2BBTA

Human deltaf508 nbd1 with two solublizing mutations.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
279
structure length
249
Chain Sequence
TEVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSDSFDQFSAERRNSILTETLHRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure and dynamics of NBD1 from CFTR characterized using crystallography and hydrogen/deuterium exchange mass spectrometry.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 249
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bbtA00
3W6NA 1P3JA 4C0AC 1HY3A 1BYIA 2FZLA 2NG1A 3QVVA 3B1WA 1CJUC 1TQ2A 2X2EA 3AF2A 2OCPA 2RH5A 1D9ZA 6Q21A 1AGRA 1UPTA 3KFXA 2W6JA 4CEHB 4JBYA 4G01B 4LDJA 1QHIA 3P1JA 2CXXA 2IHYA 2QPTA 3NHBA 4CF7A 3I62A 1F2UA 1JBKA 3SHFA 3T5DA 1OH5A 5FOUA 3G82C 3KTAA 3R9XA 1P7CA 5DHFA 4E03A 1P9WA 4P4UA 5IRCD 4JBXA 3TLXA 1S1MA 4RCZA 3B9PA 4MYHA 2J7PD 1OHHD 4GT1A 3I72A 5CDFA 3KQHA 4G3XA 3R20A 1NKSA 4DCTA 1RRFA 2BC9A 1NMYA 1WE2A 1M2OB 5FPTA 2ZROA 5ANRB 4ZCMA 1P61B 5J5CA 4AKIA 2C9OA 5HCNA 2VBCA 1G8YA 2BKEA 5F3WB 3A1UA 4URZR 1E9FA 2DY1A 1Z0KA 4OQLA 2RGNA 2G1JA 3CO5A 1IN6A 1NIJA 1ZM4A 4OI4A 2ZYUX 1IQPA 3OHMA 4NMMA 2ZITA 5IHPA 2JDIA 3N5CA 4Q4AA 3IEUA 3PG5A 4HYYA 1XPUA 4DDWA 4LBZA 2Q0HA 4HEJA 4HLUA 2YJTD 1XBTA 3GLGA 4Q1FA 2ORWA 3EWSA 1P2TA 5HE8A 5KSPA 3THXA 1Z0JA 3MJHA 4TSFA 1KKMA 2O8FA 4M2LA 4QC2A 1PLJA 5C18A 2ORIA 2ZETA 3THWA 3U3MA 1GP2A 4F93B 4A4DA 1N2CE 2ZJOA 2FSFA 4OQMA 4M1MA 3CH5A 4Q7KA 1UEJA 4EPXA 4YDSA 2CLSA 2ZE7A 4KJZA 1NKTA 4C0SA 4IOLA 1C1YA 4V03A 1F5NA 1DAIA 1II9A 1P4SA 2VL7A 3K0AB 4TLCA 2HYIC 1A4RA 3G5UA 1VIYA 4N0EA 1G5TA 2O0KA 1SXJB 4M4SA 2MSDB 2ATXA 4AD8A 1DAGA 1XEXB 2RGCA 3R8FA 1ESNA 5JJLA 4PX9A 4PPNA 4ZI3A 2FEMA 3SZRA 5F98A 1G6HA 1UDWA 2ZJBA 4NDZA 3UWOA 2ZRMA 3QKUA 3ZYCA 4YDHB 2ZAOA 2AFHE 4UNQA 5LBIA 4C2TA 3RS5A 3I5YA 4WVFA 4PHFA 1SVLA 3NVAA 5E7JA 2V1UA 3KDSE 4R9UC 2FSHA 5UKDA 3GLIB 5C4GB 4C0QC 5AR1A 1H8ED 3HYRA 3RS4A 4JL5A 4B71A 1SKYE 3F5FA 4XTRA 4GMXA 4LHYA 4HAUA 3BE4A 1O3YA 2E9SA 2RKOA 4PPQA 1OF1A 1LTQA 2OV2A 2KSQA 5D3QA 4CT5A 1JJVA 1Z47A 2OAQ1 1GNRA 1OFHA 2JEOA 2WOJA 3GJ3A 5TV2A 1G20E 5KDDA 3L0PA 5CB6A 5KYKA 3DL0A 4Q19A 2ERXA 3SFZA 1HT2E 1MO6A 2OCYC 2XXAB 1WXQA 1QDEA 3IPXA 2QGNA 3RDPA 1NMXA 1HUQA 1XF9A 1E9DA 3PUYA 4A8JB 4URVR 1OPXA 3U4QB 1E4VA 1ZD8A 3LNCA 1YZGA 2F3RA 4CEIB 1KJWA 4H1UA 3SDZA 1OV4A 2R6DA 4JMPA 4XSGA 1W0JA 3QF7A 2D7CA 4HDCA 2WWIA 5BWMA 1SXJC 2ZE6A 5M04A 2GEUA 1FPMA 4BRUA 5LPNA 4RD1A 4GNKA 3U3KA 3SC3A 2IYTA 3A1SA 8OHMA 1GZSA 4B3GA 2IF0A 2WPDD 5JRZA 4JKIA 4D80A 1Z6YA 2QAGA 1S9DA 1Q57A 1LY1A 3GEIA 4YMVA 3W90A 1OLOA 2C77A 3OFND 5KNCA 3KTAB 4Z1MD 2GVZC 3UXMA 2YC4C 4QGFA 4OHXA 4LV8B 4DEYA 1A2KC 4KLNA 3IGFA 1L4YA 4II7A 4IDHA 4AI6A 4OHZA 3ZS9A 4LJAA 4MYUA 1R10A 1VG0B 2O8CA 4DB2A 2REOA 1XD8A 1X1SA 2IYXA 4DIDA 3QEOA 1V5WA 4LHWA 2IYVA 3ZVNA 5JEDA 1G3RA 3ZD6A 1K8RA 2P65A 4QNMA 1DAEA 4JYCA 2A30A 4P0TA 4FD2A 1G8HA 4TMVA 5A4JA 2AN9A 2ZU6A 2CBZA 2WJGA 4PAOA 2EWVA 4OK5A 1EGAA 3RABA 2DFTA 2VP4A 1VYUA 4TL9A 4HUQA 4A8JC 4B43A 4EPWA 121PA 1T0HB 4NPHA 4KBGA 3V9PA 4D0LB 2DR3A 3PENA 1KO5A 4JVMA 4PFSA 5TDHA 2WICA 5DLQC 3CNNA 2R2AA 1P9NA 4F4JA 2JLUA 4BZXA 1NMZA 4HDOB 2JIZD 3W9YA 3SBDA 2WSSD 3KJHA 3THXB 1N6OA 5EE3A 1Z6XA 4M1WA 3K0EA 3K09C 1A2BA 3EA5A 2QPOA 2O8FB 2Q21A 2UZIR 3THWB 3ZD7A 4KYUA 2AHOA 1CXZA 3OAAA 1SULA 3BAFA 1KOFA 1OKKD 2EQBA 2OE2A 2H18A 2QNRA 5KSYA 4KFUA 4KFRA 1XXHE 2IS1A 4URYR 3G0HA 2O5VA 3WNDA 1JQJC 3PUVA 1XD9A 2R6FA 4AYXA 4BLTA 1XB2A 3RRNA 2P0EA 4BLPA 1HEIA 5EXTA 3M0EA 1KO1A 2IYRA 4Q47A 1G8GA 1Z29A 1OSNA 3VU9A 2YWGA 2YINC 4URUR 1OXTA 4PHHA 4TTQA 1IY0A 1P2UA 4CRWB 1Q22A 4M9SA 2GCOB 2W0MA 3SEAA 5DI3A 4POAA 2HDNB 3MRSA 1LVGA 3F0TA 1Q3TA 3Q72A 1QHXA 4RFVA 1GDDA 1NBMA 1G291 3BB1A 3RWMB 5EE9A 4Q4JA 2JJ2D 5AJZA 5H8WA 2FF7A 4JL6A 4W5HA 4CEJA 4Q7LA 4BFYA 1OFUX 1CULC 3ND9A 4EPRA 3TH5A 1J90A 5CK4A 4KFSA 1R5OA 4HLUC 3TAHA 4V0LA 2QA5A 4CIDA 1G4UR 2QRNA 1CR1A 1W46A 2ZEJA 5DISB 3ADKA 2GXAA 5D3MB 5EP1A 2ZSAA 3QXSA 3HYTA 2Q9CA 2KJQA 3BB3A 2H5EA 4S2EA 1YHNA 3H0KA 3SYKA 1U0JA 2H1LA 2QT1A 5SZIA 2ZM5A 1AZTA 2HCJB 4LGMA 3WYGA 1W0KD 4HAYA 4ZIRA 4TLAA 1KI2A 3AVPA 3QVUA 4E07A 3VKHA 4AK9A 2ZYWX 4M9ZA 5DHAA 1QHHB 3QG5A 2QSZA 5A5GA 2B92A 4NCIA 4D81A 1FX0A 4IVPA 5EXXA 4NP6A 3CUEF 1XRJA 2ZYVX 1R4AA 4MUBA 2AWNA 5FL7D 5BYKA 3AVYA 3QPWA 2QORA 2YV5A 2OSBA 4F38A 2DWPA 2LWIA 3VHXA 3ZLJA 3FHOA 1K5GA 2QAGB 5A0FA 2ZI3A 1OH6A 2QP9X 1XU4A 2VO1A 4AURA 2P3SA 4LYAA 4TL7A 1II0A 5JWRA 2CDNA 4KSBA 4JYBA 4IHQA 4DLTA 5IK2D 4QGAA 4MDFA 3KKPA 1HH4A 2NIPA 1M7BA 4OHYA 1U98A 1F48A 2RGXA 4HAXA 3TNFA 2WSMA 4YMTA 2FFHA 4YMSA 4C7OB 5JJIA 2AKYA 2DBYA 3FDIA 3QE0A 4HATA 4EDHA 1R0WA 4Q48A 4QHTA 4RSGA 4AC9A 3HJNA 4DWJA 3CWQA 3DM9B 1TTTA 4MKHA 2OAP1 3CWZA 1K5DA 4MRNA 4WW0A 2ZRPA 3KXLA 3Q5DA 5B58C 1XPOA 3FHTA 5EZ5A 4DZZA 4G5SA 4RD0A 2RMKA 5P21A 1T3SA 2QP3A 1IXRC 3LQRA 4F7WA 1ETUA 5J4KA 5KSOA 2W2TA 4HUQB 1N0UA 3ECCA 4L4UA 1E3MA 4LJYA 4RZ2A 2PEZA 2ZUBA 4B3FX 4PPFA 1G5RA 4BLQA 5KDLA 4U7DA 4UXJA 3KJIA 1LS1A 1W44A 2I1QA 5IT5A 2REBA 3MWLA 4A0RA 4B47A 1XFAA 1D9XA 5BW8A 3FOZA 3TR0A 4QL3A 3GJ0A 4TQAA 2W6ID 3K0CC 5CLLA 4WXRA 4MH0R 5HR5A 4ZPXA 2VP0A 2GZDA 1DARA 1Z28A 1U8YA 1TEVA 1S3GA 4J0QA 4W5JA 1T9HA 4B34A 2BM1A 1XXHB 4LC1A 4PHGA 3WMEA 3LX8A 2QAGC 3L82B 1CJTC 4Q01A 3U44A 2PT5A 4Q66C 3SE0A 1S3SA 2FSIA 3AH8A 1W2GA 4KITB 1YR7A 1YJ5A 2GXSA 1DOAA 2G0TA 4R2HA 4PO1A 3KL4A 3LA6A 5G40A 3Q3JB 2O0JA 2OFXA 1RYHA 2ZUDA 3TSOA 4LBYA 3QI2A 1AM4D 4V0NA 1GRQA 5L3RA 1XX6A 2OLJA 3FMFA 1KK1A 4IVQA 2EFGA 5DI3B 4BFSA 1RJ9A 1XMSA 3B1ZA 4ITRC 1OH7A 1COWA 2IS2A 4YMUA 2IWHA 2OHFA 1VG9B 3SN6A 3B78A 4OJKA 2GKSA 2QT0A 2WKRA 5BN4A 2ZRIA 4B76A 5FH9A 1TADA 1AKEA 2CL7X 3W6PA 2A5GA 5C4MA 4CGZA 2I1VB 2RB4A 2ZJYA 5E7MA 3JVUA 4ZDJA 5AWFC 1ZYUA 4KBFA 2NZJA 5KDOA 2XSZD 3CKLA 3U3OA 1Y3AA 2IXFA 4GP6A 3OE7D 5FPYA 3IKJA 4CVNA 1AS0A 2NPIA 3AF3A 3VR3A 4N1AA 1FQJA 1H65A 2ZSEA 2NQ2C 1M34E 3E5HA 3WYFA 3UG7A 1NY6A 5K8LA 5KNBA 2JASA 2XAUA 2BIFA 4QJ3A 3PV0A 1F2TA 2BMFA 3BK7A 1Q12A 2IHBA 4L15A 5JJKA 2XX3A 4NKRA 1X86B 4BUJA 2ZRBA 4XJXA 3B13B 2WWFA 2EFCB 5AJWA 1P73A 2G83A 1OYYA 2NO1A 5G53C 1FX0B 1TF7A 2Y8EA 2EWWA 1VKJA 3BRWD 1NLFA 2GK7A 2A5JA 1KI7A 2EW1A 2HV8A 1II8A 2HXYA 1FUKA 1M7HA 2CL6X 5CIQA 1TU3A 5TB5A 3VX4A 1G1MA 1U0LA 2X77A 2HYDA 1Z6TA 2JCSA 3FWYA 4P4TA 2WWHA 4IFEA 5DN6D 1M1YE 1OT3A 3QIAA 2GK6A 3AEZA 3RRMA 3K70D 1KAOA 1UKVY 1ODFA 3O8DA 2J46A 2OBMA 3VKWA 1IN8A 2H17A 4LSGA 1GL6A 2QTFA 3D6TB 2QPAA 1E2MA 3EIQA 3LW7A 1J7KA 3KUCA 3KKNA 4NYMQ 4QBFA 4BFZA 4I81A 2ZSDA 3SR0A 3BH0A 3H1TA 2H57A 3KQUA 4WBSA 1OXUA 2P6UA 3UANA 1ZM9A 3UIEA 2GZHA 4ABYA 1QVRA 2AR7A 4KI0A 2BDTA 1FP6A 5IF9A 4BZQA 5L3VA 1E4YA 3E1SA 1MABA 2WZQA 3CPEA 1D6JA 3U5ZB 2ZXUA 4ARZB 2QROA 3QENA 2IX3A 1E2EA 1Z83A 3U60B 1G18A 2F43B 1JXMA 1TQDA 3ADDA 4GOKA 2YWHA 3SYNA 4UNRA 3OAAD 3KXIA 5JHGB 2IS4A 2QY9A 2ZSFA 1W7AA 3BH7A 3NKVA 4EFNA 1UBGA 1Z2CA 1N3BA 2GA8A 3A6PC 1KSGA 4ZKDA 5DYGA 2WAYA 3U44B 1IXZA 4ZI2A 4URWR 4V0OA 1TNDA 3SJBA 3OIVA 2N46A 4PQRA 2NOAA 4RD3A 5FOWA 4BWYA 4TMXA 4F4CA 2D7DA 3WP1B 4UNSA 1UKYA 5GJVC 4CW7A 621PA 4BGDA 1GM5A 4HUTA 3PEWA 1PVOA 2C78A 2KB0A 1AQUA 3KKMA 821PA 2ZAMA 3HWSA 5FR2A 4HB0A 1Z6AA 4HLCA 4X8LA 1RW4A 2BJWA 5FPHA 4ERNA 2CK3D 3BWDD 1U90A 1RRGA 4HAZA 5H68A 3RC3A 1NIPA 4EFLA 5FBLB 1XEXA 3KKQA 4HAVA 3U3RA 4TMTA 4MGIR 2XNSA 4RD6A 3Q9LA 3QBVA 4R98A 4LHZA 2QMEA 4LJ5A 3OEEA 1Q0UA 1U8AA 1KTVA 4FMDF 3W8NA 3C4JA 4AKEA 2WWYA 1R5BA 3L2OB 4EIWA 2ZR0A 4ASUA 5EP4A 4M9QA 1QHNA 3GLIA 1S8FA 1W36D 1ZM7A 2IL1A 4QGHA 3FFAA 1KHTA 3GFPA 1ZUNB 4Y0VA 4NL4H 4CDGA 2VRWA 3W5IA 1MT0A 3OIUA 3MWYW 1HE8B 3QXHA 4LYHA 1F2TB 2B6HA 3TQFA 5KSZA 4EPVA 2PZEA 4IKEA 5CIWA 1GOTA 1DAFA 2V4ZA 4HLDA 2XOKA 3A8TA 1VCOA 3IO5A 4Q1BA 4YXWA 5JCZA 1WB9A 1IBRA 3DKVA 2ZS7A 1Z2AA 1FFHA 2PMKA 2A5FA 1KK0A 1CEEA 2OEPA 4OK6A 2EVWX 4FCWA 1YVDA 2C95A 1GTVA 3TVTA 1XNJA 3L43A 1MO3A 1II8B 2IF2A 4Q9JA 4A8JA 5FUXA 2VLIA 1CJVC 2IYWA 3THOA 2D06A 4BFVA 2ZRJA 1OJLA 4CEIA 1E9RA 4GZMA 1RYFA 3PUXA 3ADBA 5B64A 4BLOA 5JSZB 4C0LA 1ZNYA 2CNWA 1NJGA 1GKUB 2FEOA 2R6GA 3EW9A 1XTRA 1O87A 5JZVA 3PEVA 3WXMA 3K09A 3DZ8A 1TUEA 1NLZA 1FOEB 2BEKA 1S0UA 2E1RA 3SS8A 1BH2A 4NONA 2OBNA 4TL8A 1DAMA 1DG1G 2GCPA 3W3ZB 3MJRA 1AQYA 4A0FA 3QKSB 3VR5A 4DSTA 4JIMA 3PXGA 2AFIE 2CEAA 5C1BA 4URXR 4G1UC 3W5JA 4M1YA 3WRYC 3ADCA 5GJBA 3ZIAD 1JQLB 4D4LA 2QP4A 4CZ2A 3W34A 3B8HA 3OEHA 4JT2A 5JFGA 3EIEA 4NU0A 5CYPA 4HZIA 3FKQA 5JHHB 1SVIA 1TF5A 1MABB 4MGYR 2XTNA 4W5WA 4AY2A 1AS3A 2ZJAA 3HU2A 5C46F 1NVUQ 2RCNA 4E09A 1XEWX 3AGPA 2PMDA 2XTMA 2D2EA 2GAAA 2UVQA 3KQNA 2AX4A 1CF4A 2ATVA 4A36A 1U99A 3QPUA 4KHZA 4PQYA 2BCGY 1YZNA 2XNDA 4Q00A 5FFMA 1CR0A 5CITA 1N6NA 1KSJA 1GUAA 4JSTA 4GPTA 3CB4A 4P33A 5JS8A 1H8HA 3QJYA 3FGNA 2ZI7A 1BMFA 3ZZ0A 2IEZA 4LRWA 2FU5C 4HB3A 1XTSA 4DUGD 3K0FB 1UF9A 2CVHA 2GJSA 2P5TB 3BIFA 3KB2A 4AG6A 3EX7C 4WOPA 4NCJA 4XIGS 4DLWA 4L8GA 2JJ1A 4DEXA 2ZR7A 2C2HA 1VCMA 3GCGA 3LLMA 4QJ5A 4FI3C 3SQWA 2PCLA 4NH0A 4MYTA 3CNLA 2JLYA 1N25A 1LW7A 1W4BA 2PLRA 4DLYA 4ZV4A 1N6RA 4PQFA 4PZZA 4A2PA 4HZUB 4FMCB 3BERA 1N6LA 5CLQA 1FUUA 2G9NA 3MMPA 3N70A 2EU8A 4WZBE 1IN4A 5FBVB 1Y63A 3AQ4A 4PSKA 2JAQA 3IO3A 1FW6A 4D6PA 3THYB 1Q1BA 2VYFA 2ZR9A 2IBMA 2O8BB 1VYTA 3GPLA 4US1R 1NL3A 3I92A 1DVRA 2GCOA 1UKZA 4Z8YA 3RSLA 1GSIA 3LO5A 4TYWA 1J99A 3HU3A 1JJ7A 3IHLA 4Q1EA 2KBEA 5FOXA 4AYTA 2IT1A 1IY2A 5IDVA 3WBKA 1EG7A 1NRJB 4IOJA 4NYMR 5JI2E 3CR8A 4WXPA 3ASZA 3AV0B 1U81A 1FMLA 1R7RA 2EYUA 4ZCIA 1ZNWA 1XTJA 3QQ5A 1A1VA 5DGXA 5J4VA 4ZDKA 2WJJA 4RY2A 2G88A 4JSYA 3GLHE 4NHOA 3IEVA 1EX7A 3Q5EA 1KZ7B 4NE2A 3OESA 2QUZA 1U8ZA 2GHIA 3QXXA 1CKEA 5D3MA 4Q4HA 1KY2A 4QHSA 5DYIA 3X1YA 2FPLA 3MSXA 1MKYA 4B2IA 4G5RA 421PA 5K8TA 1LS6A 1QRAA 2EFDB 1EFUA 2XTZA 5F9FA 2RGGA 1EWRA 1E1QA 5EE1A 3WMGA 5EXSA 2FPKA 1DELA 4LJ4A 4BE7B 1JR3D 1N6HA 1V43A 3ND8A 2Z0MA 4UNNA 1QHHA 1UKEA 1XEWY 2V54A 3BOSA 4AIIA 3K0CA 4D0GA 4F91B 2ZRAA 1EFTA 5FUWA 2P6NA 3Q7PA 3GFOA 3GJ8A 2IYUA 3LXRA 1Q1QA 1X8JA 2ZVQX 1JNYA 1R0XA 1G7SA 3C8UA 4JLVA 1YKSA 2F55A 4NBSA 3H86A 4DSNA 5B57C 4DLZA 4DCVA 4D0NA 3V00A 5HTKA 1G3UA 3K0SA 4UNPA 1S4QA 2QQ0A 4TL6A 5AJVB 3TBKA 4ZKEA 3K1JA 4C7OA 5G41A 1C9KA 2VQSA 3KB1A 3Q7QA 1GIAA 4TLEA 4DCUA 1VG1A 4LPSA 3EZFA 2JLWA 1JXOA 2FMXA 3U7GA 4GOJA 2ZRHA 4P31A 2X8AA 3PJRA 1DEKA 3K53A 3IIJA 4BRWA 2V55B 2OBLA 2X1VA 3DKPA 5J4YA 1I4DD 221PA 2I3BA 4LYJA 2XEXA 1T91A 5JBQA 4DT1B 4OK3A 1DO2A 1SVSA 4U5XA 1JEDA 2WVJA 1N5JA 4TYYA 4P32A 5BYJA 2WIAA 3CRW1 3GJ4A 2B8TA 4MRSA 1T4GA 4UKDA 4IDOA 3HR7A 4O2RA 3QBTA 4B2LA 5J4HA 2J3EA 3RS3A 1AJEA 2WMNB 4KV9A 1HE1C 1FZQA 4JS0A 1DTSA 4C4PA 3EC2A 1KSFX 2W2VA 4IDQA 1FQKA 2NPFA 1QVAA 2CHQA 2HLDD 1EFRD 1SXJD 1XXHA 3NBXX 2WJHA 1E79A 3U3JA 3U7HB 5L3QA 3SQXA 3ZVMA 4BZPA 4EPTA 4OHVA 1D2EA 5EUQB 2O8DA 2GEDA 2VP2A 4KODA 2ZREA 2OILA 1D8TA 1R0ZA 1F3OA 5DNYB 2VSFA 3C16C 1YE8A 4JLBA 3UWKA 1R8SA 1G3IA 1RKBA 2IXGA 4ASUD 4DLXA 1NN5A 1X1RA 2WKQA 1OFIA 2J59A 2QI9C 4TMWA 3FKSA 3F3YA 4BECA 3A4NA 3ZZTA 3VKGA 4R2IA 2PZFA 2QE7A 1FTNA 4LPKA 3CZQA 4TT3A 3DM5A 2V7QD 3OZXA 1SKYB 3GJ7A 3WNCA 5EJEA 2J45A 1OB5A 3CRQA 5SZKB 4PC6A 1TU4A 4I99A 1ZU5A 2FGKA 1VHTA 2MMCA 4M22A 4C3ZA 2OESA 2ZUCA 4K8OA 2QM8A 3U2QA 2XB2A 3GLHB 3RLFA 1E2QA 1Z07A 4BFTA 1G8FA 2ZJ5A 3QEJA 1UEIA 1DE0A 1SVOA 3B2EA 4PZLA 3WMFA 1A5TA 3P26A 1T6NA 2BWJA 4TTPA 4Q4HB 5FOVA 5EE5B 4RVCA 1E1RA 4A2WA 4D4KA 5J47A 5EZ6B 2YKGA 2XGJA 3I3SR 5DH9A 5JRJA 4RCYA 3GJ6A 5KNDA 2GJ9A 3IUYA 2ZANA 5L3SB 1I4LD 1ZCAA 4DCSA 2GJKA 4LBVA 1ZINA 3KJEA 4V02A 2ONJA 4A15A 5HKKA 3LWNA 1NY5A 2W6JD 1Z8FA 2VF8A 4TYPA 1W4AA 3I4LA 3A1TA 1AK2A 2ZRGA 1G64A 2BBSA 4HSEA 2GAOA 1ANKA 3SI7A 4TQUS 4ESHA 4PPGA 5G3YA 3ZS8A 3CPHA 1GL7A 3QPVA 4OYHA 2CJWB 1KO4A 3EZ6A 3LDAA 4I1SA 3GFTA 1I2DA 1XMJA 4MUAA 4RZUA 4NCNA 5KUTA 4RZ3A 1NVWQ 5FOTA 1F60A 2GJ8A 1YRAA 2IYLD 1JR6A 1ZBDA 4BPBA 5FI1B 3Q85A 4M9XA 5FTLA 2B8WA 2VP5A 1CTQA 4EJSB 1E0AA 3LRPA 3NWJA 3SJZA 3W3AA 1G21E 3QF4A 4LJ6A 2OUKA 5HZKA 2YNMA 4DRZA 4H1VA 5JS7A 4PZYA 1TMKA 3WRXC 1G4AE 1BS1A 1JPNA 3OIWA 1U9IA 2EFHB 2ONKA 2A9KA 4XD7A 1Q1EA 4A6XA 1BO6A 4JKYA 2ASEA 4B33A 3QNUA 2RAPA 4BFXA 5EP2A 2GJAA 2CCGA 3EZ2A 4EUNA 2WMOB 4YLGA 4IVRA 2JDID 3LV8A 1OXXK 4YMWA 3R7WB 2PCJA 4KCGA 2HF9A 4XWOA 2HJGA 3NEYA 1K6MA 2BV3A 4I1VA 1E98A 1Z0DA 5B2ZA 1KK3A 2YOGA 2QZ4A 2X19A 4ARZA 4TSFD 4Q7MB 3SYLA 3NDPA 2J0SA 2F43A 4JLJA 2QMHA 1WCV1 4LC0A 1XTIA 4DVGA 1IN5A 2ZE8A 3I1FA 2ZYTX 3WNBA 1U0HC 2H8KA 3I8XA 1CRPA 4TTRA 1G6OA 4A9AA 4B3BA 4OBEA 2F1IA 2W2XA 2WTUA 4BASA 1KI3A 3TSZA 1KDTA 1KJZA 5L3QB 4X8OA 2J7PA 3B1YA 2D4HA 2WHXA 1E0JA 1OHHA 2ANCA 1OXVA 4MGKR 1PV4A 1ZD9A 2ZTSA 3VAAA 1T3LA 2O8DB 3VNUA 3EIHA 3O8BA 3PIRA 3AKEA 2FFQA 4EQ6B 4EJSC 2P67A 1GILA 3AKYA 3M6AA 2OFOA 4XOIA 1E9BA 2QBYA 4MDEA 4K81B 4NZYA 5JECA 3BD9A 4DJTA 4XH9B 1CS4C 1BKDR 2C98A 4FWIB 4JLDA 4PC7A 2LCFA 1QZXA 3L0IB 3UMRA 2W83A 3TRFA 3ZVLA 3TSWA 2ZRNA 2V3CC 4GFDA 5FBRB 2PJZA 1AZSC 1J70A 1N0WA 1HV8A 2H16A 4MITA 5FBQB 2QTVB 4PHTA 4EPYA 1N5LA 3SFVA 4QXAA 1Z0AA 1XCGB 1G3MA 2R8RA 4OI0A 1Q44A 1ZRHA 4D26A 3NHAA 1XTQA 1OW3B 4LY6A 3LBIA 1A82A 1XCMA 1GVNB 2FFAA 2ZS8A 1KI6B 3C7KA 4IEEA 4A2QA 3TVDA 4XSHA 5AUOB 1XD2B 5JEEA 3ZH9B 4FN5A 3QKTA 1W2HA 1W0JD 3ZJYA 1OIVA 3K8YA 1M7GA 2ZI5A 3LAWA 4P4SB 1HQYE 4MQBA 2IA5A 4QBHA 4HI0E 3PITA 2FNAA 2P2LA 1E2JA 3WHKA 2VHJA 3A36A 3H2YA 4BLRA 2IYZA 4JJKA 1W36B 3EC1A 3TUJC 1H8EA 2GCNA 4DSUA 3EPLA 3UMFA 2O8EB 1VYVA 2QMOA 2VTKA 4N0DA 4C0KA 5FR1A 5HE9A 3VR1A 3EPJA 5JSZA 2JLXA 3LY5A 3DOFA 1RC8A 1KY3A 1ZJ6A 3S1AA 5B30A 3N2IA 3V4RA 1G19A 4D4JA 3TIFA 3QF4B 4MKGA 1R2QA 1SHZA 3J81k 1OYWA 3B60A 3W8RA 4OQFA 3AVUA 1WQ1R 2JLQA 1ZIOA 2XITA 4Q1AA 5AUQA 1EXMA 5FOSA 2W0SA 5C2JB 3QKSA 5LB4A 4KVAA 1GL9B 1YU9A 4MGZR 1FMJA 1TEXA 3R8CA 3AP1A 1E9CA 3MAAC 3D8BA 1P62B 1FTSA 3BC1A 1KAGA 1IN7A 3L0SA 5LB2A 3NC0C 1N5IA 5KO2A 2NO0A 4N3NA 1JR3E 4UQOA 5H70A 2V6IA 2GXQA 1IOZA 3FE2A 4RKFA 1E0SA 4WZAE 4KVGA 1KI8A 3B9QA 1CJKC 2WPDA 5HPYB 5LDDC 3IQXA 2CCKA 4W9MC 1GITA 1ESMA 3HPQA 3MWKA 2BJVA 4NYIQ 1VDZA 4V0KA 1W36C 2O0HA 2J0UA 2H7VA 1EFCA 4Z1MA 5BQ5A 2R44A 2GTPA 1JECA 3EXAA 2HF8A 3T61A 4L9WA 3GP8A 3IHWA 4RKEA 2XZOA 4LJ8A 2JJ8A 1Z5ZA 3K0FA 1IHUA 1WBDA 3B7GA 1RFLA 2AK2A 3X1XA 4JVNA 4EFMA 3TKLA 4LYFA 1ZAKA 1DS6A 2GNOA 1YZKA 3TMKA 1JPJA 3GJXC 3GD7A 5BN3A 2QBYB 1DAKA 2QQEA 2GDJA 2ZVPX 1RE0A 3CONA 3NTUA 4AWXA 4TWZA 2A5YB 2YC2C 2AXPA 1KDPA 4QHYA 4QFMA 4HZUA 1U9IC 3AUYA 1NBMD 3GLFA 3GLFE 4FINA 2AD1A 4I4LA 2QU8A 4MA4A 3N2EA 2JATA 1Z22A 1ZW6A 4B35A 3EPHA 2AWOA 1G9XA 4TZ6A 1E2KA 2JIZA 1T5IA 2GESA 3U61B 2WSSA 3A4MA 2VPPA 3THYA 4IOMA 3AVWA 4DHEA 1UFQA 2ODNA 3KJGA 2MSEB 2O8BA 3KUDA 2CMKA 1D2NA 2ANBA 4IJMA 1DAHA 1E2HA 3L8ZA 2VEDA 2CE2X 4A0GA 1OKKA 4EAQA 4C2UA 2YOFA 1Q1ZA 1EK0A 2B7BA 2YWFA 3P27A 3MCAA 3VHLB 2FSGA 1KSHA 2ZJ2A 4DDTA 4B3DA 3BJIC 5EXPA 3U6KA 2NO6A 2DCUA 4UXIA 4KU4A 4PTLA 1ZC3A 3PR1A 4PANA 1ELOA 4JT4A 1ZIPA 3PQCA 2BMEA 2QM7A 5FPSA 2ZI6A 3U6BA 4ACAA 2PJRA 1P6XA 4RD2A 5E7IA 2PH1A 2VHUA 3IBYA 3UPUA 5F2EA 1JEEA 1XEFA 2G3YA 3RVBA 3MD0A 1XZQA 3MG9A 1HYQA 3PUWA 4OL0A 1XCPA 4U00A 5GVRA 1TX4B 1NSFA 4P3YA 1W5TA 3LVQE 1P2SA 1UADA 2IWRA 3DDCA 1KNXA 3NH9A 1XZPA 3EA0A 3SJAA 3FHCB 2Z6VA 5E3HA 1DADA 2JJ2A 2HT6A 2WKPA 4FIDA 2BBWA 3B1VA 4QG7A 4BLSA 2VP6A 2C9YA 4LZZA 3S1AB 2VHQA 3PEUA 5BXQC 4QNRA 4LHVA 3WYAA 1KDRA 1EFHA 2BOVA 2XB4A 4G5GA 1R8QA 3NXSA 4ON9A 1FL9A 3PVSA 2GZAA 4Q18A 1YR9A 1N6KA 2GEVA 2QRZA 3O8CA 3KFVA 4KXFB 2VSXA 2FH5B 2QN6A 4F4IA 1U2RA 1Q20A 2V1XA 3JZAA 3DO6A 2IUSA 1BYUA 1GG2A 1Z08A 1MH1A 2F9MA 4O25A 1KI4A 2QENA 5TXGA 2ZE5A 1W0KA 1L8QA 2RGAA 2F6RA 3NDBB 4PO8A 3QUSA 4A6PA 3O47A 5H1YA 2OCBA 3TJZA 3OIYA 4PSAA 3FB4A 2GF0A 4Q9IA 5SZJA 3QXJA 2ECKA 5DSZA 5BN5A 3NEJA 1X3SA 3IBGA 3T15A 4WAUA 2HT1A 1AS2A 3MFYA 5FL7A 1MO4A 3RSOA 1NNEA 3DMNA 1C4OA 4C0BA 3CZPA 3BS4A 3ZDQA 2J5XA 1MO5A 5E95A 2V9PA 3FVQA 4IEIA 4DT1A 4D4MA 5IK2A 3BBPA 3B5JA 2J0UB 2WBLC 4HB4A 4KLZA 4A82A 1VMAA 1SHKA 2R9VA 4IFBA 5TY0A 1LFDB 3K9HA 4GMDA 5SZHB 5CDFE 5KHOC 3JVVA 4GP7A 1Z0FA 4PC3A 3QG1A 1RRPA 2IW3A 4Z51A 2QGZA 3EZ9A 1WRBA 3EARA 1G7TA 3AUXA 4DDVA 3AP2A 4QOSA 2V6JA 4NTZA 1PZNA 2B21A 3CR7A 3SJCA 4RJLA 2J0QA 1HURA 2L0XA 4LOAA 3ASYA 4F92B 2XZPA 4JLPA 3NIBA 4PXAA 721PA 1COWD 4LWZA 1YRBA 2WJVA 4QKQA 2PX3A 3K9NA 3GLFB 1TUIA 1E32A 1WF3A 5L8VA 1KGDA 1E2LA 4I1UA 3CM0A 2NZ8A 4TLDA 1YZTA 3VMFA 3GLGE 1A7JA 1E0KA 1ONBA 2ZRFA 1LF5A 3JZMA 2VHTA 3LBNA 1FNMA 2WJYA 2JA1A 5JMTA 1KO8A 3GEEA 2EFEB 1NF3A 1KYIA 1GKYA 2ZS9A 4JVSB 1CR4A 1GWNA 1KMHA 2W6IA 4IXNA 2OZEA 2FN4A 4Z8XA 3SNHA 3B85A 3LVRE 2WAXA 2ZQ5A 1MRSA 1QF9A 1AN0A 3C41J 2JLZA 3K9LA 5AJYA 4US0R 1NJFA 2KBFA 2FWRA 4E22A 4GL2A 1Z06A 2ZRLA 2CLDX 2OM2A 4NCHA 4O2LA 2N1BA 4DCNA 1KIMA 2W58A 4R7ZA 5CJ2A 5KU1A 1BOFA 1ZP6A 1NI3A 5E4FA 2MMGA 4PAMA 3LH5A 1I4TD 1LB1B 3GLHA 3FTQA 1F6BA 3LX5A 4C0HA 4Q02A 2CLCX 1SQ5A 1T3HA 3VR6A 3RRYA 2FE4A 2PL3A 4IOKA 1JB1A 3CX6A 4NCKA 4DLSA 2VF7A 3PUZA 1OE0A 2GXUA 3FYHA 2BHRA 3QXCA 2QG6A 2C04A 4PAQA 3ICQB 3QOFA 2V8OA 4RFSA 3C5HA 3T1TA 3MLEA 1NVVQ 4I1OA 5L3SA 4AKGA 1CIPA 1P5ZB 2OT3B 5K8IA 3VQTA 2A5DA 3A58B 2J9RA 4NYIR 4QJ4A 4RD4A 4G5OA 3DHWC 2XSZA 2ODWA 4A0HA 2YWEA 1ZVQA 4GZLA 4X8HA 4MKIA 3OE7A 4KYIB 4AYWA 2FGJA 2KI5A 4M1TA 1UBFA 1YZLA 3BXZA 1SVMA 2CJWA 2VHCA 3IIMA 2PZGA 2A78A 1CLUA 2C9CA 3P4YA 3T5GA 1KMQA 2C96A 4IDPA 2CVFA 1BIFA 3D7MA 4DC9A 1E6CA 4TYQA 4NYJQ 1Z6GA 1KNQA 2QL6A 1TQ4A 4EJSA 3KKOA 1L4UA 2VP9A 1Z3IX 3I32A 4LV6A 1E69A 1E2PA 5TARA 4MRPA 5DO9A 4U02A 1W4RA 5AK0A 1F2UB 4KO8A 3AF0A 4QBGB 4B44A 3C14C 3T35A 3VR4A 1D2MA 1JAHA 2D62A 1XJQA 4YQFA 2QSYA 5DN6A 1JALA 2OCAA 1ZM2A 3H84A 3P32A 2DPXA 3FMOB 5CM9C 2TMKA 3R7WA 3TQCA 4TMZA 2HUPA 1VTKA 3MWJA 2G0NA 4Y0AA 3PEYA 1UBEA 1S2MA 2GBLA 3AM1A 4D25A 3IQWA 2FDCA 2VA8A 4Q1CA 3UKDA 1TF2A 1NG1A 2Z83A 4CT4B 1X8LA 3BB4A 2FX3A 1OIWA 4DB4A 1N0VC 3CRVA 4FXPA 2VSOA 1D5CA 4JBWA 2BEJA 1VG8A 5J40A 3X1ZA 3NBFA 2R65A 4B3CA 1IONA 1EX6A 3GMTA 5FPKA 4BEBA 2A2ZA 4Q4AB 5KPDA 1W47A 5KPJA 2IUTA 4LI0A 1NN1A 3GLGB 3WP0A 2D2FA 4ZCLA 1P9RA 2ZSBA 3OEED 1N6IA 4FCTA 3U7FB 3DOEA 4EQ6A 2Z5FA 1DPFA 3EAQA 1W49A 4FMDB 4XVRA 3BGWA 4PC2A 1P75A 4BFWA 1IM2A 1KMHB 2C8VA 3K9GA 4G0NA 4LJ9A 3LBHA 3RC8A 1MR3F 4LHXA 4ZDWA 2R6AA 3BFXA 1PJRA 3M1IA 1UDXA 1KKLA 1YZQA 4JJZA 3ZGXA 4Z54A 1ZD1A 2A7QA 2RGBA 1E2NA 3P4XA 4L9SA 2BMJA 3CBQA 2YYZA 2Z4RA 2DHRA 4GBMA 4PC1A 2BMDA 5GJWC 1MV5A 2ZIAA 5JWOA 5FTNA 3CF2A 2XOKD 2OXCA 1GRRA 5CM8B 4CYMA 4YXWD 2NO7A 2Q3FA 3HP1A 2YZ2A 4C9BA 3TGPA 4TN1A 3T12A 1G7CA 2GETA 4ZDIA 1M74A 4WA7A 4XWKA 4ILEA 2R6CA 1L2TA 1Q21A 2WV9A 5HCIA 3L8YA 4JLAA 2AXNA 3V4FA 1LNZA 4LK2A 4DLUA 5K8UA 1KI6A 5J4LA 4WIAA 1OFTA 3AVOA 3LXXA 2FFBA 1FP7A 3UATA 1EESA 4QRHA 4EKDA 2RGNC 1NBME 2CK3A 3T1VA 1NG9A 3UG6A 1XD2A 5FTJA 3W6OA 1P72A 2CNWD 4RFSB 3AVVA 1VPLA 2J41A 4P4SA 1Q3HA 3GJ5A 1G41A 4Q7JB 4WZ6A 3AVTA 2KWIA 3KXKA 1S96A 1SKQA 2IK8A 2Q9BA 1XJCA 5TMPA 2FA9A 2C5LA 1OH8A 1E99A 3CF0A 1S9HA 2FPMA 3ZQJA 1HQCA 3TW4A 3ZZUA 5EUMA 3T34A 3C15C 4M1OA 2CHVA 4GI7A 2FJUA 4KFTA 1KJYA 2O8EA 3VR2A 1NLYA 1JI0A 4DKXA 1SZPA 4JL8A 2CE7A 4LX0A 2QAJA 3EASA 2HJVA 3OEHD 4K46A 1UJ2A 1YR6A 3CRMA 1AIPA 2RHMA 1WA5A 4TLBA 2DFLA 1CR2A 1B0UA 5DIFA 2IEYA 2A3RA 2CCJA 3IDQA 1YZUA 1E2GA 2H92A 4D2IA 4BEJA 4OJQA 3RYTC 1B23P 4DIEA 3A1WA 4A92A 3TUZC 2BBTA 2XNDD 1XWIA 4KSCA 4XVQA 3B1XA 3O8RA 1G5PA 1GNPA 1S1CA 1J8MF 1OXSC 5GJCA 1EWQA 1IAQA 1H8HD 2DFNA 1BMFD 2QMUA 1G8PA 3K70B 3AKDA 4QBIA 1WMSA 1US8A 3RS7A 2O8CB 4R71A 1XTKA 3LW8A 5FTKA 2P5SA 2RGDA 4XTCS 2JJ1D 4PO9A 1G17A 4A1FA 1ZU4A 3CW2A 2G6BA 2BCJQ 2ZU0C 4M1KA 5AJXA 3T1OA 2WWXA 3CLVA 4Q9LA 1QHGA 1P2VA 1DO0A 1XJ0A 3AGQA 2KE5A 1LV7A 3CRRA 1SVKA 2UKDA 3MUFA 2F7SA 2ZI9A 1VCIA 4DBLC 5CJPA 1X6VA 1G16A 4XVUA 4QM6A 3ZIAA 4M0LA 2NO9A 3E70C 3FMIA 2PBRA 2REXB 4HB2A 3UMSA 2Q6TA 3DVLA 3REFA 1G3QA 2OG2A 1P60A 1NN3A 2CL0X 3U7EB 3C5CA 3AVQA 2F1JA 2P6RA 4GDFA 4AG5A 1KDOA 3SU8A 2GWHA 1NVVR 3CX8A 1OB2A 3GQBA 4TZ0A 1J2JA 4FCVA 4IXMA 2O52A 3NH6A 1XPRA 2BM0A 2FZ4A 1UAAA 1E9AA 5CYOA 5LD2B 1ZNZA 2HCBA 2JLVA 1QHYA 2J0VA 3BFKA 2WIBA 3IILA 2J1LA 1W1WA 3QKRA 1RRCA 3A4LA 4FMBB 4PR0A 1R0YA 3BORA 1TL7C 3HDTA 4DUGA 3OF5A 2XZLA 2WM9B 2OFWA 2DWOA 3K70C 1UBCA 3R9IA 3VX3A 3ICEA 3D31A 3VU9B 1RVDA 3HU1A 3KZ1E 3AF1A 3TK1A 2GBLC 4NYJR 4LJ7A 3RANA 4G5QA 2FG5A 3CF6R 3E2IA 4Q21A 3CNOA 3VTKA 4JLKA 2MSCB 4B3XA 4UJ3A 4OHWA 4DLRA 1T0JB 2DFKB 2X2FA 3DZDA 521PA 1E96A 4FMCF 3B82A 3SHWA 4M8NE 3TE6A 4FWTA 1QG2A 3ZQ6A 1W4CA 2PLFA 2HEIA 3RRZA 1E1QD 2LKCA 1GKIA 4Q4JB 4CEJB 3ZVRA 3DMDA 3KQKA 1HTWA 4UJ5A 2UZ3A 4JLNA 1QHSA 2G77B 2WWGA 4HAWA 2YVUA 1HA3A 3DEFA 2XJ4A 1VCNA 3FMPB 5KTYA 3ONWA 3F8TA 2IS6A 4MKFA 3I8SA 3LQQA 2GRJA 4B2PA 3TAUA 2VIIA 4QGGA 3T1QA 3QSYA 2I4IA 2EYQA 3AF4A 5EE0A 1CU1A 2R62A 4IRUB 3VNVA 3TUIC 3NBYC 2IYSA 4C30A 2HXSA 4OQNA 5EQTA 1RZ3A 3AVXA 4GOXA 4D82A 2AD5A 3IPYA 4LUCA 4ZIRB 1ZUIA 1Z0IA 1GNQA 2F1HA 2WWWA 3SBEA 5LD2C 5FTMA 1GRNA 4V0MA 4V0ME 4O0MA 2Q9AA 2NTYC 4GRAA 3I73A 4JLOA 4PSVA 1PLLA 1DG3A 2ZPTX 3IIKA 3TR5A 5AUPB 3BFVA 4C0JA 1XMVA 4JZKA 2PEYA 3PCRB 1AA9A 3CIOA 5ELXA 1WP9A 1ZC4A 5DI9A 1E94E 1W48A 2JGNA 1JAIA 3Q8XB 4MRVA 1FNNA 4BFUA 1XP8A 2OLKA 2N42A 3T06B 2F9LA 5JWHA 4O3MA 1TPZA 2LKDA 2Z4SA 5KOYA 2JLRA 4UXHA 2F3TA 4X8MA 1E2IA 1IY1A 1MOZA 2ODEA 4JLMA 1E9EA 1KI1A 2IUUA 4DXAA 3RHFA 1E9SA 4IDNA 4QM7A 4S35A 1LF0A 1SVWA 3P20A 5GVSA 2J7KA 2DYKA 1JR3A 1US8B 4Q9HA 1DBSA 2IC5A 2ZJZA 3B6EA 5AUNB 3EG5A 3LD9A 4CEHA 4W7SA 1IXSB 3KX2A 2GVDC 2K5UA 1N6PA 4LCBA 3HR8A 5JI3E 2VH5R 4TYNA 2YHSA 5CK5A 2BVNA 5FI0B 2RGEA 2Q3MA 3L0OA 2C03A 3SOPA 1KO7A 2YOHA 4B6FA 1VECA 3RNLA 4DLVA 1RPZA 3TW8B 1E79D 4MRRA 3OFNA 1L7VC 5CB8A 1NP6A 1NSTA 1CP2A 2ZJ8A 4OI2A 4OKSA 4TQ9A 5FBWB 3I5XA 4B74A 2ZRCA 2WOOA 3NG1A 4Q5IA 1XMIA 3M4YA 3X1WA 1U94A 1XDBA 4HLQB 2DB3A 4DSOA 3PFIA 4RZXA 5EP3A 2OXRA 2JLSA 1AKYA 2ODBA 1QBKC 1HT1E 2AK3A 4Q4LA 4MYCA 4B75A 3FFBA 1ZCBA 1KI9A 2BKUA 3AKCA 3FKSD 3AB3A 1PUIA 1TAGA 1E2DA 2F1RA 3ETLA 3WY9A 2QE7D 1CJMA 3D3QA 4Q03A 1CBUA 4TT3D 4Q1DA 3WBJA 1T8UA 2ERYA 4M53A 4TMKA 4DDUA 1SGWA 1KZGB 2XJ9A 3QKRB 2SHKA 4BQSA 2DWQA 2QTHA 1M6NA 3RS2A 4OQXA 2PX0A 4L16A 1PUJA 5FUYA 1OIXA 1ZNXA 1IJFA 1ZM3A 5GADl 3R9WA 3X1DA 3H4MA 4US2R 3I61A 1YQTA 5FUVA 4OI1A 1NVXQ 3AP3A 4B73A 1ZUHA 3RS0A 2B7CA 3K0AA 4GSYA 1RJ9B 5DE3A 4YC7A 1E1RD 2Q3HA 3NBZC 4B6EA 2HLDA 1GFIA 1R6BX 1EFRA 1SXJA 4ESVA 1SXJE 4ZO4A 1R5NA 2ZRDA 2FOLA 4M21A 5JLJA 3CH4B 3X2SA 2E87A 3DPUA 1RIFA 1PLKA 3CPJB 5FL3A 1ZMXA 4KAXA 3RAPR 1IJEA 3WHLA 1T8TA 5HKKD 1N5KA 2BBOA 1X8KA 2ZI4A 1MRNA 3GEHA 3NC1C 3UK6A 1G7RA 1TQ6A 2Z43A 3REGA 1WDTA 1YR8A 3LLUA 4YONB 2IYQA 3GLIE 3EWAA 1AGPA 2WJIA 3VFDA 2C99A 4JVLA 5JCPA 2CHGA 2PT7A 2QEQA 2D3WA 3LFUA 4ACBA 1W5SA 2AKAB 2NGRA 5G3ZA 3KQLA 1M8PA 5F9HA 1WBBA 2V7QA 3BH6A 1T5LA 2G1KA 3FPAA 4L5BA 4AKHA 4B32A 1J8YF 1I2MA 2W00A 1GAJA 4FW9A 4LV5B 5TVKA 1KK2A 2OO7A 4XWAA 2GILA 5HZHA 4M1SA 2ORVA 1VIAA 1Z63A 2IXEA 2ZRKA 1QG4A 2GF9A 3CX7A 3A1VA 3HPRA 3RWOA 2NMVA 2XXAA 1CRQA 4Q9KA 1NN0A 4H9GA 4B48A 2IYYA 3EZ7A 3EPKA 4LBWA 4XD7D 2D74A 3U4QA 1E2FA 2AL7A 3A37A 1UM8A 3MGCA 3QY0A 4IW3B 4HDQB 4E5UA 2FV8A 2J87A 2RHDA 1VHLA
chains in the Genus database with same CATH superfamily
2G4LA 3TOZA 5CCXA 5G1OA 1K6XA 5KWJA 5BQFA 1JHAA 1BYIA 5FWYA 1T1GA 2HGZA 1ACMA 4ETNA 3UWPA 3ABQB 5J2TF 3KR2A 5EFZA 3T94A 1TQ2A 2R1ZA 5JXIA 4QU8A 1X7XA 2P8JA 5JMWA 3GNTA 1D9ZA 1QIKA 3ZX5A 2P11A 4ZXFA 4CEHB 1NKVA 4PX5A 1QHIA 1K0UA 3NPAA 2C4NA 3RUAA 3MTIA 2CXXA 2VHZA 3HB0A 3IMCA 2X1MA 3NHBA 4H08A 4UEJA 2PUCA 1C9NA 1BJKA 1X38A 4R1OA 5CBKA 2HJRA 2ODPA 3G2IA 5EKSA 3SHFA 1XZ8A 5CXUA 1E7QA 2VQFB 3QPDA 4NRDA 5FOUA 3DZGA 3KTAA 1KQNA 3A25A 4EY4A 2ASVA 3EXHB 1RABA 4H18A 4QELA 5GV8A 3R9XA 1SXGA 1Y1LA 5ILGA 1S1MA 5ITSA 4AXBA 1GTL1 4RE5A 3RRFA 5T4HA 5C7OO 3UOGA 4GT1A 3P5BA 4R8SA 1K8ZB 3KQHA 1YBAA 2G4VA 2YW9A 1NKSA 3RVSA 2I7CA 2JKVA 1IULA 3OLXA 5ANRB 3JQPA 3S7ZA 3LUGA 4AKIA 5EJAA 4LY9A 4L9RA 2VBCA 5C8DA 1G8YA 3QBDA 2YH2A 5F3WB 3A1UA 2ZB7A 3CZCA 4URZR 4ZT3A 1F4VA 1F9AA 2EKLA 3ZQKA 5HP4A 2LIVA 3H0EA 4OATA 1ZM4A 3UAWA 5E6RA 2ZYUX 1GT6A 5AVTA 3SICE 4TLMB 4NMMA 4MDYA 1ZY2A 1HYEA 5IHPA 1SUIA 1SWWA 1ORDA 4Q4AA 3IEUA 3PG5A 2CJFA 1NVEA 4IQ0A 4CNBA 4DDWA 1XPUA 1M8KA 1TKAA 1QK5A 2NYRA 3GUZA 4HEJA 5E3IA 1MJNA 2HDHA 2LW7A 3ZR4B 4YRIA 1HZZC 3PC8C 1ORTA 2EJTA 3EWSA 1RPJA 1P2TA 3EVBA 5HE8A 2QZSA 3KT8A 5JZBA 1Z0JA 4TSFA 4LSZA 3KE8A 2V1UA 4M2LA 1IAVA 1PIWA 4DLPA 4RVHA 3A1FA 2ORIA 3RARA 4LJLA 3U3MA 5FQNA 4LGYA 2XRYA 1NAHA 2ZJOA 4OQMA 2WHPA 3GK3A 4YDSA 3IKTA 2CLSA 2ZE7A 4CTOA 3LWDA 4OFZA 4V03A 4EEZA 2ZB4A 3GI1A 4QQ8A 3CR3C 1P4SA 2ZJFA 2VL7A 2HYIC 5I7OA 1FMTA 1N2BA 1Y98A 1DHRA 4G2NA 3D3EA 2F4NA 5DB4A 1G5TA 5FBZA 2O0KA 3MM4A 1SXJB 5H0IA 3LE8A 3ZD9A 3H5WA 2XQFA 2MSDB 3ZJ4A 1IY8A 5H4GA 2C2YA 4JDPA 3EXHC 4JQSA 4KXMA 4OB8A 1ESNA 2WF8A 5REQA 1A2OA 3U0VA 3IT3A 1Y6ZA 4GL4A 4JR1A 3ETNA 4WT7A 4DWOA 1N2EA 3MT9A 4LE0A 1V11A 1IRIA 3NGMA 3R7FA 1QQAA 1M8FA 2NP7A 4JJGA 4R2KA 4YRPA 4E2WA 4JYMA 5KJCA 1ADJA 5JV5A 4UNQA 1QOQB 4JI5B 2C9DA 3DAFA 5AJHA 4TM8A 3B48A 3AI1A 1SVLA 3NVAA 4MJLA 5CM2Z 2NZXA 5K6RA 3KDSE 3DC2A 2DHDA 3A1NA 3E9DA 3KQMA 1H2HA 4KYIB 4MQ4A 4NEHB 4ZVUA 4IICA 2OXFA 3H42B 5AR1A 4JI1B 3R9KA 2PZMA 3HYRA 2AG0A 1AQLA 4JL5A 3H4TA 3PP8A 1EQ2A 4K26A 4XTRA 2P27A 1F38A 3WZ2A 3LWZA 1Y3CE 4NAVA 3T7AA 1ZMBA 3KIPA 2IVZA 5D3QA 2PHZA 5CW2A 3K7EA 4DM4A 4QOIA 3HBAA 3KE9A 3OECA 3R5TA 1KRHA 1Z47A 4B4VA 1K7EB 2J3KA 3LECA 4RELA 2XMDA 3STHA 1U5BA 2HEGA 4NFHA 2YWCA 4MUIA 2H7XA 4XLTA 3DVRX 3P9QA 4PLTA 1BA2A 4JELA 5CB6A 5K0ZA 5EKXA 3KQQA 2ERXA 3HL4A 2DJ5A 2RJOA 3SFZA 4N5HX 3M81A 2XXAB 1KYQA 1QDEA 3JR3A 1IWBB 4LW8A 4ZO8A 4EM6A 4NI5A 4URVR 1O95D 1OPXA 2EQ5A 1JXAA 4LF9B 4ZCRA 4BN4A 4MW5A 1KJWA 1XDSA 1S01A 1KEWA 3PNSA 1XHLA 1SZCA 2P77A 1PJZA 2IOYA 3KQWA 3OFSA 3Q3IA 2X9NA 4J3JA 3ENZA 2GBIA 1SXJC 3FHLA 4BNXA 1RM5A 2GEUA 2HFJA 4LAFA 1KYXA 4A6EA 1YQUA 2O3SA 2B2XA 4OB7A 5EEHA 2QKYA 1RXCA 3U3KA 3IMFA 1MTOA 1SUSA 1N7JA 1Q92A 3PC2A 1GZSA 2IP4A 2XB6A 1XYYA 2EJVA 2IF0A 2M1ZA 5JRZA 3VSDA 4YDQA 2H85A 2J8ZA 4I6GA 4Q39A 1P3Y1 2WK1A 1S6YA 3IC5A 1NFRA 3ZC3A 4BO2A 4C21A 3PXBA 2IYNA 1XA0A 3BWMA 2B1GA 3FB1A 4YMVA 1R4MA 2C77A 4KDCA 4COKA 4Y1FA 4N5IX 3NZEA 1Z2PX 3IGFA 4IDDA 4II7A 2Q5FA 3CO0S 1JJFA 5AHRA 3UICA 3AFGA 3OE4A 3CG4A 3LK6A 3K05A 4MYUA 5T57A 1R10A 1VG0B 1LDMA 1W96A 2I29A 1UAYA 2X9GA 2O8CA 1N3YA 4J2HA 4U7FA 1CDZA 2IYXA 1LDGA 4ID9A 2JH8A 1QH9A 2JEZA 5JEDA 5IUJC 1G3RA 5KOIA 2DBZA 4QNMA 2VNJA 4JYCA 1BKYA 3ZU4A 5AIBA 3NV7A 2PL9A 4TMVA 2WJGA 4KK3A 4EG3A 5BURA 4IIFA 4OK5A 4BU1A 4EK9A 1L4NA 3HU5A 3K1YA 3DZJA 1EK2A 1XE3A 4NMLA 5EHQA 4NPHA 4IJWA 4W8HA 5K8JB 2AN3A 5DGCA 5IXYA 1ID8A 4MUFA 1KO5A 1OXKB 1RKUA 5TDHA 4OP2A 2A6PA 3CNNA 4CE6A 5JAQA 3NW9A 2VJLA 2ZXEA 4KWHA 2JLUA 2F2TA 1JAZA 1U11A 1ND6A 4RENA 3TB6A 3SBDA 4PN7A 4MA0A 1N6OA 5D51S 5EE3A 2M6KA 3LCCA 1I1NA 1SQSA 3DMPA 4HWPA 4M1WA 1PK9A 1U4NA 3K09C 1FNBA 3EF3A 4R1TA 1K27A 2XMBA 3EXEB 1M54A 1YNOA 1RAEA 2FJ0A 2HRBA 3PL5A 5C3MA 2UZIR 3THWB 4YP6A 2AHOA 1CXZA 3M6MD 1EVEA 4P53A 10MHA 2OV8A 2VLBA 4J0IA 2RK4A 1K5PA 1V5IA 2EL7A 1GUFA 1P4AA 3A3NA 4HFJA 1CETA 1VFNA 2O5VA 3NT5A 2DGDA 3O3MB 2R6FA 5HDQA 1M2FA 1XB2A 4AYXA 1U0FA 3RRNA 2GSWA 2I6QA 2VTDA 2UUBB 4XUGB 2XT0A 2AZTA 5EXTA 4YK7A 4BHTA 1BGXT 3M0EA 3F71A 1V8OA 1L7EA 1URPA 2W8BB 2IYRA 4LMRA 4MVYA 2F8MA 5B4TA 5ESWA 1NI4B 1R8JA 2R0QC 4JGGA 2Y6UA 4G9BA 1TD1A 2YINC 2XYRA 3LP8A 4M0UA 1OXTA 3HACA 4PHHA 2AFHB 2IPNA 4FUTA 4TTQA 1MT3A 1ZIDA 3EFBA 4KIUA 2FZEA 1P2UA 4REQB 3UA4A 2PXXA 3VOTA 1MZPA 1D0IA 4UBJA 3UMCA 4B6OA 1QCYA 2NV2B 5DNAA 3SEAA 4DG5A 1NNUA 5BVHA 3RJTA 1HC7A 3ZLVA 3F0TA 4P5PA 1RWBA 5DM1A 4NH4A 3RV4A 3O7WA 1WDLA 3VAZA 1ZHOA 1G291 2OGSA 2D1YA 1VE6A 4GD3Q 4UARA 3RWMB 5CFMA 1E66A 3CVYA 1NLUA 3W5BA 2R7MA 4KXWA 2JJ2D 1T9BA 1Z13A 5AJZA 1H6CA 1VPDA 4RXMA 1J2TA 2FF7A 2JZCA 2JKYA 2FRDA 2P90A 5E4TA 1OFUX 3UAOA 4W6ZA 4UE3S 3ZW9A 5CDTA 1W93A 3EMDA 4I55B 5BYAA 1UXHA 3F96A 3TH5A 5L51A 1I5RA 1VKOA 1A8IA 3TAHA 2Y0BA 4B3SB 4V0LA 4YH1A 1H2FA 2CMDA 3FVTA 3AFHA 3UHFA 3E9RA 5K5EA 3ADKA 4KREA 1HLPA 3L41A 5EP1A 3OM1A 4QDUA 4KO2S 3DDZX 2Q9CA 4EI2A 3BB3A 1IHPA 1GU7A 1JIXA 2H5EA 3GO4A 4HNGA 3SYKA 5IMSA 1RHRA 2QT1A 4AJ9A 2ZIWB 4CFYA 2HCJB 2OD9A 4LGMA 4KE6A 2RKBA 3HO6A 5ALDA 1U0NA 4TLAA 3EVNA 1KI2A 3HXLA 5B6JA 1ZN2A 3PYXA 4DQXA 2ZUFA 2GK4A 2Y99A 4YAKA 4RMGA 2NV0A 4F7DA 3NORA 1E6MA 5DHAA 4RA9A 2QSZA 1P4HA 4TKZA 1XNQB 2NU7B 4FFNA 4D81A 4J49A 5JCJD 1W34A 2NTEA 3IAM6 3CUEF 3KKEA 1FDTA 1XRJA 4MUBA 5BVGB 2AWNA 4JWKA 5BYKA 2C61A 4NSNA 4WCDA 2VJMA 3QFTA 2VJAA 4B7ZA 1K75A 2HU7A 2KX7A 2LWIA 1CHNA 3VHXA 3ZLJA 1XO1A 4EMUA 1NVMB 3O2NA 3F97A 1L5RA 2P3SA 4PQEA 1II0A 4TL7A 5KOHA 1WEHA 4IHQA 4E08A 4WI1A 3AILA 3KKPA 2NIPA 1JLLA 1Y4ZA 4OHYA 5LLDA 1F48A 1Y1TA 4HAXA 2WNIA 3BCUA 2ONCA 4HBZA 4RQBA 1NUUA 2J09A 2ZAIA 3S1LA 4GG1A 4YRAA 4KR9A 2CKDA 2HK9A 5JJIA 2DBYA 2G36A 3FDIA 1X14A 2VSNA 2ZTUA 2KW5A 4EDHA 3DTTA 4X3OA 1R0WA 2ZTMA 1H05A 1GCIA 1AKUA 4BNDB 5EN4A 1RLJA 2JHFA 4LF6B 4MRNA 3LG2A 4ENVA 1SXPA 3Q5DA 1PWHA 3WE7A 4RW0A 5EZ5A 3FHTA 4QA9A 4QQKA 5A04A 2IGTA 4Q05A 2ETXA 1T3SA 1JR2A 1IXRC 1O94A 2A4MA 3NP9A 2ECFA 1EAMA 1ETUA 2LDXA 5J4KA 5HOEA 4B8WA 4HUQB 4P7FA 1E3MA 4XWTA 4LGCA 4NARA 1H9AA 2PEZA 2QVBA 4OAPA 2L18A 5KJEA 3C1TA 1JQ3A 2B1RA 1BROA 3PHIA 4PPFA 1G5RA 1OQAA 5KDLA 5T4BA 4BLQA 4OBXA 2ACEA 3G6WA 2I1QA 3VPSA 1FFCA 4IFIA 1FLAA 6REQA 1IM5A 5AM2A 4CM9A 4H7EA 1XFAA 4K3VA 4UHFA 5GPBA 1Y5NA 3TR0A 4YV2A 2HQRA 4TQAA 2GN6A 3EIUA 3NDJA 5IDYA 1TIPA 3LL4A 2GARA 1GN9A 1X1BA 3IR7A 4IXDA 3TM4A 1RMQA 3ROTA 2GZDA 3GUCA 1R12A 4I4IA 3C3YA 3ETDA 2FCRA 5I8PA 3ESRA 4JU8A 4BO3A 1T9HA 4N3BA 3TKYA 1FZTA 5AVVA 1XXHB 4LC1A 1QQ5A 2RHCA 4OL9A 4P80A 4R2LA 5TT1A 1SUDA 1CJTC 1EDOA 4LOIA 1DQZA 4BO8A 1JLHA 2FSIA 3ZZ1A 1BE1A 1YR7A 3SZ3A 4EY5A 5GINE 5KNCH 1BDBA 2RHRA 1LWNA 5GGYA 5JC8A 3Q3JB 4FSHA 5H9VA 2GYVA 2E4VA 2GTIA 2CB9A 3EVZA 3GEDA 3KB6A 5J5VA 2OFXA 1VI2A 2EJBA 3MCVA 1SHLA 1C9JA 2AW3A 5JAUA 2ICAA 4YMGA 2V7BA 4F71A 5ALSA 2R25B 3WL3A 1GRQA 1VSUA 1PG0A 1X2EA 1PJ4A 2K6GA 3LUJA 3JQAA 3M70A 1KK1A 1WS6A 4F1KA 1RJ9A 1RLTA 3B1ZA 1OH7A 4BAGA 2IS2A 3L6DA 1J1UA 2OHFA 3KUXA 1NXXA 2I71A 3C6ZA 2BFMA 4O4HF 3RJ9A 4H0CA 3ENVA 5CNKA 3W2FA 4CGZA 2CL7X 2A5GA 2XCSB 3ADPA 1VZ3A 2I1VB 3AEUA 3CUWA 4JB8A 1RXIA 3IPLA 3JAKB 4R31A 4KBFA 4RQUA 2I6TA 5ALWA 4Y2GA 5CTAA 5F3RA 3G2HA 4D99A 2XSZD 3RSGA 3ZN2A 2HNAA 3U3OA 4BMDA 1YDWA 3SWWA 3SQLA 2FXVA 3OE7D 3DJFA 1XTUA 1AS0A 1H2RS 2FKNA 2NPIA 3AR6A 3DFMA 1G2OA 4Y9DA 5DASA 3R75A 2QXUA 1FQJA 4JOQA 1RP7A 2PYDA 4C07A 3JYHA 3ZJ5A 3D8TA 2VPZA 3UG7A 5A7FA 1U4OA 2H1HA 1QF7A 3EK2A 4IUYA 1W94A 3VSAA 4RQAA 3PV0A 4CKBA 4QJ3A 3BWYA 1Q2UA 4UUOA 5CA1B 1Q12A 3MT0A 5JW6A 2PXHA 1YQDA 3A3YA 5JJKA 4JFAA 2XX3A 4ZQFA 1D7AA 4OB6A 3USZA 1ZLXA 4H16A 5DGDA 3L1HA 5IN5A 4EUEA 1P73A 1GGNA 3U9TA 4J3FA 3A26A 1NLFA 2GK7A 2BLNA 3G2QA 3ED5A 4QICA 1X74A 4EL5A 4MVJG 4YACA 2QX7A 4H6WA 1II8A 4L2IA 5CEEA 3SZGA 2C83A 3VX4A 2CUNA 3R7AA 2WV7A 1SOWA 1U0LA 2E49A 4MQLA 2JCSA 4P4TA 2WWHA 3JQGB 2P9QA 4IFEA 4JJEA 5DN6D 1R6VA 4ZVOA 3E9NA 5ALVA 1OT3A 3QIAA 1GUZA 1GLGA 2ZUWA 3AEZA 3MUNA 3R8FA 5CU7A 2EHDA 2X14A 5BNFA 1NBWB 1N1GA 4EI8A 2V8BA 2JNWA 2YHIA 3W8EA 2XVAA 5JNRA 3ROPA 4KR7A 3FDZA 4TVBA 2Q1YA 2NUPB 3TDNA 4LXIA 1YQQA 1R74A 4L5IA 4MAFA 1EHYA 3CLUD 3HEBA 4LNAA 3PFWO 5EZYA 2HPAA 1L1RA 4K6CA 5DBHX 5AM0A 3ROGA 4DA6A 1QLWA 1CY8A 2ZSDA 4Q3AA 5HEKA 2PBZA 2VWHA 3KOMA 3MLAA 3I9NA 3PXCX 3WLNA 1USKA 1YXMA 1N57A 1N33B 3V3KA 2YJ5A 4XUCA 2GYYA 5LBTA 3GMSA 1GEEA 2I91A 1IDOA 3UIEA 4HYTA 2A57A 4ABYA 4IILA 3E61A 5IF9A 3T5TA 3ZXYA 1SO8A 5CLHA 3QA3E 1CYDA 1MABA 4CM8B 1VLQA 2HBQA 2VS1A 1TCBA 3CPEA 3HY6A 4ARZB 2QJOA 3U5ZB 5GGXA 5YASA 3I42A 2ONYA 1E2EA 3IVGA 3OD1A 4FD3A 2AG8A 2JFZA 2F43B 3K3PA 4AUMA 1P5HA 3SYNA 2YWHA 4BXOA 1OOEA 2IS4A 2H0AA 4WKOA 3FSRA 2ZBUA 1THGA 3LQYA 4MJ3A 2ZIFA 5GV7A 2AHRA 3CLRD 2H2WA 5C31A 2QOEA 1W7AA 2A35A 1WVGA 3DV2A 4EFNA 4EGCB 4K9DA 3KVVA 4RTJA 2GA8A 3FD8A 4LE1A 4WA8A 3UMYA 2Q5LA 3FLBA 4ZU3A 4F96A 4MNTA 3FCYA 3U44B 2I3DA 3VR0A 4MCAA 2P9CA 1L7NA 3MPUA 4WN9B 4URWR 4V0OA 4J07A 1GYPA 3SJBA 1J39A 2N46A 3GRZA 2NOAA 4LZNA 4RD3A 5FOWA 1PZXA 2D7DA 1NULA 4I8DA 1T15A 1Z0ZA 2H4HA 4MK4A 1YQEA 4EGSA 2Q4DA 2N0SA 621PA 1GM5A 2C7PA 5FWNA 1IN1A 2UZ0A 3L0ZA 3CG0A 1WQ4A 1AQUA 3CUSA 3WWDA 3SG0A 2GLTA 4RDIA 4MIKA 2BGWA 5AHOA 1Y42X 4G56A 2FWNA 821PA 3K4QA 2ZAMA 3HWSA 4S0ZA 3VJKA 4I9HA 4X8LA 2CK3D 1RBQA 1FJHA 1R9GA 3BWDD 4HWTA 5H68A 5EVCA 2J3HA 4H7IA 4RESA 3GGOA 1P7VA 4TMTA 4I8IA 4MGIR 2XNSA 1RHKA 4D3DA 3NHZA 3GUHA 4ALJA 4ENQA 3HJGA 1NRIA 4BKRA 3E05A 4LRSB 2HXGA 4ZREA 3NQ41 2ZAYA 4OXKA 2EX1A 2OZLB 2Z8YA 1EFKA 3PLAE 2RDMA 4AKEA 1QIEA 4RWZA 4IG9A 5AI6A 4EIWA 4F3TA 4AJNA 2ZR0A 3E03A 1ODLA 3CJTA 3GLIA 1EE2A 3DBHA 2FHPA 5H9WA 1J5PA 3WIBA 3R4VA 1WPQA 1KMCA 2HREA 1QS0B 1HKHA 1KHTA 3DZHA 4Y0VA 4K9PA 3FPCA 3OJWA 4NL4H 4U5QA 2BKVA 4DYHA 2R8EA 3EFOA 4LYHA 4RLHA 5K4GA 1O6FA 1TZCA 4KL8S 1TB4A 1W30A 3PQ7A 4EPVA 1KZ1A 4IMRA 4JA2A 5CIWA 3ZQ4A 3MCUA 1DAFA 1TA0A 3C1OA 4EY8A 3H4IA 3IO5A 1LSOA 4HH1A 2WNSA 1WB9A 2IDMA 4H4CA 3C7TA 3DKVA 2JAPA 3OC0A 3STVA 2PMKA 2GPSA 1ZK1A 2M6RA 3FFTA 3OJEA 1XHEA 5ICGA 4KTVE 1CEEA 3AWIA 3INRA 4S05A 4OK6A 4FCWA 2C95A 2OHGA 2J9FB 4MVJH 1V9CA 3TVTA 4C78A 1D1QA 1QTNA 2ZK7A 3QMMA 4FMPA 4IX1A 4CMHA 2PH3A 3ORSA 5FUXA 2ZB8A 1N2ZA 2Q4OA 5KOJA 1OJLA 3SQDA 2QRJA 4LDPA 4CEIA 3BDVA 3PUXA 4X63A 2FW1A 1IOVA 3FDJA 1UT8A 1AZWA 1ZNYA 3CGWA 3KRTA 4LKOA 3EW9A 3Q40A 5IZCC 3HE3A 5D3ZA 4YPOA 1ABEA 1YD7A 2WP0A 3QFHA 3MAGA 2IKSA 1AURA 7REQA 5I7FA 2IKQA 4XX0A 1TUEA 1VBFA 4KIGA 4UCXA 1S0UA 3INTA 5C34B 4LDZA 1GU1A 1WF6A 1P80A 1X15A 1VKNA 1G38A 3W3ZB 5K0GA 1O03A 2XZDA 4RKRA 3RCBA 3HYNA 1EGHA 4ND2A 3N9IA 3EDOA 1Q83A 3EGDB 4XJSA 4DTIA 2C2BA 3DTYA 3ESDA 3PXGA 1Z7YA 4URXR 3HVRA 2W2LD 2CFTA 4G1UC 1MDBA 1A69A 1VI6A 2OMKA 3WC4A 4EW2A 1C29B 2L82A 3F90A 2G5TA 4HRVA 3TNYA 2LV8A 2NXNA 3N8KA 4TXJA 4BBPA 2ATEA 2HA4A 2UXDB 3KYIB 4ZMBA 4FNGA 7YASA 3SQNA 2IU0A 4HZIA 1TW2A 4AZ0A 3ACBA 4F6RA 1TF5A 5JHHB 4KHPB 4TPKA 2O2IA 1FFBA 1BXGA 4MGYR 4W5WA 4AY2A 2O3UA 4F4DA 4JBHA 1HLGA 1XEWX 2BGLA 1ULTA 3IMGA 3N7AA 1DINA 2AX4A 4OP1A 3W8FA 2ATVA 4OU4A 4CMEA 3T9FA 5CB4B 2AJDA 4ZYUA 4KHZA 4QU9A 4MZXA 2BCGY 1EX9A 2VJBA 4IJUA 5JRDS 4P0QB 5CITA 4XGKA 3O92A 1JH8A 1PDVA 4C6TB 1KSJA 2COUA 2YS6A 1WY7A 1BFDA 1IUKA 3AB7A 4LY3A 3TPCA 1A9QA 3PDCA 2FU5C 3UMVA 4B9AA 1TUGA 3B20A 1OGYA 4DUGD 2YY7A 2H4ZA 2P9ZA 2VAMA 3K0FB 4OBBA 1Z5NA 5EINA 4ZT6A 2NNWB 1XCLA 3G85A 1I6WA 2D8AA 2O1WA 2GJSA 2IV3A 1NVFA 3OZGA 4NCJA 4MW4A 2W11A 4GO1A 1MF7A 3O1JC 5CLIA 4ZD6A 3D8UA 4LTNA 4Z3DA 3ZKAA 4ZTUB 2B4QA 3HKBA 3PA6A 3AR8A 4I19A 2PCLA 3G9UA 3FZYA 3R6GA 4Q16A 4XPIB 3T0IA 3JYOA 3O5AA 1A88A 2DBQA 2ACVA 1LW7A 3VH1A 4DWWA 4AMUA 2OC9A 1W4BA 4MHOA 1RXSA 4DLYA 4K6MA 2XUIA 1QO0A 4IR7A 2B82A 2VT2A 4HZUB 3ILXA 5I47A 1JJBA 3A4IA 1UZAA 5J2UB 4NV3A 4ZRDA 3V8RA 5AD1A 1NBOA 3DHEA 4OY3A 3UJHA 3MMPA 4WZBA 1PS0A 3QX7A 4WZBE 1QORA 2TMGA 1ULSA 1X80A 3AQ4A 2AF4C 2JAQA 3JYLA 2K4MA 1FW6A 1RAFA 1Q1BA 1Y1KE 1TJYA 3IR6A 3HYLA 4I3FA 4ZYTA 2VYFA 2BDEA 2ZR9A 1NVGA 3B1FA 3WB9A 1B3BA 3AG5A 3E9ZA 5JS6A 1NL3A 3I92A 5EIXA 1DVRA 2GCOA 2EKPA 2AQ8A 3L6CA 3O75A 4TYWA 1J99A 1LUAA 1YAJA 3H18A 4F9GA 5JBNA 1ZKMA 5CFQA 3IHLA 2PD3A 2VC2B 1KJ8A 1BH6A 2B30A 1IY2A 2IT1A 2O2HA 2WE7A 4HQNA 4R81A 5AKIA 1NRJB 1Q74A 2QDKA 4XDZA 5IDVA 3BIXA 5IUNC 5JI2E 3ASZA 4LMPA 1U81A 1VSBA 5IF3A 2R8ZA 3VPXA 1ZNWA 3UW1A 4OLAA 4J75A 1N2SA 1SIUA 2ALJA 4DG8A 3RBZA 2GPTA 2XF2A 4ZJPA 2UYOA 3NUQA 3EZYA 3FNHA 3GLHE 2Z6UA 1C1DA 3NOVA 3LU1A 3H1PA 3OJLA 4FDTA 3UTCA 3ESAA 1WSAA 1DIBA 4FFLA 4INPA 4ZT2A 3D8SA 3CEMA 6LDHA 1KY2A 4RTNA 2FX2A 2MR6A 2PRSA 5CMLA 3MSXA 4UOQA 1MKYA 1NVBA 5I4KA 3DFIA 3AX6A 4B2IA 4G5RA 1PTJA 5LXTA 2FR0A 3B8EA 2UV8A 4RXUA 2PSJA 1EFUA 2XTZA 1AKQA 2WZBA 3CEPB 2RGGA 4GECA 4UU0A 3UB3A 3O1LA 4BNJA 2AOUA 2DFVA 3T5MA 2HJ9A 3GDWA 4LJ4A 4Y1RA 5IC6A 1N6HA 4BE7B 2I2XB 5CVJA 3EG9B 1QHHA 1DUSA 3TTXA 5TQ0B 1CY6A 4IZIA 2V0CA 4RYDA 5ADHA 1DKQA 1U2EA 2VCEA 2OQVA 3WL7A 3AI3A 1YAHA 1Z4OA 1ADCA 2HGSA 3OZRA 3D4BA 2P6NA 4RGBA 3GFOA 5DTIA 1J24A 5JD5A 3FZGA 1Y3HA 4D8WA 1P1RA 4QUHA 1J0DA 1YKSA 1ZJ5A 2QWXA 1MCZA 5AVRA 4CN8A 1L3BA 3OQIB 2AFIB 3R0ZA 1RYEA 4FWBA 5HTKA 3SLKA 4TS4A 5JXHA 5BMVF 3OJFA 4UNPA 4GKKB 1S4QA 3LNTA 4GGOA 1TTHA 3KOUA 3I30X 4MP8A 5CVEA 3DG9A 3K1JA 3ZWKA 5G41A 3HJRA 4C7OA 1UMKA 3KB1A 1J0BA 1YR2A 4DCUA 1VG1A 4KIJA 4LPSA 1RIIA 2PUBA 1XZFA 1W6RA 4MQ6A 2J3JA 2YHBA 2JLWA 1AKMA 1JXOA 3HKDA 1GQSA 1FVXA 2NM0A 2R85A 4MQMA 4OYLA 3GT4A 1BCRB 4GOJA 5G0VA 1XCBA 2X8AA 5GMOA 3L7DA 1IBMB 3PJRA 1JKJA 3QFFA 2V55B 3CSUA 3T7SA 4ADSG 1HRDA 2XCOA 3WL5A 5C4IA 3DKPA 1AK9A 3DGFC 3KZKA 2NU6B 1XZNA 4GPEA 221PA 3B3JA 2XEXA 1T91A 2R3SA 5JBQA 5AK5A 3QXGA 3UJ7A 3D3JA 4L78A 2X5XA 5MGNA 4ZANA 4K9OA 4P32A 4R41A 4QUDA 4O2AF 4O4IB 3YASA 2LXNA 3CJRA 1XGKA 2B8TA 4MRSA 4UKDA 3FYTA 1O9BA 2V3VA 1EWKA 4BYGA 3COJA 1AUQA 3I1IA 3DEHA 5JE8A 16PKA 1JHOA 4E4TA 1HE1C 1JSXA 5B3LA 1FZQA 2EV9A 3GHYA 1ZVMA 1HOTA 4C4PA 3BE8A 3UHOA 1PL7A 1UBHS 2IDKA 3SSOA 2XUFA 3SP1A 4HCJA 2MDTA 4WJLA 3GELA 2RSLA 1GRVA 2CHQA 1S02A 4GOLD 3E81A 4UHCA 4CTJA 3NBXX 4LRTB 3SQXA 1MAWA 2FEPA 3U7HB 1DBRA 1R3UA 4NZOA 3ZVMA 4GMHA 4EPTA 1PAUA 4TV8F 5K0SA 4MQFB 1BCSB 1U65A 2BI7A 2EX4A 3L06A 2F64A 6ABPA 4EW6A 2NZWA 2O8DA 4KODA 3WL4A 1G6Q1 3KEMA 2QRHA 1FP1D 4MVXA 5DNYB 1ZD4A 1W1IA 3PDUA 4V1CA 2C20A 1B8VA 1R8SA 3MQ2A 4PIPA 3EEQA 4X71A 5JATA 4PFQA 3UMJA 3H5NA 4ASUD 2QE6A 2VT6A 5EGSA 4B0PA 5ES4B 3QPBA 3ZCXA 4YX9A 1X1RA 3GEGA 5DSXA 2YXPX 4UFPA 5IKMA 4TMWA 3DLBA 3FKSA 4DRXA 5JYDA 3F3YA 3O4RA 5AJTA 4OHUA 4B80A 3BPSA 4RA6B 2X40A 4ZYWA 2WYWA 3S2SA 3M6IA 4MCJA 4H7KA 4UCFA 4CLOB 1I8TA 3WNCA 3OC6A 1B2RA 1SKYB 4MV8A 2YXBA 4IIYA 5DXJA 5D5PA 4CMCA 3WGLA 3ZCUA 2Q1WA 3CRQA 4RMNA 2OZPA 1Y7HA 4YMTA 1WKCA 5BSHA 2FZKA 1JU9A 1OILA 2H11A 1DFGA 3MPOA 4MVJF 1J9EA 4N49A 3DFUA 4INOA 3TG8A 4Z4EA 3M1AA 2QYHA 1SM4A 3TTTA 1E2QA 3EGXA 4RTKA 5KYUB 3G9ZA 1JU3A 2ZRQA 3D3KA 4GOND 3QEJA 2O6HA 4NCAA 1HT0A 1NQAO 2WF9A 2OXEA 2J85A 1LI5A 3B2EA 5AKHA 5C5IA 1A5TA 4GWGA 3Q1KA 2BTEA 5JZSA 2I7DA 3W05A 2XGJA 4R8LA 3AHCA 2YKGA 3PHCA 2BZGA 5JNVA 2DEUA 5DH9A 3LZCA 4CT0A 4RCYA 3GJ6A 4J0CA 1XKTA 3ED1A 4YCMA 3IUYA 1MD9A 1ZCAA 4X60A 2PWBA 4BVAA 4BS9A 4DNPA 1AQJA 2FPPB 4HQ6A 4O1MA 5HKKA 3TI9A 1A97A 1HEYA 5F7ZA 5LQMA 1OFGA 1Z39A 5FUMA 3REOA 1OV6A 3IUEA 2AT1A 4GSLA 1H69A 4I9NA 1EHIA 2BBSA 5DULA 1F1BA 1F4PA 1ANKA 2O48X 5BSWA 4ESHA 2QZJA 3N3BC 1LEHA 3RRMA 1KO4A 5HRCA 4X62B 1I2DA 1XMJA 2QX8A 1BJTA 3O8OA 4HY3A 4LZOA 1QKKA 5EMJA 4ZV9A 4DQVA 5KUTA 5FOTA 4JHLA 4PGFA 1F60A 4WX2B 1GA1A 3UKOA 1X13A 2Z1NA 3RG2A 4BPBA 5ICSA 1ECLA 4KN8A 4M9XA 2IOHA 2B8WA 3G5AA 3IMEA 1D4AA 4J0GA 3NWJA 1A8QA 3QF4A 4LJ6A 2OUKA 5TT0A 2RHLA 2ZBVA 4DRZA 3FPSA 3HA7A 4H1VA 1QBGA 4RHCA 5JS7A 1QV6A 3ZG6A 1ZJ4A 1E3WB 1YJAA 2C31A 3OZFA 1TMKA 4OQQA 2PS9A 5EKTA 3SC2B 4CF6A 2ZPAA 1KJQA 3OIWA 4PZDA 1FNCA 2B35A 4RF5A 4OGFA 3CLTD 3FNQA 5CFRA 3QE9Y 2A92A 4CNQA 3CEAA 3N76A 4H15A 1U2GA 4BFXA 5EP2A 4K86A 5LP6B 2WP8J 5EJ8A 4W5TA 4YLGA 2P7IA 3PTAA 2Q49A 2O2GA 4JC0A 5CXXA 3GEPA 1OXXK 3R7WB 5BRNA 2ACKA 2HJGA 3ZDYB 3NEYA 4E2ZA 3AM5A 1E98A 3B6IA 3V6MA 3IBTA 5IDXA 1UOPA 3N3AC 3QJ5A 3WDLA 2O0LA 2AKEA 2F3SA 1PVDA 4HC4A 3NDPA 4DPKA 5F7OA 2G28A 4OM8A 1SY7A 2QMHA 1K7SN 3EVTA 2ZLBA 1Q0QA 1XTIA 4KRXA 1RZRD 3JD0A 1O4VA 1T8PA 2ZYTX 3HS3A 2VQEB 1RXWA 2H8KA 1JSLA 4LFBB 4BAZA 3AIKA 2CZCA 2A9OA 1U1CA 2HBZA 2RAVA 3GRCA 3HCWA 3AZQA 2RG7A 3ANLA 1XC7A 1MV8A 2WTUA 4BASA 1OA1A 3TSZA 2H54A 4YYZA 1KDTA 2ZFUA 4BP3A 2ZIEA 4L5JA 5L3QB 2VF4X 3P0EA 5KYXA 4EYGA 1VBMA 1KFCB 4XGQA 2J7PA 4J16A 1U1EA 4HT3B 1OHHA 4MGKR 1N9GB 3DEJA 2PV7A 3GAZA 1NTOA 1D0VA 4HX9A 3JW8A 4L6CA 3VNUA 2YIVX 1WZCA 1M5RA 2ZJ0A 3K8ZA 1GYRA 5WRFA 1ZUD1 4EQ6B 2P67A 4MW6A 3AKYA 3M6AA 3MINA 5B1IA 2GAJA 2J9XB 4DIUA 2UZ1A 4KQHA 4K81B 4PYQA 4CKEA 4MYDA 4ITUA 1Z12A 2WFAA 3D0OA 2HJWA 4DLNA 2G63A 1L5LA 4BNGA 2BI8A 5J43A 4DLBA 3C43A 1UP4A 2C98A 4AG3A 4F9FA 3JVEA 4PC7A 2LCFA 3DJYA 1QZXA 1NUHA 3FLMA 5DCYA 1LGYA 3H7IA 3IDSA 5LP6C 3UPTA 4JXXA 2QLNA 3ZVLA 2VWQA 3G2MA 3TSWA 1WO8A 5T8KC 1SUAA 5DN9A 3K30A 2AXQA 1BAPA 3K4HA 4QJBA 2ZSKA 1U0BB 1IEQA 1N0WA 2XKJE 3TSAA 2VTBA 2BGRA 2QTVB 1U0SY 5F7XA 5JYCA 1N5LA 3SFVA 1Z0AA 1P1KA 1WKVA 2PUJA 3SX0A 1DTWA 4D26A 2DHEA 1XTQA 1P39A 3GCWA 4BO4A 1A9RA 3O4JA 4IGAA 1XCMA 4XYMA 1G8KA 4CMIA 3UT0A 2L19A 1K63A 4IX9A 3NJ8A 3TVDA 4XSHA 4YT4A 2Z3WA 3P71T 5IU6A 5GM1A 3PJGA 1DJLA 5LQDA 2CT8A 3V1UA 2JLCA 3QVXA 1EQUA 3JQEA 1W2HA 3NHSA 1UWVA 3QU5A 2VKQA 4BUZA 5DHTA 4A16A 2DT8A 4WY5A 2H0RA 1MX5A 2UAGA 1E61A 3GA7A 4HH0A 2IA5A 3NKFA 4M99A 4MQBA 4F84A 1SC6A 1N92A 1X0VA 3T7DA 1M0WA 3GCDA 4HJXA 3EB9A 1FS6A 4N5MA 4HXYA 3PHBE 4NX2A 3E53A 1O6GA 3L7NA 1T9GS 3K9QO 1YE5A 3ND7A 5T6MA 5KTTA 2IYZA 1V5GA 5DIZA 4GMKA 1W36B 2OQIA 3TUJC 1H8EA 1HSZA 1ZLYA 2PRKA 3DAYA 4CV3A 2O8EB 4TXHA 1OROA 2VSQA 4PG7A 1R6UA 2GQ0A 1ODKA 2QMOA 2VTKA 3VR1A 3LY5A 4QREA 1SQFA 3I2GA 4J1TC 4NATA 2IH2A 4RLSA 3ITNA 1KY3A 3VNQA 4IIJA 1ZJ6A 3S1AA 3H8VA 5E0OA 5T41A 2R4TA 8ATCA 4L4RA 4CTNA 2OP0A 4L6AA 4NE7A 2D2IA 3TIFA 3W5AA 3DZIA 3J81k 4L57A 2Q4RA 5EHNA 5JZ9A 5GZ1A 3E3LA 3AUJB 3RYCA 1MEEA 4JUDX 1MPTA 2W0SA 2CNBA 3QNMA 4LE2A 2GN0A 1RLOA 5JU6A 4ZVLA 1FMJA 2VDRB 3M6VA 1GZ7A 3RU3A