 2ZYIA 1E9BA 1OLSB 4MW1A 1PVOA 2Z30A 3MGKA 2O1EA 1VLLA 2EGUA 2VXOA 1Z26A 1G98A 2V97A 5C53B 3N8KA 1JU3A 4FT4A 1SKBA 2GYWA 4YWHA 3A0UA 3R5SA 2QAIA 3WMWA 2E4XA 2BP7A 1E0AA 4QG3A 1V48A 3ZLUA 1P0MA 5CA1B 4WJZA 3ZBUA 1A9PA 3ZXIA 4ZJPA 2Z2JA 2AV6A 1KOFA 4OIMA 1LTHR 2QL7A 3GQBB 4KR0A 5J2TA 3B78A 1ABFA 4KN6A 5DWDA 1JHYA 4QXQA 5EJ8A 1APBA 2R87A 1XDSA 4KV9A 4CU5A 2IYFA 3ZWPA 1V3TA 3RSHA 2AZTA 2UUCB 1NATA 3RKSA 3RYTC 3CN7A 2LV8A 1XYYA 3MB5A 4MQMA 5A2QA 1AHHA 3DE1X 4LGVA 4OFBA 2VNSA 4WK0B 2DKNA 3EXG2 1EUYA 1B8PA 3Q8XB 1ZKMA 2C9MA 2E1RA 1PT9A 1ICIA 1I13A 2F1HA 1IK4A 4Z53A 3LXUX 2HJVA 4MUFA 2FEPA 4MYTA 1DRUA 1RHUA 4M54A 2QQFA 5JBNA 3AR7A 5DGHA 1KDTA 3FG9A 1ZUWA 1ID1A 4RMIA 4KFRA 4EGJA 5JQGA 5F21A 2C5LA 3DL0A 1M8PA 5BP7A 2R1TA 2Q5QA 1X87A 3BE5A 4BMDA 3AIKA 5C4GB 3SKVA 1BOOA 2FUG6 4X3CA 1EPUA 4B0PA 3U5ZB 4A0FA 2FOIA 4MQ5A 2D13A 2X5KO 1UJMA 2ORED 1CLEA 4KDFA 2FWNA 2R79A 2GARA 4YFYA 4IILA 5THQA 5FBVB 1PT8A 3CLTD 5ERGB 1IEQA 3S2YA 1N5DA 3JVVA 2XMCA 1L1EA 2AZ4A 2IITA 2QJRA 2XV1A 4KIGA 4MHOA 3VR2D 4C7KA 4ZK6A 5T4FA 2HHHB 3ER8A 3D6HA 5A6SA 2DE0X 1H1LB 2X6RA 3GGPA 4R9NA 1X80A 2HZBA 3ANXA 4CMEC 4RTLA 5AW1A 1JIVA 3AR4A 1I0ZA 5EVCA 4D44A 2ZBVA 3RSOA 4C7VA 1WXFA 4E15A 1RHJA 3C98A 3I2YX 4PGGA 4RH3A 1X7GA 3ND9A 2XSZD 3QA3E 1XAGA 5DBIA 5ALOA 1I8TA 4EUHA 4PS0A 2VQSA 1ZZEA 3FBGA 5KYUB 2VH1A 1YL7A 4QHTA 1O95D 1DAKA 5IAOA 1SXPA 2PQ0A 3W5JA 5A4DA 2W6MA 3PZRA 2PGNA 4PYOA 4YHBA 3UV6A 3N7UA 4B7CA 5G0UA 1QQ6A 3WLMA 3RS9A 2O0LA 3N8NA 3MT8A 1ZAKA 1LC0A 3UAGA 3UJ8A 4MHTA 1OGJA 1NAHA 1FYFA 1M2NA 4YNBA 4C0LA 3H1FA 4DUYB 2QTAA 4E09A 5DM60 3D7RA 3RARA 2NZ8A 1SOVA 3N2LA 4FGWA 3Q12A 4XB1A 4BGVA 4ZAYA 4NPHA 3PEFA 4PZYA 5HOQA 5JJLA 1L0BA 1RPTA 3LUAA 3OICA 4CLXA 2XE6A 3DLIA 4ZMRA 4OG2A 3V4SA 4F5YA 3OPVA 1H8EA 1XMQB 4P0PB 4I3FA 1AH2A 1O97D 4HS4A 3UGQA 2O3UA 2R65A 4UCQA 2RHRA 1QWOA 3ESBA 3K32A 1A8IA 2Z5GA 3CS3A 3NPAA 3EFBA 1ATIA 5DM0A 3ORFA 4CCWA 2XGJA 3Q10A 4QRDA 1JFVA 1T5OA 1WWKA 2Z9BA 1TW3A 3ZWOA 2DX7A 2J9FB 4C6RA 1R6TA 4IUBS 5EHGA 5C8XA 4B6OA 3ZDEA 1N3LA 2C77A 4BFTA 4FDAA 3G89A 3EVGA 1V5WA 3VAAA 5CFRA 5DLQC 3OF5A 1DIOB 1UPUA 1KO4A 1KHHA 4FEEA 3GRYA 4EX7A 5IDQA 5JCJD 1IZ9A 3G2IA 1XD2A 2YJ4A 1GRQA 3K9CA 3BMXA 4FW9A 4Q4AA 1YUMA 4YWJA 3RVLA 3TMKA 1F2TA 1N2HA 2FJPA 1YJBA 2QN9A 3VNVA 1GUZA 1ACJA 2AXQA 3QLTA 5T8KC 4HAIA 3TBFA 1U28A 3CWZA 3FPHA 5LQCA 2PUFA 4I5FA 2MSDB 2HPHA 2NSHA 4B3XA 3ETEA 1KE1A 3VO8A 4YV2A 2XUPA 4UU8A 3TIVA 1KRXA 2W43A 3EVNA 1L9KA 3AOEA 4D3ZA 1WZNA 3MUEA 4MUYA 3KV3O 4YJ2B 5EI5A 5JOQA 1WW2A 1KDRA 4NBRA 4NG4A 5CIQA 3OZIA 5HIMA 3RJTA 1TTHA 4LRYA 3SJBA 1ESEA 1M2GA 1OXXK 5B2EA 2OP1A 3LUJA 2P5TB 4OXNA 2O8EB 3I05A 2CWDA 1JHAA 3KQUA 1CUJA 5FD8A 1ZNZA 2FPKA 1XYVA 2E4UA 1KO7A 3CHYA 4JQZA 3B48A 4KGDA 3UK6A 2FUCA 5H80A 5IT9A 1RPZA 3HA7A 3WWEA 1D6SA 1HRKA 2B3DA 4WXPA 3SE7A 4CMIA 3P8ZA 4P98A 3B3FA 5EZYA 3LSTA 4DT1A 5KDLA 3ES9A 4TUYF 4DJ5X 3IX7A 1GGVA 3OJWA 5G4LA 3ZNPA 5A06A 5JU6A 2D1TA 1XCOA 3EH2A 3KOXA 1PN3A 4EZIA 5B7NA 2IYYA 4J43A 3PUKA 4HGPA 1XTRA 4N5HX 4Z6KA 2VJNA 3PYMA 1PUIA 1VIAA 3CB4A 4DA0A 3AR5A 3QNUA 5WRFA 2H3EA 5B2ZA 1GGMA 2XKAA 4CN8A 2DR3A 4L5YA 2BGNA 3KSDO 2FPPB 1GNSA 1N2EA 3JQAA 3QFFA 4O2RA 5DX1A 3ASVA 4HWGA 2OM6A 5DP1A 5IBRA 1MBZA 2VK4A 3VZSA 2P8SA 3PTAA 3PXAA 2VHYA 3FWYA 5AJUA 1HFKA 4C0JA 1GUAA 1P4AA 3VZBA 2A0FA 3ZHUA 1IN4A 3FCYA 4S1TA 3GEEA 4S2EA 4AN1A 3QE0A 4YJ2A 4ZVOA 4UTVA 2JGDA 1GTRA 2BH2A 1D2CA 2WMDA 2OXIA 1Q6YA 1UOOA 3V1KA 3WOVA 1UP7A 3MCVA 3C5HA 3K0KA 1W29A 3WI7A 2X76A 3AUAA 2G5GX 4TS1A 3USES 2Q4RA 3QMVA 1IBSA 2PXXA 1PT7A 3UHPA 4MW7A 1QORA 2WI8A 1ISJA 1U8FO 1W0KA 2KLBA 1NVAA 5EIFA 1XR3A 3E22A 2X23A 2FX3A 3R6LA 4JU8A 4D0LB 1WBDA 1YWGO 3TL3A 1AV7A 4DCGA 2F9LA 4IXDA 3U17A 4HT3B 1T25A 3UKDA 4YQFA 4DLSA 2NP7A 2JG3A 1TOAA 3FB4A 4IR7A 4EBBA 3GLHE 4MI9A 5JLAA 4GXRA 3SBOA 2JIRA 3H5RA 4CFSA 3G8DA 4FUTA 3ILHA 5EWMB 5ES4B 1P9RA 2I6QA 2VHWA 3M2PA 4HWTA 1T4BA 4GI1A 4X1YB 4XPZA 4YIHA 3FOEC 1G291 3DP9A 4IYJA 3JRXA 3NH6A 2FRVA 2CJYA 4X3PA 3I6MA 3FMPB 4U8GA 2ZETA 4DDVA 1FVOA 1MNQA 2ZJYA 2W7TA 2DPYA 1EGMB 2VSFA 4UCWA 2H54A 4B3MB 4OX9Y 3A3YA 1E2PA 4IKPA 1GU1A 5A9TA 4P7FA 3K16A 4F3TA 5H7XA 4XGIA 1UIRA 4Q3CA 2AK3A 2J59A 4M86A 3B1YA 1K0FA 2QW1A 2F8SA 4ZAFA 1ZINA 2F90A 4R40A 3UF0A 1HY3A 1YCDA 4WFJA 4E5MA 1ODTC 5BW5A 2ZT5A 1Y4DE 1XJQA 1V11B 2KBEA 4QFBA 2VWQA 5AKYA 3ROPA 4RPGA 4C88A 5CG2A 2OCXA 1PKXA 2EP5A 1AO0A 4LQLA 2CY0A 4J07A 1OPXA 1P4SA 1L5YA 4LQ4A 1XEWX 5SY6A 3VO1A 3CWQA 3DJYA 2IYWA 3L6DA 4PPQA 2FV8A 3OCUA 1CT9A 4WI1A 5GJCA 3BZUA 3ETLA 4YN3A 4H1HA 2AQKA 5TE9A 3CLHA 4FHFA 4E03A 3DV0A 1AY0A 1TJPB 3VOTA 3ZD8A 1NVVR 3MN1A 1K7SN 4D3XA 4KQEA 4HATA 3QLUC 3CRNA 5AQEA 4J03A 4BRSA 1Z56C 4OO3A 1GGJA 1MIOA 1H5UA 4D96A 3IPAA 2GK4A 2RHHA 3LBIA 1Q1NA 4NYIQ 2XXAB 2X6QA 4LBZA 3ZHCA 1IN1A 1XA3A 3VKVA 5G41A 4B3SB 4CM9A 2AEMA 2PL9A 3WGNA 3N0RA 4DANA 4JI2B 1J42A 1WRBA 4DFDA 3SJAA 2WIJA 2X58A 4IIJA 3I4LA 3CVYA 4TTVA 4Y2JA 5IC4A 2OZPA 1X1QA 1HZZC 3T0FA 1NJ1A 4MV4A 3ZVMA 2BFPA 4RY9A 2AVDA 2J3DA 2DB3A 6ADHA 1T3LA 4M1ZA 1NMQA 4UARA 3L7OA 1GZ4A 2CMGA 4BNHA 2WFMA 1IK6A 3ILVA 2R85A 5EJ2A 4FOTA 1DIAA 2DF8A 3L8EA 5EHNA 3SCZA 4F11A 1JR2A 3B9RA 1HQYE 4YRMA 3KFLA 4MS3B 3CLSD 3EVDA 4F97A 4YACA 2P9QA 2YFQA 1YS1X 1ISRA 2DT5A 3BG5A 4AS2A 2K87A 3G5LA 4REOA 3F6YA 4EEXA 4R6WA 4OXYA 1OVMA 3FTQA 1MOPA 1B8OA 3WGLA 1KAQA 4PAMA 3RUPA 2Z4SA 3W9BA 4ID3A 3TMAA 4K81B 5LU8A 4LZPA 2CLHB 2A2ZA 4L57A 1TRKA 1UZMA 2WE7A 3SZLA 2E4WA 3BYZA 2H2WA 3QFHA 1DO8A 4ZHQF 1F8XA 4Q66C 4Q3EA 2D3TA 3OQOA 3CBQA 3GLUA 4IINA 2CK3D 4K8OA 3R6WA 2A0KA 2W22A 1RT9A 2YHIA 3FVQA 3I5UA 3H2BA 4Q47A 3RK0A 2WP0A 2VF8A 3K2EA 3PNKA 3GFOA 3KE8A 4MZDA 1PR4A 4FX5A 1HSZA 4HZUA 3VC7A 3CNQS 4FYMA 1PQUA 3BDIA 4KMRA 4L5CA 4AUNA 3KSRA 4BL5A 5FV4A 4BO0A 3JYPA 4G0ZA 4E2ZA 4JT9A 3GIDA 2AKAB 3UK2A 1NJSA 2Q6OA 2FEXA 3N6VA 2QM8A 1PIWA 3QKSA 3UIEA 5JAUA 4COOA 3FFBA 2R60A 4TKVA 1MORA 2AZDA 4DPKA 1S4MA 3SHVA 1FS6A 1D4OA 2CJWA 3NGMA 1C7FA 4IXWA 4AFNA 2VA8A 3NYRA 3L8FA 4UXIA 2FSGA 1NFQA 3KQTA 1S6YA 3LC2O 1YZQA 1RFGE 2FQQA 2OSVA 2Q6TA 2Q1XA 1M73E 4TLEA 2FHSA 2IP2A 2WVHA 3OQPA 2GVZC 1DP4A 3P71T 4RMGA 2H5JA 3PQ5A 1VMEA 4D9NA 2XCOA 1CRZA 2CD7A 3EC2A 4AJ9A 2RB5A 4CMKA 1JZQA 2XB8A 1DIHA 1W1IA 3ED5A 3QV2A 3K8ZA 5EXTA 1OXVA 2P6NA 5H59A 1ZO8A 2OXCA 1CQIA 1T1SA 2X8JB 2XJ4A 4UXHA 4Z9XA 4MVJG 5JV5A 5A9SB 1D4AA 2WFAA 1YS4A 5JAIA 3A4LA 3EWAA 2G08A 1ZJ6A 4JHXA 4M7PA 5JPDA 3U16A 4M22A 1BFDA 2P9BA 1CULC 1FQJA 4EB3A 3K31A 5B6IA 3IE1A 4MR7B 4TMTA 1YDFA 3F97A 3Q40A 4JIMA 3RFFA 3UJDA 1U99A 3RU7A 5HP4A 5JI3E 4M7OA 4LF4B 3BXPA 3LYHA 5DLYA 2QVYX 1QYRA 2GEDA 1EFUA 1YASA 4XIFA 3NTXA 4QEDA 3ADOA 2FPMA 4NEHB 5KNBD 2WZBA 2PLAA 4MUBA 5EHQA 2P11A 2GNPA 3HXPA 2R4TA 1FJHA 1NQWA 1RMYA 3PQDA 3ANSA 3D7MA 4PFQA 1S8FA 4ZYVA 2XWQA 3OH8A 5BV2P 1MO5A 2GN9A 5KTNA 4I50F 1NKVA 3WLPA 2EKBA 2CL5A 1VHDA 2OLEA 4M2LA 3EXHB 5I8ZA 3ZJ4A 1YI0A 1O5OA 2VDQB 3LRXA 2AQHA 4YROA 5IFLA 3E70C 3F0TA 5A7GA 3IEMA 4K9OA 1DKUA 1VPEA 3TO5A 4F38A 2WSLA 4R2KA 1CVIA 2PD6A 1EFDN 4IDAA 5FOVA 1SO8A 3K8YA 5CVEA 1JQDA 2H2IA 3KJQA 3FB1A 1HURA 3EGXA 5THXA 5HW0A 5TQJA 1P91A 3RJ5A 1PFKA 1FLDA 5BNWA 2IW3A 2QJTA 3ECCA 1AGXA 2PZMA 5DCUA 4AO8A 5DT9A 1M33A 2YXPX 4TLCA 4ANFA 4ZIRA 3UHFA 3SYMA 3KKLA 4HDSB 4KAAA 1JQ5A 3N2KB 3WZMA 4CMIB 3VO2A 4D45A 3O1LA 2GN2A 2P6RA 3WJ2A 2OSBA 2WKWA 3TSOA 1U2PA 2I3GA 3VSBA 4X64B 1P0QA 3ZW9A 1XBTA 4DAOA 4H59A 2GN8A 4TKUA 1U8AA 2B4RO 1P5RA 2A1TS 4LF6B 1DXYA 2HMVA 1H9AA 1UJ5A 5D6NA 4TQAA 3BGVA 3O6VA 5K01A 1K86A 4M1MA 1QH8B 4WZ6A 3VKGA 1T6YA 3DKPA 4O4HA 4AMZA 2CDNA 1W5SA 4KQ2A 3R24A 2Q5IA 2WYWA 3R6TA 4EW1A 4U3JB 4UREA 1J2TA 5EXXA 5H4GA 2CZGA 3IXLA 3WDKA 3PQ3A 4OGLA 1IH8A 5EIBC 1EVEA 1Z45A 3ESAA 5HFJA 2DR0A 5TMEA 1PSWA 1VKZA 2G07A 3V8RA 2JK0A 4LF5B 2FJUA 3V1LA 5BSWA 4FDVA 1T5IA 9MHTA 1GQQA 5HZKA 2A5GA 3CUKA 1BX3A 5TLSA 2WT8A 1T1EA 1FPQA 3NEAA 3SWWA 4DCPA 4V0ME 5LPNA 1U9JA 2QNIA 2XBLA 1IN7A 3KJFA 3VR5D 3UMFA 2H1VA 3ZE6A 2BDTA 1A3CA 2DHQA 5DGTA 1PE0A 2W6QA 3BDAA 5TB5A 4ND5A 5KYVA 3R8CA 2G88A 2A6PA 4YMLA 3LDGA 1A1VA 1K2VN 3LP8A 1Y6JA 1FYWA 5D84A 2YNMA 1EUZA 2OCGA 1QX4A 2ORIA 1FUEA 3I8XA 1ZM3A 4F5EA 4URVR 2AOTA 2BH9A 5ITZA 3QVKA 2JLYA 1Y6FA 2PPVA 3V9AA 2CC2A 2X2FA 1Y3DE 1GG2A 4HGZA 3K70B 3BA1A 3CSSA 1UC4B 2O48X 3WK5A 4IWNA 2VDUE 5JCPA 1PR2A 2OGZA 2Q6IA 1HYBA 3ANTA 4RY2A 1H8HA 1ZUD1 2Y66A 4JLSA 1XGKA 1GAQA 4YP0A 2BE7A 4UBOA 3GZNA 3RVSA 3GVCA 4EYOA 5ALEA 4TN5A 2C9BA 4EG1A 3ILXA 3U4QA 3OAAD 3W8NA 2VC2B 2LCIA 2PJUA 1YTUA 2WHQA 2NUPB 2EZ9A 1QRAA 1XTKA 3CLUC 1Y5IA 4XPIB 3N8HA 5DM4A 3G82C 4J0QA 3ZCXA 4R84A 4HNHA 4LYHA 1EK2A 1J8DA 3U7QA 1SQ6A 1RU3A 2CXPA 3C8ZA 5DH9A 5EQTA 5A9RA 2NIPA 3F8WA 2A58A 5LL6P 1HLGA 2IYLD 2DLCX 3R3YA 1N1GA 3G9UA 1N5OX 5HRCA 1SXJA 2DWQA 2ZUWA 3GRPA 3U4AA 2AXNA 2PA0A 3UC9A 2GX6A 3ZE1B 2AEEA 1BG6A 2IY7A 5L6LB 3EASA 2HUPA 4ZU1X 4XVCA 1PD1A 3H5OA 3VSDA 5JMTA 3U4GA 3JASA 1VRCA 3I2GA 3Q9LA 1R5OA 1J4AA 2R47A 2GWHA 1F8YA 4BJ1A 1J8VA 1DFIA 3I2FA 4G8DA 3NANA 2IH4A 2XB6A 1IWOA 1U11A 3AJAA 3RYIA 1PDVA 2BE9A 4M0EA 1T3ZA 4R83A 2R66A 4Q9AA 1ZL2A 1YZLA 3BHJA 4QPDA 3KPUA 3UWSA 1XPUA 3FTCA 4IQ4A 1Y9DA 4OATA 1V2HE 4DIMA 5K2MA 1ZA1A 2BONA 2RCNA 2MINA 4ZT5A 2XEXA 3QLEA 5TT0A 5I7VA 4B5KA 3N74A 1CQJB 4R1SA 3UJ7A 4QU5A 4EQ6A 4OA8A 1KWGA 2FPUA 2WIDA 1I5EA 3EWSA 1K66A 4DJEC 4YA6A 5AJVB 1LDEA 5B1HA 5A4KA 3QOFA 2PMCA 5KWJA 2A88A 1RHMA 2AG5A 1JIJA 3NM4A 3GLKA 3OM1A 4GX1A 4JD5A 4YJDA 2PX0A 3EG9B 2BL4A 2OHOA 2C29D 3D8NA 2R6AA 3LFHA 4B76A 5IBCA 5JFTA 2CXXA 5TF4A 3HABA 3QMWA 3I3OA 3DOUA 3T9AA 1Q57A 5C31A 2XNKA 4ER5A 1KZYC 1QS0A 1VCIA 1ADBA 4M7WA 4LCBA 3DF9A 2V6GA 1RYBA 3CNOA 4ARBA 4PG5A 3X44A 2HLHA 3U3RA 3CZAA 4TRJA 1A8SA 4ZAWA 1W88B 5IDXA 4RF5A 1AKVA 1MC5A 1ECPA 3IEKA 1YJXA 3U48A 1KFBB 2WWTA 3GJYA 3C3KA 3H9CA 1XUOA 4FC7A 3PFBA 4EJ6A 3QVMA 5C8DA 5CLJA 1ZUIA 3RUFA 1XPJA 4KX5A 3X2SA 1EX6A 3DBOB 3P4UA 5A3JA 4ZVUA 4A8JB 3H3XA 2ZYWX 4TL9A 3FHCB 1FC0A 4KRXA 1BWPA 2FCAA 3KS9A 1HT0A 3BREA 3L6CA 4MA0A 3W3ZB 3WO0A 1YZFA 2UU9B 2C0CA 3KJIA 2HEGA 3VOAA 4EA6A 1PEYA 1XA0A 2JGEA 3NVMB 1KNQA 4RCZA 4IGKA 3EIOA 1ZXXA 4WHMA 4C78A 2VDOB 1Q5PA 7MDHA 5JSYA 3ZBTA 1TEXA 3OCZA 1YULA 3LF2A 5G1OA 4KR2A 4NABA 4NPCA 4YJ3A 4HWOA 1GLGA 3KSUA 4ZGBA 3BK2A 5EJ9A 1FMLA 1KFEB 3NIBA 1G9TA 4OTZA 3IAAA 5HS6A 4KV7A 2X41A 1N0WA 4US0R 1CX9B 1U8CB 2WIFA 3E15A 1SIWA 3KDAA 2BBWA 1ZH8A 3I58A 3T7SA 4AG3A 5LMUB 2IBMA 1B3RA 4KTTE 5CNJA 3VSCA 3V42A 2PRIA 1DTEA 1HI9A 3E4DA 5KOJA 2BEUA 3FGPA 3AR8A 1KMQA 2XTJA 1FFBA 3FI0A 3GU3A 2FPIA 3TQCA 5IN4A 2F1JA 1KZ9A 5G4KA 3ZDBA 3TLAA 2Z3ZA 3BK7A 4AM8A 1T29A 1I9GA 4Y2VA 1E7YA 1EKXA 4OKIA 4RDHA 2WKRA 3DKIA 1UQRA 4KSCA 5KAMA 2BEWA 4XD7A 5KOHA 2ECFA 5F2KA 2AC7A 1JKIA 4JGIA 4Y1RA 3SBEA 4BE9A 5BSVA 3OE7A 1TXGA 2V9CA 3HZHA 2IHKA 3N5CA 4QUIA 2E7ZA 3L06A 2BKEA 3BGWA 4UQLA 1AQJA 1XYGA 3TPFA 4H7JA 2YIVX 1PGOA 3KWJA 3UHAA 3KQNA 3DYVA 3LK7A 5FOUA 4B3GA 3NCHA 2IYOA 4XYBA 5AOCA 5HTOA 3J81A 2CUNA 2ZJ8A 5GGYA 1S0UA 2AUMA 1FX0B 3RQSA 2XF8A 4C2TA 3GXOA 1EK6A 3GLRA 4C5CA 2WLSA 3OTIA 2VO1A 1LXCA 3DOEA 2XB9A 4UXJA 3WIOA 2PMFA 3CPSA 1TI7A 3EXHC 2XF2A 5GM1A 5CAEB 1A9OA 4AO6A 5C1DA 1XZBA 1L4BA 4XWOA 2W93A 1WEKA 2FW6A 1RI5A 3NM5A 4ID9A 2PMKA 1ZH0A 4S35A 3SX2A 3ZIAD 2Z56A 1AN9A 1YZVA 2P2DA 3DEFA 4NFSA 5TIIA 1XQYA 4Y2QA 3VKHA 1QGOA 2CHUA 1P7WA 3MCUA 2P2YA 5E3IA 2IDZA 4RA9A 3D2AA 2J85A 3RVKA 4KUGA 1IQPA 1SNYA 4FU0A 5ERXA 2HREA 3GNQA 3A7DA 4C20A 2XWBF 3GJ0A 2CB9A 2QTHA 1NL3A 4MVYA 3TOSA 5CIWA 1NVKA 2QJWA 2RC6A 4FP9A 2ZDGA 3UK0A 1JWLA 4FIZA 1UXJA 1M8GA 5GTDA 2AJLI 1QUFA 3HCNA 2FZEA 4JFRA 1ACMA 5TR9A 2ZYSA 1R00A 2CXOA 4ZQFA 3DWGA 3I1FA 1B7GO 4H4EA 5T7BA 5IXYA 3C3WA 3GRFA 5AVSA 5J4YA 4PANA 4H27A 1PWYE 4P92A 2ENWA 4MV9A 3OF3A 2AZXA 1GZSA 4URWR 4W82A 2JJYA 3BB1A 1NI4B 4Q3OA 1BCRA 3IYLW 1N2JA 2YRXA 3NHWA 4FYKA 4X0EA 3ZHQA 5I4IA 3PJFA 4XJSA 4JLNA 2ZUVA 3V00A 4Q18A 1Z5ZA 2OORC 5KHLB 1OFUA 2R1ZA 1JAZA 3ELWA 2QPTA 3QPCA 3G7NA 1YKFA 6YASA 1AUXA 3NH9A 3FDJA 4CT5A 3ZNOA 4M0FA 4ZZ3A 2Q5EA 3QE2A 1QFSA 3DHVA 5B1SA 2QN6A 1MV5A 1BTOA 4UVGA 1BH2A 1S2DA 3D8SA 3DZIA 1KS2A 1FUYB 3LQ1A 1Y3FE 3FOBA 5BYKA 3R9XA 2HT6A 4C4YA 1JJ7A 1WLSA 4DR3B 3CKKA 5EJAA 4DSUA 4IZIA 3CIFA 3RFCA 1FP7A 2QIOA 1ZJ5A 1VG8A 1QGZA 1SH7A 1DFGA 3ZHRA 1IWPB 2VH2A 5TQVA 4CKCA 4A82A 1Y1KE 2JPDA 3PGVA 5B1YA 2NUTB 2V7TA 4K9SA 1OYWA 1YE3A 1TPYA 4P5PA 1ZCFA 3AB3A 2JLSA 1GWNA 2OCAA 2YMMA 3DLPX 5EKDA 4DM7A 1N2IA 5A62A 2CCKA 5FORA 2E48A 4NJMA 4A36A 3K5IA 1ZOIA 3K70C 3GZNB 5YASA 4NU5A 5AKIA 4DLTA 5MFPA 3O9MA 4Z4IA 2MMCA 3KYDA 2AXEA 3GRRA 4GBGA 1RZRA 1MFPA 3LGSA 5FL7D 4FWTA 4OM7A 2V9ZA 5ALWA 3HYLA 1FLNA 4AX4A 3AJRA 4P83A 2ZANA 3L7BA 4QUGA 1HYHA 4R1LA 4I9FA 4BNDA 4MLCA 4FGJA 4QJ4A 1CZNA 5E38A 1SVLA 1X8KA 4NAVA 4Q1FA 4YRRA 4HEA1 3ADBA 4ERXA 2QLMA 3S5UA 4RKQA 4X85A 1I5RA 1QIDA 2ZTMA 5CIYA 3D1LA 5JJKA 3PLAE 2QQ0A 2ZWPA 4JJFA 4WSOA 1RPAA 2LDBA 4ZDIA 2J5QA 1O94C 2GCOB 3DGFC 1N2CB 1C5KA 1U2DC 1F0YA 1PG5A 5H81A 3S1SA 4G8JA 3D8HA 4PBTA 3TIIA 4EG3A 1NSYA 1W0JD 1K5HA 3HUTA 4J16C 4L8YA 1YKSA 2QRQA 4UTRA 3ZE0B 4Q15A 4ADSG 2JFNA 5ADHA 3GVPA 3ZK8A 1RQNA 2ONKA 1P2TA 1R0RE 4EDHA 2JI9A 2P9ZA 2GM3A 1G5HA 3CF6R 3QVUA 3IC5A 3ZV3A 1KEKA 1P2FA 1J5XA 1MW9X 3IAEA 4GPAA 5IVDA 2C5BA 4KQKA 4RUKA 3PGKA 1N75A 4XQGA 3RWMB 4AN4A 1RWBA 2ZU0C 4EQ6B 3UB4A 4Q3BA 1YZYA 1MC8A 4WESB 2GHIA 3RC3A 5KX5B 2ID7A 1E2JA 2UVPB 3R0VA 5DBHX 2GAAA 3FFXA 3D8RA 3U7RA 1ZJJA 3CJTA 3AVOA 2JATA 5TQ0A 3E8MA 1UXIA 4LKRA 1US8A 2QL6A 2X8AA 3A0RB 4X00A 3RS2A 2FMHA 2JH9A 5GONA 1MX1A 5TJ9A 3SC3A 3LLMA 1DQRA 4GOLD 1QS0B 1ND5A 2WYUA 4HB4A 3UJAA 3LT0A 4NOJA 3UGTA 3TR0A 3SEQA 2CMKA 2R4QA 2FSPA 4C03A 3NWOA 5CH5A 1OJLA 1T6BY 2FSVA 2AK2A 3PFIA 4U2BA 4WZZA 5LBIA 3IXMA 4DRXB 4TL6A 4J7XA 1J00A 1KFKB 1PW5A 2II6A 2WWIA 2ZQZA 4RHFA 5HIKA 4DMKA 1UBKS 2HSEA 3MCTA 4IDNA 3EZGA 3DAYA 6CHYA 2REOA 5HF6A 4F6LA 2VK2A 2X4DA 4X54A 1E1RA 4OB6A 2NP6A 4B4WA 4TV8B 5DXAA 1CF4A 2JK1A 2BFBA 3ZCUA 2ZT6A 2LNDA 1SM4A 3F47A 1K8XB 1DNPA 3R3XA 2N9UA 4KITB 1L5SA 2GMWA 1K88A 3K1AA 4R1UA 4AURA 3WAJA 1Q50A 4BNTA 5TQ2B 4A8JC 1YNSA 3HP1A 1SBTA 1MX5A 1M2VB 2HF2A 1JU4A 3WJ1A 2PX2A 2EJCA 1G1MA 3AG5A 1BHJA 5IUKC 1I7DA 2CJPA 3HA2A 1OWPA 2W0MA 4D9JA 1AU9A 1CU1A 1JIIA 4HJRA 1FOEB 4KXMA 4EL0A 3ETHA 1MEOA 3OOSA 5FTKA 2IHBA 3AHIA 3C1OA 4CNBA 2P0YA 4K5QA 2FP4A 5HZGA 1XAHA 1TD9A 2FUNB 3IR7A 5IJXA 1C7QA 5LZ5A 3W05A 2HMTA 2BVNA 3URMA 1I4OA 2OYSA 1GT6A 1PJBA 4BX0A 3R0QA 3FRIA 5F64A 2VPWA 4Q82A 3TEJA 2OV3A 4ZVTA 1XTSA 2J6IA 3CB2A 4EA7A 3S8YA 4LGMA 2VQEB 4YMWA 4XRRA 1ZVJA 5B58C 4IDPA 2ODWA 3CUTA 1LS6A 3FPSA 1N9GB 1JX6A 4FYWA 3VC3A 4MKGA 4OKSA 3WWZA 3DZDA 2DH5A 2K2QB 1CQZA 4YJGA 3RU3A 4UE6A 4P0QB 1JEAA 2MU1A 2PRSA 4YREA 1JLMA 1CJCA 1FMFA 4BKMA 3UV7A 1K5PA 4WN3A 1R0KA 1MTZA 5CT4A 1LJLA 4GKAA 3ESXA 1PJAA 2P2NA 4TGLA 1GCIA 1TPZA 5EP1A 3RH0A 3KJXA 4KE8A 1P72A 4AZVA 2QENA 4BJ3A 4YJHA 1CW2B 1UXHA 3SN6A 1DEKA 4E07A 5CVJA 2K5UA 4WBNF 4H16A 2Q1TA 3G1TA 4F3KA 4ZOQI 1ODJA 3KR2A 1L5QA 3O3OB 1EAMA 4J3FA 2X0EA 4TKLA 5JBIA 2C88A 1JKJA 3OZVA 3OOYA 2XT0A 3HJBA 3CEHA 3PXDA 3N3AC 4RIHA 5JISA 3EX7C 3H9JA 4W1QA 1Z0AA 3IAM6 4R0VA 4CWAA 3WIVA 3D54D 1SQGA 1AQ6A 2M1ZA 1NT2A 3M82A 4TSRA 4M6WA 2D4HA 3VDQA 3T7TA 2X9NA 1CRLA 5LYJF 4WERA 1DBQA 5L4NA 3COZA 5KOYA 4GOXA 4MW6A 2AGVA 2ZYGA 4PVCA 1CJKC 1F4LA 4FFMA 3FZNA 2E6UX 1O89A 4AKHA 3V8PA 2CE2X 2EQ5A 1MV8A 4OMDA 3PXGA 1OT3A 2VK1A 3ZDXB 2EDAA 3H5WA 1YKGA 1ORDA 1QONA 5JEDA 4Q7KA 4JWTA 3U7IA 2VRCD 3VI4B 3VHLB 3LHSA 3PZBA 1O5IA 4KBYA 4Y9UA 3PRJA 4FYJA 4DGSA 2YHUA 3WYDA 1YB2A 3B36A 5FOWA 4C2UA 1WUYA 3C8UA 4CMJA 2WG1A 4M9QA 3ZD7A 2WD9A 3OHPA 2P35A 2FSIA 2Q6LA 3FY4A 4DLKA 1TADA 3R20A 3V3KA 5KJ1A 5GJWC 2ZE8A 2AN4A 2Q1SA 2Z6VA 1RYFA 2WD7B 3DVLA 3G8AA 4L4XA 2JW5A 3IJRA 3A32A 4G36A 2C83A 4A7PA 3MBIA 2XTZA 2RH9B 3WSVA 3BWCA 4R1MA 2JRLA 2DUUA 2F67A 2H08A 1TT5A 1Z2DA 1EZZA 1ZESA 2W6CX 3LKDA 3K6KA 4TT3D 5I3ZA 1JNYA 1E3DA 3T7DA 4Q7LA 1NBME 3ZYZA 1NWCA 1NTOA 1ELOA 1LI7A 1VGRA 1BU8A 1EFLA 1NRWA 2Y68A 2GSWA 3O73A 5SYAA 1I4WA 3O8CA 4TWBA 3GDHA 4NE2A 5C1IA 3X2FA 1L1QA 4PNEA 2CW5A 5EJGA 2O2EA 2PUDA 1CPYA 1HQDA 4WASA 2QXTA 2AA3A 2WICA 2B1QA 2AN1A 2UV8A 1UQUA 2BKAA 3HJAA 1P1CA 4TZ6A 5C35A 4LWZA 4M1YA 2HJRA 1HYQA 2AG8A 4XI9A 4B2LA 3O1JC 3G8YA 3F7MA 3GLIE 3L0DA 3RAJA 1GXSA 4NYMR 2O54A 1ODFA 5IZCC 1NW7A 4HP8A 1XFAA 5FNZA 2YHSA 1OA0A 3IQEA 3GLHA 5B58T 1KP3A 3I8SA 1W4BA 2AVNA 4DLNA 5C8ZA 4JUFA 3HJGA 2FTKE 2VF7A 2ZWIA 3VHRA 1DJOA 1V1MA 2V58A 4PZUA 3W2GA 2W98A 2JFYA 4G5GA 4ZOEA 2XCTB 4H7IA 3SDZA 1RC8A 4QYSA 1DC7A 3HL4A 3I0MA 3ORQA 2VG8A 1N6PA 2FXVA 3LY8A 5JSZA 4P82A 3C3EA 4I08A 3KKKA 1EWYA 1LZKA 1J8MF 1I2ZA 2XBMA 3N8GA 5KPDA 5CX4A 3EMKA 4FS8A 1W0CA 2CUZA 3LY7A 3NWEA 1DXOA 3BSFA 5EMJA 1HDZA 3H1BA 1XKXA 2Z2YA 2HA5A 3ZBPA 2V6MA 1NLZA 3GMSA 3DMHA 2HA4A 4JOBA 1I0LA 2Z2XA 5JVDF 1ZQ9A 1FY2A 4WZBE 2QMUA 5DYTA 3EA4A 4DNOA 3IBTA 4M9UA 2P1DA 4G3XA 3ZWYA 3F8TA 4WCFA 4B3FX 4LSGA 4LDPA 3SQWA 2WZDA 3U7GA 2K2WA 4QOIA 4E1AA 2FF7A 2HGSA 2WQ7A 2W2QA 4PLCA 4MW0A 1UT5A 4HN4B 3RSFA 1USUA 3OU2A 2EYUA 1SU4A 5LNK6 3FNFA 3LH5A 3WYEA 3AV3A 3IMEA 4YQEA 4R2HA 4IRXA 3LXMA 1DKLA 3H6HA 1PFGA 1DOAA 1GKUB 3KVYA 4UHKA 4ZT7A 3UKJA 3ZU3A 3PE6A 5HDQA 2QRGA 4DA6A 3CEAA 4LRUA 2R7KA 1SCKA 4IFBA 3KQOA 1FSPA 1R6UA 1Z36A 3DAFA 3B13B 4I99A 5KWSA 4WA7A 4YONB 5G2OA 3A9WA 4CV2A 4NK4A 5IDVA 1KDVA 3WNCA 3DBIA 1BN7A 3KHUA 4LNUB 1F0NA 3DFFA 1L5ZA 4TQGA 1NW3A 4TQUS 4PGMA 3OZDA 4TX1A 5CLQA 3UCEA 3EW7A 1OZ0A 1TRHA 3I83A 4KREA 1WPRA 4J2OA 4H1VA 4OBWA 2GPNA 1JALA 3JAWB 1SBIA 2GZ1A 1DHTA 3G0IA 3STTA 1H6AA 5BW8A 2QRPA 2CVZA 3NKLA 3ABOB 4L1KA 5INTA 1J5EB 3OJXA 1P4JA 5KNCH 1VL5A 2PL1A 1GPH1 2XMRA 4ZQCB 4ZREA 1KQFA 3A6JA 3M6FA 4K86A 4E46A 1QC5B 1XL1A 4S2UA 4XW2A 1TQ6A 1OX4B 1ZUNB 1KS9A 3DE4X 1V16A 2XDQB 4O4LF 2C2BA 2IFTA 4EWLA 1B15A 1BDIA 1GL3A 1FL9A 3EQ8A 3NUZA 3GROA 3T7AA 1KVRA 3IB3A 2BISA 3PXUA 3L0SA 1UZUA 1QGUA 3T5BA 4Q34A 4PPGA 5LP6B 5A4FS 2W6JD 7ADHA 1XMOB 5BW4A 4IG4A 2ZJ7A 4B6JA 1E9RA 1FPMA 1KYIA 2H0AA 1UKEA 1QAOA 5AK0A 5SZJA 3DMYA 2ZIXA 1X8LA 1ZU4A 3Q88A 4MYCA 4ZPJA 2VUHB 1KK3A 3K53A 4NEQA 4X6XA 2IV7A 1XDZA 4ZVQA 4BO1A 4OHYA 3BA6A 3HCFA 1IEVA 5T41A 2PX3A 3C1AA 2X5XA 2B25A 1E2GA 1B6SA 1O9BA 1R9MA 2GASA 2IQ5A 1LK7A 4FMDF 2O2IA 4PHHA 4TWRA 1CVLA 3MBKA 1Y48E 3RVQA 1GPAA 2RAVA 2BGUA 3WYBA 1J07A 2Q41A 4IQFA 1XD9A 2BFDA 2HWUA 4TL8A 2EVWX 1U3CA 1EIWA 4PCVA 1B1CA 1O0BA 2G09A 5CH3A 4HVLA 3ZH2A 5LWQA 1T43A 3I53A 4RY8A 4FVTA 4IWYA 4M1QA 2RAUA 3VPSA 2HTEA 2PZFA 4QU0A 2ZS7A 4FHGA 5KYWA 1H2FA 3EGDA 1GGEA 4JROA 5DGCA 1N6NA 3S1AA 3WNDA 1IN5A 5JI2E 4Z54A 1V3UA 2FH5B 2VPYA 3BMOA 3DMNA 2GETA 3FRJA 2XT9A 3SR4A 4YHHB 2DPMA 4V3CA 1T2FA 1Y6QA 3PPXA 4JI5B 1RBZA 2RK3A 4Y8VA 1ZQ1A 2OGTA 4YO7A 1YXMA 3GJ4A 5U1PA 4D8XA 2HZ7A 2XLBA 3BC1A 2HFKA 2ORVA 1IOWA 2NZYA 3HRIA 4JBNA 4YQZA 3FCUB 5L3QA 5BR7A 3RHFA 3A1EA 4OI2A 3LA8A 5A5VA 3IIEA 4K2HA 4UULA 5DF1A 5JAHA 4YJHB 1U0JA 1XA4A 1YBAA 1H4QA 1HDGO 4OHFA 2P69A 4IOJA 1V43A 3X1XA 1ZGAA 2VEDA 3J7AC 3O8QA 1XTQA 4I14A 2YMQA 4MKRA 3REOA 3D6V