4GICA

Crystal structure of a putative histidinol dehydrogenase (target psi-014034) from methylococcus capsulatus
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
401
structure length
382
Chain Sequence
SMTEVKIKRLYTGDADFASQLDRLLAWSDTDIHQRVTEIIGCIRRDGDAALVELTARFDHFVVDTAAALELPRDVLEAAWQALPAEQAKALREAAERIRAYAERQKLDSWDYREADGTLLGQKITPLDRVGLYVPGGKAAYPSSVLMNAVPAKVAGVPELIMAVPAPRGELNALVLAAAYISGVDRVFRIGGAQAVAALAYGTETVPRVDKIVGPGNIYVATAKKLVFGQVGIDMVAGPSEILVISDGRTDPDWIAMDLFSQAEHDEDAQAILISPDAAHLEAVQASIERLLPGMERAEVIRTSLERRGGMILVDDLEQAAAVANRIAPEHLELSVESPEVLVESIRNAGAIFMGVLPTSGTARFSSPLGVYDFQKRSSLIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative Histidinol dehydrogenase from Methylococcus capsulatus
rcsb
source organism Methylococcus capsulatus
molecule tags Oxidoreductase
molecule keywords Histidinol dehydrogenase
total genus 120
structure length 382
sequence length 401
chains with identical sequence B
ec nomenclature ec 1.1.1.23: Histidinol dehydrogenase.
pdb deposition date 2012-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4gicA01
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 4gicA02
1FP4B 1FP4A 4WESA 3PDIB 5GGYA 5JG7A 1QH8B 3MINB 4FNAA 3NU1A 2M6KA 4H59A 4OXQA 3U7QA 3PSHA 1QH8A 2PHZA 4FILA 5B58T 1MIOA 2AFIA 3R5TA 5JOQA 1PQ4A 2R79A 4OVKA 1XVLA 4INOA 2XDQA 4OXRA 4LJSA 4WZBB 2WI8A 4PAGA 1KARA 3ZK9A 3GI1A 4WN9A 5GGXA 2ETVA 2OGWA 4INPA 4GICA 1H1LB 3AEUA 1M34B 5KOJB 4BBPA 1M34A 5CX1A 2XQVA 3K1AA 2Q8PA 2XV1A 4UDNA 5BVGA 4HN9A 4CL2A 3MWFA 5I4KA 2PS0A 3HJTA 5KHLB 3MD9A 1L5HB 4NNOA 3G9QA 4WESB 3PDIA 3U7QB 3R5SA 1M1YA 4PM4A 3TLKA 4HMOA 3CX3A 1K7SN 4WNAB 4TKVA 2AFHA 4FKMA 2QI9F 2AFHB 3AERB 2WHYA 2XH8A 5KOHA 2PRSA 3HH8A 3EIWA 5JPDA 2OSVA 1M1NA 4M7OA 1QGUB 3ZK7A 5M2QA 5M34A 3AEKA 3LHSA 4ND8A 4XPIA 5CX1B 2YNMC 3K1AB 5JJ5A 3AEQB 1QH1B 1H1LA 2MINA 5KOJA 1ESZA 3AEUB 3HXPA 1K2VN 4WN9B 1PSZA 5FLYA 4DBLE 5HX7A 1QH1A 3AEQA 4UDOA 1G21A 3EIXA 4WZAA 4WZAB 3ZK8A 2X4LA 3MFQA 4MX8A 3MINA 4WNAA 2YNMD 4G09A 4H0FA 4G07A 5BVHB 2AFIB 2RG7A 5BVHA 5AFSA 5KOHB 2R7AA 3MWGA 3AERA 4MO9A 3LI2A 3AETB 4TKUA 4TKVB 4NNPA 1G20A 1N2CA 3AESB 4N01A 1N2ZA 2XDQB 1KAHA 2PS9A 1G20B 3PSAA 1KAEA 2MINB 1TOAA 2XUZA 2OV3A 1M1YB 4HMPA 1G21B 1EFDN 4MLZA 4HMQA 1L5HA 1K75A 2PS3A 4IRMA 4MDYA 2M6LA 4UTOA 5HDQA 2O1EA 4K3VA 1N4AA 3BE6A 4WZBA 4UTPA 3UJPA 1K0FA 4FI3F 3ZTTA 1M1NB 1MIOB 5CR9A 1QGUA 1N4DA 3AESA 2Q8QA 4LS3A 3ZKAA 4ND8B 1N2CB 4XPIB 2XY4A 3AEKB 3BE5A 5M3BA 3TEFA 3TNYA 4B8YA 3AETA 4TKUB 5BVGB 5M29A 2OV1A
chains in the Genus database with same CATH superfamily
3EAGA 3OZCA 2XOEA 3MRXA 2NZ2A 4JBNA 2V7EA 2FGJA 4B76A 1BYIA 1D2MA 4CQMD 4RAOA 3HXLA 1U1FA 3FSGD 4M0PA 2V59A 1YI8A 4QBFA 4ZI5A 1O96B 3TTSA 2HAEA 2QTZA 5L4NA 1O2DA 1VL8A 3D6UA 3M5PA 3IURA 2FE1A 3VSCA 3PEEA 1UPTA 2ZIEA 4DCVA 2E82A 3KZNA 5AVOA 2ZQZA 1UJ5A 2W4QA 3ONFA 4O5AA 2WIKA 3H9BA 4D82A 1L4UA 2I99A 2F3UA 5JDCC 4CV2A 3CHYA 1P1IA 2WU1A 4KSBA 1DOZA 5JTTA 1FB5A 2J08A 3COVA 4S04A 4C0SA 5GONB 2XE6A 4JI0B 4KE8A 4MVJM 2OLEA 2OZVA 4R1TA 3WR5A 1W2WB 4F3YA 1MX9A 1JG2A 4PLZA 1G66A 1M9NA 3GJRA 3OM0A 4IIJB 4XDZA 5EUCA 4JQYA 1C1DA 2XMZA 3HQ4O 1D09A 1BO6A 2WD7A 1YDWA 4ZO7A 4ONEA 1J2JA 2JEYA 2VP5A 1Q1EA 2VDRB 4WA7A 3JASB 1VTKA 1XK6A 4IIEA 1NY6A 2JBAB 2P6OA 3DEHA 2PSJA 1UBLS 3R8CA 2JJ8A 1XEWX 3FNRA 4F7WA 3VJRA 1YNOA 5H3HA 1FDTA 1L5WA 2G71A 1AV7A 3H4MA 2LD4A 3ZDQA 2VDUE 4GWKA 1KVTA 1T34A 3DXXA 2QRLA 4PSVA 4DBLE 1LNSA 3WRYC 1MJGM 3NGXA 5B3LA 5K0ZA 1JHAA 1JDTA 4OUKX 1IHOA 3EDMA 1P2GA 3ITEA 4H6PA 5ESWA 3V2IA 2PZFA 1V45E 1VCHA 2BFFB 2ZIWB 4PLYA 1SK9A 4O4JF 1SHLA 2BBSA 3GIDA 2FKAA 3OD5A 4J2HA 3SS9X 5C81A 1GIAA 2X4DA 2C4WA 4WT7A 1YJAA 4NZ9A 3TCXB 2B9VA 3EPKA 1H6DA 3LP6A 3ZW8A 1R4NA 3ABZA 4G36A 1L7AA 2YYAA 4K0KB 3F5MA 4PC7A 1K5PA 3IEKA 4O33A 2AC4A 1KU6A 3BF7A 4C0JA 4D9BA 4LRXA 2FOLA 3HXMA 3NMUF 1M5UA 4KBFA 3PR2B 4PYMA 3WRXA 2DLCX 1E32A 3WWYA 1Y3DE 1RXVA 3GLTA 1QIJA 3OJ0A 2TRSB 2WTNA 3HWSA 3A4TA 3FLMA 4P7KA 1DIHA 2P65A 3IXQA 4L27A 1IPFA 3RRFA 3M6VA 1ZNWA 1VXRA 1W76A 2J67A 3HL0A 3VSAA 4ALNA 3OWXA 1U3WA 1AKUA 1F1BA 4BVFA 3PWKA 4N9WA 3VKGA 3DVAA 4FYHA 1G21E 1H0SA 3RS8A 1E2MA 1MPXA 3ZU2A 2H4JA 1JKFA 1EAMA 2OP0A 5GJBA 1A2OA 3RYFB 4O63O 3ESXA 2OM2A 3NHKA 1P5RA 1OY1A 1UC4B 3DR3A 1HZJA 4CMCA 4GHWA 2O3TA 3IGFA 2QI9C 3LLVA 4RS3A 1M0WA 3EQ8A 1JNYA 2IXFA 1P19A 3A3YA 2CVZA 3R9XB 2VK8A 3LUHA 1W46A 4D8VA 3BL5A 3T06B 3GCGA 4GR9A 1I7LA 3CPHA 4WKPA 2A1TS 1T8PA 4F93B 2B8EA 1U7XA 4CR8A 5HOQA 4GSLA 4X41A 4KG7A 1NUPA 3GA7A 2E4UA 5H9VA 5AM0A 1MO5A 1XELA 2OBBA 2R79A 3HJCA 5ITWA 2B9EA 4QLOA 1CV2A 1R0XA 1U2GC 3PP8A 3D02A 3PQ2A 3ACDA 3PGVA 1SG6A 2YYYA 1CUGA 3JQCA 3O8LA 4PQEA 4B3JA 1RCUA 4L2IB 3AM1A 4DANA 3QSGA 3A9RA 2I4OA 1W75A 1GV1A 2H54A 3AKYA 1YQTA 3CRNA 1IE3A 4TMWA 1GT6A 1HLDA 1I2DA 4HDSB 3M82A 2WHXA 4K6GA 1Z63A 4B47A 1FZQA 2BJHA 5BYJA 4PYQA 1C9EA 4OQPA 2EJWA 1NP7A 1T10A 2QIPA 4Q3OA 5B3KA 2CVFA 3C16C 1D1SA 3K6SB 4MA0A 2D3TA 1XVUA 3BBPA 3DOJA 4EHLA 3EWIA 4PO3X 1J6UA 4LYJA 3SQLA 1YZYA 3RFVA 1UPXA 1FOEB 3FOBA 3HWWA 2DU8A 1EVKA 3VTZA 4FWTA 1KMMA 1RI1A 2RI0A 4JBWA 4NH4A 1FDOA 2O23A 4EQ6B 1JYSA 4KGDA 3URKA 1E9VA 3FPAA 2ECFA 4LGYA 3MBIA 4DNFA 4IIJF 4EBBA 3VR1A 3OCYA 2TECE 4NVRA 4YAFA 3V80A 3MS4A 2A5YB 1NU8A 3W7VA 3EZ9A 3K9HA 2H1WA 4UD6A 2QQ5A 3OMLA 4AS2A 3PHGA 3I61A 3WZMA 1RKBA 5GONF 2V7UA 4U7TB 1Y5RA 4YCSA 4B2YA 4X1YB 1JUDA 3PPWA 2JJ2A 2ZJ1A 3L6BA 2FJPA 3AERA 1M6VB 4YA6A 4MUYA 4BN4A 3ESQA 5KQMA 4F8JA 4O1HA 3ZWNA 3TB4A 3MPUA 2P2GA 4QG3A 5JQWA 2DUNA 2QM0A 3UK7A 2MMGA 1EUCA 1RXCA 3JQPA 2P7HA 1NGSA 4HTFA 5DXAA 5JD5A 1PFGA 1TIKA 4GYYA 1HEUA 4N3CA 5IYZB 1VYUA 4HH0A 1RLUA 1XAJA 3PFKA 4C4OA 4DZRA 3ROTA 1N0WA 4LV6A 2ZRHA 2C57A 4PTLA 3IDAA 1TB4A 4IQFA 4UTOA 4NFYA 2HMTA 1A8SA 1HMYA 3AJDA 2GLUA 4JUDX 4QAQA 4GDMA 1T3HA 3NNNA 2JAUA 5JXWA 4DBVO 5JTUA 1Q2XA 2F4VB 3SBXA 5KCMA 5BT8A 4M1TA 4DIOA 3CW2A 2BFBA 3TG2A 2VJKA 3QQPA 3OLQA 1NMEA 1LV8A 3WYBA 4LSWA 4WEQA 3HCDA 1E3QA 1VI5A 2AQ8A 4KIUA 4TSFA 4TXJA 3T7RA 2K7FA 4DB4A 4AF7A 5AHWA 2VF7A 4X64B 4ZDKA 2P9JA 5D3ZA 5CFOA 2YN4A 1WTCA 3KWMA 2CFTA 2J6CA 2DWUA 4TLBA 3V00A 1JKIA 3VSBA 4QARA 3QPDA 3MBOA 4R05A 3HO1A 1UANA 2YJ6A 1YR9A 1H2AS 4K05A 2GXUA 2FR8A 3D1LA 3K6SA 2BGJA 1Y1QA 3NXSA 3N0RA 1M2HA 3Q5GA 2VDKB 4KMOA 4X95A 3WGUA 3MMNA 4PQRA 4IX9A 4P5PA 1WMBA 2G5GX 3EFOA 3JQAA 2IDMA 1EA7A 1O95D 2R87A 3KVOA 3PI7A 5GZ1A 3WICA 3H8WA 3VOAA 1U0GA 2FUG6 2FN7A 2R7MA 5LBTA 3GX1A 4X20B 3PQ6A 3VH2A 2HF8A 4CMEC 1NT4A 3P8ZA 1COWD 1XKXA 1L5VA 2TMKA 2WI8A 3W4IA 2J09A 3LPDA 4X7MA 4ND7A 2H1LA 2HNBA 2PQ0A 4AFNA 1DAPA 3ZD8A 3H18A 4II3A 5IKXA 1W5AA 1TO1E 2E9SA 2IT1A 3EEIA 3M6AA 2PR2A 2E48A 4HN9A 4KW7A 5D6OA 1B6SA 5IC6A 3S27A 4KPUB 4YK7A 3FR7A 3I0MA 2II6A 1PGPA 4G1VA 1ML3A 3OA2A 4IQ8A 1LPNA 4NU0A 4BVBA 3C0KA 4ZQBA 1BMFA 1NRJB 1S8AA 2ZB4A 5IVHA 5HZHA 2EFEB 5JI3E 3FYDA 3R6DA 3NBKA 1H69A 1E6LA 2PA3A 3O2SB 5BXQC 1XN4A 1JHXA 1E5DA 4PNPA 2NAFA 3CZPA 3NAMA 4RMJA 1PL0A 3V2GA 2CYAA 3H3JA 3RC8A 2QX4A 1JJVA 1JIIA 1RWQA 3DW1X 1GNSA 3K0AB 5HVNA 4DQKA 1T9DA 4IVNA 1DRVA 4HWSA 4GLLA 1HI9A 5GM2A 8ABPA 5KHOC 2DWQA 2ZM6B 4JI8B 2YFQA 3BAZA 4ZQHA 3RIXA 4DMMA 4LDNA 2ZDGA 4F84A 1E94E 2L82A 4WZAB 3CZMA 4IDOA 1VE1A 3GP3A 1PP4A 4R1SA 1OZGA 1T2UA 3TIFA 3E5NA 5CVEA 4MUMA 5F64A 3IKLA 2HXSA 2FG7C 3U9TA 5FOQA 2XUFA 5IN4A 2FPIB 2W98A 5EJMA 1TM3E 3NIWA 5DYIA 1XKQA 4D0SA 2CJWB 5AD1A 1DWUA 1FK8A 3BUSA 3EOAI 3UWPA 3VJLA 3MJDA 4EF4A 5K99A 2JRCA 2UYOA 1X7WA 4YAIA 3R7DA 1ZIPA 2JFOA 2GX6A 3FKSA 4ARBA 3OCXA 3EGVA 2IH5A 1CU1A 1KAEA 3WDKA 3O74A 3GGDA 3QUTA 1P75A 2F59A 2FKNA 4F46A 4XZ3A 1Y34E 2EKPA 3HSYA 2XGMA 1XDSA 4BV8A 4CR6A 3DNMA 1BEEA 1TAHA 1ZM9A 2VJOA 4MRNA 3WYEA 3O31A 4A8JA 2X42A 1N6PA 2JANA 2Q2OA 4FPXA 4PXYA 1RE1A 2AOVA 1RI3A 4Y2HA 4LHXA 1R5OA 3F97A 4DN6A 3A9WA 4PZ9A 1EH5A 1I30A 1PG2A 2JDIA 1I1OA 1MEOA 4H3KB 4G24A 4LYAA 3GLGE 1EVQA 1I10A 4GKKB 2UAGA 4Z4EA 2C1ZA 2M32A 2XDWA 1N2CB 1C0IA 4N39A 4PLCA 1BTOA 5JS6A 3ESCA 5LYJF 1GQYA 3HCFA 4GOKA 3VR4H 2FPGB 3FRJA 1Z7YA 3GZNB 1PEYA 2FOXA 3UAGA 4X94A 3K1YA 1Z3IX 2O1WA 4NU8X 3VMFA 3OEED 1T8WA 3ZQJA 3KJNA 4WI1A 1DAIA 1TCVA 1UOPA 2F62A 1R74A 3N8DA 3T3IA 1K6XA 4HFJA 3KYIB 3PUHA 3NOQA 1NBME 2GK6A 4R9RA 4G5OA 1G3UA 3E9DA 4AZ3B 3DLBA 3TZCA 3TZKA 2HHAA 2N1MA 3IYLW 2HNAA 4LY6A 4QEKA 3VM6A 3W1WA 4XGQA 2QRZA 1JE0A 2ZANA 4FEGA 2JLZA 5G1OA 2WMYA 1J4AA 1GTZA 1XU4A 2Q3HA 2SKEA 4N5MA 2AYYA 2P0EA 4BHTA 3NHBA 4BVKA 3D0QA 4EY8A 1NU6A 5D3KA 2OC9A 4DJDC 4ZAWA 5EPEA 1ZOLA 3IOYA 4UHCA 3ROGA 4EG8A 1F4LA 4LX8A 1B16A 1N2JA 3QW4B 5EP4A 2VUTA 3HBJA 3KUCA 1XN1A 1OBFO 4OK5A 3I05A 2QTLA 4JFRA 1MB4A 4WXPA 5AI8A 1TAUA 4DC1A 3PYMA 2FFQA 4HLQB 5E0OA 2DUUA 2Q28A 3LT4A 4C22A 1XXHB 2EX1A 4ZV9A 1ID8A 2EW8A 5LIRA 2HSZA 3V1KA 3K8ZA 4Q9IA 4MPRA 4CCAA 1I94B 4EY4A 5G1PA 5C8ZA 2P2CA 3MCTA 1X2BA 3VI4B 4L9AA 1BE8A 2BI8A 3MOSA 4N18A 3NJ8A 3UUGA 4P5EA 1G8GA 1FZTA 2H1RA 4EY3A 4ZKDA 2FSVA 5EHQA 1HZZA 3RRXA 5A6VA 1WPRA 3TMYA 2JZNA 2QUBA 3GELA 1PJ4A 1HDOA 4KLRA 3FXAA 5CLIA 1QQBA 4PO9A 3H2HA 4EJ6A 1V7CA 2FQQA 4JB3A 5JROA 2Y0BA 4YC7A 3EIQA 5DT2A 2XHZA 4O2BA 5H02A 3GLFB 1GJRA 2X9NA 4C7MA 4F71A 1G3IA 3T5TA 1J0DA 5L45A 4CEJB 4RPIA 3P9KA 1CVRA 1ONPA 2Q2VA 1ABBA 4FGJA 4CMAA 3ZN2A 1HL3A 3CRRA 3PHJA 3QXHA 2PL5A 4C03A 4YX9A 2X9LA 1AXGA 2CVHA 1GN9A 3CLTD 2Q3DA 2R8YA 3CUUA 1YR7A 2IEAA 2RHCA 3OPMA 4E2XA 1CUDA 3A58B 1TEZA 5I9TA 2H1CA 4XJTA 2ZRDA 2ZU0C 4FYPA 5EA2A 1QYXA 4D8XA 5K2MA 1QKKA 2P1DA 4O4HB 4A0HA 4QGHA 3NHUA 1OHHA 3O8CA 3IJRA 4RY0A 5B1IA 5LMUB 1M6EX 4ZYLA 3BK1A 4H4CA 3PZRA 1EMDA 4QGAA 2W9XA 1YKGA 3QOWA 4XB1A 2X22A 1EG7A 5G3YA 4M87A 4U7DA 2FU5C 1RPJA 3L9WA 1WCXA 1ZJ6A 3OIVA 3CF0A 1ZFNA 2WFLB 2IE0A 3H1FA 3ETHA 1L7VC 1CY8A 3WGKA 1X9IA 2O8FA 4XDHA 1RXIA 1A96A 1E7WA 1DKPA 1M2WA 2CBXA 3N2YA 1TLTA 4G86A 4NI5A 5DWQA 4BVLA 3VI3B 3K05A 4MQ4A 4WADA 3DYIA 4BQEA 1WZ2A 4N3GA 3FWNA 1X87A 3BREA 2G9QA 1OBHA 4BQFA 3N86A 3E81A 1OF1A 2WABA 3Q6IA 3RVBA 3OVMA 4PX5A 4Q12A 4XQ9A 5FNZA 2Z6AA 2PJRA 2RHDA 5JAQA 1OLUA 5H3CA 1DV1A 1YMQA 3CH4B 4ZAYA 2JJ1D 3E9NA 1JFTA 2JKZA 3IJPA 4MINA 1G5IA 6CHYA 3NIGB 4FX2A 1FUYB 4UREA 1YRYE 4EJFA 4CKEA 3C85A 3MELA 3OQPA 1EM8B 4E11A 1YBFA 3L07A 4X63A 1QRSA 4XB2A 3TL2A 4C08A 3D64A 4XUDA 3F0TA 1BHJA 1QR6A 1KARA 4AP5A 3B3JA 4ZFNA 1SXPA 1L9XA 1QAMA 1PNVA 2KI5A 2OPBA 3A2KA 2KLHA 4PG7A 1Y4DE 2G3YA 3F71A 4KAJA 2V58A 5EG5A 2PVSA 3M83A 2OQVA 2ZKIA 1O7JA 2GZRA 3ANTA 5I9IA 2IOFK 1GZ7A 1YQQA 3B7PA 3C5HA 1EWTA 4ALJA 1SXQA 2PS0A 1JG7A 2AX3A 3HC7A 3MLAA 4H35A 1D03A 2HW8A 3NV7A 3G9QA 4FD2A 1GTVA 1EVJA 1QZ3A 3OC6A 3VOSA 5JZ9A 2HMAA 4Z9BA 4IR7A 3PFHA 3WK8A 4GP7A 2GQ0A 3RS5A 3L41A 4BO2A 4ZOAA 4ZJUA 3PQCA 1OH8A 3WSVA 3SQMA 1R9MA 1YRWA 4YRZA 5HJ5A 4D3XA 5LZ8A 4COKA 2OHHA 3OZGA 1RXWA 2EG9A 2L69A 4Z9FA 1IN4A 1Y42X 4JP2A 4H77A 3AOGA 4ND8A 5CLQA 3DJFA 4PC6A 1UPFA 2Y1GA 1KR5A 4OPMA 4F5EA 5LP6B 1GWNA 3I23A 5G3ZA 4MDEA 4YCLA 1TIPA 1XLWA 3N58A 3GGSA 2Z57A 3Q3GE 5IFKA 2VJLA 3B5EA 2Z5VA 3OQHA 4Z1MA 4BV9A 4YLEA 2WICA 3IB6A 3G8AA 4POAA 3EF3A 2JAPA 4XYLA 1JEOA 4HGYA 1Y33E 3I34X 3MMZA 4G0VA 5H8WA 4FQ7A 4WCFC 3ZGYA 4E30A 3WGLA 3LW7A 3E23A 1GZVA 4XWGA 4EW2A 3CYFA 4JP3A 5BN5A 2EGUA 3HEMA 3ILXA 1V16A 1PZFA 3HO8A 1WVMA 1KMHB 1W35A 4WUVA 4ZICA 2FLVA 4M0FA 5EVJA 3BMQB 2VQ3A 1JKJB 1XZFA 4JC0A 4MJLA 2PGOA 4Z8XA 4DJAA 1I0LA 4QDKA 3QE9Y 4UCWA 1BJTA 1WDTA 4H7IA 5CFRA 4LDQA 5LP6A 5NLLA 5AI4A 1PLLA 1TVCA 2YIJA 3LQRA 1T6YA 5EQFA 2GESA 4JJAA 2VTBA 3WB0A 3A28A 1VHDA 1V5GA 1N2CE 1L5OA 1UJBA 1U2RA 2ZQYA 2A92A 4II7A 1TRHA 1R0LA 4K3VA 4LZWA 2F1KA 1J07A 2G6BA 4AUEA 1N57A 4KQFA 4JP1A 2GRAA 4BFXA 3O1HB 2NU9A 1RAIA 3GVCA 2K87A 3GR6A 4HAVA 4RC9A 4QYSA 2OBYA 3DW3X 4N5NA 3AW8A 3EVBA 2Q3BA 3K9QO 1LVUA 2WTXA 3SHQA 4N5DA 4F4FA 3CPSA 1Y7IA 5ALMA 2YZNA 2CJWA 2X77A 4LGMA 4Q00A 4JI7B 2A0UA 1XO1A 1HFWA 1KYTA 3F8SA 4YP5A 1DNPA 3F7TA 1TUGA 3T5AA 3GDOA 1ZGCA 2NUPA 3KDAA 5K3EA 3WKDA 3WIBA 4NAHA 7AT1A 4KGXA 2N75A 4I6JA 1EUDA 1US8B 1YVEI 3DXYA 4LWZA 3VFDA 1H2FA 3AVOA 4ZCMA 2FLWA 4GVLA 1Z25A 1P61B 2XEDA 4EUKA 4EFDA 1ZL0A 1O97C 4OSOA 3AY6A 3L8GA 4CMIB 1XYYA 1H4VB 2BP7B 4YRJA 1SBCA 1UBMS 1NW5A 2ANBA 4BNUA 4FR2A 1P1BA 1XXHE 3IMKA 4RMGA 1E1MA 2DBVO 4HFNA 4D8WA 4YQFA 1GFIA 4DLAA 5KBYA 1MNQA 4B74A 2D4AA 4UQLA 4OREX 5EP1A 1WOYA 2ZR7A 2AG5A 4I55F 1CJCA 2IOFA 2VK2A 2KBFA 4X7BA 1FEZA 4EPVA 5IJ9A 1DMRA 1H2EA 2FEMA 2QN9A 3QBEA 3WLSA 5ALEA 4GKAA 1KWKA 3OU2A 1MO3A 1EUQA 1I0IA 1S8OA 3KYCA 4ZZ0A 4YN3A 1N1GA 1WXXA 5CK4A 4A0SA 2WK1A 4EB6B 5LVAA 3M6FA 1NA5A 4ZVMA 5C1BA 5ALQA 4BNMA 5CM9C 5GQSA 3CZ4A 5AK5A 2P9FA 1NQTA 4CMIA 3U61B 1OX4A 3KOUA 1BCRB 4J4TA 4PFJA 4IAOA 1RCTE 2O2JA 3R9WA 1Y8RB 4KR3A 2ZRBA 1K98A 2OXEA 2QQFA 1QHEA 3MCVA 5ADUS 3UWKA 1KRWA 4OFBA 3KPUA 4OQEA 1L8QA 1W5EA 1T2FA 5ENZA 1IXZA 5FXMA 2C83A 5KC9A 2EQ5A 2QVGA 3D4NA 1A50B 4Q24A 5FI1B 3GCDA 2ZYAA 1PK8A 4IYRA 1E9RA 1R4ZA 3OFKA 4RE6A 5FLXA 1KAMA 3LLCA 1KY5A 5K3DA 4I5EA 3K5IA 3PXCX 3X2EA 4ZI7A 1ACLA 3BH7A 6AT1A 3KQWA 1GL7A 4R4JA 4NDAA 5CJJA 1HDZA 4MO2A 3LUFA 3MWGA 4RD2A 2BGGA 5C1IA 2D2EA 2LWIA 5JSUA 1SR8A 4MRRA 1CULC 1BXZA 4B79A 2X58A 4TLDA 1MC5A 4QU8A 4EDHA 5EZ5A 4N8EA 4U2KA 4CUJA 4ALKA 1Z8HA 4QDUA 4OXIA 3T3HA 1WDLA 1Z4KA 2EWVA 4QEZA 2BCJQ 3CUWA 4X65B 3DCIA 5SYMA 5DN6D 3G9UA 1EI9A 2G82A 2VK4A 1IOZA 2JFPA 2NTEA 2G9VA 4ENPA 4GRIA 4JB8A 4RY8A 3WGMA 2FPWA 3PA6A 2AF3C 3I72A 1PW7A 3PENA 4FHEA 2O8NA 4LQ4A 4X5OA 4XEUA 4PO8A 3EGWA 5J63A 3V6MA 3UPUA 1TCAA 1J9EA 3T4UA 1MJGA 1QDLB 2CGEA 2O7SA 2I03A 5D7NA 3TEMA 1MFPA 1B1CA 3HR8A 1ZP6A 1G9SA 2CLHB 1E9AA 4IDNA 4ZZ1A 2X9VA 2A9OA 5BSWA 4FZ5A 2FY8A 5EERA 1WMAA 1CQWA 2FMXA 5KJCA 1E2BA 1QKIA 3QUCA 1T36A 5T64A 2O4UX 4C7BA 1KP9A 2R85A 3ZDDA 2JLBA 3BZWA 3I2HA 3QX8A 2GDJA 4H60A 4R16A 4TWAA 2P8SA 2HU7A 2ZVDA 3GNTA 4L6IA 1Q77A 3TSYA 1OE0A 3T3OA 1E2HA 2H1VA 4X60A 1UZUA 1F8FA 1VE5A 2DUWA 4PFKA 5C5IA 2RGDA 1FA9A 2ZITA 2OXTA 3I64A 4DR3B 3HLKA 1PF7E 5L3RA 4DLSA 4QTTB 3SX4A 4B6RA 3EBPA 3UMVA 1LFDB 3B78A 3ZJTA 1LJLA 1H5UA 2PUVA 1CQZA 3L6RA 2NW6A 2UZ3A 3CPJB 4MW2A 4CCYB 1G8KA 1O9HA 4DHWA 1A8IA 1GQQA 1XEAA 1XSEA 1KK2A 4Q3EA 3C8ZA 2GGSA 2OBMA 3AQIA 4C0BA 4HD8A 4OHOA 4NU6A 2ZRMA 4LSGA 2I78A 2YRXA 3L1HA 3UWSA 2OGWA 4JQSA 1T2CA 3WJAA 5IHPA 3DR5A 4MV7A 3VJKA 1O97D 1VE9A 3Q7PA 1QH0A 3TM5A 3EPHA 1PWXA 1QGED 5CB4F 5CX1A 1GUAA 3PWZA 2F55A 4B4OA 2FW1A 2IEGA 4YMUA 3HJTA 4IDPA 4K9QA 4Y6OA 1L4EA 2BKLA 2R1ZA 2XAAA 1N8KA 2FCAA 3N2IA 4HDKA 1ONNA 4PCAA 4Q4CA 3PJRA 3PNVA 4O4IA 1L6IA 3KJZA 2RB5A 1Y0BA 4RETA 5FR1A 3C4VA 2PXAA 3UW3A 4ZCPA 2P91A 1VJGA 5I01A 5L7WA 5DHPA 3OZTA 4FR5A 1V3UA 1A2QA 4FEEA 3WMGA 2EEZA 3AY0A 4M7OA 4RL6A 3G79A 3BDIA 1QKJA 2H2IA 1JQEA 2PZBA 5AXAA 4C87A 1XZEA 4I08A 1NP6A 1NVKA 4RDIA 3CBGA 2APJA 4U7PB 3W04A 5A4FS 4HRXA 2PNFA 3P9YA 1K3UB 2JFHA 1CJKC 2ASVA 3HB5X 4K9OA 4QICA 5GM1A 1UMDB 4B4KA 4E6PA 3E7PA 4UE2A 4NEGA 3SMQA 1E6MA 2H4HA 2O2ZA 1FDVA 2W37A 3PHCA 3CWQA 2GZDA 4N49A 1D2EA 4PHTA 1A8PA 5JR3A 4G1EB 4ENTA 1U8YA 2QRVA 4NF2A 4TQUS 4LGCA 4QYIB 4LQDA 1YZ3A 2VZ8A 3S1SA 3HY4A 4EPRA 3EZ2A 4L6CA 4MPTA 4UULA 2IUUA 4PZLA 1XWWA 1O0SA 3JX9A 4M9ZA 5A05A 5CA0A 4RCVA 3OX2A 4G0OA 1O6CA 3UYKA 1RM3A 3CZQA 4BKQA 4XUEA 1B2LA 1UT8A 2WAXA 2ZUVA 4BCDA 4NU5A 1KMCA 3X1MA 1U8ZA 2Q5EA 1JIQA 4B7XA 4E2YA 1UM9B 1U90A 1IZ0A 2O3UA 1K4MA 3B6IA 4MKZA 4P22A 4RF4A 2IYPA 3WNZA 5IABA 3C7CB 4RD4A 3IR7A 5JD3A 5E7QA 1PK9A 2OUKA 3U7JA 1SB8A 2V0GA 3EARA 4Q48A 3CVJA 3OPYA 3HJBA 5B5SA 1DGQA 2H52A 1G0NA 5FTNA 1EDEA 1XEXA 4WGFA 5CG1A 1Y8CA 2QY9A 3D4OA 3G1UA 4RXTA 2FZEA 3IUYA 3ELYA 2CHQA 2ZWIA 3AK4A 5JBQA 3FJ1A 4YMWA 4YQZA 3AGPA 2NXJA 5DWDA 2F17A 1JSLA 2P1ZA 3V8NA 4PZYA 5GGYA 1E6EA 3HGTA 4PYJA 3MTGA 2HC9A 3RS9A 4TYYA 3OOYA 4CV0A 1CJMA 1I5OA 4G4GA 3WO1A 4KNVA 5IXYA 3EUFA 4W5WA 1ZW1A 3HFSA 2HGSA 4F6CA 2QDKA 1VLMA 4LHYA 5B58T 1TGVA 1UQRA 5K09A 1TQ8A 5LA6B 5IKOA 2H2DA 1ENOA 1UBNA 3WIOA 3D54D 3FMOB 4JYMA 4S2EA 4AJ2A 4KSYA 2BR4A 1X3LA 2YHUA 4DY4A 2FMTA 3G6KA 2FF5A 1IQUA 4I1OA 5K3BA 4N65A 1W0JD 2D3WA 4JUAA 3TLJA 2VNAA 4DUZB 3SE0A 4PIVA 2EGGA 3WV4A 4F4CA 4Z3OA 1V41E 3TG8A 3QUAA 4BZQA 1YV9A 4LRSB 3ZWPA 4DWWA 3C1AA 2EX0A 2FZ5A 2YTZA 1VLLA 5IZ4A 4HWPA 3QMWA 3I6IA 4OLAA 3N2KA 4W9NA 4OYHA 1F0PA 2IOHA 1VLZA 2W5UA 3CX3A 1XEWY 3G5AA 4TMTA 4AJLA 5BQXA 4BVGA 2H9AA 1RABA 4NFSA 4Z0TA 3BTSA 1GPAA 2GD0A 3MTQA 4V24A 2WNIA 3INYA 1GITA 3CRZA 2I34A 4R5HA 5F3DA 3AUFA 3O82A 2VJNA 2CJFA 2Z43A 5EJ9A 3BA6A 2EHDA 2HIHA 3BFPA 3F3KA 4N03A 2J9FB 3OJXA 2FEWB 2GSDA 3QVJA 2X76A 1VL5A 1V37A 2BD0A 3KBBA 4J0IA 1QNFA 2YOHA 5H9WA 5KSWB 3AHIA 1PZGA 4I5FA 4B6JA 3DG9A 4F04A 1U1DA 3MIIA 3AF1A 4K6CA 2V7TA 3WK9A 4BYGA 3M9LA 1DQZA 3DE5X 3LSYA 3Q1LA 1I2AA 2D7CA 4HDRA 2G17A 3ODGA 5TARA 2P62A 4M9UA 4JYAB 4FGKA 4KB5A 3NT4A 3F6SA 3PEVA 1P18A 4JLMA 3GRYA 1LA2A 1EWYA 3HI6A 4KI0A 4RIIA 3W9BA 4DWOA 5L3QB 4DLVA 1NJFA 2RAPA 3KFVA 2F8LA 2H06A 2NZJA 1TMYA 2GTHA 2VYNA 2ZR0A 5I47A 2IXGA 1WABA 4KO4S 5FB3A 2O2GA 1NW4A 4MUXA 1JQAA 2QV0A 2V54A 2HXYA 3I32A 3LPNA 3NORA 4R2WA 5I4CA 4KR2A 3ELWA 3KJHA 3OE7A 3PE3A 4IH9A 3JVUA 4LOLA 5FV7A 1ZR2A 4WA8A 1UAAA 1N25A 1S3SA 3SQOA 4OJNA 1UDXA 5IS2A 3F73A 2GXQA 4NJMA 3BRCA 3LUBA 1EZ4A 1L8AA 4PY2A 4B34A 2W2KB 2B4YA 1QTRA 5DYNA 5FI3A 1S3IA 3HP4A 2NZVG 4YT5A 5JLAA 2B35A 1JQDA 1UZMA 5KSPA 4GL2A 1R7RA 1L8XA 1HYBA 4MEAA 1GFZA 4GT1A 2FHSA 1A71A 3KZOA 4XVRA 5FNVF 5T6BA 4B09A 5U9CA 3HXOA 3FPSA 5CYPA 5I7UA 1MABB 1E3WA 1A1SA 2QD5A 821PA 1FFCA 3AY7A 3PQ8A 5FA6A 1YK1A 2GZSA 5J2UF 2BUBA 1KI6B 2GF9A 2ZJ3A 4CM4A 4PBTA 1NI5A 1QK4A 4G85A 2HU2A 3KZCA 1TXGA 1Y4ZA 3U56A 1G5HA 1U7WA 1YFJA 1RBMA 3QNUA 1A4UA 2GOYA 5ESRA 3W2HA 2PLFA 3FPGA 2C2HA 2OAQ1 1D4AA 1F38A 3Q2IA 3QVLA 1O6GA 1BXGB 5E4TA 2DCMA 3NHMA 5TMPA 1XTBA 4KO2S 4R9VA 4RHEA 4F38A 3FCAA 2CVPA 1BD4A 1N6IA 3UIEA 1EWQA 5H82A 4TTTS 1BE6A 3VR4D 5A4DA 4Y2GA 3WMXA 4BJHB 4WNIA 2VHWA 5K0NA 4RH3A 3RJZA 3V48A 3HV0A 4G2NA 3SHWA 1OPXA 4EHBA 3K70D 1YE8A 2WUVA 5JBNA 2B7LA 1GO2A 1J56A 2PRKA 2ZRPA 3NLLA 3G59A 1OAAA 1OFVA 1V4NA 5EHZA 5ELMA 2I4TA 2QLNA 4KCGA 1G8PA 4WY2A 3MRTA 4E4YA 4YCMA 2IYWA 3OE1A 5A4JA 2CV2A 1CUWA 4FEYA 3TQHA 2VKQA 1YR1A 3QVSA 3IJEB 1OGJA 4GG1A 3RABA 1E1RD 1II9A 3R1IA 4X91A 3T7TA 4OI0A 4MRVA 1ZKDA 3MTIA 1K5HA 3JSXA 3ZWAA 1ZQ9A 1NATA 2J5KA 3H1GA 1UFRA 4GX2A 4RTLA 3LX5A 2HWYA 2W6JA 1XWIA 3BJRA 3I4CA 3IBGA 1N6LA 3MA0A 4QECA 4BLUA 5HRCA 2ID9A 1E6WA 1N2EA 1EQ2A 4QDJA 5CFZA 5TJHA 1ZHOA 5COQA 1R0WA 3JARA 5JPDA 1HOXA 3DOFA 2R1UA 1JAXA 3L06A 1SBQA 2R47A 2XYQA 3L8YA 5L8VA 1KI1A 1T8TA 3Q3JB 2EZTA 2WP8J 4DUYB 2XZTA 3CV3A 1POXA 2WNHA 4OH7A 4F2PA 2IV2X 1KEUA 1SO8A 2WEKA 1KDYA 3PNMA 4CKWB 721PA 3QWIA 2BEKA 4C9BA 1V0JA 5SZKB 4HNTA 3LYAA 1VJTA 3O3NB 3B3FA 2TMYA 1DS6A 1Z6QA 1W48A 2WE8A 4LNUA 4MWTA 3U39A 1G60A 1RAEA 1ZQ1A 3L40A 3MZ0A 3QKSB 5C8YF 1XI2A 4EAAA 2I9KA 1E3MA 3GRRA 3I9NA 4RABA 2VHTA 4TWJA 4I9HA 2PGAA 3H99A 1CUJA 3FFXA 3D6JA 3PTLA 1UBTS 4KXYA 4XW2A 5G2OA 4QGBA 4BDTA 2V7QD 3MWJA 1PJBA 1U0FA 2WAOA 4XDGA 1WA5A 2O19A 5U1PA 2BE9A 2Z3VA 4K8OA 3WHIA 4YYZA 5J4KA 1NFRA 4UNRA 1N7HA 1N5KA 4Z6KA 3BXFA 3UGTA 4N76A 4KO3S 1NNSA 2R96A 5L7TA 3JAKB 4K9MA 2Z0MA 4XVUA 4UBMA 4CKWA 5BR8B 5DT9A 3BWVA 5ICMA 4DQ0A 5K03A 1W52X 3TR0A 3ZKWA 3NZEA 4UFPA 1AKTA 3F2IA 1EFDN 3T4EA 2Q5JA 1P9RA 2RHOA 2QSYA 2Q1YA 5IN5A 1G7SA 5JJIA 4EY5A 1A4IA 1CY2A 1N5LA 4LJLA 2UDPA 3BD6A 4M86A 2G1KA 1DKOA 4M83A 1HQKA 2PKRA 3R7WB 3ZHYA 3TSCA 1Q16A 4MV8A 1DRJA 4BLRA 1Y8QB 4EL0A 3IOEA 4E15A 1SC3A 1G8HA 2QMUA 3EZLA 4AP9A 3U7GA 1NNEA 1Z7WA 4ZIRB 5AP9A 4AULA 2QR2A 3RSZA 3NOXA 4OHWA 4PLPA 3IEUA 4TTJA 4CQMA 4N41A 1DE0A 3PDHA 3IVCA 2PKEA 5JH7F 5DBIA 1CYEA 2PKWA 5EP3A 3GWGA 3RRBA 1TCBA 1JJAA 3RNLA 1JP7A 3IHLA 1JWLA 3WYNA 2K6GA 3AY3A 2P9EA 2VP2A 1EP1B 2Y0CA 4OF4A 1Z2CA 5KPJA 3AKCA 2WUWE 4TS1A 2Z4TA 3N76A 5CVUA 3H16A 3U16A 1GCUA 2FH5B 3A26A 3HU5A 5F21A 1EFUA 3I8XA 1A69A 3O4GA 5I9NA 1B26A 2WFAA 2KLBA 2V3WA 4M36A 3KL2A 3GIWA 1F3LA 4KQXA 4HQRA 1UAYA 1EK0A 1RRKA 1W2HA 3CLRC 1M33A 3OFND 5HJ7A 1MR3F 4Q4DA 4YFYA 3CEAA 2XNKA 1T36B 3M4NA 3PFBA 4IWXA 4IIHA 3H5OA 3CNQS 2E4XA 1NOJA 3SN6A 3K1AA 4AQDA 1ISRA 2PQMA 2B2NA 5DBOA 4B2IA 2FETA 3L1VA 3KQVA 1S1CA 3D8TA 2J33A 1QIIA 3D6TB 2HDHA 3HS3A 3LQYA 1XTUA 2ZRAA 3PFIA 4H16A 3TH5A 3H65A 2O7NA 3JQ7A 3HCWA 4H1VA 4MGHA 5HMLA 3T3DA 3TQQA 2D2VA 1DXHA 3RK4A 5ED4A 2QI9F 2VDWA 4OBBA 4R31A 4GVXA 2ZLBA 1UBJS 1Z0DA 2W2VA 3B2NA 1VRVA 2CV0A 2PCJA 1A9SA 4XH9B 4ZT2A 3LUCA 1BNCA 2ZIFA 4CCSA 3VTFA 5B4VA 4LHSA 4TYPA 3UC5A 3B13B 3G0OA 1C30B 3M4XA 1ELOA 1DV2A 2O2YA 4DUPA 3CIFA 1DEXA 3D3JA 3D6MA 4XIGS 5JZBA 1CUFA 4OLJA 5IM4A 1B8OA 4F91B 1N9KA 2BHNA 1FDSA 4NBNA 4M9SA 4OQMA 4FCVA 2O54A 1KJ8A 2A35A 3GV0A 5KOHB 3UGJA 2DFLA 5L95A 2JFXA 1YE3A 5ILGA 3PIDA 1UMCA 4MR9B 1LU9A 2FMFA 3WB2A 4IDEA 2A1IA 2J3MA 3PCTA 5J4YA 1AY0A 3AESB 4JOQA 5AW9A 1Q5PA 1E66A 3A1NA 4MRMA 3RVLA 1KAHA 1R8YA 1EXNA 2JFVA 4PZ0A 2B30A 2WJYA 1PJQA 3H3FA 3VYVA 2ACVA 5B64A 3I37X 1J33A 4B3XA 3PICA 4EAQA 3Q8MA 2EZ9A 1W5SA 3Q1KA 2NU7A 4J0CA 3E18A 1N5OX 1QGDA 4MVJE 4X90A 1R5NA 3U3KA 3P97A 1N32B 3AHGA 3QENA 1KSHA 4BC0A 3GNLA 4QREA 3KEQA 2AUMA 5CA0F 4CDRA 2ST1A 3QBTA 4YAOA 2D8AA 3OE5A 3ROEA 3PS9A 1JBEA 2W4IA 3IBFA 4I1SA 2IIPA 4WECA 5CA0B 5E95A 3VU8A 1OLXA 4NENA 4RA9B 4B8YA 1QUFA 5CITA 3WGNA 1N2GA 2FPOA 5IJWA 1T2NA 5INTA 4R2XA 5CMLA 2Q3JA 1S9DA 4FW9A 2P3QA 4P4UA 2DPGA 1EBFA 1RQPA 3Q6MA 1TMOA 3LVBA 2R8BA 4WKGA 4RZHA 1OWOA 1RYYA 2XNCA 3DTVB 1E6KA 1QB8A 2ZBFA 1S8NA 2PH7A 3GZ4A 5EUQB 4LN1A 3U81A 5GIOE 1Z5WA 4KC0A 1GUFA 4NOLA 5E7MA 2IHKA 1C7QA 2FRDA 2NNLD 3I6QA 4MCJA 3T1QA 3K70B 1MQAA 4Q16A 3F9RA 3KZVA 4DREA 1F12A 3G6WA 4K40A 4B2LA 2P4SA 4B7CA 2XCOA 3U7EB 4HAZA 1ODTC 1EK2A 5DK6A 3WNVA 3FI0A 4G4SO 3BXGA 3U17A 3D4LA 4RD1A 1RU3A 4ZC1A 1OFTA 4O4LA 1S3FA 5KC8A 2E4WA 2VT2A 1FCJA 4O4HA 5JT1A 3OF5A 1SUWA 2QU8A 3OX3A 2GCOA 4IX1A 1Z08A 1DC5A 3OY7A 3A6EA 2CJYA 3GLIB 4B4DA 1F17A 2IW1A 3D7KA 2RGGA 1RLMA 1IU9A 2NTNA 3V3KA 1WF6A 2OCLA 1KKUA 5AM1A 2P68A 2FWAA 1SCUB 5F9HA 4PTZA 2GNPA 2RG1A 1KRHA 1XQYA 2PLWA 5J1TB 2AXQA 1CCWA 3T9FA 3DVAB 3JYPA 3CVOA 3Q11A 4FJ2A 5TS2A 1Q84A 3V46A 1L8LA 4NCXA 1DX9A 1LUAA 3MS7A 1ZS9A 1ZKMA 1UBCA 1E2UA 1IY1A 5GP1A 2D0DA 1QIHA 1UMDA 4R3NA 4RNCA 4TV9F 4F9TA 3DHEA 1XD9A 1BN7A 2X15A 3JZDA 1J0EA 1H2BA 2IOYA 3OOSA 4JIMA 5EPUA 2OFFA 2HPVA 1MOZA 2QKYA 3VOBA 4XRGA 2HPZA 5H81A 3ZDYB 4CEJA 4N5LA 2VAMA 5CW2A 4B81A 1EFCA 1X8KA 4GLFA 3ZQUA 3PKJA 3EVDA 2ACKA 3AVQA 3DZGA 4PVDA 4QYIA 4Y6SA 2YJNA 3K0FA 1C2YA 4KQGA 3OKPA 4MWOA 1CB7A 1N3BA 5IZCA 1QVZA 1ZHFA 2ZBEA 1L4YA 2RKWA 3UUWA 4B33A 2QP4A 1YBVA 2O07A 3KJEA 2BEJA 2NUAA 2DRIA 4Q34A 5ITZB 4B9EA 3NBMA 2JW5A 3ZWQA 1TFRA 1CLUA 2YQZA 1JE1A 2FN8A 3EDRA 4G89A 3UJAA 2YYZA 4KQ1A 1CIVA 3DQPA 3GK3A 3G0CA 2OG1A 2VSNA 2ZYDA 3JR7A 3WAKA 3TUIC 1SC4A 1AF7A 4UDYX 2FN9A 4QGSA 4RL4A 1UMKA 1XRNA 4QUJA 4ZEOA 4LMRA 2WF5A 4TQGA 3W79A 2PUJA 1I0ZA 3TDNA 3IDFA 4JVNA 4XWOA 3TGPA 4QRHA 4EJMA 3UAVA 3KNZA 5LB2A 1V48A 2ZZMA 1ZM2A 4LRUA 1QHHA 4AI6A 3A8TA 3RBZA 1MAAA 3NH6A 3DMTC 2GM3A 2ISQA 4EHAA 4KSCA 4EMTA 4ZQFA 2B4TO 3FB1A 5HZGA 4DRZA 3GJ8A 1R0RE 4AZ3A 2IYEA 4QPPA 1ZN9A 3ECSA 1B14A 3NU1A 4QSHA 2ZRGA 3AI1A 2QE7A 5HF5A 2W2KA 2Z58A 2VT6A 2VDLB 3PXBA 3SSAA 2UKDA 1RAAA 1T4CB 1X7YA 3FYTA 3IULA 2E1PA 1QH8A 1HGXA 3OU6A 4ON9A 3W8FA 3ZGLA 4C4PA 4MW7A 1HY3A 2Z2IA 4LW8A 4BAUA 4UOEA 1G6OA 3GT4A 4L74A 1ENYA 2YWCA 1TUEA 4BKPA 4LOKA 2I7VA 4N5IX 4OXNA 1FYVA 3HLYA 4CM8A 1OWMA 5LSAA 1RI5A 5CA1B 3G2QA 3QLTA 4B85A 1JG1A 4PAGA 4UU0A 3AR9A 4B82A 2VAPA 5K6RA 3GI1A 2X1VA 2PUTA 3IKMB 1THGA 1F51E 3A1DA 1PLJA 1KZYC 5C4IA 5ERXA 4FMDB 1QOZA 3KYJB 4Y9TA 4HPWA 3OKCA 3VPDA 1BMFD 3OSZA 5HDQA 3CTMA 3H7IA 4GBED 4EOGA 1YHZA 1CNMA 2Z08A 3PD1A 4UUAA 4EP1A 1N78A 3KQOA 1D7AA 2H08A 2YMQA 3FNBA 2FN3A 2PAAA 4FDLA 2GN2A 4BFVA 4DWVA 1L8OA 2RK6A 1UINA 4FYMA 4AZTA 1D6NA 3NHFA 1UBGA 1TA9A 2HQBA 4OO3A 4ZO8A 1U9JA 1AT1A 5AXBA 4NOKA 3SF8B 4ZYWA 4IILA 2YWDA 3MCWA 3A4NA 2MR5A 3GYGA 4YLGA 5AKIA 1YZKA 1KPHA 1Z38A 2Q4OA 2Y9MB 4MQFB 4L08A 4WZBE 4X6UA 3EC1A 3KPJA 3L79A 1CQJA 3MN1A 3PJDA 4L8WB 3WSWA 1PIWA 1M6HA 2YY6A 4XR4A 3W2GA 3Q8WA 4P84A 2ZTMA 4UZSA 2OZPA 4F45A 1ATIA 5FEMA 1B0UA 3IAUA 3MT8A 5KNCD 4UPDA 2RAFA 3QLVA 2CEKA 4C6RA 3NNDA 7ADHA 3KPVA 1LF5A 4NOJA 5KNBA 1JTVA 1FFYA 1H3FA 1CF2O 3DZCA 4HNAA 4LXTA 1ZINA 3UT5A 4DEYA 3FKSD 4OA5A 2YNMA 5DHRA 2WMDA 1RMQA 4GGMX 3M5WA 3ZYZA 1YQEA 3TE7A 5LD2C 3LPLA 3QITA 2P6NA 1P9WA 1YCDA 3I2IA 4FFWA 4PAOA 1KYIA 5GMOA 3AF6A 3EEOA 2CL0X 2UUAB 1MHTA 2QU7A 4IZOA 1EFVB 1ZMRA 2YDYA 1T5HX 4J6EA 4Q1EA 4YP7A 1EFRD 4KLAA 1F4VA 1GQRA 1NPDA 2CL7X 2R66A 4N8DA 5DBHX 5EIHA 1U0SY 3HJHA 4I4NA 5DULA 4CIVA 1J42A 2Q9AA 4JVOA 5ECDA 2P1RA 4BNXA 3TTUA 2Q0XA 3FFWA 1MUUA 2RMKA 1OH7A 1XRRA 3ETJA 3JALB 1GYQA 4MS3B 4QYWA 4S0XA 3S1AA 1Y3AA 1J8MF 2YXDA 1TO6A 5LLDA 3N0XA 4P4SB 3WWZA 1ZJZA 4EQ6A 1QHXA 1I3NA 1LI4A 1WUTA 2ENUA 2PJDA 2OCPA 3PF9A 1CE8A 4LJ8A 5E38A 2ZTSA 5KX5F 4ZAXA 1YAJA 3WMWA 1W88A 5ALKA 4JS0A 4ESEA 5EJ4A 4KAAA 4MRMB 1IEQA 1ECCA 3I4FA 2QLFA 5JG7A 4TN1A 1SUBA 4GR4A 4LJRA 3E53A 2VHEA 5HRAA 1F2UA 4QU0A 2ZYRA 4RAQA 1R12A 5ECYA 1D0IA 3SG0A 2ECOA 2GHRA 2OECA 2H0QA 2ZK7A 4LUCA 2JGDB 2V7GA 3AV0B 4XLZA 3UW1A 2IHNA 1WV1A 3G2HA 1L4LA 4ZAFA 3VYRB 2D5BA 1UMBB 1NVMB 3UICA 4AAYA 4RKRA 4X3PA 3WLHA 4YRSA 3DV0B 1WCIB 5JJKA 4U2EA 5LQJA 1QHIA 4M0MA 1TUIA 4GEKA 1D2HA 1E99A 5FA8A 1DO0A 1C9NA 1NI4B 3DWEX 5JYCA 1ZK4A 5ES4B 1R4MB 4UHKA 3H97A 3GGGA 3PKIA 2VF5X 2QAGA 4CL2A 1DG1G 1A95A 1LLCA 4M1EA 4BNZA 3QXCA 4U3JB 3QOYA 5BP7A 5JXJA 5K0GA 2PX3A 5JPIA 4MWSA 2IF0A 3EVZA 2BKUA 2XUDA 3I9JA 4G37A 5IDVA 3LFUA 4HLUC 4DOMA 5KVSA 1GTG1 1FFDA 1W2GA 1Y4SA 1IN7A 1IUKA 3OEHD 3R7SA 4A27A 4A8JB 3OQIA 1ZH6A 4GPAA 2C5HA 1GUBA 1ODFA 1WL8A 3KWFA 4IO0A 1ZI8A 4HY3A 4J07A 4I55A 4YRAA 5KTYA 4MIOA 1XZLA 2DR3A 3EGCA 4TGLA 4XUCA 3OM1A 1SCQA 4J75A 2BH9A 5AVYA 2QL5A 4PQFA 4CGYA 5KQGA 1I5EA 3V4RA 1ES9A 1XU9A 1ZI9A 4TT8A 5KTPA 4GYJA 5AHXA 4DR1B 1C4KA 1GTL1 4X61A 2MSLA 1NW8A 3EJWA 4OLHA 2ID8A 1U9IA 2VDVE 1GAEO 2G06A 3CRVA 4MR8A 4U7GA 4Z2AA 1CWUA 1YZLA 221PA 3DWFA 2ZSIA 4LJ5A 1X80A 3KJQA 1V16B 2PL1A 2ZJ7A 4KQ6A 4LMBA 3UZUA 2XXAB 1LDBA 1VBKA 4J7AA 4LOAA 4D97A 3LNCA 5DCYA 3IERA 2BFAA 1PWYE 1NZFA 1Q7BA 3D5QA 3K35A 3NPMA 2C00A 4N0EA 5F5NA 2UUPA 1A82A 3KSRA 4P98A 2M9MA 5EZQA 3ROZA 4MW5A 4EFLA 2IYTA 3AJRA 4FYWA 3BBLA 2CKDA 1HTBA 3MBKA 2UU9B 2Y71A 4C5CA 1HYHA 1YDFA 4P5DA 3UG7A 2YMLA 2NM0A 4URWR 4CMJA 5LKRA 3KETA 1LK0A 3ZD9A 4EEZA 3PFFA 1U8AA 5HIMA 1Y6FA 3CCBA 3PXUA 2G70A 1RVDA 4PPQA 4WXMA 1PT8A 4KPUA 4E3WA 1NJ5A 1P9NA 3H4TA 4EKYA 5JS8A 1USVA 2AK3A 2YICA 4TPKA 1G17A 4BYMA 1YFZA 4P7JA 5K01A 2NP6A 2WKQA 2XJ4A 3C98A 1DJOA 2QXUA 3BG5A 2DT8A 2XT9A 3ND8A 5L51A 1XCLA 3NBYC 1CJTC 2XBUA 3P1JA 1HNXB 5T7BA 3CXRA 2HDOA 1DBSA 4RQAA 3V1YA 3IRUA 3BKWA 4XPIB 1PJ2A 2PYIA 3U3DA 1BVUA 3LYHA 5BV0A 1JI0A 4PC3A 5NULA 1QV7A 4RXMA 3II6X 1HL7A 1P62B 2A6PA 2X2OA 2VQ6A 5K0EA 3DPSA 1CZKA 1MX5A 2EJVA 2PJZA 4RANA 5CUQA 4EM6A 2PUGA 2OO5C 1KORA 4JJIA 2Y1CA 2WLTA 3MTAA 1J21A 1OYYA 3L0SA 4UUQA 4MW0A 2ECKA 3QU5A 4XPZA 3U3RA 3URMA 3WGJA 3GDHA 1Q1NA 1Y7TA 4BP1A 1NYRA 3BB3A 2C5SA 4MS1A 4TKMA 3FOFC 3AM5A 4A73A 6REQA 1YS1X 2WIJA 3A9SA 4UBOA 4D9GA 3COYA 2Y3IA 4Q7JB 4J1TA 1F0NA 4BO6A 3I42A 4IMJB 3AB7A 4B75A 4L9RA 4ZTZB 2Y1WA 4CUKA 5JO0A 2OL4A 2N1BA 1AKMA 2XCQA 4PHGA 1HE8B 5D85A 3RS3A 5EGNA 3V1TC 4D46A 5BNZA 1N2HA 5LQAA 2B25A 5DTQA 5AK4A 1LS6A 5KTRA 2ZJZA 4XQ0A 1L7XA 1ZM4A 1KBOA 3NBQA 4QUBA 3V97A 2GILA 1ULHA 1XZQA 1YHYA 1V6AA 3MD9A 1Y5MA 4MUJA 4NPAA 5GZ6A 3VPHA 3ZGNA 4E5UA 3H8JA 3P0HA 4HDKB 5A71A 2GJ8A 4YPOA 1OVGA 1UM9A 3OZVA 2ZXUA 2OGZA 5IKEA 4NX2A 4BXOA 2Y67A 5DP2A 5KYXA 4MP6A 1PG0A 1R27A 2XE4A 2OGTA 3D31A 1JL3A 5K8LA 3RFUA 2GZ1A 1M66A 4ZYVA 4W5NA 1I13A 5UKDA 2P2ZA 3CO0S 5IANA 2VWPA 2WB4A 1DU4A 4IHQA 2P0AA 4IF4A 4MUIA 2R6ZA 3IQGX 2BMDA 3AEKA 3DDCA 2JARA 2JH8A 2HCJB 4KWHA 1VOTA 2XQFA 1VMIA 2JF0A 3MJTA 4JJ8A 4OHRA 4RW0A 4KN9S 4P0QB 3QTLA 4QUIA 1JBQA 4AYWA 2NVOA 5JAPA 2FPGA 2H2WA 4CTOA 2MU1A 4YRQA 3L05A 2FYTA 4L5JA 1H0RA 2PT5A 2RH4A 2WJ6A 2OFWA 2L18A 1T0UA 3LHFA 3QE0A 1EWKA 4A0RA 4BE9A 2AS0A 3PEFA 2JPDA 3PEUA 1NBHA 3E5HA 2D5IA 2QMOA 2R5WA 5SZJA 4BX0A 1G19A 2H59A 2O5RA 3FUWA 1CQXA 3IAM1 1RHRA 1LPPA 2AD1A 1WUIS 3F6CA 3JRWA 4MJ3A 1PLKA 1VG1A 2YZGA 4G9EA 1OXTA 2D1FA 4DDMA 2SKCA 2J3LA 4TKVB 1IBMB 1BDJA 3C74A 3W4JA 4B0PA 3FB4A 4DR7B 3IO3A 4DT1A 1KI7A 3K1TA 1P33A 5JJBA 8AT1A 5J4LA 4E5SA 3MWLA 2B69A 1MDFA 5AOVA 2Y9PB 3GLVA 3B7WA 4D43A 3B1VA 3GJTA 1SKYB 3LTEA 4TMKA 4A0QA 4B84A 4Y7CA 1C2TA 1PG5A 2OK7A 1C0PA 1DRKA 1W73A 5B12A 1VLVA 5TMDA 3ZU6A 1CDOA 1GXSB 1OB5A 1RQ7A 4O2LA 5AH0A 4CF3A 2FI1A 3EY9A 3I5AA 5HBGA 1AQUA 1XFDA 2DQ4A 2OO5A 5CT6A 1TTTA 1O08A 1PHRA 4Z99A 3WMFA 1XVIA 4F8YA 1QE0A 3MWDA 3OESA 4K9KA 3K94A 4LJAA 1PBNA 2QGNA 3VU9B 3MXOA 3O2NA 5SICE 1QGUA 5JH7B 1JXOA 3EVNA 2JATA 3BT7A 5CLLA 1KDZA 5CNKA 3B1JA 4DT1B 3HUTA 1C5KA 1ILEA 2QRJA 4AU1A 2W6QA 1H8ED 4Z4GA 1PGQA 3AC0A 4EX6A 1Y63A 2ZRNA 1YRLA 2C5GA 1VIYA 2EC5A 1N8TA 2AKAB 2QZ9A 3MQ2A 4FNAA 1JA0A 3INRA 1F2VA 1NQVA 5CDSA 2JCYA 5K7SA 4PRZA 4IUDS 1Q91A 2QVLA 1CF4A 3EZ6A 3OJEA 1NUSA 4FILA 2C7PA 4G8BA 4HT3B 1BKSB 1GPYA 5EXDA 4U2DA 4GYWA 5FRDA 3HDVA 1Z12A 3JAWA 2F1RA 2HA6A 3IE1A 1J23A 2SCUB 1M72A 5CYFA 4NYIR 3CUKA 3GL9A 3OP1A 4JASB 1YJ8A 4D99A 5EZYF 4DVJA 4OXYA 4LF7B 2IA5A 2QJWA 1C9JA 3VKVA 4DV6B 2XOKA 2ZIXB 1NC1A 3BCRA 3D7MA 1GVHA 1FRQA 4PRLA 4Q1CA 5F33A 2PYDA 5KOJB 2GN4A 3CX7A 3BE8A 4O5OA 1CE8B 1C7ZA 1KK1A 1DUIA 4EW3A 4UVHA 4YHBA 5HQTA 1EBUA 1TCUA 2C7BA 1T91A 5YASA 2XBLA 2XUQA 1ESMA 3ZWKA 4CLOA 2W6IA 4HGRA 3TOVA 2GPBA 2QRUA 2OQIA 2X5KO 1XZAA 3TTXA 1QANA 2IIQA 4F4UA 3DHWC 3RK0A 4EA9A 4JFAA 1IYZA 1PR0A 1NJ1A 2YVKA 3GLHA 3H2BA 3KB6A 1J5PA 4GF5A 3QELA 4UM8B 4Q9KA 5FOWA 5KTSA 3CNEA 2AE2A 3LRPA 2DTEA 2PL9A 3VDNB 8OHMA 4P58A 4JNKA 5AXCA 4TLEA 3EE6A 3B9QA 4Z5XA 2JKYA 3AFIA 4ZTBA 1ZD2P 4QHYA 4W5HA 3IVMA 1Y3FE 4ZODA 3SIPA 1U7PA 1J8VA 2VQSA 2JLUA 4YCCA 1E3JA 2XUOA 2P2YA 4FMDF 4JLDA 5I7AA 5KYVA 2QAGC 2YHSA 2RHBA 3V2HA 4EG6A 5CD9A 4LFBB 3CW8X 1G59A 4MMXB 1JG3A 1YDEA 1Z5PA 3W9SA 2GF0A 2PZLA 1UXKA 1O94A 3D0OA 3GJSA 3V4OA 3VPSA 1VBMA 2W2OA 4YUXA 3ZIDA 3UT6A 4XFJA 3W78A 3WNCA 4B3HA 3OZDA 1R6BX 3I01M 1FUEA 3OQIB 4IGEA 4WOCA 4RZIA 2XA2A 5LC1A 1WO8A 1LI5A 2LXNA 4O2RA 4IDHA 4WXEA 5TGZA 1N5JA 1XV5A 2HJWA 2PKYX 3WBJA 3AUUA 1ZC4A 1YUBA 3FPJA 3NBUA 3P52A 1S3GA 5JSKA 3UYLA 4HATA 1VIAA 3RCBA 2A5DA 3TGWA 4DXDA 4N48A 3VU0A 1GL3A 4DCUA 2JFUA 1KF0A 4TYQA 1IWOA 4ACBA 1GA1A 2RHTA 5ICEA 5ITSA 4CFYA 1NMQA 3QMVA 4RESA 3RARA 5EE0A 3UJPA 4FS3A 1RKQA 4H4EA 3W5DA 4UM5A 2IHTA 4CM9D 2VDJA 1NPTO 4O8ZA 5EIWA 3DOOA 1E3TA 4MMZB 4B44A 4GM4A 4OHCA 4QPCA 1R4NB 3IPXA 1OX4B 5ERYA 1KGDA 3UMSA 4C2AA 5ADWA 2YN2A 4MIYA 2V1UA 5ECWA 4JLVA 1FVHA 2GBLA 1FFEA 4TSRA 5E8JA 5LL6P 2BFDB 1C4WA 1T9BA 1ZOPA 4QVGA 2B83A 5DSTA 3D0RA 3E9QA 3WKAA 1PX2A 4AO8A 4R7TA 1WHSB 4UTXA 4G01B 1ULUA 4D96A 2WJPA 1UK6A 2HCBA 4DCSA 4QDOA 3THOA 1ZCJA 3TFQA 2CE2X 3M7IA 3QE4A 4LHZA 2C4HA 1Z4PX 4CLXA 3UT0A 1EQAA 4IXNA 1R8JA 2AFIA 1J24A 2YV1A 3BWMA 3C3BA 2O2HA 4NK5A 3WIEA 2FDCA 1DTSA 1TIBA 3KOMA 4DNQA 4M1YA 5K8VA 4IJQA 1K27A 3U3OA 3GU3A 1WMFA 4DSAA 1L5MA 3WI7A 2O8EB 1ZUWA 3EBLA 4YJGB 3V1MA 3WJ7A 1YU9A 3CN9A 1KK0A 4E51A 1VKRA 1ZD1A 1JSZA 3FZNA 3R5JA 4XFKA 5EJ6A 3R8FA 3WJ1A 3I52A 5FDFA 2JJQA 1DP4A 1K7EB 1NNLA 3BK7A 4EVIA 1R9NA 3BM5A 2AXNA 4TV9B 1DC3A 4AMBA 3KD3A 1EZZA 1UWVA 1FVOA 1LBSA 1PAUA 3QMMA 4XI9A 4BQRA 4ZOQI 3I04A 3ZVNA 2WVGA 2GD1O 3SIWA 4L78A 2C8KA 3ZWMA 3IKJA 1ZAYA 3T3NA 5DASA 3TQIA 1MAHA 5TV2A 2EP5A 1Z16A 4QPDA 5HKKA 2C2GA 1YJBA 3CVXA 2Z8XA 2Z04A 5DDIP 1SOVA 4ZANA 3UMYA 3KEGA 1B00A 2IYNA 2C4KA 3ZXSA 3LHSA 4TWZA 1DWOA 2NYVA 4ZK2A 3H2SA 3LZ6A 3WFIA 1TYAE 4QATA 4EMUA 2QXTA 3H2KA 1WY7A 3E4CA 4Y2QA 1GV0A 1CQJB 2D74A 3AR5A 3BD7A 3TX6A 1O8BA 1T3SA 2JVJA 2Y1FA 3EWSA 4HTFB 3WGTA 3H8VA 4CQMB 4D79A 4QHTA 1AQLA 2WJAA 2VDNB 4NZNA 3PC3A 4M8KA 4C7OA 4DGSA 3B9BA 3QYFA 4X6LA 2OESA 2G77B 3O4VA 4FLMA 4AJ9A 3AR3A 3UUEA 2H1SA 2W4MA 2EBWA 2H4XA 3LS2A 1XC7A 2GZ3A 2WTBA 3E27A 3Q3EA 5T41A 3RVPA 3UPDA 3UH0A 1G20A 1X7DA 3AJAA 1TJYA 3A04A 3LDAA 3PQFA 2BZGA 1UJMA 4Q7MB 2ZWVA 1TVMA 3GQBA 3D8HA 4LJKA 1FXWA 3T4XA 2G76A 1I2CA 3FPCA 4QXQA 1IEWA 3RK1A 5HUQA 4Q9DA 3GPDG 5ALIA 3UKJA 4L5BA 2G0TA 4J94A 3D2CA 4ZTUB 3MTDA 5H80A 2Q7OE 4OKSA 4QKQA 5IUNC 1QJ4A 4MW4A 3VYSB 3TZQA 3DQQA 4C7OB 4EW6A 4TX1A 3HCBA 3FOWA 1LBEA 2HSJA 3LCCA 3OM8A 1XT6A 4GOJA 2GI4A 3IVRA 2XMSA 4QT0A 4E46A 2G72A 4RHFA 1IMOA 4RHTA 4ZVKA 1K0FA 3H5WA 4RF2A 2W2LA 1Z4NA 2B92A 1EJBA 4JJEA 1KAOA 1TVKB 5ANRB 3OECA 3W7BA 3GRZA 1FSPA 5KSYA 1O6ZA 1Q12A 1QJCA 1WY5A 4IEEA 4UVIA 5EOVA 4S0ZA 3KSUA 1V5FA 3BMNA 3QEMA 3NHYA 1YR8A 4FP9A 4HLDA 5CTJA 5KINB 3KUKA 5K4HA 1D07A 3CX4A 5EL0A 1U2ZA 3STYA 1XJ0A 1KFKB 2A9QA 2H7VA 3CF4A 3THRA 2RHLA 121PA 4P8RA 3RG2A 1KI2A 3W3AH 5A5GA 5DI3B 2XUJA 3I8OA 4IXWA 4EB8A 1X94A 4OATA 2NU6B 1DEKA 4Y6GB 1YIOA 4HFRA 4G84A 4PC2A 4HXFB 2ATVA 1E79D 4XYEA 3LC2O 3FVWA 1F8YA 1VP9A 5HS6A 3RJMA 4XVCA 3Q72A 2O8CB 4FU0A 3P5SA 2O5VA 4HR7A 3Q7IA 2HSEA 1IY9A 13PKA 3BORA 1KJNA 3ZK9A 1IOLA 2MYNA 4NZZA 4YXWA 1UADA 3W8DA 3A7DA 4YPVA 5JAMA 3ZY3A 2Q4EA 4I1VA 4HXGA 1OSNA 4FMCF 4MKHA 1K1EA 1UUFA 3OZSA 1XL1A 1BGXT 4RD3A 1PJRA 2ZGVA 2QTNA 3ZI4A 3S8YA 1QYIA 4ARAA 1YI1A 1CY6A 3MLEA 3RS0A 3VQTA 4JLNA 1R5BA 3ID6C 2I2BA 3MHPA 4MAMA 2NU7B 2XCRB 1LBIA 2VZ9A 4J43A 4YGYA 1WMSA 3FZQA 2CDBA 4WNAB 2A88A 2QNBA 3TECE 3M49A 4W7IA 1NHWA 2HGZA 3AFHA 3QGMA 4MS4A 4H3SA 1BAPA 4H15A 1A4XA 1SUDA 1VSVA 1Q44A 2JRLA 1T0PA 2A9JA 2I4MA 2SNIE 3OZXA 3QV1A 4Q9AA 3SEZA 4FWIB 1RACA 4K86A 1TKAA 1RZ3A 1PUXA 1LLFA 1FRZA 2YVUA 3ST7A 5E6UB 3F4LA 1TAGA 2NN3C 3RI3A 4KR7A 4FBLA 5EMJA 2Q3FA 4JEMA 4E5PA 4KACA 5SY9A 1O5TA 3GFVA 3VYTB 4ZCQA 4YAEA 2LKCA 2QNRA 4BQOA 1G8YA 1ML4A 1T5TA 2IF2A 3PA8A 3G0IA 5K0LA 1CHDA 3THSA 4EYGA 3VNUA 5BO5A 3TLCA 4QTYA 1VCNA 3MAAC 3L7CA 4D8YA 2WWWA 3VRHA 3DO6A 5I51A 2RG7A 4HEA6 1RE0A 1HM5A 2RK3A 1YMVA 1SUAA 2Q45A 3H19A 4G0MA 1QF9A 1UDBA 4TM7A 1HF3A 3PPXA 3RVJA 1U8EA 5KYUA 1F9EA 5CYGA 3RU2A 4KVZA 3HA3A 1AQIA 1YR2A 2ZJYA 3G2JA 3PK0A 1QNLA 3VR5A 4ZWNA 1P8AA 4FCCA 1J9ZA 1U3UA 5CCXA 1TT5A 1OKKA 1Q7CA 3H4IA 4RH0A 3T8YA 4BGVA 3CTPA 1KETA 3JPYA 4ZCSA 1UBOS 1V96A 1SQSA 2YWEA 1M1UA 5F2OA 1NYTA 1JZQA 5CVCA 4C7JA 1SAYA 4QL3A 1A8HA 1A5AB 3VVMA 5A0TA 4GNKA 3IDOA 4GI1A 3OCWA 3OHMA 3SXJA 1QHGA 2PUWA 2AG6A 3KU4A 5A5EA 4O3FA 4BJ1A 5MDHA 4M9RA 4LY0A 1YQXA 1JU9A 2DBRA 3KZKA 2HMYB 3C1OA 3RYIA 4DCGA 5BVGA 3PGMA 3EULA 2CFCA 2NZWA 4L0QA 4BNTA 2WZQA 5A4KA 2ZT7A 1CUCA 1GKUB 2QVZX 1C0LA 1EYZA 1KTVA 1KGSA 5FQNA 4RHYA 5HRUA 2ASEA 4CG0A 4NV3A 5AKXA 1N2SA 1R0ZA 2I6SA 1TK9A 2AXPA 2JHPA 2P9CA 3JW8A 1QG2A 2ESRA 3N2ZB 3DHYA 4N9QA 1DWPA 2GWRA 3T3EA 4CYMA 3HYCA 4Q9JA 3THXB 1NI3A 2YUTA 3IIEA 1USKA 4TVSA 1OI7A 2PD3A 1NXQA 3V8RA 4IP0A 1K6EA 2J0UA 4X00A 4R2JA 1QE5A 5LOVA 1IQRA 4YV2A 3ILYA 3TLEA 3VR2D 2OV2A 1HZZC 3BWXA 1TZ2A 2ETXA 3M6IA 4K0RA 5C34B 4DNOA 2CVQA 1C3VA 2BDUA 2QPLA 1JLSA 2O0HA 3TMAA 1RSZA 2IBSA 1LW7A 5HR5A 3F9IA 4CXMA 3OUZA 5BOSB 5IDWA 2A0WA 1YSCA 5B1DA 3OIDA 1RLOA 2G07A 3TQSA 4CL0A 4XVQA 3W5VA 5HCUA 2NUAB 3CVVA 3V32A 5CNMA 1EP9A 2IXTA 3MUNA 2GBCA 5BOVA 3WLRA 2BAGA 3QFFA 1U4SA 3E15A 4I50B 1G5QA 2Z9CA 5C3UA 1FC0A 3B6ZA 3C97A 3QEAZ 3Q9LA 4RO0A 4YPFA 1DAGA 4QJBA 1BFDA 4IRXA 2M98A 1C9YA 1OBVA 3N59A 5DCLA 1T25A 1PEKE 5A2GA 4BGDA 1CS0B 1X7ZB 2GEKA 2JD1A 5IU6A 2OAEA 5LMCA 4US2R 3IMCA 4XDYA 1Y7LA 3B89A 2FUCA 1QF7A 2VQEB 2IUSA 5G0WA 3U7IA 3C5CA 1EJ2A 2XB9A 3Q15C 3KT3A 3ILHA 1C3JA 3PC7A 1MABA 1TKRA 3NHLA 4YJHB 3RROA 4D0NA 4ERNA 4GW3A 1U3DA 1Z6GA 2RONA 3BDAA 3M6WA 4E09A 1E96A 2YFYA 3WLAA 1GPUA 2B5OA 1ISSA 4JR0A 2GJSA 4JEUA 3RLIA 2IYAA 4BTVA 1GR0A 1K86A 2NO7A 1OILA 2NO6A 3LW8A 1L4GA 5A03A 3NDBB 1XUOA 5JD4A 4YO8A 2YASA 4RQUA 4Z0HO 2P2SA 1CVLA 4JCOA 2JCVA 2RDMA 2VJBA 4YV0A 4HDQB 3G7NA 5B6IA 2PMCA 1YVDA 2VCHA 4GMFA 4DR5B 4R7GA 3PWTA 1U9YA 4RDHA 5JNLA 1WQ3A 1YR3A 4LKRA 3UB2A 4G0ZA 4V3CA 3EDCA 3FROA 5EMLA 1EXMA 2R6GA 3H9GA 5F98A 1K7CA 3PTZA 2QSUA 3F96A 2ORYA 3C7DB 2H2HA 1XZDA 3NP7A 3H0KA 3DD1A 5AW7A 1A9XB 1XAGA 1OW3B 1M2JA 3ZY6A 3ZWBA 1CG6A 4Q3KA 4I0WB 3RVDA 4YY3B 1HSOA 3RC3A 1CZOA 4D2IA 3FGZA 4AS1A 1EP2B 2WPNA 2XCUA 2JLVA 3LNTA 1M1ZA 1Q92A 3C5WP 5TPZA 1A9XA 2QORA 4WZBA 3BCUA 5I5EA 1ZRMA 2WJVA 3PI6A 3KOYA 2M2IA 5F51A 4X44A 2NAPA 4IIUA 4LFCB 4UBNA 3CG0A 4L7QA 1UQTA 2P4HX 3H84A 5PNTA 3STXA 1K92A 1ECLA 1DTEA 5EAIA 3IAM6 4XJSA 2X4IA 4Y1RB 2E1RA 4DB2A 1RC8A 2R1TA 2JFQA 2P3SA 1M10A 2P79A 3LUAA 4FGWA 4X1KB 1A9QA 1K8ZB 2CW5A 3LX4A 1LEHA 4QXAA 3WL5A 4AK9A 2Q4RA 3ZWXA 1DDGA 2ZYUX 5GONA 1CS4C 3R2JA 1AOXA 4WESA 1X7XA 2Z83A 4YJKA 5KDOA 3OTQA 3AVPA 2WMOB 4ZAGA 1FBNA 1UFOA 1XNHA 4XX0A 1YGYA 3PGJA 4LYGA 1TMKA 4FZJA 5DW3A 5EESA 2R62A 3ZVKA 1NW3A 3ZY2A 5IYZF 1KJ9A 1N6RA 1M2VB 1EHYA 4BIMA 2NQ2C 4IXMA 3EMVA 4US1R 3HJRA 1HYQA 3KLMX 3QEOA 3HZRA 5DHTA 1XTKA 2GSWA 3PDCA 1U0LA 2UZ1A 3G85A 1XVLA 4OVKA 2Q27A 1KOLA 3IBTA 1VZ2A 3VGPA 3ZNOA 1KAQA 1LNZA 1FS6A 3G0GA 4KAXA 2RJNA 4U02A 4RX1A 4XGIA 3ZQ4A 3V8BA 1Z5NA 2H4YA 3BDVA 1R50A 1YZHA 3LD9A 4WH0A 4Z7NB 1OFHA 1W94A 5EYPB 5HYVA 4HGNA 2FQWA 3WIVA 1EJ0A 3GFOA 3T1OA 3QM1A 3O91A 4MWGA 1H05A 3C4JA 3JAKA 2N9UA 3OZRA 4K03A 1CP3A 3RHFA 5JPCA 4KLNA 3LWDA 4UNQA 1G8MA 1EE1A 2I8LA 3D8NA 3ZKWB 2B8WA 3B1WA 3BHJA 3M1AA 3M81A 3OIFA 4UTZA 1AO0A 3FRIA 4L85A 3QTTA 3CMMA 4OP2A 1P8JA 1XHEA 1NJ6A 3JD1A 1Q0ZA 3SBOA 2IZ0A 5BQOA 2LUOA 3ZH2A 3T9CA 1GFWA 1JG4A 1I4DD 3JALA 1QB7A 2VPTA 1PDWA 2Q46A 3K2EA 4ZVQA 1KH2A 4IZIA 3OQNA 5C35A 3GEIA 2VSOA 1J0CA 3DZHA 1O4VA 1D9ZA 1JVNA 2FSSA 2Y6UA 2YZKA 3QF7A 3QKTA 1PYDA 3D5EA 4GPTA 4JBGA 1PZNA 2WIAA 2ZREA 5CG2A 3E7FA 3RSHA 4E5MA 1QH1A 1ZXLA 4OQNA 2BM0A 3BRSA 3B52X 1SOMA 1CW2B 2QBYA 2F64A 5F5XA 3I6MA 3X1ZA 1QCDA 4ZVOA 1FLVA 4PZZA 3ROMA 3EXHA 4GMKA 3E7WA 1MH1A 4QLAA 4V0OA 1KRXA 4K26A 5AQ1A 2BONA 1CJSA 2IPXA 4X7RA 2EIXA 2ZROA 2YS6A 2GYVA 2B0JA 3WA7A 1U5BB 4FFRA 4G0UA 2VH1A 2NWQA 1OXMA 2CJXA 3DS8A 5G0SA 2NG1A 3KEFA 1QIFA 3L8CA 4GX5A 1C7JA 5GINE 2JH3A 4RSHA 5MFZA 3VU3A 1BWSA 3F7MA 5A9SA 5LA6F 4MS4B 3HCRA 3H1BA 3KKQA 2OCAA 1UWLA 2PKQO 3I3SR 1JT9A 4R1UA 3J80A 3TNLA 4GZ3A 4P93A 5EEHA 4UCFA 4IICA 5CFPA 5DM4A 1K5DA 4K9RA 4U2BA 2NLOA 2OPHA 1BKDR 1XJWA 2O2EA 2BM9A 3LC1O 4Z4HA 1GKYA 3MF4A 2BJWA 1W4LA 2HMVA 1Q83A 5EKSA 4I7EA 4LF8B 2EJTA 4AN1A 4CU5A 1E9EA 4OFWA 3KSZO 3L5OA 4JZYA 4AXXA 4C4YA 1KQFA 5BN1A 3R7NA 3K9GA 1KDOA 3FOAA 1BRTA 5FL3A 2OHIA 3UKOA 3QLEA 4ODIA 1OI4A 3VV2A 3LL7A 3BZUA 1JI3A 3OI7A 2WG2A 1JB1A 1R66A 2Y76A 2ZCUA 3EUEA 1K6MA 3QOFA 2VP4A 1KEVA 2C9ZA 2DUMA 3NTUA 4GS5A 4U2GA 3JVEA 1N3LA 3QLUC 3U31A 4Y2SA 1P6UA 2NSYA 2ORED 4CODB 1YVUA 4ZEMA 4OJKA 2MHCA 2AOUB 3AVTA 1MAUA 1KKMA 4YACA 1MDBA 1U7OA 2D2IA 5F76A 1QH8B 4UUBA 3U26A 4XXHA 3LBNA 1G5PA 2BI4A 1ZWLA 2F9FA 3L0CA 3U7QA 2EW2A 4IEIA 5ALVA 4PZEA 1Y6ZA 4F6LA 1X14A 1I9GA 5JCZA 2BHRA 2EFCB 3ADDA 3FCCA 4QPJC 2PDAA 3HKEB 1XMJA 5E1BA 5IKMA 1JALA 1Z9BA 4EYSA 3OO0A 1A77A 2A5LA 5IJ0A 1AHHA 3L0IB 2G63A 1P73A 3TZHA 2DQYA 4L5AA 5B7QA 5JLJA 1TC2A 1ZD5A 4TMYA 1L5KA 5KQSA 3DNFA 3PFCA 1TTHA 2JFYA 4MR9A 3UK1A 3KUDA 2CXNA 2DFNA 3LECA 1PQUA 3ZS9A 4Q1FA 1UC5B 2AJCA 4DLYA 2A3RA 2Q3LA 4PYNA 5LBUA 2ON6A 3CS3A 2JAHA 2YJ5A 3PC2A 3AFMA 3K1JA 2XV1A 3UK0A 4I9NA 4IDDA 1DTWA 2GPNA 2CL5A 2WYOA 3LT2A 4LHVA 3KUUA 4DCJA 6NULA 4A16A 5JFGA 5K0CA 4R41A 4TV9A 3SFTA 2AC7A 3IUJA 1UEIA 3JWEA 3OF2A 4HDCA 5GOZA 1KOGA 5A62A 5CEEA 4B7ZA 2NSJA 4C0LA 1YBAA 4G6ZA 2DKOA 3W4KA 2DYKA 3DL7A 1II0A 2FFAA 3N9IA 4Q03A 4Y0VA 1H2RS 1Q1QA 1ZU4A 1H0KA 3U62A 3K70C 1SPBS 5DOVA 4YUAA 5CLHA 2BMWA 1X8JA 5EN4A 4WXRA 2X7HA 1T15A 3WQRA 4DLBA 5LWQA 3QYAA 3VR3D 4G4JA 3WYGA 5ALWA 5D7BA 2DKFA 1IMJA 3BPSA 5BURA 5IAKA 5EKXA 4BMXA 3PT9A 4UASA 1A88A 4I9UA 4E5DA 2PWZA 5IXJA 1W6RA 4FSDA 4AC9A 3FCSB 4FSXA 2QTFA 2VHXA 4FGZA 5J2UB 1X9GA 5I3CA 2DFDA 3DMHA 3P9NA 3DT9A 5DGCA 1CZNA 4ARZA 1KTIA 1RKVA 2Y1OA 3E5MA 4TMFA 4Q9HA 5IG2A 3X2SA 2WU0A 3R0JA 1VDMA 4XQCA 3RYHB 3N2GB 4N6GA 3ZQ6A 3NHZA 5JCXA 4GSKA 4A3SA 3QVUA 4UPEA 3O75A 4AJPA 4KX5A 1OFIA 1RYZA 5JCJA 2VHZA 2BFEB 1RS0A 1Z13A 3HB7A 3IAAA 2CWWA 2F00A 3RTBA 4Q39A 1YWGO 3LUGA 1G4AE 4A23A 1CD5A 4KRGA 1JDBB 1P1KA 3Q41A 3LF2A 3TW4A 1VPTA 4YJFB 1LK5A 3IQDB 1M2EA 1CDEA 3BHMA 4MKGA 4S1WA 5AJYA 5TC4A 4HLCA 3GVPA 5DNWA 3H1EA 2D1YA 1LVGA 5I48A 4U2CA 2PV7A 1NSFA 1U81A 2J5XA 4P7BA 4K5QA 4QULA 3EC2A 2DR2A 2PSDA 3HM9A 1GSOA 2WIDA 2UYYA 1XCMA 1AIPA 1VLJA 2F4NA 3F6BX 5DHUA 3L0YA 3WL4A 4BNKA 4KREA 4S24A 3FE2A 4PHFA 4DIMA 1YCGA 5G1NA 4EABA 2ZBGA 5FBZA 1MNAA 3HEAA 3AUKA 4U8HA 1DPFA 5AUPB 4YJ3B 4RCYA 1EFHA 3P9CA 1MC1A 5EWJA 1KEEA 1N2IA 3R7BA 2R00C 1XA4A 2FP3A 1ACMA 2P40A 3HNOA 4EIWA 3C3AA 1AGNA 4J0QA 5JDIC 3QU9A 3ONEA 5KYYA 2P67A 1I4LD 5CXUA 5DRTA 4MVJF 3TAHA 3DPIA 3HFRA 4JODA 4YNBA 3NTRA 1ZH2A 4OJMX 3KDPA 1R18A 3L82B 4LZOA 1U94A 4HLNA 4V0SA 1JQLB 2YZMA 5HFAA 4ZI3A 2AGVA 1NXXA 1JQ5A 1UZLA 3H05A 3PHHA 4UQPA 1FUKA 4ZQIA 3UJ7A 5JATA 5K6AA 2V03A 5KMGB 2BGUA 3AM3A 3IUEA 1U5CA 3TQCA 2AG0A 1DFHA 1JWBB 3QWFA 2X3UA 4HZIA 1FVXA 1FYDA 1B8PA 4KDCA 2NVBA 3MW8A 2VDMB 4CIDA 4PIPA 3ZZ0A 3EGXA 3ESAA 1W87A 1EGAA 1W1IA 3TSZA 3KDSE 3U4IA 4F1WA 3UWMA 3FAZA 4U7WA 3AZQA 3MOIA 1EHIA 3L7DA 3ZLBA 5FO0A 3KC2A 1NZJA 1BMDA 1R0SA 2JVKA 4LYHA 4MPDA 4QXPA 1RP7A 4WESB 1AH2A 2BM1A 2ATXA 3M1LA 2NPIA 4IV0A 5DM1A 5CM8B 3ZOKA 4OHYA 1CETA 5KYXB 3AR4A 4EUHA 2FGKA 4BUZA 1P2TA 1HK7A 3HUDA 2ZI4A 1ZGAA 1DEAA 3ABQB 3IX7A 3T5CA 1H9BA 1FQWA 2FK8A 1BW9A 2Z9DA 5IMSA 2FRDC 1CSEE 1SBTA 1QR2A 3Q9NA 5TQ2A 4C6HA 4MPPA 3FWKA 3M70A 3PQ3A 4QGFA 2P30A 2ZTVA 1X0VA 4DMLA 5LQKA 2WUGA 2HJHA 1NPYA 4CKBA 2YXPX 2WVHA 5AW5A 2B4QA 3FUVA 1B6GA 3QIAA 1VLQA 3CZRA 3VBCA 1REQB 2GCIA 2P6RA 3F1KA 1Y98A 3ZBTA 3B8EA 4D9IA 2C54A 3D43A 3Q9SA 5TPWA 1D5WA 4H7DA 2VJMA 1YB5A 1AG9A 3B2QA 4R0NA 3ZDRA 4BNIA 2IRWA 3G5LA 4CLEA 4C4TA 1UMCB 3RQSA 5KYWA 1DL5A 4CI0B 2IDKA 2VPPA 2GZAA 3R4CA 2XNJA 4CR7A 3A7EA 2ZUCA 3KSMA 4NLLA 1QDUA <