3HEBA

Crystal structure of response regulator receiver domain from rhodospirillum rubrum
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
142
structure length
142
Chain Sequence
VTIVMIEDDLGHARLIEKNIRRAGVNNEIIAFTDGTSALNYLFGDDKSGRVSAGRAQLVLLDLNLPDMTGIDILKLVKENPHTRRSPVVILTTTDDQREIQRCYDLGANVYITKPVNYENFANAIRQLGLFFSVMQVPETEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Response regulator receiver domain protein (CheY)
publication title Crystal Structure of Response regulator receiver domain from Rhodospirillum rubrum
rcsb
source organism Rhodospirillum rubrum
total genus 54
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hebA00
2QU7A 2O20A 2NZUG 5TPWB 5CNIA 1Z17A 1JYFA 3HZHA 4OTZA 2ID7A 3A10A 2E4ZA 3FMVA 4YR7A 1D2AA 5EWLB 1URPA 1F51E 3GBVA 4ML3A 3RVKA 4Z4FA 4MS4A 9ABPA 5TQ2B 3LUJA 1TM2A 5CHYA 3TX6A 5ED4A 4YLEA 3NNSA 4MR9A 1FSPA 3W9SA 1BDHA 3N0RA 4JB2A 5JNSA 2ZAYA 1MB3A 1NXXA 3H1FA 3HCWA 4MYRA 2WJWA 2DRIA 3QLUC 4RK0A 4WZZA 1ZY2A 4Q7EA 3N53A 5EWMB 3T95A 4LE1A 2FLWA 2CHFA 3KYIB 4RU1A 1QKKA 4KK4A 5I4CA 3NNNA 2WWVD 4RSMA 2LUOA 3CRNA 3SG0A 4Z9AA 3HUTA 4XLTA 1K68A 4QYWA 1JYEA 4IRXA 2E4XA 4MS4B 4YO7A 3F6CA 4ETNA 3JPYA 1U0SY 4Y9TA 4TLMB 5IULC 4MR9B 3MYYA 4DADA 2HQRA 2QVGA 5IUKC 2YHBA 2E4YA 1TJYA 2GI4A 3LKBA 2JK1A 1QP0A 1JF8A 1FFWA 3CZ5A 2MSLA 3KJXA 4F12A 3EAFA 4EVSA 4IILA 3GYBA 2PLNA 5GOTA 4KVFA 3B2NA 4G0MA 3E61A 4H3HB 2L2QA 5KC9A 3C6QA 1NXOA 3H75A 3MQ4A 3RVLA 5KC8A 4NICA 3HV2A 4TN5A 1JWLA 3MF4A 1ZH4A 4N47A 1Z16A 2VUHB 4E7OA 5DLEA 4KPYA 1J56A 4N03A 1BDJA 3LOPA 4RY0A 3HM9A 3H5IA 3HK2A 3EDCA 3EODA 4FE4A 3FGZA 5KQGA 4DN6A 2PUBA 1MAVA 4O1HA 5DTEA 4XAQA 3KLOA 4KQCA 2NUBA 2TMYA 3QEKA 3JPWA 1M5UA 1DJMA 5KQLA 4Z4GA 1C4WA 3QLVA 4ETMA 2E4WA 1USGA 3H1EA 4ZYLA 3OQNA 4GNRA 5IX8A 4QYMA 3FFTA 1VLZA 1ABFA 5HSGA 1PNTA 1P6QA 3DBIA 1B00A 3HEBA 3LUKA 4P1ZA 5TQJA 1D5WA 4Q6BA 3UUGA 3OLWA 1VPWA 1Z13A 2FN9A 4PICA 5ABPA 1I3CA 2M98A 1YK1A 3OLYA 3EQZA 3IDOA 1RXIA 2B4AA 1ZGZA 1YVUA 1U2PA 2XDYA 5TPZA 5TE9A 1DBQA 2MYNA 2OENG 4W5NA 4L85A 3E3MA 1TLFA 3H5TA 2E4UA 2IDMA 2R47A 7ABPA 2MSKA 3QELB 4RDCA 3QK7A 2A9OA 5JS1A 4D74A 1BDIA 2GKGA 4F8JA 3F7NA 3GL9A 5IEBA 2R4QA 1P8AA 2LPMA 3CNBA 2OQRA 3LTEA 3NHZA 4ETIA 3TO5A 1E6MA 4EUKA 3I42A 3I5AA 4O5AA 1JFVA 4MS1B 1QP7A 4IF4A 2J48A 2FEWB 3OO0A 5FWXA 4LDAA 5JNVA 2PUFA 3T6KA 1MB0A 1FFGA 2FMKA 3IPCA 4ZJPA 1ZHHA 1TVMA 3SM9A 3RVPA 3LUHA 4LX8A 1NATA 3KHTA 4OATA 4NV3A 3SAJA 3CZCA 2M1ZA 8ABPA 3H5WA 2IPAB 3OLXA 4G0YA 2MYPA 4RWEA 5CNMA 2IPNA 3ILHA 4RXMA 3F6PA 5JS2A 3FFXA 1XWWA 4Z4EA 4MRMB 4HNQA 1DBWA 2F8SA 1PNRA 4KV7A 3I45A 4O1IA 5JNWA 3ILYA 3QLVC 3D02A 3CHYA 3KTOA 3SY8A 2WRZA 5IC5A 4UHJA 1CEYA 2R48A 2A9PA 4KRFA 3OO1A 5KI6A 3HJFA 4OLAA 4MQEA 1JLKA 4Z4IA 2IPMA 4GPAA 3A0RB 1YMVA 1PUXA 3K9CA 3JTEA 1D4ZA 3N75A 2I6FA 1DC7A 4N0PA 1YTUA 2NZVG 1BAPA 1PEYA 2W42A 3KLNA 4N76A 3KG2A 3BRQA 3OLVA 4F11A 1RXEA 1DRKA 4OBBA 2FEKA 3N8IA 3CLKA 2PUEA 1ISSA 3T8YA 1P2FA 2RJNA 4CBVA 1YS6A 1DCKA 4YP9A 1U8TA 2FQWA 1CHNA 5IBQA 4NCBA 4RK6A 4TMYA 5T7BA 2L18A 1RPJA 2PL9A 3HS3A 4EYGA 2JBAA 4WUTA 2A9QA 1GLGA 3LUCA 4LZLA 3IP6A 1USIA 2CD7A 1JFTA 3GWGA 4NCAA 5TPZD 2JRLA 4RKQA 3O2JA 3DLBA 1YIOA 4L4UA 1EFAA 4N41A 5B3JC 4WT7A 3Q7TA 3TMYA 1AB5A 4OG2A 1LJUA 1PHRA 1NTRA 4G97A 2PUDA 4Z4CA 1SXHA 4W5OA 3RVMA 3CU5A 3FFWA 1GUDA 3MA0A 3JS5A 2FSPA 2VYCA 3LMKA 4ZMRA 1LK0A 1XHEA 1D1QA 5D2CA 4RK4A 3MIZA 4KFCA 1JDNA 5DKFA 1YS7A 3KYJB 4S05A 1FQWA 5CNJA 1F4VA 2PE5A 5CNKA 4EY3A 1L5YA 3IPAA 2N9UA 4MQFA 1M2EA 1ABEA 3VNAA 5JNRA 4D6YA 1ZAYA 4G86A 1Z15A 4JA2A 1YK0A 4LDZA 4WWHA 3LUGA 5TQ0A 3CTPA 1QQBA 1DCFA 3JVDA 4EYKA 2E4VA 1SRRA 1SXGA 2MYUA 3MMNA 4N0QA 1WETA 3Q7SA 1QO0D 1XHFA 4EYOA 4G0ZA 1VKRA 2FN8A 4ZPJA 4MLCA 4RXUA 4HYEA 4DQDA 3HO1A 2BGGA 1U04A 3DGEC 1NXWA 4KNYA 4FB4A 2FLKA 2HSGA 3ROTA 5FBHA 5IEJA 6ABPA 2L19A 4KREA 4MQFB 5C5EA 3IP7A 3VNBA 3HDGA 1RZRA 4JP1A 2FQYA 5BRJA 1Z26A 3O1JC 1JX6A 1QNLA 2HQOA 4Z4HA 3UK0A 2Q5CA 3QEMA 3KKEA 2JCGA 3EQ2A 2QZJA 3D8UA 2JB9A 3NHMA 2PL1A 4MS3A 4PYRA 1TMYA 3JY6A 2QSJA 2V0NA 3OMWA 4G0OA 4H3KB 4Z0NA 3DLHA 3RQIA 1DP4A 1EAYA 4WXMA 2AYZA 3OM0A 4HNSA 2PKXA 3JVIA 2MYTA 3H5LA 2L17A 2H0AA 3QLUA 1A2OA 3FDFA 2PAFA 4WXEA 3URMA 2JVIA 4B09A 1Z18A 1ZGGA 1KMIY 1EHCA 4D6XA 4S04A 4YCSA 4HNRA 1NY5A 3DZDA 3N0WA 1JHZA 4Z9BA 1JL3A 1P6UA 1T34A 4MGEA 2HQBA 3RVRA 1QQAA 3QLTA 1JFSA 3RVJA 2FW0A 3OMXA 2X7XA 3HXMA 4Z99A 5KWSA 3QEMB 4JB0A 3GA5A 5EWJA 3RVQA 5FWYA 1W9HA 3RVOA 6CHYA 3IP5A 1W25A 4F06A 3CFYA 3ROFA 4YV7A 3P9YA 3NNDA 4UHKA 3H5OA 3SNKA 1E2BA 1QO0A 2RJOA 2KYRA 3N6VA 2FTKE 4XASA 3SQNA 1Y1LA 2HJ9A 2IPLA 4JOQA 5FWXB 4RK1A 4XXHA 1USKA 1BVHA 3LFTA 5EWMA 3HDVA 3RH0A 4KMRA 2FMHA 4MAAA 1QPZA 2IYNA 3Q41A 5IUNC 1Z25A 2RGYA 4KQ9A 1NXVA 3LUFA 5DCLA 3M6MD 1KRXA 4RS3A 3K4HA 2FEPA 2PUCA 3CG0A 4RZSA 5EWJB 4JASB 1JH9A 3KCNA 3C3WA 5FWYB 3DGFC 2P4UA 2FXIA 3H6GA 4RKRA 1A0OA 4W5TA 4RK5A 3HUUA 5GQSA 3BRSA 3EGCA 2PUGA 5KQPA 1DRJA 1K66A 1U2QA 3GV0A 1QMPA 3Q15C 2FQXA 1YMUA 5FBKA 4RXTA 3A3KA 3O75A 1EWTA 4M88A 3GBPA 4MQEB 5HKOA 3TB6A 3BREA 1Z2DA 3OLZA 1GUBA 1ZITA 2ZWMA 2GBPA 1RZRD 3Q9SA 4RY8A 1LBHA 4MPTA 3UKJA 4RY9A 2QW1A 2RDMA 2LP4Y 5BQ3A 1JBEA 1E6LA 2WJAA 1HEYA 3LUDA 2YHAA 3H1GA 3H6HA 5PNTA 4YS6A 2IKSA 4IMJB 2PUAA 4PZ0A 2B1JA 4W5QA 4YGXB 1CYEA 1EWKA 1OXBB 3F73A 3N0XA 4FE7A 3R0JA 5E3JA 3BILA 3GT7A 3LUAA 3O1HB 4F3TA 3CKMA 1S8NA 1VRVA 3O2SB 2JBAB 4YWHA 5JNTA 4W5RA 1M2FA 1IIBA 2LBPA 4QICA 5T3YA 2CHEA 4IMIB 5JNUA 2JVJA 4PE5B 1LBIA 1LJLA 2GWRA 1ZVVA 2FVYA 4MR7A 2FMIA 1GCAA 1DZ3A 3OQMA 5HQJA 1ISRA 3QX8A 2IOYA 1KGSA 2QXYA 5HM6A 1Z12A 1NXPA 3G1WA 3O74A 4ZMSA 4IGAA 5BR1A 3C3MA 3EULA 4LE0A 4EVQA 1M5TA 1Z2EA 2ID9A 3I09A 2GX6A 4PEVA 4QPJC 4NQRA 3HVRA 2NT4A 3C3KA 4LE2A 3C97A 4XARA 3TD9A 4EGSA 1RNLA 4XFKA 5DGCA 1E6KA 1GCGA 3T38A 3OQOA 3QELA 3LKVA 2PMCA 3L6UA 3HSYA 4MR7B 2QVCA 3M9XA 5BRAA 4TLLB 4G0XA 4RK7A 2WB4A 1ZN2A 4KZKA 1MIHA 4RV5A 3O1IC 1FFSA 2JVKA 1DG9A 1R8JA 2QV0A 3BBLA 4JAVC 4MR8A 5TQ0B 4EYQA 3RVSA 2R25B 2LIVA 3IP9A 3QX9A 4MS1A 1ZESA 2A9RA 1OXKB 1JDPA 1DC8A 4G0PA 3GRCA 3CS3A 3H5VA 2QR3A 4H60A 5F64A 2WMYA 2H3HA 2WY2D 2CWDA 3A0UA 1NXTA 2AYXA 2P9HA 3KSMA 4MLDA 3RVNA 1BA2A 5IUJC 3KS9A 1UDRA 3OM1A 2VUIB 1NXSA 3NBMA 5TPWA 4P98A 1DCMA 2HPHA 2NT3A 4EVRA 4KK3A 1AB6A 1ZDMA 3O2QB 2MSWA 2FKAA 4MRMA 1D1PA 2FMFA 5EWLA 2VK2A 2PJUA 3L49A 5C5CA 3O21A 2F8TA 3Q7RA 3EJWA 4MR8B 4E7PA 3MM4A 1ZH2A 1L5ZA 4MS3B 5TQ2A 1A04A 1SXIA 3M9WA 3G85A 4G0QA 4Q6WA 3S99A 1SD5A 4OLBA 1KRWA 1DBPA 4YRZA 1APBA 1MVOA 5KQMA 4LRQA 1H9CA 1QP4A 5B3JA 1PEAA 1C0EA 3CG4A 1EWVA
chains in the Genus database with same CATH superfamily
2FRDC 4WZBB 3OT1A 5DASA 5LZ5A 3A6EA 4N6GA 3O94A 2G1UA 1SOAA 1VHDA 2WAYA 5CVVA 1D1SA 4J43A 4OH7A 5B53A 5EKSA 4NK5A 3PC8C 4FJ0A 5DYYA 3K9QO 1NBAA 1ZVKA 2X3UA 2XMRA 2XVZA 1NBHA 3FYDA 2VDOB 2Z56A 3EQ6A 1EX6A 1DXYA 4IX9A 3TOCA 2KPOA 4B35A 2Q2WA 4C0WA 4JYPA 1PTJA 4CKBB 3FGPA 3H0CA 5IG2A 1PT5A 9ABPA 4N39A 3TX6A 3RS2A 3WGVA 1JHXA 2F1OA 3DDUA 3IBCA 3OQPA 4B45A 2IEIA 3NHSA 1A88A 3E4DA 4KU4A 3FVTA 4N0EA 3RI3A 2VQFB 1NFRA 4H9GA 1T36A 4O8ZA 3UEOA 2HIGA 3IBYA 1C5KA 5AOAA 4UAUA 4RABA 3CF6R 3AFGA 2DRIA 3HGTA 4Z0TA 3TPFA 3P9QA 3KUCA 3VZCA 1CUCA 3CRQA 4F93B 1I4DD 3Q3CA 4BZPA 1FQKA 4EI9A 1MX1A 4IJQA 2JJQA 4HDNA 5HRAA 1B93A 4CM7A 1K4MA 4R2IA 4DANA 2QUJA 1S8FA 3HUTA 2H48A 2QD4A 1Q5PA 4WOKA 3RT1A 2EP8A 2WIDA 4WZ6A 3TGLA 4U2KA 3ZD6A 4PN3A 3AVTA 1G42A 1Y7HA 4PCUA 2PH3A 2P1ZA 3INTA 4MS4B 3VNVA 3AUXA 3ELYA 2JNWA 2PQMA 3ND5A 1G1AA 3K5PA 4HH3C 4JI6B 4YA6A 1KAQA 1SVIA 3B7WA 4LPKA 2R1ZA 2WF5A 2H1WA 4CT0A 1DLJA 4HLCA 1GCUA 1R1DA 4V0SA 2MSLA 1JQBA 1ZD3A 3DDZX 1T8WA 1GSAA 3CINA 1YBVA 1YR6A 2IYAA 3HP1A 2A1UB 1LDGA 4I0WB 4IFTA 4I4CA 4TRJA 2IU6A 5CFPA 2YWGA 4FYWA 5CH8A 4BFCA 5CFZA 1JPVA 1KI8A 3FYSA 5IXYA 1FX0B 2OM6A 4F2HA 3H1AA 2I2DA 4Y1FA 1J0XO 3BAFA 3BSSA 1J0CA 3DW1X 3NIWA 5KC8A 1VDMA 1SJ9A 2PIAA 5EPUA 4QM7A 3D0KA 1WB6A 1YCGA 4NBNA 1HFWA 1ZH4A 5A6SB 2XT6A 3PHJA 1RCFA 4ZAWA 5MN5A 3PC7A 4M0DA 1PGQA 4KPYA 4N03A 5B12A 5H3CA 1N5OX 2AC7A 2AWOA 1EVJA 1OY1A 1QH1A 1DRVA 5IKEA 3HK2A 5IARA 2JKVA 5FNVA 3SZOA 5DM60 5GJVC 1U3GA 5G1PA 2B83A 3FGZA 1HDRA 4X20A 4BVEA 1NBIA 3M5WA 3BPSA 4PSDA 3WG9A 3AHEA 2FEOA 4HDSA 1LTHR 2ZYHA 1W8DA 5JOQA 4NMHA 4V0RA 1VGVA 3NLLA 3UXMA 3KZ1E 4RVNA 5TT0A 1Z7GA 2E4WA 4CM1A 1H8ED 3G0OA 4F8EA 2NUAB 1ISGA 3OESA 3VYSB 1U0EA 4YJ3A 4FQ7A 4BMNA 5D3MB 3I2FA 4GBGA 3TK1A 3HE3A 5FUQA 3HY6A 2PYIA 1YOVB 2WFZA 3AESA 3HO6A 4R0MA 1L7MA 4WN3A 4JVOA 4KR7A 1T5LA 1Z13A 3E1SA 1CJCA 1TGYA 2JZNA 2OWDA 1C30B 4U9HS 2Z6VA 1ZBQA 4BIIA 1ZH6A 3OLQA 3ZBPA 4DZRA 1AG9A 1B74A 3PUWA 5HFAA 1ZJ4A 2EIXA 1YU6A 3H17A 3UWDA 4BJ5A 4IZ6A 2UYGA 3UMYA 3VBCA 1TLFA 4LRWA 1E1LA 1ULTA 1TRHA 3QELB 4CNBA 4RH3A 2YUTA 4ZGGA 1BDIA 2C94A 4MRPA 3TLCA 1XTVA 1N6NA 3RIHA 2HWWA 3HVIA 3IMEA 3KLMX 3ZW7A 4D82A 4EFNA 5ERXA 4WY8A 1MGPA 4KDEA 2ETXA 1WBBA 4CTNA 2I2AA 3MMPA 4XEHA 5IFKA 2QAGC 5BW8A 2WUVA 2J3MA 1MB2A 2HSDA 2IBMA 2ZTVA 1T5HX 3OCXA 4OIFA 3LY7A 1XWFA 1QP7A 1DC5A 4FFBA 4LJ4A 2HA0A 5B7NA 3ICQB 1H22A 5KCMA 3WLLA 5IZ4A 5BSVA 3G79A 2WHPA 2P90A 4KOEC 2YW9A 4KCGA 3AVOA 5FORA 3A1VA 4LX8A 5HCUA 2VI5A 1H2BA 4X6LA 2IHVA 4Y2XA 4M49A 3BQMB 5GONA 1DIOB 1QCYA 1VKOA 3GZJA 4WLVA 5AI0A 3PKIA 4W5JA 5DHSA 5T8KA 4BZWA 2O5VA 3C4QA 3Q40A 4EB6A 4MRMB 3BQNB 3BRWD 1V41E 1P61B 3NT4A 4IR7A 3V9PA 4O1IA 1TJNA 1YAHA 3ROQA 3D7SA 1GARA 2PJDA 1VKZA 2PMDA 1MH9A 2IKQA 3EVEA 1WTCA 2ONKA 4EO7A 3W0LB 3E2MA 1N2XA 1NMXA 3U4HA 5CFLA 4BJ6A 4EEKA 3IP3A 1WQ3A 4OLAA 1BZYA 3AOEC 2FJUA 5ESWA 1CIVA 2G67A 1S9DA 3HJHA 3IOMA 4Z4IA 4HEA1 3K92A 5K0JA 1RC1A 4X60A 4L57A 1A7KA 2J1LA 4FU0A 3RG2A 3PHIA 3KK0A 4N3AA 3FW1A 3TJRA 1P7WA 2KI5A 2QRKA 5IVPA 2C3OA 1P6XA 5IYZB 3LBAA 1XVVA 3ANSA 1IN5A 1GG2A 3OZGA 3NM5A 1PQWA 3R9XA 3S5UA 2JLAA 4M1TA 4ODIA 3EY9A 4B9AA 1VKJA 2AOVA 4R8MA 3OLVA 3QXHA 5C37A 3V4SA 3NJ8A 4HEA6 2GM3A 4XIIA 4Q4DA 4XQ0A 3C70A 1F1BA 4CBVA 3ZQKA 1XBTA 2J08A 2WIJA 1EFDN 1VFPA 4RHYA 4X93A 2C7RA 2I22A 1BS9A 3OIFA 3RASA 3PQ3A 3WLPA 3BMOA 3NBXX 4Z6KA 3KSUA 5K8CA 1G63A 5J40A 1GAJA 2XRYA 3T9CA 2J7PD 3K8ZA 1LPPA 1SEPA 2HJGA 4IIDA 3N2EA 3L41A 4BNZA 4HSEA 4N41A 4PLWA 2OD7A 2PTGA 3IBFA 2PWZA 4HDNB 2WZDA 3VH2A 4F2PA 1E0SA 3P7MA 3U3RA 1NTRA 2V7TA 3NALA 4ZT4A 4Z4CA 1R9JA 1Z6TA 4PLHA 4JA0A 4Q3NA 1P1KA 1HE1C 3T7AA 3ZK8A 1KK1A 3GPIA 3FCYA 2OV4A 2Z2IA 1GTZA 1OX4A 4UM9D 3U39A 2W6JD 1DIAA 2UZAA 3R20A 3F6YA 2X4LA 1DKNA 4ME6A 4O4HA 4L1KA 3IEIA 4TL8A 3K9HA 4OHXA 4G4SP 4YRKA 4LIPD 1NAHA 1ZGCA 1J00A 1RM0A 2Y1EA 3U4GA 3W8RA 3MTGA 2YVAA 4YMSA 5JCPA 4KWEA 4DMMA 1OHHA 3QW2A 2R6HA 2DH6A 3CR7A 4O4HF 3PEVA 2R11A 3DAGA 3IPLA 4AIRA 1ZM3A 4TZKA 1PT6A 1H3FA 2BV3A 2QRJA 5EPEA 3T15A 1PS9A 2PUJA 1G19A 4LV8B 1KYYA 3V4ZA 4DSZA 5LSAA 4ZPXA 2IS1A 3TQQA 3U7GA 2ZYRA 1E5XA 2QBYB 3E1GA 1SBIA 1FS5A 3I9OA 5LD2B 1G41A 1HH4A 4MLCA 1NT2A 2GZMA 3V6MA 4TTQA 3IAHA 4ID3A 1GRNA 5JG7A 5CBKA 1V6SA 1U81A 1ECLA 1V7QA 5FNVB 2MHCA 2G5GX 1GG8A 2O14A 4UZSA 4BGIA 2K7FA 4LF7B 1ZM2A 1L9XA 2WM3A 5TY0A 4X20B 5JCOC 1CZUA 2Q1WA 3BMNB 4NFSA 4PX9A 4QDTA 3U4IA 1OREA 2IYSA 1DQRA 4HS9A 5I6DA 1ESEA 4HDSB 4NYJR 3V6LA 3H9BA 2B4RO 3RUHA 4BLOA 2PY6A 1JFRA 2DBVO 3D8UA 4QDZA 4QU5A 1F3OA 3I4LA 1Z33A 4MCHA 3HTXA 3OMWA 1XWIA 2QTWB 3K0EA 4R1QA 1XU4A 1DP4A 4L8YA 5FOSA 1MEOA 2Q4DA 3RQIA 3E8MA 1VSBA 2ZRQA 3DJYA 4UHCA 2V3WA 3VZQA 4P81A 2FI1A 2XYGA 1KH2A 3CNEA 1OLUB 2SBTA 1ZEMA 4Q47A 3DBRA 4PQEA 2ZUSA 1W2GA 6PFKA 4G41A 2UUOA 4LQCA 1MV8A 3AHHA 1E8NA 1DO8A 1FTSA 1TCBA 3ZWQA 3ZYZA 2JGJA 2PL5A 3NO4A 4ZQBA 1I4EB 3AUSA 3DTNA 2JH9A 2VP2A 1KBQA 5A4DA 1GCIA 1S9HA 2WE7A 2X4IA 3D6JA 3JQQA 5CVUA 4NCXA 1NZFA 5KJFA 4MW5A 1IBKB 5FWYA 1QRRA 3IOEA 5JS6A 3FJOA 1QE3A 4H1VA 4NBWA 3KOXA 1GAQA 4QVGA 3URKA 4CTMA 2X76A 2Z1MA 5CGZA 5J1TB 4QECA 2AXEA 4J7UA 4Q4LA 2CLSA 2Z4TA 5I9NA 1NJ2A 2NOAA 4DDUA 3SR4A 3LK6A 5CA0F 1XDZA 5E4YA 3FLEA 1XAIA 3QUTA 4FFBB 3I2GA 4E3ZA 3K1JA 1M34A 1TF5A 3OI7A 4M7WA 3ICEA 1CLUA 3DCNA 1UIRA 4YMWA 1JS1X 1DWOA 1V39A 3DL2A 3TKLA 2WHPB 3ILXA 3OZCA 3WL6A 4AN4A 4ZMSA 1UDAA 2GXQA 5B7PA 1G8MA 5U1PA 1ZRHA 1VIDA 4GQAA 3K35A 3ROGA 2BEVB 5FBQB 3PPXA 4H7FA 1YZTA 2QXTA 2P5SA 4RPIA 4CF5A 2QIOA 1YDGA 1PG0A 4LSMA 4NECA 2I8LA 5EWJB 3V8QA 3ZJ5A 4D99A 4EB6B 5CA1B 2JA1A 3LPCA 3AHIA 4EL5A 2RHLA 1J5EB 4F46A 1NPTO 2XGOA 2YBEA 4X3CA 2DP4E 3Q4GA 1GA6A 1U8AA 1NZJA 4M0EA 3M6LA 2PGIA 4EKIA 1W0JA 3BXFA 1YMUA 3KOOA 4GM1A 1U0FA 1X1QA 4WKBA 4C29A 4C7JA 5BY2A 4ENTA 3E4CA 5JXHA 1OIWA 2VTVA 5FDFA 1Z2DA 2B78A 2HTEA 4B32A 3L40A 1ZITA 4ZJUA 3THXA 1GTJ1 1V45E 1DT3A 3NP7A 3A7EA 5H82A 5ALSA 5HIJA 4INAA 2D7JA 3D81A 3KJZA 5FPKA 5J4YA 1T3ZA 1ZINA 2VZEA 2YNMC 2YXEA 3R41A 3MJCA 1GADO 1P8JA 2JLWA 3AIKA 2E9SA 3SYKA 3R9XB 4F45A 1UFKA 3G2KA 3MSXA 3FWPA 2B8NA 3D7NA 2IY8A 3G2MA 1I4LD 3H5NA 3FNGA 3E5NA 4WVLA 3GUVA 5ALTA 2XSZA 1SKBA 3G2QA 3NIFB 3I6IA 2QNBA 3FHOA 3MJVA 4BHTA 4F3TA 4YP0A 4BV9A 2W58A 4L4ZA 4JT4A 3U9TA 3FSGD 3KXDA 4TV9B 2X5KO 1OXSC 2H7VA 4AKTA 1GJRA 5FTJA 5HQTA 3CSDA 3Q2OA 3ITKA 1GFIA 1KXZA 5AR1A 1PU2A 3IDFA 1S2DA 2ZXFA 1RAHA 4F1JA 3U6KA 2Y93A 1IVSA 4M9UA 2D13A 3GRVA 3UG6A 4IH1A 4YDSA 2ONJA 3HADA 4RTQA 2PLWA 1N5RA 2AFVA 3CN9A 2P9QA 1QHNA 5EMHA 4BS9A 1JG3A 5ER6A 2VDWB 3RNOA 1VG1A 1RKXA 2G8NA 4BO0A 1FJXA 2NG1A 2JG3A 1XJQA 1X6VA 2GM4A 2YINC 3CT4A 1H4SA 3SD7A 1U8FO 1A9YA 2JI7A 4Y18A 3JZAA 2B7BA 2C20A 4UBLA 2CMKA 2NT4A 3VX3A 5TMEA 2OV1A 3LP8A 2XUQA 3W06A 2JGFA 3FSJX 4N8DA 3LKVA 1H8HD 2YX1A 5FUVA 2AI2A 4LGYA 2CLEB 5HBGA 4K0KB 1C4OA 1M1NA 2PBRA 4XM1A 5I7EA 5FRDA 1V47A 1V16A 1X7XA 2YXBA 3W3AD 1DG9A 4JAVC 1SD1A 2BFEA 3TECE 3KKKA 1RHUA 2LIVA 3C41J 3LGAA 2XT0A 1LB1B 2J9XB 3KZOA 4OYHA 3F98A 1DC8A 2P9EA 1RWNA 3CS3A 1A98A 1R6VA 1HDOA 1XK7A 3KKZA 1M2KA 2JFBA 1SUEA 1TO6A 2FQ1A 1I36A 1XAJA 5CEEA 5IDXA 4G89A 1RWBA 1E2KA 5KYYB 4LOIA 5AVWA 4NAUA 4HFJA 3PDIA 1FDOA 4KUGA 1PV2A 1U1CA 1Q1GA 3NBMA 2BDUA 2HA5A 3A37A 2XF8A 4EVRA 2ZS7A 2VCEA 3HLYA 1XD2A 2Q5QA 2AJDA 3KQQA 2XZLA 4GL2A 5A4JA 1NJSA 2GJAA 4OA8A 3GO4A 4PXAA 1KZ4A 2BC9A 1RADA 2BMJA 1C4XA 4UUMA 2VUUA 2YICA 4LZNA 4OQQA 1TEZA 4QM6A 3HXLA 5LMUB 1T3HA 4AZVA 1EXWA 3PSAA 5G40A 1XZKA 5A03A 5AM3A 4IOKA 1NRJB 1KDOA 1L7QA 1TF2A 3HM2A 2V7QA 2WMDA 3NAZA 5D5HA 5IZCC 2FPPA 3VNSA 4HY3A 3FWNA 3HCFA 4I99A 4MTLA 3D8BA 1HLPA 1O87A 5FIUA 3UK1A 4DLBA 1C0EA 3CG4A 1EWVA 1ZMOA 3O3OB 1EUCB 2FN3A 2ZETA 5TPWB 1DEOA 2FOIA 1Z17A 3VO1A 3TGPA 2VNKA 4IDFA 4RD3A 1D2AA 3ZWWA 1W0CA 1O9GA 4K6HA 3P9ZA 1E20A 3STWA 2ZT5A 2HBZA 3G9ZA 2V6GA 3NYQA 4KSBA 1U7PA 3TE7A 5A7GA 5TQ2B 4EY7A 2PK3A 3OCUA 2YJ3A 3I1FA 4CM5A 2NYUA 3ZE8A 4L15A 5KUTA 4B2YA 5JIBA 3OJWA 1O8CA 1T3LA 1YE5A 1UK8A 2OZKA 3DPSA 3QKIA 4Y1EA 5AJUA 3WI7A 5NLLA 1M75A 4H7DA 1W4AA 2BH2A 1OKKD 2VLBA 1MBZA 4KXUA 4XLZA 3VSBA 2XDWA 2BGNA 4GM4A 2NXEA 1Z6XA 5I4CA 4YCJA 2PRZA 3CRNA 1T2AA 5THXA 1OCEA 3MTEA 4Y6LA 1IXZA 2YV1A 3ZU5A 2FSFA 1TZKA 2W0MA 1D7AA 2XTAA 3RYFB 3SZUA 3WDMA 3ZPXA 1XG5A 1RWWA 1WLSA 2E4XA 1HRKA 3WNDA 1E1CA 2PFKA 1W9MA 2WIKA 3ACDA 4L9RA 1JQJC 4CT4B 3GLIA 3MYYA 1XZCA 1H9AA 3JYNA 1PFWA 4C3ZA 2ODPA 1OA1A 4F2GA 5JI2E 1EE2A 2GPAA 1GPBA 1CJUC 2JK1A 3NUQA 3Q7QA 1L5HA 3ZWDA 1MD9A 4KOAA 2AHOA 4V38A 3ZCRA 1VI6A 5CLJA 1LNSA 5BV2P 3KJXA 2X6RA 3KWLA 3F78A 2CVQA 4IO0A 2NQ8A 2EWMA 3A6FA 3L18A 1OI2A 2B8JA 3P9XA 4PZEA 3DAYA 5T41A 3ZY2A 4YB8A 1OMOA 3N8HA 3EMKA 2AR0A 1G21E 2DLDA 3JWEA 1VTKA 2IL1A 3AUAA 1JQDA 3L82B 4HVAA 3T35A 5GOTA 1NONA 4WV3A 4DBVO 5D5QA 1W29A 2FDXA 3CLRC 2FP4A 4BPRA 3JVVA 1HDCA 4URYR 3GGGA 2C5GA 1JWLA 1H4VB 3QXGA 2Z3WA 2IH2A 3V7UA 2PS3A 5BWLA 1Z16A 3OIUA 4E11A 3IQEA 1Z35A 4LBZA 4JV5B 4RY0A 1UBGA 4BZZA 1EGMB 4CCAA 3RRNA 3SJBA 4UTRA 2AZTA 2XI4A 4EKNB 1QGDA 3PNPA 1MXFA 1TW3A 2C82A 2DQ4A 4B8WA 5EUCA 5DGIA 2PVCA 2FV8A 1M7GA 3OC6A 1DKMA 4F4JA 1GA4A 3V1KA 3ECSA 2QS9A 3EIEA 3UYLA 2TMYA 2BFDA 3WXBA 5BSWA 5H1YA 3SC6A 4KO8A 2OFFA 2AD5A 2VK8A 3C3CA 1C4WA 2AOTA 3W1VA 1L4BA 1BXGA 1U0TA 2JARA 4AKSA 1EWYA 2GOYA 4TTPA 1Q74A 2SHKA 3UJHA 5HUQA 5KPDA 3EPKA 3G2IA 2Z8YM 1P6QA 3HEBA 4K9SA 5FA8A 1SVSA 1VYUA 3THSA 2QENA 3UUGA 4FFSA 2GB4A 2WJ6A 4A8JB 1KMMA 4MDYA 4PICA 5E7MA 5B58C 2NZJA 3TSAA 4YRCA 3KNZA 2D5CA 1IZYA 1KZHA 4GXTA 1NOJA 4H16A 3SIRA 2Q5IA 2QMZA 2ZBGA 4ZYWA 2I4MA 1GRRA 1LF5A 2A14A 2HO5A 2QNIA 2YN2A 4XDGA 1Z2AA 5KTKA 1E2NA 2GSWA 4RDCA 5ENVA 5JQGF 5DXAA 2ZIZA 1SD2A 4D74A 2XWSA 1K5GA 1QWSA 4KBYA 1W87A 4CIAA 1M1NB 2C2YA 3UWSA 4JC5A 1P8AA 1P77A 4FHCA 4Z4QA 1X7XB 5IAEA 4Q4AA 3IMFA 2QTFA 4BNWA 4YQFA 3HB1A 1JP7A 2BFEB 2D8AA 3L0ZA 4FE3A 3MLEA 4HNGA 4XTRA 4ZU1X 1FK8A 3VNUA 1LTQA 1HTBA 1YBMA 2ERCA 2X5XA 3EUAA 3FVQA 3I39X 3OO0A 4GT1A 4JCCA 5JJIA 4KQEA 1GYRA 1CS0A 3Q9LA 3PFHA 4AKIA 1TADA 2CNOA 1LS6A 2ZYDA 3A4YA 3HUDA 4IOLA 2SICE 4XCXA 2XCSB 4YP6A 2F1RA 3KHUA 2AXPA 1G1MA 1R3DA 2GYYA 1M2JA 2PSSA 3HDTA 4NL4H 4OATA 1ZNWA 5E2IA 3PDIB 1PSZA 4R8LA 3IV9A 3PJEA 4I2NA 3I6MA 1RQLA 3AR8A 1O96A 2XUKA 3BGDA 4MWZA 1NBWB 5CVEA 4D25A 1E63A 1EUYA 3AEUA 5EIFA 4E32A 1C9DB 2P9GA 3BH6A 2W6MA 4ZZ2A 2I4RA 3TX2A 4E4RA 3AFIA 4ZYUA 1VYTA 2QA5A 4RJIA 3IC5A 4QJ4A 2O8BA 3L93A 5JWOA 3WLOA 5LFAA 4MWBA 4ZU6X 3QY0A 2QLTA 4B4OA 3MB8A 4YR9A 3TOSA 4HDCA 3B48A 4TM7A 4X85A 1A9OA 4QGSA 2IA5A 1DQPA 4IEFB 4BVGA 2OXEA 1F8GA 4GPAA 2BYTA 3ZQ4A 3ZY3A 3NXSA 3T9AA 4AJ9A 1X8KA 3N75A 1JXAA 1Q16A 3B9QA 5D85A 3ADOA 3ITDA 1QRSA 1BAPA 3T3NA 3VX4A 1GNRA 2UXBB 4OHYA 1KI6A 5F12A 1NFQA 1TK2A 2GCIA 2N75A 2VXYA 1SZJG 3ONDA 3DV9A 2W48A 4LJ8A 4P38A 3SLKA 1M0SA 1DCKA 1KK0A 1U8TA 1M8GA 2AC4A 2VYVD 5KTPA 1QFSA 5KHLB 4NMWA 3HS3A 3DMYA 2RHOA 2A3NA 4Q3KA 5KIAA 3I61A 3CRZA 5CIWA 1IOWA 3FAZA 3AF1A 4L27A 4Q05A 4DA9A 5A7HA 1JMYA 1II8A 3TLGB 4O2LA 3B3QA 1J1IA 1QHHB 1W4LA 3K15A 5D00A 3W05A 4LN1A 4TXHA 4QC2A 1JQ3A 5FLYA 5CA0A 4MUBA 1M5RA 2GCPA 5IH7A 4C9BA 1H2XA 3WMEA 3JQ8B 1WG8A 3BXOA 2C2ZA 5A62A 3MA0A 4YRPA 1TJPB 3EAGA 4JXKA 1KKLA 3K5HA 4Y2QA 3VKUA 4AO7A 4DTCA 5BUSA 1XHEA 3GU3A 4FFMA 1PTJC 1G20A 3IDQA 2PM8A 1R27A 2P8SA 4ZOCA 4E88A 2CW5A 2D0IA 3GLIB 1KO5A 1NQ5A 3EARA 4CL0A 5AI4A 1C7JA 1HDIA 2HV8A 4YT2A 5BOSA 3KE8A 1H0RA 2JGAA 4J1TA 1ZMBA 3N7UA 3PRHA 2R87A 1HYQA 3GA7A 3K1ZA 3OHSX 2W8ZA 1C7EA 3AF2A 4MW4A 3COVA 4KXQA 4Q3CA 5FPSA 5H83A 4BJ3A 1IB6A 3PUJA 3MJ4A 1JI0A 1KSFX 3R5SA 1AJEA 4ZZ0A 3I5UA 4E5VA 1FZTA 4K5QA 3LUGA 4MVCA 2PKQP 3ZXYA 4L3VA 2H06A 3R3VA 4DWWA 3WYEA 2OXFA 1D2MA 1ZJZA 1C7ZA 2WDZA 4F3RA 2BMEA 5BQFA 2MYUA 2AL7A 2B69A 4QTUB 4ND4A 3D6VA 3SHQA 3ITNA 1M1YA 2OSBA 2PV7A 1R0CA 3DPUA 3ON5A 3ZK7A 4KQIA 4EUSA 1H1TA 3BXXA 4KIWA 5IF3A 1OU0A 2HRCA 1P4AA 1PZNA 2GVZC 4MNTA 1L1EA 3LPAA 5IEJA 4TMKA 2C29D 3PP8A 3WLKX 4D46A 5B3LA 1RM3A 1P72A 3D43A 1KPIA 5BRJA 4GRIA 3AEQB 3MC1A 4DQLA 2F4NA 1YB1A 3ZWXA 1MR3F 4WJKB 5DX8A 2MMGA 3GARA 1YZLA 2J3KA 2DWPA 3KXIA 4QLOA 3ND7A 1RKBA 1E9DA 4FILA 4S12A 1RYHA 4I5DA 3ZH9B 1D4AA 2HA3A 1J1UA 3FPCA 3D3KA 3AKEA 1A76A 1DV2A 2PANA 3OM0A 5DK4A 3VISA 2R44A 2YMQA 1FZQA 1NM5A 3QLUA 4C21A 5BWOA 2BEKA 1RP7A 3DT6A 4OGWA 4AMVA 1UJ6A 1CXZA 3URMA 1UWVA 2LDBA 2ZIEA 1ZI8A 4OA5A 4DG8A 4NBSA 1Z39A 1ENZA 4P3OA 1G9TA 2NIPA 3NBAA 3VUEA 1M1UA 4LYDA 5L3SB 1NLZA 1P6UA 1PGNA 3OM8A 4JXXA 3A9WA 2EV9A 1B76A 3VKWA 4N9WA 4U7PB 4QTYA 5I7UA 3WKEA 4LHVA 4L16A 4A73A 1M8KA 2WIBA 4MKFA 3E9DA 2NZYA 3RGGA 3R3ZA 3IIJA 1IY2A 3UA3A 1JIVA 1SM4A 5BV0A 2B5VA 1XDDA 5DT2A 1IWOA 4DCOA 4Q4AB 3P9YA 5AWFC 1JIIA 1E6CA 1H23A 3O0TA 3RWMB 2P30A 3KJNA 2FNAA 1K6JA 2YJ5A 4MQ4A 4O4HB 2B34A 1Z38A 1Y1LA 4V0LA 2IPLA 1BTOA 1MRNA 4HAWA 1CS0B 3BWBA 2XKAA 1GG9A 3UATA 5BORA 5EWMA 2A7XA 2X19A 5CLHA 1FFBA 3WYFA 3C5HA 3KOWA 5EXDA 2PMEA 4K28A 2HGSA 4Q7KA 3UB2A 2B1RA 2JCBA 3CLUC 3AYXB 2WKWA 3GXOA 1QIJA 4HK4A 2DUJA 2HU7A 2G9ZA 3OZTA 4TKZA 1KWGA 3P52A 1FY2A 4LVNA 3ZOZA 3MWFA 4BTLA 1JDUA 5GJCA 2ZWOA 3B6MA 1K5PA 3IR6A 4U0KA 1XYVA 1ZPDA 1F0YA 4IOMA 1E2FA 4C5CA 1QMPA 2G3YA 2P67A 3TINA 3WLTA 1FNDA 3FUWA 4GQBA 5FF9A 4RCZA 3R44A 1Z28A 1OWPA 3A3KA 1MLDA 3AB7A 4IDNA 4S2UA 1CRQA 2GK3A 5DOZA 5BYJA 1XD8A 1GPNA 4FHZA 5C51B 1N7HA 3W77A 1NBOA 2ZWMA 2G08A 1YR2A 3AETA 2AE2A 5AHOA 1A9RA 1RZRD 3PYLA 1PL0A 1L7RA 1TM7E 3A1NA 1KY2A 3RJTA 4QU0A 2CSXA 5CVDA 4UEOA 4IGIA 4D43A 4RWZA 2DHQA 3N2LA 2A8YA 5GVRA 1KJ8A 2GPTA 4P4SA 1KI6B 2YN0A 3A04A 1XTUA 3PNMA 4NBLA 5C4GB 1R6AA 2AV6A 2QRUA 1TGVA 2F43A 4RFSB 1W4CA 4RORA 5HKLA 1PT8A 2XNCA 3IX7A 2YYAA 5BNTA 1CLEA 1TU3A 1YQGA 1DJNA 2DPGA 2N1BA 4ZOBA 3VYUB 1GRQA 4ZHQA 1SHZA 2V0GA 2QTHA 1RBZA 5SV2A 2VS1A 4DYHA 2EBUA 4QRIA 3LT0A 5LZ8A 1IN7A 3TZKA 4IDDA 4LG1A 2CNKA 5DHPA 3IAXA 4E2XA 4C7KA 1II8B 2EZ8A 1Q83A 2JJ2D 2VHYA 4GE0A 3KL4A 5E95A 3OZ7A 5CA0B 1O9BA 3KKQA 1G16A 4RKWA 1PR5A 3WJ2A 3ROMA 3TGWA 2AS0A 3GNQA 2VQ3A 5FWNA 3A7DA 2IHTA 3A9CA 2XBUA 1OFUA 1V48A 4HDQB 3MEQA 4ZQEA 4L73A 5HHTA 3LRPA 1BWQA 1U7TA 3TRDA 3I34X 2RHWA 3WP1B 1HTWA 3EXHA 2EKQA 5G0VA 5CG1A 3CW2A 2GZ1A 4E33A 1G20B 3I09A 2VN8A 3MJEA 3L4JA 5ALEA 1HYBA 5H9VA 3WYCA 1ECCA 1LBTA 2YDYA 1WHTA 3T9EA 1JEYA 4FDAA 4KZPA 4BE7B 4LCEA 1VZ3A 4CRWB 3F8TA 3GEEA 4F9EA 3B6KA 5FKJA 5CDFE 3GAAA 4O02B 1GSIA 1HDEA 3I8XA 3E7DA 1L5KA 3EXIB 1RC0A 2CNNA 1ORHA 2I3ZA 2WBLC 2ZU6A 4KZKA 1GCOA 4RK7A 5BSFA 3HA3A 3UYKA 5JI3E 4F2DA 5JMTA 1FUUA 1ZCFA 2RBEA 3LXXA 3ZLBA 4QDUA 1VHLA 2JAWA 3U19A 1BHO1 2BRUC 3KQOA 2A35A 4TMXA 2C98A 2GESA 4QVKA 4BGVA 1S3IA 1CEEA 4KXFB 5D51S 2QR3A 3T7RA 1T91A 2NVWA 1KIFA 4PM4A 4PHTA 1CR6A 1T10A 1UXIA 2R751 4CMIB 5B30A 1A9TA 3TPCA 3EBOA 4EJ0A 3OFND 2Z4SA 5FEUA 4G0WA 2A5DA 2P6PA 3GD7A 3PKZA 4IUCS 1JG7A 2I76A 3BIOA 5FXMA 4IRUB 1IVYA 1ZDMA 4NC9A 2VYND 1K4YA 3F97A 5IAAA 2W6ZA 1R8QA 3VDXA 4EM6A 3CX3A 1O0BA 4IDPA 1DKOA 4FKZA 5HWSA 1BW9B 4YEDA 1CJSA 5EMJA 5K8LA 5AIBA 3V55A 1GQYA 2UUCB 1RKQA 3M3PA 4YDRA 3UZUA 4K05A 1YVPA 3N74A 3MT9A 3O6VA 5C3UA 4QUEA 1F8XA 1UK7A 5ESDA 4B6FA 3COPA 1E7SA 4G0QA 3AF4A 2DR2A 2PIDA 2JLQA 1RS0A 3RJ9A 2BELA 3BH0A 2XXJA 4DLNA 3NRBA 5FUXA 5CDTA 2NO1A 3H42B 3UIEA 4EDHA 1MW8X 5EJ8A 1AU9A 4I1UA 3QWHA 1FDIA 1H2YA 5UKDA 2GO7A 3T41A 4B6GA 5DEOA 1SPXA 2IHZA 2EFGA 1RCTE 1VLVA 1Y4DE 2WIFA 4HQ0A 1P5ZB 4UAGA 1OTYA 3S4YA 1DXQA 1E62A 4LJSA 3CZQA 3TF5A 5LQRA 2ZZMA 1YRBA 4MITA 2EX1A 3D8HA 4QO8A 3RVKA 4LF4B 1OTHA 1TAQA 2F64A 3C8ZA 2V7BA 4A5OA 1Q77A 3GCGA 4CU2A 5JQGA 2FWBA 1MB9A 2ES4A 5HTOA 2ZJYA 4RVGA 5DSTA 3OLCX 3AV3A 4ND7A 2DECA 1J39A 3SQXA 4BMPB 3I12A 3EZ2A 2BGMA 2J45A 5B58T 3FCOA 4EPWA 1AVTA 1D4OA 1DZIA 2D54A 5I7OA 3ETJA 1RJDA 3PHLA 1SVLA 4R3WA 4OJYA 5EWMB 4ZT2A 4AY6A 4XFDA 5BWBA 2IE0A 1JG4A 2RAFA 3QE2A 1AK1A 3DXFA 4KE6A 4LQLA 1QKKA 3F6BX 3F74A 4ZU3A 2LUOA 1YB2A 3HV0A 1KF0A 1M6EX 1N77A 4HYQA 2JFZA 3DVAB 3P96A 2O2YA 4R1NA 2ZSHA 1ZSNA 4XLTA 3NOVA 4BFZA 3B36A 3H9GA 1SIBE 2Z83A 1JYEA 1W4RA 2OB2A 1XRNA 4Y9TA 3KD2A 2GJ4A 4KO4S 5HKKD 3IAEA 1KO4A 3PJFA 3QI7A 3GFOA 4LC0A 4TXLA 3UUEA 1JF8A 1XZEA 3A1EA 4XX1A 4Y2TA 4CLRA 5KNLA 2AQIA 1VXOA 4KYIB 2VPIA 3HG7A 1FUIA 3MPUA 3NX4A 4WCDA 1T6NA 5AVOA 3T5DA 4A4DA 5KNDH 2AB0A 2Y0CA 2Z2JA 3CIOA 1PG2A 3AETB 3WL8A 3PBKA 5SYNA 5ENDA 2WTUA 3DQZA 3PHGA 4QKQA 5DT9A 5EJ2A 2H08A 2RGUA 5ANRB 3W8NA 4OFBA 1GPWB 3BJIC 2FSVC 3BTSA 3QLJA 4HUTA 2EFCB 2HF2A 1WW2A 3CY6A 4BUZA 2R6R1 3HV2A 2AQHA 3MCWA 1OX6A 4O59O 1AUQA 4M1KA 5JYCA 1J56A 2YMPA 3TAXA 2WG2A 3E1KA 4ZAVA 3TAHA 1NP3A 2VP6A 4HEQA 1W36D 2Q0HA 4WOPA 3AP1A 1UQUA 3FY4A 2ZE8A 1MAVA 4BLVA 1SKYB 3BVPA 1D6SA 2ZPUA 3AFOA 3GFFA 3MWYW 1K9SA 4R6XA 4FX5A 2OV2A 4ZRNA 2CL6X 4EFMA 4EUNA 2DUUA 4KQCA 1J25A 1H5NA 2ZPAA 3RRBA 3U4CA 4DQVA 1B3RA 1I0LA 1YZKA 3BWEA 4D02A 1BE8A 4PYMA 4ADSG 4RIFA 4D8VA 4JZYA 4RKEA 4ZEWA 4IL5A 4CZ2A 4ETMA 1PK9A 2DBQA 2QX9A 4GP6A 4P7GA 4W1PA 4E2YA 5D3QA 4EUFA 1ZD1A 2CJXA 3EWNA 3FYCA 2WMNB 5IT5A 3WBBA 4CN8A 1W5TA 1O97C 5DYNA 1NVVQ 3DBIA 4MYUA 2OVBA 2E0IA 2EKPA 3NHAA 4MIOA 3EXHB 4TS4A 3SWWA 1SXPA 3FIJA 3RJ5A 1THTA 3ZCSA 4E6PA 2DHCA 4BRUA 2OAP1 4GKVA 3OCCA 1O94D 1J1ZA 2WF6A 3NETA 5JPDA 3DO8A 4BLTA 3C8HA 3ENZA 1WHTB 2HX1A 1W581 2VHEA 4CM8A 3RIYA 1HGXA 3ED1A 1IZ0A 3Q9NA 5F1KA 1SHJA 3TSCA 3AZQA 4J0FA 3EA0A 1QU3A 5IDVA 1UMKA 1VKHA 3IEUA 4HMPA 4L9SA 3G6WA 7ABPA 4RX1A 1KI9A 2VLIA 1M54A 4F8JA 5JJLA 2I6QA 5J58A 4H7JA 4HGNA 2OZVA 3EGEA 2R4QA 2A1TS 4G1BA 2I91A 3B78A 4G01B 2YHIA 3F96A 2R8EA 1ESNA 1G8SA 4G24A 4RF3A 4O5AA 1FFCA 2C54A 1E79D 1H94A 5JNVA 5C1OA 4CQMD 4NTZA 1U3CA 4QNNA 3VZRA 4A8JC 2GSDA 1JV2B 4RTJA 1GYPA 1IRIA 1I2ZA 2IXFA 3SM9A 1K2WA 2YASA 3W5VA 1Z37A 3D5EA 4K6GA 4C3OB 3JARA 4JKYA 4X64B 3E27A 3ZLJA 5C52B 4RTSA 5D6NA 1Q3TA 4G6ZA 4ND3A 1K8ZB 2P75A 3L8ZA 5KQRA 5D3KA 2RI6A 1X80B 1H2RS 1Y5RA 2DM6A 2FB9A 5EMNA 2JFOA 3I6QA 2XVYA 5E6RA 4A92A 3L8YA 2XCTB 1AXEA 1DT5A 3D02A 4UVGA 2N46A 3PQ7A 1FYWA 4IIBA 2XGSA 5K3SA 3UG7A 5GINE 1Q3HA 5IS2A 1Q95A 3GRAA 4KRFA 1JKMA 3FPJA 3OO1A 2V55B 5J5AA 1G9XA 3NC4A 1YKSA 1RTKA 1ZNYA 2REQA 4DQ0A 3IELA 3D2LA 2FPXA 3PC4A 4JVNA 3PE4A 2FX5A 4BO6A 4V1CI 1V11A 2ZK7A 3KX2A 4N0PA 3FWKA 1UPUA 4LSGA 1C9EA 5IWCA 4RTPA 1GPKA 4HGPA 4WNAB 3VSCA 1EI9A 4DJ5X 3C3AA 4NQZA 3V97A 1QAOA 3ROKA 5B6PA 4HC4A 2Q0SA 4P08A 2A0FA 2V6JA 1ZFNA 3TMAA 4BFSA 3BTUA 2I4TA 2J09A 4D9BA 2QG9A 1Q0SA 4L72A 1MQAA 2FSHA 3EOBI 4KUHA 5AW0A 4RK6A 4E30A 4HB3A 5JQGB 3MVEA 4V02A 3S28A 1D2NA 4B34A 2ZR8A 4LHYA 5AHKA 3BS4A 2PVPA 3SIXA 5EJEA 3BORA 3L43A 4AJKA 3JAMA 2W2QA 1RM4A 2EDCA 3I72A 4YUAA 4GI3A 1USIA 3TL2A 3QEJA 4MUGA 2JFUA 2P2YA 5DTQA 4L4UA 1XVTA 2HK7A 3L0OA 3K0CA 1DKLA 2IP2A 1ZRSA 5DNWA 1A9XA 1I3NA 1BJKA 1AB5A 1UBLS 1XXHA 1GEGA 3KM0A 4FOSA 3ZVNA 1KMNA 4YCMA 2ZB8A 5CW1A 3OE7A 3ZWKA 4CKWA 2IYZA 5KJEA 3RVMA 5KTTA 2BKLA 1RM5A 2YYSA 1OBOA 2C5HA 4M0MA 3EF3A 4PS1A 3RC3A 2HHCA 4C03A 5ILOA 4F4UA 3PQDA 1SQSA 1R0RE 3O5AA 1ZK0A 3SZ3A 1WKBA 4PX5A 1I8TA 1G4UR 2JANA 3F71A 4C30A 5DKFA 1GTVA 1V9CA 1M1XB 2O2EA 3BE4A 3KFXA 2OPBA 4FJ2A 2FZVA 1WPQA 4X1KA 5D7NA 3JRWA 4JJ6A 3ZV6A 2Y77A 2FUKA 2YJ6A 4CMCA 4XWGA 4PNPA 4MGHA 4CU5A 1RHMA 1Y34E 2WTXA 4TQ9A 3MXTA 4WNCA 2GAIA 1QTRA 2VYQA 4G9BA 4DC0A 3DT8A 2PKYX 2IPXA 4GBMA 1SUBA 1Z15A 4AY3A 3WAGA 1A5TA 4IHAA 3IEXA 4QDKA 1MVNA 1GGMA 2FKNA 3L0SA 3LBHA 4FDTA 1BEZA 5LBIA 4FP9A 4Q4CA 3MMZA 3QE4A 4UEWA 2BD0A 4GZ6A 3RIEA 3DHNA 1WE2A 3FTQA 2NXCA 1J0BA 4P5EA 3MCAA 1UBJS 4M9QA 2SNIE 3I9KA 2OO7A 2J9FB 2LCIA 4BO8A 3DTVA 1C9MA 3RRFA 3W5JA 1X70A 3C7TA 3H65A 3KJEA 3ENWA 1H65A 1AMNA 1Y9JA 5LMCA 1TCCA 3DMHA 4BMCA 4ZDJA 3VNBA 5LQJA 3TAUA 1SKQA 2LCFA 1Q0LA 3MNFA 4L9AA 5CLFA 4XPZA 3QEMA 1BX0A 4ZOLA 5ES3A 5JLJA 1K6IA 5TR9A 3GJTA 2O1EA 2OD9A 4L6IA 3VAAA 4CCYA 2DYKA 5A2GA 5K99A 4G0OA 4KQGA 1ZIXA 2ACVA 4P7FA 5CPFA 2CKMA 4MYTA 3GC6A 4J3NA 4EEZA 3NYWA 3TBHA 5K8UA 2NU6A 2ERXA 4GOMD 5G1NA 2ZJ5A 3FZQA 3TVYA 1A2OA 4JT8A 4JKIA 1UM9A 3NFYA 4BNNA 1CFJA 5ULLA 1IZ8A 1TA0A 2YJZA 2HV9A 3C5CA 3EXFA 3ZU3A 2GXSA 3RVBA 1US8A 1VQ1A 5BPFA 1FNMA 3RHZA 4JT9A 4A0HA 4RPKA 4UBIA 4MI3A 2Q62A 1CR1A 1OIXA 3SKVA 1VE6A 4EOGA 2J3EA 1QQAA 2Z2XA 3T5AA 4ESVA 2O52A 3NYIA 1WABA 3TE6A 1V4BA 1JE1A 1AC5A 2X0KA 4NARA 3PX2A 4G23A 5CYOA 2HJSA 4OAPA 3T5BA 4H7EA 2H59A 5ALGA 4BNYA 4G1FA 2ZBFA 1P1IA 4WNAA 3MTQA 2OQVA 1H2ZA 3LFHA 5B3KA 3CFYA 4D4LA 4ZAYA 1X77A 1PD1A 3H5OA 4IKPA 2YWCA 1E2UA 1GRCA 1O03A 3TOVA 1T2FA 1W49A 2BFBB 5LJLA 4RK1A 1BVHA 3AHDA 3EQ7A 4OJQA 3OICA 1PJRA 1VMAA 4AJLA 1JECA 4R51A 1HSOA 4EHFA 1NVTA 3JARB 2H6EA 1G0NA 3E9YA 1AZSC 1VJ0A 2D4AA 1NXVA 2GHRA 3EVGA 4IXNA 2YRFA 4KLNA 3M6MD 3EEFA 3IUNA 1EUZA 1F2UB 4IO1A 1KFEB 1V71A 2M6LA 2Y27A 5HNKA 5DULA 3K6KA 3QQPA 4U7FA 5E6RB 3BFJA 3HUUA 2NTEA 4GX0A 3O84A 1RXUA 4BB5A 3PLNA 4KFUA 4CLOA 1X38A 4O3MA 3EGXA 2UVPB 2X9GA 3QBTA 4B3HA 1U8ZA 3ORSA 2V7EA 5AJXA 2FW7A 2RBKA 2BMVA 1EWTA 2VZ0A 2GZRA 3K96A 4BNKA 4XX0B 2BEWA 3UMRA 2IEDA 4X45A 1U6IA 4Y2HA 2WIGA 5G53C 1QPBA 5A3VA 4G1UC 2HUPA 4EDFA 3B70A 2Q4RA 5T64A 5F9MA 2HH9A 1C2YA 1IAVA 3PNOA 1JBEA 4QSHA 1K1EA 3S8EA 2C2KA 3VFDA 3MBIA 3AHGA 3PDUA 5B36A 4Q01A 4S1OA 1VJ1A 4N48A 5MF6A 2B8TA 1Y5NA 1UPFA 4FYJA 2XMSA 4W5QA 1XRJA 4JIMA 1CYEA 5CURA 5CVJA 1E2DA 4MUIA 5FTLA 5KYXB 4D26A 4H15A 5DHAA 1P4JA 2E4AA 3PD0A 4IHJF 4Y98A 2LBPA 3ESRA 1H6AA 1T26A 5JNUA 4KVGA 1JA1A 3LXUX 2DHEA 3L7OA 4Z8XA 3R7LA 2CK3D 1OAOA 1GZSA 5EP1A 1I7SB 4KMMA 1A9XB 1FE8A 3CSSA 4EA7A 4KI7A 5A2QA 1YDFA 4IIXA 4UE3S 1PP4A 2DAPA 1XXHB 1JT2A 3C3DA 3ESAA 5LB2A 2EF0A 2OCXA 2RMKA 2VDJA 1I14A 1P75A 5G0SA 3R7WA 4BKUA 5JMWA 4WEOA 4JODA 2I62A 2QHXA 2JLUA 1K8QA 3AR4A 5EKTA 4JI8B 5JTTA 2WUFA 2IZ5A 4A6XA 1SBYA 4D0NA 2XHZA 3NXKA 3CGGA 1XDGA 5H81A 3RUEA 1THMA 1VSTA 4WNYA 4RSRA 4X3PA 1I1HA 2A6PA 1Y3FE 2CXUA 4PEVA 3SX0A 1TT5B 4J90A 3CVJA 2V74B 3CT6A 1D2EA 4B74A 3H5AA 1OFHA 2GAAA 3BIXA 3WGZA 3WL3A 2Q9BA 3LVBA 5FB3A 3BXZA 5FOWA 2D0DA 2PX4A 4Y9SA 4KTTE 2Z98A 3OSUA 4MR7B 4K3UA 5HK8A 1XLTA 5JAOA 3UB3A 4K9QA 4FYHA 1DAOA 2BAGA 1N9GB 2FPMA 2Q41A 2Y9PB 2E18A 1ZN2A 1E2IA 4IZHA 4CQLA 3CW8X 2JBWA 2P2CA 2XE8A 4OXYA 4Z7QB 1A9QA 3BBLA 5LIRA 4HQ6A 3HCDA 3FNEA 3R6WA 4JP3A 4XGNA 3ZW8A 3VKHA 3LBNA 5CHEA 5A1JA 1OFGA 1J99A 2CDCA 4P7KA 1MRSA 2BI4A 2E89A 3AG5A 4NCHA 1DAKA 4I3HA 5ADUS 1Y8AA 4G0VA 3AF5A 1Z8HA 4EF5A 1O5OA 4I1OA 3B9BA 1MEJA 4NV1A 1YS9A 2H3HA 4GOKA 4PO8A 3VR6H 5K7SA 5CGQB 3HCEA 2AYXA 3UTCA 3PENA 4EHAA 1L5FA 2UDPA 1BA2A 1D2CA 3ANYB 3P2KA 5IUJC 5JDIA 2J0SA 1Y0BA 1EJBA 3AIOA 3BMXA 1LZKA 2NVBA 3CBQA 3GDHA 4NAVA 2XZTA 2QMOA 4J1TC 1G3IA 3DHVA 1CK4A 1GUAA 1RTTA 2WFLA 3CONA 1AB6A 4OYYA 3ZYCA 5J43A 3K94A 4LX0A 1N75A 1SA0A 1XL0A 5LM3A 1ZIPA 2QRHA 3I73A 1Z0AA 4EJSA 3AY6A 1DBRA 2PQ2A 3AFMA 1FFEA 3HKEA 4D9CA 4CCYB 4E5PA 2YUIA 5KU7A 4B4KA 4LMAA 1ZJJA 1BX1A 2UXDB 1SD5A 3AVUA 1L7PA 1LSUA 3EUFA 1WCIA 3SICE 4YDQA 2GARA 1IN1A 3UGQA 3KETA 3SJUA 4OMCA 4QXRA 5HM8A 1DHRA 4NYIR 1KI7A 4BRWA 1QAQA 3EXFB 1N4AA 1IM5A 4KN8A 2YWFA 1CDEA 3DDOA 4COOA 3NS7A 3TIFA 4DJEC 2BFWA 3L0PA 1N8SA 4UPVA 4ZEMA 3K6SA 1YQTA 3GJ5A 3EIWA 3SJAA 5JVDF 5CFRA 5MN4A 2ESRA 1YDHA 2APJA 1XPUA 3RPEA 2VJYA 3EEIA 1RLJA 4DZZA 2HHJA 2CEKA 4WINA 1T0IA 1H2FA 5KHOC 3S70A 1HF3A 1Y82A 4CV0A 4PWZA 1PW7A 5JZSA 1TJ3A 4EZEA 1B15A 2B8WA 3L3BA 4MMZB 1OUMA 2Y0EA 3FZYA 3NU1A 1KFBB 2YRWA 3LPLA 4LQ4A 4PSAA 1NM5C 1CF9A 1LQ2A 3QLUC 4N40A 3BTVA 3L1HA 1D04A 3LTNC 1WZ2A 2HRZA 5M7EA 2BI7A 5DNYB 2Y92A 5FBVB 3E5HA 3ETDA 2AMJA 5CFOA 1ZGBA 1PR0A 3PVZA 1LLQA 3TD2A 4EG5A 3V33A 1I7PA 3AR9A 4HGZA 1EFVB 2P5YA 1AKEA 4WI1A 1ID8A 3WP0A 5DN9A 1M9NA 2O3QA 5KYGA 4HLUA 1KKMA 1LRLA 1MOPA 1X3SA 4UQPA 5EE0A 2FPUA 3U37A 3VTZA 3JX9A 4M1SA 4P35A 1XVAA 2CN1A 4RFLA 1MC5A 1VJCA 1W6UA 3ONEA 2QT0A 3QJ5A 3WNCA 1ZNZA 2CDRA 3IVMA 3LCUA 4CLOB 1P80A 2X86A 3U4AA 1TJYA 1R37A 1BQ3A 2BZ1A 2QUZA 1T0JB 4TWAA 4FZ3A 4JI7B 3E9QA 1OPXA 1RCUA 3CZ5A 3C1AA 4ZCPA 1JU4A 2BEWB 4I1YA 4EHHA 3PI6A 4CCWA 5IM4F 4H27A 1IJKA 4QTTB 3MAJA 4BNDB 1ECBA 4DLRA 2IYVA 4DVJA 2A88A 4ZICA 4JZKA 3H2JA 1F20A 1KDRA 4V0NA 4EO9A 1KDTA 2FZ5A 2LWIA 1BGWA 1ZCAA 3E61A 3N2NA 4FFWA 2OR3A 1W88B 1ZEJA 1QOQB 5DYWA 2H63A 3DUWA 1CVIA 1LV8A 3EG9A 5JFGA 1B8PA 1KHHA 1LSSA 2QRGA 2RAUA 1RQGA 2IDZA 2JAPA 2WJPA 2QZZA 3KC2A 2H85A 3AEXA 4MQ6A 3FWHA 1UJBA 3R1IA 4O0LA 4BZXA 3O3NB 3Q85A 1ZIYA 3VTKA 3RODA 4GYKA 1A5SB 5JATA 3A28A 3LQFA 2ZYIA 4BQSA 4HGQA 2B6HA 1UPCA 1K8RA 2ZCUA 3IRUA 3NAMA 2BT4A 3EODA 3KFVA 2DC1A 2ZRJA 4JVSB 4R8RA 5F5LA 4EL0A 1DEXA 4PYIA 1P18A 3C24A 2R7AA 2YYYA 4OV6B 4L8VA 4ZGWA 1GVHA 3SBXA 1FLVA 1L5LA 4ZEVA 2FMUA 3D2BA 3E35A 1MHPA 4F8YA 2V3VA 1DJMA 1UJ4A 3LDAA 1XMIA 3W7VA 2JFNA 4P4GA 4BDTA 3I2KA 3R7WB 5I7SA 4AKGA 1GNSA 3WWZA 3KSDO 3JRNA 3P9NA 2OKGA 3NUGA 2BHTA 1Q7TA 4DSTA 5DE3A 1D2RA 2AEEA 1GITA 1YR3A 3AU9A 3LWNA 5EJGA 1JYSA 3F6EX 3DZJA 2IW1A 3ZZTA 6YASA 2CJYA 1YKFA 4JN6B 4RZ3A 4L6AA 4A0QA 2XY4A 2CL7X 2BHRA 2ZJ8A 4KSYA 2ONCA 3RAFC 1PK8A 3NMUF 4YHBA 3TJZA 2JF0A 4JSYA 1J20A 5F51A 2D00A 1XA0A 2OSVA 3LBIA 5AKIA 4C6TA 3ORHA 1ORVA 5IEBA 2C9MA 3LYUA 4HVLA 4CQLB 1LY1A 1SC6A 2WKSA 5EN4A 2WR8A 1DFGA 1JEYB 3VU8A 2JEOA 3ZLUA 2PS0A 5LLTA 4INPA 1NN1A 4PYJA 2OHHA 1JEEA 3HP4A 2YIJA 2CUNA 3JYOA 4DCJA 4XDYA 3NWEA 4KNWA 2A67A 1JR3D 2I2BA 2XMGA 3EXHC 1DIHA 3IPCA 2BKVA 3CIFA 3U48A 4G9EA 2J7KA 1XZBA 2OFXA 3F46A 1J2TA 3RVPA 1EQ2A 3WGOA 3SAJA 1C1YA 3TLBA 4OQEA 3AEKA 3CZCA 4XUDA 2Z8XA 3H5WA 2GNAA 2WZQA 2ZUVA 4G0YA 5IF9A 1DADA 3DM5A 1WBDA 3ZDAA 3ILHA 3FFXA 1CD5A 3WWCA 1I3LA 2FFJA 1ORIA 1PN3A 1O6GA 1SA0B 1TVCA 2WTBA 1PNRA 1RIFA 2VNJA 4EJSB 3EFHA 3T1TA 3CHYA 2G9NA 3TR5A 2H29A 2VJCA 1UEIA 2AW3A 3KWJA 4FONA 1J8DA 5IC5A 3DLCA 4UHJA 3FMOB 1B0UA 4YMTA 2UXCB 2HLDD 2FDRA 4DV4B 1E0AA 3BKWA 3L01A 4Q39A 3MFYA 1E3IA 4GC9A 1WCIB 4XWAA 1YONA 1UBFA 3N2GA 4XD7A 3NHYA 1FMFA 4YV0A 1AUOA 3DE2X 1SVMA 2VP4A 4R9SA 1I94B 1NW9B 3ENQA 2DWUA 2IOFK 1OLXA 4XKJA 3G17A 1D4ZA 3L7DA 2P4SA 4RGQA 2D2FA 3RD5A 4H7IA 1D0SA 4N5MA 4PC2A 3HU5A 5EP2A 2JAXA 3ZD9A 3I92A 2I54A 1XDBA 2WP8J 1JSXA 3QWAA 1EVYA 2NNLD 4HN2A 2EDAA 4NYMQ 4Y2VA 5ES4B 1K5DA 4JI4B 1HWYA 1QH9A 4AYWA 3SX4A 2DQSA 2XODA 3TMKA 3ICPA 3KWFA 4P58A 4UARA 2BDEA 3CRMA 4V0MA 2ZUDA 1UANA 5AXAA 3KYDA 3T7EA 1FRZA 4R6WA 4U6QA 5LYJA 2JBAA 4LJKA 4MMXB 4DT1A 4GMXA 2X8BA 3ETNA 3REOA 4RETA 1NIPA 4RQUA 5ALRA 8ATCA 1G60A 1NW8A 3K9GA 1YS2X 2BM1A 2E82A 3FNBA 3IRVA 4RKQA 4Y2PA 5DNVA 4EITA 2FMTA 3PQ2A 2VHXA 5CVCA 5LP6A 3RV4A 2YYZA 4Z5XA 3WFIA 2VAPA 4ZD6A 3WGYA 4Y9DA 4TRMA 1WVIA 1VA4A 3TRKA 3O8QA 3OPYI 4TT3D 4EMSA 3JQAA 2O2IA 2VYCA 3DFIA 5C32A 1Z2CA 5HF6A 2Q3CA 4X95A 3A05A 1AXRA 3INYA 4LMRA 5CMLA 3BWDD 4NX2A 5K0GA 3WSVA 4FNOA 1IC6A 2IGTA 3GDGA 4C06A 4TTTS 2DFDA 1KL7A 3VPXA 1KC3A 4MJ7A 3IPAA 4H0CA 1F4PA 4YROA 4XJSA 3MMXA 4Q7LA 3SS8A 5KNBH 2ON6A 5C1IA 4G86A 3DC2A 4B6OA 4J2OA 2WTAA 4UUPA 3ISTA 4O2BA 4ZXFA 4CEIA 1MDBA 3G9QA 4IINA 3JQGB 4A8PA 3Q8LA 4QHSA 2VVTA 1ETHA 3EG9B 2QG4A 1WETA 1WXIA 5B3AA 5F9HA 1D4FA 4Q1EA 3RS5A 1P3DA 2VF7A 4Y1GA 4JU8A 1U94A 3Q0TA 4P3YA 1OWMA 2VUTA 2X7HA 4OB6A 4R8SA 1CJMA 3NHRA 3AY7A 2Q3FA 1CZHA 2HSGA 2OBLA 4AI6A 4PHCA 1ZN9A 1KFCB 1NX6A 4PLZA 3FKQA 2L19A 4XDHA 1X1BA 1H42A 3BWMA 3QG1A 1B0ZA 4BJ1A 3VR4H 1Q0HA 2R2GA 4BB6A 3W6ZA 2WM2A 1GUYA 5DIFA 2G4VA 3ZHVA 1JX6A 2Z6UA 1K98A 3GR6A 3EMVA 4ZOQI 4IHJA 2JCGA 1TK9A 1WDTA 3DONA 2K2QB 1FMTA 2CFRA 2ZTMA 3E22B 1SVKA 1JPJA 4NBKA 3ZWMA 3ANLA 3LBFA 3B1YA 3NIGB 4MWEA 4CUJA 4ENUA 4LWPA 3EIUA 3JVIA 5H4GA 2L17A 2Q6KA 5MGNA 4NH4A 2GXAA 5DW3A 4LZZA 3KT6A 1V7ZA 4AZ3A 2CFOA 1OI3A 4S04A 1U3DA 1ZC3A 3F7MA 3L46A 3R7AA 2AEMA 2YFKA 4N3NA 4TYMA 4ARBA 1JHZA 3ZTWA 4NS1A 5L3QA 3LXRA 1E61A 3GLHA 3Q72A 2HQ1A 3GFGA 3RVJA 4NNOA 1WPXA 3EPLA 1WDMA 2X7XA 4HNUA 3KB1A 4C6TB 2DH5A 1E7MA 2OM2A 3GA5A 4QT0A 5BT9A 3HKCB 4AUEA 4MYCA 4E1VA 1MOZA 2XKBA 2RBGA 5BN3A 1E9BA 1WW8A 3Q12A 4R98A 3RC1A 4UM9B 1F48A 1HG0A 1F3LA 2IIPA 3PF8A 3S2ZA 3TJMA 2HY7A 3LHIA 1AURA 1PX2A 1X15A 5ERYA 1CR0A 1D07A 2A2ZA 2W2MA 2ZYSA 3VO9A 4D4GA 3UV3A 2H1SA 2PEYA 3CZ4A 4JY7A 3VVCA 1Y89A 2D4HA 5C81A 3DEZA 4DIUA 1SCIA 4ISBA 5NULA 2R6ZA 1YE8A 1V1MB 1H8HA 2XTJA 4MP8A 4BNFA 1QLJA 3UT5B 4UPEA 4K87A 1U0RA 2H5JA 4YAEA 1KRXA 1E69A 3L7LA 3R7SA 1M7BA 2OCDA 5CTJA 3TQSA 5KYNA 1M76A 4M38A 3S2EA 1OB5A 1Q20A 4ZO4A 5LXTB 2QDXA 4M8SA 4GLFA 4TVOA 2AJ8A 5ALMA 1OXTA 4IUYA 1D5CA 4ICIA 2IOHA 3KJFA 3UJ8A 1DEHA 3EGIA 1YVDA 1S1CA 2M2IA 5KQPA 3FOCA 3A9SA 5SY9A 3SMVA 2WSIA 3LG2A 1MX5A 1XZNA 2J85A 2JIMA 4ES6A 4MZXA 1DFIA 1BS2A 3SHFA 4YT8A 3I6ZA 3KDSE 3DFFA 4P3XA 3N2GB 5TIIA 2A5GA 1WHSB 1WU7A 1I3KA 3COWA 1EG2A 5BV8A 5EJMA 1Y9EA 5C1DA 1TYCA 1KQFA 3MXOA 4F5YA 3Q9SA 2G63A 3RHTA 1L6IA 4MPTA 4PAGA 1QYVA 2BISA 3JR3A 4HBZA 4RY9A 2FR8A 2LP4Y 5BQ3A 5E9AA 3Q11A 3QKSA 2E1PA 3K30A 4MJXA 2LVBA 1FFYA 1FQJA 1SGWA 2POQX 1KMHA 4MQLA 1WZEA 4LYGA 4KN9S 2G88A 5F33A 1M6HA 4RUKA 4ZYYA 3N0XA 1JGTA 5IVIA 1JHAA 4G37A 5CDGA 4HAVA 1MA3A 2IZZA 4IIJF 3U3OA 4OEHA 4YPFA 4IIHA 1JR3E 3DHYA 2JBAB 4FVTA 4I6JA 4FOLA 3RTBA 4DT1B 5DBHX 3FUCA 5LZ4A 3W34A 4CJXA 3G5LA 3H84A 3JQCA 1KK3A 4QU9A 1EQUA 2IS4A 1G21B 3ZEAA 3H2ZA 3SP1A 1VPLA 2JFXA 2VAWA 3LP6A 4FGUA 4P0TA 2OYCA 3T7DA 4Z7NB 1OH8A 1I6LA 4JOCA 4V2UA 4BBPA 3NVKI 1I2MA 3WGIA 5L40A 3G1WA 1LU9A 3UENA 1K7SN 3O8QB 4H0NA 3GB9A 5HJ5A 3JQAB 3NWOA 3N0TA 1QF7A 3TVTA 1S6YA 1KXJA 3CWQA 3VI4B 1NVFA 2FVXA 4QELA 3WQBA 1W59A 3UT0A 4CLEA 2CD9A 4UEKA 5DI9A 2H5LA 4OUKX 2EEZA 3BA1A 1OKKA 5U4QA 1LXCA 3ZDQA 1N1GA 1K7FB 4CR6A 5AXBA 1XQYA 1Y8RA 2YY7A 2RK4A 4L4RA 4RJKA 1OA0A 2NZWA 1MNAA 2RG7A 2GERA 4YAIA 5JC8A 2VRNA 3JD1A 4OLFA 4YK7A 3W2GA 1WV0A 1W7AA 3OPMA 3LSYA 1C3LA 1KP2A 2DR0A 1IQ0A 3W5BA 2AA3A 1GU0A 4MR8A 2JAUA 1UP7A 2XTNA 1A5ZA 4X24A 5A3QA 2VDPB 4LFCB 1RYNA 5IM4A 4I46A 4Q9AA 4RPGA 4NLLA 1JDPA 3IILA 4MUFA 3WGNA 3AY3A 3MWEA 4FLEA 4ZRDA 4A6DA 1DL5A 5EJ7A 5F64A 1X1DA 4RVCA 4DY4A 3BE5A 1NXTA 1PO7A 1UAAA 3LHKA 2DHRA 4DILA 3LH5A 1N0IA 1NY6A 3T34A 3OH8A 3GEHA 3OF5A 1TOAA 2MMCA 2D5BA 1EG7A 4XA8A 1X7DA 4DTIA 2R0QC 2V98A 1ZIOA 2EZUA 2K7ZA 4LSWA 2PR7A 4KK3A 2A9FA 4G5GA 4PZAA 5IU6A 4WFIA 3TTSA 1R5NA 3U1BA 1YA8A 3PL5A 4PS0A 4WKGA 3UHFA 2CJWB 1R9NA 4IHJB 4YFYA 5BUQA 5F7OA 3LCJA 2JD1A 2L69A 3F8WA 4NEQA 1M0WA 3LQ1A 4J16A 4LVCA 3HR4A 4ZO8A 3FYUA 3KDPA 3SQOA 3ZDCA 3IAM1 2LV8A 2Q9CA 2XT9A 4TWJA 1QGZA 3HB9A 2RHTA 1P2BA 1NUHA 4RLSA 3BIJA 1MVOA 5I45A 3TW8A 4LRQA 1PF7E 2GEJA 2GAOA 2OBNA 5B37A 1PV4A 3T5PA 4KI0A 5B3JA 1PEAA 2Y1OA 2NO9A 3MS7A 1GGKA 1YQUA 4KDCA 2OYRA 4AZ3B 4MUXA 3PFGA 5CNIA 1XTBA 3OOJA 3QPBA 3ND8A 3QSGA 3EUEA 4HZUB 1V25A 1GU7A 3U49A 5L3QB 2PSHA 2QB5A 3GLHB 5E4JA 4Y6OA 1FU8A 4RVDA 4AD8A 5LYYA 2DXIA 3WL4A 1XB2A 1U4OA 1YR8A 2XVXA 2FG6C 2BGRA 1M6VA 2IXBA 3L04A 2CY0A 1G3RA 4D1YA 3ZWOA 4U8GA 1TM2A 1YVEI 3HL0A 4GG1A 3H3FA 3MRVA 4EHBA 1G3QA 3EVAA 4WK0B 3W9SA 4I14A 1OLSA 3UKDA 4H77A 2C77A 5BN3B 4M8LA 5JNSA 1EESA 5D1HA 3QYJA 3DNPA 3FNQA 1Z73A 3CUVA 1HT0A 1Z82A 1XZMA 3I9JA 4X8LA 1DG3A 5ITWA 3K1YA 1O57A 4HT3B 1Q7RA 5JSZA 3L7BA 3BIWA 5KKNB 2YXLA 3DWIA 1W52X 4IXMA 4TWRA 4RA9A 1SC3A 4U63A 4RU1A 2ZWIA 3NNNA 3OIVA 4FSDA 2WWVD 4RHFA 3Q2KA 3R23A 2BIFA 2OFPA 5LQSA 3ST7A 2YJTD 1T6XA 5KYVA 3TTXA 3GLFA 2IV2X 3TLEA 1EZ4A 2FEXA 4ZO7A 5BYKA 2YDXA 1N3LA 2OECA 3KKMA 3FIUA 4LVOA 1U2TA 4HADA 4ETNA 1RWQA 3IV7A 2Q2OA 2RGDA 2WTMA 3QM1A 4QASA 3EMBA 3HUFA 1U3TA 2W98A 2G07A 3QYAA 1ACJA 1NNUA 4G56A 1JJVA 3CLUD 3DM9B 3F9CA 4M1YA 4LOAA 2XQKA 1WF6A 1ZM7A 1DAMA 1VG8A 1VBNA 3N3BC 2OGUA 1Q92A 3DLIA 2BW0A 5DCYA 3ZQUA 5EHXA 4Z0HO 2H4ZA 3DAHA 2Y1DA 5EZYF 4I1VA 2GEDA 4HLDA 4L4XA 3BZWA 4YRJA 4DS3A 2IDKA 4ZZ1A 2QTVA 1V43A 4WACA 3E5MA 1E98A 2ZYGA 1NTOA 4TN5A 3U81A 5F2NA 2NTJA 1KJYA 2P2GA 4D3DA 4EVIA 4FEYA 3RSHA 3MF4A 4G1VA 4OJMX 3D6MA 3G1TA 4D0LB 1D09A 1I2CA 2W2NA 3ZHYA 2IHYA 4L0QA 3LOPA 4W6ZA 5BR4A 3R3SA 2X3FA 2YWEA 3BB4A 4QGFA 1RI3A 2GCOB 5JVDB 3U3MA 2Q5LA 2ZRPA 3WOHA 3F47A 4M2LA 1Y3IA 1ZVMA 4EMBA 2VO1A 1LV7A 3TL6A 1OGJA 1QJ4A 3B1KA 3GK3A 1Z5WA 3R7BA 4WJZA 2XYHA 2BMDA 1Y5LA 2AR7A 3JQEA 4P34A 2C2BA 3G9TA 2OK7A 1TPZA 2C7PA 1XR3A 1CP3A 1KJIA 4RY2A 1L4MA 5B1DA 4IUDS 2V0CA 3Q7IA 1Q0QA 1SHKA 1ULHA 3MJDA 1GIAA 4H7HA 5AVVA 1LLFA 4TLEA 2MINA 1SOMA 2B4KA 3ZBTA 4D8WA 1LPBB 2GN2A 3D0OA 1W6RA 1NURA 4IIVA 2HMTA 2CZQA 2Y2UA 4ERNA 2VTDA 3IQHX 3EA4A 4CVNA 4AAYA 1PJSA 1NF9A 4CDNA 2K2WA 1U2PA 4YASA 4Y2YA 4UC0A 2EZTA 1AZLA 1EXMA 4E4YA 1Y8RB 3BXEA 3QUQA 3HSSA 4B4WA 6NULA 1MPTA 3CO0S 3SE7A 4ARSA 1R8YA 1VCIA 2PKEA 2FZWA 1PVOA 3I4CA 2GF0A 1AK2A 1OAOC 1FTNA 4XH9B 5C8VA 7AT1A 1SQ6A 3JD2A 1NUUA 4GI2A 2Z6AA 2Y66A 4K88A 3LLVA 3ROEA 1FFXB 1DV1A 4R2HA 2PXAA 3WWOA 2FPLA 1JFVA 2AE1A 4TMVA 5BQXA 4BNHA 2J48A 2NP7A 3KZNA 3MWEB 3PIDA 2DF8A 4P93A 1LFAA 6LDHA 4BNVA 1I3MA 3QU5A 1X19A 5IP5A 1ICEA 5CU7A 1R4AA 4FDLA 2DSNA 3RYHB 4ASUA 1BMFA 3G8BA 3GFTA 4UJ5A 4LY3A 3AR7A 4IP0A 4J7CA 3ZZNA 3SVLA 4RESA 4C78A 4L95C 5DV9A 4CF6A 4CG0A 2XAUA 1NNLA 3U3DA 3KOMA 1R15A 5ITVA 3F6PA 5JS2A 2Z5LA 5BYBA 2AMFA 1XLTC 5LQCA 2DY1A 5E9JA 4L28A 2CHGA 3L7CA 3B5JA 1S4MA 1FYFA 2PZ8A 3KEMA 3ZWBA 4YECA 3VR0A 5AVZA 3MWDA 3KTOA 3VTAA 3FYUB 4EGJA 1P1RA 2C84A 4XYEA 2HZBA 1DU4A 4MRNA 2VPPA 2XDQA 2DHDA 4DV1B 1BX3A 1K7EB 3TW8B 4J3FA 5CX1B 5T57A 3WNBA 4EQZA 1E3DA 4TRRA 1QHFA 1D2HA 1YMVA 4LTMA 3WQRA 3ZHZA 4QEZA 4C4ZA 5EJFA 1M8PA 4U6SA 1OHHD 3HFGA 5JBQA 1DC7A 1KDYA 4RTKA 1RFGE 1I3OA 5FHQA 3P2YA 1A9SA 2ZGVA 4BXOB 1U9ZA 5TQVA 1V7PC 4D97A 5EJAA 1KJNA 1P4RA 4YQZA 4NG5A 2E5FA 1J70A 5GZ6A 1DRKA 2V7PA 1FFDA 1KKUA 3GCZA 5G3ZA 4B3JA 3CLKA 3IAUA 1Z5UA 2ZE7A 3PVSA 1P2FA 4ITVA 3I1JA 1QCDA 3ACBA 4BN5A 4EJSC 3DMRA 4QOHA 1CNEA 5FV7A 5IN4A 3IT1A 1WMBA 1L8LA 1KORA 4Z2YA 3GUUA 3SQWA 1EDDA 1Y6FA 2E55A 3KQKA 1UDXA 4FGJA 4H2DA 4YJGA 4V2IA 5JWHA 2HM7A 2CNDA 4AP5A 3K7EA 1GPUA 1GDDA 5KWIA 1WPGA 1UXGA 2R5NA 5JSZB 4ZIRA 2YOHA 5FOUA 3F90A 4FC6A 2VPYA 2ZSKA 4G67A 3WIOA 1ES9A 3D4LA 3GQBA 3I01A 4OG2A 4RA9B 5IFLA 1DRWA 2HFKA 5EKXA 2O5CA 3I53A 1FF9A 2P3QA 5AW7A 5AD1A 4F6RA 3GZ4A 4C89A 1KSGA 4NJEA 2NVUB 4D6PA 4Z9XA 4R9VA 3N70A 1XMXA 3TBFA 3IIKA 3MIZA 1A71A 3GT3A 5KWEA 3FVRA 4J07A 4UM5A 4DWJA 1ATIA 5JD5A 3NM6B 1ETUA 4BO5A 2N3ZA 4FLMA 1FP7A 1R0WA 2RHHA 3JQ7B 3G3EA 5CNJA 2C99A 3ZWYA 2HXSA 4N49A 2V45A 3OX3A 4PR3A 3IFSA 4EI7A 1K7CA 4ZARA 4BYMA 4CKYA 1Z75A 4P4UA 3WHLA 4G8BA 3EF0A 3WK4A 2Z2ZA 1HZZC 1M6NA 4JIGA 4Y6PA 5EKUA 4JA2A 3FUXA 5BSHA 2AMLA 2HF7A 3P27A 1P9RA 2H7CA 5EZQA 5TQ0A 4K8OA 2FWMX 3H3JA 5AHXA 5FP0A 4QJ3A 3MCTA 3TZBA 4B2IA 3HU2A 4UBNA 3A9RA 2DJIA 4DLVA 2CXTA 3KZXA 4FOOA 1D3AA 1WBJB 1XHFA 1RIIA 3UJDA 3CX7A 4C4RA 4RXUA 3I01M 1Z45A 1SUIA 3OWHA 1C9YA 3R5HA 3TUIC 3LVFO 3U56A 3HO1A 3O8LA 4BPBA 1HXHA 1D0VA 3T61A 1Q19A 4TLCA 1GL6A 1GQFA 4H0FA 4LOKA 4X00A 1PJQA 1TM3E 2QTBA 3IXLA 4MQFB 4Y67A 5GM2A 1RZRA 2CLCX 3CM0A 3GA0A 5BNFA 1BCSA 2YJNA 3GXBA 3UJBA 4TZ0A 1AH2A 1E4OA 4UCQA 4EEXA 5HX7A 2P69A 3I04A 1PWXA 1SG9A 2GHIA 3KT0A 1VPDA 1I51A 3G49A 3R3WA 5DWVA 1NV9A 3KZCA 1F5NA 3W1EA 4JROA 4UM8B