2BBTA

Human deltaf508 nbd1 with two solublizing mutations.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
279
structure length
249
Chain Sequence
TEVVMENVTAFWEEGFGELFEKAKGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGRISFCSQNSWIMPGTIKENIIGVSYDEYRYRSVIKACQLEEDISKFAEKDNIVLGGITLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKADKILILHEGSSYFYGTFSELQNLRPDFSSDSFDQFSAERRNSILTETLHRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cystic fibrosis transmembrane conductance regulator
publication title Structure and dynamics of NBD1 from CFTR characterized using crystallography and hydrogen/deuterium exchange mass spectrometry.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 85
structure length 249
sequence length 279
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2bbtA00
2IHYA 3KTAB 4TTPA 3N70A 1N6HA 4MITA 1EXMA 1SULA 1XJCA 2WPDA 5LB2A 3VX3A 4ZO4A 3DPUA 3NDBB 4QNMA 2OEPA 4A4DA 4A6XA 2RGEA 1RJ9B 3AGPA 4DWJA 3Q7PA 3FOZA 1FPMA 4PPNA 2IWHA 4QG7A 3HYRA 1E4YA 4XVQA 4KAXA 2EQBA 4M22A 3U6BA 4YLGA 4LC0A 1SHZA 3MFYA 3U3OA 3AF0A 4MRRA 2GNOA 4RZ2A 3VU9B 2DR3A 1XTRA 2BJVA 3E5HA 4GSYA 5GJWC 1EFHA 2WOJA 2F43B 4PO8A 4XSHA 4UJ3A 3IEVA 3RS2A 5KTYA 3CNNA 1N0UA 2R6FA 4EPVA 4QM7A 4UNNA 1JALA 4TMKA 1E3MA 1OYWA 2ZI9A 3R7WA 4Q00A 3IDQA 3GLGB 1W48A 2CJWB 2AHOA 2QE7D 3SFZA 4C0KA 3X1YA 1E2GA 1OIVA 1I4LD 3QXXA 3HPQA 4JBXA 2XOKD 3KKQA 4DEYA 1YRBA 2VO1A 2ZS9A 4V0MA 1UJ2A 2FFAA 3QEOA 3KKOA 1KAGA 4HDQB 4IEIA 3EWSA 1KKLA 2F6RA 1HE8B 2QTFA 2BJWA 1WMSA 3RVBA 2GJ8A 2ZPTX 4A9AA 2GCOB 1E0SA 2IYWA 2FU5C 1S8FA 2CCJA 4Q9IA 5DI3B 1EWRA 2OAP1 1E9DA 3FTQA 3N2EA 3T34A 1X1SA 1X8JA 4QGAA 1FNMA 1Z6XA 2F9MA 4Q01A 3WNCA 1G64A 5JS7A 3LLUA 2KSQA 2OO7A 3PQCA 5CITA 2XJ4A 1E96A 4XD7D 4HYYA 1UF9A 2XSZA 2OFOA 4PHGA 4BEBA 2FV8A 4D80A 2G6BA 5GJCA 2ZREA 2XNDA 1XMSA 2YOHA 1EGAA 2YOFA 3EASA 4TSFD 4RCYA 2WJHA 5EXTA 3GJ5A 1QDEA 1QBKC 4Y0VA 2JIZA 4B3XA 2GZDA 5IRCD 2JJ1D 2QEQA 2QUZA 3L0OA 4DZZA 2VHCA 4ACBA 1TQ6A 1SVMA 3S1AA 1NL3A 4CW7A 1H8EA 2Q3HA 2UKDA 4PANA 5AUOB 1Z0FA 4BLRA 4LJ5A 1XD2B 1QRAA 2H1LA 2RHDA 4NYMR 2HJGA 4ITRC 3T12A 2OSBA 2C95A 3LY5A 5SZKB 4PQRA 4PPGA 2FPKA 2ECKA 3SYNA 2JEOA 4IFEA 4JL8A 2QSZA 4HUQB 4DLTA 1NF3A 4OI1A 4ERNA 4DDVA 3MWLA 2FNAA 4C7OB 3AF3A 3I8SA 4QL3A 4IDPA 2OCYC 4GNKA 1H8HA 1IQPA 4LZZA 5FUWA 3A58B 2HCJB 3P4XA 1G3IA 1XXHE 4YQFA 2J87A 3QVUA 2WWFA 1G3QA 3R20A 1DAIA 4RZ3A 2F1RA 2J0QA 3GJ6A 1YKSA 1KSJA 4Q1FA 1RVDA 4P4TA 3I62A 1VG9B 2BMFA 4WOPA 2O5VA 2QP4A 1TMKA 2ZU6A 4B2IA 1QHYA 4XVUA 2QY9A 3WY9A 1UBFA 5A5GA 3ASYA 5GVRA 4AY2A 1NRJB 4Q1EA 4DEXA 4AYXA 2REBA 2IYTA 3FB4A 2ZE7A 4URYR 2GXQA 5LB4A 1T0JB 4KSCA 3VKHA 3PIRA 3THOA 3U44B 3PR1A 3TQCA 4EKDA 1XJ0A 1XU4A 4KVGA 2J0SA 5FOWA 4E07A 2C2HA 3K0AB 5EE5B 1K6MA 3A8TA 3LVRE 3BB4A 4HAXA 1M8PA 3T5GA 2CEAA 3BS4A 2HLDA 3KX2A 1J90A 2OLJA 3RHFA 4XH9B 1ZC4A 3O8CA 2IXEA 1IXRC 2EYQA 3U7HB 2ATVA 4M9SA 3LV8A 1EFUA 1AS3A 1R5NA 3T5DA 3KTAA 4B3GA 1OJLA 2V8OA 2IYQA 4BFYA 2GXAA 1F6BA 2WM9B 5J4YA 3ZLJA 1CR0A 2GTPA 1GNPA 4OJKA 2YHSA 3TSWA 4NBSA 1BO6A 3U61B 3NBYC 3AVXA 1M7BA 4OI4A 4B3CA 2XTZA 4KYIB 2NO1A 1HA3A 2GCPA 3Q7QA 3VU9A 2XGJA 2UZ3A 2W0MA 4DLYA 3EARA 2F43A 4QHYA 4EDHA 4YXWD 2NO9A 5FPYA 4M4SA 2FEMA 1NJGA 4FMDB 1KKMA 4TSFA 1MABB 1VYUA 4ON9A 3GLFE 1A2KC 3EZ2A 5FR2A 1NKTA 4WIAA 5SZIA 3K9LA 4MKFA 4GRAA 3GLGA 4NYMQ 4JVSB 2CJWA 3LBHA 1ZD1A 3Q5EA 1XTQA 2ODNA 4FD2A 1R0WA 3EZ6A 5E3HA 2Q21A 1DARA 1FNNA 1XMJA 2SHKA 5EZ6B 5E7MA 4UNRA 2ZJBA 4KU4A 1AN0A 2ONKA 2VIIA 3EXAA 3SFVA 2ZJ2A 3A37A 1M74A 4B33A 4B73A 4ZV4A 1II0A 2GCOA 3PV0A 3FDIA 4Q4JB 1VIAA 5BQ5A 4V0NA 3BORA 3OFNA 4AKIA 1AZTA 5FTMA 2GXUA 3KDSE 3WHKA 5B2ZA 2XX3A 3K09C 4A0GA 1EX7A 1LY1A 1TUIA 1KDTA 3P20A 5DSZA 4V0LA 5TDHA 3ZS8A 2XZLA 2ZJAA 3IBGA 4PHHA 4G5OA 2ANCA 2I1VB 2IEZA 4QGGA 5FUYA 1S2MA 1NI3A 1TNDA 2D7CA 1P9RA 3RLFA 3TR5A 3WMFA 2WSSD 2Z43A 4HAVA 3AB3A 2O52A 2CVHA 3OEHD 5AJVB 1W4AA 3X1WA 1E0AA 2GEDA 5JHGB 1KI4A 3IILA 2FSIA 4DJTA 3KL4A 5L3RA 4V0ME 2Z4RA 1W47A 1YRAA 1JR3E 4KCGA 2J7PD 3Q3JB 4LJ7A 3EG5A 4NMMA 3CW2A 3CLVA 4PZYA 4ILEA 1N5KA 5GJVC 1SVLA 4V0OA 2GZHA 4TMWA 1S1MA 1XD2A 2HCBA 3U60B 1OKKA 4EPTA 1NVUQ 1SHKA 1TX4B 1MO3A 1C1YA 2FGKA 3KKNA 1YU9A 2ZANA 4B43A 4DLWA 2BBSA 4C7OA 1E9BA 4KBFA 1P75A 3LD9A 5K8IA 2ORWA 5JEDA 3WNBA 2NMVA 1ZVQA 1YVDA 2REXB 4JYCA 2J5XA 5D3MB 5DH9A 1KK2A 2QZ4A 1P4SA 3P1JA 3NKVA 3CZPA 1ZNYA 4OHZA 1OXXK 1NBMD 2XB4A 4D6PA 4QKQA 4NL4H 3WMEA 1WXQA 2MSCB 2WHXA 1N6RA 3KUCA 3REGA 1GM5A 4QOSA 2B6HA 3BH0A 2PL3A 3FMIA 4CEIB 5E95A 2OBNA 2OCPA 2VBCA 3KQLA 4PHTA 1PV4A 2FSHA 2E87A 2TMKA 5AJXA 4B71A 4JLKA 1ZM9A 4MYUA 2G1KA 1S3GA 2RGXA 3OIYA 2QU8A 2QROA 2V1XA 2NOAA 4W5JA 2OBLA 5KDDA 2B8WA 1Q1ZA 1IXZA 2CHVA 1W1WA 3EC2A 4WBSA 4F4JA 4Q47A 1KI8A 1MRNA 3K0AA 4QBIA 2ZTSA 4G5RA 1XTSA 1I2DA 3WRXC 1FP6A 2DHRA 4R9UC 2DFTA 4L5BA 3SHWA 1E94E 2ZSAA 1DEKA 2IS1A 5HCNA 2EFCB 2OZEA 4GOKA 1KZ7B 2O0HA 2EFGA 4OQLA 3W9YA 3MWJA 1EG7A 1WE2A 4NDZA 1N5IA 1F3OA 3EAQA 4A2PA 2XXAB 2R6GA 1TQ2A 1J2JA 3L2OB 3GJ8A 1E6CA 3QKRB 1CU1A 1LW7A 4QC2A 2ZQ5A 4OI0A 3LBNA 2FG5A 1F2TB 2CNWA 2WWHA 4QHSA 2OHFA 3NVAA 5IT5A 1JXMA 3B78A 1Q21A 2F1JA 1Q3HA 1QHSA 4P31A 3OEHA 5AUQA 1MABA 4GZLA 3C15C 1XX6A 4UKDA 4ASUD 1ZC3A 3DO6A 2QRNA 4I99A 4Q7KA 2CLCX 1NLFA 1R7RA 2PZGA 1OIWA 1YZTA 1CTQA 2ZAOA 4GDFA 4LHXA 4AKGA 4IVRA 5J5CA 1KAOA 1YR7A 3QKTA 4BFZA 4MDEA 3Q72A 1EFTA 3ECCA 4DBLC 2GF0A 4KLNA 1R0YA 2OG2A 1G19A 4XTRA 3QE0A 1ZYUA 4ARZB 5CB6A 2Z5FA 4PC7A 4LSGA 3GLIB 3L0SA 1FUKA 4HLCA 4HLUA 1KMQA 3LXRA 2IYYA 4TLBA 2HV8A 1II9A 4Q4JA 2ZI7A 4AG6A 4DIDA 5FL7D 2JLUA 2HXYA 1IN5A 2JLXA 3IHLA 5HE9A 1TTTA 1Z6GA 5BW8A 3K09A 1Z0JA 2R9VA 3CX7A 4KV9A 4LCBA 4NCHA 3X2SA 4IW3B 3LVQE 1OHHD 2R44A 4IOJA 4JSTA 1G20E 4LJ4A 4KSBA 1TAGA 2NO6A 2VH5R 4IEEA 5FOSA 5ANRB 2YYZA 3B5JA 3TIFA 3UKDA 3GLGE 3OZXA 2FFHA 4LHWA 1E2KA 4K46A 4FXPA 2A2ZA 1NY5A 3EA5A 2IF0A 3O8DA 3IQWA 3BERA 3EIHA 1G5RA 3B8HA 3GCGA 2A5FA 5FPHA 4NKRA 5FR1A 2ERYA 1GDDA 1YZLA 3OIVA 3CF6R 2BV3A 4OHXA 3U7EB 2IS4A 2IA5A 5E7JA 3KXLA 2W58A 1FUUA 4JLPA 3BC1A 3LBIA 2AWNA 2QA5A 4JL6A 4C0SA 5FPKA 2AFHE 1VKJA 1KI6B 4F4CA 2A5GA 1FL9A 3LA6A 5B57C 4Q1BA 3P27A 1KHTA 1P9NA 3SN6A 3K0SA 2ZJOA 1X6VA 2OV2A 4MUBA 4BFUA 2YWEA 1VHTA 4M1SA 1LF5A 5D3MA 1JECA 3TVDA 2D06A 3LAWA 2FDCA 4L16A 3RWOA 2JLZA 5CIQA 5TARA 3F5FA 4LBZA 4MH0R 2IYZA 3NH9A 1EX6A 3TMKA 5KOYA 1D2MA 2ZRLA 3C5CA 5KNDA 3OAAA 1Z06A 4CEIA 2IYLD 4X8OA 4O3MA 4AKEA 1RZ3A 3PG5A 2WWYA 1RPZA 2XITA 5FBWB 4MGZR 1N6LA 1RRGA 3LXXA 4ASUA 4KXFB 1XCPA 1XMVA 1JEEA 2WBLC 4TLDA 1QZXA 3KKPA 3HU2A 4Q1DA 2RGDA 1I4DD 5EJEA 5KSPA 3SYKA 2GVDC 3AF1A 4AIIA 5JI2E 2JA1A 4IDQA 5DE3A 3TNFA 1NP6A 1W36B 1CP2A 5EUQB 1E9SA 4PC3A 2Q6TA 4D4MA 2OUKA 4HAUA 1OSNA 3PUYA 2QPOA 1TU3A 4XWOA 4JMPA 2ZUDA 1GSIA 1M7HA 2D74A 1D6JA 1VG8A 3MAAC 4B35A 1NN5A 4FIDA 1KI7A 1S96A 2PH1A 5AUPB 2XXAA 1CEEA 4US1R 2PCLA 2C03A 2RMKA 3QKRA 2N42A 1ZNWA 1GNQA 3GFTA 1F2TA 3DZDA 1GRNA 2W2XA 5A0FA 3GEIA 4RSGA 5EP3A 1UKZA 3I72A 2YNMA 2IYSA 3AEZA 1DAEA 2WPDD 3LQQA 3OIWA 2XZPA 4DCUA 1EFRA 4U00A 2RGNA 3GPLA 2A7QA 3BRWD 3AV0B 1IY1A 1GKIA 2GJ9A 4V02A 2QAGB 1P7CA 2QAGC 1OLOA 2YC2C 1L7VC 2F1HA 2OILA 1J8MF 4A0RA 5C2JB 1W44A 4ARZA 1AQYA 2P2LA 3GLIA 2D62A 3P32A 4TL8A 4ACAA 3R9WA 5F2EA 2WKRA 2QENA 3E1SA 3MJRA 4YONB 3BWDD 1QF9A 2OFWA 2WICA 2F9LA 4BRWA 2W6IA 3U6KA 3TBKA 4Q9LA 3RSOA 2CE2X 4D0NA 3CF0A 2IS6A 1KNXA 2P65A 4XWAA 3KJIA 2GJKA 5EP2A 2YVUA 3RSLA 3AM1A 2AD5A 1JEDA 3RRNA 1JR3D 1BMFD 3BK7A 4PAMA 1OH5A 3BIFA 1OT3A 1XEWY 2BEJA 3IQXA 3BJIC 5J4KA 1X8KA 4UNQA 3FVQA 1OB2A 4BASA 1JXOA 4ZKDA 3EPKA 1NVVQ 1PUJA 4LUCA 3EZ7A 5BN3A 1CULC 3DM9B 4M53A 5EUMA 3QKUA 4Q4LA 1AK2A 2VYFA 3A1UA 1M2OB 2J7KA 2WKQA 4URUR 4QXAA 1Q1EA 4RD3A 1CS4C 3V00A 1X8LA 2JATA 3QG1A 2ZETA 2IUTA 3WYAA 4URZR 5FTNA 3FE2A 2WZQA 2WWGA 2XSZD 5JZVA 1GTVA 3QG5A 4QGHA 2W2TA 4MYHA 4URWR 2ORIA 4JLDA 3TKLA 1DTSA 3L8YA 1GVNB 2JIZD 2VHJA 4G5GA 421PA 4TZ0A 2IUUA 2EFEB 2WSMA 3ONWA 5DISB 3T15A 3DZ8A 1E1RA 1S0UA 5DIFA 2BCJQ 1H8ED 5FPSA 3C41J 3VFDA 1V43A 3SQWA 2IX3A 2WAXA 2YWHA 3SHFA 4BE7B 1GL9B 3TGPA 4LYFA 4B3DA 3VR5A 3GLFA 1FZQA 1KO7A 2CBZA 4DCVA 4QM6A 4E22A 4IOMA 4RZUA 1FQKA 1HH4A 4YMSA 1KI2A 2ZRFA 1D9ZA 1Z29A 2WAYA 3UMSA 1G3MA 5EE3A 3WMGA 1FQJA 4QBFA 5JWHA 1GWNA 2Q9CA 3BFXA 1XJQA 1H8HD 4GP7A 1XTIA 5EXSA 1R10A 2C8VA 5DYGA 5E4FA 4ZCMA 4TT3D 4PC6A 3TAHA 3ZGXA 1OV4A 4M0LA 3AVWA 2W6JA 4UXHA 1DG3A 2IT1A 2RCNA 1VPLA 1MH1A 1JAHA 1MKYA 3Q8XB 3ZQ6A 1G6HA 3VNUA 2J41A 1VG1A 2Q3MA 1HYQA 3FMPB 3E70C 2B92A 2VP5A 3D6TB 1G7TA 1XF9A 4KODA 5CLQA 4YC7A 1LF0A 2F7SA 2LKDA 3CF2A 2G3YA 2WJGA 2VRWA 3ND9A 5FI0B 2O8FB 1LB1B 1KGDA 1CIPA 3ZDQA 2ODBA 4D81A 1TADA 3KXKA 2PT5A 1U99A 4ZI2A 1G6OA 2NZ8A 1ANKA 3ADBA 2GXSA 1P62B 2LCFA 3RABA 4NH0A 1AM4D 2ZRKA 3I32A 4B3BA 4DIEA 4D82A 5LD2B 5LD2C 1VHLA 1XRJA 4DLVA 1JR3A 4FN5A 1BMFA 2HLDD 1XDBA 1LNZA 3TW8B 3U3KA 2ZIAA 1T4GA 4OBEA 1YZUA 1L4UA 2QQ0A 4FW9A 1MT0A 4ZKEA 1AGRA 5CM9C 2QAJA 2ZSFA 3CH4B 5JI3E 2ODWA 5FOUA 1P72A 2H57A 1TQDA 2CHQA 4XOIA 2DY1A 4A6PA 1RW4A 4B75A 3EPLA 5CJPA 2QM8A 3W34A 3AH8A 4OK3A 1NIJA 1P73A 4TL7A 4A36A 2E1RA 2QAGA 2ZI3A 4C30A 2Z83A 4F4IA 1WF3A 3WYFA 4FWTA 1VYTA 3EIEA 4PHFA 3LO5A 2GA8A 2O8BB 2QP3A 1S9DA 5J4VA 3OEEA 1F5NA 2CCGA 2IK8A 4ZDJA 3U3RA 3AKDA 3I4LA 1S1CA 1F60A 2XEXA 2ZE5A 3K9HA 2FOLA 1D2NA 1GP2A 221PA 3L8ZA 3AUYA 2QG6A 2GEVA 4I1UA 1B0UA 3EWAA 1N6KA 4GPTA 3I5YA 3THWB 1QHXA 4D25A 2R8RA 3CH5A 1W7AA 3IHWA 4WXRA 1JPJA 1Z3IX 1TUEA 1QHHB 2A30A 1FFHA 2BHRA 2X2FA 2ZU0C 4AG5A 2X8AA 4B32A 3OFND 2R65A 2C5LA 1T6NA 4BFVA 3B2EA 3GLHB 3T1VA 2GEUA 2HYIC 2ZYTX 1ODFA 4IKEA 1VTKA 2OESA 4TT3A 5KHOC 3KQUA 4HUTA 1BKDR 1YR6A 3QXHA 4KJZA 4KYUA 4W5WA 4EPXA 2YC4C 3GLIE 4TMTA 3LW8A 4AYTA 1W4RA 4J0QA 1ZP6A 2Y8EA 2AX4A 3V9PA 1VCIA 4A8JB 1ZIPA 1YJ5A 4MDFA 5FPTA 4LYHA 1MV5A 1OXSC 3D3QA 3MD0A 5AJYA 5KPJA 2H5EA 2X77A 1M6NA 4LBYA 4WVFA 5C4GB 4IOKA 3CRRA 4JZKA 4P4UA 4F38A 3CR8A 3KFXA 3CWQA 4I1OA 1F48A 1XEFA 1G41A 1OFHA 4R71A 5JS8A 5H70A 1Z5ZA 4HZIA 4LJYA 4OHVA 2V9PA 3FKQA 1AZSC 3MG9A 4ZCLA 1NG1A 3TW4A 1OKKD 2NIPA 5IK2D 1NVWQ 1KMHB 1X86B 4X8MA 4DCTA 1KZGB 2JLVA 4B44A 3I8XA 4CT5A 2HUPA 1TU4A 3MRSA 1A2BA 4PC1A 1G3RA 1P60A 3F8TA 2ONJA 3X1XA 4ZI3A 1E9AA 2ZI6A 3GJXC 5CIWA 5EE9A 1LS6A 5B30A 3QPWA 4JJZA 5AJWA 2PEYA 4KFRA 3A1TA 4AK9A 2A5JA 1R8SA 4HB0A 3B1VA 2CL7X 3A1WA 1TPZA 3B6EA 3TE6A 3UMFA 2KI5A 3L0IB 5C46F 5CYPA 1RJ9A 3E2IA 5EP1A 1A5TA 2IL1A 2B8TA 4C9BA 1SKYB 5E7IA 5CK5A 1OH7A 2O0JA 4OL0A 3EPHA 1W4BA 4BZXA 3DVLA 1EESA 4LBVA 5DHAA 2GBLC 2I3BA 4V0KA 3B85A 3NIBA 3REFA 2NO0A 3ICQB 1RC8A 3D7MA 3NC0C 1U9IA 1IONA 5J4LA 4JLJA 4RFSB 3AVPA 4DCSA 1BS1A 2ZJ5A 3PXGA 2O8FA 5BYJA 3SNHA 1JAIA 3W3ZB 3UK6A 3HR7A 3LDAA 5HCIA 1GKUB 1MO4A 2IEYA 4DUGA 4DCNA 2QMEA 1DS6A 1Q12A 3RC8A 4IVPA 3WHLA 1OW3B 1BH2A 4JVLA 2JASA 4TN1A 3RS0A 5L3QB 1UBGA 4KHZA 1N6IA 1FTSA 4FMBB 1YZNA 4S2EA 2OCBA 2C98A 2RKOA 4HLUC 4P32A 1G8GA 4P0TA 4DDTA 5CJ2A 3AP2A 1CR1A 3ZVLA 1MR3F 2W83A 4NTZA 5DI3A 3K70B 5AJZA 3FYHA 4YMUA 2QGZA 3U7GA 4KLZA 5TY0A 3EPJA 2QMHA 1O3YA 4XVRA 4BGDA 1D9XA 4LV6A 4ZDWA 4E5UA 4RFVA 1M34E 2FPMA 2ASEA 1DADA 2DPXA 5HZKA 5EP4A 3CO5A 2CNWD 4MRSA 3CUEF 3ZJYA 3W8RA 1XNJA 1LTQA 1NN0A 1OB5A 4PSVA 2QP9X 1FMJA 2AKYA 3LRPA 4NPHA 2RGGA 3PUXA 4FCWA 5KDOA 4A82A 2ERXA 3MUFA 2AL7A 2J3EA 1XBTA 1N6NA 2O8BA 1AKEA 1T8TA 2NO7A 2OT3B 1T3LA 2ZSBA 3GFPA 5EXPA 3WBKA 4F7WA 5CDFE 5DLQC 4HDOB 3VKWA 4D4LA 1IY0A 1DAKA 1YZQA 2HT1A 3LQRA 3PUZA 1YZGA 3GJ0A 3CWZA 1V5WA 2WIAA 1G7RA 3GJ4A 2J0UB 1N2CE 4A92A 3IIKA 3MWYW 5TB5A 3EX7C 1KNQA 1KO4A 3F3YA 3THWA 2O8EB 3B60A 4JLMA 4JLOA 3ADKA 5IK2A 1HTWA 4JYBA 4JVMA 2R6CA 3VMFA 5HTKA 2C96A 2OAQ1 2QNRA 3U3MA 2WJYA 1KDPA 4MGKR 4P4SB 1QHHA 3HU1A 4HUQA 2W0SA 5EZ5A 1U8ZA 1VG0B 1U8AA 2GJSA 3ETLA 5SZJA 3ZYCA 3GLHA 1Z08A 2CLDX 3PEVA 4UNSA 2NPFA 2O8DB 4QGFA 4JVNA 2YV5A 1NJFA 3CPEA 4PFSA 1Q1QA 4DRZA 4GT1A 4BUJA 3AVYA 2KE5A 1GAJA 3ZS9A 3LX5A 1SXJB 4KI0A 3SEAA 3EC1A 4A8JA 2PZFA 4MKGA 1S3SA 1GZSA 3F0TA 3LW7A 4CVNA 1CKEA 1YQTA 3D31A 2NG1A 3AP1A 1F2UB 4M1WA 2X19A 1JQLB 3BH7A 1NKSA 1UM8A 2HJVA 3CKLA 2R6DA 3JZAA 1W2GA 4EJSB 5B58C 1AA9A 1WA5A 3AVOA 4EJSC 3RAPR 2PLRA 1Q44A 3MSXA 3U44A 4NZYA 1E2QA 4AC9A 5KUTA 3HR8A 3QIAA 3WP1B 1NMXA 3X1DA 5FUVA 1DG1G 2JLQA 1E2PA 2YWGA 2ZJYA 1IXSB 5KDLA 1IY2A 3NH6A 3R8FA 4IXNA 1E9EA 4LBWA 1R4AA 1L2TA 2FGJA 1NMYA 2VP6A 4KO8A 4H1UA 1A82A 4LV5B 3RS3A 4Q5IA 1Z07A 2PX3A 1R0XA 1GIAA 2FJUA 3DM5A 3H2YA 2ZR7A 2OM2A 4MRPA 5LDDC 2ZRBA 2IC5A 1T3HA 2OLKA 3FHCB 1TEXA 3AUXA 4Z8YA 3FMFA 1UKEA 4IOLA 5G41A 4HB3A 2ZS8A 1OF1A 2PMKA 4D0LB 4MGYR 3QSYA 1E2LA 4EQ6B 2IF2A 3TUIC 1IN8A 2NZJA 4TQAA 3OAAD 2QBYB 2KWIA 5F98A 4PSAA 2GBLA 4V03A 3QJYA 3HJNA 5JLJA 1HE1C 3T06B 4BLQA 1NNEA 5LBIA 4M1KA 5FOTA 4W7SA 1G8PA 4RFSA 3N5CA 1FW6A 5TVKA 2Q0HA 2RGNC 4C0LA 4CYMA 1JQJC 4M21A 4LYJA 4DHEA 2VP4A 721PA 4MKHA 1MOZA 2G0NA 3H4MA 1R2QA 4B47A 1WBBA 4BPBA 4N0EA 5SZHB 1FP7A 1XCMA 2MMCA 3EIQA 3VNVA 2ZITA 1TL7C 5L3QA 5H1YA 1D2EA 1ZW6A 5L3SB 2WMOB 4FMCF 1AIPA 1G21E 2C9CA 2A5YB 4POAA 3FFBA 3BAFA 1HV8A 1UEIA 1XTJA 1E99A 2V54A 1N0VC 3TRFA 1E32A 3FHTA 4DSNA 4RY2A 1KTVA 2PZEA 1XB2A 2QORA 2CK3D 1G8HA 1G18A 4Q03A 4AD8A 3KXIA 4C3ZA 3GJ3A 4C0HA 4M8NE 2WV9A 4MGIR 4NYJR 3A1VA 1U0HC 1IJEA 3QEJA 4ZDIA 3NEJA 5KYKA 3T35A 2PJRA 5FBQB 2P67A 1ETUA 1EFRD 3QXSA 2LKCA 3MJHA 2V55B 6Q21A 4Q9JA 2ZRHA 1NY6A 2GHIA 2KBEA 4PX9A 1GL7A 3JZMA 2ZM5A 1DAGA 3T1QA 1OIXA 1DBSA 1Q57A 1YZKA 1TF5A 3TH5A 2J0UA 1PUIA 3CIOA 2O8EA 4NONA 3QF7A 1OXUA 3K0FB 2DB3A 1P61B 1OFUX 4WXPA 2BDTA 4NCNA 4A0HA 1JI0A 2BMJA 4XTCS 3C16C 4JLNA 4P4SA 2VF8A 4IHQA 1ELOA 1I2MA 2W6ID 4QRHA 3UG7A 4RKFA 3IGFA 4CEHB 521PA 1K8RA 2O8DA 4LX0A 2GRJA 2ZXUA 4JL5A 4F91B 4Z1MA 1EFCA 2WMNB 2W00A 2A9KA 3H0KA 4L4UA 5JWOA 5A4JA 1SXJA 2WWWA 1UPTA 3NBXX 3QBVA 2KJQA 4M1TA 2X1VA 1DAMA 3SJAA 1F2UA 2BC9A 3FKSD 3QNUA 1J8YF 5FOXA 1N6PA 3MCAA 2C99A 4DLSA 2JCSA 4ZCIA 3W6NA 1NVVR 4LGMA 2HDNB 3IUYA 3JVUA 1KI9A 2VHTA 2ZRPA 1IBRA 3I3SR 3N2IA 2R2AA 4X8LA 3VR3A 3M1IA 4TWZA 4EJSA 1UKYA 2GVZC 2ZRGA 2VEDA 5G3ZA 5DGXA 1AS2A 1ZCAA 4M1MA 1Z47A 3T1OA 2RAPA 4MYCA 2ZI4A 3PCRB 3VHXA 2GCNA 1G5PA 2HXSA 1LFDB 3B1XA 4IRUB 3B9QA 3GLHE 2VP0A 4A2QA 2V4ZA 1PZNA 1W36C 3G5UA 1E1RD 1YE8A 1RRCA 821PA 1Z83A 4YMWA 2EVWX 2Q3FA 3L0PA 4CEJB 4G1UC 2GETA 3ADDA 5L8VA 1N5JA 2AK3A 1DOAA 4FCTA 5J47A 2Z4SA 5EQTA 2BBWA 1G8FA 2CK3A 1KY2A 3TLXA 2H18A 1XPOA 4DSTA 4LY6A 1S4QA 4EQ6A 4NYJQ 1KJWA 1ZD8A 2Q9BA 2QBYA 1ZIOA 4C2TA 3THYB 3NTUA 5G40A 1KO1A 3WP0A 4DSOA 5BXQC 5F9FA 2ZROA 5FL3A 3A1SA 1E0KA 1L8QA 1QG4A 3RRZA 4LHVA 3W90A 3CPJB 2VPPA 3A4MA 3UWOA 1LV7A 3RDPA 2W6JD 2D7DA 5KO2A 2HEIA 2O0KA 4NCIA 2UVQA 3EZFA 3ZD7A 2EWWA 3TQFA 4C4PA 1XEWX 1Q3TA 1SVOA 4RJLA 1VDZA 4Z8XA 3K9NA 4TLEA 4EPYA 2JLWA 5J40A 4IJMA 4EUNA 1Z6YA 2G83A 1IOZA 2QT1A 4Z51A 1KSFX 4O25A 1W36D 5HR5A 3HPRA 1UKVY 2VSOA 2Q9AA 3L82B 2GWHA 3DMNA 4Q02A 5JRJA 5L3SA 4HB4A 5FBVB 3VAAA 4UQOA 1J7KA 3CX6A 2QMOA 3KJEA 4GI7A 2G77B 1SKYE 4MYTA 2PT7A 2JJ2A 1WQ1R 1XEXB 2WVJA 4MRNA 2JDID 4Q21A 4RD2A 5C4MA 1GRRA 5TV2A 2BKUA 4BZQA 1RYHA 3NHAA 3VTKA 3B82A 5AR1A 1A1VA 2D4HA 5FUXA 1GFIA 2DBYA 1CF4A 2N46A 2QPAA 1ZBDA 3BFVA 4BFWA 3W8NA 4CIDA 1NIPA 4MQBA 2ZYUX 3ICEA 4FI3C 3WXMA 2PEZA 4B74A 3FKSA 3K0CA 2BEKA 1QG2A 2YWFA 3BOSA 4O2LA 4WZ6A 3BBPA 3S1AB 4L15A 2QT0A 4HB2A 5AK0A 1DELA 5DN6D 2GESA 2AD1A 3MWKA 5BYKA 1HURA 2DWQA 4LWZA 4OI2A 1KOFA 1N5LA 4MRVA 1HEIA 1QVAA 4NP6A 5HPYB 2BM1A 2J0VA 3K0FA 2OBMA 2VHQA 4DT1B 2X2EA 1KO8A 3DOFA 3ADCA 2F55A 2GDJA 4RKEA 1KI6A 3OEED 3P4YA 2HYDA 1IM2A 1AGPA 1J99A 2ZRCA 4NCKA 4IVQA 2XNSA 5IDVA 3H84A 3G0HA 4EFMA 5F3WB 2WWIA 2XB2A 3AKCA 4OK6A 3OF5A 4B3FX 4Q7JB 1G1MA 2EW1A 3ZVRA 1CR4A 4M9XA 2QSYA 2CMKA 1E2EA 1IAQA 2DWPA 3B1ZA 3U2QA 1SKQA 4D2IA 2WKPA 4JJKA 1G8YA 3FFAA 1DAHA 1P2SA 2ZAMA 3UMRA 2AR7A 3K8YA 1SVKA 1E9CA 1CRPA 1Z0IA 1L4YA 1RRPA 2C9OA 4GOXA 4OYHA 3IKJA 1W0KA 2AXNA 2QM7A 4FMCB 2QGNA 3KB2A 4IDHA 2CE7A 4RZXA 1NVXQ 4CRWB 4Q4HB 1B23P 3B9PA 2MSDB 3CZQA 4XSGA 2IXFA 4D26A 4LRWA 1CJMA 1RKBA 3CONA 5AWFC 3TVTA 3CB4A 1E79A 1TQ4A 1TF7A 2CL0X 1NN1A 2ZVQX 3A4NA 4DKXA 4DDWA 1Z8FA 3UG6A 3THXB 4JT2A 1US8B 1E2JA 2ZRDA 2A5DA 3C14C 2CHGA 1T3SA 1U9IC 4TQ9A 2ZVPX 5HKKD 3R9IA 2YZ2A 1UDXA 2JLYA 1E2IA 4WAUA 4CEJA 3AQ4A 4YMTA 1G5TA 3DEFA 1SXJE 1XP8A 4I1VA 4D4KA 5IHPA 1T9HA 2FE4A 4BLPA 1W0JA 2CDNA 1N25A 3TUZC 5CDFA 1UEJA 2ZEJA 2JDIA 3SC3A 3QUSA 5TMPA 4NYIR 3AF4A 4UJ5A 3VR4A 3ZQJA 3AVUA 4D4JA 1NN3A 2IHBA 4KFSA 5G3YA 5M04A 3NWJA 3THYA 5JSZB 4EFNA 2PLFA 3KQHA 4GP6A 1XMIA 2ZR9A 2VQSA 3I73A 1HUQA 3H1TA 3SU8A 2QMUA 3WBJA 4FCVA 2GF9A 1G7CA 4QJ4A 3O8RA 1CXZA 3KJHA 4LDJA 3NXSA 4C0JA 4LV8B 1WBDA 5DN6A 4URVR 3VR2A 5J4HA 2JLRA 4TYWA 1A4RA 3M4YA 3IIMA 1T5IA 4ZIRB 4JT4A 3QI2A 1E9RA 2FEOA 1U0LA 4N3NA 4PPQA 1R5OA 4EPWA 2ODEA 3M6AA 3QXCA 3CR7A 4HEJA 4YMVA 1OPXA 1QHIA 2CL6X 4B6EA 1R5BA 3QPUA 5D3QA 5JECA 2V6IA 4GL2A 4LPSA 1W2HA 2VA8A 3V4RA 3OIUA 1XCGB 4B6FA 1E2FA 4DUGD 4KITB 1AQUA 1KDRA 2OE2A 5HZHA 4E09A 1U94A 1XEXA 5AUNB 2YINC 2VP2A 2EWVA 5KPDA 2L0XA 2ZE8A 2RH5A 2QTVB 4M9ZA 2DFKB 1OFIA 3HU3A 3WYGA 3V4FA 1ESNA 3AGQA 3CRVA 1COWA 1CBUA 2WJIA 3U5ZB 2V7QA 2VP9A 5LPNA 4HLDA 1X1RA 3W6OA 5FTLA 1T91A 2WWXA 5JMTA 2MMGA 1R6BX 4I4LA 4JBWA 1E1QD 4XJXA 3TR0A 2VTKA 4PXAA 3AVVA 1N6OA 2P5TB 2FF7A 1ZINA 2P3SA 1ZUNB 1GILA 3O47A 4DLZA 1Z2AA 5JRZA 3AP3A 1E98A 4FWIB 3CX8A 1XTKA 2B21A 4GZMA 4A8JC 3T1TA 3ZZUA 2NQ2C 1SVWA 1Z2CA 1U2RA 1VECA 4DLUA 1Z0AA 2C77A 3AVQA 4G5QA 4KFUA 2BM0A 3PUWA 3KFVA 4UXJA 1ZCBA 1HQYE 4WZAE 5EE1A 4OQXA 3SOPA 4DT1A 2IYXA 2EFHB 3TUJC 2DWOA 3W5IA 4TYYA 2V1UA 2QL6A 3QBTA 3GJ7A 4IFBA 2FSFA 1UBEA 5HKKA 3RS5A 3CRMA 4D0GA 1EWQA 3SR0A 3GQBA 3KKMA 3O8BA 1VIYA 2C04A 4H1VA 3RWMB 3SZRA 5K8LA 1PLJA 1U90A 1Z28A 1BOFA 1XZPA 2PMDA 4Q66C 3SDZA 3KUDA 4QJ5A 4NYIQ 3Q9LA 3IPXA 3LWNA 2J59A 3VHLB 1ZM4A 3DHWC 2BBTA 3NC1C 2J9RA 3IEUA 4A0FA 2QPTA 4HDCA 3K0EA 1ZNXA 4XIGS 1O87A 4JKIA 4RD6A 2BOVA 5EXXA 1NLYA 2AFIE 3B1WA 3U4QB 3PENA 4PSKA 4DLXA 3DMDA 3D8BA 4LHYA 4Q4HA 4TL9A 4RVCA 2HF8A 3OESA 3R8CA 2QE7A 4DLRA 3T61A 2BVNA 3ASZA 4LHZA 2XOKA 1KSHA 4NE2A 1XZQA 4AURA 1WCV1 4H9GA 3MGCA 1DO2A 3SYLA 1BIFA 1G16A 2QQEA 3THXA 4OK5A 1KJZA 3SJBA 5K8TA 4TZ6A 2H92A 1RE0A 1US8A 4L8GA 1MRSA 1Y63A 1JB1A 2D3WA 4Y0AA 2H16A 5DNYB 3QOFA 4C0QC 4BECA 2ZI5A 2Z0MA 3AKEA 3SI7A 5CM8B 4DSUA 4US2R 1M1YE 1TF2A 3CNLA 3PJRA 5BWMA 4GOJA 621PA 1NMZA 2AXPA 2UZIR 3B7GA 2PJZA 3KQKA 1XD8A 3B1YA 1II8B 1W49A 4KFTA 5CLLA 3LH5A 4UXIA 4XD7A 3SJZA 1W4CA 3HWSA 2KB0A 1RIFA 1PLLA 3VR6A 1SQ5A 1Q22A 2FFBA 1KK3A 2NPIA 5JSZA 4OJQA 5FH9A 4PZZA 3QF4B 1I4TD 2JJ1A 1A7JA 1GOTA 5UKDA 3BXZA 5HE8A 4ZDKA 3K70C 2JAQA 2ZS7A 3EA0A 3C4JA 1SVSA 2WTUA 3LNCA 4E03A 1Z63A 4JLBA 4QJ3A 2P6RA 1YR8A 4PO9A 2XZOA 1E1QA 2IYUA 3DL0A 4B76A 3FGNA 1QHNA 4W9MC 3BB3A 3QKSB 4G5SA 4PAQA 2R62A 3IO3A 1PVOA 2RHMA 3W5JA 3BB1A 4ZIRA 4JS0A 3SBDA 5CK4A 3SS8A 1W46A 3X1ZA 4XWKA 4OHYA 1EK0A 1N3BA 4GBMA 3WNDA 3ZVMA 4TQUS 3KQNA 4Q1AA 1HT1E 2V3CC 2PBRA 1CLUA 3LX8A 5EE0A 3NG1A 4GMXA 2B7BA 2BCGY 4YDSA 2IBMA 4HAZA 4NCJA 3RRMA 4HZUB 5G53C 4L9WA 1E2NA 4O2RA 4TTRA 1Z0DA 1DE0A 3SBEA 4ESVA 2GKSA 2OCAA 4TMXA 2ORVA 1IJFA 1ZJ6A 2GILA 2CLSA 4R2IA 1AKYA 4AKHA 2VLIA 3TJZA 1UAAA 3U3JA 3I61A 4R2HA 2P0EA 1Q0UA 5JCPA 3K70D 3PEYA 2HT6A 1OXVA 4NHOA 3LFUA 2IYRA 3GD7A 2A78A 1CJUC 4PZLA 1XPUA 1G17A 1CRQA 1NSTA 5JJKA 1R8QA 3P26A 4BLOA 2WJVA 2QI9C 4LJAA 2FH5B 4M1OA 3ZD6A 3TK1A 4OQMA 1SXJC 2V6JA 1CJKC 1XD9A 2YOGA 4BRUA 1P2TA 4BLSA 4LJ9A 2ZUBA 3FPAA 1GKYA 1ZUHA 4G0NA 121PA 2IWRA 1XPRA 1G3UA 3AF2A 3DKPA 2ZJZA 1Z0KA 2E9SA 1WB9A 2VSFA 4CZ2A 3UATA 4Q9KA 1XWIA 1AJEA 1XFAA 4JKYA 4M2LA 4DB4A 2P6UA 3A6PC 2HF9A 4Q48A 1KMHA 2ZE6A 3Q5DA 5P21A 4S35A 4C0AC 2YKGA 2A3RA 4YXWA 2RGAA 2DFLA 3I92A 4A15A 3OE7D 4A2WA 3U4QA 3UWKA 1WP9A 2EYUA 4OHWA 4JSYA 5JJLA 1UFQA 4U5XA 5KSOA 2ZRNA 4YDHB 3PUVA 2FFQA 1JPNA 1BYIA 3K53A 2I1QA 3L43A 3W3AA 4RD4A 3TSOA 4Z1MD 1QHGA 1IHUA 1GRQA 1SXJD 2DYKA 5DO9A 4HAYA 2IW3A 1E2MA 3BFKA 3PVSA 4FINA 5GJBA 2PX0A 4P3YA 4TLAA 4IXMA 2DCUA 2MSEB 3PEWA 1ZM3A 4KVAA 2I4IA 1S9HA 2P5SA 2H8KA 5ELXA 1KO5A 4HATA 1M7GA 5FTJA 1UBCA 3U7FB 1P2VA 2G1JA 1D5CA 1IN4A 1LVGA 3K1JA 3NBZC 3UIEA 4TYPA 2R6AA 2W2VA 4AWXA 3WRYC 2QRZA 1SZPA 3DDCA 3DKVA 5KSYA 1II8A 4PQYA 2IS2A 4DXAA 5JBQA 1HT2E 1WDTA 4C2UA 2G9NA 2WSSA 1Q20A 1SVIA 4BFSA 1GUAA 5FTKA 3RYTC 1C9KA 1MO5A 2NTYC 4TYQA 5KNCA 3G82C 4JLAA 5IF9A 5KSZA 4CGZA 1E0JA 2YJTD 2VL7A 5GADl 3QF4A 1E2HA 3GMTA 4BZPA 2RB4A 4OQFA 1PLKA 2J7PA 3TSZA 3GP8A 1XXHB 3A4LA 3GFOA 4TYNA 3FWYA 2D2EA 2XTNA 4HSEA 3ZH9B 1G291 3QKSA 3QQ5A 2B7CA 4U02A 4BFTA 4B34A 4K8OA 4WZBE 1G4UR 2IYVA 2ANBA 3K0CC 1DVRA 1VCOA 3I5XA 4ZPXA 2CVFA 4BLTA 3C7KA 3Q85A 1GG2A 2WIBA 3PFIA 3QENA 1U8YA 2G0TA 2N1BA 4HZUA 1Z6TA 1NBMA 4CF7A 5JCZA 3TAUA 1PJRA 1NSFA 3SJCA 3UANA 4EAQA 4LYAA 4JLVA 4UNPA 5JFGA 3AKYA 1E4VA 2ZRIA 4OKSA 1P5ZB 4TMVA 4BFXA 2WJJA 3RANA 3NBFA 4B2LA 4DVGA 5DI9A 2FSGA 4QBHA 4US0R 3RS4A 4TLCA 3PITA 4PTLA 1FX0B 4QHTA 1KYIA 4TMZA 5FBRB 5CB8A 1ZMXA 3OE7A 2ZSDA 3C8UA 2BIFA 2RGBA 4LK2A 2GK6A 3BH6A 3EW9A 1VMAA 2FMXA 2JJ2D 1ZD9A 5CYOA 3RNLA 1WRBA 2BMEA 4MA4A 3RRYA 1Z22A 1U0JA 3CRW1 1CJVC 1ZU4A 2XAUA 2FZ4A 4LPKA 2GAAA 1H65A 4G3XA 1IN7A 2ZRAA 2H7VA 5C1BA 2FZLA 4Q4AB 4RCZA 1JR6A 2OXCA 2FA9A 4RD1A 2O8CB 4GFDA 4LI0A 2J1LA 3BE4A 8OHMA 1CJTC 1IN6A 1TEVA 1RRFA 2F3RA 1U81A 4QBGB 2BBOA 4DDUA 4HLQB 2PCJA 2RGCA 3GLFB 1HQCA 1ZU5A 4M1YA 5JWRA 2VF7A 1KDOA 2CCKA 3ZIAD 2ZR0A 1RFLA 2AN9A 2C9YA 4I1SA 2FWRA 4TTQA 2ZRJA 1CR2A 3J81k 1MO6A 2IXGA 2REOA 1DPFA 1Y3AA 2IUSA 2JJ8A 3UXMA 2ZJ8A 3VX4A 2XTMA 5FOVA 4QNRA 1JNYA 2NGRA 4LC1A 4ABYA 4JBYA 4II7A 5DYIA 4CDGA 3BD9A 4KBGA 2C78A 2F1IA 4C0BA 1DAFA 3CPHA 4EIWA 2DFNA 4Q1CA 3B13B 4Q18A 2H17A 2GJAA 4AI6A 1AS0A 5F9HA 1T8UA 3KZ1E 3HDTA 2CXXA 1KJYA 4HAWA 4WW0A 1SGWA 4DC9A 1W0KD 2D2FA 4URXR 1KK1A 5TXGA 2EU8A 3R7WB 3R9XA 4M9QA 3SQXA 5FL7A 1OH6A 3BGWA 1JJVA 4PR0A 4B2PA 1E69A 2GAOA 1YR9A 3EZ9A 4Q7LA 3VR1A 3AVTA 1E79D 2FPLA 4HI0E 1UDWA 1P3JA 2QN6A 1OHHA 5KNBA 3CNOA 3SE0A 3ZZ0A 5K8UA 1BYUA 1GITA 2ZYVX 3A36A 1X3SA 1E9FA 1VCMA 1GNRA 1FOEB 3VKGA 3GEHA 4U7DA 3IO5A 1J70A 1OFTA 3FHOA 1OXTA 5FFMA 1YHNA 4X8HA 3HP1A 2BKEA 5FI1B 3QXJA 5GVSA 4CT4B 5L3VA 4PQFA 5H8WA 1OH8A 1HY3A 2XJ9A 4AYWA 1W0JD 3ND8A 5H68A 1JBKA 3GEEA 3H86A 3IBYA 4L9SA 5JJIA 2OXRA 4F92B 1KK0A 1JJ7A 1ZUIA 1XXHA 4TL6A 3MMPA 3DOEA 2JLSA 2FN4A 4O0MA 1QVRA 2GZAA 3JVVA 4QFMA 1P2UA 4IDNA 4OQNA 2K5UA 3CM0A 4Z54A 2AWOA 1KI3A 1FMLA 4EFLA 1KIMA 1N0WA 1C4OA 1G7SA 2ZUCA 3ZZTA 5C18A 4PC2A 3IIJA 2FX3A 1RYFA 1Z6AA 3KJGA 3PEUA 5BN4A 1U98A 4WA7A 4BWYA 1KI1A 1D8TA 3CBQA 2WOOA 5BN5A 2BWJA 2BMDA 4LOAA 3ZIAA 3UPUA 1T0HB 1ZM2A 2Z6VA 3NDPA 4Q7MB 4Q9HA 5FBLB 4DB2A 4B48A 4I81A 4F93B 4K81B 4LJ6A 4R98A 4LJ8A 5DHFA 4FMDF 2P6NA 3MLEA 1ZAKA 3QPVA 3K9GA 4MKIA 1UADA 4IDOA 3ZVNA 1FX0A 1P6XA 4GMDA 3KB1A 4W5HA 1R0ZA 2VSXA 2F3TA 1LS1A 3C5HA 3FMOB 4N0DA 1W5TA 4CEHA 3I1FA 1VYVA 4MUAA 4PAOA 2LWIA 1K5GA 1K5DA 1NLZA 1ZRHA 3RC3A 5KU1A 3VQTA 2J46A 1GL6A 3M0EA 1ESMA 2XNDD 3HYTA 2EFDB 4NU0A 1COWD 1OYYA 4PPFA 1E2DA 2V7QD 4RD0A 1ZM7A 1T5LA 4Q4AA 4ESHA 1DO0A 3OHMA 1ONBA 3NEYA 4P33A 5JEEA 1Q1BA 2O8CA 1KY3A 2GK7A 4PO1A 4JIMA 4BQSA 1FTNA 4N1AA 3RS7A 1P9WA 1NBME 2AKAB 5JHHB 2ZRMA 1KSGA 2ZYWX 1NG9A 2AK2A 4G01B 1OE0A 2ATXA 2JGNA 3CRQA 1VCNA 4R7ZA 1ZNZA 4EPRA 3NHBA 2J45A 2ZSEA 3QY0A 2VHUA 3LLMA 4BEJA 2G88A 3W6PA 4A1FA 2QTHA 1W5SA 2OFXA 2KBFA 3IPYA 5B64A 1G9XA 1G4AE 3QVVA 4Q19A
chains in the Genus database with same CATH superfamily
1WXWA 3ZJVA 3FMVA 1EJ0A 1GPLA 4KXXA 1N6HA 4MITA 5DTRA 1XJCA 1I6MA 1K6EA 1MC1A 3GJRA 3ADOA 1QPZA 2RD2A 4A4DA 2G25A 4DWJA 1U5BA 3FOZA 1FPMA 3LYLA 3OOWA 3OURA 3BJMA 4HGZA 4QG7A 4YAEA 1EGMB 4BBJA 4KAXA 4M22A 2ZIFA 2GPBA 4LC0A 4CLRB 3ODGA 3U3OA 3HZOA 3VU9B 4C2BA 1XTRA 4GSYA 1EFHA 2WOJA 4FGSA 1JE0A 4NMLA 4XSHA 3RS2A 1SKAA 2PRYA 5K0ZA 3CNNA 2R6FA 2B6NA 4YGXB 4QM7A 2WU4A 2NP7A 1ZJYA 4NAHA 2PS3A 2OD7A 2YMPA 1S2IA 1JALA 3EF1A 2C4MA 4R7GA 2AA3A 3E3NA 4MCIA 1XIVA 4NULA 4Q00A 3IDQA 1PR3A 3LPDA 1B73A 3NETA 2Q50A 1U11A 3BHIA 1QTQA 4D3FA 4EKIA 1I7PA 3T6KA 4ID9A 1KP3A 4ZC1A 2FQQA 4JBXA 1PT9A 1U0FA 3IVGA 2RHTA 1W5EA 2AG5A 3KKQA 2ZS9A 1U4NA 4FK8A 4NV3A 4F3RA 1G8SA 1UJ2A 2FFAA 2VK8A 3QEOA 1KAGA 3L07A 4HGOA 4CG2A 1A77A 1KKLA 1GD1O 1UMBB 3MGGA 4RH0A 4C4XA 3L05A 2BH9A 4JU9A 1XTVA 1C81A 2ZPTX 3IEXA 4A9AA 2PVSA 3BCHA 4TMFA 2R60A 1O9GA 4PLPA 4EL0A 5DI3B 4IXWA 5EJ5A 1JMKC 2FETA 3MF4A 1G8KA 3I9OA 1JMVA 1X1SA 1XQ1A 2RHWA 4OTZA 1C41A 1G6KA 1UPUA 2M2IA 4Q01A 4RVOA 3UHOA 2XZTA 3USZA 1DG9A 4W5NA 3FDZA 2DH5A 3BG5A 3FUXA 4PVDA 5LJLA 1L4MA 5JS7A 1NV8A 1PYGA 1IBKB 2R1VB 3QZUA 2PLNA 1E96A 3DWIA 4KWTA 4PYOA 4XD7D 5TMEA 2Q7DA 2W6PA 4FTWA 1JR4A 3I9JA 4FMPA 3P9KA 5FXMA 3ZQKA 2XNDA 1XMSA 1XA3A 1EGAA 3EASA 3FCAA 3NHLA 3F3SA 1GR0A 5EXTA 5FPQA 3TGWA 1R6VA 4BKMA 1QBKC 5CDGA 4NV0A 5B6JA 4G4GA 1CHNA 4CBVA 1O96B 1W73A 3QTLA 1FBTA 2X9GA 1F17A 2E5FA 1TKBA 4X45A 1RHMA 4P7JA 5JZBA 2OORC 3EULA 3FPGA 5EIFA 2J8ZA 3UF0A 3V48A 5ENVA 1DKMA 1H8EA 2Q3HA 2GPSA 3DYVA 2CFIA 3HZZA 1H1DA 1PQUA 1BA3A 1XD2B 2IRWA 4N4AA 4XDHA 2XA9A 1IH8A 1M75A 2V4MA 1MT3A 4BNYA 1ZJZA 2DUMA 3OPYB 4IUCS 5KWEA 3D0QA 3H4VA 3LCRA 1XZ8A 4IFEA 4CQLB 4JL8A 2IY7A 5KX5B 1QFYA 5LWHA 3RFUA 4DMUB 3V8MA 3I8SA 3VNRA 4IDPA 3PNBA 3OO0A 4GNKA 3VZCA 3RYFA 1IQPA 4LZZA 4D74A 3A58B 4YQFA 1EG2A 1G3IA 1XXHE 4DWWA 2X0IA 2QM0A 1PG5A 4MVJD 3SR3A 1YI0A 2OV6A 1YKSA 3UJNA 4JXXA 1WMAA 3AEKB 3A06A 4ZV9A 1O94C 1RVDA 2XMDA 4P4TA 4RLHA 4DDHA 5DBOA 4F8JA 3RSFA 1U7TA 4C20A 2QP4A 2FW1A 1M66A 5K3BA 1NASA 1U2DA 4LXTA 4XVUA 1MU0A 2I4TA 3OPVA 2QY9A 3GUZA 2YZNA 1UBFA 3WY9A 5JU6A 3INTA 5A5GA 3ASYA 5GVRA 4DJDC 1T34A 4NBLA 1B3RA 4Q1EA 4ZOBA 4J6FA 2P75A 3R0ZA 1M2GA 1GPDG 2AMVA 1CT9A 3IQZA 4GEKA 1LBIA 3BM5A 5LB4A 4KSCA 2WNSA 2WYIA 3THOA 4FOSA 1L6RA 3VAYA 4L5JA 1W2WB 5DEIA 1R88A 2X9NA 1R15A 1M1ZA 1NULA 2GSWA 4KQJA 2J0SA 1L4LA 5EERA 3JQPA 4HXEB 5HX7A 3V4VB 3UV3A 2YHUA 1LPNA 4X93A 1A9XB 4IH1A 3LVRE 1R4MA 1KVTA 3BB4A 3P9YA 1E6KA 1J23A 2F64A 5ALYA 4B31A 2GUGA 1W8DA 1QFMA 3T5GA 2CEAA 3IUBA 2HLDA 4W8HA 3FCSB 2OLJA 3RHFA 4QDOA 4XH9B 4CCSA 1HKUA 4I9HA 3AHJA 4B4VA 2BT4A 5AW2A 4MJ7A 3U7HB 5EEHA 1EUCB 1T0BA 2M1ZA 1EFUA 2K4MA 4JBIA 1AS3A 2IUYA 1UANA 5DNUA 3O94A 2IYQA 2NYAA 3KVNA 5TRTA 3BE6A 1HQKA 1WQ4A 5BPFA 1DEXA 3PT9A 2VJMB 4QUEA 4I50A 3B1KA 1ZXBA 4Z3KA 2UUOA 4X85A 4OJKA 1TB4A 2YHSA 1MG5A 1YB1A 5T4FA 3J80A 3G8BA 2DQKA 5FF9A 1PD1A 4B3CA 1V3VA 2XTZA 1D8AA 4C3OB 2RK4A 2GCPA 3Q7QA 4IBOA 3SBXA 1EAYA 2O8VA 4WGFA 3KQYA 4XSVA 3ZBUA 2W0MA 4DLYA 1AMUA 1Q2XA 1EUZA 4YXWD 3EH1A 3EQZA 2NSJA 4M4SA 3T7TA 1KKMA 4JJ8A 3T7CA 1ESEA 1U8EA 1AQIA 2C57A 3HBMA 1GCIA 4ON9A 3IQFA 1NKTA 4WIAA 4Q9DA 1T2CA 1LKZA 1NJ5A 2JGJA 3ZLUA 1ZSVA 1LBQA 3T5PA 4PBRA 3GLGA 3UXYA 1G66A 2N47A 4M60A 3BCUA 1U7PA 5AHXA 4D3ZA 4F2DA 3H11A 4PZCA 1R0WA 3ROMA 3EZ6A 2IEBA 3FPBA 3ROTA 4A03A 4RJ2A 2SHKA 4CM6A 5EZ6B 5E7MA 4EZEA 4UNRA 2GM5A 3A9TA 1PWEA 3I6BA 3SFVA 3TXAA 2X4DA 1YS6A 4W8GA 5FPPA 3N2KA 4NFLA 3L6UA 1II0A 3PV0A 1HQDA 2I87A 5BSHA 5J3JA 4EB8A 1V26A 1U3VA 4QUHA 3BKXA 1CX9B 2MYUA 3OFNA 4HRXA 5B37A 4Z4FA 1TAUA 1LDEA 4AKIA 2Y0CA 3GFVA 2MIIA 4XCVA 4RMGA 5BNTA 3K9FC 4A0GA 2C3PA 4MQ5A 2I9KA 1V11B 2B4YA 1TUIA 1KDTA 1KR5A 2HIGA 3C97A 4V0LA 5MN4A 3HM9A 4PNHA 2EJTA 2LR0A 1WPXA 3E4CA 3F6SA 4MW9A 5A0TA 1CQZA 3LYUA 2WNIA 3A0UA 5FV4A 4C06A 2HMAA 3DDSA 4P80A 2JZCA 2D7CA 5A71A 3IR7A 3TR5A 3WMFA 1E1LA 3AB3A 2VUSA 1T3GA 5CCXA 2E85A 3PD1A 4QWMA 4WK2B 1WKCA 2JI9A 3SFTA 1P1FA 3L1HA 3IILA 1CZRA 1EE9A 3DT8A 4EGAA 4FC7A 1Q11A 4Y1GA 2WJPA 5L3RA 4WESB 1XLTA 4V0ME 3OHSX 3QHAA 1EK5A 4PYIA 4O08A 2ODAA 1GKLA 1JEAA 3AJEA 3EK2A 3Q3JB 2JRLA 4NMMA 5HDQA 3ZWOA 5LYJF 3PC7A 4PZYA 1VE5A 4M86A 3BVPA 1S1MA 4H31A 4LNUA 5IC5A 2EARA 1JT9A 4M0EA 1W88A 3DAPA 4FSXA 4OY3A 3H04A 3P2YA 2RJ3A 4Z9XA 3QIVA 1YT5A 2BKXA 7MDHA 1X8XA 1MO3A 1RQGA 1UP4A 3AJDA 3CRNA 1T9GR 2P9EA 5CB0A 5JNWA 3P96A 4LXXA 2BBSA 3KM0A 4X1KA 4DZRA 2P9FA 1ULAA 1P75A 3NTRA 5HMLA 5I9BA 3TZ6A 2H9YA 3MWEA 5JEDA 5K8IA 4HWPA 1PWYE 1WIWA 1WXXA 1YVDA 1KJNA 2J5XA 2XVXA 3FYTA 4JYCA 1KK2A 3HBLA 4XDGA 5FT9A 1P4SA 1GDHA 5IVDA 3VGJA 3CEAA 3NKVA 3S2ZA 3CZPA 1PSWA 2XE7A 4K3VA 3VYSB 4OHZA 3QVGB 1BVYF 1J1UA 2XB4A 1MD9A 3Q6IA 3MJ4A 3KZOA 1HSZA 1Y80A 4NL4H 3FWNA 1M76A 1BFUA 5I7AA 1QRUA 2ZRQA 3KUCA 1JIUA 4PGHA 4Y6SA 1IAVA 1KH3A 2HJWA 2WJWA 5E95A 4B5LA 3V3KA 3GDGA 5LFAA 4ABTA 1UXKA 3FVRA 1GEGA 3U3ZA 1QPGA 4YRAA 3KEQA 1GPNA 3H19A 5D00A 2QX6A 4MYUA 4W63A 3IPRA 3VVMA 3EXG1 4K7JA 4KUHA 4ZTUB 1NW9B 2PMBA 2XY4A 1YR2A 5CLHA 5L95A 3TOXA 2B8WA 4F4JA 1IXZA 3N2NA 4NZZA 5H02A 1NDHA 2IV3A 5A5FA 4WBNB 3B1FA 4PYKA 5K5EA 1Y89A 5CA0A 3PWTA 3K1ZA 3JD0A 1NNI1 1Z6PA 4CM1A 3SQLA 4JAVC 3UWPA 3WLOA 4MIEA 4FYPA 3AL3A 2DFDA 4OX9B 1I2DA 4Q3OA 4E4TA 2DHRA 2P6PA 3QUBA 1CY7A 3EGDA 4AZ3A 5BNZA 1EFPB 3V3TA 3O4FA 1DEKA 1EGQA 3V8QA 4DIMA 1KZ7B 4FDVA 2EFGA 3U4HA 3AETB 2GPJA 3W9YA 2FR8C 4ZYWA 4X7PA 1MB0A 3MWJA 5CX1B 2XVZA 1CUBA 3O3NB 4V2UA 3WNVA 2G7MC 2ZSIA 2PKRA 1G8AA 1TQ2A 2OYRA 3GJ8A 3L9WA 4B7CA 2X8BA 4QC2A 4GKAA 1SNYA 2V7PA 3RVPA 4DL9A 3HI4A 3OD5A 4KXUA 1F2TB 5KWJA 4QHSA 5TEVA 2NLOA 3VDRA 5AQ1A 2H2HA 2PLAA 3DZFA 1GQRA 4BOYA 2XDWA 3H7IA 4DNFA 2YNMC 2MOKA 4KXQA 4QTTB 5GONA 1HYEA 4EA6A 1PP4A 1AHIA 4M7PA 3NV9A 4IH4A 1DV1A 1Q6YA 4X6YA 1ZC3A 5BOVA 2QRNA 4QOGA 4WNIA 3D8RA 1RQ7A 1NLFA 1R7RA 4E21A 3G5LA 4PXSA 2QUBA 3G8CA 3AINA 3EF3A 3I5MA 3EDMA 2GZ2A 1KAOA 3CMMA 3ROXA 3L06A 4RE5A 3QKTA 4ZPJA 3ZWYA 4MDEA 3AXTA 1AK1A 1M0SA 3L77A 4JJGA 3ECCA 3ND7A 4E2ZA 4XTRA 2W37A 3DBHB 5K8CA 1RZUA 5ARDA 2Z5FA 1QANA 1AHPA 3LOQA 3IAS6 1KMQA 2IYYA 4LHSA 3KZKA 3R44A 2QLMA 4AECA 5KREA 1DINA 2GNPA 4HRAA 2BFFA 5DMHA 1KARA 1T0IA 2FFJA 2JLUA 1TTTA 2JLXA 3IHLA 2V59A 3H9BA 1UPBA 1WHTA 1Z6GA 1CRLA 3K09A 5BYBA 1VE1A 3KTOA 5LP6C 1GCOA 2IHJA 4ANFA 4LCBA 1E8DA 3FG9A 4IW3B 4OQPA 3ETCA 4IOJA 4JSTA 1G20E 1CNEA 2WNHA 5CP8A 5K3SA 3WGKA 2ESRA 3OZRA 1TAGA 4L27A 1Z62A 1AKQA 5G0UA 5KYUA 3WJAA 4MS4B 4FOOA 3RUDA 1JKIA 5ANRB 1XKTA 2BKAA 1E3QA 3CZ9A 3PJGA 1KYVA 4JOCA 2NV2B 3FTEA 1TUGA 1PYOA 3NHPA 3OZXA 4HHEA 4UD6A 3SDBA 1R50A 3GRRA 4OQZA 4YAIA 4FXPA 1VKHA 2P1RA 4X0EA 5AKKA 2IF0A 1X1AA 3O8DA 3WLHA 3BRQA 3WKEA 3BERA 1CY6A 3PNMA 2HA6A 1TK3A 4NQZA 1Y7TA 4Z86A 3T3GA 4YO8A 4PQGA 1QIGA 1V3UA 2IS4A 1TLTA 2L82A 5CEEA 3KXLA 2QRVA 4JLPA 4S12A 4GBGA 1ABFA 4J7AA 4H08A 2NQTA 1VKJA 3SM3A 2A5GA 2V5VA 5GZ1A 2I62A 1X1EA 3AEUB 1K6IA 4BB0A 3Q3CA 5KB3A 1P9NA 5LMZA 2HA3A 1M67A 3BX1A 3I05A 1IEXA 2D0PB 2Q4BA 4ZYTA 2GB4A 1JHAA 2OV2A 3ZK7A 3IA7A 1VHTA 2G70A 4FHEA 1DJLA 1OTXA 1MA3A 7YASA 2A0YA 2QLLA 1JECA 4BUCA 1M6YA 3TVDA 3W2HA 2D06A 1P2DA 1ZWKA 4MAFA 1YDWA 3U9TA 2CHEA 2CWDA 3F5FA 4LBZA 5CIQA 3KSDO 4A6EA 4MH0R 2WSBA 2UZAA 4I19A 1UAYA 1R9MA 4OJYA 2POQX 1SUAA 1XRRA 2Q28A 3P9CA 4PCAA 5JBNA 3C5CA 4H3HB 3G2PA 3IIIA 5BV8A 1CV2A 5AM4A 1P80A 1ZK3A 2D1TA 1DBVO 2R8XA 3TIGA 1E6LA 1WSWA 3OPMA 4MQUA 3K5HA 2J0EA 4ILKA 4X24A 4X8OA 1RPZA 4O3MA 4FHZA 5FBWB 5HK9A 5JDCA 3BUSA 3KU1A 4BATA 3QELA 3HCFA 3STYA 1IQUA 3C3EA 4FYIA 1KMNA 2ZT7A 4XPIB 4KXFB 1KIFA 1T5OA 1KRXA 2ZW9A 3HUTA 1KQ3A 1XMVA 1JEEA 2BH2A 5EHZA 1CYDA 4TLDA 1JHDA 1Q77A 1YA8A 1QZXA 4RV9A 4XCQA 5JVDA 1HOTA 5JQGF 2JKVA 3IP1A 2D7JA 1U2SA 4GR9A 1VB5A 4P3XA 1PG0A 1PQWA 3W2EA 3QXGA 1HG1A 2YY5A 3DNPA 1AZWA 1YHYA 2QLJA 1OXMA 1KPHA 1UCFA 3A9RA 3B6IA 1HTTA 2JA1A 1M5TA 3MZ0A 4UBOA 3VU0A 4AIIA 5A9SA 1W36B 3LWBA 3JY6A 4U2FA 5EUQB 3WRXA 1JAXA 1TCUA 1YU6A 3ILYA 4GAEA 4OSOA 4D4MA 2NSHA 4HAUA 1OSNA 5JAMA 3T3OA 3NALA 4HS4A 4LK3A 1IQ0A 3I9V6 4BC1A 4C6TA 4CG1A 4ZRDA 4F46A 3OTOB 1T25A 1FE8A 1GSIA 1QHEA 2O2YA 3MAAC 5FO1A 5IEBA 3SXPA 3ZE6A 5BUZA 1XDDA 3JVIA 2UUAB 3ROZA 3CZ4A 2LCQA 1TDJA 3P7MA 3PHHA 2C03A 4MW6A 4A0FA 3WIDA 1ULZA 2JGMA 4P82A 3R7NA 1ZNWA 3GA0A 4AWBA 1QUEA 4HK4A 3GDFA 3DZDA 1VE7A 1LEHA 3DULA 2PL5A 4H60A 3WWEA 5CCBA 4JQCA 2ZDGA 5EP3A 3I72A 4YB8A 4FFMA 5BWLA 1VI5A 3C24A 2FB9A 3QLEA 4M0MA 2PMCA 3IV7A 1LPPA 1E5XA 2G76A 2Y1EA 3OIWA 4W99A 1ARZA 3KHKA 4OMCA 4DCUA 2ET6A 4GOMD 4DV0B 4O8ZA 2RGNA 4I5EA 2ZUWA 2P91A 5LM3A 1BE1A 3BRWD 3QMWA 3AV0B 5FBHA 2IFTA 1FSPA 4I9UA 4NH4A 1GKIA 4V02A 3WGMA 4CNBA 2RHRA 3UMVA 4D6XA 3COJA 3EQ6A 1NOJA 1KDVA 1U1CA 2YC2C 2QDKA 3MINA 5IZ4A 5C2JB 3DTVB 4EA8A 2IOQA 2P1ZA 2P2LA 1UM9A 1TTHA 2QIOA 3EDOA 3P32A 4XXHA 3X1JA 4GI1A 1RWXA 5F2EA 2W4QA 2QENA 2WKRA 3MJRA 2HQBA 4YONB 3W0LB 4HYEA 4XR9A 2I7XA 2WICA 3PGMA 2Q3DA 4DC0A 1XRSB 4JCOA 4JK3A 3TBKA 4Q9LA 5E9WA 3QEAZ 1SIBE 4D0NA 3CF0A 4TUYF 5DCLA 2IS6A 2B8JA 2ALJA 2OHVA 4KQKA 4XIIA 3DVAB 3MTIA 4XWAA 3VJKA 3SZMA 3L8DA 2GJKA 3RSLA 1FBNA 1M6EX 3IH5A 2XQJA 4COKA 5CDUA 1QTIA 3U31A 3I9NA 1Z5OA 1GAEO 1CUFA 3BJIC 4MPTA 4R31A 1X8KA 1QRDA 3HCOA 2JJYA 3BPSA 1OB2A 3U7IA 4BASA 5K05A 3EGCA 5E8RA 1Z68A 2G5PA 3MTBA 1NVVQ 1HPLA 2QZPA 1N0HA 1PUJA 4XB2A 3UENA 4CLHA 1K3TA 2BFWA 3OJWA 4IIXA 5BN3A 3DEKA 1DQYA 1CULC 4V0SA 4R7TA 4W9NC 4B82A 5B1DA 3S2SA 2IH5A 4Q4LA 1T15A 5IT9A 3TG2A 3R5KA 1LH0A 4P4NA 4YDQA 1H0HA 1D0VA 1M2OB 2FVYA 2J7KA 2B36A 2QRHA 2WKQA 4RD3A 3ZEAA 2DE0X 2OOKA 3V00A 4KXVA 4KH0A 2IUTA 2O5EA 1IBCA 2AX3A 2IZ7A 2XSZD 3FE2A 5FTNA 4BMYA 1GGNA 1XVVA 4QGHA 5HUHA 2R00A 3W5HA 3U4IA 4JLDA 1DTSA 4DA9A 3KB6A 4J9UE 3JWHA 4EFDA 1GPH1 5CURA 1XTBA 2IDMA 4XWYA 2WSMA 5DISB 4UCQA 1RKVA 4YJFB 2Q3BA 2X1HA 6YASA 3PA6A 1VHDA 3OF3A 2UV8A 5DN9A 4B7XA 3VC3A 2OBYA 3ZWCA 1E1KA 2BGLA 2O1SA 4OSPA 3ML1A 1OWOA 1JEQA 4B3DA 2H4YA 3D1LA 1DMSA 1G2IA 1PE0A 1UH5A 1E7YA 1IRIA 1LQ2A 2XUHA 3ICVA 2QN7A 1E6WA 4KGVA 3AUFA 4J1SA 1Q91A 5AM0A 2CBZA 1TQHA 2WQ7A 3RROA 3K9CA 4E22A 4QM6A 3IUSA 3JQGA 4D1YA 5JC1A 1RYDA 1JILA 1J9ZA 3GRCA 4MUGA 3EVAA 1FQKA 1HH4A 3JZDA 1KI2A 2Q6IA 4RZUA 2WAYA 2ZBGA 3V2GA 4GKKB 3WMGA 1N5OX 1FQJA 1NLUA 1DC3A 1GWNA 3KHSA 2Q9CA 4FEGA 5THXA 1ZOLA 1UMCB 1BX3A 3QK7A 2AN1A 1M1NA 1Z8HA 1R10A 2BGIA 4IIVA 4Y2TA 1E3IA 3OQBA 4I14A 2BFNA 1Q95A 4PC6A 4F71A 2JKYA 5AI5A 3EZYA 1ORVA 4EDFA 3OE5A 3I6MA 2Q6LA 4Z9BA 1A5BB 1EJ6A 3BRWA 3GFBA 3B7PA 3KKZA 2RCNA 1FP4A 1VPLA 1TJ4A 3E23A 3R5XA 1MKYA 2UYHA 4YYZA 1AXEA 2J41A 3Q8MA 3M2TA 5K3FA 5AK4A 2FRDA 4MVYA 1M34A 2Q3MA 1N2EA 1HYQA 1KPIA 2NUPA 1MQ9A 1RABA 2VHVA 3JQ8A 4INAA 2PKQO 1FPQA 1Y4SA 2VCYA 5EKDA 1TD9A 4JHLA 2LKDA 1IZ0A 1YQQA 2WJGA 3JYHA 3E22B 4NEGA 1RS0A 4JX9A 1CIPA 1ODIA 4UOZA 2PTGA 4G81A 1VHQA 5DHRA 2XMQA 1ZGGA 3ADBA 3PI6A 3OQOA 1C1DA 4HYQA 3RABA 3GJZA 5LD2B 4B3BA 4QWWA 3L7OA 4D82A 1CDDA 3FBTA 1RQLA 4KACA 4YAWA 2PMWB 5IX8A 5AW0A 3JQFA 2JVKA 4EG6A 3V8VA 4JP3A 3FYCA 1KFBB 3TW8B 1XZIA 4FGLA 1L4UA 1N2CA 5KOHB 2IIBA 3HY6A 1RCTE 2GBPA 4JDPA 4L72A 4ZKEA 3ICOA 3I6IA 3H5TA 3GT4A 4YAJA 3CH4B 3A3PA 3CLHA 1K68A 4MTLA 3RSGA 4LGVA 1KY4A 4FFRA 2DY1A 3EPLA 4G4IA 4DY6A 2W6OA 2QM8A 2Q1XA 1WSDA 2XBLA 1GU7A 4IG4A 1FFBA 1P73A 4TL7A 3WIUA 4DA7A 2E1RA 4C30A 2HRCA 2DEUA 3OZTA 4NFSA 2FY8A 4LA4A 4OBWA 3VH3A 3QLUC 4KL8S 4CNQA 1DIRA 1VYTA 1RHKA 4I66A 3M7IA 4GRIA 3LUHA 3PPIA 2WHQA 1RXCA 2F59A 1VJ0A 2FUG6 2GA8A 2QX7A 4WTOA 3U7QB 3I0ZA 4OKNA 1PZEA 4Y2SA 1F5NA 4H7JA 2IK8A 4ZDJA 3U3RA 1KORA 4QSMA 4WHMA 5YASA 3RVRA 3V1TC 3IUNA 2I54A 5IJ9A 1F60A 1KJIA 2G4VA 2ZE5A 3K8OE 3PHLA 1MC8A 2HA4A 3DAFA 4MNTA 3L8ZA 1D2NA 2P1DA 4RU1A 3EGXB 4UHJA 3AUYA 4DAEA 2FVXA 4EEZA 1HSOA 2GEVA 2WG0A 4I1UA 4M76B 1Z88A 1Z4JA 1N6KA 2H9IA 1RZVA 1J39A 3G2QA 1TCCA 4NARA 1XFDA 3F7NA 4EAAA 1MXHA 5JZMA 2VQDA 5HSGA 5JXGA 2QNIA 3SG0A 3IOYA 3C7AA 5IARA 1WDKA 1QCZA 2FN3A 4GSLA 4MVJM 4O5OA 4WXRA 1TUEA 1QHHB 3UH0A 2BHRA 2X2FA 2XLCA 4B6JA 3DZBA 5KYYB 3VYVA 1VP3A 2C5LA 1RYEA 3IPCA 4E88A 4NX2A 3UC5A 1FTWA 1OBHA 2QV0A 1AKMA 2H2AA 3ASUA 2GEUA 2ZYTX 4IMIB 4Y6RA 4F2WA 2OL4A 4PEVA 1VTKA 2C9MA 5KHOC 2GRAA 5ARBA 3KQUA 4X6XA 1M1UA 1FSGA 1SCKA 3R6DA 4KJZA 4KYUA 3JAMA 5BPHA 4UEKA 2IPMA 1N5RA 5EYPB 1GDTA 1MVOA 3OZ7A 5HF8A 1YCFA 1VHWA 1IULA 4MWDA 1Z73A 4H4EA 5FPTA 3W8FA 5DNDA 1Y81A 2VDNB 2VT3A 4LYHA 1QFSA 1OXBB 2ECFA 4N7RA 5AJYA 3T4PA 4EYQA 1H2XA 4WVFA 2ZIZA 2ZBQA 3K0KA 1X9HA 2FG7C 1M2JA 4IOKA 5C4GB 5A5EA 5K6TA 1RM4A 3G79A 4GVLA 2VYVA 1PVOA 1FJHA 3AIKA 3KFXA 3GBVA 2MT9A 1EVIA 2NU7B 3GUVA 5HUQA 1XEFA 4HKTA 1OFHA 4DMCA 1N36B 4WRRA 1Z5ZA 4LJYA 2EF0A 4OOEA 4DCGA 2OXEA 4MP3A 4OHVA 3T5AA 1ETHA 3AM3A 3GDHA 1QH8A 1D1TA 1H2EA 1BH6A 3DBOB 4QTXA 5IK2D 4EB6B 3G2KA 1VBFA 4DCTA 3B20A 2VKQA 1K08A 4ZAYA 1IZ8A 4CT5A 3MRSA 1GT6A 3A2MA 3FDJA 3JPWA 2XCQA 2WJAA 4OXNA 3WHIA 1Y48E 3X1XA 1P60A 2MYTA 2ONJA 1F5SA 2F00A 2H4FA 4R1NA 2ZI6A 5CIWA 5JIBA 1VL2A 2Q4RA 3QPWA 4JJZA 1QP4A 4NBTA 5LVAA 1XROA 3QP9A 5JAUA 2A5JA 3KR1A 2Q1YA 2PV0A 2ZP1A 1PNQA 3MOSA 4HB0A 4HRYA 5BNIA 2CL7X 1KZ1A 3A1WA 1N5MA 3FCYA 4DLLA 1JG1A 3B6EA 1EVEA 1LK5A 3IX7A 3MXOA 3TE6A 2KI5A 5C46F 5LP1A 2IZZA 4P86A 3KD2A 4FIZA 3ZY5A 1OZ0A 3E2IA 4XGIA 4DBZA 3GLSA 3PNYA 2ZBPA 3PX3A 5EIBC 3I2JA 1SKYB 2VAVA 4CV3A 1Z38A 3AR6A 4Q15A 1JVNA 2HQRA 3B89A 1OH7A 2MSLA 4LCJA 4W1RA 5G0SA 3L7LA 2D5CA 3IMKA 3PDJA 2K2WA 1TZKA 2GBLC 3KKLA 4N3GA 4ZVTA 4Z4EA 1ZIYA 5KS2A 1CUXA 5DXAA 1Y1TA 4MWGA 5TVGA 1IONA 2LV8A 1R6AA 1ZUWA 4FFSA 1KP9A 4TVSA 1MX3A 5K01A 1RWOA 4DCSA 1EX9A 3FPLA 4GLOA 4FSDA 5KCZA 1CDEA 3AB8A 4Z7QB 3UK6A 2C5HA 1Y4AE 5EZQA 1V1RA 2YN0A 3D7RA 1GFZA 5EMMA 4IMJB 4R2MA 3BWBA 2X0DA 4TN1A 4UEOA 5L3QB 1K2WA 4R16A 4FMBB 4S2EA 4QDJA 3TZCA 3T3IA 1V71A 1G8GA 4P0TA 1DJPA 1W4ZA 2A1TR 5JPCA 1XQ9A 1ZPDA 4E51A 4YRLA 5DJ5A 4EGQA 1MR3F 1QIJA 2W83A 1VGRA 1BN6A 5A6VA 1JG2A 3RUCA 3U7GA 3GROA 1Q0QA 5TY0A 2QMHA 1U6IA 2JA2A 4BGDA 5CTJA 2C20A 4NBNA 3NWPA 4O4IB 4X41A 5KJCA 3COVA 4Z6KA 2L18A 3DV2A 4EECA 4W82A 5H9WA 2DPXA 4P3NA 4BMSA 5EP4A 5JBIA 1XNJA 3OUZA 1DDIA 1OB5A 4PSVA 4AZ0B 4E94A 4NPHA 1HNZB 5HIAA 3CA8A 1ISFA 2QD4A 1ZNQO 3A27A 1DDGA 4A82A 2YZMA 3EAFA 2VJQA 2CXOA 2RHJA 1AKEA 4KVZA 3PCXA 1T8TA 2FOIA 2OT3B 5DHSA 2JCYA 4F2PA 4EHAA 1DFGA 3NAQA 3NIDB 4MYDA 5DLQC 5IT0A 4MV1A 3N7UA 3JQ7A 3IE2A 1R18A 2OBFA 3LQRA 3PUZA 3E2PA 4F3TA 1FUIA 1YZGA 2XUAA 1LJ8A 3GJ0A 4ZOLA 4BCCA 1V5WA 3OU7A 2RHCA 1G7RA 1NX9A 4NWIA 2EKBA 3JQQA 2J0UB 4W5OA 2OG1A 1PZMA 5JQWA 3MWYW 5TB5A 3TMAA 2Z2YA 3THWA 1P91A 3F3YA 1NU8A 1P0CA 2AI3A 2AG1A 4JLOA 5IK2A 4JYBA 1VOTA 4B81A 1OA0A 4JVMA 5BQ3A 4ZREA 3G7NA 3R0VA 1T2VA 2C96A 2F8MA 3KAPA 2WJYA 3U3MA 4GHWA 3VO1A 4ARBA 4P4SB 3ZVKA 5JATA 4B17A 4UAVA 1VG0B 2Y1GA 2O2EA 3ETLA 1VL1A 3G2MA 4ZZ2A 5SZJA 2VJKA 1Z08A 3I9MA 4UNSA 5CVEA 5F51A 2NPFA 2W4MA 4QVGA 3OZFA 1F0YA 4O4JA 4DCMA 3BHNA 4HQFA 2JHFA 4BNHA 4EFKA 4HTAA 1NJFA 3ZUPA 4P7BA 2C4WA 1NBAA 5EJMA 2VC2B 4ER3A 3F1KA 4BUJA 2YIJA 4WKBA 3MERA 4JKOA 4YV1A 4A8JA 1U0BB 2PZFA 1EP3B 4MKGA 2FXVA 2JK0A 3LW7A 1CKEA 3QX9A 1KJ8A 1C0IA 1Z0ZA 2GD6A 4PRZA 1C9DB 1F2UB 4TVKA 1IYZA 1UM8A 2NNLD 1O5TA 3DZGA 2X0FA 2J9ZB 4XX0B 2R6DA 2E6KA 3NV7A 3DXFA 4RMJA 3UUGA 1YBVA 4MQ6A 3E05A 1VMIA 4RYDA 2ZDHA 3KZNA 2R5WA 1I1HA 5TT1A 3TTYA 1AA9A 4FS3A 4ZCPA 3RAPR 5CRIA 4CKEB 1VFNA 2PLRA 5GY7A 1Q44A 1WUJS 3SXUA 3IUMA 1RI1A 1U2GA 1WB4A 5C9ZA 2OHGA 1S2LA 1E2QA 2AUMA 1TJ5A 4J0DA 1KEEA 5KUTA 1QR2A 4ER5A 3HR8A 3QIAA 1PFWA 3VHXB 5FUVA 4GQIA 1DG1G 5I01A 1E2PA 1G1AA 1PTKA 2FPGA 2XWJI 4H1TA 4ND6A 4AW9A 3KL2A 5AVJA 4KRYA 5KDLA 4IXNA 3DFKA 1E9EA 4MPPA 4LBWA 5KNCH 2VP6A 5FEMA 1KRWA 4ZQEA 3MMNA 2D0IA 4OATA 2ZYRA 2ZYDA 4LV5B 5JXIA 1Z07A 2RAVA 2Z08A 4TS1A 4I4CA 2ZQZA 5ALZA 2F1KA 2EXXA 3FYSA 1GSOA 5E1BA 9ABPA 1XU7A 5IAJA 4B2YA 2IC5A 4GRDA 4ESOA 1U3UA 4Z8YA 1P7ZA 3FMFA 1UKEA 1U2PA 3JCZA 4HB3A 3CSDA 3MSCA 4IPTA 4LDQA 3RVQA 5I7FA 2I2BA 3ZV6A 2IF2A 2Y2UA 3TUIC 5KNDD 1RMQA 3OAAD 4HDKA 2VNAA 4G0MA 4LY9A 2FMUA 1ZHHA 2XMPA 5CW2A 3EXEB 4E5VA 5F98A 4PSAA 1NW4A 1NI5A 4OP1A 2JIQA 3WMRA 3QJYA 5DWDA 4RVGA 4UPEA 3S8YA 1I1QB 4FYMA 4BNWA 1NBEA 2CHUA 1FLAA 3WLAA 3KFLA 4FSHA 4M1KA 1QMPA 1RWBA 3TWOA 2FKNA 1RBZA 4RA6B 4W7SA 3WI7A 5TQ2B 1SQGA 1WEHA 3V1UA 1FW6A 5D84A 2Q0HA 4LXYA 1KZ6A 1FVFA 4CYMA 4L9AA 3WQSB 1GUBA 1JQJC 1ISSA 4MROA 3IAHA 2VP4A 3PJFA 3M4NA 2C4TA 2YY6A 1QSGA 1WBBA 3P9QA 4BPBA 1X1BA 2HPHA 5SZHB 4NXNB 1F14A 4M1QA 2ZITA 5DHUA 1TL7C 1QGUB 2GBFA 1J49A 2XMZA 3ISJA 1H66A 1V6AA 2W6ZA 2HPZA 3IBFA 3H0EA 1NM5C 1UJ6A 3D6UA 4GL4A 4FDAA 3K72B 1DIHA 4WLEA 4YCAA 1IOLA 3E2MA 2PKWA 4REOA 3RBXA 3ZY4A 2A5YB 1DLIA 3BAFA 4KGZA 5AW8A 4JB0A 1K3UB 1B7GO 4QUAA 4C08A 1X2BA 2WFMA 3UO8B 1AUXA 1TAQA 4FFBA 5HILA 1TMYA 3BMNB 3LZDA 3VV3A 1LLCA 2R2GA 4RY2A 1G9TA 2PKQP 2PZEA 1DP4A 1XB2A 2A1UB 2QORA 3EMBA 4HDNB 2BFCB 4IG9A 1NSYA 1WUKS 1J8FA 1TM5E 3C0KA 1WMDA 4Q03A 4CKXA 3ZDAA 2ZBDA 4MR8A 2M6LA 3C98A 1RE1A 1TVMA 1BWPA 2BFDA 3NLLA 4M8NE 4BP1A 2E48A 2V97A 3CR3C 4LF8B 1ND6A 1D5WA 5LYYA 1QOQB 3C70A 4MCAA 5IDYA 2QVXX 1BU5A 4ZDIA 3A11A 4HF7A 4M7WA 3T35A 5FBQB 4F56A 5LA6B 1ETUA 1MW9X 2LKCA 3EQ8A 4BO6A 4MHTA 3IR5A 2GQ0A 1DUSA 4Q9JA 5AK3A 2ZRHA 4OFBA 2GHIA 3WK4A 1JFVA 4CLOA 3VJMA 4FHDA 4GXQA 4P3KA 3GRVA 2ZM5A 2PU7A 1YZKA 3GA7A 4YUXA 4BFXA 1W85B 4IF6A 4AJ9A 3QF7A 2HGSA 3JRNA 1X14A 5JJCA 1P61B 1WCIA 4O29A 1OBCA 4WVLA 4PCVA 1FRZA 1T0PA 1ADCA 2JJQA 4NCNA 2Q4DA 3RVKA 2BMJA 2WFLA 3T7JA 2MDTA 4JLNA 1IOWA 4LAFA 3Q0TA 1C7JA 2A9PA 1ELOA 2CB9A 2X0RA 3EG9A 4RPGA 3L8FA 3PFKA 3UG7A 5A4DA 4E5MA 3HABA 5BSGA 3HNRA 3IGFA 2FPIA 6LDHA 3CWCA 4CEHB 2BEVA 2ZQYA 2SCUB 1I01A 1RRKA 2XT6A 3L02A 4K86A 521PA 5C7YA 2DLCX 2O8DA 1F0NA 3ZLTA 1YIAA 1GZ7A 4LX0A 5AW3A 4J90A 3SE7A 3PA8A 1LCIA 4QQ8A 1CB0A 2PGIA 3HCBA 3I1IA 1GZHB 2WMNB 3H0KA 1TXGA 3ILXA 5T57A 4UTPA 2WWWA 4N0MA 1SEPA 1PWHA 2C5GA 2HWKA 3F9RA 3NBXX 1C4WA 4L8YA 4OO3A 4PG6A 5AJTA 5I48A 1BMTA 4FT4A 2H1FA 2PO5A 3EIWA 4TV9F 3FWHA 5AFSA 1I2CA 4LYGA 2F4NA 5FOXA 3MCAA 1U28A 4DLSA 3LBAA 5H82A 4KLAA 3WWZA 3BXHA 4YRGA 1NI4B 2NUAA 1GN9A 3IUYA 4RPCA 3KOMA 4ZQFA 2Q7OE 4IX1A 2XRZA 1E64A 1U8XX 4X8LA 3Q10A 1J6UA 4GWLA 2GVZC 1KEZA 2ZIUB 1O97D 4N0PA