1WEHA

Crystal structure of the conserved hypothetical protein tt1887 from thermus thermophilus hb8
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
b'MRLLAVFVSSRLSPEDPLYARWVRYGEVLAEEGFGLACGGYQGGMEALARGVKAKGGLVVGVTAPAFFPERRGPNPFVDLELPAATLPQRIGRLLDLGAGYLALPGGVGTLAELVLAWNLLYLRRGVGRPLAVDPYWLGLLKAHGEIAPEDVGLLRVVADEEDLRRFLRSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved hypothetical protein TT1887
publication title Crystal structures of possible lysine decarboxylases from Thermus thermophilus HB8
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 59
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18306 LDcluster4 SLOG cluster4 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1wehA00
3O8NA 3U39A 3HNOA 4KXNA 1KZHA 4NPAA 4P5EA 2F64A 4I4IA 1S2IA 2IZ6A 2KHZA 2IZ7A 1RCUA 5ITSA 6PFKA 3OPYA 2IZ5A 1WEHA 2F2TA 1T35A 3SBXA 3O8OA 4FYIA 4OHBA 1MTOA 1F8XA 4PFKA 2HIGA 4U1RA 4LJKA 3QUAA 2KLHA 1WEKA 2A0KA 4RH3A 1S3FA 2Q4DA 4JEMA 2PFKA 4JENA 3BQ9A 4WL0A 2F48A 3F5MA 2F67A 1PFKA 4A3SA 1YDHA 3K2QA 4FYKA 3GH1A 1S2DA 2PMBA 4FYHA 4P5DA 1S2LA 3MAJA 3PFKA 1S2GA 2NX2A 3OPYB 1F8YA 4MEJA 4KXLA 1ZXXA 4KXMA 2A33A 3O8OB 4I7EA 5AJTA 3O8LA 4HX9A 4JELA 2Q4OA 3UQZA 3EHDA 4OHRA 5AJUA 4I36A 3IMKA 4LJLA 4LJRA 4MCJA 2F62A
chains in the Genus database with same CATH superfamily
1CQPA 2HMUA 1HT1E 1PJZA 5KZMB 2AKAB 1SVUA 3LHFA 1EHIA 5B58T 2A6PA 3M83A 3EZ2A 4IDGA 4MLDA 4R81A 4IZHA 3A3OA 3PDJA 3TNFA 1WUHS 1A1VA 1XN4A 3OH8A 1P1RA 3S5UA 4AJEA 2X23A 1LLFA 4HN4B 3QPDA 4MV4A 3KCNA 4QJ5A 5CW2A 4EQZA 2C4VA 3WTCA 1HE5A 2V1XA 3Q40A 5EJ2A 5A9TA 1U1EA 4X6LA 3QLJA 1A1SA 1RPTA 5CT5A 4O2AA 4H77A 1BMQA 3F74A 4PZAA 3G7NA 3DLAA 4MIOA 3GLRA 1EGVB 3VBCA 4NONA 1I1NA 5F35A 1BXRB 5H16A 2LRHA 4PNZA 1QO7A 2AOVA 1J5PA 1QF7A 3FSGD 3HKCB 3CCFA 4BIMA 4RA9A 3JZIA 2ZUUA 4YBZA 3WB9A 2H1LA 1NXOA 2H00A 4YQYA 4YPVA 4NOMA 4XA8A 2FSPA 4WY2A 2QN9A 4ZZIA 1QO9A 3Q3CA 4GRAA 2Q6VA 3HLYA 5BNWA 1GNLA 3WSTA 3HN6A 2CN1A 1H0HA 1UANA 2HF9A 4M60A 3T15A 3T1OA 4YACA 3T7KA 4EYOA 5A05A 1JBKA 4RLSA 1E1MA 2B61A 1K6IA 1YUBA 3LXUX 1UXIA 1JWAB 4LMRA 4D8VA 2GUGA 2BPOA 2JBAB 2YWFA 3GEBA 4NPCA 1DIAA 5AOBA 5LCXA 4GKJB 1R4MA 3IMGA 1OIWA 2QLBA 4I81A 2E55A 1UBMS 1C5KA 4E0BA 2HW8A 2B3TA 4TTRA 1UWCA 1IQUA 4BL5A 2VWGA 2VYQA 2BAGA 1MG5A 1SURA 3WHIA 4KWHA 5A4FS 1NXPA 3K53A 4IFEA 3VC1A 1DJLA 3BQNB 2H63A 2GD2A 2IKSA 4W5WA 2JAPA 1J2JA 3OCYA 3AWDA 5AVOA 5G3YA 1CZRA 4FE7A 2ZR0A 1APBA 1OBFO 1W47A 4GD3Q 2JARA 4O2LA 4XFDA 1V47A 2IXFA 2ZJ0A 1E3DA 5JJLA 2MIIA 4HH4A 3TQFA 2AN1A 1E99A 4G6ZA 3EEFA 3MB5A 1GGVA 1M6VA 2JKVA 5AOVA 3WLPA 4CLRB 4F04A 2EW2A 1SXIA 1V1JA 1E4EA 4BRUA 5GJWC 2I3AA 3WGQA 5TXGA 2W43A 1XMXA 3QLUC 2VHQA 4RPLA 2BRUC 1V48A 3FVQA 1T1RA 1D1QA 3K0FA 4RK4A 1T8RA 2DY0A 3LK7A 3BB3A 2JZOA 4MVJI 3CEMA 4BX9A 5C1OA 1TZKA 4I7EA 2Z4RA 3P20A 2P1ZA 1MFPA 3OPQA 4X20A 3FGOA 1G6KA 2W6MA 4QBKA 1QCZA 3LX8A 3SR4A 3WMFA 5ALRA 1T5OA 4BKMA 5HW0A 4YJ3A 3UMGA 4BNKA 4RY9A 2AUMA 2DKOA 3UMCA 3I2YX 3ZDRA 5BSFA 3BHIA 1RZRA 4KFSA 3GT7A 4RIEA 3K0EA 4L6IA 3WG9A 3GLIB 1FZTA 5C4IA 4EA7A 4WFIA 3IIEA 5WRFA 2YCBA 2C94A 4C78A 5BVHA 4LF4B 3NBYC 1QU3A 1IG0A 1W36C 4DMHA 3SZ3A 4Q6WA 3HRIA 4QGFA 2NU6B 3BWMA 2C42A 2W4MA 5C52B 4PX2A 4LEIA 4IDHA 3WP0A 3A6FA 3LT4A 2F64A 4R1SA 1BS2A 3MRXA 3T8YA 1RJEA 3DF9A 4MWTA 4G0UA 1P19A 3RJ5A 2IBMA 5J40A 3NOQA 1I7SB 2DPXA 5LIRA 4X6XA 1M6YA 5BRNA 4BGEA 3NLLA 1FYDA 4OHPA 1VPLA 2BUAA 2FUEA 3I5UA 3KZVA 1OQAA 4JLNA 1SBZA 3SDBA 2B30A 4NFLA 2JAWA 3B5EA 3HYNA 1X6VA 5ECGC 3B13B 5HDBB 4AZ0A 4OBWA 1J9ZA 1ZD9A 1BX1A 1X7YA 3FNQA 4MJLA 2VTBB 3W3ZB 2F2TA 2R8ZA 1LSUA 1E9CA 1H9AA 3RKUA 2TMGA 3CIFA 1IRXA 1YVPA 3H9UA 5AYVA 4LS3A 2A0WA 1Y48E 4TV8A 2R8PA 3AKEA 3PFIA 4AYTA 2CNWA 1TL7C 1I3CA 4IOLA 5GY7A 3EVBA 4QVIA 3QKWA 3IQWA 4KO8A 1R0KA 1SPBS 5K6TA 2VP2A 4J3NA 2FJUA 3SJCA 4OQEA 4EHKA 4EHAA 4F2WA 1KFCB 4EPTA 3SK0A 3HKDA 1Z82A 3L82B 4F8YA 4JI4B 1NVDA 4ENSA 1J9EA 1NQUA 1VL0A 2C1ZA 3E0XA 3N2NA 1VBNA 1ZGCA 3FTNA 3LVRE 4DLYA 4CCYA 2OORA 3FPFA 4ROTA 2TRSB 1RBMA 3KETA 2Q9AA 1N8KA 1O89A 3NEAA 3WJAA 1FFXA 5FOQA 4H7PA 3HGTA 3VHRA 4YV1A 4ZC8A 2AFHB 3A8TA 3OY7A 4JI6B 4C7BA 2IYYA 3QU5A 4RHXA 5JNVA 5D3MB 3QVTA 4EEZA 2ODBA 2I91A 4H16A 1Q74A 4U7TB 2BEVA 3ILHA 2UXDB 4CM4A 4FEGA 3MQ4A 3OCUA 4RVGA 3L1IA 2ZYHA 3ZE1B 2HSGA 4KMRA 2VSYA 3SFZA 4LY6A 1G8FA 1ADFA 1MOQA 1T5BA 4NI5A 3UUEA 3DHYA 3TRKA 4ENUA 3AI7A 1OW3B 5EJFA 5MN4A 2D0DA 5BRJA 1YE3A 4QICA 3NU1A 4N8SA 2ECFA 4FEAA 3H6GA 5JCJA 5IANA 4R9NA 4OXXA 2C9MA 2CUNA 4KAJA 3OFND 1Z5NA 4CCWA 4E08A 3Q0EA 3KPVA 5FJJA 2XW6A 1XKLA 1YCFA 4GICA 1J0DA 5FH9A 4MV0A 3SF0A 1Q92A 3PA6A 2WM8A 3KPJA 1KJZA 3GK3A 5ECYA 3VC3A 4CIAA 4C5BA 4YEDA 1JX6A 2QU7A 2O48X 1L7XA 4BTLA 2OZLB 4TRRA 5F52A 3R9XA 1L1RA 5C1BA 3IMKA 4HQKA 4N0QA 2DFNA 1GAWA 1JDVA 5HIAA 1TTHA 1TU3A 3ZJVA 5AW5A 5FNVF 2OFWA 4Q19A 1X8XA 1ULAA 1EG2A 3JQ9A 3I6ZA 3QLVA 3E4DA 3V2UA 1IXSB 2Q2WA 2C77A 2QUJA 4AY5A 5FBWB 1M8FA 3CR7A 1O6FA 1Y4AE 5CB4B 1KJ9A 1T5DX 4DW8A 621PA 1BROA 1VXRA 3BE8A 1L8LA 4FOOA 4CIXA 4HNVA 4XPIB 1UFKA 4XIIA 1B43A 1I0IA 4ZGWA 4PSCA 3SX0A 4MI9A 1Y3DE 2Q1TA 3ELYA 4X8OA 3EZ7A 1Y9EA 3E5MA 4FU0A 1P0FA 5AVRA 2G1PA 3U4GA 4MWBA 5CITA 2X4IA 3NIFB 2ZU6A 4QQKA 4EPVA 1XPJA 1WHTA 3BXGA 3V4ZA 4CL0A 2CZCA 3I2HA 4ISCA 4K9DA 2RHOA 3RLIA 3PIDA 4XD7D 4TTJA 1UMDA 2IJGX 1RWNA 2V58A 3P0FA 4ZYTA 4H1VA 4G97A 4MQBA 3PVZA 4TZ6A 5JRDS 2B0JA 3GCZA 1GT6A 2GEFA 2I8LA 5TT1A 3ZHCA 4BFXA 1K9SA 2EJCA 3VPGA 1H3NA 3PKJA 3RYFA 4B6PA 1IZ9A 3NB0A 5ERYA 4V0SA 2JIOA 5CIYA 4QJBA 1H1LA 5DTJA 4EG4A 1HBJA 4L2IB 3NTRA 2O5CA 1NMEA 1YHYA 3KS9A 1WHSA 4O4JA 3BCRA 1IU9A 4WJZA 4OMCA 4E6EA 5IAAA 5ICEA 3BL8A 4L3WA 2HNAA 4TTAA 3SBDA 1ZK3A 2C9CA 1VPEA 5EE5B 3RGGA 4FX2A 3KWFA 4K9PA 2C78A 1YE5A 5EJAA 1BMFA 4BO5A 2OM6A 1KPIA 2F43B 3GFQA 4DEYA 1EKXA 3DNMA 4QG3A 4NYJQ 2AOTB 4GAEA 4W8GA 4RTLA 3AXTA 3ZY6A 3B1ZA 3ANSA 3QKTA 2F48A 4M1EA 4MPDA 1L3CA 2Y6UA 3JS5A 3P5BA 4HXYA 3JZFA 1CRLA 3RK1A 1VLHA 4P2BA 5GZ6A 4HATA 3NHSA 3SC4A 2X5OA 3SXUB 5JASA 3PR3A 4EA9A 4WT7A 3VNQA 3C8MA 1UIMA 4YXWA 1NN3A 5K51A 4C5CA 3OEEA 3G6WA 2Q6IA 4ZQGA 4BVKA 2PPVA 2H5EA 3FKSA 3IJ5A 4U7WA 4UDOA 1N1EA 3COPA 4QXAA 1OE0A 1V8FA 3L7YA 3GJ8A 4JFRA 4DCOA 3V42A 4B0PA 4ED9A 1YUNA 3IBGA 2BBTA 3CX4A 1JDSA 4FCWA 4CETA 4D4KA 1NI5A 2FWBA 4FFWA 1UBHS 1ZZEA 5E6UA 5DM60 3HO8A 1EZ4A 1GG9A 3O8BA 2JLXA 2AN4A 2I4OA 2QLFA 3ZKAA 1PJRA 2OK7A 4R8MA 4E2YA 1XN1A 2IE8A 3EF1A 4Q00A 1XCPA 3EMVA 1FP7A 1P39A 1U8AA 2KJQA 3RO7A 4F3NA 1ZJJA 2BFEA 4OBEA 4PSVA 1E7QA 1WABA 3EA5A 1ECFA 1EJ0A 5JC1A 3E22A 1S1MA 3D2LA 2EKDA 4M8IA 3RIHA 1AK1A 1MB2A 1POWA 2G9RA 1VLLA 2X7JA 1OT5A 1YZTA 1KMHB 1YE8A 2H4YA 4M38A 1HYQA 1ZW1A 3DFUA 1YVDA 4C4XA 1NNEA 2J0VA 4ZOCA 2GZ3A 4FC6A 4IXDA 4V02A 3SLKA 4UQOA 1QYWA 2FUG1 3QEMB 5EP4A 1NC3A 4WGFA 3VTZA 5K0ZA 3TZCA 5CXXA 2W6NA 2HRRA 3H4MA 4QRHA 5EWMB 4CQJA 3C4JA 3HXQA 4WJKB 1BG6A 1D5WA 2XYGA 2P8JA 2ZULA 3QIVA 4LC9A 1Z4NA 1W9HA 4OJNA 5ABPA 2ONYA 1WXGA 3B7PA 3RAGA 1G5IA 3PTAA 2WR8A 4OXRA 1ZJ6A 4LNAA 1JFRA 1FDIA 2I54A 4OB7A 3QYPA 1E60A 2ERYA 3PA8A 2V6JA 4KDFA 4RTOA 3T9DA 4NEQA 1SOAA 1DKNA 4F5YA 2WKQA 2WU4A 2I76A 3DKRA 5LC1A 1VI2A 2OCKA 1N1MA 1NYRA 2OP1A 1G63A 2Y0CA 3B1KA 1NZJA 4YUAA 1S2NA 1MVLA 1IL0A 3JQQA 4K9MA 3ZX5A 3M1YA 1C0KA 5B3AA 1RM5A 1FFGA 3P9SA 5IJAA 4A91A 3V8MA 1E20A 3EXHC 5BSKA 4P1ZA 4I4CA 4HDRA 4KR0A 1KEUA 4DHWA 2BFMA 1BW9A 3QA3E 1JNXX 2MOKA 4CODB 1MHTA 1CDZA 4XM1A 1FK8A 2FJPA 2QQGA 3I0ZA 3R5JA 3AFNA 2RH4A 3GFFA 4M1SA 4A9AA 1G9SA 2JASA 2VAVA 4DDTA 1ZC4A 3B53X 3OLCX 3TOCA 4RA6B 3R3YA 1IOVA 4DV2B 3IUNA 3IILA 4WNAA 4BNNA 4R1QA 4BB5A 1OKKA 4R71A 2YJ3A 1PVVA 3AP2A 3V4PB 3ZLJA 3T9CA 4E88A 1U1DA 5E6SB 1RKUA 3D8UA 4N39A 2EQ5A 721PA 4CGYA 2GBGA 1OVMA 4WACA 1JSCA 3OWHA 4Z9BA 1AF4A 4KFRA 4Q7EA 1PT8A 2QTTA 2D1TA 1XZBA 4RWZA 3U3OA 1SIWA 4L8VA 5KSYA 3H18A 1P73A 2QTLA 1OXTA 2AF3C 3O4FA 5TPWB 4O3MA 4JJGA 4HNSA 1XYYA 4FDUA 2PLAA 3CNHA 3GLQA 3UPDA 3SQDA 3TFWA 1YZGA 2R1ZA 5FTWA 4YV0A 3PQDA 4HT3B 4LGVA 2BDTA 3ELUA 3EH1A 1YZNA 2GX6A 1MV5A 3NOOA 4WK4B 1QHNA 1F2UA 3GVXA 2OFFA 1N8NA 4CCSA 4MCIA 5DWDA 1MQAA 2GN0A 3URKA 2BGNA 5IHXA 3IR5A 1OC2A 2ID9A 2P9HA 1WD5A 2PTGA 4NNJA 4TMXA 3RRBA 2XZTA 3IFSA 3ED5A 1NGSA 4LECA 5C0OE 4EPRA 5KX5A 1SG6A 3L0PA 4RYDA 5ENVA 3GG2A 2Q50A 1RXWA 3IHWA 1PFGA 3OIWA 3VVMA 1Q1AA 4HDKA 4QOSA 2X14A 4ZO6A 4LDRA 2XVYA 3CZ5A 3PNMA 3P2YA 4UPDA 4IVQA 4UNIA 3IULA 1QFMA 3GLHE 1MO4A 1NHWA 1BQEA 2OO5C 2PIDA 4QUJA 5DTEA 4TSFD 4A23A 1K75A 4ZV9A 5BSWA 2FZGA 1EWKA 1NBHA 2IXEA 3DXXA 4MI6A 1LEHA 4JBHA 3IEMA 1T2UA 2L82A 1IY1A 2C4MA 4QOHA 1UC4B 4INPA 2QM8A 5FL7D 4PQYA 5IAKA 5CFOA 1VYHA 3G17A 1JE1A 4C3ZA 3KALA 3KTFA 4L9SA 4MH0R 4CM6A 3PHHA 1WAMA 5I9IA 1KZHA 4M7PA 3QHAA 1V1RA 1JIIA 1D2CA 1WX1A 1TW3A 4EQ6B 5DRTA 4GYWA 3EVFA 3LPLA 5B64A 4KPUA 4QOJA 4RSGA 3LDGA 4ZDKA 3C7AA 1G5QA 2BT4A 3CGWA 4XGNA 4L75A 4Z1OA 1QDUA 4NYIQ 3UB2A 4J0CA 4HAXA 1CYEA 3BGWA 1YFLA 2IHJA 1CJSA 1YQDA 2QN6A 1TAHA 4MV7A 5C8YA 2AUNA 4AJOA 3PNKA 1X15A 1X92A 1WKCA 1Q12A 5FT9A 2X5XA 4QFDA 1GYRA 5BQPA 1J6UA 3DC2A 3I53A 5LMZA 3LSTA 3PWZA 3FZGA 4NX2A 4IXNA 4Z4CA 2BZGA 2VJQA 3AKDA 4OHZA 3DXZA 1TZ2A 1VE7A 4HB2A 2AI3A 4ZJZA 4M9CA 3VO8A 5JY1A 3PDWA 3CF4G 3FN4A 4KJZA 2R7AA 1JP7A 2CNDA 5LBUA 1QQAA 4P33A 1ZSVA 2CGEA 1USIA 1P9WA 5C37A 1DPFA 2NSDA 3L7JA 5IVKA 3EARA 2ZU0C 4P7BA 4E5KA 2JLYA 1H4QA 1TAGA 1CUYA 2HO4A 2JGDA 2J3HA 1DC3A 2AD1A 5KB3A 2ZRFA 5THXA 7ABPA 2Y1LA 4LXXA 4XJSA 2FCAA 1JHRA 5C53B 2R87A 2JGAA 3HWWA 2JAHA 2RG7A 1E0AA 4ROSA 4JR1A 1VCIA 3ECSA 3RUFA 1VGQA 3RIGA 2A5JA 2ARKA 5HVNA 3SF8A 1UJCA 4DJFC 3MJVA 3JVDA 4B75A 1UC9A 3CM0A 5AJVB 4UDXX 4ZZ2A 5MF6A 4LTNA 4ND6A 2EBWA 2VPQA 8OHMA 3ROEA 3ZZMA 1PF7E 1AQUA 3IMCA 5AVYA 1HPLA 4MGIR 3P27A 4HUQA 1VG9B 1QZZA 1J49A 1IEQA 1AO0A 1OGIA 2H9IA 4MHSA 4L78A 3GLFB 2UVPA 4I2VA 4RGVA 2ACKA 4JWKA 5CRIA 3KSBC 4BDSA 2GJ9A 2WDZA 3EGIA 1E1DA 3IJEB 1CLEA 3FSEA 4JXJA 2EQBA 4WCFA 4RVDA 1PR2A 2IY9A 4Z7NB 1OC4A 1RWBA 1W2WB 1P7VA 1OIXA 1C7EA 1IM8A 1KI3A 4X1OA 2WZQA 2B7LA 3UAZA 1PZHA 1HUQA 3IAHA 2COEA 4RVFA 4YMVA 5C1DA 4XGRA 1WUKS 2E4YA 1PEAA 1Y9DA 2NGRA 2QMZA 3KVOA 4NNOA 2WYVA 2GQ0A 2RJ3A 1FSFA 1YRAA 3S1AB 1CX9B 1HKUA 4DYDA 3FOAA 2VSNA 4D57A 2JLVA 1KYZA 3P9RA 3P9PA 3M6VA 3I1YA 2HA2A 4Q4HA 4YJGA 5LWHA 4OUDB 3DF7A 4FHZA 2REBA 4WKBA 4WZBA 4HWGA 3WNZA 2V7UA 4TKLA 3TNDA 1MAUA 3OWXA 3RFFA 3UAYA 2IEIA 3AW9A 3D8SA 4WAUA 2FZLA 3K32A 1OZFA 3KWMA 3TSAA 3IAM6 2DC1A 1QS0A 1VIMA 4PYLA 5LMNB 1O6BA 4ND2A 4G24A 2P9GA 1XB2A 3DOUA 1GZDA 4R8SA 3VI4B 1EX9A 4F86A 2BISA 3Q9SA 3TNJA 4CIDA 4EL5A 1OX4A 3QFHA 5EFZA 3IAAA 2PX4A 5J2TF 1CG6A 2C97A 5D5HA 4OQFA 3WSVA 5C7LO 4HEA1 3W9UA 4FJ1A 1PSWA 3UAGA 2BJHA 1QR2A 5AW8A 7MHTA 4MX8A 1ISFA 3B1WA 4RJLA 4Y7DA 3FIUA 3FKQA 4AK9A 4CKEB 3HABA 2EP5A 3UGQA 4O29A 2X8LA 4J4BA 3SQOA 3B2QA 1XMSA 2QVGA 3HDQA 2JGMA 2O0LA 4MKIA 4P3NA 3VYRB 4K1XA 4CG3A 4CMGA 2F3UA 1MRZA 2NVWA 3ZY3A 5JNSA 2X2PA 1YKSA 1HDOA 1C1XB 2O2ZA 1QJCA 2VT7A 4C08A 1VGRA 4F2PA 3EVNA 4KH0A 5SYNA 4BAUA 3ULKA 5FWXB 5J9FA 1FNCA 4BMZA 4BKOA 4F4CA 1T35A 4CEHB 4WUVA 4EITA 3MMPA 2AZXA 5FAKA 4AXBA 1G8YA 2OHGA 3I1FA 2WWRA 4UJ5A 3FM9A 3HDJA 3EQZA 1MV8A 2Z04A 1VHDA 1D04A 2B4KA 3G0IA 3GDWA 4ID3A 5EQJB 2UXBB 2LV8A 3TTWA 1C1YA 3L1JA 2JS7A 1ODKA 1HE1C 5ALVA 3HY4A 4C4SA 3VO1A 1C8VB 1DUVG 4RDXA 4DIKA 4I50F 1P2DA 3GELA 3KEFA 2RHBA 4PTLA 3JU3A 1U8UA 4U2DA 1JVNA 2ZITA 3TRIA 4UUOA 2FMUA 4KI7A 3A28A 2ZBQA 5LJLA 4PYJA 5I7VA 3I83A 2D00A 3PUHA 3PXEA 5JD3A 3QPVA 2WSLA 2R6ZA 3IOCA 4M1MA 3V97A 4DIFA 4Z7QB 4D45A 1M76A 3IA7A 3LUGA 5EKSA 2H57A 4QG7A 3DXFA 1U6IA 1LKZA 4KE6A 4B6OA 1PDVA 1YS2X 4YRKA 2CXOA 3F8TA 2NXNA 3AIIA 2Z9CA 1DFHA 1EB8A 4NMXB 3SS8A 4PLZA 2GXAA 4M37A 4XX0B 4CT0A 3T4PA 2LPMA 3PNQA 4OLAA 2ZI5A 4II3A 1T1EA 1YA8A 3DG9A 4Y30A 4KGZA 1Z0DA 2E4UA 3GUVA 3LWZA 3S2EA 1K86A 3SCZA 3VKFA 3HJRA 4W7IA 3ZE7A 3BGIA 1W75A 1T8TA 3Q2KA 3PK0A 4CFYA 3Q7RA 1KU0A 3AUXA 5CVJA 3PB3A 2PZLA 2ZR8A 1NAIA 1RDFA 2F8LA 2ZB8A 3IIMA 5BYJA 1Z56C 4LISA 3BHJA 3LWDA 4CKWB 2KLBA 4ZEMA 1FJHA 5DRYA 1XJ5A 3LT2A 3PYXA 2UUPA 3LOQA 2R8RA 4MRRA 1K7SN 2FWRA 3IOBA 1M2VA 3PBKA 3TPFA 4P2GA 3ML1A 3GVPA 3COZA 1PVOA 1U3UA 1LXCA 4WXPA 1XL0A 2WFLB 1FB5A 2YHIA 3AOGA 1SELA 3N86A 4QTZA 4UU8A 2CY0A 5DX8A 1QMPA 2AR0A 4R2JA 5E0KB 4DLUA 5HE9A 3B85A 1WXFA 3EHDA 3TTXA 4AN1A 5FOTA 1SVWA 3SX4A 5CFRA 3DTTA 1Q0HA 4EI7A 4RD6A 4EKYA 5IVHA 1YS7A 1FL9A 1E6UA 1QP8A 2BFDA 4H3HB 1Y37A 2FQXA 2J5KA 3RS5A 3SNHA 4CDMA 4ER3A 3JQBA 3ET4A 5LNK1 1SFRA 2JIRA 3BC1A 2DFDA 3HO1A 1T26A 2LR0A 1FEZA 3IQDB 4B2PA 2ZB7A 4RSMA 4JYAB 5HGJA 4CKCA 1Z5UA 1IONA 4KNWA 1RHQA 4V3BA 5IKPA 1RBYA 4DV6B 4Y2UA 4JOBA 4EGCB 1LTHR 1N75A 2IW1A 3R5KA 2FLKA 1DLIA 3DDZX 5HNKA 5BSMA 1NJFA 1J09A 4AM8A 4BE9A 1UK9A 3NBAA 1KAOA 2JZCA 2HPAA 3PF8A 4DR7B 4GP6A 2IK8A 4JBGA 2HCFA 1HDIA 4LNUA 4DEXA 5LP6F 2EJVA 2HV8A 5FBKA 1YRBA 4HZGA 3RREA 3R40A 1T8SA 5E6RA 1TUGA 1F3OA 3MHPA 3GIDA 1DGQA 1GSHA 3LRTA 1C3OA 1XROA 1WMAA 2YRWA 1TIPA 3AP1A 3HCCA 3KELA 1B7GO 2FJ0A 2AFVA 2YNMD 4M1ZA 4UE6A 4MGHA 1L5OA 1UXJA 2VHZA 4WEOA 3ROGA 5C5CA 4L4YA 4AWXA 3LDFA 4EY4A 3QE9Y 1O3YA 2QTZA 3E05A 4L0QA 1VKOA 4X3CA 5F7OA 1XHLA 3OZBA 4TXLA 2D7DA 4BV3A 4CN9A 3BIWA 4HRXA 2C04A 2ECQA 3RYHB 3R7WA 2HIGA 4D3FA 3KWJA 2GUWA 3P2JA 4M1QA 2ZE8A 3F7OA 4P4SB 3ZV4A 3U4HA 1NXTA 3EW7A 3CVYA 1QIHA 2Z56A 3KK0A 4J0KA 1KWGA 2R8EA 3C3CA 1GPYA 1H94A 2EX1A 4FHGA 4AQYB 3NTOA 4CU2A 1CUFA 2GFIA 3PUZA 1C8LA 2ZZKA 3UIEA 3D3JA 2C5AA 1XEXA 2HSDA 4DQKA 3WO1A 2VH5R 4HP8A 1ES9A 1P17A 1XCLA 1IBSA 1DMRA 1XR3A 3QM1A 4OA5A 4U02A 5MGNA 2ZJ4A 2JAUA 3KKQA 1KZ6A 1WETA 1AF7A 3KQKA 2XIQA 5EHGA 2PMFA 1UPAA 2E4WA 5HJ2A 3A7DA 2WPDA 4WJLA 4TMZA 2ECPA 2HZ7A 2OVBA 3KOUA 4OBXA 4WXRA 4LF8B 1GFZA 1UKEA 3RI3A 2R6R1 4H9GA 1L5RA 2FCRA 4P5DA 3JATB 2PX0A 1IEWA 2B5WA 1QIKA 1U3DA 1WIWA 2UXCB 4ESEA 1LPOA 2IHYA 1DCTA 2XNHA 1C1DB 2WTUA 1KQPA 1RYMA 4XW2A 1F6WA 2IDKA 2NUAA 5H3LA 2D5IA 1FTQA 2I5PO 1ENOA 2P6UA 2WM2A 4YH1A 3C41J 2PL9A 4RLFA 1KS9A 2A4MA 3FJ1A 4MPTA 4I1VA 1USVA 3SVLA 3GT3A 3R5SA 4GSKA 1CJBA 1Q14A 2EX0A 1ONNA 4FFOA 1QTIA 4PRYA 1DC7A 1IH8A 5CJJA 3GJSA 5GIPE 4XKJA 3D6TB 4WDRA 2J6HA 1GPMA 1MJ5A 1YXMA 3KYBA 1NJSA 3AJ9A 4J7XA 1N3BA 2Q9BA 2A30A 1OU4A 3FCCA 3ZGXA 3DBIA 1JYFA 2BMAA 3AI1A 1C41A 3HKEB 4QGSA 5JSHA 4DIOA 1KYVA 2YYAA 3U37A 3VX4A 1TT5B 3TB4A 3H7IA 1EM8B 3OIDA 2SCUA 5AJUA 3A37A 3FCXA 2XYPA 2E37A 3BILA 2OLKA 5AWFC 4MTLA 4P81A 3VPHA 2HTEA 4NXNB 2IDZA 4ZK6A 1CB0A 3OIUA 2WMNB 1Y9JA 3RT9A 4E30A 1TIKA 4EW2A 1P7CA 4UVDA 4GOKA 4P7GA 2VP6A 3X3HA 4ZGGA 3KOOA 4KUGA 2O0KA 3WJ2A 1V6AA 3BZWA 3HCWA 4QTTB 4P0QB 4Y6QA 2JD1A 4AI6A 2ZRCA 3UFXB 4U9IS 1A5SB 3KNZA 4FLMA 2CB9A 2BFAA 2VSQA 1XDSA 5EXEA 4I3HA 1OWPA 1KMCA 2CUKA 2GSDA 4I1UA 4K26A 4W5OA 1Z25A 3S40A 1KQ3A 3SSOA 1AE1A 1JIQA 3UA3A 1RHKA 3MERA 2H3EA 4DVJA 3D0RA 1G8GA 2QDXA 3RYIA 2HAEA 2Q5LA 4D02A 3IRVA 1VDZA 3CPEA 1R0LA 1NVWQ 5JAIA 3I62A 1MNAA 5CLHA 4BB9A 3NT4A 4F5ZA 2ECOA 3BGSA 2OV2A 4BOYA 4J91A 1W8DA 1K5GA 2V6BA 2Q45A 3Q6NA 1Q15A 3JYPA 3D3KA 3QWBA 1YZFA 1Y3HA 1PT6A 2HIAA 5JW6A 4GWLA 2FZWA 3FRJA 2PU5A 3B7WA 4L8WB 4U7HA 3WZMA 4ZZ1A 4LZAA 2FU5C 2YMPA 3DE5X 3EDMA 3HJTA 1FA9A 4JROA 4LV6A 4WW0A 1QIFA 3GLSA 2CL5A 4RZ3A 1RVDA 3MVEA 2HCJB 1GRQA 2PRKA 4PFKA 1ML4A 4JJAA 3HXPA 5DLDA 5IDQA 4GMGA 2QQEA 1AMUA 3SEFA 3U5ZB 2OKGA 5CNMA 1TFRA 3HXTA 3SFTA 1U0HC 3ILVA 3TS1A 1TQHA 4LRWA 5G40A 1L4GA 3OETA 4PBTA 3UCXA 3GHHA 4EO7A 4GXTA 3M6LA 2ZIXA 2ENUA 3SHOA 4UNNA 3N05A 3ZS9A 1XZHA 5REQA 3H1BA 5TV2A 4B46A 1Y5RA 2Q5QA 2E7ZA 2P4SA 4PLYA 2AWNA 3ENKA 1GNRA 3QBDA 5FTNA 2FMFA 5FYDA 3V7YA 1OPRA 4OX9B 1FP2A 3AETA 3AM4A 2LKCA 5CB0A 1GUBA 3G02A 4IDPA 1UM8A 1ZUNA 4MWCA 1D4AA 3H2IA 5DF1A 1V35A 1CR2A 2P27A 3GJYA 4K6HA 4TV9F 4WQMA 4ZCQA 1M0SA 2P9FA 1I0ZA 4X6YA 3KQUA 2YY5A 5D6OA 3A9UA 4PZYA 3QVMA 4KQ1A 1YR8A 4QO7A 2GNAA 1QH8B 1MHPA 4KBFA 4YAOA 1KDZA 2QP3A 3TUIC 3G59A 3R1IA 3TQOA 2LCFA 3OEWA 3GROA 2QX9A 5FTKA 4MGKR 4C07A 1RHUA 1DG1G 4O1IA 2QRJA 5DGDA 2ZSAA 1L4FA 3DUFA 3GGJA 5SY9A 4NBUA 1EFLA 4LHYA 3EWIA 2PJZA 1N9ZA 1H93A 4R3NA 5IC6A 4AJNA 1RQGA 3C3AA 1M5TA 2BI4A 5FL3A 4GKBA 1X7ZA 2WOJA 3UUGA 1S1CA 3QVUA 1RBZA 3NYWA 4R2WA 4RTQA 1LDBA 5K3DA 4OAQA 6Q21A 2QPLA 1NDQA 1U7WA 2OHXA 1GTZA 4A5OA 1JNYA 1M3SA 1JDPA 1Q95A 2VAWA 4IEEA 7ADHA 4EVSA 4N0EA 5IBPA 1HZJA 2Y71A 3HBMA 1C4KA 5T4FA 3W1VA 2OWEA 3N5CA 5A6SA 2CXUA 3BJRA 8AT1A 2I2FA 2XEXA 1CR4A 3LU1A 4EGJA 3CH7A 3KU1A 4F9GA 5CA1F 3WGYA 2VHUA 2OGZA 4PEVA 2I8AA 3OIGA 5AHOA 3ZBQA 4IFTA 2IELA 3L7CA 4ZP1A 5J43A 5FOXA 5BOVA 2LW7A 3SIPA 4RK7A 5KAMA 1ZR2A 2UUCB 2FX3A 5HSGA 5G0VA 4PZ0A 1SQ0A 3A14A 3QNMA 5TNXA 1L5WA 1ULTA 1FS6A 2A88A 5SZIA 3QJGA 2A5FA 4HDAA 4GBGA 4F5DA 4POAA 4D44A 4LBYA 3E3MA 5TJ9A 4PIMA 3RT1A 3VM6A 4GDFA 4AMGA 2IYXA 4UU7A 2P3QA 3DAYA 4GL4A 1NKVA 1F4PA 1Z34A 1KBQA 3LQYA 1LB1B 1G6Q1 1H1TA 3OE1A 3NBZC 5AOAA 4EKNB 3U4QA 3HUFA 5FX2A 4YLYA 3DOHA 1M2HA 3I4CA 3TG2A 5EPOA 3ICQB 2OECA 2P11A 3HVIA 4D9KA 2R1TB 4R2XA 3KZOA 1B74A 1YJ5A 4NK5A 2W6JD 1R12A 4IIJB 4Q1VA 2QVYX 3OOHA 4A16A 3LO5A 3U3MA 3O47A 5I45A 5FTLA 3W6NA 4AKGA 4MUEA 1JRLA 2FN3A 2C2WA 3OA2A 4L4SA 4KO2S 3DV0A 1EA7A 4WLNA 4DQDA 3KXDA 4D9FA 4EPYA 1W4BA 2PYZA 2X0NA 3E7DA 3NUGA 1IYZA 1EFUA 4ARZB 1VP9A 4OP3A 1SC6A 4HNAB 3PCXA 5E4FA 3UA4A 2BN4A 2W90A 1QO0A 4X00A 4NE7A 5I4CA 1XLWA 1WKVA 2HRQA 1SO8A 4DEVA 1WPQA 4QT0A 2NTNA 2X1VA 4QFMA 4WL0A 4LVOA 1SG9A 5E2AA 1OLUB 2AMLA 3LC2O 2JEZA 2IPLA 2JFOA 1NQXA 3AEKB 1OXUA 1GSIA 1ENYA 3ZU4A 2I2CA 3OCCA 4WZBE 4YUYA 2HK9A 3FDZA 1THGA 1T3TA 1VMKA 2ERCA 2J30A 3EZ6A 4JK3A 4AMBA 4F92B 4OI0A 2XXJA 2XT6A 1NG1A 5I7RA 1LBQA 3QGMA 5AFSA 3G8CA 2C2YA 4Y18A 1CUXA 2O1WA 2ZREA 1L0BA 1XCGB 2BUCA 3LQQA 4FD3A 5BPFA 2G72A 3QTLA 1QV6A 2X9VA 4NYJR 5HS4A 1JKIA 1EU1A 1Z0IA 2BMFA 1XQ6A 4LOLA 5IM5A 1QAOA 1TRKA 1KJIA 1Y82A 2ACWA 1K8XB 3L7BA 1D09A 4P32A 2I2BA 3INGA 3P9ZA 4JEUA 4LK2A 2H18A 2UAGA 1NBWB 2GERA 4NYMQ 2V8BA 1ULZA 1BC5A 1GGJA 2VRNA 2YWXA 3AY7A 1T9GR 3EMDA 3P97A 5B5SA 1AB5A 3INTA 4J0HA 5UKDA 4BWGA 4HMQA 3ESAA 2C4HA 4PGHA 4OD0A 3WK5A 3ERCA 3WLTA 1RYFA 2V98A 1Z5GA 3IO3A 2HPZA 3FYDA 2NO6A 2PXCA 3HL4A 4JLKA 4KO1S 3Q9NA 4F3RA 5CXUA 4X5OA 2WD8A 2HPVA 1PHRA 5IZCC 3D6VA 2ZUWA 4DMKA 3U6BA 4Q4LA 3Q7QA 1TO1E 2R86A 1E9BA 1ZI8A 2B8NA 2JL1A 3LTEA 2VUUA 2Z2ZA 4V03A 2F62A 3DWIA 3E5HA 4NBLA 4BNUA 1VSTA 2DOKA 1EFVA 4RV9A 1KDTA 5A3RA 4EVRA 1XLVA 1YB5A 1U3FA 1QGDA 4G1BA 4IGAA 5IMBA 1H66A 3MUFA 3ZDFA 4EM6A 5LZ2A 3PFBA 3PGMA 3PC7A 4TMWA 3KTAB 4M7WA 2Y0BA 2X4GA 2PS1A 3FG9A 4AO6A 4EKDA 1VE9A 1E2GA 1ZH8A 4DKJA 3Q3HA 4S1PA 3F9CA 3WAGA 1WULS 3IEUA 3OQBA 1FFSA 2JGJA 3K96A 2IZ7A 1Z6PA 3I92A 4NCBA 4HEQA 3E9ZA 2DBZA 3QVWA 5DBFA 1CK4A 2EEPA 1E1YA 4N9WA 4P7FA 2MHCA 5LYYA 1OXVA 3RFXA 4J43A 1LZKA 2D62A 1J1ZA 4OHVA 4DQUA 3JPWA 5DHPA 4XD7A 1PIWA 4WLUA 1NQWA 1B41A 2B37A 1BYIA 2YWRA 2C2MA 2QAGA 3KXIA 3KYCA 1YIDA 1H23A 3EPPA 4L9WA 4P3XA 4PBSA 3WGMA 3X44A 2QMYA 2WAXA 4BDTA 4XDGA 1QH0A 4KTVE 1T6XA 2EZUA 2RGDA 4D9BA 2XCOA 1GKLA 1OROA 3PPIA 4M9SA 2AN9A 4CDRA 4ZO8A 2FE1A 1U6JA 5J4LA 1ZWKA 2XNKA 3WRXA 1T4DA 5BMOA 1ISSA 3FPHA 5I3ZA 3A04A 1H2ZA 3W2TA 3A6ZA 4EY5A 3Q11A 1EXDA 5AVQA 2OV3A 2NT4A 3MWDA 3DLPX 3FFXA 4LFAB 4BV9A 1R74A 3SZGA 1DDGA 2WD7B 5M04A 1JGTA 1LWOA 2YMLA 3STVA 2C88A 1VJ0A 4ZDWA 2ZE7A 2FEMA 1MA3A 3GHYA 4MMXB 2YRFA 2W83A 2PKRA 4MUGA 1QG4A 5DLEA 5A06A 5K8JB 2CVFA 2CXXA 1CQXA 3M70A 4PHTA 2X2FA 1F2TA 2HHHB 3HSSA 1JHOA 2OCPA 4PO8A 3MT9A 2OCDA 2NXEA 3GRPA 4I8DA 2KBFA 1UDRA 2AMJA 3RUHA 1QG0A 1MGPA 1LF0A 4A0RA 2IITA 2P6OA 3Q5GA 1HT0A 1Y9ZA 2Y9MB 1AGNA 2V7QA 3DZHA 3RUCA 2NU8A 1L4YA 4X1KB 4AURA 3PIRA 3ICWA 1KZ1A 4GIBA 3TEMA 3ZKWB 3JWJA 3PENA 2J0UB 3JQGA 3B3JA 4CIWA 3SPXA 2W6ID 4IKOA 5DO9A 4LE0A 2Q3EA 5BWLA 1DKPA 5DYIA 1XRNA 3AHJA 4BWYA 1HYBA 5CVDA 3DMHA 4TL7A 3EQ8A 2Q41A 2A33A 3ZBPA 2NSJA 1XEWY 4OLFA 1FVOA 1OFTA 2M6RA 3P4YA 1SCBA 2HA4A 3RRJA 4L4RA 1U7TA 4G5OA 2JJ1D 2XTAA 4M36A 1UKYA 2R65A 5DBGA 3D3QA 3GYBA 4QOIA 2VH1A 2H17A 3NASA 2WBLC 4FMCF 3ZIAD 1Q1BA 2C96A 3CONA 3RSZA 3QU4A 4F6RB 2IH5A 1PG0A 4DCSA 5JYDA 4B3DA 4QHTA 4P08A 1G20B 2EHJA 1TYEB 2PL1A 3PQ5A 1C7JA 3QKRB 1A8PA 5JYCA 5ENZA 1IM5A 1SVNA 5EEHA 1NWHA 1ODCA 3CKLA 4FJ2A 4X7PA 3S6JA 2C7PA 2RCNA 4ZQIA 5EJIA 2XBMA 3KSMA 3D7SA 2C61A 2QLTA 3QFFA 3WLNA 2I4IA 2ORED 3NEPX 4Z9YA 4PRKA 4PLCA 5CCDA 2M6SA 3A6JA 2HWKA 2ZM6B 2KHZA 2DVMA 4WFJA 1ZMOA 2A78A 3E2PA 1ZD1A 4N0MA 3TJZA 3K35A 5FWYA 1N32B 3ANYB 1G3UA 4GUAA 1KQOA 4TM8A 1PV4A 3AUUA 3LRPA 3OHSX 4FJ0A 1CSEE 2OUIA 2ZVQX 4C05A 3RV3A 2XGGA 5LDGA 4FT2A 2PE5A 1DEXA 3R24A 3FCEA 3W2GA 5SYMA 2ZG6A 3TCNA 3QBJA 3U4DA 1OILA 1K1EA 2WYIA 1WXHA 4Q01A 1EUZA 4DCGA 2OBFA 2FPGB 2II6A 4DCTA 1OWLA 1MENA 4BE7B 4G1UC 4E70A 4ZOLA 3E9NA 3H2KA 3T4UA 3TLGA 4EP1A 1JQKA 5L3SB 4HGZA 4KDCA 4IQFA 4JYMA 1IZYA 5I4IA 1DKLA 2ZIZA 4EFNA 2QJTA 4C43A 2R5WA 4NYIR 3IKVA 4NMWA 3PUJA 1ZHOA 4KFUA 1JQ3A 2PRIA 1GNSA 3LC1O 3PXBA 5T8KC 1QF6A 4N0DA 2YN4A 3L6DA 3WO0A 3F96A 3O4JA 5DX1A 3TINA 1DAMA 1BD3A 3BFXA 4MCAA 4MRNA 5C46F 1I33A 1XVAA 3JWHA 4ZPXA 5JEEA 3GJZA 3H6KA 3QKSB 2WMOB 2ZYTX 3R5XA 4F2HA 3ZQUA 1IWPB 3CR8A 1SKYE 1E2EA 2RKOA 4DCUA 1N6PA 3C16C 1MOSA 3F5MA 1LPMA 2ZBGA 4CQLA 4FOSA 4LV8B 4Q1BA 2V7VA 1O94A 1MC5A 2QG6A 1MMFB 4ERNA 5LQAA 5I47A 5GJVC 3TMAA 2X7HA 2OMKA 4OQNA 3L43A 5CMLA 1LU9A 1OI3A 2JGLA 4RF2A 4HYTA 4JYCA 1P1KA 2VDOB 3KOMA 2WJWA 4WLOA 4YMWA 3THXB 1ZIPA 4F3TA 5JCOA 2MMGA 4CMJA 3VPFA 1BMDA 4YRGA 2OQVA 3ESQA 4BVBA 4YP1A 1HT3A 4NBSA 3WLLA 1T1JA 3RAFC 1D2GA 2YWEA 1SD2A 1E3JA 2DSTA 1EINA 3KYIB 3H9QA 3JZAA 3THYA 4FE4A 3HY3A 1HDRA 2P75A 3JALB 3M6FA 1FVFA 1NF9A 2DFTA 2DUJA 3IUQA 1E3IA 3VOAA 4BJ6A 3U7HB 3GAFA 1MO6A 3LUCA 4GP7A 3LZCA 4GM0A 4HSGA 2AI1A 4ZI5A 1ZK4A 3TLBA 3WZ2A 3NHWA 3WGHA 1TF7A 2BEWA 3RU2A 4QBIA 1VB5A 4Z1MD 1W35A 1ECBA 4JLWA 4YMTA 1H2HA 3UJNA 2VJNA 4DJDC 3U3ZA 4B8ZA 3AH8A 1YU6A 4EKGA 4WIAA 5B4VA 4G09A 1VPTA 4ZARA 2I9PA 2EKQA 1SIBE 1FBTA 4OM8A 1ZRSA 3GGGA 2A0UA 5FUXA 4BNZA 1ZI6A 2F1KA 2VT2A 4QOGA 3PNSA 1X7XA 5BMVB 5CEEA 5KVAA 1JLLB 4RTMA 4PG7A 5A7HA 5IC4A 1BJTA 2FW0A 1AURA 2VYFA 3CT4A 5HZKA 2C8VA 5U9CA 1R4NA 4RAOA 5EG5A 4BN0A 3L07A 1HRKA 4U39A 1TQ4A 3FIJA 3UBTA 3EA4A 1U9IA 3ZWBA 2PD4A 1E32A 2BEJA 2HREA 4TSFA 4OIFA 4X1IA 4XE5A 4Q4DA 3NALA 1DXHA 1KP2A 4RMHA 1QBGA 1CY1A 2B83A 1X1TA 2QR2A 2JZNA 3LAWA 1O1YA 5FL7A 2RK3A 1RXIA 4ZYWA 2FFAA 3A4TA 3ZLBA 1US8B 4NBVA 1BEUB 3CURA 4O4LB 3ZTWA 4B6JA 2ZDGA 2GF2A 3RH0A 4KW7A 4BMCA 4AQDA 4DRXA 3OM1A 4IH9A 5J23A 1G291 4E15A 3S1SA 3I5YA 4J94A 4H4CA 5DN6D 2OYSA 4TROA 2ZBUA 3KKPA 1WW3A 1YL6A 2VC2B 2VDWA 3CW2A 3DO8A 5F3DA 5NULA 5I9NA 4C2UA 5A02A 3FCYA 3P8ZA 3R7FA 1L8AA 2P4QA 4EEXA 2BR4A 1W7AA 3PXUA 3TQRA 3LQKA 1NP7A 3AESA 2NNWB 3TTVA 3L1VA 3WWYA 4AJ2A 1WQ4A 4ZQEA 5JQGA 2FW8A 3PYLA 3GBSA 3M2PA 4HVAA 3JARB 4LVCA 1SVSA 1QRTA 2Q5CA 1L4MA 3SR0A 3A4LA 1GLGA 1GPUA 3S99A 3ZEAA 4W1SA 2FQQA 3L6EA 5L3VA 1CCWA 4IHKA 3OMWA 3LCJA 3VR6D 3AERB 3ZK8A 1KI4A 2ADMA 2RAVA 5EJGA 4CMEC 2I55A 1YK1A 2NO0A 5DNUA 4GW3A 3EFOB 1TE2A 1VLMA 1QQ7A 1ZBDA 1O4WA 2ETVA 3EIHA 4RU1A 2NN3C 5EIAA 3WRYA 3WWZA 1N92A 1RQNA 1OX6A 4YAGA 4NLLA 5JSFA 3EQ2A 4KWIA 3ZK9A 1KA9H 1KJNA 1ZY2A 3V7WA 1DEAA 4MYCA 4Y1RA 4U0JA 5MGBA 4FW9A 2QMHA 1PL7A 5AXCA 1SVKA 4N0PA 3N6RA 5F5LA 1XWIA 2VUTA 4GFDA 4TWAA 4YUVA 4FYKA 2N46A 1CRZA 1HOTA 3V00A 1N6IA 4BU1A 4KLAA 3WL6A 3JAWB 4BVGA 3IUPA 4AKHA 1RXUA 2HK7A 3IQGX 3DDHA 1E2NA 3QW2A 5BN1A 2VR1A 5M2QA 2VTDA 4JT2A 3LFUA 1ZN2A 1W0JD 3QI7A 4RE6A 4TYMA 3UXYA 4LRSB 2GCPA 2FWIA 3CYFA 1DQZA 4FX5A 5LZ9A 2BDEA 4H4EA 2HU5A 4UAUA 1Y3IA 4XX1A 2BGJA 2C00A 3I30X 1WUYA 4BGDA 1T5HX 2CKDA 2C9OA 3L5KA 1H6CA 4UTPA 5I4KA 1II9A 3MW8A 1ZAKA 2CDCA 1WV1A 3GFPA 3CRW1 2ZYSA 4TLLB 2W9XA 2IYLD 2OAGA 16PKA 3DP9A 3MEQA 1DC8A 3QX8A 3U2QA 1WV0A 3AEUB 3KJHA 3K9HA 2DWOA 1JHQA 3PGXA 4IDDA 5DM0A 4DL9A 3VOSA 4RKQA 3DBRB 3K4HA 1TQDA 4N3NA 4MUIA 3PCRB 1CDDA 1N6NA 4C22A 2PFSA 3HV0A 4DSTA 1SCDA 3CISA 3LLVA 1V16B 3KQYA 2CHEA 1ZL0A 4DTCA 1EXVA 1LVUA 3HDTA 2G88A 3N2LA 4MLZA 5SICE 2WJ6A 3KBOA 3M1AA 1WVIA 5IZ4A 2GEUA 1IB6A 1ZNYA 1DRWA 2JI8A 2IV7A 3O8RA 3IAXA 2GYUA 4PM4A 4TVBA 2CL6X 4DCPA 1YS6A 1A2OA 2WVGA 3P9CA 4RD4A 4RYLA 3ZDQA 3RS7A 4OBBA 1IWOA 1RHJA 3DFFA 3L40A 4MQEB 3ZHOA 2CDRA 3ADOA 4MDHA 4I4IA 3KVYA 5KPJA 2Y1KA 4MB2A 4KIWA 2KSQA 3CG0A 3OC0A 3K9BA 4M7RA 1OB2A 2BEKA 5KYYA 3BGDA 3CH4B 5EQDA 1B26A 2XDAA 1SUAA 1VKJA 5J4HA 4CV1A 4NV1A 3AHIA 4MMZB 1UBKS 3T1TA 5B57C 3ZDYB 3W90A 2BM8A 3KTDA 3IP3A 3I76A 3TWOA 2W2LA 1Y1KE 5A3VA 4D43A 2J7KA 4LE1A 3ZD6A 3AOEA 1K3FA 4BNMA 1W5SA 3ZWDA 1F4VA 2FSVC 2BSAA 2OZKA 1XAHA 1CD5A 2HHCA 2HIMA 2F1RA 3L4BA 4UD2A 1B1CA 3UG7A 1A98A 5B4UA 4MUJA 1NI4A 3K0HA 1IHPA 3COWA 1YZUA 2HJ9A 2PBLA 4LZWA 4R54A 1G9TA 2XJ4A 3EJWA 2AN5A 4MS4A 4ZAGA 3SLRA 5BV2P 4PZ9A 1VGVA 3WB1A 2PQMA 1GXSA 1EFDN 3ZYCA 2CJWA 2RAFA 2CE7A 2B4TO 5BUZA 2OK8A 5JATA 1WOMA 1XALA 2DPLA 2JIZD 3QNUA 1NRIA 3ND9A 1YQWA 2HA5A 3BRSA 2IWRA 2BGKA 1IZ0A 2P8SA 3QU7A 4R51A 3B7GA 2DHRA 3VZRA 5IX8A 1CTQA 1QFYA 1ZD2P 5JNRA 1I4EB 4Z86A 3Q2IA 3M6XA 5NLLA 4YASA 4ZT2A 1KR2A 1D7AA 3PVSA 4ICIA 3K1JA 2OB1A 5G4KB 3NHPA 1X86B 2JANA 2OXEA 1K7EB 1Z5OA 4FGLA 4DXDA 1I2MA 3IH5A 5JMOA 1OV6A 4KQ9A 3HGQA 4HWOA 4M6WB 3AC0A 3CF2A 3OFJA 3OO0A 2LTAA 4JVMA 4UXJA 3QZUA 1FDRA 2M2IA 3JQDA 3M2TA 3G2PA 3EXEB 3VHXB 4AJHA 1Y8CA 4CN8A 1U4SA 2UYQA 2ZFUA 3Q8XB 4JUCA 4Y2GA 2EG9A 3CU5A 3E3AA 3V1YA 3WGVA 5F98A 1LK0A 1SC4A 3DBLB 4PG6A 3R0JA 1F51E 3MLBA 4EB8A 1MVNA 4E2XA 2CLDX 1G5HA 1K7YA 2MSWA 1SUFA 4QQ8A 4WNYA 1KSFX 2FG5A 1XZQA 2P9EA 3FFTA 3IV9A 3U40A 3NT5A 3HLKA 3AR9A 1XZLA 1ZJYA 2NO9A 4IZ6A 3ZCQA 4E7OA 1FLNA 4K9RA 2O8NA 2AKEA 3V1MA 1YBHA 2X6RA 4EA8A 3GU3A 1DOHA 3C0KA 3NTLA 1NVVQ 4UBJA 1LWNA 5IULC 4KR7A 1O97D 5B53A 1UL1X 1M6EX 1ZK0A 2WNIA 3KT6A 4HJXA 4ALMA 4P53A 1WRBA 3E35A 4GS5A 4I36A 2ZT5A 3TFOA 3RJTA 1GFIA 1OU0A 2YFKA 3W3AH 4EKIA 5C8ZA 4O2AB 4PW0A 2O3RA 3UW1A 1NMSA 1SOUA 4HVLA 3H42B 3K8QA 3AV0B 5C32A 2GLTA 3I9V6 3ETJA 4PAMA 3Q7TA 4KN9S 1P18A 1V96A 2AI2A 3ES9A 3KVRA 4TKVB 4U00A 5BWNA 1YA6A 4RIHA 1P60A 4RA9B 2QPOA 3DR3A 5ULLA 3UB4A 1FJGB 3A6HA 3NAQA 3GLHB 1QHEA 2HU8A 1Q16A 2VKTA 3RVDA 2HIHA 2PQ6A 1YMUA 1KTIA 4UHJA 4WLFA 4YHBA 3X1KA 2VJMA 3IV6A 1QU2A 3A1DA 3QUSA 3T7EA 2G6BA 2QQFA 3DAFA 2FB9A 3R7SA 4DHEA 3I2JA 3HHEA 4PVCA 5AI4A 4BO4A 2B9VA 3VU3A 3RVRA 1R4MB 4O4IB 3ICPA 4NWIA 1WKBA 4FHDA 4LMAA 3H6HA 5A3JA 1EK1A 1NYQA 3G1UA 3TSZA 4QXPA 1QLJA 2J31A 4MYUA 4EH1A 3FF1A 3EFHA 1II8A 2PAAA 4NZMA 4OLJA 2I4RA 3ZG6A 1J8DA 4M76B 5T4BA 3A6PC 1V11B 4ZPJA 5FEMA 1ZPDA 2I7TA 5K0NA 4B2IA 2DRIA 2QYTA 5JXIA 4KXYA 1ODSA 4WY8A 2WP8J 1Q7TA 2DWQA 4OY3A 2YNMA 3Q10A 4BIIA 1SXQA 2BP7A 3R0IA 1RYHA 1EM6A 4UPEA 1Z6ZA 4FKBA 4M86A 1C7RA 1WB6A 4PAQA 3RE1A 1QVVA 3HP7A 4Q3AA 2JLQA 1P8AA 1Z6XA 1BVUA 2W70A 2O4CA 3WTBA 2MDTA 3CO0S 5BN3A 2BFOA 7AT1A 3OKCA 1AZWA 4PGGA 2WWHA 3K4PA 3UMRA 1GPDG 1Z5PA 2RGNA 1E4EB 2RHCA 4RW0A 1GARA 4BX2A 1FLDA 2Q4TA 1WSWA 1Z6QA 4MW2A 1E92A 3L8FA 1Y6FA 5I7EA 4RZUA 1QK3A 3N8GA 4IMRA 2GCOA 1P0QA 4GT1A 1FP4A 1TUEA 1A9OA 2EXXA 2R96A 2X0DA 3K92A 4FFSA 5DNWA 5C5IA 4ZMRA 4X20B 1ORVA 1T0PA 1TD1A 1ZVKA 3ASUA 2QUHA 3FOCA 3HR8A 3L79A 4DIBA 4I99A 1S8OA 2B4RO 2PUJA 3OTQA 5CIQA 3SVZA 2Q5OA 1ADBA 4AFNA 2NX2A 3HO6A 4MLCA 4YJ3B 2RGXA 2G1JA 3EDQA 3LW8A 4ZO4A 3W5UA 1GDTA 1PQYA 1CERA 1KETA 4BPBA 2FW9A 3IE2A 3ISJA 2ZSEA 5JT1A 3H2SA 4E5DA 1VE5A 4OXYA 5BVHB 4H3KB 3WNQA 1CP2A 4WXEA 2JBWA 3LUFA 5H70A 1JT2A 1RMQA 1KI7A 4V1CA 4DM4A 4D9CA 1TAQA 5CB6A 1P5FA 1X1RA 2QQ5A 4ZVLA 3VPCA 1C9NA 4DIEA 1Z88A 4EO9A 2ZBFA 5FNVA 4LJSA 3WWEA 1XXHA 5EUBA 1RAEA 1SZPA 5HP4A 3LLCA 4CXMA 4J9UE 5ALYA 4PNPA 1SRRA 5B1HA 3V2GA 3IPRA 2CHVA 5BR1A 2FZKA 1HORA 2OC9A 2Y1WA 3VR5H 4E32A 2FFBA 3F8WA 4ZEVA 3VKHA 3D0OA 1T9AA 4KVGA 1L1EA 4OUKX 3OD1A 1KH1A 1NQOA 1SCJA 5BOSB 4Q9KA 1LDGA 1O54A 1X7YB 3O92A 4QOEA 2DHDA 2GZSA 3NXKA 1G16A 2HGSA 3W06A 4PYOA 2Q0SA 4JR0A 1ZISA 1D0VA 2X41A 1UK7A 5THQA 2XDWA 3RJZA 4IMPA 1MQ9A 5T3YA 4ACBA 2UZ4A 4BJ1A 1E1CA 1E0DA 2XGOA 5ALHA 4JC5A 3QSYA 4I6GA 1JR3A 2ZBVA 3PPXA 4X63A 2O2XA 3BK7A 4GLOA 2F1OA 2V5AA 2WIGA 3ONFA 4MP6A 2VA9A 4MAFA 2FI1A 2KQUA 3LYLA 3BMOA 3BSSA 1R5NA 2CCKA 2MMCA 4WN3A 1P2GA 3W5JA 3S1LA 2YV4A 1Z7GA 1GTJ1 2G9ZA 3NHJA 1X0VA 4LRTB 5FBRB 3PX7A 2H2GA 2DSNA 2EJUA 2H31A 4XVHA 1RZVA 4HLUA 4B17A 3ER9A 4B3RB 2PBRA 4OI1A 5LD2B 3RAPR 5CP8A 3UM9A 1RAHA 3C3EA 1FFXB 2VP4A 2VA8A 4KX5A 3LV8A 4TTQA 5AMXA 4DA6A 3TMKA 4LMBA 4F97A 4MQ6A 1NYTA 2NYRA 3OZCA 2ZPAA 2ZEJA 2A5LA 2AJ8A 1UM9A 4W7SA 1CFJA 1X7DA 3HDVA 4J0IA 4PCAA 4DJEC 1Q7BA 1X9IA 3WYDA 2BEVB 4GC5A 5I7HA 3PX2A 3HYRA 1WB4A 3RS3A 1O87A 4RWEA 1YDEA 5ADVA 3FWHA 3U80A 1SB9A 1X1AA 4NABA 4E3ZA 1Z3IX 2ESRA 3KT0A 3M0EA 4L85A 3TQTA 3T5TA 2DETA 4K3UA 4YAKA 1E8MA 3MCVA 3L6BA 2A9VA 2NLOA 2PWBA 4AS1A 1RZUA 1T9HA 1VI6A 1W76A 1NMXA 3DPUA 2Z8YM 3VKGA 2IP4A 5B30A 2IHZA 5CB4F 1GLVA 4JXKA 4NIMA 2E18A 5CCEA 1B0PA 2O0HA 3EG9A 4P3YA 1BHO1 1EUQA 4HQ6A 2DT5A 2IBSA 1RYYA 1TJ4A 4IOJA 2RMKA 1E2HA 2WTNA 3WLHA 1HO3A 1SNYA 5KYXA 1UWKA 2FMXA 3B36A 2N75A 5ILOA 3ITKA 3KEMA 2W71A 3G1TA 1JEQA 3RROA 3LCMA 2ON6A 1GILA 3D6HA 4JLBA 5KTSA 3IIJA 2QJRA 3RBXA 4C76A 1EBFA 1G59A 1SXHA 3CLUD 1LC3A 1M8GA 4QJ4A 3HY6A 3CRQA 3I04A 5JS8A 3P45A 1SUSA 5DDIP 2EARA 2JGRA 1K7CA 3OY2A 2WJAA 2QOEA 2QZSA 4D3SA 1I7LA 1P29A 4UFOA 1HMPA 2ZQ5A 1U0EA 2D1RA 2GDZA 1V6SA 3EQ7A 3FPKA 1EAYA 2GRUA 3UXHA 3B8EA 3TL2A 4GECA 1BU8A 2NZYA 2D7CA 1U3VA 3PI7A 1P31A 1RRFA 1O58A 3BA1A 2G25A 3V48A 4PLHA 1SCUB 3ZY2A 3FZEA 2NZWA 1A9PA 3LWBA 3OE4A 1XTTA 2XAAA 3B8HA 4NYMR 1UMDB 1NVXQ 2YIVX 3W8EA 2QN8A 3CLRC 1P2VA 2ANCA 4JDUA 4RCYA 1Z8FA 3BEDA 3EEYA 1KTVA 3DDWA 1V8DA 2XPCA 1X1BA 2ZBEA 2Q5EA 3GRAA 2UYGA 1JEYB 2CC2A 1W73A 3MJCA 1H8HA 4OU4A 2AZMA 5JISA 2BH9A 3PQ2A 3RYFB 4LHZA 1EK5A 3EEIA 4MQ5A 1GPWB 2DCUA 2J5BA 4TL8A 2I4TA 1ZIYA 1VCMA 2OOKA 1H1LB 1FFHA 1IBCA 2BBSA 4ASUD 2Q5JA 3D4BA 2QM3A 4OEHA 4DB2A 3REGA 4LX0A 3UMBA 1A8IA 3DNFA 1YB4A 2GYVA 3BHMA 3GRFA 4JUFA 1R8SA 4I0WB 4TLDA 1JHZA 2YRXA 3NYIA 3PXXA 5BNTA 2FV8A 3QELA 1EK2A 4KXWA 1EHYA 1XRPA 3W5AA 3KYDB 4ZCMA 2VYNA 5CK5A 1ESNA 2OORC 2XADA 1HE2A 1ZD4A 4DXAA 2OCAA 1PR5A 4KI0A 2IHUA 1B8UA 5KDDA 4OHBA 3WIVA 5LD2C 5BR8B 5B3KA 2OHFA 2TMYA 1PGJA 1RAIA 1VL8A 2MSLA 3IUMA 4R5HA 2CCJA 3I6YA 3WV4A 4UHKA 1QG2A 3QIAA 3TD6A 3F7MA 5H02A 3OZDA 3VDNB 4RV5A 5ALJA 1VKNA 4IW3B 3RBAA 2K7FA 2V6MA 1O77A 1PZEA 1UPBA 1VYTA 2RFLA 1K08A 4FLFA 4NDAA 2JLWA 1DRVA 1EP9A 4H6PA 4UARA 3NP7A 4FGKA 5EZSA 4AP5A 4BEVA 1LCIA 4MINA 2R0QC 3V8NA 2W6JA 4X8LA 5LOVF 3ZBTA 4ZFNA 3V2IA 1ECCA 1HXHA 3IOMA 1GL3A 4CTKA 2HLNA 3I9V1 2V7EA 3CKMA 1RPZA 5K3FA 2H7XA 3FAZA 3UZUA 5HKAA 1EB9A 3KAJA 2FPPB 4CVNA 4Z2AA 4CUJA 3GF4A 3B9PA 5E6UB 1C7FA 3CUEF 1UOEA 4DPKA 1KYTA 4KWCA 5FD8A 3MT8A 1Y3AA 4F1KA 4BLTA 5LBIA 5CU7A 3AEZA 1BU5A 1DWPA 5EMLA 4WEQA 4WN9B 1KR5A 4X62B 1PZXA 1ZLXA 4CMIA 2BFEB 5AW1A 4GF5A 2H2DA 3DXYA 4EUHA 1KQGA 1CUCA 3E22B 4RESA 5MDHA 2XUZA 1PJQA 3GLTA 2RIRA 4LOIA 1CYDA 2HQOA 1PEDA 2WD9A 3W7VA 5A4MS 1PGOA 3CVVA 1KEVA 4Q39A 1U2RA 4EY3A 1USWA 1V4BA 2OGSA 1H0KA 1Z0UA 3JQ9C 1MW9X 3QLVC 1ICIA 4QNRA 3M8KA 5L4NA 2AVDA 4EZEA 4OKSA 3UAVA 1DX6A 1Z2PX 4CV0A 4CWAA 2BGRA 5FR2A 4AJ1A 4IR7A 2YBEA 2Z2JA 4BNYA 1UPCA 2ES4A 3DKIA 3S81A 3F2VA 4H1HA 2XWQA 4IGKA 2O8BB 1IOLA 3N8DA 3GAMA 5HZGA 4QATA 3B82A 3EQ6A 2P6NA 1DJNA 3WA6A 4DSUA 3RTDA 5F9MA 1XVLA 2EL7A 2G1KA 3VR3D 1GYPA 1S3IA 1F14A 3MTEA 3GGPA 4J03A 2LWIA 2UU9B 4JCCA 3THWA 3MCAA 1P0PA 1UJ5A 2BFCA 2RBKA 5LUBA 4DC1A 4EO4A 1K0FA 1UJ2A 2AMYA 5D3KA 5IJWA 2BTEA 2DTEA 1YOBA 2IDMA 2IVZA 1KAEA 1RLJA 2PH1A 2AKYA 2XOEA 3EOAI 4FP9A 4XLZA 1FXSA 1DE0A 2ZI7A 3HB7A 1JALA 4BC0A 5B6IA 4ZT3A 5H3HA 2FSHA 2XQIA 4GG1A 1JG6A 3LPCA 1FMLA 5F73A 4EMUA 2Z6QA 5CG1A 3VDXA 1PBTA 2BI7A 4N8DA 2GD6A 3VR1A 3HKBB 3RIMA 4DE5A 1MAHA 1BW9B 4QKQA 2HU2A 2IF2A 2JI4A 4KSBA 4ZVSA 2PLFA 4C6HA 1SU4A 4ZVMA 4D9MA 3VMFA 4D6YA 4NOKA 3LC7O 3E82A 4PPQA 3DM9B 3NAZA 4N3GA 5FORA 5HTKA 1XRSB 3GMDA 2D3TA 4ZT5A 4Z54A 1E2IA 2BUBA 3BTSA 4DLVA 5JH7F 4UNPA 1QE0A 5AUPB 3RC8A 3H3JA 1RW4A 1A96A 2PH5A 1L8XA 3R0QA 3C6BA 1JS1X 1SZJG 4RJJA 1MX5A 1VJTA 4XFJA 5GWXA 4BBAA 1KMNA 6ADHA 1KC1A 3ME5A 4WADA 2BHTA 3NPAA 3SQNA 4COKA 4HF7A 3LSYA 1CY6A 4YNBA 2M6KA 3DKPA 4OK6A 1L4EA 1IULA 1BRMA 1RD4A 3NKLA 4HX5A 1M34A 1N6KA 4GQAA 5KVSA 4IXTA 4PLPA 2WVJA 2GF9A 2NUBA 2WDPA 2YDXA 3E58A 1QDLB 3QHPA 4NMHA 3N8NA 1Q3HA 2WJHA 1TA0A 4GMXA 1JKFA 3QEBZ 3IHKA 4XWKA 1XRRA 2BMVA 2YJTD 2QRGA 1H2XA 5ALGA 5CFZA 1UQUA 5FWDA 1U0GA 1JLHA 1SK8A 1XUOA 2EFGA 1YK0A 1E7SA 1G4AE 2O5RA 3EXIA 3HCEA 4RIGA 1F2UB 3KIPA 1A2BA 3KOYA 2HWUA 4PCUA 1QQBA 1U2GA 2X0IA 2X6TA 3S2SA 2OE2A 1J2TA 1E2JA 3NG1A 4GSLA 1UZUA 4HAYA 4DR4B 4FYPA 1YTLA 1E3EA 2XZPA 4JYBA 3M89A 1QQTA 2A1UA 1O96A 4TRNA 4DDMA 5KX5B 2X2OA 1Z9BA 2GXSA 3KUKA 3OZAA 2VJBA 5EKTA 3R75A 4YCNA 3GP5A 1R37A 2SBTA 1SB8A 4YRCA 1GPKA 3HJBA 1YFZA 4ITRC 4HDKB 2DHQA 2W0SA 1C0LA 4OIMA 4P84A 5MN6A 3NYQA 5AKYA 3SKYA 1XBTA 1E94E 2YWJA 4RMGA 4W99A 3U3DA 4MPJA 3TAXA 1CY8A 5EJ5A 1SUIA 2GARA 3D64A 2AG1A 2O07A 2I33A 4TXHA 2VP0A 1OD6A 4DOMA 5JC8A 1KY3A 2ZRAA 3DKVA 3HSKA 5KPDA 3D1VA 4R40A 5TY0A 3TIXB 5ETJA 4UDYX 2IU4A 3T6KA 1X7GA 1XRQA 2W6IA 3LLMA 5ALMA 2R6GA 2ZRIA 3QXSA 1UBRS 3RVPA 1U63A 4KN5A 3WQQA 4BMOB 2JFBA 4HVCA 4TS3A 1MIOB 4RANA 1VIAA 1UJ4A 4N76A 5T4HA 4DR6B 3IAUA 1WXIA 2FPOA 1GG2A 2OV8A 3BTUA 2ZJBA 3U0BA 2JJ1A 1RU3A 1CQJA 4XSHA 3UFBA 2AC7A 4PIPA 4F1WA 3ZD7A 4IDFA 2F4VB 3ZIAA 1L2TA 2ODNA 1WSDA 4HQOA 4Y67A 2Q6OA 4W1RA 4ZIRB 5C8YB 5J2TA 1R9GA 2I2AA 1KIMA 3CT6A 3GA0A 4ZCTA 4OGWA 4G4IA 4MQMA 3R3ZA 4LQ4A 4X61A 1C9MA 1P5ZB 3TE6A 3ZIUA 3LBYA 3P96A 4QFBA 4B73A 4OI4A 5FXMA 3I34X 2ATEA 1RRVA 2ZRJA 9MHTA 2IXTA 2P79A 3C8DA 4ETMA 3GN2A 2DXIA 1J0EA 2RK4A 3GRCA 3HL0A 4JJ8A 4TMKA 2QS9A 4B6FA 4E5NA 1M5RA 2FUKA 4MZXA 2C2KA 2CV0A 5E4JA 2G9UA 3R09A 3DL0A 5A4JA 2OBXA 2ZR9A 4G41A 5DKFA 4FFDA 4FQ8A 2JGDB 3F46A 4INAA 2PG3A 4H7FA 3DFZA 2C5HA 1N9GA 4UAVA 1VSBA 4FHFA 4MI3A 1S3SA 2PX5A 3BD9A 1KY5A 5MFPA 3O8OA 1GWNA 2B6NA 4EBBA 1OBHA 4DLKA 3ABIA 5CBPA 1R6BX 2WWTA 1G2IA 4IKPA 4HDQB 2HDWA 2YJ6A 2IY8A 1M2WA 3SF8B 5G41A 4CL8A 1MVOA 4I50A 5B1YA 4BZWA 2CWDA 3OLZA 1BDBA 4FPXA 4J6EA 3WYEA 2C5FA 3ZHBA 4DM7A 3LUDA 3C8ZA 4A82A 1GZ4A 3F71A 3I6QA 1E9DA 1OPXA 4WE3A 4V0RA 5TQ2A 4AWAA 5DISB 4DSAA 3WV5A 5KNBD 1XRMA 3CPHA 3U19A 1AN9A 4RX1A 1JH9A 4XDZA 1H2YA 1VL6A 5JBNA 2ZIFA 1EWYA 4C0XA 2UVPB 2ZE5A 4C6TA 2EATA 2ZXEA 4QPCA 2FE4A 4JI3B 4W9NA 3WJ7A 3CVXA 3ETGA 2CVOA 4K5QA 4KJXA 3B60A 3FFAA 2WU1A 2ZRHA 4RAQA 4CMKA 4KR3A 1NXQA 1JSLA 2B34A 3K05A 4PNEA 4C7OA 1HMYA 2RHHA 2EJWA 4ND7A 2PKQO 3VVCA 1HLDA 4K3VA 3IMEA 4G26A 3FNBA 2BYTA 2H1IA 4YDRA 2YVUA 2GS9A 4FBGA 3LIPA 4UBIA 1KMQA 3OKPA 2G1UA 3OFKA 4UNQA 2R2AA 2VXCA 4F96A 2HADA 4Z4HA 1ULUA 1UZNA 1ZM7A 5EMJA 2QV7A 3TW6A 4ZZ0A 3HDYA 3MQFA 5J4KA 2HA0A 1Z3CA 2WFAA 2PSDA 5DM1A 4YJGB 4Q4HB 5G0UA 2AIRA 1MZPA 1U04A 2EIXA 4CFZA 2IUEA 3SSMA 2R84A 3DAGA 4TWBA 4WZBB 3G7SA 4GMDA 4KR6A 4QELA 4BQIA 3CTMA 5E9QA 4CV2A 3FLAA 1PLLA 1QVAA 2JIQA 2NUTA 2HMWA 3W2EA 5FLXA 3OT5A 1QS0B 1IC6A 3MELA 9ATCA 4Q9HA 5F1OA 3OTHA 1A3CA 3SSAA 3H9GA 1QAQA 1JR3E 2C7BA 3KQPA 1IUKA 1G2OA 4ZVUA 4BTEA 4C2AA 2YJNA 3JASA 2QLJA 1E7YA 1OX4B 4RL6A 1F38A 2NAFA 3BJMA 1J0BA 3V34A 2YV1A 5F78A 2ZSBA 5J2UF 1E58A 3GB9A 1P9NA 1XTKA 1JW9B 4LY9A 4D6XA 1U2DA 2EZTA 2VUHB 5EHIA 4NF2A 5E3IA 3UK2A 4WCVA 3N3AC 5EZ5A 5IDXA 3E15A 2ZTLA 3TRHA 2HSWA 2VDKB 4JJFA 4Z1MA 4R0MA 1XV5A 3C1UA 4BUJA 2APJA 2IPAB 3B20A 3CC8A 2PSEA 4YMUA 2JHPA 4RNCA 4XYEA 1ZRMA 3PNYA 3W05A 3HWX1 3RODA 3AR2A 4RVUA 2XUDA 5GGYA 1KC3A 4BFCA 3OPNA 4C4RA 1PHPA 2JKYA 3J81k 2X1HA 1ZSYA 2G06A 1TQ8A 2J67A 4NPAA 4EG7A 4P5EA 3SJZA 4X8HA 1VLJA 1AS3A 1GKKA 2XWPA 4MVJE 2CFTA 5JMPA 2GAFA 2IBTA 5LP6A 2O6HA 1U8YA 3H65A 2DR3A 2OESA 3P9XA 1GPBA 2XWJI 5EERA 1O8CA 4YREA 1N1DA 2NO7A 3KEOA 4KRYA 5IG2A 2O7VA 3TLAA 3V8PA 3MS2A 1U98A 4MWZA 2YVKA 5HIJA 2PBFA 2AG5A 2XE6A 1QIDA 2VHCA 2OCIA 3L8HA 3G85A 3A05A 2G70A 3NS7A 4KBYA 4OFZA 4TQGA 2I78A 3S7ZA 5KSPA 4QWMA 3PJRA 3TIFA 1MC4A 1PFQA 1M72A 2OEPA 2VP5A 1E7MA 3C15C 3VU9A 1CY2A 2C3OA 2GPJA 4KZPA 4PTYA 3WGOA 3SXPA 3FYSA 2PV7A 1UJBA 2WF8A 1WU7A 4YDSA 3MAAC 3IESA 5DN6A 1YL5A 2P6PA 4REQA 5K45A 1ZNWA 1P72A 2E5FA 4O8CA 4TM7A 1JEJA 4DR5B 4ZQFA 5HE8A 1VFNA 2IX9A 2XUQA 1P2UA 1J2RA 4JA2A 4AUNA 2NVUB 1DKOA 1ADCA 1YR1A 1Y5NA 1E2FA 3BCUA 1E3WA 1XVIA 2DM6A 2PWAA 4KWTA 1IHDA 1Q0TA 1RQRA 1OYVA 1GOTA 1CY0A 2CMDA 6REQB 1E3TA 4D80A 1A69A 1OREA 2PKXA 821PA 3RADC 4ZYUA 3KHTA 4NCNA 3ZZ1A 1DFGA 3EZFA 4JENA 1DRJA 5DK6A 1Y5IA 3E9YA 4S0ZA 3KL4A 4MV8A 5BNFA 2QR5A 2GAIA 1Z22A 3QWIA 5ADHA 3U0VA 2UYOA 1KE2A 1XRJA 4JR2A 2H8GA 1G8MA 3IBYA 3X1WA 3OM9A 1M2VB 3BN3A 3UWMA 4YT4A 1Y8RA 3C3JA 1PX0A 2DJIA 3GEDA 2YKGA 3UO8B 4IIGA 1KRWA 4A03A 2YHIB 4LSWA 4L16A 4ZVKA 1U7OA 4UCFA 5DXAA 3V8RA 2DULA 3TF5A 5JECA 1F5SA 3DHWC 1JQJC 3ROMA 5DTQA 1U02A 2VDJA 3D8RA 1VHLA 1NX6A 5F1PA 5CX1B 3QOFA 3VQTA 1W0JA 3SJBA 3TB6A 2HH9A 3EASA 1J21A 1ZICA 2QTCA 2L69A 3K3PA 3TI7A 1YKFA 1RYNA 1DAGA 3WGGA 2PGXA 5JS1A 1FPQA 1UDWA 1MQSA 2WYOA 3EY4A 4EUSA 4DIMA 1OZGA 1XZKA 4Z5XA 2Z2KA 2NO1A 4MQFA 3QJYA 2MSEB 4RVNA 3AF3A 4CLOA 5CH3A 4ZVPA 4BPRA 3D2BA 1WNFA 3K9QO 2J9RA 1V7QA 2Q6KA 3EFEA 4KGDA 4B47A 2IEGA 5EIOA 1KVTA 1OFUX 1C2TA 2A4KA 4MS3A 2I4MA 2QJWA 2ZYDA 2BKVA 1RLOA 3LDUA 4H08A 4IILA 2HY7A 4A6EA 4LNUB 2WMDA 4BFLA 3DE7X 3VH2A 1Z62A 4MCJA 4N5NA 4GZMA 5ITVA 5ALOA 5K5EA 3FNEA 4II7A 4YJKA 5E6RB 3L0OA 2C9YA 2GM5A 3QVJA 2Y77A 1C3OB 2P40A 4K6MA 1B42A 2D8MA 1F8GA 3A4YA 4RZSA 1NVVR 4AZTA 4Z49A 1QGUB 2HBZA 2OT3B 2DQYA 4E22A 3AQ4A 1YJQA 1P91A 3LW7A 5DGCA 2IS2A 3ZI4A 3TKLA 4CF4A 5HKLA 1FFDA 1S2OA 3DD1A 3PHLA 5B7GA 5F2NA 1F1BA 4AJ4A 2AJCA 3AONB 3F5DA 3R3SA 2AFHE 4JQSA 5HDQA 4M1KA 2ORWA 3R3VA 4H7DA 3Q41A 4M2LA 4TUYF 3EUFA 4YPOA 5IUJC 5EVCA 5FUYA 2HJWA 3A06A 3ZC3A 3T3NA 4MWOA 3FA2A 3GG9A 3NBXX 4ZANA 1UZMA 1NIJA 3QXCA 4BP9A 2AR9A 3LXXA 2BKUA 1SEPA 2R7NA 5U1PA 2IIBA 4ZTBA 2HK8A 1E2QA 1L5LA 1MX1A 4W5NA 1X87A 4IP0A 1KK3A 1LK7A 3UT6A 4IUCS 1P6XA 4KAAA 5G4LA 5C4GB 1R10A 4CL2A 4DBLC 1U0BB 2RHWA 4BQSA 3G5AA 1I7PA 4D4GA 3V5NA 1T25A 4A36A 3HRKA 2O8CA 2J59A 3LGAA 3LVQE 3WK4A 3OX2A 4JB2A 3T9FA 4CM8A 2NZ8A 4TTIA 3UCFA 3X1DA 4EK9A 2X9QA 3JRXA 4LJYA 5I48A 5KYWB 4EHFA 2IH2A 1N78A 2QT0A 5BORA 1PNRA 4P4LA 1WY7A 3L8EA 2HXGA 1VDMA 4W7HA 3V4SA 1MEOA 1GAQA 4Q4CA 1O6CA 3MCWA 2ZP1A 4ZHQF 5EPEA 3D5QA 1X94A 4Q9AA 3MRTA 5EUQB 1NVFA 2JIZA 4TV9A 1U7UA 1Z0SA 3L7NA 4RMJA 4ZDIA 3BWYA 3MTGA 3O73A 4GI7A 1JA0A 2YCLA 1OFIA 3GL9A 3Q9UA 4TTSA 5HJ7A 5LQUA 5LQMA 2VPYA 5IXJA 1SKYB 2QT9A 3ETLA 1ORWA 5LZ8A 4D4LA 4R1PA 1TVCA 2QW0X 4YJHA 3WVNA 2F8TA 1R64A 1U1GA 2VRCD 2GEBA 3FOBA 4GWKA 3KJZA 5C18A 3OECA 1JR2A 2ZVJA 1IHOA 2B78A 3OPYB 4IJWA 1I5RA 4LJ9A 2QX7A 1SKAA 2WKSA 3FHCB 2IIPA 4TVKA 1KDVA 4DDWA 1JJFA 3B78A 1CLUA 2R11A 3CLTD 4QEZA 3OSZA 1UBTS 4UM8B 3UMSA 3MWGA 4CI0B 3QVGB 1TDJA 3GMTA 2PX2A 5HIMA 3ZGLA 4Z6KA 4NE2A 1FRFS 1W96A 4G1VA 5GINE 1IPEA 3JQBC 1RACA 4PLFA 3OUTA 4KRGA 2W58A 2VAMA 2VRBA 3CFYA 2NM0A 3DE6X 2W4IA 2XUHA 3N87A 4LI3X 4M0DA 4K9SA 5EKXA 4NENA 4A4DA 1HTTA 3K1YA 4PCVA 5F3RA 4CDNA 5GOTA 5B2EA 3CKKA 3E1SA 4QTXA 3N3BC 4HDCA 1V4VA 2FZCA 2VAXA 1K4KA 4WCDA 4BHTA 3MPUA 1WMDA 1DIBA 4S35A 1XXLA 1CZHA 3IALA 4IRXA 5KQMA 2WJGA 4NCXA 3PRJA 4PGAA 1CU1A 2QXTA 1VJRA 2YYSA 1VOTA 4P35A 3RYTC 1JECA 1YR3A 1RHRA 5CA1A 4RZXA 1EYZA 5E3JA 4GC9A 2DLNA 3ANMA 3B38A 4NARA 1CS0A 2YWDA 3C3DA 4REOA 4YO7A 2G0AA 1XU4A 1SHKA 2QN7A 3VYSB 3ASYA 2WRZA 3SKXA 2CHGA 3OPMA 4ZALA 1J7KA 4D97A 5C4MA 3RB8A 2AT1A 4H27A 1GO2A 2J4CA 4O0MA 3FMFA 4E1AA 1NUUA 1KXZA 2YH2A 3HCRA 3VI3B 3O38A 3ZJ5A 2IS6A 1L5GB 3SZMA 4Q3LA 4LZOA 3RVQA 3U7QA 2WSMA 4NCAA 1BXGA 3TJRA 1QPBA 1GQOA 2PMWB 4QECA 5JSZA 3O0TA 4AAYA 1MC8A 3D6UA 4CIYA 1VSQA 1YCHA 4LWPA 3X1YA 4LTMA 5C81A 3FHJA 3CO5A 3KKZA 1KFKB 5AR1A 2FWAA 1PCXA 3GCDA 4RJKA 3K9FC 2W6PA 3ZWQA 2J33A 2ZIXB 4KVAA 4J1SA 5REQB 1DADA 1PR0A 5F9FA 3PGLA 3BA6A 4GWGA 1V9CA 2CL7X 3TYXA 5FPHA 1B4DA 4RLQA 2JAQA 1H3EA 1XLTA 3AETB 2IEYA 4GMFA 4QO8A 2VEDA 2A1TS 1A9QA 1NJ5A 2X86A 1N2BA 3AMVA 3K0AA 3KKKA 1L5SA 3IEVA 4X7BA 3S7TA 2V5VA 5LPNA 2B94A 3GLKA 1N5KA 2IEBA 1NF3A 3OM0A 3SOZA 1OLSA 4HX2A 2UUAB 3AVWA 1YBMA 2D0OB 4RH3A 4A6XA 1N33B 4YT2A 3UVEA 3ENWA 2AZDA 3V46A 4MO9A 3SVTA 3TTUA 3CG4A 5FLKA 3MJTA 3BG5A 3I9FA 4PFJA 5HYVA 4G9BA 2CKMA 1JEDA 3E1KA 2V7BA 4DV0B 1V39A 3NFRA 1WQ1R 1KEPA 3DUFB 3HWRA 1SBYA 5DBOA 1E5XA 1TM5E 4L22A 5DNDA 3RK4A 3BXFA 1PZNA 1JIXA 2P90A 2D3WA 3PEEA 4X84A 2UVQA 1IXRC 2CXRA 2XE7A 3PQEA 1IBRA 3CNOA 5TVKA 1R5JA 4DLSA 1EVQA 3LDAA 4G0YA 4AMYA 3VR2D 5AXAA 4JY7A 1HM5A 4K8RB 4AD8A 4LF5B 1WXEA 4RFLA 3UCEA 1GKUB 2BKLA 5A62A 4QM6A 1H9CA 3MINB 4LJAA 2PJDA 2BMEA 4Z4EA 4QUKA 4YPFA 4MRMA 5I9SA 4TLCA 4LA4A 4Z99A 4NC9A 2E4AA 3MMXA 4NCJA 1AV7A 3LP5A 2ICAA 4XDYA 1FLAA 2WWFA 5DMXA 4PYIA 5BSEA 1K7FB 3H5IA 5A6SB 5LJIA 5CCBA 4I55B 3R44A 4H59A 5IM4F 3CVWA 3O94A 2I2WA 1Z0KA 4TKMA 1AKTA 1EVJA 2ZR7A 3PGVA 4FZ5A 3ZD8A 4BNGA 4E4YA 5B12A 3UBMA 4KQ6A 4NZOA 2OY0A 5DOVA 5AXBA 4EHBA 1PEKE 3I5MA 4NMMA 4IIJF 3WXBA 1M2KA 3N6VA 2J41A 3W4JA 3FDIA 4BMDA 4YRAA 3WL8A 4OFXA 3ZDZB 5JHHB 3VUEA 2UUBB 4N1AA 3Q9LA 3IQHX 2GCEA 3B52X 3GJTA 4UMFA 1DQNA 4XYMA 1C50A 3DGEC 4RD3A 5EQFA 3TPCA 4P6VF 2B8TA 5TQ0B 1D8TA 3OQHA 4ONEA 3WYCA 3AF2A 1CUDA 1VLQA 2M9MA 3P2EA 2Q4RA 4NFYA 4WOCA 3W34A 1EAMA 4B74A 4C7JA 1W5FA 3U4QB 5KWVA 1UMCA 4JSYA 4WZZA 2CHUA 1RFLA 5FAXA 4UM9D 1LJLA 3ZHSA 5AQ1A 2ZI6A 4P83A 1SQSA 3NM6B 4HFNA 2BLLA 1KJ8A 3RKSA 1C4OA 1VZ3A 1VBMA 1XD2A 3ZWWA 4IIUA