3HEBA

Crystal structure of response regulator receiver domain from rhodospirillum rubrum
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
142
structure length
142
Chain Sequence
b'VTIVMIEDDLGHARLIEKNIRRAGVNNEIIAFTDGTSALNYLFGDDKSGRVSAGRAQLVLLDLNLPDMTGIDILKLVKENPHTRRSPVVILTTTDDQREIQRCYDLGANVYITKPVNYENFANAIRQLGLFFSVMQVPETEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator receiver domain protein (CheY)
molecule tags Transcription regulator
source organism Rhodospirillum rubrum
publication title Crystal Structure of Response regulator receiver domain from Rhodospirillum rubrum
rcsb
total genus 54
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hebA00
3IP6A 1BVHA 1RZRD 4UHJA 2FQXA 3EJWA 3JVIA 3QELA 1W9HA 4YS6A 3CZCA 3GA5A 5HQJA 1YMUA 2PUBA 1SXGA 1EWKA 1TM2A 5TPZD 3A10A 3H5TA 4G0OA 4OBBA 4Y9TA 4JB2A 5BRJA 1QQAA 5ABPA 1H9CA 4PZ0A 3H1FA 1BDHA 3SQNA 2CWDA 3UUGA 5FWYA 4EYQA 5TPZA 4CBVA 2FQYA 3OQOA 4N0PA 4RK5A 1DG9A 1SRRA 3H5VA 1KRWA 2YHAA 1EWTA 3HDVA 4G0PA 1Y1LA 4WXEA 4YV7A 1TLFA 1U0SY 3F73A 3QEKA 4LX8A 4PEVA 5IC5A 3HO1A 4MR7A 1P6QA 3RVRA 5KQGA 2QW1A 3GBVA 2E4YA 3DLHA 4D6XA 4Q6WA 1DBQA 1JBEA 3JPYA 3UKJA 3F6PA 3JPWA 1FFWA 1K66A 3KLOA 3C6QA 5IEJA 3DGFC 3K9CA 3D02A 1PUXA 2FQWA 1XHEA 2PJUA 4YR7A 2WB4A 2CHFA 4HNRA 3IP5A 1CHNA 2M1ZA 1YS6A 3HV2A 3N53A 3GRCA 1ZAYA 3QX9A 3H6GA 1NY5A 1USKA 1DC7A 3N0WA 3VNAA 5FWXB 5DTEA 1QPZA 5B3JA 2XDYA 3CKMA 1UDRA 1KRXA 2Q5CA 4MQFA 3KG2A 3IPCA 4TN5A 4NCAA 1EAYA 4ZPJA 3KLNA 1C4WA 1JYFA 4RY9A 1VLZA 2IPNA 2B1JA 2JB9A 1EFAA 1ABEA 3HUUA 3H5OA 5I4CA 2RJOA 4PE5B 1FQWA 4MRMA 4RK7A 3C3KA 3CS3A 2IYNA 2HQRA 3L49A 3OM1A 4MLCA 4WZZA 3QELB 1GUDA 1MB0A 3KJXA 3Q9SA 2ZWMA 2QZJA 1LK0A 1JHZA 4OLAA 2L18A 1R8JA 1BDJA 1USIA 4MPTA 5KWSA 1YK1A 4FE4A 4ETIA 1U2QA 1ZESA 3LOPA 3TX6A 3HK2A 2ZAYA 2MSWA 4Z99A 3CLKA 4YO7A 4MR7B 4P98A 1BA2A 3Q15C 5JNRA 3E61A 5FBKA 4KK4A 4RY0A 5JNTA 1OXKB 2FEWB 4XAQA 5DGCA 3BILA 1L5ZA 2YHBA 4HNQA 2BGGA 3FFTA 3T6KA 2JCGA 3OM0A 1KGSA 2TMYA 4L85A 4G0MA 2F8TA 4F11A 4G0XA 3HSYA 1LJLA 1DRJA 1JLKA 1Z15A 4ZMSA 1ZN2A 3KSMA 2GI4A 3LUCA 3FDFA 1QNLA 4RK4A 1D2AA 3MMNA 4N03A 6CHYA 3GL9A 3DGEC 1DP4A 3GT7A 3IDOA 3KKEA 4KK3A 1JFSA 3HS3A 5IUKC 4W5NA 2PUDA 3Q7SA 5TQ0B 4ETMA 3Q41A 4F12A 1NXSA 2PL9A 1GCAA 3A0RB 3C3WA 4DADA 1BDIA 1SXIA 2FTKE 4ETNA 4ML3A 1AB5A 2IDMA 1SXHA 1BAPA 3E3MA 2MYTA 4RS3A 4YCSA 3O2SB 5ED4A 4WUTA 2VUHB 4MQEB 2IPMA 3TB6A 2QU7A 1P2FA 3RVSA 4QYWA 3H1GA 2GX6A 2FMHA 2E4WA 4MR9A 4MS4A 3QEMA 1NTRA 3IP7A 3CG0A 3C97A 2PE5A 4S05A 1EWVA 1AB6A 3KS9A 5HKOA 1DRKA 1Z26A 2X7XA 2H3HA 3CRNA 1URPA 4MS1A 5CNKA 4XXHA 1GCGA 1F4VA 3QEMB 4KFCA 2DRIA 1I3CA 1DC8A 2IPAB 1QMPA 4MR8A 1VRVA 1RPJA 4N47A 3F7NA 3TD9A 4JASB 1ABFA 4E7OA 3NHMA 1E6LA 3O75A 3BBLA 3OMXA 2HPHA 4UHKA 3RVQA 3MYYA 3HXMA 3B2NA 3JVDA 4IMIB 1M2FA 5TE9A 1E6KA 4QICA 3CU5A 5GQSA 2FEKA 3T38A 2HQBA 2WWVD 2L19A 2MYNA 3IP9A 4RXMA 3GBPA 4Z4CA 2QV0A 1NXOA 1RNLA 3NNDA 4JB0A 3RVNA 5C5EA 1RXIA 2OENG 3OLYA 1Z2EA 2IPLA 4KNYA 4G0YA 1QP7A 5HM6A 4KRFA 2NT3A 4N76A 5EWJB 1LBIA 2B4AA 3FFXA 2VK2A 3QLVA 2FMFA 2LPMA 4KQCA 3TO5A 2FN8A 5KC9A 3S99A 3Q7RA 2R47A 2KYRA 3H5IA 2WRZA 5D2CA 2WJAA 4W5RA 2HQOA 4W5OA 2AYZA 3OLZA 1F51E 1A04A 1FFSA 5KQLA 1B00A 1JWLA 5EWMB 3SAJA 5HSGA 2PUEA 1E2BA 4MR9B 3RVLA 2PMCA 4GNRA 1FFGA 4MQEA 3EAFA 4H3KB 4RKQA 9ABPA 3OLWA 4P1ZA 2VUIB 4YLEA 1E6MA 1NXPA 2LP4Y 3QLTA 1ZH2A 8ABPA 1D1PA 2FEPA 4KPYA 1GLGA 2N9UA 1ZGGA 5EWLB 3RQIA 4RSMA 3FMVA 4LZLA 3HDGA 3NNSA 4RU1A 3A3KA 3I5AA 4IGAA 3HM9A 1DBPA 2WJWA 3SG0A 1DCFA 5JNVA 4EYOA 4S04A 3L6UA 4E7PA 4OLBA 3RVJA 1LJUA 3SNKA 1C0EA 2FSPA 3P9YA 4YWHA 4PYRA 7ABPA 4ZYLA 1K68A 2P4UA 3EDCA 4LE2A 2R48A 1TJYA 4RY8A 5CNJA 4F8JA 2JBAA 4NICA 4O5AA 4RV5A 2H0AA 1M5TA 5CHYA 3O1JC 1U2PA 4MS3A 4RK0A 1Z17A 4TMYA 1Z16A 1P8AA 1U04A 4YP9A 5IUNC 4YGXB 3QLUA 2E4ZA 3EODA 3JY6A 4GPAA 5E3JA 2ID7A 5JS1A 2V0NA 4W5TA 3LUAA 3MF4A 5GOTA 3F6CA 4HNSA 4L4UA 4KQ9A 5T7BA 4KVFA 3CZ5A 5TPWB 4EVRA 3DLBA 3M9XA 4OG2A 5B3JC 3BRQA 1A2OA 1VKRA 4Z4HA 1QP4A 3MIZA 1YTUA 4RK1A 1NXTA 4RWEA 4Z9BA 2CD7A 2JVJA 3T95A 3MM4A 4XLTA 4Z4EA 4MS3B 3NHZA 4FB4A 3OO1A 1DBWA 3RVMA 2W42A 3LKVA 4RK6A 1QP0A 3QX8A 2NZVG 2HJ9A 2QVCA 3GYBA 3LFTA 1ZGZA 2E4XA 4FE7A 3M6MD 1JH9A 1WETA 2JBAB 3MQ4A 3DZDA 3NNNA 1JFVA 4N0QA 3O21A 2GBPA 1JYEA 2E4VA 3QLVC 4LDZA 4EYGA 3O2QB 3LTEA 1JFTA 5FWXA 5KQMA 2PUGA 2A9OA 3C3MA 3CG4A 4H60A 2FMKA 2IKSA 5JNWA 1TMYA 1U8TA 1USGA 2FVYA 3EULA 4LE0A 2A9PA 4LRQA 4M88A 4PICA 4QPJC 4WXMA 4EGSA 1ZITA 4KZKA 4RKRA 3KYJB 1M2EA 4XFKA 1PNRA 2F8SA 2I6FA 4KV7A 4MLDA 3OLVA 6ABPA 5JNUA 4KMRA 5JS2A 3O1IC 4OATA 4MAAA 3KTOA 3RVKA 2MSLA 3NBMA 1LBHA 5EWLA 3G1WA 3EQ2A 1D5WA 4JOQA 1JX6A 4RZSA 4D74A 4Z4GA 2MYPA 3LKBA 4IRXA 5IBQA 5T3YA 4ZJPA 2M98A 3G85A 2AYXA 1VPWA 5C5CA 1ZDMA 2OQRA 4HYEA 1S8NA 3URMA 3OLXA 5FBHA 4NV3A 2WY2D 1D4ZA 5TQ2A 4DQDA 1RXEA 4G86A 3O1HB 2A9QA 1P6UA 3CHYA 2FMIA 3IPAA 4NQRA 4RDCA 5F64A 5FWYB 5EWMA 5BRAA 2ID9A 2JVKA 3RVOA 1QKKA 3OQMA 3I09A 3FFWA 4EYKA 2NT4A 1PHRA 1JL3A 1NXWA 2JVIA 3CFYA 1HEYA 3R0JA 5EWJA 1NXXA 2PKXA 1MB3A 4NCBA 1L5YA 2LUOA 3H1EA 4MYRA 3BREA 1RZRA 3N8IA 2GKGA 3N6VA 2CHEA 2PUCA 1W25A 3KYIB 1KMIY 4JAVC 1TVMA 3K4HA 4TLMB 2J48A 1T34A 3HEBA 1PEAA 3GV0A 2RJNA 3A0UA 1D1QA 1MVOA 1PEYA 1ZHHA 2FLWA 2R25B 3CNBA 5DCLA 5TQ0A 3I45A 2PL1A 5BQ3A 3EQZA 2PUAA 4EVSA 1EHCA 2IOYA 3D8UA 3FGZA 3ILHA 1M5UA 3QLUC 1Z2DA 2JRLA 3H5LA 4IILA 3W9SA 4KREA 1JDPA 5CNMA 5IUJC 3GWGA 1IIBA 2LBPA 4G0QA 2WMYA 3LUJA 3QK7A 4D6YA 4EY3A 4RXTA 3LMKA 5PNTA 2L17A 1ISRA 4OTZA 4XARA 5DKFA 1A0OA 3VNBA 3ROFA 3LUKA 3ILYA 2RDMA 1XWWA 3UK0A 4WT7A 3LUGA 4MR8B 5KI6A 1YVUA 4G97A 1JF8A 1XHFA 1JDNA 1QO0A 2QSJA 5IEBA 5TQ2B 3EGCA 3JTEA 2GWRA 4RXUA 2JK1A 1ZY2A 4MS4B 2P9HA 1ZH4A 3O2JA 3SY8A 3TMYA 1CEYA 1DCMA 1YK0A 1CYEA 1OXBB 1QO0D 4JA2A 3LUFA 4F3TA 4Z4IA 5JNSA 3SM9A 3OQNA 1YS7A 3N0XA 1DZ3A 1Z18A 2RGYA 2A9RA 4TLLB 3BRSA 2LIVA 3HJFA 2FW0A 2FN9A 4ZMRA 3KHTA 4G0ZA 3ROTA 2HSGA 1PNTA 2MYUA 1Z25A 3RVPA 2L2QA 4IMJB 1FSPA 2QVGA 2QR3A 4MRMB 4B09A 4Z9AA 4WWHA 4O1HA 4Z4FA 4QYMA 4Q7EA 2QXYA 3N0RA 1YIOA 4F06A 1NATA 2E4UA 3KCNA 4N41A 1QQBA 3OO0A 4EVQA 1GUBA 1APBA 2R4QA 4MS1B 4Z0NA 4MQFB 1MIHA 3LUHA 3O74A 2NZUG 5DLEA 3H5WA 2PAFA 4LE1A 1DJMA 2FLKA 3HCWA 1ISSA 3H6HA 5CNIA 4Q6BA 4MGEA 3T8YA 2O20A 2PUFA 5KC8A 3MA0A 5IX8A 1ZVVA 1Z12A 1J56A 3M9WA 3RH0A 3HZHA 3LUDA 5IULC 4JP1A 4O1IA 4XASA 2PLNA 3Q7TA 4DN6A 1NXVA 5BR1A 3JS5A 2FKAA 4LDAA 1YMVA 3HUTA 4H3HB 2NUBA 5TPWA 4YRZA 2VYCA 3I42A 5KQPA 3N75A 2MSKA 1SD5A 2FXIA 5TQJA 3DBIA 4EUKA 3HVRA 4IF4A 4W5QA 1DCKA 1Z13A 1MAVA 3H75A 3CTPA 3OMWA
chains in the Genus database with same CATH superfamily
1UMCA 5E9QA 4OF4A 1I5OA 1G66A 2CLMB 3RAFC 2VJLA 2D0OB 3EJWA 1AO0A 2O5VA 3OQHA 2Q50A 3ELDA 2PUHA 4HBGA 3DS8A 1YMUA 3HCNA 3WAJA 5LJLA 2XNJA 2ZXEA 5DHQA 4ZYVA 2D13A 1KH2A 5CG2A 1THZA 3A10A 1XNGA 4Y6SA 2XOKD 5CX4A 4DR1B 4Y9TA 4B8YA 2G4CA 5ABPA 1LI4A 3OF3A 3PX3A 4LW8A 5KINB 3CZQA 1QJCA 1RAFA 4WBNA 1R6VA 2EU8A 3TLMA 4NBNA 4WOJA 1CRQA 3ZK8A 2X0IA 2HK8A 1X7YB 1PL7A 5ENVA 4CMBA 4NOJA 4UJ3A 3RJMA 5DK6A 2Y8EA 2OG2A 4X6XA 3WIOA 3I76A 4YJFB 1Y4DE 2ANCA 2JS7A 2AMYA 4DRYA 2J6IA 4ZAWA 3ZY2A 4A3SA 1DAFA 1S8OA 2CMGA 3GBVA 2OB1A 4AS1A 4QGFA 5D00A 1ZD2P 4C3ZA 3OOSA 2GA9A 3D7RA 4DA8A 4DUGA 3MAGA 3GBSA 2H2GA 4GO1A 4ZCRA 4PPNA 2R6DA 5IEJA 5K2MA 3GXOA 1RJFA 4P4TA 1Z7YA 1WAMA 2WHRA 1P29A 1GZ5A 2VZLA 5D7NA 3BEOA 4NF2A 4FBLA 3QJGA 1GD1O 1PGPA 1T8WA 2EKDA 2EKZA 3I72A 4ZI7A 3EEOA 3AVQA 2QTZA 5CEEA 2LKDA 3OF5A 1J2EA 3LE8A 3DM5A 1I3KA 2BDUA 3RAPR 1XF1A 4MVJD 5BMVA 5BY2A 5JI3E 1SCQA 2B5OA 1JA1A 4MVJG 4Y1GA 1KFKB 2OHIA 3B6JA 4N7BA 4DNFA 4ZHQB 1Y6GA 1AH2A 1H8ED 3OCYA 2Y71A 2BFPA 1P4RA 1X1TA 4V0OA 1U4SA 1YBHA 4IIJA 3TTYA 3C2QA 4DNXA 3CXRA 3AY6A 3DWEX 2GARA 3OSZA 2R66A 3QUAA 4JLAA 4B6RA 3FWKA 3O3OB 3Q8LA 3OJLA 1M1ZA 4J0JA 4Y0VA 3IVRA 3MWDA 1TECE 4R1SA 4E1VA 4DEYA 3MFQA 4CR7A 1JHZA 2XXBA 2ZJ2A 3G5MA 1NOKA 5EEGA 2FRDC 5J5AA 1T5SA 2HH9A 4OB7A 4ETIA 2DCUA 1EESA 3TX6A 3T5BA 2PYIA 3H9GA 1P17A 3KEMA 4Y18A 1BA2A 1MDBA 2OM6A 3G3EA 1IXRC 1LGYA 4LSMA 1CP3A 1R0RE 1K89A 2RGGA 4MRSA 1L5HA 3VNAA 2PQMA 1RIFA 1IVYA 1Z39A 3M4NA 1E9VA 4KGXA 4MX8A 3UXMA 4U00A 5KUTA 1O5IA 4EGCB 2PY6A 1H22A 2JAUA 4X84A 3HBJA 1M7GA 1PJ2A 3O9ZA 4AG5A 1L9XA 3T6KA 2X6TA 1X74A 1F0NA 2WZQA 3QY0A 3GUZA 5JXHA 4Q48A 4ZEXA 2VDVE 4QBHA 5IDYA 3QPCA 2EZ8A 3TLZA 4RTRA 4ZMSA 2MWMA 1Y5MA 1Z15A 4L50A 1A9TA 2DTDA 3KSMA 5CB4F 2ETVA 3JAKB 3M3HA 2GI4A 4HNGA 4UTNA 1QO7A 1ZU5A 3HG7A 3FLAA 3SZGA 3O83A 3EK2A 3KC2A 3WYDA 2OCBA 4O4IF 1ZN7A 1BU5A 1BXZA 2AF4C 3DE4X 3G2IA 3HR4A 4ZVKA 3CIFA 4WKOA 2C2YA 4YPVA 5L7TA 1TW3A 2Y66A 3F5DA 3KKEA 4NLLA 4EG7A 1YVRA 4M4SA 3ND7A 3VHLB 1XRJA 1HWYA 5F35A 4YRLA 5LDDC 2IDMA 3WGKA 4LC0A 1UOQA 1Z83A 3PRKE 4KTTE 5ELLA 4DIOA 4YCSA 2QNRA 4RGQA 5E2AA 4OHYA 4URZR 2D2VA 1FUUA 1TADA 3DXXA 3N3AC 2W8ZA 2QLBA 2TMKA 2M9MA 1SXJE 2JI8A 2IHTA 5IBRA 2GX6A 4B3MB 2JKVA 3I01A 3IOBA 4S24A 2GYWA 1RYFA 2V58A 3D3WA 4EM6A 1EWVA 2EEZA 1J2TA 1XNJA 2YFKA 4O4JB 4PO9A 2ANBA 5CNKA 3UCXA 3RM3A 1VHDA 2QVYX 1SKQA 4L0DA 5FP0A 2BTQB 3TZKA 4E7OA 1QQTA 3ZNPA 5JFOA 3JQBA 1PE0A 3SMQA 1KPIA 3B2NA 4EG1A 3DTNA 1KAHA 1SBZA 4N9QA 2FUCA 3D6AA 3T99A 4KOEC 1U0FA 1ND5A 1BH6A 1PCXA 1E7SA 2DGDA 4KPGA 1E9FA 3PA6A 1ULZA 4OYRA 3T3NA 2AJ8A 1Y5IA 2HV8A 2R1VA 4URYR 4N6OA 2AHRA 5AM0A 5EG5A 4OHVA 1TVCA 2O5RA 3RC2A 1SUCA 4D3SA 1YJBA 4O59O 5FOQA 3Q11A 3HJBA 4PBRA 4PIMA 2EQBA 2X6QA 2X0EA 4IX9A 3A1UA 2HCRA 2XTZA 4EJ6A 5HNKA 1NU6A 4OP3A 5JFTA 4BB9A 4I5EA 4RQUA 1R6AA 2WF8A 1V1RA 1NMXA 2F2TA 3N28A 3B3QA 4D3YA 2Q0XA 1VHWA 1NM5A 3QE9Y 1LBIA 2DBVO 2OYSA 3FZNA 3EPHA 5KWIA 1V7CA 1Z6PA 3O8QA 4P32A 3TO5A 5BMVB 5JPDA 4LOJA 5JJLA 3GJ7A 5IAEA 1CWUA 4H6WA 4WY8A 4OQEA 2P5SA 1OAOC 2CYCA 5BNWA 3VA7A 3GFPA 5IM4F 2C95A 4L8YA 5KYNA 3KKQA 2PUEA 1W5SA 2EVWX 2H8GA 2FK7A 2W6MA 1UQTA 3EISA 1K2VN 4K6KA 5F4ZA 4BNTA 4JYAB 1CQWA 2O1EA 5EE9A 4BNLA 3GNSA 5A7FA 1NUSA 3SIWA 2P2DA 4B3DA 1YZTA 2LP4Y 2HSDA 3QBEA 4G5SA 3A8TA 2DY1A 3G1UA 1DEOA 1HO3A 1TCAA 2DECA 2NQ8A 1YJXA 1D1PA 1NONA 2AK3A 2Z8YA 2Q07A 2G17A 2Q1UA 4UOEA 6LDHA 3C6MA 3AF4A 2P35A 4JLMA 5ALDA 2PUVA 4JHLA 1M2OB 5DTMA 3X2FA 3AL2A 3EIUA 2X8LA 4BRWA 3ZW8A 1EGQA 2IHJA 1BXKA 3N2ZB 3TOVA 1U1GA 2B2CA 4IVRA 1LQTA 1U80A 3PXAA 1QYXA 3SOPA 3V7YA 3ZH9B 4HH4A 4E7PA 1DKRA 1II0A 2B2NA 4G4SP 1AGNA 4AXBA 2O7SA 4DW8A 3AVWA 2A1UB 2EHDA 1THTA 1MPTA 2UKDA 5AXCA 2P2GA 4HAXA 4X5OA 5EXEA 3GUYA 3ZCTA 1V47A 1VDZA 4D9GA 1JHYA 4GWLA 4NP6A 4C1BA 1CR1A 4M9SA 1U7DA 3FGNA 4TKVB 4WGGA 3O73A 4KQXA 1IIRA 3CW8X 1YA4A 3UPDA 5EJ4A 5JQGF 3JQRA 2FRXA 1KH1A 1QS0B 4B34A 2PMFA 4X94A 4F60A 1J49A 3KKKA 3CVVA 1XJQA 3D3NA 2BHRA 1Y89A 2E4ZA 1G7TA 1XR3A 2AE2A 2P9TA 1NDHA 3AM4A 2AJBA 3LUAA 2VHQA 2PX8A 4AUMA 2G9ZA 3U0VA 2NTYC 4CCYA 4X44A 5EERA 1KOJA 4TKLA 3ZVLA 5IXSA 2W2TA 3QHPA 5ALOA 3WICA 5C7YA 3LT4A 1SBNE 1B0UA 1V9CA 4X8OA 1UC8A 2EZ4A 3DHEA 3HZZA 3MM4A 3L8MA 2RG7A 5HF9A 1U28C 4FB4A 2XUZA 1JFFA 4B5LA 5LXTB 1ZM3A 2PR7A 2Y0PA 3GUUA 2H1IA 2KB0A 2FDRA 3E4CA 3IA2A 2PJRA 3GVXA 1G4AE 4E1BA 1SWWA 3M33A 3MMPA 2JFGA 2VUSA 5DI9A 3ORSA 3ROPA 2R3SA 2DLNA 4JVSB 5K8JB 3NCTA 1VL5A 2H5LA 4NIMA 2ZCUA 4KHZA 3QHAA 3ESCA 3GQBA 5AXDA 2ONZA 1FX0A 2QMQA 2RH5A 2ZIWB 3U4GA 4BVFA 1BFKA 5LLTA 3AVTA 1U0TA 1T2EA 4KMSA 5F2KA 4MTLA 1B76A 3LTEA 1EGHA 4OXRA 4F92B 1L5FA 1EFUA 2ATVA 5JNWA 1NFRA 2FMKA 3D6FA 3KZ1E 3MUOA 3PWSA 4DCPA 5HPYB 5EESA 5JY6A 1B16A 4RF5A 2RGNA 2Z98A 2IX9A 3JYHA 3QYJA 3AEKA 3COZA 4AN0A 2DQKA 3LNCA 2X5JO 4HRYA 1DO2A 1FP4B 2F8SA 1GWNA 3PKZA 3UOAB 3OLVA 5EIFA 1LSSA 2XQVA 3WQQA 4KQ1A 4HQ6A 3MCVA 2IWHA 1OFUA 2BHLA 3IILA 4NK4A 4IGEA 1QC5B 1E6WA 1Y1PA 3TIVA 3WVNA 1XPJA 3NM5A 4BAZA 5A5DA 2DPYA 2V1UA 5LLDA 5SZHB 1BDMA 4OB8A 3C8UA 1W96A 2ZU6A 1Y1KE 5I51A 1F5SA 2O2IA 4E88A 1KMHB 3RK4A 4O0MA 4HYEA 3TBFA 3M1IA 1DWUA 5JDIC 1XFAA 3VR3D 4H0CA 3P2OA 4U2DA 1TX4B 2B25A 4NCKA 4GGPA 2FMIA 4PHHA 3R74A 3FAZA 2XRFA 4ZIRA 5E8RA 4EL0A 1CVIA 3TVTA 4JELA 5J2TF 1WTCA 1FUYB 3QU9A 2JVIA 5EWJA 1M6WA 3BN3A 2PKXA 1CSEE 4N0DA 4CCWA 4F3CA 1L5OA 4MGHA 3V4OA 4D4JA 1ZGAA 4LAFA 2OXRA 4C7JA 3RS0A 3ZK9A 2ZAMA 3WDKA 2CDCA 4C76A 3GNQA 3JWJA 3VAZA 2GGSA 2H51A 1RBMA 4JAVC 3K4HA 1JHOA 7MHTA 4GAEA 4HWTA 4KR9A 4JUBA 3GH3A 5EHIA 3KAKA 5EP4A 4BFVA 4NCJA 3GPLA 1U1DA 1NNSA 3SBDA 4RGVA 2HIAA 1H4TA 2ZTSA 3BE5A 4ASUA 2R6AA 3I0MA 1YDEA 3EXAA 4KREA 4UATA 1EH5A 1EGVB 1X3LA 3B7PA 4MB0A 1BW9B 1CR4A 3AXSA 3R44A 3WGHA 2IBTA 1GR1A 5AUOB 2B4KA 4M8IA 1NLZA 1WZNA 3B85A 5DCWA 4A0FA 4G0QA 1UXKA 5HDQA 4AKIA 4BZPA 4MP3A 3C41J 3RVDA 3V3TA 1MAWA 4MARA 4PCVA 3ZHSA 3LX4A 2F9MA 3COPA 3P0FA 2AG1A 1NSFA 1UBOS 2HX1A 3R6WA 4O4IB 3EE6A 3NWBA 4L9AA 3W2FA 1IOLA 1XWWA 4B33A 2V7PA 1ZUWA 1QZ3A 3D1LA 1KK3A 2PKRA 4G97A 2O1SA 4QUIA 3WTCA 1UJ2A 4B4UA 3O8RA 3FCYA 1V8FA 5L3VA 3WWOA 4EHDA 4UM5A 3DUWA 4OHKA 4GDFA 1KVRA 4KFTA 4QUAA 4MW5A 3MGBA 5C53B 3CKYA 5JASA 2EJTA 3RYHB 4YRGA 4RIGA 1L7DA 3LT5A 4PPFA 3UAXA 3LLSA 5JECA 3H84A 3ZHQA 2EW8A 2CJWA 3MHPA 4DKXA 3LUFA 5A71A 3AG6A 4GF5A 4RIEA 5M5BA 4LF6B 1OXVA 3FNBA 3N59A 4FEAA 3H7IA 5ALQA 4XIYA 1N34B 1A5TA 3F2VA 2QAJA 1M8GA 1QRDA 4MVJA 3WO0A 5F9FA 1KJ9A 3EVGA 3B7GA 3KHTA 4ID9A 1J25A 1P77A 3QSYA 1JLMA 1PWZA 2MYUA 4EITA 3BXOA 2L2QA 4ZN6A 3W5VA 5EYPB 3QEBZ 4G4SO 1M54A 1SG0A 1ORWA 1TJ5A 2XMDA 5C8ZA 4XLZA 1VDMA 2HCJB 3DV2A 1OWPA 4BO2A 2QGZA 5E7IA 2W6CX 4QQNA 3RIEA 1F2TA 1TK2A 3BTVA 4EVQA 3GVPA 1ZSYA 4IOMA 2PPVA 3V6LA 4OYHA 1IHXA 3AKYA 1A98A 2DWUA 3JQGB 3NALA 4TQ9A 4YA6A 4Z0NA 2OQVA 3ZWOA 1RQRA 1WXQA 3P19A 4EY7A 5DOVA 1KZ6A 2BFEA 2O20A 1B0PA 1KH3A 1PL6A 3QOYA 5AJTA 5C8DA 2P1RA 3KQUA 2W4QA 4GYKA 5HCNA 5EIBD 1L8AA 1T3TA 3WA6A 1MTOA 4FOOA 4OHWA 1T0JB 4F9EA 1II9A 2HNBA 1VHLA 5D6NA 5C7OO 3PJRA 2C94A 4J0FA 4TMWA 5FO0A 3E22A 2NVWA 5FBWB 5HF5A 5DM70 4X1KB 3W6UA 2GYUA 2XMBA 5DBHX 4W5QA 4UNSA 2QWXA 4D26A 1DFGA 2E55A 2VJKA 3LH5A 2ZP1A 3OE1A 2GEBA 4OQQA 2A84A 2ZYRA 2PUWA 5AHWA 2JHFA 1T6NA 3WIBA 1I4DD 4BY9E 3IALA 2OLKA 3UMJA 3Q6MA 3CZCA 5BP7A 4G85A 3C1TA 4R4JA 2ZSEA 3IKJA 4FFSA 1KI9A 1ESZA 3A1CA 4G0OA 3NDBB 4IDFA 4B4VA 1S9HA 4NU5A 4LJ5A 4PPYA 5BN1A 2Q45A 1Z4LA 1V37A 2BHNA 3DZKA 2BTEA 4QU9A 1EK5A 2RHGB 4FIZA 4Y67A 5GZ1A 5JISA 3FIJA 2IQIA 2ZBDA 1T25A 3SJUA 3PSAA 4Q4LA 3TM5A 4D5EA 1TIBA 4PC2A 1DG9A 1IAQA 2FPSA 2ZRCA 2B69A 2C0CA 3ODPA 1VGQA 5DXAA 4OYYA 3WRXA 3ZEIA 4ABYA 3ZCQA 5HZHA 4OJTA 4TL8A 1BG6A 5CJJA 4ZO9A 4BNYA 3HO1A 3I62A 1WMBA 1XEWY 4L1KA 4DBLE 1U5BA 5ALVA 3AQ4A 3D9QX 1U0GA 3LRXA 4E2XA 4BB0A 1NVFA 3U44B 2WAMA 4W9NA 1KJ8A 1V16B 4DT1A 1OGYA 4DXAA 4Z9XA 4BQOA 1LUAA 3MJCA 1NW9B 4I4TA 4Q6WA 2I99A 2Z8ZA 4H7EA 5LQAA 4G0WA 1AHIA 4FX2A 3Q12A 5I7SA 3ZUPA 3K9CA 2Q3JA 4N5HX 5K8TA 2PJUA 1RABA 1V9LA 2YJ5A 3MWYW 4ARAA 1K7CA 4IEIA 4KWEA 2QP9X 2E87A 3R3YA 1C4XA 1Q7BA 2OCDA 1ZAYA 1NE2A 3H65A 3FNHA 4MV6A 4U5QA 3ZE0B 1S2LA 1DC7A 2PM8A 5AD1A 2Q2WA 4Z8XA 5FWXB 1W0JA 1KDPA 3QHQA 3V8PA 4CIDA 1SQSA 5AMXA 2B0CA 1EGAA 3BGSA 4A2CA 1Z06A 1RLMA 1SIOA 4R3UC 5HE9A 2WYWA 2XVXA 3IIEA 3LF1A 1SUWA 1EAYA 2DCMA 4TN5A 2YHSA 4EVIA 1CETA 3M2PA 3KLNA 4PG8A 5IAAA 1VLZA 1FDIA 4XW2A 3TW6A 2P91A 1ABEA 1K8YB 2F8LA 1NI3A 1V1JA 3AB3A 1EDEA 3PG5A 1G8MA 2XVZA 3H5RA 1Z35A 2XAAA 2HWYA 3LD9A 1ZD4A 4UZSA 3SFTA 1H42A 2UUAB 3CS3A 5BRNA 4URVR 3UMVA 3Q7IA 4W1QA 1H4VB 1TTHA 1AS3A 2PRSA 3IEPA 4BFXA 1Z29A 2PZEA 2VL7A 3EG9A 2OBMA 3QELB 2DSNA 3NT2A 3ROGA 2QZJA 1OTYA 3D4IA 1R9GA 3QOXA 3DE6X 1V8BA 1VKZA 1R8JA 3PE6A 4YAFA 3JVEA 3VZSA 2C84A 4DEVA 3IQEA 3NIFB 4CEJA 2O0LA 2H5JA 1C80A 2Y1KA 4LJRA 2C54A 1L7VC 1SHJA 1YRQA 2QD2A 2V7XA 4JJ8A 3CLHA 1WPRA 2SKDA 2QB5A 3A6DA 3PWTA 1AZTA 2IYFA 2P9ZA 4O2LA 4J3NA 3T0GA 2R4UA 2LIPA 2C59A 1XVUA 3LQ2A 4PYQA 4R9RA 1RJWA 1JEEA 1R8SA 4KK4A 4M9ZA 4TS3A 5NLLA 4IL5A 4FHEA 4GR5A 3HVHA 5CM8B 3ZWNA 3AIIA 5JTUA 4C0SA 3H97A 1Z7GA 4FYPA 5JSFA 2PKCA 2YHIB 4UKDA 2AW3A 5AI9A 3WE7A 2XYHA 5LN1A 2QNIA 3BC1A 5MGNA 1RZVA 4LZZA 3FVRA 5TT0A 3SK0A 4PSUA 4H3VA 4B3CA 1ATIA 3AYZB 1E7QA 1JXMA 1Y9EA 4FN4A 5DHTA 4KPEC 4QARA 2FZWA 1WB9A 1MVNA 2QTMA 4OHPA 5JCXA 1KFJB 2XB9A 1KZ7B 1F20A 5ENZA 4XGIA 4OJKA 3L6CA 1GAWA 4N7JA 5J4LA 3FDFA 2GJ4A 4JKIA 1Y34E 2A2ZA 1SUIA 4KQKA 1KF0A 5DMXA 5DSZA 1GTG1 3DF7A 5CDGA 2O8EB 3I39X 4WRRA 6CHYA 2VWPA 1HKUA 1XC7A 3UMSA 2J5KA 2OQ2A 1D0VA 3GZTB 4GZLA 4R9UC 1ZISA 4Y7DA 1JGTA 4MSUA 3QYPA 4RCZA 4W5NA 1Y0BA 1AHNA 3Q2KA 2QJOA 3STUA 2FW7A 1ZA1A 2PL9A 1FDUA 2RHDA 1C7JA 3DDWA 1O95D 5JQGB 1E96A 4XQ0A 2I2XB 4RLQA 1O97C 1YT5A 1EFLA 3CSSA 3DSRA 1KAEA 2FK8A 2ODAA 3ORHA 4ZZ1A 3K0HA 4NKRA 2AC2A 2X9LA 5HIAA 3I2YX 1G6Q1 1WE2A 2O5CA 3H1GA 3BJIC 3IERA 2EFGA 3ZV7A 2P41A 4N8DA 3A6JA 5BVGB 3LDGA 3C45A 1J2RA 2ZRFA 3MB5A 4JYPA 5HKOA 2GZRA 2X5KO 1DKOA 4XE5A 3EFHA 1N0HA 4OHBA 1P9OA 3X1DA 2XH8A 1N5IA 2YOFA 3WK6A 3ZWWA 4YCNA 4RD0A 4XH9B 2WSLA 4MMXB 3BL5A 1GP2A 4HVTA 4JASB 4MNTA 2YH2A 1HFJA 4S1WA 5J58A 5CDFA 3BBLA 5KYWB 5LP1A 1NJ1A 4QO8A 1MA3A 3K0SA 1G55A 2ISQA 1ADCA 2ZQ5A 4QASA 1OIVA 4NI5A 1MIOB 2DM6A 3L84A 2VH5R 3CZAA 1NC3A 3NVKI 1QAQA 2CFCA 3UYKA 2ZU0C 3TL6A 3OZDA 1GLNA 1MB9A 1W88B 4FFPA 2HFJA 2J45A 2QTTA 3FCCA 3FJYA 2QT9A 4FUTA 3SDZA 2BDEA 4RH3A 3FNFA 1W1IA 1Y1TA 2WIAA 4JB0A 1IN5A 1GHTA 1RXIA 2PR2A 4TWBA 2Z2XA 3BDVA 3OJXA 5DDIP 2AEEA 5DWQA 4ZT3A 3ASUA 1VI5A 3B9BA 5AK5A 1I6LA 1ZJWA 1QPBA 1B6SA 4X85A 1QP7A 5EP3A 9LDBA 5K7SA 4KRFA 1Z5WA 2GF2A 1JU4A 3ISVA 8GPBA 1CZNA 4OL0A 2C5EA 4RH1A 4F2HA 1NTOA 4QVKA 3NVAA 4IXWA 3OFSA 1E2EA 2X9QA 1F0YA 1C7FA 4HGQA 3Q85A 2R47A 3AW8A 2E7ZA 4RNCA 2ZSHA 3R3XA 4D8UA 4QZVA 5JADA 2HQOA 3TRJA 3EYAA 1CJCA 1J0AA 1Q2XA 2QI9F 1R16A 4GBGA 4GSKA 3SGLA 1QORA 1J00A 4E1AA 4Q3EA 4BVKA 1KKMA 3DKKA 4F5ZA 4LBZA 2DC1A 2WHYA 2MT9A 2NXWA 3HY4A 3NTOA 3SSOA 5IT4A 3KQVA 1N9GA 3QFFA 5DYWA 4DJEC 1G5QA 1XCPA 4RL6A 3UGQA 3PEVA 3PTAA 2BISA 4Q4HA 1EFCA 5JRDS 3GH1A 2JGKA 3AK4A 4FHGA 4AKTA 5KTRA 3AFIA 2AD5A 1ZH2A 1NYQA 1T1RA 1EAMA 3KHUA 4L4RA 4LDRA 4GKAA 4P6VF 4PANA 4CQLB 1TUEA 1KO7A 4E4TA 1PTJC 1C1YA 3AHHA 1N2EA 5ALYA 2HLNA 1SIWA 1U2DC 2Q7DA 3ULKA 3IEMA 2Z3ZA 4KDFA 3NTUA 5FULA 4L5BA 4YJFA 2CDBA 1BXGA 3I5AA 3KZCA 4IGAA 5H3HA 3VPGA 3A4MA 2GFIA 1FNBA 3WYAA 1E2PA 4ZQGA 1GGKA 3HE3A 5ALPA 4KMOA 3VQTA 3VGPA 1BKYA 1Z73A 3WRYC 1YGYA 2VP3A 4HAWA 1IWBB 4B84A 2C4HA 4OQPA 5IK2D 1EWRA 3I9V6 4JGGA 4MVYA 4B8WA 4NH4A 5EGNA 2FSPA 3MXOA 3MW8A 1DQSA 1OV6A 3H4TA 3L8YA 3SSNA 3WIDA 3M6IA 5K6TA 1DEKA 4H0FA 4XWYA 3D7MA 4EKIA 1E1CB 2AYYA 3KXPA 3CLVA 2QZ4A 4CMEC 3LVQE 1A5BB 4EO4A 2JI7A 4RUKA 3ACBA 4KXWA 1UDBA 3D1JA 5CHYA 3TZ6A 1Y63A 1HFKA 2Y27A 1B2RA 1IQ0A 1YVDA 4B17A 4OHOA 2OXCA 3IIJA 3B7WA 4Y6RA 2EOAA 5ALNA 2F43A 4Q4JA 4LK2A 5A2QA 2OORC 2PZAA 4X1YA 4ZMBA 4J3FA 5FWAA 4KSYA 4KQ9A 3GNLA 1CUVA 3PR1A 1EE2A 4MGKR 2YQ5A 3DLBA 4Z1OA 2UVDA 1NBWB 2O19A 2WWRA 1KORA 2NN3C 3C7DB 2MSDB 3O9MA 1O1YA 3M5PA 4PCUA 2WIKA 5F3DA 4MROA 2HL6A 1UADA 2EEPA 4MS3B 4DJFC 5LBTA 2JFNA 1ENYA 4YJ3F 3WLLA 3B3AA 3KIPA 5JVDB 1MBZA 2J9RA 4LHSA 2ZYVX 1TYDE 3N8KA 1RAGA 3GYBA 1OC2A 4QQKA 2XB8A 4KCGA 3EGXA 1SBTA 2GRUA 3WG9A 1SQ0A 4DDHA 4E5VA 5JROA 1XZGA 3ZE1B 1VPDA 1HDRA 3E9MA 3RK1A 2XB4A 4NY1A 1UBKS 2CVFA 1W8IA 4IG9A 4YJDA 5B3LA 5C18A 1VJ0A 3KT0A 2W00A 3HGMA 5LP6B 3RASA 1ZK1A 1JKFA 2EL9A 3BIFA 5C9ZA 4XI9A 3BF7A 3R7NA 3KB6A 1V6AA 4TRMA 3VX4A 3BMNA 4ZU6X 3TOSA 1B43A 1ML4A 2P8SA 2PFSA 1SHZA 1ONPA 3CSUA 5A02A 4DV2B 1JHDA 3N07A 3WBKA 2VDJA 4H15A 1RAAA 1K92A 3IODA 1A2QA 2PWBA 5FNVA 5A6SA 4L5IA 2CXPA 5E1BA 4X3PA 5CLJA 3EIFA 2O2GA 3O1IC 5IYZF 1E99A 5HK8A 1W581 3EFOB 4ONEA 4BKQA 1QH8B 4EGQA 1UL1X 2VPXA 4N5LA 3AEQA 3VNSA 3EEYA 5E6SA 4PHGA 2J0SA 1UP6A 3D6UA 2SECE 2GN4A 3U7QB 4AWBA 1ZZGA 3ESDA 4IRXA 1GNVA 1SUDA 5A06A 1A82A 5IMBA 4JT4A 1RM3A 4BWYA 1GADO 1EB9A 1GGNA 1UEJA 2F3SA 1ZDMA 2H7CA 3IQXA 3TPZA 5C5CA 5IF3A 2WHXA 1UZNA 2OV3A 3G9ZA 3UAZA 4LZOA 3ZX4A 2AX3A 2OCYC 5KYYB 4K88A 4HXGA 3CHYA 1U3VA 4TKUA 3TTTA 4F4FA 3AHJA 3EBPA 2ZIGA 4MA0A 5H82A 3THSA 4CM9A 3T5AA 2C9BA 4QUHA 3CGGA 2JJYA 4X8MA 5HM8A 1G2QA 3FFWA 1IZ8A 3BBPA 4NE7A 1CIVA 5IC6A 3WP1B 1FE8A 3ISTA 3K9BA 3OZGA 1FU7A 4FMDF 4ZXPA 1Z22A 1SOUA 2PBZA 5B4VA 4C6HA 4MYRA 2H5EA 3KUXA 5COAA 4Q4AA 1H65A 4L76A 1XMSA 1Q2UA 2H2FA 3TSAA 2B36A 2Q9BA 1A9RA 4IJMA 3GGJA 1L7RA 2CHEA 1IM5A 1NVVR 1SKUA 3KYIB 3BA1A 2Q5LA 2J3HA 3FUUA 2OFXA 3CV3A 1ZMXA 3GAFA 3GPCA 4BQNA 2R25B 1CUXA 3BWXA 4V0RA 1FLNA 5DCLA 2ZUBA 4AY2A 5JH7A 3ETEA 4LQLA 4OOEA 1IZYA 2JD2A 1N6HA 2IC5A 3JRNA 4ESEA 1H5NA 4PLVA 2B7BA 1YTUA 4UNPA 4DR4B 3H5LA 2JIZD 3OIGA 1CUYA 4DR7B 1JDPA 3KJHA 5FQOA 1S3GA 3AR2A 2BM9A 3C3EA 2PSEA 4EFDA 4DVGA 1YI0A 5FI0B 4I36A 1CB7A 1IHPA 4J75A 2JGFA 2XYPA 3FCSB 1RVV1 2WMYA 3FCXA 3KLPX 2FZLA 3UO8B 3QF4A 5DYYA 5AUQA 3A6GA 3PFIA 3LKDA 1XCJA 1Z4OA 1SOWA 4N7RA 3W5IA 3JQDA 5K4GA 3GFRA 5F7ZA 2ZWAA 1YHYA 3B1WA 3KP1A 5IWAB 1A9XB 1WEHA 3GRVA 4BASA 4HWOA 2EX4A 4PZ9A 4P3NA 1Z2CA 2POCA 3T0FA 4P31A 3D7NA 3F74A 4HSGA 3EGCA 2KBEA 1W4RA 3II6X 2X0DA 3RR2A 2GWRA 4UAJA 4DMMA 4PR3A 3GAZA 1GA4A 4F9FA 4PNHA 3IXMA 5B58C 5C1PA 1BIFA 2NAPA 4MO2A 2O8DA 3BH6A 3JU3A 5GY7A 3OZAA 1E0AA 5KOYA 1RI1A 2HWXA 1J0EA 4KQ6A 4F3TA 4FOLA 4HUQA 3S29A 1HLGA 5AJWA 1K97A 3EWIA 4MQLA 2R8EA 4R9NA 3T61A 4MUBA 5C7IO 2Z8XA 1M0EA 3PL1A 4TGLA 2A0FA 3SZRA 2J9FA 2C31A 3W5SA 3CWQA 1ODJA 3K1ZA 4E22A 2MR5A 3ETGA 2Q2OA 5F3WB 2QVGA 1QG2A 2EKQA 2A9FA 2WC1A 2XKBA 5EFOA 1LBEA 3LOUA 3QQ5A 3MS2A 1KY3A 3CEAA 4N9WA 2G1JA 4NBTA 1ZCFA 4TX1A 2FEOA 1DWOA 1BJTA 5GGYA 3STHA 3KCNA 2H29A 4IH1A 4DV4B 1X3SA 1J8MF 4HJRA 5BQOA 1K98A 2NYRA 2YV5A 3HKDB 3WP0A 2GA8A 2ZYUX 3EGXB 2FPKA 3PWZA 4BMPB 1NBMD 1ADJA 1W0CA 2DUWA 1Z9BA 2JARA 3FPJA 4MJXA 3WBJA 3U17A 5E4FA 2H1FA 2ZJ4A 4N39A 1JAZA 3K4PA 3AY0A 3R3WA 3FCAA 5AK3A 5IMSA 1HF3A 2B1IA 1UKYA 3P0EA 4XJTA 5JMWA 1FL9A 2NO1A 1I7PA 3K5PA 2OMEA 1BJKA 2PRJA 3HLYA 3QWHA 4EB8A 1K7FB 2O54A 1OAAA 2NVOA 3ZDDA 1GL3A 4DIFA 2C7PA 4BRSA 4NG4A 2DKNA 5CA0B 4RACA 4LJ8A 3HUTA 3IE2A 1Y6JA 5G1OA 2CUTA 2RBEA 4IFTA 5JH7F 2MSKA 1DV1A 4MVJH 2NUAB 3FHOA 3IC5A 4BLOA 1YS1X 4WACA 2ZUVA 2R2GA 4YFVA 3L1HA 4NRDA 1SK8A 1P1BA 2NZJA 1JPUA 5I9BA 3H75A 3OEHA 4PM4A 4ZAFA 4XRGA 4BZZA 2X58A 5AR1A 1BVHA 1Q7RA 4B0PA 4EGAA 3UJCA 2FQXA 3KXLA 2RE8A 3UAWA 1RZRD 2R6CA 4S1NA 3CQ9A 3NXSA 3U4IA 1F6BA 4HOYA 3NW9A 1A50B 3AR4A 4LYJA 3VSCA 1M1YB 1SXGA 1ONNA 2GBFA 4CR6A 1VXRA 5BR7A 5KU7A 3D7LA 4MUKA 5AVUA 3EQ9A 2C04A 2C2GA 5EHZA 1KNXA 2P4SA 3SSAA 1RYYA 2GPAA 2MU1A 1ONOA 4RTQA 1TM3E 1HDGO 1CULC 1N2BA 1DKLA 1VSQA 2OGWA 5BSMA 1JFFB 3MT7A 1SD2A 5K8IA 3MT8A 2XYRA 1ES9A 3DVLA 1DC6A 1U0RA 2D1QA 2OC4A 1CD5A 4JT8A 4CTJA 3OQOA 1HI9A 4GZ6A 5BSVA 2Q1XA 3F96A 1U99A 1Y1LA 4YV7A 1UPTA 3DBHB 1TLFA 3TQRA 8MHTA 1XB2A 1BEZA 1X2BA 2HYDA 3KPUA 3U48A 1SUFA 2J59A 1LKZA 4I5GA 3FR7A 5FH9A 3GLQA 1F2UA 1G7CA 1T8SA 2R1UA 2PJDA 4QJ3A 1K6EA 2XF2A 1DOAA 1UXOA 3A06A 2QRZA 1JEDA 3N70A 4B40A 4P5DA 5INTA 2COUA 4JY7A 4N3GA 1E9DA 3W2GA 1L7QA 1PUXA 3BFPA 3PLNA 2HF2A 3AEKB 1OLSB 2QJTA 2O4UX 4YMVA 4L0MA 4TTAA 4XZ3A 5CFLA 2BFMA 2R6FA 3L0YA 4MUHA 4OBWA 1HE1C 3BG5A 1WXGA 4L73A 1MMFB 3SD7A 2EHJA 3AUKA 3SEQA 4F3NA 4JYBA 1LI7A 4UM9B 4GU5A 1KRXA 3RJ9A 3KKOA 3DHYA 2XGJA 1AZWA 4QGBA 4LZPA 2C9ZA 1WVMA 4ZPJA 4OY3A 2B1QA 5LA6B 4RD4A 4QUKA 4ETWA 3W5AA 1DTWB 1N8SA 1SU7A 5DGDA 4EDFA 4TWRA 2G63A 1F8GA 1YDHA 3B36A 821PA 4BRUA 1X7DA 2HJRA 3ORQA 3I8OA 4I6JA 4LZWA 2ECKA 4XCXA 2GZAA 3E58A 2ZR9A 1GVHA 4YQEA 2J3EA 3LHKA 4QOIA 5GADl 2JLZA 1EWQA 2K87A 1Y5NA 4AY4A 4FT2A 5EJ7A 2IODA 1MEJA 1OW3B 1WCIB 1GUDA 4BX3A 4EB3A 3VH2A 5B7QA 3GN1A 4K86A 4P8RA 3SYNA 4R0VA 4BNDA 5FEUA 2I2DA 4L27A 2J3LA 2PA0A 1KFCB 1V95A 2RGCA 3IUMA 4ITRC 4R51A 1TYAE 1EKXA 1HY3A 1NM5C 3FUTA 4ARUA 1GITA 3GDGA 3Q15C 1AQ6A 2DQ4A 2PZMA 2WZBA 4KUGA 4L8GA 5FBKA 1OUMA 2JIMA 3KOUA 2C00A 2ZWIA 4XGKA 2QUKA 5DBFA 2J5XA 1ZG3A 2LCQA 3EMVA 4RTMA 1XN4A 4O2AA 1W6RA 5FA5A 1M8KA 1T9HA 1TYBE 1L5GB 3ZG6A 4R2MA 2C3MA 4LHXA 2Y1EA 3UAGA 3S1SA 2JCGA 3FXAA 4ZKEA 5P21A 3C4JA 2D59A 4MUXA 2Q4RA 4PYMA 3QPVA 2H1OA 2HSJA 2F8TA 1NBME 3FKQA 1G5HA 5EAIA 1R9JA 2DKFA 3R40A 3S55A 2VDKB 3HSYA 1MEEA 2DBYA 1JLKA 3IAS1 1GQFA 2W2LA 2PGNA 5BNTA 3O38A 2RHOA 1IXKA 4FKMA 1AT1A 3K6KA 4KSBA 2AR0A 3KSUA 1RJ9B 3OM9A 2CYAA 4IEFB 3T52A 3WLHA 4P3KA 1VE1A 5BWOA 4H7HA 5FUQA 4KXNA 3L0PA 3GT7A 5F1KA 3BRCA 3GFVA 3PIDA 2W58A 3TR5A 1VE7A 1UXGA 3E9ZA 5ICFA 2M1XA 2NUAA 1H5QA 2CXHA 3Q7SA 2X3UA 5EJIA 3VAAA 4ETMA 2AJDA 3ZWAA 3OBBA 4J0HA 1IWPB 1KAGA 1SXIA 3LQFA 5HZGA 2IHNA 2J5RA 2H18A 2JFBA 4F38A 2YWJA 2UVQA 3OTOB 3MAJA 2PRKA 4ZO7A 4A23A 4D1YA 3T5GA 4KPUB 3CUUA 3MWEB 2F3TA 4LPSA 4OHFA 2EV9A 4URXR 3NVMB 2YMQA 3KPJA 3SQDA 2QQGA 1LWNA 4YK7A 4MKIA 4L74A 2JLBA 3WWEA 2X7XA 4FZJA 2XUIA 3UW3A 1H6BA 4IRUB 4FMCB 3VPXA 3ZKWA 2X8WA 5AW1A 2FE4A 2ZE7A 4HP8A 3S5UA 3F7NA 1P2GA 3TD9A 4UD2A 1UT5A 3RLFA 3OMXA 2PVSA 3HWRA 4PC6A 4YH1A 1CT9A 3MUFA 3OKFA 1X7ZB 1M2FA 1CLUA 3ZCRA 5D5HA 4J2OA 4A36A 1JVSA 1X9IA 1B3BA 2QP4A 3MC1A 1Y8RA 1DI0A 1EE1A 3W9BA 4ER3A 2BR3A 2JIOA 3CB2A 1JI3A 4FKZA 3FROA 1A9QA 2HRCA 2Z2KA 4Q05A 2AMLA 1R15A 1XJ0A 2O0HA 4N8EA 3SYLA 3B1KA 1ZCZA 5IABA 5ANRB 1GDHA 3OLYA 3KOMA 3V1TC 4CG3A 5KIAA 5EXTA 2VHTA 2I6GA 2GCOA 3I4FA 3HKEA 3L6BA 3I0NA 4MGZR 4D46A 3ELYA 4TVOA 1NKSA 2IXAA 4Q3DA 3ZQ4A 3GQVA 2NZYA 4G84A 5JEDA 2BI8A 5ALFA 5EKXA 1PJZA 4FGJA 1RRCA 2FPOA 2NUPA 3AJDA 5KC9A 2J4CA 5GAJA 1H3FA 1XP8A 3O9VA 3J7AC 4HWKA 2I6UA 4F45A 1IONA 3T7TA 2VTBB 1FA9A 2E2WA 2Q5QA 1U2TA 5F9HA 1JWLA 3NMUF 1X1QA 1VFPA 1RHMA 1YDMA 2HA7A 1ZIYA 3X1KA 1XTIA 5F7OA 2PMCA 3B6EA 5C8YF 5JW6A 3HDJA 2CBXA 1XU4A 1FMFA 3DOCA 4EHJA 3ZHVA 3GCXA 3ENKA 5ITVA 3RIMA 2GCPA 1QVWA 3RUDA 1P2TA 1UOOA 1YQWA 2J4FA 4NEHB 3CISA 1L4GA 5J5VA 3MTAA 4QFCA 4AUKA 1LDYA 4I5FA 4YALA 4CRWB 4ZYYA 1NYRA 4WY5A 5J59A 1N2CE 1F3OA 3UGTA 3VPFA 3VPHA 3L4BC 3IT3A 1Z5NA 4LZLA 5HRAA 3BT7A 4TS9A 1UR5A 4EY8A 5FLYA 1DAMA 4BQEA 1OQAA 1PEKE 4RU1A 3URKA 4BNJA 1RXCA 3DT9A 1C9JA 1U2DA 2ZAIA 3KFXA 2C7OA 3O8DA 1E3EA 2I2CA 1TRKA 4O2RA 1PKXA 4QBGB 2Q0HA 4KIFA 1SELA 4FFNA 5CVJA 4P35A 2XQJA 1VG1A 3RFVA 1HV8A 4M3NA 4Q3AA 3ZQ6A 4B2YA 3CNQS 5DPMA 2WLSA 3SHVA 4OQMA 4C6RA 2R4TA 3BJEA 2IS2A 1DTWA 1ULTA 1KHHA 1V41E 3K9LA 3SZ3A 1M0SA 4PRKA 4JJEA 4NICA 2AJLI 2CZGA 2JK0A 4Q37A 1GCOA 1P73A 1QVZA 2IZZA 5SYMA 1L1RA 2H1CA 1J0XO 4MQBA 4BRZA 1I7QB 5DGHA 1Z17A 4RF4A 4F2DA 2XWSA 3DFFA 1PR4A 1E6EA 1ZRMA 4DIBA 1XEFA 3EARA 2QQFA 1DQZA 3GDFA 1LH0A 4G01B 4AB1A 4YONB 4XIGS 2B35A 3ZHXA 4BYGA 1GRCA 1TO1E 4N3BA 4ISBA 1VP9A 3U7QA 3HBLA 3BEDA 4QRHA 5LBUA 2P6PA 4MRVA 3ER6A 4L4UA 1O89A 4IDBA 4GQBA 1AF7A 1E5VA 4V3BA 5J47A 1OROA 1B73A 1RM5A 1XYVA 2HLHA 1OR8A 2LCIA 3HA2A 5ED0A 5C5IA 3S28A 4Z4HA 1U4NA 3V7WA 3E5RA 1Z8FA 1NXTA 2J07A 3T5MA 4DSAA 2HUPA 1IK4A 1H0HA 3DUFB 5JWHA 3QA9A 2GO7A 3VYWA 4YAOA 1HT3A 4EKEA 2HF8A 1MKYA 1ZSVA 4Z2AA 2QXTA 3LGSA 2IEZA 1RPTA 1CJBA 3H2SA 3VC3A 3AOGA 1R9NA 2OZLA 1JFRA 2P65A 1WETA 1CQJA 3DAYA 3NETA 2KI5A 3NNNA 3U5ZB 2UZ1A 1G59A 1NR7A 3BS4A 1H6CA 1USUA 1EZ4A 1RMYA 3LVFO 3O2QB 4LZJA 5AVRA 1ZHFA 1H2YA 2IEBA 2I34A 1QVAA 1I33A 2Q99A 3ZWKA 4EI8A 2PUGA 2D00A 5ARCA 2VTKA 4H60A 2Q6OA 3VKWA 4D57A 3DDOA 2QMHA 2M6SA 3OY2A 4WXMA 2X0NA 7ADHA 4LRQA 1XCOA 4F4JA 3L7AA 5LQDA 4Q93A 3H0EA 5AW8A 1GTJ1 1W29A 3K4QA 1OWLA 1M2EA 2DUJA 2R86A 4H17A 3SM3A 3AT1A 2O1WA 1E3SA 1H2XA 3E22B 3NIWA 2A6PA 4DCOA 4ZTUB 2M6KA 3W05A 2AG8A 3RTDA 2FMTA 3DPIA 3LCRA 4MWZA 4Y6PA 5ESXA 1DBRA 4DZTA 4N40A 1E2IA 2C7RA 3GVHA 2NO6A 3TLCA 2AEFA 1NVUQ 3WDMA 1KQOA 3LKBA 5DNAA 5D3ZA 1Q0TA 5DSXA 3PITA 4I08A 3DDHA 1J97A 1XZAA 3M4ZA 2C4UA 3HU1A 4NFYA 1RXEA 2ZSAA 4QLOA 4G86A 5KNBH 2CLSA 3B9QA 3U5TA 3FIUA 4JYCA 5JZMA 2IU6A 4G36A 3ICCA 5BRAA 4ZOEA 5EEHA 4U8HA 1KWKA 3ZI7A 5FF9A 4PGFA 4GX1A 2DWOA 4HNVA 2FSFA 3OECA 5BWLA 1LNQA 2D1SA 1P7WA 1EA5A 1ZXBA 4J16A 4ZFNA 3FRIA 4NS4A 4P3YA 3EFBA 5CUQA 4LXUA 3M6WA 5L45A 3KQWA 2XOXA 3Q7PA 4Z9FA 3EC7A 3RTCA 3LP8A 3RVBA 3IOMA 2FZGA 2F3UA 4Z0HO 1O96A 2GZDA 4F6LA 4DZZA 1KZ1A 1PEAA 1T6XA 3WKEA 3RRJA 2Z5GA 4PZCA 2JD1A 1YDGA 1SZDA 4LDJA 2EZ9A 4RPGA 2E0IA 4KXXA 2IZ0A 4GP9A 2WNHA 2XMZA 5CHEA 2EDCA 3K1JA 3D8UA 3AF6A 2XD9A 3P5SA 4D8TA 1EP3B 1VE3A 3AHDA 1RHUA 2V6JA 2Z1MA 1VM6A 3ZDXB 4PRZA 5F73A 1EHIA 2YRFA 3BWBA 1DLJA 3L18A 1J5EB 5DX0A 1XQYA 3F6EX 4D98A 4W8HA 3P2MA 1L4NA 2QRPA 5K20A 5F21A 1OLUB 4DV5B 3OOWA 4ODIA 1QGDA 4RXTA 4DUYB 2FPRA 3LU1A 4J6EA 4NX2A 2L17A 3FBTA 4MHSA 3WMRA 4DYDA 1A0OA 1PLLA 3OZ7A 1U02A 4FFBA 3SJCA 1O94D 3JASB 2OE2A 1NBEA 3DYVA 1JDNA 3L04A 1KIAA 4B43A 1DMRA 4WX2B 1K1EA 2NVBA 4HDKB 4O4IA 2LVBA 2PSSA 4V0LA 3AO0B 3JZAA 2Y1XA 3LCMA 3ORYA 4A0QA 4HEJA 1NPYA 5GM1A 2O05A 1H6AA 4ICIA 4R7TA 5LCXA 3VYVA 1KU0A 3X2EA 3MRSA 1K9VF 1ZHOA 2YVKA 1HLDA 2ZETA 1G8GA 4A8PA 2XCUA 3JD2A 4FDUA 1YR2A 5JNSA 2C92A 2FOIA 2YOGA 4Y98A 4WNCA 5K03A 5TMPA 1ZBDA 4UMVA 2O8FA 2BIFA 3FFBA 1ZFNA 3GEIA 4EQ6B 2PKQP 3RT1A 4EPTA 2RGEA 1NF3A 2OECA 1KAQA 3JQPA 1AURA 3K94A 4HUQB 2KX7A 3HJFA 1PNOA 1GTL1 1PNTA 1R0KA 2C3YA 1P5RA 2OB2A 3GGDA 4KRGA 4A4DA 4IZHA 3JQ6A 2EC5A 5HBGA 3KJQA 5TJ9A 1AMUA 4IV5A 4GM0A 2GDJA 3DBRB 3F1KA 1R3UA 2H1VA 1CUGA 5EOVA 1IZZA 3DWFA 4JCCA 2GPNA 2ZE6A 2UZ1B 1GR0A 2IYOA 4JQZA 4IIVA 2VCHA 2ODWA 4RESA 2FR1A 4K8OA 3FHJA 3QQPA 4OA8A 3RC8A 2WBLC 5JSHA 1LSJA 4YCLA 2CXNA 4E5PA 2BN4A 2H2WA 4IIDA 1V6CA 4FN5A 3P2YA 3V1NA 1L5RA 3MQFA 2IA5A 1NBIA 5EHXA 2DJ5A 4I99A 4BJ3A 3TUZC 3ZH2A 3V55A 3S7ZA 3L4EA 4KXLA 3ZU5A 5IULC 4JLSA 1C9KA 4D9MA 1VJTA 4RC9A 4TRRA 5P8WA 1IG3A 1RRMA 2E18A 3O91A 2ZT7A 3B53X 3WL6A 1TU0A 3EH1A 1L4YA 1A5AB 3HB5X 5EQDA 4A15A 4X54A 4EUKA 1XDUA 2HMWA 2PT5A 2ZBRA 3ESQA 4IF4A 4Q18A 1KEUA 4KBFA 1V71A 4LFAB 2OQIA 3GJ4A 1DRWA 3HDYA 4MICA 1Z36A 4CHGA 1DMSA 2BP7B 2NLOA 3VHRA 3EDMA 1Y4UA 3GELA 4KWIA 5K0FA 1GPNA 4JUIA 4BFTA 1MOQA 2R96A 5HQJA 5CTJA 3RHZA 4CQMB 1CQPA 4LRWA 2AN3A 5CCXA 1LLDA 2D8AA 3OE4A 1Z5VA 1M0TA 4OLFA 5IM4A 2PUTA 2W6NA 2PZJA 3RGWS 4C7BA 2WNSA 4I66A 1IY9A 1N1DA 1NWCA 1IN1A 1F06A 1Z0UA 1N2SA 1JS1X 1UH5A 3SS9X 4QM7A 2FSGA 1OH7A 1PIWA 2QX4A 4J94A 1EGMB 4YP6A 4CTOA 2C82A 3N8DA 2YOHA 3F4KA 3DFKA 4N0PA 2G08A 2X8JB 5GZ3A 1LBSA 3Q2OA 4NFSA 5KWJA 2JGAA 3CWCA 1N0VC 2REOA 4WBNF 2Z3WA 4TLAA 4YAKA 3FSEA 3KKZA 3NO4A 3SF0A 1BCSA 2XE7A 4P0QB 2P4QA 4NBRA 3M1LA 4FMCF 2FFHA 2ILTA 3JQ8A 1JXOA 3A32A 3FNGA 2LR0A 4P93A 5B1IA 2JGMA 1PGQA 2IY7A 5TSDA 4WECA 3PRJA 1RKBA 5B7PA 3DWGA 3C6QA 3VKUA 1V16A 2FQWA 4CFSA 4DTCA 4PXSA 5BPHA 1M7BA 3ANLA 1X7XB 3IP5A 1PI3A 5EKSA 3T41A 5ALEA 3BMNB 1F14A 3MN1A 3F49S 4EHBA 3N0WA 1KBOA 1QG0A 2DHQA 4BLQA 4RHTA 3R6DA 1MD9A 2K5UA 4OH1A 4V0SA 4CGZA 3THYB 4D9CA 3PQDA 3ABSB 4F96A 1UQRA 4WERA 1MB4A 5DTJA 4D5GA 2HB6A 3CVWA 5BV0A 2PT7A 5KTMA 4ILEA 3EZ2A 4IUDS 4B3HA 1EEHA 4RL4A 5EA2A 1TEVA 3FVTA 1XUOA 3EYWA 2XDQA 2BDTA 5KHAA 1SB8A 1AS2A 4W7SA 3USES 5CX1B 1RC1A 4A92A 4RW0A 1ZS9A 1XTZA 1WCV1 2YFYA 1YDFA 2NZXA 3FSGA 5G3ZA 1Z5UA 1ZI9A 1ZVQA 3IAHA 4P2GA 1CXZA 3QI2A 4RVGA 3KFVA 5KWVA 5I5EA 1OKKA 2B61A 2X41A 1I8TA 5IHXA 2ADOA 1ZWLA 4YRNA 2ZB3A 1TA9A 4MWCA 4AJ2A 4DUZB 2GR9A 4KPFC 1CS0B 3F67A 3N1UA 4E30A 3ADOA 1SH7A 4RHEA 1USIA 4UHDA 3V4VB 4MB2A 3X1YA 4WOBA 2LW7A 1A4XA 1QTQA 3NEYA 1VIVA 1QMGA 3K09A 2G88A 5G02A 4R84A 3S2ZA 4YO7A 1LNSA 4MR7B 5EZSA 4P98A 2QRKA 4QUJA 1DAIA 3VHXA 1EX1A 4ACAA 3T5TA 1SUSA 4C3OB 2H54A 2EAUA 1NAHA 5HW0A 1YE3A 2BJHA 3LRTA 4GLOA 4HN9A 1I2CA 1E2DA 3EIXA 4U7JA 3UQZA 5CGQB 1WF6A 5IU6A 2ZTLA 1D5CA 5FUYA 2GEJA 2QRJA 1PFYA 2TRSB 3ZE8A 2LCFA 1FNMA 2B6NA 1CVLA 5DGIA 4CQNA 1TZ2A 1V1RB 1J90A 2XMQA 1RFGE 3SKVA 1LJLA 4O4LF 4E46A 2WI8A 3H2GA 4UC0A 2JLQA 3IA7A 1S2NA 2X5NA 3AFNA 3S2UA 4OKNA 4K6MA 5A05A 4ZQIA 5G4KB 3PFGA 3D3QA 1PGOA 2C61A 1UOEA 3DGEC 3FWHA 4HEHA 4V2UA 5DHUA 2OFFA 1BS9A 1VYVA 2IVZA 4M1MA 5EPUA 4I2VA 1A71A 1T5OA 5IN5A 3W2TA 4ENTA 2P78A 2VAWA 3LWDA 3NRJA 3L7DA 4P0TA 3KTDA 2Z6UA 2EXXA 1I9CA 3QVUA 1QAMA 1W88A 4LRUA 5FI1B 2BMFA 1BHO1 4IZ6A 1Y42X 3DB2A 4GZMA 2I91A 1NBHA 4E6PA 4X41A 1VRCA 5ED4A 1QU3A 1G8PA 4JOCA 3SHWA 1U31A 2NG1A 5FBRB 2P69A 2V5VA 2BZ1A 1GARA 3TB6A 4UZFA 5ADHA 3ICEA 2DH5A 5G0VA 1G63A 2EP5A 2O8CB 1NQXA 4ZARA 2ZT6A 2PE5A 3TINA 4K81B 4CQJA 3VR4H 2VH1A 4KLRA 4AF7A 3WNBA 4ZIRB 5HRUA 5AK6A 4ENUA 2DRIA 4RFSA 1A7AA 2GO1A 4JT2A 1AXGA 1QMPA 4N47A 4B31A 3OIDA 3D8TA 2V59A 5CK4A 3MTEA 3JYOA 5DSTA 3IUNA 5LVAA 3VYRB 3ZDCA 3RKSA 1OB2A 4Y2XA 1JQKA 1D8TA 3AR9A 2VOJA 2DKOA 3M6LA 5TE9A 3YASA 3CSDA 3FPHA 4QICA 5L3QB 3S81A 4C6TB 1LF5A 4DPKA 1JEYA 4PLGA 3OEWA 2BMVA 3H2IA 2VSYA 4ZCSA 5J40A 2J5BA 2O2XA 3M3DA 4EAAA 4HNTA 1ACMA 5HX7A 5AOVA 3BZWA 3D7KA 1NUHA 1VL2A 3M5WA 1RNLA 2ODEA 4KO3S 4Y6GB 1YU6A 4BNXA 5A1JA 2COEA 5KNBD 1E66A 5IT5A 3LDAA 4GMXA 1IDN1 1COWD 2YJGA 2JAHA 4JLDA 3R3SA 4KHPB 2LZ0A 1NJ8A 3CTMA 4JJZA 4N76A 3K2QA 1EFRD 2DTXA 2GWHA 3B6ZA 3DTYA 3JQ9A 3QV1A 4CQMD 5C1DA 5CFOA 5FBVB 3RYIA 1GSOA 4E08A 5CIQA 2QT1A 3OE7D 1A9XA 5EVJA 1B8UA 3W8NA 3ZTYA 4LY3A 4AN1A 4CDMA 3E3NA 3SAJA 1MGPA 1L5NA 3F47A 4YCMA 3H6KA 1XMVA 5CFMA 1U3FA 2BEJA 1P75A 3BB4A 3LL4A 3ONNA 3TW8B 3H2JA 2Y2VA 1CUAA 4GNRA 5A4FS 4CLRA 3HU5A 2DOKA 4FYHA 9ABPA 2P9JA 1A3CA 3ZDBA 1T9ZA 4MKGA 2W6OA 3FWYA 3H9UA 3SQOA 4OFXA 2FH5B 4AZWA 4FXPA 4UUQA 4XB6B 4XUGB 7AT1A 2FW9A 2BGTA 1DEXA 4L6IA 2XQGA 3L4SO 4O2BB 4ZEVA 3NP9A 2NM0A 1ACLA 3K32A 2QTFA 4PLPA 4X1YB 4GW3A 4BVJA 3OTHA 5LZ9A 4HRVA 3AX6A 3L0ZA 2D1YA 4HNAB 4P80A 2Y3IA 4M0EA 4RMJA 4B80A 5I7FA 2GN6A 3CT6A 2AOXA 1H4SA 3AIKA 1SBIA 5HCIA 5JXJA 1DBPA 5EJ8A 2ZBVA 5FUVA 5J63A 4P83A 3DT8A 3UEOA 2G07A 1ZJJA 1DIHA 3L6UA 2DBQA 3PHIA 4KXUA 4R8LA 2AD1A 4HDNA 1ECBA 1Z5PA 2WYHA 4J76A 4RVUA 3W1EA 3OURA 4L28A 4NYJR 3CCCA 4NYIR 4TLBA 1VHQA 5K3AA 4RM2A 5FR2A 3TBKA 3EDCA 2Y9PB 5JRZA 4W9RA 3GGPA 3MAAC 3P0JA 3Q1KA 1TJYA 5DBOA 3W4IA 1ILEA 3QKRB 1Y3DE 3WGLA 4TT8A 1U0JA 1FF9A 3OA2A 1R0SA 2QG9A 3ZGZA 1IOWA 1UBFA 3PHCA 2YJ6A 1RP7A 3DLCA 2D62A 3GFFA 1H69A 1L5HB 2Q9CA 4MA5A 5I5GA 1GPBA 2C2BA 3COJA 2E21A 2VUUA 2XUFA 2E3JA 2YHUA 3IUPA 4YGXB 2DYKA 1H2HA 1HRDA 5DO9A 5FO1A 2AN1A 3RFUA 1INLA 3U7JA 4MYTA 4AN4A 1R6TA 2PLFA 3ZDQA 1CF2O 5AM5A 2QQ0A 4IKPA 1XAIA 1B2LA 4AJJA 4FGZA 3PEYA 4BNUA 4MJLA 3DD5A 5KNCA 1O94A 3EF1A 1CR0A 2A0WA 3DDNA 3GEMA 4WFIA 1QHXA 4FOPA 4AROA 2WYUA 1TDJA 3LBAA 4RE6A 2OLJA 3WLJA 3M7IA 3PGMA 1NF9A 4CDRA 4BVLA 2P4EA 4OH7A 1I1OA 1T0HB 1GGFA 2QW0X 1R7RA 4L07A 4L4SA 4C4YA 1SKMA 3HHPA 3DBHA 1FXUA 5AQEA 3OZTA 2HM7A 2W42A 1JALA 1DJLA 3MJHA 5JE8A 1XZKA 3OCJA 4WBNB 1ADGA 4OBEA 4JI3B 2WM3A 1Z82A 4GUAA 3O8CA 1YQUA 4HWSA 2I9KA 3AYXB 2E4XA 4GRDA 4RX1A 4XYMA 1Y7HA 1G5IA 2P0AA 3E03A 2FV8A 4RIFA 1Q6ZA 3HM2A 2Q62A 4XCQA 5BUZA 3PL5A 3HKDA 4BJ5A 4XIIA 1EVYA 4DNQA 4BB5A 2VXBA 2PVPA 4K9SA 1RQGA 2I7CA 1W0JD 1CLEA 4UUBA 1XZBA 1E58A 3CRVA 5CRIA 3UYLA 1JFTA 1ZUIA 1E9SA 2DFPA 2HUNA 1VB3A 1YKSA 2IF2A 3CBGA 3KQYA 1UEIA 3ZJ4A 1RMTA 2HU7A 2OORA 4DJTA 1HKHA 2G5CA 2QRGA 4UFNA 5FLEX 4CKBB 3HRIA 3HVIA 5KYTA 2WJ6A 1XCBA 2RFLA 1PJ8A 2C1EA 1A72A 4MYHA 3VFDA 3ECSA 1DT5A 4CQLA 1PNRA 3OT1A 2I62A 5CB4A 5LQRA 4E5YA 4C7XA 2I1QA 2JFWA 1KMNA 1RPNA 3DT6A 5I9LA 4V1CB 3A3YA 1C8VB 3GRFA 1UBLS 2HBRA 2QQ5A 3N5KA 4YJGB 2WHQA 3RRYA 2DB3A 4RANA 4TTSA 4IQ4A 3G1WA 5KTSA 1P9RA 2VDLB 4JOQA 2RAPA 2MYPA 4FFOA 2WTNA 2XMGA 4HQNA 2ZULA 2E4AA 4D3FA 2GS9A 2M98A 4XB1A 2FMXA 1VG9B 2WKSA 5D01A 1JG7A 3USZA 3U7IA 3PJEA 3ESYA 1D4ZA 2W2VA 4R01A 1I5RA 5TQ2A 3R8CA 1HZZC 1DFIA 1YJAA 2W2KB 4KAFA 5F1PA 4EIWA 3SZLA 4JC4A 4LEIA 5C80A 4C2TA 4OXNA 2P7IA 2ZJOA 4LV5B 3W6NA 2VJOA 2XTAA 3FLBA 2AI2A 3C6YA 1C81A 2WD7B 4UEOA 5BR8B 2R60A 2QPOA 3SKYA 4J0KA 2DR2A 3EEFA 4Y2HA 1Z88A 1DADA 4L9SA 4C06A 3AFHA 2GKGA 3I9LA 3TIIA 1UZLA 3K9WA 5HZMA 1KI1A 1XD2B 1Y98A 4LF8B 4EMUA 1MO6A 1ITZA 3H13A 3IUQA 1AV6A 4UCXA 1OZAA 3HWSA 2Q4TA 1ZHHA 2OESA 4QPDA 2ACKA 1X42A 1FBNA 2XLCA 1USWA 2ZKIA 4TMXA 3VJMA 2H4WA 1CY2A 3B3GA 4HO1X 3SWWA 4KE7A 1KVTA 5GMOA 4L3OA 1C0PA 4O25A 2C9OA 4I3GA 8LDHA 2PUAA 3QLUC 1A8PA 2RHMA 1VBKA 2JJ2A 4LCJA 4ENRA 1CU1A 1GKKA 3U3ZA 2QSYA 3ELWA 4LECA 4ZO6A 5FI5A 4Z0TA 1KQNA 3UY4A 3VU9B 2CWWA 4L3WA 1H0SA 2AR9A 2IXFA 3P26A 5U4QA 1PJ4A 2VQSA 3MIIA 5LQUA 4RULA 4KWTA 3ZIAA 4EFKA 3GRPA 4URUR 1XTKA 1CZOA 4O4LB 1NJ5A 1VBFA 3LUJA 3K1AA 5DM1A 2ZJ7A 4BYMA 1UT6A 5PNTA 3KYDA 2JCBA 4WZBA 3HL0A 1T3LA 2I55A 3IUEA 1E94E 3JD1A 1C1XB 2B30A 2C4MA 4M0FA 2PNFA 3L6EA 1AKEA 5EN4A 2DR3A 1DDIA 1P61B 3VR6D 4AJOA 3QPBA 3TFQA 5T4HA 4CIVA 4AYWA 1GNTA 5DRTA 2CXOA 1PVDA 1WXEA 2QLNA 5JLAA 4J1SA 4FFBB 5FEMA 2VLIA 5HIIA 1M2WA 3KDPA 2QMOA 2G5TA 3DLTA 2JK1A 1OZ0A 3CY6A 1TZJA 2C7BA 3G2HA 4LBVA 3BL8A 3WGTA 3LP6A 3MOGA 5K8LA 2D5AA 1CX9B 1G6OA 2O8BA 2Q27A 5I7WA 5BR4A 2I2BA 2PXHA 4A0SA 1LV8A 1MVLA 1E7MA 3E7PA 2NXJA 4QU0A 2ASEA 1DQYA 3TNLA 3EFOA 3UJNA 1J07A 3FYSA 1Z33A 2PKWA 2RGWA 5G4LA 3U40A 3ZHZA 3KZNA 3RARA 4IQ0A 4M1KA 2AJCA 4LWZA 3O8BA 1J8VA 1G20B 5D3MB 5BV1A 3KVOA 5G3YA 4LOIA 3JATA 3TRKA 2XCOA 4ME6A 5HYVA 1XZIA 1VL6A 3LWNA 2AA3A 5DLQC 4MRMB 5A5EA 1N3BA 3KEQA 1K7EB 2IYXA 4EYEA 3GR6A 1VE9A 4WN9B 3IIMA 1D2EA 3VR4A 3EIQA 4N41A 2YICA 4JL6A 3T3IA 2BTQA 1E1YA 1U3GA 3ZI0A 4DANA 2JFOA 3OQJA 4BV8A 4CF5A 3R6GA 3A7EA 1S3SA 4EZEA 3FMGA 3U4AA 1THMA 3TAHA 5BSRA 1T5IA 4DLUA 3WLSA 3KSRA 3THXA 3K9QO 2J32A 1RWXA 3KR0A 1SCUA 3GGCA 2FPIB 4OHRA 1P5FA 3Q9LA 3PQEA 1QHSA 3FX2A 4GOMD 1J39A 2YR0A 3O94A 5AJUA 3S2FA 4EABA 2DERA 3LUDA 2JIBA 2OXFA 3V1YA 4WKBA 2VSFA 1O87A 1O9GA 5AI0A 3PQ7A 4R81A 4PG6A 1OX4B 2OV8A 3R9XA 1EBUA 2NUBA 5I9MA 1F7VA 4I9NA 4WE3A 1U7TA 2NACA 4X6UA 2BRUA 1XL1A 1VLQA 2IE0A 2PLWA 4MW1A 1N33B 1C9NA 4I55B 2OHXA 4FYJA 1BMFD 3GLIA 2OP0A 5LP6C 3IP6A 2E1RA 4PC7A 3T3MB 3L0CA 5CX1A 3JVIA 2BUAA 5GJWC 1JWBB 4YUXA 3UATA 5AM1A 5JO0A 1ZWKA 1D0SA 2GEDA 3A9CA 3N76A 1Z0ZA 2WTEA 4M1SA 5H81A 3U2QA 5CG1A 2BW0A 1RHKA 3ZVRA 1M76A 2AFIB 2GDZA 3HN7A 1JIUA 1MRNA 1ZMBA 1Q91A 3AHEA 3KQTA 4GPZA 4NENB 4KB5A 4LPKA 1TMKA 1YL5A 4ZZ3A 4Q3OA 1ADFA 3OKPA 2WD7A 4MGYR 4US2R 1J42A 4L2IA 4LA4A 4LNHA 4MV5A 3UH0A 1ZUD1 1V3TA 4KR0A 3G9UA 1OSNA 5LXTA 2JLUA 4OIMA 2FQYA 2QTGA 3E0XA 1DAGA 1EP2B 3ORFA 4PX2A 2X86A 5HP4A 3WNDA 1BHSA 3VPDA 4E07A 2CLFB 1KEZA 4N82A 1QQ5A 1RAHA 4WXEA 4PLHA 4D25A 4AX4A 3F73A 4OD0A 1XQXA 2GYVA 4MR7A 4KVAA 5B37A 4ESHA 2I5PO 4MVJE 1T4CA 4TZKA 2FAXA 2LE0A 1BN6A 5EZYB 1E3LA 1UPXA 4G25A 4YROA 1JBEA 2AZTA 2C5HA 1YZLA 3GO4A 4CN9A 4JDUA 3CURA 1SOVA 4A2QA 2QN2A 4QDUA 1FUEA 3R3JA 4TTJA 1QF6A 1VFNA 3O3CA 5LKRA 3HXOA 1PFQA 1Q1QA 3W3ZB 4UBMA 1AGRA 1FB5A 2M1ZA 1TIPA 2J67A 3A1FA 3A6KA 3JW8A 3EW9A 4Q3KA 4Y2TA 3IULA 5A7GA 2Y0BA 3H6GA 1TT5B 2FI1A 2EATA 3HO6A 1UBTS 3NJ8A 4H3SA 3MLEA 2Q5OA 4R2JA 3DKVA 1VKNA 4G8JA 1AU9A 2XB2A 4GYWA 4LQ4A 4OSEA 5EQFA 3I2JA 5JJBA 4Y2PA 1ZQ9A 2EDAA 1Q16A 5CGZA 4AJ9A 1WHTA 1E98A 3NHBA 2Q3LA 2WK1A 1NW5A 1V7QA 2WUVA 3H5OA 2FW6A 5KHLB 1JPVA 1PVOA 5G40A 4M0CA 3SBXA 4GHWA 5I4CA 4GI2A 4D4KA 3BXFA 4CXMA 3PF8A 1A9OA 2WPDD 3AV0B 4MCHA 3ICQB 1MQ8B 1WBJB 1VE6A 2C2MA 4A26A 2F7SA 4K05A 3L4BA 3KDSE 3MVEA 4MUIA 1OFGA 4UBJA 1UT8A 1PAUA 1W46A 2ZWMA 1LK0A 3AHGA 2QL6A 4OLAA 3ONVA 2GD1O 4R2WA 4XCVA 2YW9A 1XV5A 2CFOA 3AKCA 3SDSA 5EUMA 1STOA 4HR7A 2MSWA 2JJ1D 3UT5B 2FR0A 4KQWA 3QIAA 5FTWA 4B32A 4B2LA 1NUTA 4E3ZA 4UTRA 5G0TA 3DD1A 3RYHA 3EVAA 3U49A 2YVAA 3VZCA 3IKLA 4RVHA 5GP1A 3B70A 1LCIA 2BGNA 3QZUA 4H4CA 2R6ZA 4G8CA 3IE0A 1AKYA 4Q03A 4CLRB 3KXIA 1OXKB 2ECQA 3PYLA 3QFRA 4XD7A 4BOYA 4AJ1A 4N7MA 4RMHA 3PXCX 4UTPA 1NUUA 3FETA 2FPIA 3DQZA 5IDVA 5CIYA 5IJXA 4KLNA 4OKSA 1QFXA 1TB4A 2XKJE 2BFBB 4Z8YA 4Z9YA 4FIDA 3MWJA 4KMMA 3M6AA 4BKPA 3MSXA 1QAOA 3I53A 4MV0A 1VSTA 4L85A 5DM2A 4OVKA 4TSKA 4C4ZA 4ER6A 1QCCA 5BT8A 1HNNA 3U60B 2ZJYA 1NAIA 1P1CA 1EZZA 4HRAA 2QZ9A 4KOAA 3E7XA 4R1QA 3CRZA 1D03A 1PLKA 4UNQA 1RXYA 4LXTA 1M6VB 2I65A 1T3ZA 4BLUA 3AXTA 4F3YA 1EFTA 2EFYA 2GERA 4C0HA 3EMDA 3GL9A 4Z3KA 1NFFA 3A1WA 3VR5A 3O3NB 2GMWA 2VTEA 3IDOA 1D8AA 2CL7X 4OAQA 4P2BA 5TQ0B 1ZL0A 1ZPDA 2FEAA 4EG8A 4RTPA 1GCAA 4AS2A 3UWMA 3ILSA 1GZHB 3SSMA 5BYKA 1I94B 4WXPA 3AY7A 2IJGX 3KLMX 4OM7A 4NPCA 4KP7A 3C7KA 4ED9A 3GU3A 4Y9RA 2BCEA 2AWOA 4K26A 2I4TA 4Y6OA 2M6LA 2D2XA 2FMHA 2BEWA 2E4WA 2IWRA 2RGXA 2O8DB 2OD9A 2PMBA 1CK4A 2JH9A 1UPBA 3HLTA 3IBFA 4NONA 3IOEA 2AT1A 3HLKA 3AM1A 2JI9A 4PR0A 4EPYA 3H2BA 2HR1A 1GA6A 3EFEA 3EUWA 1P9NA 4HGOA 5TS3A 2JEYA 1YL6A 1KAOA 1J24A 3I37X 5KX5B 4XD7D 1WDMA 1X6VA 4HADA 1W4CA 2H4HA 1LTHR 1DWPA 1MHPA 1QV9A 2BR4A 2CUZA 4IF6A 1QRAA 3AGPA 4MV9A 5IKMA 3AJEA 2XD4A 3ZLTA 3BRWA 1WV0A 3RUPA 4DMUB 1MDFA 3GARA 3V9PA 2FEKA 2APJA 4RY2A 5EKUA 4YJ2A 4G5QA 2ATEA 3SC2A 2PA3A 1XJCA 4MOWA 3IP9A 4IXTA 5CPFA 5F51A 2BFAA 4RPCA 4Y1EA 5CMLA 5JAIA 3IKTA 2WTXA 5T57A 3BWEA 3RSOA 2WILA 5DI3B 3O4RA 1L5LA 3N87A 1VPTA 2A5DA 3A6ZA 4INOA 3RBVA 2I66A 4H7DA 4LN1A 4TV9B 3TPCA 3DZIA 4AYTA 4JZYA 2WTUA 3VDXA 3KSZO 4HMOA 4ARVA 2AXPA 4HKTA 4G0YA 1DHRA 2VPWA 3NM6B 4ZOCA 1HOTA 3KSAC 4KLAA 1YTLA 2DQSA 1U9IA 3EGDB 5KNDA 3VSAA 3QNMA 4C78A 3UK6A 3S99A 2V0GA 1KBZA 3T9CA 5BXQC 1M6HA 1AUXA 3H5IA 5JAUA 3E4DA 3ME5A 5TEVA 2AYZA 4H7FA 1NZDA 2JEOA 3JXEA 4J0IA 4XJSA 3SQWA 1N77A 2CHVA 5KQLA 3I23A 3I34X 1QO9A 2BSAA 3UFBA 4ZGWA 2JCXA 2V3VA 3REQA 4H1UA 4CM7A 1Q7CA 2CVQA 3A27A 5A04A 3TSOA 1A96A 2J4DA 3QXCA 1E69A 1OWMA 3GLKA 1TF2A 3CLUD 4KQIA 3LQ4A 3OZRA 3PR2B 4OKIA 4ZT7A 1SPXA 1IAVA 1PO7A 1QCDA 1ZGGA 1PS9A 1RCTE 1YO6A 3JTMA 1FUIA 3FMVA 4OPMA 4RSMA 3SJ7A 5I45A 3FYUB 4J8PA 1VIAA 2I1VB 4ZA2A 3C5WP 4L02A 3ZHOA 4X7RA 5KNLA 1ZRNA 1CUEA 5EPEA 2D2EA 4U2KA 4XDGA 1XEXB 5DYGA 1MFZA 5C8YA 4D44A 2ZIFA 1IJKA 2LWIA 2X8JA 4NVRA 4BU0A 4CF7A 4QRIA 1GPYA 1O94C 4S04A 1RYEA 2FYTA 2HA3A 4KXQA 3T34A 4RZQA 2OYCA 3ZD9A 1E0DA 1NR5A 4OLBA 3DR3A 4YWHA 4NH0A 2WAXA 4JLPA 1C3JA 4BNNA 5JSZB 2ZUUA 2RIPA 2DP4E 1W19A 3R7FA 3ROQA 4NU6A 1D4FA