1WEHA

Crystal structure of the conserved hypothetical protein tt1887 from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
MRLLAVFVSSRLSPEDPLYARWVRYGEVLAEEGFGLACGGYQGGMEALARGVKAKGGLVVGVTAPAFFPERRGPNPFVDLELPAATLPQRIGRLLDLGAGYLALPGGVGTLAELVLAWNLLYLRRGVGRPLAVDPYWLGLLKAHGEIAPEDVGLLRVVADEEDLRRFLRSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Conserved hypothetical protein TT1887
publication title Crystal structures of possible lysine decarboxylases from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
total genus 59
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18306 LDcluster4 SLOG cluster4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wehA00
4FYKA 5AJTA 2HIGA 4MEJA 3SBXA 1S2IA 3GH1A 4OHRA 3U39A 4LJRA 1WEHA 4MCJA 1F8YA 3EHDA 1S3FA 3IMKA 2Q4DA 2F67A 2Q4OA 4FYIA 3F5MA 1ZXXA 1F8XA 4I36A 1S2DA 2F2TA 1MTOA 2IZ5A 2KLHA 4JEMA 4LJLA 1YDHA 2PFKA 5ITSA 1PFKA 1S2GA 5AJUA 4NPAA 1WEKA 4OHBA 3O8OB 4JELA 4U1RA 4JENA 4A3SA 3PFKA 4WL0A 4I7EA 1KZHA 3O8OA 1RCUA 3O8LA 2A0KA 4HX9A 4P5DA 3K2QA 2IZ6A 3OPYB 3HNOA 4LJKA 4KXLA 4P5EA 2PMBA 3UQZA 4PFKA 1T35A 1S2LA 2A33A 4I4IA 4KXNA 2F62A 2KHZA 4RH3A 6PFKA 3BQ9A 3OPYA 3QUAA 4KXMA 4FYHA 3O8NA 2F64A 2IZ7A 2NX2A 2F48A 3MAJA
chains in the Genus database with same CATH superfamily
1H2EA 5UKDA 5KNLA 2PQ2A 1VHTA 3EYAA 2DQ4A 5CD1A 2H5LA 5DISB 4YJFB 1GN9A 1EWTA 5FA5A 1PWEA 2NZ2A 4OK5A 2B1JA 1ZGAA 4HWRA 4BVJA 5FOWA 3H87A 3EN0A 3LYLA 1P1IA 1V11A 1I3LA 1QQ5A 1EE1A 2OCBA 2A5GA 2BSAA 2L2QA 5FYQA 3ZXXA 1J6UA 1PT7A 2JF0A 2ZWIA 3FG9A 2IH4A 1IEVA 2QQFA 2WZQA 4BYMA 2CXXA 1PL0A 2O0KA 1M2VB 3N2KA 4O63O 3TE7A 1L4BA 1HG1A 4XDGA 5I8ZA 3VU8A 5FKJA 5G2OA 2FWAA 2J5QA 2AN5A 1QH1B 3NWJA 4B2PA 5J2UB 4CKCA 1NR7A 2YV4A 5KX5A 2VAPA 1AZLA 4CTJA 2G88A 3EAFA 2J7PA 5BYKA 4IOLA 1B41A 1F8XA 3EXIA 4WKOA 1N5OX 3HWX1 3KKLA 3EQ2A 2XWQA 4XFKA 1GRVA 3S1AA 3TQSA 2AOUB 5FLXA 4TL9A 2F4NA 1UKEA 1V25A 4MUNA 4NZZA 2PKCA 4YROA 3AZOA 1L5LA 3TBKA 2FPXA 4K6HA 5DH9A 5L9AA 2YQ5A 4Y2HA 3ZDEA 1P6XA 1ZGGA 3DE1X 2XY4A 5BSFA 2OBNA 5TMEA 1X92A 3OZVA 4DW8A 1AN0A 3SM9A 2FFAA 2IYAA 5L7WA 4G2TA 1XHEA 4EBBA 1ZJWA 1JLRA 4YAFA 3RW9A 4M0UA 2I6SA 5M34A 4Q19A 3M6FA 4B6OA 4J4HA 4EI2A 1R4ZA 2X22A 1G6OA 1Y81A 1B3RA 4CQLA 2W11A 1XA3A 2ZWMA 3EVBA 4FYVA 2OCXA 5DASA 4JJ8A 5TLSA 4GIBA 3FPFA 3HVJA 4Q3EA 5DNVA 4FB5A 5MFPA 1I3MA 4Z9YA 3QU2A 4PYRA 5BN1A 3LXXA 3EPHA 5DRYA 4RANA 3RRXA 2PUAA 1KOJA 1JHUA 1O4WA 3ELYA 4OLAA 1B1CA 2IIQA 4ZAYA 5FTLA 3G9ZA 3SWWA 3OCCA 2FPIB 4QFCA 4V39A 5TVKA 3UT0A 2A9JA 2RGNC 4FT2A 1CWUA 1P44A 1Y33E 1SAYA 2DBVO 1RQGA 2W22A 3AESB 3Q11A 1TQHA 3UMGA 1GM5A 4JT4A 3DO5A 5DOZA 4G5GA 1GUZA 3TXXA 4BKPA 4A8JA 3OZBA 1GL9B 2BZSA 2Z6VA 1EQUA 2GBCA 4G9GA 2YASA 3FVVA 4ODIA 3WB9A 5IWCA 5DIZA 3HU5A 3QFTA 4FGUA 3ZKWB 1D7AA 2ZSDA 4LFCB 3VR3A 5CDGA 5GIOE 3X2FA 1QZUA 2NUPB 1NXSA 1KYYA 1GRNA 4B6FA 3CG4A 1G2OA 4PVDA 5A1TA 1L4YA 3BN3A 4QUHA 2WTXA 3TQTA 1U2QA 3OHPA 4J07A 4AO6A 2XTJA 1OREA 1RBMA 1CQJA 3WFZA 1YR2A 1GUFA 1LD3A 3LVBA 1ODIA 4FCTA 3ZE9A 4O5AA 4JKIA 3KYDA 2O2DA 1COZA 3NBKA 4LISA 3NB0A 3OJFA 2I67A 2VBGA 2PZ8A 2X5NA 4F92B 5IT4A 3HB7A 4U2DA 2DQYA 2ZSFA 3EMDA 3H4VA 4MROA 5CT5A 4BQPA 4E70A 5KWSA 3ETLA 2GJSA 4PE5B 4KBFA 4H3VA 4DA6A 1Z4MA 1E3EA 1QVZA 3C3YA 4DV3B 2IYNA 4MP8A 2AFIA 1XVVA 5HJ7A 3AUYA 1U9ZA 1TAQA 4MGYR 3P27A 3STTA 1HEUA 3K6SA 3FKQA 3G7NA 3D8RA 1WLYA 1SBQA 3KVYA 5CIQA 1QMPA 2IVFA 3UWPA 1D8AA 2GZMA 3H2JA 4Q1CA 3D7MA 2B83A 2HMAA 3BD7A 4QXRA 1QHHB 3LXMA 1E61A 1NY5A 1D1QA 1Q1AA 2X23A 4X94A 5AKZA 3BM5A 4QXQA 1V1JA 4XA8A 1T15A 2AR7A 1C0IA 2VHXA 5DV9A 1Z5VA 2B5OA 5LZ2A 1E6KA 2BLNA 2Z6UA 4BTLA 2V03A 3T3EA 3PHBE 3GVXA 3Q8WA 5MGNA 3LC7O 1UZUA 5EP2A 1PGJA 5EXXA 1KJQA 3ZZMA 1GTMA 2Q0SA 3IJEB 4V0RA 3HDGA 4BE4A 2RSLA 2IBMA 3W7VA 3U44A 1OVMA 3IDZA 1W4BA 2F55A 1M5RA 2FSPA 2QENA 3D3WA 3GLUA 1ZJ4A 1KQPA 4HPJB 2FSVA 2KJQA 3WYBA 1G8FA 1KI4A 1KS9A 4JU9A 5IN5A 2WZDA 2I3DA 3O5AA 3AZPA 4JC0A 4S12A 4DMUB 4QXPA 3BC1A 1ZK0A 5I7AA 5C4GB 3EAQA 4MKZA 5LVAA 2OOSA 3EQ7A 5DW0A 5LZ8A 4B8ZA 2W5UA 3O74A 1CG6A 4RDXA 3IAFA 5JLAA 3W5UA 1F06A 2IXAA 4IMJB 4LY6A 4ETMA 2BCJQ 2CLIB 2VVTA 2D4AA 4RO0A 2D0IA 1BD4A 4C6RA 1ZCBA 2FEXA 2ZTUA 3RRJA 4D4LA 1WUKS 1G6Q1 4J0IA 3FHCB 4R31A 2KB0A 3QKTA 4ZD6A 2YWEA 3L82B 1QHFA 1GPKA 1C9JA 4OGKA 1OBHA 4OQPA 4E51A 5JNLA 5KNBD 1HE5A 4J7CA 1KAOA 2PTGA 4RXUA 3WRYA 1FW8A 4XLZA 3E2MA 3EIEA 3PC2A 4OSOA 4FWTA 1TUBA 4F8YA 2ZE5A 1MC8A 3PFWO 2BFBA 2IV3A 3W6PA 4CMHA 3LDGA 4OKSA 3A4YA 1T26A 1RXYA 1A88A 2B3DA 1IN4A 1C3VA 5CVVA 1UWCA 5CVJA 4AI6A 2WOJA 4DLVA 1KMHA 3HCRA 2ZJZA 3IBTA 3ZCUA 3R8FA 4J6FA 4NOKA 1H2BA 1R3DA 1WDWB 2YOHA 2R3SA 1RRFA 3OM8A 4Y1RA 3R6LA 3E58A 2OZLB 1LX6A 3P5SA 3GAZA 2OP1A 3FZNA 1JQJC 4GS5A 4OGLA 5TEVA 5IZCA 2JA1A 2W8ZA 3RUFA 1S2OA 5MN4A 1CY8A 2EQ5A 3B48A 3JWHA 4LRQA 1F1BA 1YCFA 5ALIA 1NTOA 4LV8B 4RZ3A 2EKBA 4QECA 3GLKA 3K9QO 3ABQB 3OVMA 2XDWA 1S1MA 1ZNQO 2HXYA 3OU6A 3VSDA 1O54A 3ED1A 2FMKA 3OTGA 4BVHA 2V4ZA 4U3JB 1V2HE 4Y2XA 3W2GA 4TLCA 5CK5A 4RPKA 4DR3B 1W36B 3OHMA 3KUKA 4H0NA 3LCUA 2GN2A 4LECA 1YCHA 2E5FA 4K88A 3DOFA 2PGDA 4M88A 2HXGA 4AMZA 4V38A 1FS4A 1ZEMA 3MTJA 1XC7A 2C2ZA 3TNLA 1CP2A 3W78A 3WL7A 5KYXA 4GR4A 1TM3E 1ONOA 4N39A 4M9UA 4IXDA 1DHTA 4D8TA 3KBBA 4WACA 1BW9B 3IP1A 3S2EA 1A8UA 1LZKA 3DMDA 2NYAA 3LBFA 4LNAA 4NZ9A 4YASA 1ZMTA 2FJ0A 3PPVA 4HNAB 3QA9A 1EXDA 3T1TA 3MELA 5ADUS 4NBKA 5BMVB 3AG5A 3FDZA 1C4WA 1Z3CA 4ID9A 1S3SA 4D42A 5JXWA 1E2IA 1X7ZA 1M1ZA 2E21A 4W82A 1K2WA 4HH0A 1IBMB 1U28C 1E77A 4FFBA 5U9CA 3VA7A 5LYJA 4WNYA 4LRSB 4IEEA 4OQDA 3QKSB 1Z2DA 3VYSB 3HCNA 2VJBA 5DE3A 3ZBUA 1L3BA 1OXMA 2C9YA 3E1SA 4D8WA 1W581 2KWIA 1WSDA 2PWPA 3FCAA 4Q1BA 4LYYA 3A6ZA 3SFVA 4JLWA 3G88A 4UUOA 3QWHA 3IAHA 3FXAA 4ZYWA 2Q4OA 4HKTA 3RUIA 4X20A 4D79A 1SGWA 3PX7A 3RBXA 5SZIA 4Q9DA 4Y8VA 1J1ZA 2WFZA 2FVYA 4QT4A 1Q7CA 4BNYA 1Z8NA 3IFSA 4D9EA 4TQUS 8AT1A 3Q6MA 4MJ3A 2PS9A 5IAGA 4KTVE 1XK7A 2XCQA 3E2PA 4D26A 2QTFA 3SPXA 1E3WA 3NEYA 4DMGA 4GDMA 2OXFA 1O0BA 3DLBA 1ZOLA 5JI3E 2PX6A 2I0FA 2C59A 4FX5A 4BNZA 2PUHA 4HNSA 1GPWB 3CX7A 2ACWA 2AMLA 2M98A 4MVJP 3ZHBA 2YJGA 4DMCA 1PFKA 1GAEO 1Y5IA 3PQ3A 4IUCS 1H23A 3GVIA 3I23A 3WV4A 4AN1A 3VUFA 3THYA 1RFLA 4O3FA 3K9NA 4YRQA 3SD7A 5JZVA 1QVWA 1QZXA 2C5GA 1KDTA 2IUYA 2FRXA 3D0QA 4OQXA 1Y8QA 4ZZ0A 5ANRB 4QBHA 4H9GA 4MQ5A 1ZK2A 1N2CA 2OPHA 2VF2A 3NTLA 1BDBA 1SVLA 1W4LA 5IKEA 2DPMA 4HWSA 3RUAA 5LLTA 1J06A 3SYMA 1U0GA 2R5WA 2VT3A 2VRWA 4HUQB 2A5FA 2XUAA 3CNQS 3MEQA 1XKLA 5JJIA 1CS0A 2ODAA 1TEVA 4XFJA 1E0DA 2WSMA 5IKPA 4EF6A 5EC8A 5DSTA 2W2PA 4JI3B 4DLPA 4Z7NB 1C1XA 2VXYA 4MKHA 5K0TA 3EFOA 4FMCF 4BY9E 5KSOA 3VBCA 1DUIA 3QTBA 4AUNA 4PCAA 2CZQA 2F3SA 4DV1B 4MHTA 1GRQA 4WDQA 1SEVA 1EUYA 3AF6A 3ENQA 3I5AA 5F2NA 2YJZA 4RPCA 4LK3A 2FLWA 3OKAA 3F5FA 1ZH0A 1JFVA 2L18A 3L1IA 4FX2A 3GLTA 1ITZA 2A59A 2WEKA 4GQAA 4LC9A 5MN6A 3BMQA 3AB7A 1IQUA 1MRNA 2RK3A 1SA0A 2OV1A 4RKYA 1L4HA 3KSMA 3D5TA 2XWBF 4N65A 3GP3A 1DE0A 5B1EA 3M1LA 1ISPA 2YC2C 3WIDA 2Z5GA 2QN8A 1MR3F 3HDHA 4EKEA 3RYHB 2HV9A 5CT8A 2WHPB 3E9ZA 3ZNOA 2QTBA 4RGQA 3R76A 3BA6A 2QPOA 4IUYA 4NWIA 2FMTA 2HA5A 4A6DA 2IYRA 1RU3A 1SU8A 2Q62A 2VH5R 1TQ6A 3DXZA 1HDXA 2V5UA 1QIJA 2J6HA 3H5AA 3PENA 3PU6A 1I5EA 4RAQA 5EMKA 3W2HA 2WYIA 3A1UA 3MCUA 3PEUA 3CVUA 1L8AA 1WCYA 2C78A 5HE9A 4ENTA 1TE2A 3LLMA 1JLLA 2PRJA 5JEEA 2VAWA 3GX1A 4RENA 4BGEA 4L73A 4PG8A 4KRFA 4G3XA 1XYGA 4K81B 2Q5QA 5EG5A 1HT1E 3L7MA 2GD2A 4XB6B 3ZVNA 1YUMA 3QVUA 4X44A 1FDUA 3GDGA 4GPEA 2Z1MA 3B2NA 5CJPA 3VR5A 2J3IA 1A9TA 4J1TA 3T7KA 2YWGA 4HB3A 4YV7A 2O8BA 2PLNA 2AEJA 1KYZA 4G41A 4MUHA 4OOEA 5EKXA 2YICA 4B7XA 4B32A 3OCJA 2EL7A 1Y8ZA 3U3XA 1POWA 1USWA 1IIBA 2CLSA 3DMTC 4U6QA 3WSWA 3TTVA 3NYRA 4MA5A 3N53A 5FPPA 5KNCH 3TJZA 2PX4A 4UQOA 1KZ6A 3TS1A 4OLBA 1S02A 4C2AA 2D6FA 4GKKB 4OHZA 4YJDA 1JHQA 4PIVA 1KQNA 3D2LA 2X1VA 1Z6TA 5K0ZA 5U4XA 1N2BA 1MH9A 3GFBA 5KDLA 5LJIA 4YRNA 1MNQA 4P4GA 4BDTA 2K7FA 3BTVA 2P65A 2CMGA 3CF6R 4NEQA 5C3MA 1CEEA 5JDIC 3VUEA 1ZCAA 1GQOA 4Q48A 4M53A 5B4VA 3K5HA 4JEUA 3KEMA 1D03A 1KAMA 3D2BA 1Z29A 5DBGA 1XRRA 1P18A 3RNOA 3TLXA 4C4XA 1TUGA 4CM8B 1KOFA 3GQBA 3ZCSA 1OFUA 5F77A 3F4KA 5G3YA 5TNXA 4ZRMA 4QTZA 3V2GA 3UFBA 3ZBQA 2QDXA 3PIRA 4EDHA 3RRYA 4EHFA 1PFYA 4ZALA 1L5HB 5EFOA 3VR4D 3QSYA 3D6JA 2HHCA 2JEYA 3FF1A 3H04A 4MUFA 2X0NA 3T8YA 4C0WA 5TXGA 1Z4PX 2G8LA 2Z58A 5BV2P 3V80A 5IHXA 3RT9A 5CDFE 4UQPA 4DG8A 1LK7A 2X7JA 2H7XA 2BFDA 4IXNA 2Y0DA 2O0HA 4JBXA 4A2CA 3G79A 4BVBA 2V5VA 1GPMA 4Z2YA 4EUSA 2QJOA 4YMSA 3H65A 3MFYA 1RJFA 1DX4A 3PWSA 1ZAKA 4BLVA 1NI4A 2L42A 4FIZA 3KXIA 4GKJB 3DLIA 4LYJA 4BNUA 1JFTA 3PUKA 1NTRA 1R0LA 4MV7A 2D2IA 4O1HA 2H8GA 4OBBA 1OR8A 4S1PA 1UDXA 4I4TA 2DWPA 3EDMA 5JS6A 2OESA 3IO5A 4Q37A 4O5OA 3DXXA 1M1XB 2PD3A 1V6SA 3ZJVA 4N76A 3S2SA 2XXAB 1FYDA 3BSSA 4O2BB 4XWGA 2QJFA 3GLHA 1PU2A 2Q1WA 4N3AA 2CJWA 2PNJA 4QELA 3QPUA 3CVWA 4UPEA 5JNSA 4IRUB 2XB9A 1II8B 4IAOA 4OYLA 1JXMA 4AF6A 4CMIB 5JXGA 4AWAA 4CLEA 5C8YB 2CVOA 5DSZA 3OFSA 3T5AA 4DNOA 2Z1DA 1YZUA 4HOYA 4WOBA 4GUDA 4CLDA 2Q6VA 3LP8A 3JVDA 4J4TA 1JDBB 3JYHA 4PC2A 4RSRA 4CEJB 2AOVA 2BTQA 2IZ7A 1V35A 3ZWXA 2JZCA 1Y3BE 3EISA 1T4GA 3C6KA 3O82A 1QIEA 2OK8A 3RJMA 3ZU4A 1F2VA 5HKKD 3INNA 4BKRA 1EBFA 4OJTA 1OAOA 2XQIA 2YC4C 4LOAA 2FN4A 1GL6A 3ECSA 3CF4G 3OCYA 5BWLA 1J70A 3JAKB 5H4HA 1DLIA 4JROA 3VO1A 4DUZB 4XM0A 1WU7A 4WBNA 1X94A 3ZU2A 2RH4A 4V0KA 1DWPA 3FNIA 1BQ3A 5JTUA 3GW8A 1HTWA 2H3HA 2IE0A 4QPNA 3P2IA 4IDGA 4MLPA 5CW1A 5EZ5A 1HDEA 2FWRA 3VKWA 3WGQA 1NJ8A 4DCNA 1UINA 4PX3A 4ZQCB 4ECAA 1KO8A 3HA3A 5JAOA 2P79A 3DFMA 2GM4A 3ANLA 4D9NA 2OEPA 5DBEX 3KSBC 2X3UA 3UJBA 1ESCA 2QAGB 3N0XA 2JFXA 2FRDC 3OTHA 3ZQ6A 3P4YA 1E3DA 2ZR9A 2J31A 4QTUB 2CXNA 2XBMA 3G5LA 3LBYA 1H0RA 4FU0A 3FUVA 1JTVA 4IWYA 2XBUA 4KDRA 4AYWA 4BMYA 1F60A 2QLLA 4MINA 1SVSA 2XB6A 4MLZA 5A05A 5CD9A 4IYJA 3C6QA 4A0QA 1P8JA 1IHUA 3ELBA 1IULA 2J3QA 4OGWA 2ERCA 3VH2A 2PUEA 2VUSA 4QVGA 1JA0A 4BLQA 1XD8A 5HWSA 4Q12A 1TF5A 2HCRA 2W6JA 2Q6OA 2ZVJA 1TK9A 4XX0A 1KY5A 3E1GA 3FW1A 4NJEA 4YCBA 3S55A 2CZGA 4KLAA 3AR4A 2AC7A 3LOPA 5B3LA 3GARA 4BBPA 4NJMB 2X4DA 3P2YA 3BH6A 4EZEA 2HDHA 1ND6A 5J63A 5I5EA 1EG2A 1RZUA 3U4MA 1MJFA 2GDZA 4QDXA 2O2GA 2WUWE 3CLSC 4OXRA 2R7AA 4LQCA 4OI0A 1E6WA 4GZLA 4ZMRA 1R0SA 2Q1SA 4N5MA 3TVYA 2JG3A 1ZMRA 4KMSA 1Q22A 3MF4A 3LL4A 4MQFB 4ZANA 1SC3A 1M2NA 1VOTA 5CH3A 5C5EA 4Y6GB 4M8SA 1QO0D 3GCWA 3PCRB 2CK3A 1C1YA 4TV8A 1ZL0A 5JCOA 5A7FA 1P81A 5MHTA 3T3PB 2I03A 1RXSA 2XOKA 2ZWAA 2ZM6B 1Z62A 5CGQB 4D3XA 3LQFA 3P5BA 3UK1A 5HR5A 2O5VA 2V7QA 4BNWA 2GF0A 2C8JA 3Q7IA 3SHFA 4QTYA 5EQJB 2C0QA 2Z98A 2C2KA 4TTRA 4JA0A 4FYXA 1CUIA 1HRDA 4ZO4A 1N8KA 1RW4A 3LBIA 4NL4H 4AXBA 2IUSA 4TWIA 1FRFS 4FFNA 4ZEXA 5CCDA 5CEJA 3PI7A 4OREX 4QJ3A 1CR0A 3C3DA 4NYMR 3JY6A 1ADYA 2F9FA 3IAS6 4RL6A 4QYXA 4DC9A 1S1CA 4B81A 2DY1A 5F7OA 3IUJA 1ADCA 3ZGNA 1AQ6A 1LQ2A 3M6VA 2FZKA 4X1OA 3RRBA 4K2AA 5FA8A 4NLLA 1OX5A 4AECA 4Q7KA 1K5PA 1C81A 1RKUA 3R41A 1OXUA 5I4KA 3I5YA 5JMWA 3EG5A 2CJFA 4F93B 2KE5A 1FRZA 4YMVA 1B8PA 4NECA 4QUJA 1G66A 3B3FA 2FN3A 1G3IA 2P6PA 3N2ZB 2Q7DA 3C14C 2OXIA 1IC6A 5C80A 1WBBA 4ZV4A 4L3OA 4MWTA 4FONA 1ISFA 1IZYA 3LYHA 4JBWA 4WJLA 3FPBA 4KXYA 3FBWA 1YIDA 2D7CA 1GT91 2Q46A 3DTVB 5GWXA 4DLRA 3P9IA 3F6YA 4HQRA 3REGA 1Z82A 3EZ6A 1UBFA 2C03A 2QGFA 3LT1A 4M9RA 5EYPA 5IVPA 2ZYGA 3L43A 4ZN6A 4X60A 2ZI7A 3L7YA 4MMYB 4X91A 3GQVA 5A06A 5AM3A 10MHA 1J0EA 2GERA 2XTZA 5HW0A 2PUFA 1LTHR 2YHAA 5CURA 1NBIA 1BAPA 5DTIA 1NW4A 3R3VA 5AUOB 1WP9A 3N0WA 2ARKA 3B2EA 2JCVA 3AWIA 4YQFA 2PAFA 1SXHA 2QMHA 3A31A 3CTPA 3KSUA 4ZREA 3RU2A 5LM3A 3VQTA 2JLBA 4YRFA 1A76A 2WYUA 3A4NA 1T5TA 4AURA 1EK5A 4JIGA 5T6MA 2QYOA 4HYQA 3JQAB 2FRVA 2XA9A 2X9GA 3HL4A 5LBIA 1K4MA 1CT9A 1PTJC 1G8YA 4H7KA 4BNVA 4JLJA 2FZWA 4CF7A 2RGEA 3D4OA 3IUEA 4YJ3A 4AMGA 2O8VA 3EH1A 4NESA 4UU0A 4BKMA 1R9MA 2Q8NA 1JIXA 2VK2A 4D43A 1M1NB 5D3QA 4HWPA 4E2WA 1GXSB 2ZJ3A 2G5TA 1VRVA 2VBCA 4L2IA 1J39A 1DJNA 2VO1A 1RIFA 1CSEE 1DXOA 3AF3A 1R12A 4KO8A 4NK5A 2BI4A 2FUG1 1RCTE 2JA2A 2WTMA 1FCJA 4GNRA 4CIYA 1YHYA 2WYVA 1FU4A 3PE3A 5FRDA 1Z4KA 2YWCA 4G56A 3ES9A 5EKUA 2I22A 1KR5A 4OATA 2ASVA 4W7IA 1XVTA 1HR0B 5F9MA 2IYEA 2BEWB 2V7GA 2YOGA 2BM1A 4BMCA 2VP3A 3HUEA 4I50B 4CKXA 2HBYA 3NVAA 3L6UA 3AUKA 1SUEA 3F3SA 2PRIA 3F6PA 3MVEA 2VUHB 3GRPA 4JJ7A 4BFLA 5HDBB 1QVAA 4B74A 4ZGWA 2ZXFA 1CVRA 5TQ0B 4NCBA 4HN2A 1IRIA 1L1RA 3LWDA 4V3CA 3DLHA 3RC8A 4D81A 4AQ7A 2QG6A 3LHDA 3UWSA 3V8QA 2WKWA 4P22A 4TV9B 2WM9B 5L51A 4IDDA 1NBME 3TAHA 2HPVA 5I7EA 4ESEA 4QE3A 1OI4A 2ATVA 1NBWB 4PWYA 3VNUA 1PIWA 2QRQA 3C4QA 3SOPA 4C7KA 1LDMA 2VPQA 4QGGA 3TN7A 3VV2A 1X8XA 1NT4A 5KPDA 4HRXA 1P2GA 2W93A 4RH3A 4FR5A 4YONB 3TQQA 3D6AA 1FFYA 4DYHA 2IELA 1UP4A 5GINE 4NC9A 4GR5A 3ITDA 4IS2A 4E12A 2VL7A 1TL7C 5HZHA 3DBLB 3MHPA 3TIFA 4F04A 1SVKA 3E5HA 1PZXA 2WM3A 2NP7A 4ZZIA 3FJOA 1MVOA 3QKIA 3VKFA 4BO0A 1R18A 3LVFO 5LB2A 4C0QC 1ENPA 4DKXA 2MYNA 2DFDA 3DFIA 1JILA 4PHHA 3SIXA 4C4SA 1IVYA 4IIDA 5FAKA 2JZOA 3E48A 4GKVA 1K7EB 4BAGA 5ELMA 2CV2A 5T4BA 3A6JA 4G09A 4ZOQI 1YMUA 3WSVA 5M5BA 5T7BA 1JYSA 4O25A 3UK6A 3H18A 3U19A 1QYXA 1RMTA 2P6OA 5FHRA 3RVDA 1CB7A 3RREA 1R8JA 3WMGA 5JVDF 3RFVA 3T7CA 2FMIA 2F00A 1SVWA 1S3FA 1MO2A 1XU9A 2PQ6A 4HH1A 1KJYA 4IY1A 4ZHQA 4HSGA 1KL7A 1CJBA 3NTOA 3I2KA 4GWKA 3RQSA 3D0RA 5HYVA 3W7AA 3CZCA 4KRXA 4OXKA 1PWXA 3CLUC 1Q3TA 2C2GA 2G5GX 2FN7A 1O6FA 3K9FC 5IVIA 4AICA 5AIBA 3BTOA 3I5XA 2JLWA 3P71T 5IDWA 2XMSA 3BGOS 5JG7A 1AZWA 3I01A 1YV9A 1GQQA 3NALA 1GKIA 4GOKA 4R16A 4V3BA 3JQCA 1ENYA 2Y0BA 3A3PA 2OKGA 4AKGA 2WDZA 4ZU6X 1SQGA 3W05A 3DKVA 1VKJA 5TSDA 3F78A 4DJEC 3SX4A 3DMRA 4KWHA 2UYQA 1E2NA 2OO7A 2XVXA 3PNBA 3V9PA 1KBZA 2FSIA 3JASA 4RZUA 3EPJA 1ECCA 3KE9A 3QJ5A 4W6ZA 2COKA 1Z5GA 3PPXA 2X2PA 4R9UC 1XMXA 1Z6PA 2GEUA 3CNEA 3IUMA 4PX9A 1UFOA 1TTHA 4K3UA 4O0MA 4DWJA 2FZVA 4P8RA 2VTBA 4KDEA 5IT9A 2L17A 1ZNZA 1AGXA 3M8KA 3GLGE 2DWQA 3ZYZA 1P1KA 5F7XA 2SHKA 3BIWA 2P75A 3M81A 1YZLA 1RRVA 4UE3S 5F78A 3A9TA 4IWXA 3VFDA 2FJUA 2PHZA 1DZIA 1H6CA 1CNEA 3T7AA 1VE3A 2W2MA 5GJCA 4QKQA 3TXYA 1E3TA 1ND5A 3ASYA 1R9JA 2YZNA 2OGUA 3AOGA 3FLBA 4O4LB 4Q7JB 5ALGA 3UHAA 3D6FA 3L4JA 1ANKA 2ORYA 2Q6TA 2Q9AA 1I4LD 5DN6A 2AMFA 4WW0A 3AR5A 5LZ7A 2PGNA 3WYAA 1ZYUA 4EUFA 5JJ5A 5DM1A 4CIWA 1VC2A 1R6XA 3AOEC 3Q87B 4HHEA 4IVPA 2A0KA 4QDUA 4BNGA 1W4RA 2BFFA 4KXXA 3NYIA 3LF1A 2H4HA 3H6KA 3SJBA 1ZH8A 1R64A 5E2AA 4DIEA 3IEMA 1FUIA 3HYSA 4Q1FA 1HE4A 1Y4AE 2GDJA 3PTLA 5DBOA 2BKAA 4RFLA 3L3BA 2HI0A 1W0KD 2OCAA 3THWA 4HFMA 5TF0A 3QU7A 5JSKA 5EL0A 2BZ0A 2PSSA 3L07A 1JDSA 1TF7A 1GFZA 1ZUWA 1K08A 4W8GA 3V32A 1NC3A 2G83A 2HTEA 2W2QA 3AZQA 1HLFA 3QBEA 5ER9A 3V8BA 2BHNA 3E7PA 1XQXA 1R0WA 4HZIA 4JJAA 4B3CA 3WWEA 3DC7A 1DBIA 3PKJA 1ID8A 1D07A 4UE6A 4X7MA 5I9SA 2QUAA 3LECA 3QLJA 2FMUA 3KYCA 1KP2A 1PS8A 1WMBA 1NRJB 1NX6A 2GPAA 2YH2A 4N82A 3LCRA 4M0EA 2GD1O 1YNOA 3DJYA 1U2DC 1FMLA 3DWIA 2XUKA 3QM1A 4JBGA 4Q1VA 2GEFA 1NW8A 2ORIA 4QC2A 3V1KA 3PFNA 3SIWA 3PNQA 2NU9B 5CBPA 2R0QC 3FSGA 2Q4TA 3AP3A 3VV3A 4QYIA 2OECA 1WKBA 3OHSX 4YQZA 3UMVA 1PX0A 1D1TA 1UBLS 2FPPB 3K1JA 4OH1A 4YPOA 2OCDA 3ZK8A 3IQEA 5CHYA 1XVAA 1RRPA 1PV4A 2OZVA 4G0XA 2JGFA 3T7TA 3WKEA 5DBHX 4EHAA 1BA2A 3I0MA 3I39X 3ILYA 3M70A 3NT4A 3S29A 3GFRA 1YT5A 1Z39A 5CA1B 3QKRA 3L1UA 4FEYA 2X58A 4JJEA 4PONA 1THZA 5EJ4A 3BHIA 1CRZA 2ADMA 2IPXA 4J2OA 3A9CA 3GEMA 721PA 3STXA 3WOVA 3AHJA 5CFNA 1TAUA 4JVSB 4MR8B 4QEDA 2NPFA 2AW3A 3CA8A 2G6TA 2WAOA 1LNSA 1ZJ6A 1ZJ5A 2BJHA 2QM0A 3B1ZA 3VJKA 5A3SA 5A5VA 3GAFA 1PFUA 2IZ5A 3KJGA 3MOSA 3R3WA 3L01A 3QWBA 2R1TA 4Y2QA 4DR4B 1JLMA 3OO0A 5I7SA 2RB5A 2I2AA 3IOBA 4ID3A 1CUVA 5L3ZA 4XSVA 1QJCA 1I1HA 2Q5CA 1NPTO 3HY3A 3K1AA 4LNUB 5FL3A 3RGGA 3WK6A 3U4QA 3ESRA 4MCAA 4TWBA 4IIHA 4RMHA 3QRWA 2WWRA 3P4UA 4CLXA 1AA6A 1IHDA 1GSOA 4G8CA 5SZJA 2PJZA 3MIIA 1GV0A 1ZP6A 2Q8QA 1RXUA 1YR9A 1E6UA 2ECOA 3E9MA 3QVTA 4I8DA 5FH9A 3Q9NA 5BPFA 1ZONA 4EMSA 1RS0A 4HAYA 1VBKA 2CXRA 4Y67A 2ZYTX 3HJGA 4QQKA 1J0XO 4MICA 3PQ8A 3UFXB 4XAQA 2VF8A 1NVWQ 1FJHA 1RBYA 4PPGA 5IARA 1FYFA 2Q4BA 5F2KA 3HG7A 3DUFA 5JNRA 3ODPA 3IPAA 1WTCA 4GI5A 5T57A 1Y6JA 4CV2A 2OD9A 4C4ZA 1G18A 2C3UA 4LFBB 4AZ0A 1RLOA 1X2BA 3T3IA 3ELDA 4JU8A 5DYNA 1N2JA 3OZUA 4FQ8A 4J0DA 4ZPJA 2ZYDA 4WZBA 3KL4A 4R2HA 3THOA 4AKSA 1V2GA 1LPNA 3QE3A 3AEKA 4P86A 1LXCA 3GFQA 2J08A 2OCPA 4Z5XA 4CMKA 4BP8A 2ZCJA 1VA4A 4GMFA 3UBMA 2AXEA 5G40A 3K6RA 4J2TA 1TI7A 4DWWA 5AM0A 2CXQA 3AJRA 1VFPA 3GO4A 4OGGA 3UTCA 3L8YA 4KQ6A 3UGKA 3EB9A 4F4HA 3UUGA 4DCVA 2E1PA 4HQKA 3L4BC 3NNSA 4EKDA 2L19A 1CUHA 2A94A 2OO5C 5E8RA 3DVQX 3SZLA 3PS9A 4CJXA 4J29A 4BO2A 2VYNA 4YUXA 3AYXB 4MSUA 1FFCA 3AVQA 4ARSA 4H7JA 2PGAA 4IKPA 2UKDA 2BJWA 1QSGA 3QHAA 4XVRA 2BGMA 4DANA 1T1IA 4RVHA 2ZRFA 1AO3A 1OLSA 1H3NA 2NPIA 2PX0A 2HLDA 2IUTA 3I01M 2UZ1A 2ETVA 3E15A 3OLYA 1UMCB 2A14A 5I4BA 2B36A 5I5GA 4ZI5A 4G4SP 1U4SA 2CYCA 4EO4A 4OI1A 5AVSA 2R7MA 3PCXA 3DS8A 2RHTA 5EIBC 3HS3A 3QKUA 3R74A 1Q0UA 5ABPA 1YR3A 2ZBDA 4ASUD 1WCWA 1LPSA 1IY9A 3PITA 2WVGA 5MGBA 5JH7A 1FUUA 3Q0EA 3X1YA 5LD2C 3EFBA 5KQMA 1CHNA 1I4OA 4M55A 5F1YA 4D96A 1NVAA 4F46A 1JJVA 4L85A 1N7HA 1RJ9B 3DE0X 3SQWA 5A5DA 1U7HA 1RKBA 4PANA 1AK1A 2XT6A 1FMFA 1W35A 5KREA 4QATA 3G2JA 3O92A 4R8MA 1VHJA 1A3CA 2J0SA 3MAGA 2IEIA 4JUFA 3WY9A 5C46F 4FBLA 4CQMB 3D7LA 5BNZA 3UAVA 1ZDMA 1EJ6A 3DOCA 1XA4A 3MINB 5ALLA 4EEKA 5JAZA 4FR0A 3KP1A 4DHEA 1O9BA 1CUBA 1WOMA 3E05A 1JN0A 2VF4X 4EDFA 5IMSA 2O8DB 3GJZA 2VS1A 4MIYA 3G8YA 3RADC 5AJXA 1NMXA 2G1JA 4IFBA 3HEMA 3DE2X 3MJ4A 5FL7A 4H3SA 3CUYA 1U7TA 3GY0A 1O6ZA 4TM7A 3C1TA 1G21B 1JT2A 2JBWA 2ST1A 3V1TC 2YZGA 3ZKAA 3ZNPA 5KCMA 3W3AH 1FFXB 2IXBA 4DRXB 4YMWA 4EENA 3E5MA 1M2JA 1WMEA 5IYZB 2VRNA 1WO8A 4ZIRB 4E1BA 1CLEA 3SLKA 4N0DA 4WXHA 2Q3HA 1LJUA 1AMOA 4UW9A 3QVVA 1SVOA 3PLNA 3DNFA 4JLKA 3E22A 3ENVA 5C1DA 5ITZB 4Y6LA 3R9WA 1NBMD 1JUDA 3OQHA 4P33A 4R2KA 4RD3A 1YDEA 3F47A 2Q2VA 2JBAA 2VBFA 1KQOA 3VYWA 4TWAA 2GNOA 3KNZA 1U9JA 2PKEA 4C6HA 1I80A 5DP1A 3C5VA 3DAPA 4YRPA 3G13A 2GHRA 2XEXA 3N6XA 4N8DA 3TG8A 1FNMA 4AJ1A 3TLAA 4C1NA 1FB5A 2JVIA 4RVOA 4D0LB 2XPCA 4P93A 2PSEA 5IEJA 2ETXA 3UT5B 5G4KA 2LP4Y 3B36A 4UNPA 3HJNA 1I2DA 3N87A 3NUGA 4IIEA 1FTYA 4S35A 3T95A 4JVLA 4R7ZA 2VZ0A 1F4VA 2WC1A 4O4HA 3CZMA 1YVEI 5KUTA 1RWPA 5M7EA 4GDFA 3QEAZ 2ZSHA 3T38A 1KEPA 3WLJA 3PEYA 4OHYA 4HDSA 1Y8RB 2QJTA 1OV4A 3LG2A 4NAUA 3TX2A 3NFRA 5EE1A 1OAOC 2CLFB 4CM1A 2GFIA 5EWMB 3LKBA 3ZGYA 2NZXA 4WCFA 1X2EA 3A37A 3VDXA 1YE3A 5JAHA 2QPAA 4MRAA 4P84A 5LIRA 1F4LA 1Y1LA 3O95A 4XUCA 5B1SA 1V16A 3SCZA 3PXUA 3TECE 3PI6A 1AS2A 3KL2A 3HABA 2G67A 2LPMA 3K72B 3O1IC 4M0LA 1QVVA 3IEVA 1J97A 2AV6A 4NOMA 5EGSA 4G0WA 4FBGA 3SVZA 4BLWA 4Z7JA 4FFPA 1ISJA 1UBCA 1YD7A 3Q3GE 5CVUA 5JPCA 3QE4A 3UA4A 2Q1YA 3KHUA 1F51E 3G6WA 4A91A 4EQ6A 3CR8A 5B2ZA 5BWBA 1XRNA 1YGPA 2GBGA 1G60A 1PLKA 4LWPA 4MRNA 4R8RA 1F6BA 1ULBA 1KKUA 1DI0A 1PL7A 1C2YA 2Y6UA 2BMVA 1OAKA 4ZI7F 5EKSA 3BEOA 3OJ0A 1TKCA 5HBRA 1FX0A 5H1YA 5LN1A 1XPUA 1G3UA 1VSBA 2R8BA 1YVUA 2PYIA 5JJLA 1FS6A 3FZQA 2HNAA 3RS4A 2GZRA 2RJNA 3DMYA 4TXHA 5DGDA 3EGIA 2C77A 5DLYA 4BVLA 5JDCC 3PRHA 3WRWA 4HYYA 2VUUA 3B1XA 1CRQA 4G1BA 4PR0A 3WVNA 4TYWA 2NSJA 2FCRA 1U0FA 4QYMA 1C7RA 2WDPA 5LUBA 1KJ8A 2FEMA 3AX6A 3AHDA 2YZ7A 5ESDA 3QEMB 4FYWA 2VNKA 4NBVA 2HJRA 4TZTA 2GN6A 3A3OA 1YBMA 2GR9A 2I6XA 3PNYA 2OBFA 4B4VA 1Y4ZA 2G3YA 3AFGA 2EATA 5FNVB 1GDHA 1G2QA 1NE2A 1JR3E 2ZPAA 3W8FA 4GPAA 2P9TA 4H08A 3QF7A 3T1QA 2K2WA 2EGGA 3OC0A 3LRPA 3AUTA 1K98A 2IU6A 2OLKA 3IERA 2GAJA 5HM8A 2VWGA 1L5FA 3DHYA 1MNAA 4YP1A 5JCOC 1CRWG 1WEKA 4FSHA 4DJJA 1E89A 5FBHA 4CTMA 3MIZA 1JWBB 4L4RA 3DHNA 4PLTA 2JGEA 1U3UA 4IQ8A 1K2VN 2DFLA 4MUMA 3WG9A 2FPRA 3ROGA 5JI2E 4ISCA 1XDWA 3TTWA 2JH3A 2MR6A 3EH2A 3W6ZA 4KFTA 1I3NA 2P3QA 4Q05A 2YYAA 1UZAA 2F1IA 3H4TA 1UANA 1MIOB 3HKEB 4MW5A 4GLBA 4PZUA 1WL8A 1EZZA 4REOA 1WHTB 3O8BA 3WKCA 4JI7B 2MSLA 3OD5A 2B92A 1NC1A 3CF2A 4AJKA 4LFAB 4IGAA 4WE3A 5KYUB 1Z5PA 2J32A 4Q7LA 1G3QA 1UKVY 2WJ4A 2Z04A 2D59A 1DQNA 2XADA 1CEXA 1KY3A 1K5GA 2Z2IA 3IA2A 3RR2A 3RS7A 3PC8C 1VLQA 3S28A 5D5HA 3HMKA 1Z8DA 3KZXA 2VDRB 3KQHA 1NMQA 4TZ0A 2JH9A 4JYPA 1P74A 3Q0TA 4UU7A 4NXNB 3EQ6A 2C4NA 5EQFA 3L7IA 4BMPB 3AEUA 5DW3A 1KKLA 1UH5A 4DGSA 3HZZA 3L0DA 5D8DA 5K3SA 2NW6A 3W79A 4GZ6A 1J4AA 1NQOA 1WXXA 2HMWA 3DOJA 4G5HA 1BGVA 1KPIA 5LQMA 1JAIA 2PL1A 1B0ZA 4AQYB 4CMGA 3VHLB 1VGQA 4IHJB 4YJ2B 1A4XA 3R5KA 3NC1C 4P7KA 5LP6B 4B3DA 4TLDA 3YASA 2K5UA 1ZH4A 5F73A 4ARBA 1TVKB 3ZZTA 3CV3A 1IMJA 3M6IA 1YVDA 1XLTA 4XKJA 4MW1A 2ZRCA 5A9TA 1AMNA 5CAEA 4GLJA 2QQEA 1R5OA 4PFJA 3WMRA 2F9MA 2P3SA 3GRFA 3EA0A 3QE0A 4FKBA 1T3GA 2HIGA 2NO0A 3ZPXA 1I33A 2ZEJA 4FNAA 3K4HA 3CLKA 4CQJA 4CN9A 4MB6A 3PVZA 5DBFA 2PH7A 1BOOA 1BDIA 2E48A 5K51A 4JZYA 1UC9A 1W0JD 2G7MC 2OQIA 1FRQA 4GGMX 4B8WA 3ME5A 2X3FA 4GZ3A 1I30A 1ETUA 2XJ9A 3PUWA 2IHBA 3M4NA 2CXHA 3F5DA 4BQRA 1E7RA 2ZYIA 2H18A 1SVIA 2MINA 4X24A 3DG9A 3L0BA 3EY4A 1IN7A 2VHWA 5JWOA 1T5IA 2QMYA 4LG1A 2QTVB 3U4CA 4W9MC 2FXIA 2QUBA 2QTTA 1ICIA 3IDFA 2UUAB 3PA6A 5IRCD 2RBKA 1P3Y1 5CVEA 1OC2A 5BOSB 3STVA 4NBSA 2HK7A 5EZYA 1M7BA 3VU9B 4D3DA 1WF3A 3EXFA 5DFAA 2YV2A 5K3FB 1DAIA 1GRRA 4J7UA 4FCWA 4MUAA 2Q9BA 2R6CA 3FDIA 3OCWA 3NP9A 1UFVA 3R24A 4JP2A 4MTLA 4TXJA 1D9ZA 2FQYA 3UH0A 4WDRA 4YBZA 3AVUA 3FHLA 2JFWA 4RZQA 2SKDA 1A69A 3JAWA 5B3KA 3LFHA 1J5EB 1FSFA 2C2HA 3IT2A 3LMKA 1KQFA 1LFAA 1V45E 1KHHA 4QBFA 1SD2A 1TT7A 1M6YA 2CLOB 4Q1AA 1ZQ1A 3GUYA 3HP7A 4RLFA 1CJTC 3M6UA 1PNOA 1TCUA 4GSYA 1A2BA 1CUZA 3RDPA 2OGTA 3IMCA 4N03A 4PCVA 4EEXA 2D74A 1PJ4A 2DHQA 1XEXA 2JVJA 4RDIA 2WIGA 5LA6B 1JHDA 3MUOA 4KO2S 3TNFA 4URVR 3WQSB 2HRQA 1MP0A 5IJZA 4LBZA 1CUCA 1USKA 4P38A 1G20A 1SD5A 4GMXA 1EFPB 3WZMA 3KK0A 2J5KA 3FRJA 2GNAA 1AKUA 4FGKA 2X0IA 4BAUA 4DA7A 5HKBA 5GONB 3H75A 1GPYA 3L92A 3CRVA 2IW3A 4W9RA 1Z0UA 2IEBA 2QRJA 5B58C 2E7ZA 1W0CA 2ILVA 4EOGA 2VSNA 2WINI 1KVTA 1W5TA 1WZNA 4RV4A 4AZSA 1QR6A 2IPNA 2JD0A 4Q4JA 4C29A 4ZZ1A 1JR4A 1MGOA 2O2CA 3CEPB 3FHTA 1RM5A 4NZNA 1FUKA 1W2WB 1T9ZA 1FDSA 3CH4B 3A4TA 3H8VA 3NT2A 2ECKA 3OICA 5ALQA 2OVFA 2VCYA 1KDZA 2ZRJA 4IFIA 3HC7A 4JVNA 4M87A 3NUZA 4W8OA 2FYTA 2W00A 3VYVA 2C0PA 1CFZA 2F43A 4I46A 3SQLA 4B48A 3H11A 3LQ2A 5P21A 2AR9A 1KYQA 4MCHA 4BBAA 1RVDA 5C8DA 3GI1A 1CXZA 2XKAA 1P77A 1RHMA 2ONZA 3NH9A 3MYRA 4HX2A 1XZLA 3VO2A 2YBEA 2VZEA 1T8SA 3TZEA 4H17A 5EJEA 4YHHB 2Z6AA 4KKXB 3N2KB 1VJCA 2GZSA 4LV5B 2IP1A 1VCHA 4MW7A 3PE6A 4EYKA 2BI8A 1EE9A 3NHBA 4DC1A 3P9PA 5LMZA 4DUGA 2X19A 4RTOA 3B9PA 2WJ3A 2HAEA 1BMTA 1CERA 1Y3AA 3DYBA 3W06A 4URXR 5IH7A 5KX5B 1UBKS 2J46A 1VJRA 3CUEF 1C9NA 2QTNA 3LAWA 4DNXA 4TWJA 3WQRA 3EXIB 1AURA 5FOQA 2VP9A 4LHYA 1TC2A 3C98A 3JQBA 7ADHA 3S1AB 5K01A 2ZBUA 2GPNA 1I1QB 2Z6QA 1IQPA 1ZLYA 4CFZA 4MUBA 1PLLA 1Q84A 4RK0A 2HU8A 3AUXA 4ITUA 5C7IO 3I6QA 3S1LA 4HNTA 4MAMA 6LDHA 3B7WA 3GLIA 3C3JA 3RC7A 5JS7A 3I9NA 2C5AA 2W4MA 4I36A 5KWVA 3U5TA 5D3MA 5C81A 2YVAA 5LLDA 4MZDA 1KI9A 3TTSA 3MTDA 1CR4A 5ALOA 3VVMA 2LVBA 1H1TA 4E5SA 4XJXA 4CQLB 4EMUA 4H1WA 1L2TA 3BB3A 3IJPA 4JNCA 1UC8A 3QELA 4MRRA 2PQ0A 2D5LA 1C30A 1U6KA 2WNHA 4TS9A 1HDCA 1K3TA 2XDAA 4BN4A 3CBGA 3BD6A 2E3JA 2M9MA 4BLSA 5IWAB 1JMKC 3ZHUA 4YRTA 5AUPB 3NIGB 4FN5A 4ITRC 4ZCIA 2QRHA 4UVHA 3HH8A 4WVFA 4Z0HO 4RIHA 3S7TA 5I9LA 4YUYA 1TMYA 1XRMA 2I3ZA 3VVCA 4EFMA 3ANYB 1UWKA 3IPRA 3FDXA 4B3GA 3WYGA 1JWAB 1E1NA 2W58A 4BXOB 4FMBB 3UEOA 1RWQA 1IOVA 1OJLA 2H2IA 2SKCA 3VU3A 4K6KA 3T1YB 2HFKA 2KM1A 1T2AA 3IVXA 4A8JB 4DADA 2OHIA 2RIPA 4LQLA 4LJ4A 1Z6ZA 4GEKA 2YCBA 3P7MA 1RWBA 3KQTA 1FTWA 1UPUA 3GNTA 1CNFA 4OO3A 5FDFA 1LLCA 1FZTA 3Q3JB 1R6VA 4F6CA 1X87A 3B7GA 2DYKA 4U02A 1R8XA 5F64A 2ZJBA 4MA0A 5KDOA 5LOVA 3HK2A 4YY3B 1OVGA 1X7WA 2AA3A 4HPWA 2WB2A 5IW8A 3PQ4A 1P1JA 1Z45A 4HH3C 1P2BA 2I91A 1TC1A 5CH8A 3TI7A 1S3IA 5AJVB 2GI4A 3CGWA 4CV1A 2B37A 2X1HA 3D5EA 3KYDB 1J09A 3A3NA 3KAJA 1W8DA 3FYDA 2PR2A 1IM8A 2H9IA 2I87A 1MOPA 1I8TA 2VK4A 1M8PA 2B5WA 2ZPTX 2QW1A 2EDCA 2C3MA 3M6LA 1NBAA 4B35A 2AFIB 3DEHA 2RKWA 3DKIA 1RQ2A 1VI5A 1DL5A 1VZ2A 4D4IA 1XJWA 2O06A 1RPTA 3OFNA 3K6SB 2XA2A 2PMEA 1VTKA 4MQEA 2CV1A 4EQZA 2V7VA 1Q7BA 4OHVA 3T9BA 2H11A 1R4MB 1VPEA 3VR5H 1F17A 4H35A 1TJPB 1UDBA 2IJGX 2DKOA 3GFVA 2V7PA 3RUDA 3DDUA 1DRJA 1PW5A 1SXJC 2GLTA 2X5XA 4R69A 2CHGA 2JI8A 2Q07A 4QQNA 3SKXA 2COUA 3RUPA 2NSHA 2E4AA 2IV2X 1JR3D 3FPSA 1DTWA 4U5XA 5FTJA 4BKUA 4BWVA 3UMSA 4D5EA 1H2XA 4YAGA 1LF5A 1XDZA 2V5AA 4ALJA 3IC5A 4DLUA 3GEGA 1HRKA 2QP4A 4JFRA 3ZVRA 2HL6A 2P2DA 4ZAWA 2IEDA 3U44B 3EDYA 3L84A 2HHJA 3AJ9A 1CR1A 4CT5A 4NNJA 3D3WB 5HEKA 5LQSA 2LTAA 5AJWA 1NXPA 1E58A 4FOLA 4HD8A 5CFZA 1ZN8A 4FILA 1K4KA 3P9SA 1K9VF 3NMUF 2XB4A 4E09A 1KFEB 4NCAA 2Z5VA 2QT0A 2IUUA 1Z33A 4GNKA 3RKRA 3Q5EA 3DDWA 4GBJA 4EPTA 5JPDA 5AICA 4ZFNA 1X6VA 1XDGA 2WU1A 2NQ2C 4KE7A 2RD2A 3H3XA 3QX9A 1MAHA 2IYWA 2YRXA 4PPQA 4HDRB 1C3OA 1Q21A 1TZCA 1X1AA 4V2IA 3FPHA 3VZSA 2QN3A 4FZ3A 3H9JA 4UHHA 3G0BA 1RWOA 1EX7A 4PYMA 1D09A 1U2EA 5CYOA 5T8KA 1NN1A 4A23A 5ADWA 2SKEA 5GVSA 1ILWA 4QPZA 2V6BA 1PVOA 2WWVD 3GMDA 3ZUPA 4DILA 4LHVA 3HBLA 2BFBB 2UXCB 2WWGA 1U8EA 3FCSB 2ZROA 4KIUA 4R1TA 4XR4A 5AOAA 4DBZA 1QHGA 1HFEL 1CDZA 1AKVA 2BSXA 3HP4A 1PG5A 4E5KA 3DE3X 5CLJA 1MOSA 5J9FA 1KMHB 3SJCA 4J16A 3HACA 2HPAA 2NXCA 5HF9A 3AR7A 5EE3A 2VQDA 2FI1A 3WGOA 1DC4A 4UZFA 1YACA 2Z56A 2HK9A 3FOEC 1I3KA 1OI2A 3OPQA 3SR0A 3TLYA 2GRJA 3BWYA 3FZEA 3PFBA 3FDFA 1FDOA 4FC7A 1OA1A 1JJFA 3DCIA 2CCJA 4AAYA 3S4YA 3C43A 3LGSA 5I9IA 4KQCA 5T41A 1L8XA 3PLRA 2QOEA 1ZJZA 5TPZA 2NVUB 2AEMA 4Y9SA 2BY4A 4TYYA 2HGZA 3AIOA 1XZAA 1N2SA 1N6PA 1LBEA 1QQBA 4UAJA 1FNCA 1Z0DA 5C8XA 4Y6SA 1MX1A 3SP1A 1PKEA 4FLFA 4BFTA 1XZQA 2BGTA 3EGOA 1OPRA 3EVGA 5JYBA 2FE4A 1OZFA 3KOMA 5B55A 1NP3A 2EZUA 1YA4A 1ZESA 1J7KA 5KYXB 2EX1A 3CY6A 2V55B 4R83A 2R8RA 3UENA 2WP8J 3OPYA 4AW9A 2F90A 2ZJ0A 3H5NA 3CZ9A 1HE1C 2CWWA 1U7UA 3ESDA 4JVMA 3ETEA 3LUFA 3ZV7A 1NZFA 1ODCA 1RYHA 2JAWA 3FDZB 2IY8A 3CZAA 4XIYA 5E1BA 4UD6A 4DMMA 2BT4A 1X7ZB 4KX3A 5F9HA 3EW9A 3NHUA 4D46A 2AF3C 2WNIA 4K2HA 2HCJB 4IJQA 3NAZA 4FFBB 4RZXA 4WGGA 3GG9A 3UH1A 4DABA 1BH6A 3NTQA 4L0DA 2B8NA 2JAOA 4G9EA 1MFPA 4IIFA 2QS9A 5LFAA 4YAOA 5CX1A 1Q15A 2ZIEA 1IZ8A 1BQ4A 2Z3VA 5HMMA 2BDEA 4MS1A 1HSOA 4X20B 2J9RA 3TUZC 1CZLA 1YCDA 1XAJA 5TE9A 4HXEB 2A1UA 4NYIQ 5ALZA 3S5JA 2QM8A 3CKMA 5CPFA 3OETA 4B82A 2QKYA 4HN4B 1KZGB 5HP4A 2CL7X 2R4UA 3V4OA 2ZB7A 1ZUIA 4X5OA 1TUIA 2RHMA 1E3WB 2IBSA 9MHTA 1JHYA 2VBIA 2XV1A 4N54A 1DDIA 3F4BA 4I6EA 1QCCA 1IZZA 2HSDA 3ZN2A 3GMIA 4R81A 4DLXA 1CTQA 5JXHA 2IS1A 4LJ7A 4GOXA 3E35A 3DL0A 4RADA 5JAIA 3ZLTA 5KNBA 1EGVB 1TQ2A 3GYBA 4JZKA 2ZRBA 4O33A 4QGBA 1YWGO 4XFDA 3I9LA 2EVWX 1RKQA 1QFSA 1Y8QB 3S2UA 2I6TA 3EXHA 1N2CB 3Q5GA 2JI7A 3OT5A 1QVRA 3WS7A 5J23A 3O0TA 3V4SA 1WCXA 4OU4A 4US2R 2HGSA 1NZDA 1GCGA 3CU5A 1ZX1A 2OYSA 5CYPA 5E7JA 1DTSA 3OIGA 2LKCA 3LDUA 4Z4QA 3VNAA 5K9ZA 2XUQA 4ZCLA 3LGAA 1KC1A 1XZPA 4MUGA 4ZWNA 5BVHA 2C0CA 5I8PA 1CS0B 1EPUA 2B8TA 3ANTA 6REQA 3ZW9A 2G76A 1QAOA 1FXUA 1GEGA 1RJEA 2PA0A 4LZAA 4L5CA 2FDRA 4OHOA 4YH1A 1YJAA 1C1XB 2P4UA 3I45A 3EFOB 3NBAA 4YI5A 4UFPA 1K0FA 1QNFA 1XDSA 2ILTA 1TO2E 1NI5A 2F6RA 4P4SA 2GO1A 2H92A 4WXPA 5IDXA 4CCWA 3HDVA 3QW2A 3RT1A 5I6DA 3R7BA 2D7DA 1YNSA 2WFAA 5CITA 2G40A 1DAMA 4KI7A 4N3NA 4J9UE 2Y9MB 2Z4TA 4JLBA 4GH5A 3W8RA 2WYWA 4QZVA 4ZQHA 3BH0A 3L05A 3UOWA 5F33A 1YR8A 821PA 3SG0A 1Z0AA 2Q29A 3BMQB 3I9MA 2PU7A 3ISTA 4U8GA 5BNIA 4UVGA 1ONNA 1SA0B 5F21A 2HX1A 2CXSA 5EN4A 3VAYA 5MDHA 5C5CA 1QGZA 1NONA 1S3GA 1D9XA 1TF2A 5CYGA 3TXAA 3SHWA 5LQNA 3LPMA 2OR3A 5ALFA 1JIJA 2K87A 1KFJB 2I8LA 5LXTF 3SMQA 3NONA 1RJDA 2BR5A 2XNHA 4EM6A 1BWQA 2G70A 2GA9A 1YB4A 1I6WA 2VDOB 4CV3A 4KQEA 5FHQA 2UUOA 2BONA 4AFNA 4R0MA 1UKAA 5CVTA 1F38A 5AP9A 1XV5A 1THTA 2ZATA 1QRTA 5AHXA 1JLLB 4OQEA 5B7PA 3FDJA 3RFXA 4FSDA 3G8CA 3A2NA 3L0IB 4TSKA 3TO5A 2AN3A 1GZ7A 3SSNA 3M33A 2GJ4A 3EGDA 4ND5A 1QIMA 3DLPX 2Z2JA 2VJAA 1E3SA 1UXOA 1NF8A 1XEWX 4MDHA 2H9YA 1U7ZA 2OB2A 3FVRA 3IS3A 5I9BA 5CA0A 2PUCA 1GOTA 3RAJA 2QN2A 1EI9A 3QWFA 5CM9C 2GRUA 3LA6A 1HQCA 5AJZA 2H0AA 5JC8A 5FOUA 1LC0A 4Q0MA 1J9GA 2H2GA 3D7RA 3HXKA 3O75A 3Q3HA 2QRNA 3OE5A 1GQFA 4FI3F 4PINA 4C0KA 1X7YA 4II7A 5A4IS 1S9DA 4RHYA 3OQMA 4ARIA 4TT3A 5F1PA 3PHGA 3EVZA 1B73A 3UK2A 3F7NA 1HLPA 4RDCA 4RM3A 1HPLA 1I4DD 1NN0A 1U04A 2I4RA 3C45A 3EUEA 3O9VA 4PZ0A 4UULA 4BO5A 4C06A 4ZHSA 1II9A 3TLKA 2AJLI 1Q6YA 2IHVA 1SCQA 1ZNYA 2A9KA 5DHFA 2J9FA 3W9BA 1U6JA 2IA5A 4K6MA 2MSNA 4XIJA 1QRDA 4G8DA 2RHRA 4CE6A 4E3ZA 3HO8A 1Z63A 4P32A 2PWYA 3GQBB 2HM7A 3NIWA 2HBZA 2XDYA 4HEA1 3WGLA 3EFEA 5A03A 1KOGA 4KGZA 5HKAA 1KE1A 2OXEA 5KSZA 2WD7A 1XALA 2YHUA 3FYUA 1BCRA 3S40A 1CBUA 3M6AA 1EU1A 4AJ4A 1YDWA 1EYZA 4MKGA 1SKMA 4YDQA 5HCNA 1KEUA 2C5LA 1XQVA 2PIDA 4NICA 4XWYA 1MDFA 4DV0B 2BHSA 2C4UA 1B6SA 1C4OA 2IZ1A 4WPGA 1EWQA 3EXG2 4QHSA 1SQ0A 3D4PA 2BGKA 3GNQA 4E4RA 4QA9A 1LVUA 2GX6A 1ZUNB 4YN3A 1M0TA 4D6XA 1GITA 3ZXSA 1NI4B 3I6BA 3AKZA 1C5KA 1B6GA 1A4UA 1VDMA 4D0NA 2HO5A 1Q0PA 1I3CA 1RSZA 4MITA 1CQZA 1HXHA 1SWWA 4AL4A 4I4TB 1XXLA 1ZG3A 4EPRA 4PPFA 5JO0A 2WTNA 3AL0C 5BXYA 4RELA 4B4OA 5C8YF 2HEIA 3GLHB 5GV7A 5BRNA 2CJWB 3T7DA 2WWFA 5D84A 4AZ3B 4EHBA 3HY4A 1QR2A 2CHVA 5TDHA 5K4GA 4P3PA 2ZTHA 2CXOA 3R3XA 3SYKA 2XGJA 3DAYA 4IR7A 2JLCA 2WJ6A 3R8CA 4TKMA 4RH0A 3JQFA 1XD2B 2W98A 2ZI3A 3EVAA 4WASA 3NBXX 1FU7A 3E3AA 4IMPA 3WLAA 6Q21A 3DMGA 5G41A 3ZOKA 2P5UA 2BTQB 2ZG6A 4OSPA 1NVVR 2D54A 1CIVA 1J0DA 3MS4A 1UBJS 4HNQA 3ZD9A 1EZ1A 5ARCA 1L8OA 4MV0A 1OI7A 2ZI4A 1TIPA 3IE2A 2C5FA 1KAQA 5F7JA 3K16A 3BJZA 3BRSA 1CW2B 1YBFA 4WBNB 3TOXA 4LJAA 1HOTA 1T2NA 4A27A 2WM8A 1FDVA 2YUIA 5AI6A 5L3SA 4L1KA 2WJYA 1MVNA 3L7BA 2CFRA 4U7HA 4ZO6A 5K7SA 2WG0A 2FQ1A 3NWPA 4UEOA 1WZEA 1WSBA 2ZJ6A 3F6BX 3HEBA 4OLFA 1TD1A 4A0RA 5L6LB 2CDBA 3DZ8A 4CMEA 4BV8A 3NHRA 1KAHA 1U0LA 2HPHA 2V96A 2V6IA 3QU9A 1KI7A 3TTXA 7MHTA 3N7AA 4DQUA 3D1VA 2AHRA 3FMGA 1PJ3A 1QHEA 1WU8A 3SXUA 3INRA 1YMQA 3UMCA 1EINA 3RRFA 3K15A 1SUFA 3FTPA 3R09A 1X3SA 1ODJA 4JUIA 1MX3A 2VSOA 4MR7A 4C04A 3CO0S 5KOYA 3KR1A 5CLLA 2ERXA 3I5UA 2J0UA 4Q02A 4QD3A 2DWUA 4WFKA 3ZV4A 5GM1A 1W96A 4DSOA 4EI7A 1TCBA 1Q0SA 1YQEA 1TAGA 3P0IA 5AKIA 4UM8B 3TQIA 5BP7A 2OB1A 5ALPA 1YFLA 1EFHA 3FSEA 4M4SA 3VR4A 4XX0B 1UK7A 1JDJA 1ORTA 2JFPA 4MV8A 1IJKA 4NJEB 4CEIA 2OCYC 1WCIB 4ZYXA 3HO6A 1TJ5A 4JLOA 2ZSIA 3I30X 4G97A 2O3SA 1B23P 3NDRA 3ND8A 1N6KA 1XP5A 1RABA 3X1DA 4FFMA 1ADJA 4QOJA 6ADHA 2OHHA 3P9NA 4A0SA 1K7FB 3BMXA 1D2RA 1UZNA 2FXVA 3E4DA 4WADA 1ZIYA 4P4UA 3AONB 1F3LA 5CM2Z 4CEHB 2G77B 4BQEA 1JFFA 3PPWA 3FOAA 1GZ5A 2RGGA 3GOHA 2XWPA 1J8QA 4RACA 4RZHA 4B6EA 4HMOA 2Y0PA 4OUKX 1S2GA 1YVRA 2Y2UA 4PSKA 4TZKA 1FTNA 4JSTA 1AC5A 4TN5A 5ENDA 4G0VA 3KZNA 3WYDA 1E18A 4AJHA 3NGMA 4QQ8A 3KT3A 4F3RA 2AFHE 3KTDA 1B2RA 2XRYA 4IJ5A 4KACA 5C34B 4YRAA 4O08A 4TV8B 3LU1A 4E21A 4FMDB 3IVGA 5E38A 3NPMA 3SZGA 1D5CA 1AO0A 3K70C 2NQ8A 3OU7A 2GN1A 1A98A 1PQYA 1Z7YA 2BGRA 1NX9A 1IAQA 2EGUA 4K1XA 4O4JF 4MPTA 1XWFA 4U63A 4F3YA 4TX1A 3L1HA 1U0HC 3Q98A 3QF4B 4MJ7A 4BRZA 2EWVA 2FK7A 5BQ3A 5LNK6 2ZUFA 2VQEB 1H65A 1BRTA 2LIPA 4DCTA 5JIBA 3L8ZA 3IUNA 3GRRA 5AXAA 1I32A 1U98A 3ESYA 4L9AA 3SJZA 2VQ3A 3WO1A 5KWEA 5J1SB 4FS3A 3TF5A 4JAVC 3EW7A 5CFRA 1UIMA 3GD7A 2DX7A 2CNWD 1H2AS 3C6BA 4Q7QA 5HKKA 2FFJA 3P19A 1PT8A 3K4PA 5AI8A 3KLNA 2JW5A 3DDZX 5KYKA 5C53B 4M7OA 2EF0A 4DSTA 4G8JA 1EK2A 4RHUA 3NWEA 5AO9A 4AJ2A 2WAXA 2ROQA 3SJ7A 3MJDA 3RKUA 3REOA 5BURA 1OH8A 3M1YA 4KQXA 3USES 1ZVJA 4HQ6A 1JQDA 1VMAA 3CSDA 3IHKA 1WBDA 3HRIA 2PFGA 3DEFA 3RVBA 3RWOA 3TSYA 3VZRA 3C3EA 3NTVA 4R5MA 1NNI1 3ZW7A 3VX4A 2ODNA 1KEWA 2W6ID 3W5HA 3DYIA 1QX4A 4H4EA 5EMJA 1I14A 2H2HA 5KHAA 2XNJA 1BGXT 4K6FA 5BSGA 1GAXA 3BK1A 3QNWA 5FADA 1IMOA 4MQUA 3RBAA 2B82A 2N3ZA 3IDSA 4RVFA 3R20A 5EYPB 3D4IA 1H9AA 3JQBC 5ADHA 2OM2A 4B33A 4Q3CA 2EZTA 2PBZA 2RMKA 3AM4A 1RI4A 1B8OA 2HJSA 3IRVA 4NHEA 4NPHA 4DLZA 2JJQA 3PGA1 1X8LA 2J6IA 2JASA 1TYCA 4G1UC 4XCXA 3ZG6A 4Z4CA 5IK2D 3HJFA 1MD9A 2JC3A 4JXKA 1UOQA 2EP8A 2GWRA 4KO4S 1IWOA 4YCLA 3K2EA 4R2JA 2ZBFA 3KE8A 4DE5A 5KYNA 2AYYA 4UXJA 4Y6QA 1DCFA 1M8GA 2JRLA 2R9VA 3GEDA 5CRIA 4LYAA 4DZTA 3OM9A 2EFDB 4G25A 5B1IA 4E03A 1XMQB 1QH1A 5G4LA 5DI9A 2C5HA 3FBTA 2LKDA 3FPJA 5J2UA 4O29A 3C1UA 3NTXA 5HJ2A 2HSWA 4MUYA 5AOVA 4AS3A 3OA0A 4RD4A 5I7RA 3KQYA 3BQMB 5EI5A 3R6TA 4GO1A 4M7PA 4F6RA 4OP3A 4L2IB 3LK6A 1B76A 1K89A 1PNQA 1PTKA 2QX4A 3OT1A 4IQFA 4IXMA 3REFA 1SIWA 3IRUA 4B6GA 4EG8A 4M83A 2E37A 3KQLA 1FU8A 1HMYA 2IK8A 3OAAD 2Y9PB 3KAKA 1WY5A 3VMMA 5DPMA 3D8UA 2IIPA 4PW0A 1JJBA 4ESHA 1U80A 2HXSA 3WLNA 2YMPA 5B12A 2BLLA 5B6PA 5A4DA 3GN2A 2VNAA 2HF9A 3K0FA 1OIWA 3LK7A 5FBZA 1XVUA 5C8VA 1KYVA 5FJIA 3ANXA 1YI0A 2AWNA 2BYTA 2EWMA 4RCVA 5DT9A 4MI9A 5F1KA 5HF8A 1BEZA 4G85A 4HXYA 1R8SA 4EVIA 3H8JA 1H8HD 3THSA 1QUFA 3C0KA 3CB2A 5EZYB 2OV4A 4BNTA 1PZHA 1EUCA 5IANA 3X1XA 3ASUA 1W19A 1J0BA 1U3VA 1JKXA 2FZLA 5BRJA 2RHOA 2YDYA 1UL1X 4H27A 3SR4A 3I9V1 4DA9A 5TARA 1ZJJA 1I6LA 2AC2A 2FAXA 2JIMA 5MN5A 1NP6A 1JU9A 2OK7A 3H7IA 2AT1A 3K0EA 3HHEA 3LHFA 4GPBA 4MQ6A 4O2LA 2APJA 4BN5A 5KSPA 4EUKA 5JW6A 1PZEA 3MRTA 4RD2A 1KFKB 5CVDA 2ZBEA 4K28A 4ZXPA 4YLEA 4D6PA 3O8RA 1WF6A 3T0GA 4EG4A 4LKOA 2H3EA 2EP5A 3ZJTA 1VL0A 3AFIA 4I1IA 1KJJA 5A71A 4MUJA 2WTUA 1YBVA 3M6XA 3RH0A 5C52B 4IX9A 3CEMA 2J6BA 3FZYA 1DWUA 1GZSA 4AM8A 4HGZA 1V8DA 2GCOA 1Z5WA 3ZH2A 2WLTA 3S99A 5MFZA 1RRCA 1X9HA 3CUWA 5FWNA 3U40A 4OB6A 3AUJB 1XMSA 3QYFA 3CCBA 1KS2A 1YZTA 5BNFA 1JHMA 1GNPA 3H5OA 1T6BY 1UT8A 1WUIS 5AW0A 3CRMA 4C0XA 3M1IA 3C6ZA 4TTJA 3UAGA 3TQOA 1UBRS 1Y89A 3CFYA 2J09A 3OJWA 3K8QA 4JKOA 1HFJA 1ZWKA 3KALA 4UCQA 2R6R1 2BGNA 1LEHA 2WIKA 1PAUA 2O4CA 3JZIA 5FBRB 3VSEA 4CV0A 1HDOA 3K05A 5DF1A 3KXDA 4ZHQB 4BO7A 2OAGA 4P5PA 1GRCA 4I8XA 1RE1A 4BVGA 3ONDA 2OHOA 3G2QA 4RS4A 3E8SA 4RZ2A 1XDBA 4KXUA 3TVTA 5A5EA 4XRGA 1V4BA 1H1DA 2O3JA 3BB1A 3WP0A 1OLUA 2NXEA 4ABYA 5B2EA 2H2DA 3UICA 4KR7A 3A6DA 4V1CB 3JU3A 3TGPA 1XKQA 4RKEA 1CJSA 2XKJE 4ZTUB 2D2XA 1ZITA 3TGLA 1VB5A 2HMTA 4FDUA 2W2VA 4TGLA 3NAGA 1GPAA 3BICA 3WMFA 3HCPA 3AYZB 5CXXA 4CLRB 5DU2A 1DLJA 5H0IA 2A1IA 4MS3A 1A2KC 4HX5A 1R88A 1YFZA 4LMPA 5EJ6A 1H8ED 1KWKA 2IU3A 5DI3A 3F8TA 3VXKA 2BVNA 1QGAA 2QN7A 3I9OA 4M1KA 1ISRA 1SHTX 2FPGA 2VNSA 4KE9A 4K9OA 3PHIA 5HS6A 4AJ9A 4EYOA 5C37A 2VTBB 2OFPA 3VRHA 1HX7A 1QOQB 1LS1A 1N6LA 2G1AA 3IEIA 2AOXA 3C7TA 1TM4E 1D2NA 1NA5A 1E94E 2BKVA 2EBFX 3U9TA 4BHTA 2JFQA 4DQDA 4C20A 2DECA 1A9PA 3GVCA 2V0GA 3IUBA 3LBHA 2O2ZA 3ZDAA 4BBZA 1QV7A 2P91A 4DLLA 3Q2KA 5C0OE 3SHVA 5AJHA 3KJXA 4UBIA 5CFOA 1N0WA 1VHWA 1YRAA 1ZI8A 3FMIA 4DCJA 3O84A 2C3OA 1BQEA 3EVTA 3G2OA 3T7EA 2OC9A 4AJJA 3BHJA 1C7EA 1L5KA 4NKRA 2Z30A 1ZVMA 5ITVA 3C3XA 1EVKA 1GADO 1D2EA 4BFWA 1KMMA 1YKGA 2BFFB 1X86B 2WPDA 1ABEA 1H5NA 3P9RA 5KYWA 2XMCA 3BT7A 1L4GA 3HUUA 3OQVA 2GETA 2Q7OE 4ZQBA 2ZBRA 4PSDA 4ER6A 1U02A 2WWXA 1VYUA 3EPRA 3ILVA 2H7VA 4A3SA 3TZ6A 3GJQA 4K05A 3MT9A 4P3KA 4A9AA 1BX3A 2PRSA 2QIPA 4WGFA 3THWB 1HT2E 1ZM2A 2VWQA 5IN4A 3E3MA 4FBMA 4KLZA 1OIXA 3G2HA 1CIJA 1TLLA 2OZLA 5JMTA 2VTVA 4CU5A 3REQB 1I51A 1DBQA 1UBOS 2CDRA 2XUDA 2YNMD 1LCIA 1NVDA 1QYRA 1X1BA 3MD0A 2ODEA 4D92A 5K4AA 3RSOA 1MBZA 3HNOA 1E8DA 3KCQA 2IOQA 3MJVA 4AJOA 4EHDA 2GCIA 4DMRA 1N7JA 2R1VA 3LC1O 5A5GA 1VSUA 4U2EA 3G85A 2P1RA 4JN6B 3VJLA 5K0LA 5HKOA 3A9VA 4F4JA 3VZDA 3KYCB 1ILEA 3Q8KA 3C7DB 2BP7A 3A2MA 2AOWA 3S8EA 3OPVA 1WUTA 1C4XA 3LWBA 4N7JA 5JBIA 3U7GA 2BRUA 2VK1A 3KAPA 4UTVA 4O1IA 3IJRA 4QYIB 3F6CA 2RCYA 4TYPA 1FF9A 2WW8A 4BWYA 2W37A 2YXBA 3X1JA 3R2JA 3IL2A 1GZHB 2GSWA 2EZ8A 4F72A 5KOJB 1A7JA 1Q7EA 2I29A 5EE5B 2BWJA 2X6RA 5DNYB 2PX2A 5SY4A 4D9BA 1OFGA 4DZRA 4ISBA 1SFRA 4H6XA 2AX3A 1KGDA 4JDPA 4JYCA 4KV7A 5DO9A 3T3HA 1XPOA 2VP0A 3QVJA 4LNHA 5D3ZA 2MMGA 2V7EA 3K71B 4A5SA 3E53A 2XYRA 3SQDA 3QKRB 3ZY5A 4CL3A 1YQ9A 3GH1A 4Q4CA 2ZTLA 1GJRA 4NDZA 3HXQA 1U8UA 1UFQA 3QKSA 3HCEA 2DSTA 5ALNA 5T6BA 4HAVA 1QFYA 2WILA 3ORQA 4L50A 1APBA 1XROA 5JR3A 4X41A 4C4AA 1C1HA 1GGVA 1MG0A 3DQZA 5J5VA 4WXEA 2BCGY 1VE7A 4YRGA 1WVGA 4O4IB 1QU3A 2PZAA 1Y6RA 5TGTA 5F12A 1F3OA 4KIGA 3IP6A 1PJ8A 3K1AB 1Z18A 4Y30A 3V6MA 3JTEA 4ND6A 5JT1A 2F8SA 3U4QB 3B2QA 3DKPA 3F7TA 3K5IA 2UVPB 2EJWA 5ALXA 2IVZA 1CIPA 4KW7A 3ZIDA 1FNNA 1JHVA 1OFUX 1P4JA 3C3AA 1X1CA 4TRMA 2DUMA 2EU8A 1QE5A 2R6FA 1AXRA 3MB8A 1GQYA 1P0CA 1KJIA 4R7GA 5AXDA 3WMXA 4DDTA 1J8FA 1DQYA 1LSJA 1QLWA 4AJPA 4F84A 5CB4F 4OX9B 3TLEA 4M2LA 4BMDA 4CMCA 5JBNA 2G4VA 3ECAA 3LUDA 4CL2A 3I8OA 3H2BA 4FGWA 1VG9B 4TSRA 3UO8B 3GDHA 2E85A 4RY0A 3QW4B 4QARA 4X71A 3AILA 3UJ3X 4M38A 3X1KA 1W0KA 1DC3A 4H1UA 1CZNA 1HLGA 3HWWA 4B84A 3NANA 4EG6A 4PGAA 5BNTA 1PJZA 1TM5E 2OAP1 3ZHZA 3SQXA 4GGOA 4AZ0B 3LXRA 4D6YA 3HCAA 4RDHA 3ID6C 3OM0A 4WZBB 1YGYA 1KR2A 5ULLA 1FTGA 1JIIA 1VLHA 2Q9UA 1YR6A 1YQDA 2J3HA 2Y2VA 4NV0A 4Y2JA 2JLRA 3B12A 5C35A 3ZWYA 1AK2A 4KXVA 2WV9A 4KFRA 2CD9A 3A10A 3DDOA 3FCUB 3NBUA 4RYLA 4TQAA 4EEZA 3I2IA 3ICQB 4WEOA 1FMTA 1IUKA 4YREA 1GPNA 1MDBA 2VPZA 4OQMA 1XL1A 2O8EB 3HCWA 4HAIA 4WESA 2MSCB 3OY2A 4YCJA 2XZLA 1AV7A 2GBFA 3DT9A 5KU7A 1CQIA 3A58B 1H66A 5K3BA 3P2MA 3GP8A 3CVOA 3S68A 4BIMA 1RKVA 5BSMA 1OLSB 3BULA 3C3MA 5EHQA 3JWPA 2UZ1B 3M4JA 1QU2A 4I14A 4RLSA 4U2KA 1G98A 2NUAB 3AHEA 1BYUA 2AL7A 2CLCX 4RMGA 5IJ9A 4A1OA 3AHIA 4C7XA 4UDOA 4YT8A 4LOLA 1DT3A 1DTEA 4BJ3A 2AZXA 3EXG1 5ALJA 1UJCA 1R6AA 1PJRA 4F2HA 2H1IA 3UMBA 1KYXA 2CFOA 2UVQA 2XCLA 3CX8A 3DO8A 1C0EA 1Q12A 4GM4A 2IYZA 1QWSA 4KB5A 4L0MA 4GPZA 5DM70 5A1JA 4HCJA 2QW8A 4M9ZA 2DSNA 4DV7B 3I0NA 1OZHA 4BFSA 1U9YA 1I1OA 2AXPA 3A6HA 3HI4A 4MVJH 4B3BA 4EFLA 4ZGBA 1FPQA 1RIIA 3RVPA 2CB9A 3A0RB 3NLLA 5H3LA 3TB6A 4D98A 2CD7A 1EQ2A 4AYXA 4QOHA 3ASZA 3L6EA 2WHEA 1BXZA 4KGDA 2NYVA 2VHVA 3L5OA 1DO8A 5FR1A 3UOGA 5BRAA 2GWHA 4IH4A 4MB0A 3ETJA 2I3GA 1JYFA 5IYZF 1UBGA 3FYUC 4MRMA 3IQHX 4XB2A 5BPHA 4YRIA 2Z08A 4QPJC 5ED4A 1GVNB 2XE6A 3RBVA 2EJTA 3OOYA 5JROA 2QN9A 4C87A 5HILA 4DG5A 5BNWA 4MKXA 4W1RA 3SICE 4K0RA 3ND7A 4ERXA 1R6UA 3Q41A 4KZPA 4MJLA 1YHNA 3IP9A 4RETA 3G0HA 1WV0A 5DBIA 3HVRA 1QPZA 3E22B 1CYDA 1OCEA 3AERB 2XQGA 4RD1A 2ZSAA 4MB2A 5EZQA 1DBPA 2ZU0C 3DOHA 3JQGA 3NHFA 4YDSA 3BDVA 3GGPA 1NXTA 4QT0A 5AM4A 3OJCA 1IE3A 1TM7E 3OIYA 3QNMA 4OHMA 4YPFA 3X0DA 2BZ1A 4MYSA 3DAFA 1XTVA 1OXTA 4RIEA 2HQ1A 3VR0A 3GLRA 5CLQA 1DIHA 4A82A 1KA9H 4C43A 1J00A 3KOZA 1CUFA 1Z0KA 2P2CA 1JKJA 4CNBA 5G4KB 3HV2A 5JOQA 1L5HA 1J23A 1O6BA 1S2MA 1VIAA 1ORDA 1SUDA 3R7NA 1XZNA 3EG9A 3JQFC 5DCWA 1K6MA 1V3UA 2AB0A 3UHFA 3H1BA 3N7UA 4L7VA 1W94A 1JBKA 3JW8A 5J5AA 3VDMA 4O4HB 3S44A 5K8IA 1M8JA 1GG8A 2QW0X 1OH7A 5DZSA 1GTG1 2H5EA 5ED0A 2FNAA 3BBLA 2P78A 4LN1A 4KUHA 4HQLA 2DM6A 5IBRA 1R0ZA 5A2GA 1M5TA 5JECA 1L4KA 2R1ZA 1EFCA 3ORYA 4H0CA 4PAWA 4WZ6A 4U4AA 3H8SA 1YASA 4CW7A 5EXPA 3O2SB 4D56A 3L8FA 5ALYA 4LJ6A 1F2UA 2V4MA 3FGPA 4WCFB 3D4LA 1QDLB 1PYGA 1IN1A 4AN4A 3ZGZA 1ZISA 3A05A 3CLRD 4XGKA 3IT3A 3OZRA 3PUYA 3T15A 4DR5B 2MMCA 4ASUA 1V16B 3KO8A 2P90A 4OHWA 1BE1A 1USGA 3K0AA 4AJNA 2ZWVA 1Z2AA 5GP1A 2O0LA 3EA5A 4MS4A 4K86A 1G5FA 3R4VA 2C20A 3WGZA 4R2WA 2QTGA 3TOVA 3TOZA 1UOPA 1QIIA 2FR1A 5A4MS 3L49A 2PRZA 5FOSA 4EQ6B 3AF5A 3SE7A 3BMCA 2C9ZA 1RC8A 3A1TA 4IDFA 3N07A 4P36A 5U4QA 3M5DA 2EQBA 2XMRA 1RLJA 1KWGA 5FUXA 4AS1A 2CFTA 1PJQA 2P2SA 1VGRA 1AB5A 1V95A 5FWAA 5T3UA 3SHQA 4P4NA 4EJ0A 3LTNC 3N86A 1FYEA 1AK9A 1FX0B 1KNQA 3WJAA 1D2MA 3VKHA 1RMYA 3H2KA 1NDHA 2G0AA 1JA9A 2R00C 3WYFA 3F1KA 3O2QB 2X8BA 4M36A 5B1DA 2BTEA 3LT5A 4PG5A 4C76A 2ECQA 5EE0A 3V1UA 1FLVA 3FUWA 4RA9A 4URHA 4ZAZA 3QXSA 1TPZA 1BE6A 2I2FA 1YBHA 1TX4B 2R6GA 2XE8A 1TVEA 1P5HA 1Z38A 3O8DA 2D00A 3MTGA 3TRHA 1RFGE 4JYZA 4I1YA 3FOBA 2VPYA 4ZAVA 3MWJA 4K40A 3C3BA 4LKRA 3H3FA 3P9CA 1NQTA 1QNLA 3INYA 1NBMA 2G17A 3NWOA 4NDNE 5FV7A 2BFCA 1NVEA 3B1JA 1QONA 1KHTA 2OV8A 2Z2YA 1PGNA 3A1NA 3I9KA 3CUKA 3PFGA 1PD0A 2ZDQA 1YMVA 2E18A 1N8NA 4QLAA 5EJ2A 5IC6A 2VHEA 3BA1A 3DMHA 3DXFA 3RS3A 2IOHA 3SYLA 1WY7A 3T9DA 3LNTA 3PQFA 3W5CA 2YMQA 1XTPA 3AVPA 3HU1A 2OOKA 3NNNA 4JB8A 5JYDA 1WW8A 5JU6A 3OX3A 4HWKA 2FWMX 1ODTC 2JFGA 1LJLA 2F2TA 4P81A 1SKUA 3AETB 4LDQA 4MMXB 4X93A 1JZSA 1XXHB 4L6AA 3IP3A 3RHZA 2GMWA 3DEYX 3EMKA 3WIOA 3P0JA 2Y0CA 3BE5A 1YDHA 2P9HA 2QTMA 4W9NC 3U3JA 4ENPA 1G63A 4MWEA 2CV0A 4EKNB 5JO9A 1DNPA 2R2GA 2ZIUB 3SMVA 4M1OA 4FXOA 4UXIA 2EXXA 3IBCA 2WFLA 1TLTA 2R44A 4YMIA 1KJNA 5D2CA 5EMHA 3GBVA 1HK7A 4EECA 5I51A 4G36A 3HB5X 3W0LB 2GXUA 5JATA 1RYDA 1BN7A 1TXGA 2P40A 3BSWA 4KLCA 4MQFA 2HDOA 5ICFA 4HQ0A 4BJ6A 2PVPA 3OQ6A 3A0UA 3ROZA 5FYDA 4FPXA 3FB1A 4ZJPA 4DSZA 1RRKA 5M3BA 3G7SA 3QLEA 5K09A 3NQ41 2IX3A 3ILXA 1G0NA 3WRXA 1QP4A 1YKFA 1AVTA 3AV3A 3QOYA 3VNVA 1FTQA 1KXJA 3W9UA 1FBNA 2VPPA 4FR2A 1O95C 2GSDA 2VNJA 3R3SA 4YX9A 4PGFA 2C9OA 2E4ZA 2JJMA 2LDBA 4TPKA 1O6GA 3G5TA 2HBRA 1I7DA 1JTEA 2JCSA 5LMCA 3K6JA 3C8HA 1Q0HA 1BG6A 3HJUA 2CYBA 3VPCA 2YY7A 5KQLA 3U7QB 1K8XB 4NBTA 3D2CA 1Q5PA 3NIBA 1R5BA 3WNQA 4U9HS 1YR1A 3C7KA 4BZXA 1F0YA 4B17A 1DAFA 5DJ5A 1PJBA 5L40A 3WISA 3DFKA 2B7BA 3MBOA 3HLTA 1HSZA 1GTJ1 3UYKA 3MOIA 3K9HA 2A92A 2JCYA 3NZEA 5CAEB 1YDMA 3V4RA 1JT9A 2OQVA 3FKSD 4LYGA 1UEJA 1SVMA 3C6MA 5LBTA 4DJDC 4DQXA 1HO3A 4A03A 2YY5A 1PR3A 2X9NA 3C5WP 4QHTA 1S5PA 3C1OA 4NQZA 1MB9A 4AY5A 1SCBA 2O50A 4HTAA 4ZZ2A 3K0CC 4AMUA 1N3IA 2DQZA 2RAPA 2RGXA 4INOA 3V1MA 4NQRA 1A2OA 4UCFA 4G0QA 3DTVA 2OWEA 2JFVA 1LPOA 1I2AA 3ND6A 3F74A 5JCJD 4Y1FA 3TCKA 2WVHA 2BJVA 3V1NA 1AS0A 2MINB 1E5QA 3GJ7A 2BBOA 1ODKA 3P9YA 3QFFA 4GG1A 4BNLA 1SCNE 1V9LA 3TVDA 3OMLA 1Z0FA 3GLQA 3K5WA